5DCHA

Crystal structure of pseudomonas aeruginosa dsba e82i in complex with mips-0000851 (3-[(2-methylbenzyl)sulfanyl]-4h-1,2,4-triazol-4-amine)
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
187
structure length
187
Chain Sequence
b'DYTAGKEYVELSSPVPVSQPGKIEVVELFWYGCPHCYAFEPTIVPWSEKLPADVHFVRLPALFGGIWNVHGQMFLTLISMGVEHDVHNAVFEAIHKEHKKLATPEEMADFLAGKGVDKEKFLSTYNSFAIKGQMEKAKKLAMAYQVTGVPTMVVNGKYRFDIGSAGGPEETLKLADYLIEKERAAAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thiol:disulfide interchange protein DsbA
publication title Fragment library screening identifies hits that bind to the non-catalytic surface of Pseudomonas aeruginosa DsbA1.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Oxidoreductase
total genus 63
structure length 187
sequence length 187
ec nomenclature
pdb deposition date 2015-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01323 DSBA DSBA-like thioredoxin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5dchA00
1ILOA 8GSSA 1SL1B 1TRSA 2AYTA 1QXHA 2VM2A 2GZZA 3PINA 1QK8A 2GGTA 1ERTA 3GKXA 3IPZA 4BVXA 2XPEA 1EV4A 5DQYA 2QKEA 3FEUA 3TGZA 1SJIA 2M46A 2GZYA 2CQ9A 3KCMA 1GLPA 2DJKA 1PX6A 2H1AA 2YWIA 1MDIA 4KDUA 3I6AA 2HLSA 5ECNB 3VWUA 1SJZA 3DRNA 4AF2A 2E2GA 2TRXA 5HFGA 4I5QA 4ZILA 1H75A 4DSSB 2YWNA 1ZYQB 4EO3A 2BJXA 4N11A 3BBYA 2YNXA 4PQ1A 3FKFA 2RLIA 4TVEA 3CTGA 3O6TA 2CV4A 2VL9A 2OACA 2GSSA 1Z6MA 3APQA 2FWGA 4LMWA 1THXA 1TP9A 3CBUA 3QAVA 1FO5A 3P7XA 4HUAA 3CMIA 1FG4A 5FHIA 3ZYWA 2JACA 3UAPA 1XVQA 2FCHA 4BVYA 5D9WA 1SD9A 2FNOA 1TW9A 4PNGA 2F51A 3GUSA 3I43A 5ECKB 2VCXA 3EINA 2I81A 2NDOA 1ERVA 4FH8A 1M7TA 2OBKA 6GSTA 2FGXA 2HSHA 2VL2C 2KLXA 1PD21 4KX4A 1WP0A 1JLVA 5AISA 2HRFA 2E0QA 5DCGA 4BWSA 3F0IA 1X9SB 3M9JA 3FR6A 3HYPA 3DD3A 1G0TA 3KMOA 1YKCA 5C04A 3J7Yb 1GL8A 3KM6A 4OMVA 5JCWA 1RQMA 2H73A 2IMFA 1SKWB 2E7PA 1Y25A 3FRCA 3TJJA 3EVIA 2JZSA 1C72A 1X5CA 2OBIA 3DYRA 4JEDA 4WKWA 5ECMB 2H6XA 2X8GA 1WE0A 1TU7A 3BJ5A 1WJKA 3EYTA 4RI7A 1GWCA 3QPMA 4GLTA 2P31A 1B48A 5G31A 1SKSB 4DSRA 3L9VA 2IMIA 2FWHA 3Q74A 1AC1A 1ML6A 4XCSA 1X5EA 2AB6A 4H86A 1ZOFA 1X0RA 3W6GA 4FIWA 1V40A 5CP1A 3IK7A 4WR4A 2DJJA 5DAKA 4MK3A 4O92A 4EC0A 1ZGNA 3WGDA 1HNAA 1B9XC 4WF4A 4TW5A 3F4TA 3ME8A 2AAWA 5JWOB 4RQRA 2L4CA 2EC4A 3RPNA 3BCKA 5B7CA 1DE1A 1NM3A 2YJ7A 5A4VA 3FZAA 3L4NA 4GQCA 1XWCA 3A2WA 2IFQA 2CZ3A 3PH9A 2V6KA 4ZBDA 3TJGA 2ZUPA 1SU9A 2J9HA 3MDKA 1ZZYA 3TKSC 3TJFA 2DLXA 1Z7RA 4ZL7A 3A5WA 2H6ZA 4JR6A 2HZEB 2CZ2A 2GQMA 2LNSA 4IJIA 2VCVA 5KN2A 1X9MB 4KCEA 5A4UA 3GV1A 3GYKA 4KDXA 5B8AA 1O81A 3IAM2 1GUHA 1YF1A 4J56E 3Q18A 2V1MA 2B7JA 3BD2A 3CSHA 4NAXA 4YQUA 1AUCA 2G2QA 2HFDA 1GTAA 3F3RA 4ZXGA 3HKRA 3DGQA 1VF1A 1PX7A 4PX1A 2FY6A 4Q5FA 5HR1A 3DMLA 3L78A 2IFQB 4PNFA 2C3QA 1ZCPA 2JSYA 2LQOA 1RW1A 1XW5A 2LJKA 3DVWA 1TOFA 1XCCA 3VI5A 3KJYA 4IELA 1CQHA 2VCWA 4F82A 2GSRA 2R37A 4CW9A 2L5OA 2YJHA 1GLQA 2OE1A 4OWYA 2G0FA 4PURA 4X0XA 1A2JA 3ZREA 1T00A 3U6VA 1F2EA 22GSA 3ED3A 3O3TA 4Q5QA 3ZMKA 3H79A 4IQ1A 3L9UA 2ON5A 5JWRB 1W4VA 5GSSA 1EV9A 4LLRA 1A0FA 3D6IA 2CAQA 1U6TA 2DBCA 4HS1A 1O7UA 1XWKA 3GKMA 4WETA 2R4VA 1N2AA 4MLYA 2P5QA 1TRUA 1DUGA 1F3AA 2DSAA 5CRDA 1VRSD 5IO0A 2RM6A 4LL4B 4BL7A 1K3LA 2IIYA 4MPGA 1JZDA 2MYGA 1A2LA 1T1VA 1Q4JA 1V98A 2NPBA 5D9TA 2MBSA 4ECIA 2YOIA 2HYXA 2IPAA 2PGTA 2OADA 3WGXA 5C00A 4ILFA 4OFTA 4TR1A 3US3A 2KOKA 1V2AA 4ECCA 1PGTA 1KEBA 4G19A 1TK5B 1M2DA 4ID0A 3IA1A 4OCEA 2PVOC 3GHAA 4EXJA 3APOA 1M9BA 3LSZA 1YDKA 3V1WA 4E8HA 2A2RA 2VLTA 3LJRA 4NV5A 2C0FA 4MJBA 2TRCP 3F63A 3GL3A 4ZBAA 4GF0A 1ACVA 3GX8A 4ML6A 4X1UA 4D73A 4KNDA 3EU4A 3LXZA 3UEMA 2MZCA 4IGJA 3D0ZA 4WEYA 2GLRA 2PWJA 1SYXA 2GVPA 2OE3A 3G7IA 4MPFA 2O7KA 1XVWA 4L8EA 3EU3A 2VIMA 1MD3A 5IIZA 3S9FA 5FWGA 2XBQA 2AUVA 2V32A 2ZNMA 3M3MA 1E2YA 1GULA 1T3BA 2I1UA 5A5KA 2GDRA 1TK0B 2YZUA 4MJCA 1GNEA 2ES7A 4ZBBA 2B7KA 3HZ8A 4G9HA 3MWHA 1B8XA 3M9KA 1DSBA 4DSSA 2RUEA 3RDWA 4LMVA 2VM1A 1K3OA 1FAAA 3LG6A 3GH9A 1R5AA 1N8JA 4QL9A 3E9JB 1AW9A 2WDUA 4FYCA 2C3TA 1NSWA 4WBJA 3M0FA 5KN3A 3D5JA 4AJ6A 10GSA 2R6KA 3ERFA 4N0ZA 3ZVJA 2C80A 2H0HA 2H66A 5AIXA 3A2VA 3K8NA 3QFAC 3IDVA 4TXVA 1GUMA 2DMLA 20GSA 1O6JA 1WMJA 1XIYA 4AGSA 3NIVA 1V9WA 4CDOA 3FYGA 1HNBA 3SBCA 2K9FA 1QUWA 2V2GA 1UC7A 1SK0A 5IMDA 4IVFA 4XHMA 3GMFA 2RIIA 1FW1A 1GSEA 3VPQA 3TRPA 2LSTA 3GKNA 4MA9A 5E4WA 2XPDA 2MMOA 2AV4A 1ERWA 4TXOB 1XPVA 6GSYA 1T4ZA 1MTCA 4XRAA 1OVNA 1TJDA 1DE2A 3F6DA 1SK1A 5DVBA 2AHEA 2O85A 5CYYA 2X8CA 3TKQA 2ZCTA 1B4PA 3G9BA 1SENA 3HJMA 1K3YA 2PBJA 2AJQB 2JSZA 5H5RA 4KGIA 4F9ZA 2JADA 3MAKA 4L0WA 3HJPA 3I69A 1GTBA 3WGEA 4TN8A 1U3IA 3LYPA 4ZL9A 1E6BA 2GTUA 3ZITA 3ZIVA 4MABA 2H0IA 3G7JA 3GX0A 3D4MA 2TIRA 3IR4A 7GSSA 4PQIA 2C1YA 1UVZA 3VWVA 3LFLA 5ECPB 2F9SA 2IMKA 5F8BA 1FVKA 1AQVA 1G7EA 2V6OA 14GSA 3W8JA 2H19A 2NTOA 3I9V2 5HR0A 4I6XA 2R3XA 3TRQA 4EKZA 3FZ9A 2JL4A 2CAIA 3KP9A 1BQ7A 2LQQA 4QL7A 2K6VA 3LEFA 3HZ4A 2HE3A 4MZCA 3UVHA 5INYA 2CT6A 1EOGA 2H70A 1K0OA 2GSQA 3P8WA 4G10A 4MZWA 3VURA 6GSUA 2M72A 1KNGA 3CXGA 3HDCA 2YCDA 4K2DA 5B6NA 1LJRA 2V41A 4RUVA 2ON7A 5HQPA 2K8VA 1W89A 3FHKA 1B4QA 4HI7A 1T4YA 4TR0A 1M2BA 5GZZB 2BTOT 3WT1A 4O7HA 3C7MA 1U3AA 1EEMA 1JZRA 3C71A 1A0RP 1BJXA 5H5QA 5HFKA 3UL3A 5J41A 3TJKA 3VFIA 1URMA 4HJMA 4WXTA 4K7OA 4TRXA 5ABRA 3GSSA 2HZEA 3WYWA 3E3EA 3EMPA 1O85A 4JR4A 4MF6A 2HXKA 4K7NA 1PQNA 3RAZA 4KB3A 4HEA2 4NV2A 5AGYA 2GS3A 3VWXA 3FZ4A 2X99A 2LRTA 1SD8A 4BA7A 3ZFBA 2VCTA 1PMTA 4V2NA 5H5SA 3CSJA 4POMA 1BG5A 2EIQA 1YEPA 1OC9A 3SWLA 2WFCA 4IS0A 4V2MA 1KTEA 3TB2A 4YQMA 1GRXA 4I2TA 5CO3A 5ECQB 2RM5A 1THOA 4Z7XA 2DJ3A 3HVXA 3BCIA 5ECHB 3DKSA 4GCIA 3M8NA 2H8LA 1F3BA 2KP1A 4ZB8A 2P5RA 4PUFC 2B6MA 5CRGA 5IOXA 1YKAA 2LJAA 2YWMA 2C4JA 1XW6A 1EEJA 2WB9A 2VCQA 1SKRB 2NVLA 5G1LA 3GRXA 1JFUA 5FT3A 3VLNA 2REMA 2MMNA 1OC9B 1EGOA 4IP1A 2OE0A 3KZQA 5KN0A 3EWLA 5F06A 3EURA 3GTUB 1MD4A 1MEKA 1OE8A 4OFNA 1X5DA 2H76A 1VF3A 4L5LA 5EY6A 1SL0B 3UOMA 3RHCA 2H71A 3IHQA 4ZL8A 2JU5A 2N5FA 3KH9A 1U87A 2H75A 2WGRA 1WOUA 2K18A 4ULXA 1JZWA 2HZFA 1AAZA 3GL5A 2O89A 3C1SA 5CRWA 1I5GA 2R5GA 5DBQA 3G7YA 4KDYA 2LRCA 1GSDA 2O87A 3DVXA 4JE1A 4K1FA 1OC3A 1XBSA 2B5XA 2NBSA 5D8IA 3KP8A 2GQKA 2C0EA 1HYUA 5DJLA 2CA8A 1ZMAA 2GZPA 5F05A 4FO5A 4CHSA 1WPIA 1Z9HA 1G7OA 2FD3A 1J0FA 1TU8A 1PN9A 4J2FA 2H01A 4PQHA 1AIUA 4HU9A 3TCOA 3ZIJA 4GSNA 2C0DA 5ID2A 3TOUA 1OAZA 4L5OA 3QR6A 2FWEA 1TRVA 4PXOA 3A3TA 1Z3EA 9GSSA 3DEXA 3TKPA 3H1NA 5DQSA 2YP6A 5CNWA 3J7Yk 1A2MA 4F0CA 18GSA 2KUCA 4IQAA 3KTBA 2PPTA 3PR8A 4HOJA 1M99A 4WF5A 1K0BA 1LU4A 3HVSA 5IMCA 3LXTA 1Z6NA 3C73A 2LV3A 3GH6A 3HHVA 3PGTA 1R5PA 2IL3A 3TOTA 3KTLA 3UBKA 4NWYA 2EIOA 2WCIA 2PMTA 3HD5A 5LD0A 2H1GA 1F37A 1XWAA 3TKSA 2H0GA 2H74A 4MP4A 3IK9A 3DIEA 4ISDA 4K0GA 2HNLA 5J5NA 2A4VA 2KP2A 4EE0A 2QSIA 3RPPA 1K0MA 4PUAA 4JBBA 1PRXA 2LS5A 5ID2B 1S3CA 1XXUA 19GSA 4XTSA 3ZMLA 2K8SA 4BWQA 4EDZA 5D73A 1GNWA 3KD0A 1AQWA 1O8XA 2IWTA 2CVKA 4V2LA 1VF4A 1T7PB 3NZNA 5IMAA 1TTZA 3IBHA 5GSTA 1JLWA 4K8MA 4XS4B 4KAEA 3VPTA 1TDIA 1ABAA 1WIKA 4O32A 2YANA 3U5RE 3ZL5A 5D93A 3TKSE 4IW9A 2B1KA 1S3DA 3GA4A 1WWJA 3C8EA 4POKA 1GSFA 1TRWA 3QMXA 2WRTA 1FHEA 3UBLA 1TK8B 5CREA 4ZB9A 1QGVA 1TXXA 3UMAA 4V1Ap 5AN1A 2N5AA 1KBNA 4TXOA 3NOFA 3F8UA 4KH7A 3EMXA 5IMFA 2HI7A 2VLUA 3W8SA 4OD7A 3C1RA 1XOAA 2PERA 2YV7A 2H6YA 4OO5A 16GSA 4Q5RA 2XC2A 3QAGA 2B5EA 1R26A 3TRXA 5GAND 2ALBA 4IBPA 1IYHA 2OKAA 4MZBA 2FUG2 5DCHA 5F0GA 1LBKA 3GURA 1OKDA 1UA5A 2B1LA 5L71A 3RHBA 4GXZA 3IE3A 2GQLA 2LNTA 3N9JA 4POBA 3CSIA 4IKHA 6GSWA 1GP1A 4DEJA 3TUEA 4DVCA 1VGLA 2H1BA 3A2XA 4LA1A 5G5EA 4LL1B 4ZIJA 3IC4A 4KCAA 2L5LA 4I2UA 1EP7A 3O76A 1V58A 3IAS2 3GIXA 4WR5A 3D4TA 4HQSA 1UN2A 3FK8A 4K9ZA 2O8VB 5J9CA 3F3QA 3QOUA 2QGVA 2PU9C 2FA8A 4EF0A 3ERWA 2LRNA 3VK9A 3UIWA 1U88A 4POLA 4V1Ag 4TR3A 3HY2A 5ECIB 3F4RA 5ELGA 5IO2A 2VO4A 5IPGA 2MMAA 2KHPA 3H8QA 3F6FA 5ELAA 3D21A 3HVVA 4JU5A 5HFIA 2DC5A 4RQXA 2J23A 1GSSA 2VD0A 2YN1A 2H72A 3Q6OA 3ZTLA 4P3YB 1USBA 3ISOA 3ZRDA 3E0UA 3JCML 6GSVA 4GRFA 2DIZA 1XW9A 3QCPA 1QQ2A 2M80A 2HSYA 4MMMA 4G2EA 4MJEA 3GN3A 2C3NA 1AQXA 4GSSA 5CAXA 4I97A 4K0NA 4HU7A 5ECRB 5GAPD 3GFKA 1O73A 5G30A 5EVOA 4BPYA 2IN3A 1V57A 2RUFA 1TI3A 1EP8A 3APSA 5JCUA 4AJ8A 2FA4A 3GKKA 1EWXA 3KMNA 5IMZA 4MJAA 6GSXA 1RK4A 2VOCA 4KE3A 2L6DA 3L0HA 2OJLA 1ERUA 5KEJA 3D22A 2I4AA 3H93A 4HQZA 2VAFA 2JZTA 3CTFA 3H4KA 4IP6A 5D9VA 1A23A 2I9HA 5ECOB 4JRRA 2F8FA 5J4UA 3F9UA 3QD9A 1FVJA 2CX3A 2GT5A 1GSQA 5DJMA 3DXBA 4HZ4A 1BEDA 2PUKC 3QFBC 1S3AA 1VF2A 4F2IA 3ME7A 1QMVA 3HA9A 4TR4A 2B5YA 4GTUA 1M2AA 3LWAA 1Z7PA 2QC7A 3IOSA 1J9BA 3LQ7A 2JZRA 3P2AA 1FB6A 2FWFA 5JCGA 2HT9A 4KW6A 3VI7A 1A24A 4L0UA 4MF5A 4TOPA 2F3MA 1Z5YE 4FYBA 2VL3A 1K0NA 1XWBA 5HR3A 1G6YA 1SYRA 4IHUA 2P0GA 4MCUA 1GH2A 4GQFA 2CVDA 2DIYA 1GSYA 1H4OA 3EC3A 5J3RA 2X8HA 3ZLPA 1K0AA 5IPHA 1YEXA 1YY7A 3GTUA 1O8WA 1PL1A 4F0BA 4YH2A 3ZFLA 3HJOA 3UVTA 5EL8A 5F07A 4YAVA 2C0GA 3HXSA 2EIRA 5JWQB 4J57E 1F6MC 1A8YA 2IMEA 1GUKA 1NHYA 4IJ3A 1YJ6A 4EUYA 13GSA 5AIVA 2L59A 2HRNA 17GSA 3UARA 1OE7A 5G1KA 2IJYA 3ZVJD 5IM9A 4QQ7A 1M0UA 1PL2A 3IXRA 3TKRA 4XS1A 5DDLA 2VL2A 1OYJA 3CYNA 4MF7A 5DALA 5DAKB 1YZXA 2L57A 3M1GA 4EL1A 3IRAA 2B3SA 1SK2A 4YQVA 4NPBA 3EE2A 2YWOA 3LORA 3F4SA 11GSA 1HQOA 4AJ7A 2LJRA 1FB0A 4HDEA 1GSUA 3FR3A 4NMUA 5KN1A 3GNJA 5E59A 3IV4A 3UJ1A 2LEGA 2F8AA 3Q19A 4I8BA 3AY8A 2CVBA 2OA7A 1WRYA 4GWRA 1NHOA 1GTIA 2WJUA 4N10A 2PVQA 4HZ2A 4RI6A 6GSSA 4NXIA 4EDYA 1M9AA 3N5OA 3GSTA 5J9BA 12GSA 1XOBA 5B6MA 5ECLB 3FY7A 3ZZXA 1A8LA 1AXDA 1Q98A 4GSTA 5IOWA 1BAYA 4HJ2A 2X64A 3P90A 4O5RA 2LUSA 4EVMA 4F03A 5DALB 1SJ6A 4MH2A 1XWGA 3BOAA 3LGCA 3R2QA 3WT2A 1SL2B 2IMDA 4OO4A 3KEBA 1R7HA 4ACSA 1JHBA 4KA0A 4XS6A 2DJ0A 1F9MA 2Z9SA 3TDGA 1R4WA 3MNGA 3KH7A 4KSOA 2WS2A 1BX9A 2WULA 1J08A 2WZ9A 3DWVA 1G6WA 2VD1A 4JZQA 5IQYA 4ECJA 1OKTA 3WD6A 2GSTA 3LYKA 1T8EB 4IN0A 1ON4A 3CRUA 4KUNA 5HR2A 2R2JA 4YAPA 2XBIA 2YZHA 3L9SA 1ZYEA 1BYEA 2E2MA 2N5BA 5LNKe 4OCFA 4DSQA 3ERGA 4XS4A 2LKUA 4WBRD 1EOHA 4FYUA 1Y6EA 5ENUA 4ZB6A 2L6CA 5A4WA 2MMZA 1FOVA 3FR9A 5CRHA 2A2SA 2YPMA 2VLVA 1TI1A 3FZ5A 2H30A 5D9XA 1PKZA 1EZKA 2MBTA 5G2ZA 1ST9A 1XFLA 4PGTA 5D96A 2BMXA 2L4QA 3FW2A 5IMVA 4E8EA 2DJ2A 3QAWA 1ZL9A 5ECSA 2DMMA 2GT6A 1QFNA 3OR5A 1HNCA 3RBTA 2CX4A 1I9DA 1PSQA 4NHWA 1X9WB 1DBYA 2XHFA 5EPFA 4N30A 2DJ1A 2C8UA 4XIHA 5LCZA 3VWWA 5COHA 4X43A 3HCZA 1HD2A 2LTKA 3TJBA 1MDKA 1B9YC 2D2ZA 2VCZA 3KGKA 2FLSA 3QDNA 3KIJA 4TR1B 1PA3A 2H1DA 1YQ1A 4ECBA 1CQGA 5B8BA 1PKWA 1K0DA 2YV9A 1GTUA 4KSMA 4XRDA 3MSZA 1OC8A 1MDJA 1EGRA 4MH3A 4N0VA 3KXOA 1IYIA 3CRTA 1TKDB 1JZOA 5G5FA 1XZOA 2PN8A 1K0CA 2I3YA 1NW2A 4ML1A 4D73B 4K7IA 4K6XA 2VUPA 4NHZA 4TKYA 1YF0A 2FHEA 4OFMA 4Q5NA 4MDCA
chains in the Genus database with same CATH superfamily
1ILOA 8GSSA 1SL1B 1TRSA 2AYTA 1QXHA 2VM2A 2GZZA 3PINA 1QK8A 2GGTA 1ERTA 3GKXA 3IPZA 4BVXA 2XPEA 1EV4A 5DQYA 2QKEA 3FEUA 3TGZA 1SJIA 2M46A 2GZYA 2CQ9A 3KCMA 1GLPA 2DJKA 3HVNA 1PX6A 2H1AA 2YWIA 1MDIA 4KDUA 3I6AA 2HLSA 5ECNB 3VWUA 1SJZA 1ZYNA 3DRNA 4AF2A 2E2GA 2TRXA 5HFGA 4I5QA 4ZILA 1H75A 4DSSB 2YWNA 1ZYQB 4EO3A 2BJXA 4N11A 3BBYA 2YNXA 4PQ1A 3FKFA 2RLIA 4TVEA 3CTGA 3O6TA 2CV4A 2VL9A 2OACA 2GSSA 1Z6MA 3APQA 2FWGA 4LMWA 1THXA 1TP9A 3EPTA 3CBUA 3QAVA 1FO5A 3P7XA 4HUAA 3CMIA 1FG4A 5FHIA 3ZYWA 2JACA 3UAPA 1XVQA 2FCHA 2DKIA 4BVYA 5D9WA 1SD9A 2FNOA 1TW9A 4PNGA 2F51A 3GUSA 3I43A 5ECKB 2VCXA 3EINA 2I81A 2NDOA 1ERVA 4FH8A 1M7TA 2OBKA 6GSTA 2FGXA 2HSHA 3A5IA 2VL2C 2KLXA 1PD21 4KX4A 4CY8A 1WP0A 1JLVA 5AISA 2HRFA 2E0QA 5DCGA 4BWSA 3F0IA 1X9SB 3M9JA 3FR6A 3HYPA 3DD3A 1G0TA 3KMOA 1YKCA 5C04A 2HRAA 3J7Yb 1GL8A 3KM6A 4OMVA 4A5PA 2QA2A 5JCWA 1RQMA 2H73A 2IMFA 1SKWB 2E7PA 1Y25A 3FRCA 3TJJA 3EVIA 2JZSA 1C72A 1X5CA 2OBIA 3DYRA 4JEDA 4WKWA 5ECMB 1M3JA 2H6XA 2X8GA 1WE0A 1TU7A 3BJ5A 1WJKA 3EYTA 4RI7A 1GWCA 3QPMA 4GLTA 2P31A 1B48A 5G31A 1SKSB 4DSRA 3IHGA 3L9VA 2IMIA 2FWHA 3Q74A 1AC1A 1ML6A 4XCSA 1X5EA 2AB6A 4H86A 1ZOFA 1X0RA 3W6GA 4FIWA 1V40A 5CP1A 3IK7A 4WR4A 2DJJA 5DAKA 4MK3A 4O92A 4EC0A 1ZGNA 3WGDA 1HNAA 1B9XC 4WF4A 4TW5A 3F4TA 3ME8A 2AAWA 5JWOB 4RQRA 2L4CA 2EC4A 3RPNA 3BCKA 5B7CA 1DE1A 1NM3A 2YJ7A 5A4VA 3FZAA 3L4NA 4GQCA 1XWCA 3A2WA 2IFQA 2CZ3A 3PH9A 2V6KA 4ZBDA 3TJGA 2ZUPA 4Z2RA 1SU9A 2J9HA 3MDKA 1ZZYA 3TKSC 3TJFA 4O5UA 2DLXA 1Z7RA 4ZL7A 3A5WA 2H6ZA 4JR6A 2HZEB 2CZ2A 4PTSA 2GQMA 4ICYA 2LNSA 4IJIA 2VCVA 5KN2A 1X9MB 4KCEA 5A4UA 3GV1A 3GYKA 4KDXA 5B8AA 1O81A 3IAM2 1GUHA 1YF1A 4J56E 3Q18A 2V1MA 2B7JA 3BD2A 3CSHA 4NAXA 4YQUA 1AUCA 2G2QA 2HFDA 1GTAA 3F3RA 4ZXGA 3HKRA 3DGQA 1VF1A 4KF9A 1PX7A 4PX1A 2FY6A 4Q5FA 5HR1A 3DMLA 3L78A 2IFQB 4PNFA 2C3QA 1ZCPA 2JSYA 2LQOA 1RW1A 1XW5A 2LJKA 3DVWA 1TOFA 1XCCA 3VI5A 3KJYA 4G0IA 4IELA 1CQHA 2VCWA 4F82A 2GSRA 2R37A 4CW9A 2L5OA 2YJHA 1GLQA 2OE1A 4OWYA 2G0FA 4PURA 4X0XA 1A2JA 5KOXA 3ZREA 1T00A 3U6VA 1F2EA 22GSA 3ED3A 3O3TA 4Q5QA 3ZMKA 3H79A 4IQ1A 3L9UA 2ON5A 5JWRB 1W4VA 4EIQA 5GSSA 1EV9A 4LLRA 1A0FA 3D6IA 2CAQA 1U6TA 2DBCA 4HS1A 1O7UA 1XWKA 3GKMA 4WETA 2R4VA 1N2AA 4MLYA 2P5QA 1TRUA 1DUGA 1F3AA 2DSAA 5CRDA 1VRSD 5IO0A 2RM6A 4LL4B 4BL7A 1K3LA 2IIYA 4MPGA 1JZDA 2MYGA 1A2LA 1T1VA 1Q4JA 1V98A 2NPBA 5D9TA 2MBSA 4ECIA 2YOIA 2HYXA 2IPAA 2PGTA 2OADA 3WGXA 5C00A 4ILFA 2R0CA 4OFTA 4TR1A 3US3A 2KOKA 1V2AA 4ECCA 1PGTA 1KEBA 4G19A 1TK5B 1M2DA 4ID0A 3IA1A 4OCEA 2PVOC 3GHAA 4EXJA 3APOA 1M9BA 3LSZA 1YDKA 3V1WA 4E8HA 2A2RA 2VLTA 3LJRA 4NV5A 2C0FA 4MJBA 2TRCP 3F63A 3GL3A 4ZBAA 4GF0A 1ACVA 3GX8A 4ML6A 4X1UA 4D73A 4KNDA 3EU4A 3LXZA 3UEMA 2MZCA 4IGJA 3D0ZA 4WEYA 2GLRA 2PWJA 1SYXA 2GVPA 2OE3A 3G7IA 4MPFA 2O7KA 1XVWA 4L8EA 4K2XA 3EU3A 2VIMA 1MD3A 5IIZA 3S9FA 5FWGA 2XBQA 2AUVA 2V32A 4EIPA 2ZNMA 3M3MA 1E2YA 1GULA 1T3BA 2I1UA 5A5KA 2GDRA 1TK0B 2YZUA 4MJCA 1GNEA 2ES7A 4ZBBA 2B7KA 3HZ8A 4G9HA 3MWHA 1B8XA 3M9KA 1DSBA 4DSSA 2RUEA 3RDWA 4LMVA 2VM1A 1K3OA 1FAAA 3LG6A 3GH9A 1R5AA 1N8JA 4QL9A 2UZ8A 3E9JB 1AW9A 2WDUA 4FYCA 2C3TA 1NSWA 4WBJA 3M0FA 5KN3A 3D5JA 4AJ6A 10GSA 2R6KA 3ERFA 4N0ZA 3ZVJA 2C80A 2H0HA 2H66A 5AIXA 3A2VA 3K8NA 3QFAC 3IDVA 4TXVA 1GUMA 2DMLA 20GSA 1O6JA 1WMJA 1XIYA 4AGSA 3NIVA 1V9WA 4CDOA 3FYGA 1HNBA 3SBCA 2K9FA 1QUWA 2V2GA 1UC7A 1SK0A 5IMDA 4IVFA 4XHMA 3GMFA 2RIIA 1FW1A 1GSEA 4HSCX 3VPQA 3TRPA 2LSTA 3GKNA 4MA9A 5E4WA 2XPDA 2MMOA 2AV4A 1ERWA 4TXOB 1XPVA 4BIKA 6GSYA 1T4ZA 1MTCA 4XRAA 1OVNA 1TJDA 1DE2A 3F6DA 1SK1A 5DVBA 2AHEA 2O85A 5CYYA 2X8CA 3TKQA 2ZCTA 1B4PA 3G9BA 1SENA 3HJMA 1K3YA 2PBJA 2AJQB 2JSZA 5H5RA 4KGIA 4F9ZA 2JADA 3MAKA 4L0WA 3HJPA 3I69A 1GTBA 3WGEA 4TN8A 1U3IA 3LYPA 2HRKA 4ZL9A 1E6BA 2GTUA 3ZITA 3ZIVA 4MABA 2H0IA 3G7JA 3GX0A 3D4MA 2TIRA 3IR4A 7GSSA 4PQIA 2C1YA 1UVZA 3VWVA 3LFLA 5ECPB 2F9SA 2IMKA 5F8BA 1FVKA 2A2PA 1AQVA 1G7EA 2V6OA 14GSA 3W8JA 2H19A 2NTOA 3I9V2 5HR0A 4I6XA 2R3XA 3TRQA 4EKZA 3FZ9A 2JL4A 2CAIA 2QA1A 3KP9A 1BQ7A 2LQQA 4QL7A 2K6VA 3LEFA 3HZ4A 2HE3A 4MZCA 3UVHA 5INYA 2CT6A 1EOGA 2H70A 1K0OA 2GSQA 3P8WA 4G10A 4MZWA 3VURA 6GSUA 2M72A 1KNGA 3CXGA 3HDCA 2YCDA 4K2DA 5B6NA 1LJRA 2V41A 4RUVA 2ON7A 5HQPA 2K8VA 1W89A 3FHKA 1B4QA 4HI7A 4CY6A 1T4YA 4TR0A 1M2BA 5GZZB 2BTOT 3WT1A 4O7HA 3C7MA 1U3AA 1EEMA 2R0GA 1JZRA 3C71A 1A0RP 1BJXA 5H5QA 5HFKA 3UL3A 5J41A 3TJKA 3VFIA 1URMA 4HJMA 4WXTA 4K7OA 4TRXA 5ABRA 3GSSA 2HZEA 3WYWA 3E3EA 3EMPA 1O85A 4JR4A 4MF6A 2HXKA 4K7NA 1PQNA 3RAZA 4KB3A 4HEA2 4NV2A 5AGYA 2GS3A 3VWXA 3FZ4A 2X99A 2LRTA 1SD8A 4BA7A 3ZFBA 2VCTA 1PMTA 4V2NA 5H5SA 3CSJA 4POMA 1BG5A 2EIQA 1YEPA 1OC9A 3SWLA 2WFCA 4IS0A 4V2MA 1FOHA 1KTEA 3TB2A 4YQMA 1GRXA 4I2TA 5CO3A 5ECQB 2RM5A 1THOA 4Z7XA 2DJ3A 3HVXA 3BCIA 5ECHB 3DKSA 4GCIA 3M8NA 2H8LA 1F3BA 2KP1A 4K5RA 4ZB8A 2P5RA 4PUFC 2B6MA 5CRGA 5IOXA 1YKAA 2LJAA 2YWMA 2C4JA 1XW6A 1EEJA 2WB9A 2VCQA 1SKRB 2NVLA 5G1LA 3GRXA 1JFUA 5FT3A 3VLNA 2REMA 4O5QA 1S3RA 2MMNA 1OC9B 3CQFA 1EGOA 4IP1A 2OE0A 3KZQA 5KN0A 3EWLA 5F06A 3EURA 3GTUB 1MD4A 1MEKA 1OE8A 4OFNA 1X5DA 2H76A 1VF3A 4L5LA 5EY6A 3FMWA 1SL0B 3UOMA 3RHCA 2H71A 3IHQA 4ZL8A 2JU5A 2N5FA 3KH9A 1U87A 2H75A 2WGRA 1WOUA 2K18A 4ULXA 1JZWA 2HZFA 1AAZA 3GL5A 2O89A 3C1SA 5CRWA 1I5GA 2R5GA 5DBQA 3G7YA 4KDYA 2LRCA 1GSDA 2O87A 3DVXA 4JE1A 4K1FA 1OC3A 1XBSA 2B5XA 2NBSA 5D8IA 3KP8A 2GQKA 2C0EA 1HYUA 5DJLA 2CA8A 1ZMAA 2GZPA 5F05A 4FO5A 4CHSA 1WPIA 1Z9HA 1G7OA 2FD3A 1J0FA 1TU8A 1PN9A 4J2FA 2H01A 4PQHA 1AIUA 4HU9A 3TCOA 3ZIJA 4GSNA 2C0DA 5ID2A 3TOUA 1OAZA 4L5OA 3QR6A 4X4JA 2FWEA 1TRVA 4PXOA 3A3TA 1Z3EA 9GSSA 3DEXA 3TKPA 3H1NA 5DQSA 2YP6A 5CNWA 3J7Yk 1A2MA 4F0CA 18GSA 2KUCA 4IQAA 3KTBA 2PPTA 3PR8A 4HOJA 1M99A 4WF5A 4Z2TA 1K0BA 1LU4A 3HVSA 5IMCA 3LXTA 1Z6NA 3C73A 2LV3A 3GH6A 3HHVA 3PGTA 1R5PA 2IL3A 3TOTA 3KTLA 3UBKA 4NWYA 2EIOA 2WCIA 2PMTA 3HD5A 5LD0A 2H1GA 1F37A 1XWAA 3TKSA 2H0GA 2H74A 4MP4A 3IK9A 3DIEA 4ISDA 4K0GA 2HNLA 5J5NA 2A4VA 2HSMA 2KP2A 4EE0A 2QSIA 3RPPA 1K0MA 4PUAA 4JBBA 1PRXA 2LS5A 5ID2B 1S3CA 1XXUA 19GSA 4XTSA 3ZMLA 2K8SA 4BWQA 4EDZA 5D73A 1GNWA 3KD0A 1AQWA 4USSA 1O8XA 2IWTA 2CVKA 2X49A 4V2LA 1VF4A 1T7PB 3NZNA 5IMAA 1TTZA 4YKGA 3IBHA 5GSTA 1XG8A 1JLWA 4K8MA 2X4AA 4XS4B 4KAEA 3VPTA 1TDIA 1ABAA 1WIKA 4O32A 2YANA 3U5RE 3ZL5A 5D93A 3TKSE 4IW9A 2B1KA 1S3DA 3GA4A 1WWJA 3C8EA 4POKA 1GSFA 1TRWA 3QMXA 2WRTA 1FHEA 3UBLA 1TK8B 5CREA 4ZB9A 1QGVA 1TXXA 3UMAA 4V1Ap 5AN1A 1PN0A 2N5AA 1KBNA 4TXOA 3NOFA 3F8UA 4KH7A 3EMXA 5IMFA 2HI7A 2VLUA 3W8SA 4OD7A 3C1RA 1XOAA 2PERA 2YV7A 2H6YA 4OO5A 16GSA 4Q5RA 2XC2A 3QAGA 2B5EA 1R26A 3TRXA 5GAND 2ALBA 4IBPA 1IYHA 2OKAA 4MZBA 2A4HA 2FUG2 5DCHA 5F0GA 1LBKA 3GURA 1UA5A 1OKDA 2B1LA 5L71A 3RHBA 4GXZA 3IE3A 2GQLA 2LNTA 3N9JA 4POBA 3CSIA 4IKHA 6GSWA 1GP1A 4DEJA 3TUEA 4DVCA 1VGLA 2H1BA 3A2XA 3R3EA 4LA1A 5G5EA 4LL1B 4ZIJA 3IC4A 4KCAA 2L5LA 4I2UA 1EP7A 3O76A 1V58A 3IAS2 3GIXA 4WR5A 3D4TA 4HQSA 5BRTA 1UN2A 3FK8A 4K9ZA 2O8VB 5J9CA 3F3QA 3QOUA 2QGVA 5KOWA 2PU9C 2FA8A 4EF0A 3ERWA 2LRNA 3VK9A 3UIWA 1U88A 4POLA 4V1Ag 4TR3A 3HY2A 5ECIB 3LW9A 3F4RA 5ELGA 5IO2A 2VO4A 5IPGA 2MMAA 2KHPA 4FQUA 3H8QA 3F6FA 5ELAA 3D21A 3HVVA 4JU5A 5HFIA 2DC5A 4RQXA 2J23A 1GSSA 2VD0A 2YN1A 4BVXB 2H72A 3Q6OA 3ZTLA 4P3YB 1USBA 3ISOA 3ZRDA 3E0UA 3JCML 6GSVA 4GRFA 2DIZA 1XW9A 3QCPA 1M3IA 1QQ2A 2M80A 2HSYA 4MMMA 4G2EA 4MJEA 3GN3A 2C3NA 1AQXA 4GSSA 5CAXA 4I97A 4K0NA 4HU7A 5ECRB 5GAPD 3GFKA 1O73A 5G30A 5EVOA 4BPYA 2IN3A 1V57A 2RUFA 1TI3A 1EP8A 3APSA 5JCUA 4AJ8A 2FA4A 3GKKA 1EWXA 3KMNA 5IMZA 4MJAA 6GSXA 1RK4A 2VOCA 4KE3A 2L6DA 3L0HA 2OJLA 1ERUA 5KEJA 3D22A 2I4AA 3H93A 4HQZA 2VAFA 2JZTA 1ZYPA 3CTFA 3H4KA 4MNNA 4IP6A 5D9VA 1A23A 2R0PA 2I9HA 5ECOB 4JRRA 2F8FA 5J4UA 3F9UA 3QD9A 1FVJA 2CX3A 2GT5A 1GSQA 5DJMA 3DXBA 4HZ4A 1BEDA 2PUKC 3QFBC 1S3AA 1VF2A 4F2IA 4BVYB 3ME7A 1QMVA 3HA9A 4TR4A 2B5YA 4GTUA 4G0KA 1M2AA 3LWAA 1Z7PA 2QC7A 3IOSA 1J9BA 3LQ7A 2JZRA 3P2AA 1FB6A 2FWFA 5JCGA 2HT9A 4KW6A 3VI7A 1A24A 4L0UA 4MF5A 4TOPA 2F3MA 1Z5YE 4FYBA 2VL3A 1K0NA 1XWBA 5HR3A 1G6YA 1SYRA 4IHUA 2P0GA 4MCUA 1GH2A 4GQFA 2CVDA 2DIYA 1GSYA 1H4OA 3EC3A 5J3RA 2X8HA 3ZLPA 1K0AA 2DKHA 5IPHA 1YEXA 1YY7A 3GTUA 1O8WA 1PL1A 4F0BA 4YH2A 3ZFLA 3IC8A 3HJOA 3UVTA 5EL8A 5F07A 4YAVA 2C0GA 3HXSA 2EIRA 5JWQB 4J57E 1F6MC 1A8YA 2IMEA 1GUKA 1NHYA 4IJ3A 1YJ6A 4G0LA 4EUYA 13GSA 5AIVA 2L59A 2HRNA 17GSA 3UARA 1OE7A 5G1KA 2IJYA 3ZVJD 5IM9A 4QQ7A 1M0UA 1PL2A 3IXRA 3TKRA 4XS1A 5DDLA 2VL2A 1OYJA 3CYNA 4MF7A 5DALA 5DAKB 1YZXA 2L57A 3M1GA 4EL1A 3IRAA 2B3SA 1SK2A 4YQVA 4NPBA 3EE2A 2YWOA 3LORA 3F4SA 11GSA 1HQOA 4AJ7A 2LJRA 1FB0A 4HDEA 1GSUA 3FR3A 4NMUA 5KN1A 3GNJA 4Z2UA 5E59A 3IV4A 3UJ1A 2LEGA 2F8AA 3Q19A 4I8BA 3AY8A 2CVBA 2OA7A 5BMUA 1WRYA 4GWRA 1NHOA 1GTIA 2WJUA 4N10A 2PVQA 4HZ2A 4RI6A 6GSSA 4NXIA 4EDYA 1M9AA 3N5OA 3GSTA 5J9BA 12GSA 1XOBA 5B6MA 5ECLB 3FY7A 3ZZXA 1A8LA 1AXDA 1Q98A 4GSTA 5IOWA 1BAYA 4HJ2A 2X64A 3P90A 4O5RA 2LUSA 4EVMA 4F03A 5DALB 1SJ6A 4MH2A 1XWGA 3BOAA 3LGCA 3R2QA 3WT2A 1SL2B 2IMDA 4OO4A 3KEBA 1R7HA 4YKFA 4ACSA 1JHBA 4KA0A 4XS6A 2DJ0A 1F9MA 2Z9SA 3TDGA 1R4WA 3MNGA 3KH7A 4KSOA 2WS2A 1BX9A 2WULA 1J08A 2WZ9A 3DWVA 1G6WA 2VD1A 4JZQA 5IQYA 4ECJA 1OKTA 1PFOA 3WD6A 2GSTA 3LYKA 1T8EB 4IN0A 1ON4A 3CRUA 4KUNA 5HR2A 2R2JA 4YAPA 2XBIA 2YZHA 3L9SA 1ZYEA 1BYEA 2E2MA 3MYDA 2N5BA 5LNKe 4OCFA 4DSQA 3ERGA 4XS4A 2LKUA 4WBRD 1EOHA 4FYUA 1Y6EA 5ENUA 4ZB6A 2L6CA 5A4WA 2MMZA 1FOVA 3FR9A 5CRHA 2A2SA 2YPMA 2VLVA 1TI1A 3FZ5A 2H30A 5D9XA 1PKZA 1EZKA 2MBTA 5G2ZA 1ST9A 1XFLA 4PGTA 5D96A 2BMXA 2L4QA 3FW2A 5IMVA 4E8EA 2DJ2A 3QAWA 1ZL9A 5ECSA 2DMMA 2GT6A 1QFNA 3OR5A 1HNCA 3RBTA 2CX4A 1I9DA 3PPUA 1PSQA 4NHWA 1X9WB 1DBYA 2XHFA 5EPFA 4N30A 2DJ1A 2C8UA 4XIHA 4BL7B 5LCZA 3VWWA 5COHA 4X43A 3HCZA 1HD2A 3MIXA 2LTKA 3TJBA 1MDKA 1B9YC 2D2ZA 2VCZA 3KGKA 2FLSA 3QDNA 3KIJA 4TR1B 1PA3A 2H1DA 1YQ1A 4ECBA 1CQGA 5B8BA 1PKWA 1K0DA 2YV9A 1GTUA 4KSMA 4XRDA 3MSZA 1OC8A 1MDJA 1EGRA 4MH3A 4N0VA 3KXOA 1IYIA 3CRTA 1TKDB 1JZOA 5G5FA 1XZOA 2PN8A 1K0CA 2I3YA 1NW2A 4ML1A 4D73B 4K7IA 4K6XA 4K5SA 2VUPA 4NHZA 4TKYA 1YF0A 2FHEA 4OFMA 4Q5NA 4MDCA
chains in the Genus database with same CATH topology
1ILOA 8GSSA 1SL1B 1TRSA 2AYTA 1QXHA 2VM2A 2GZZA 3PINA 1QK8A 2GGTA 1ERTA 3GKXA 3IPZA 4BVXA 2XPEA 1EV4A 5DQYA 2QKEA 3FEUA 3TGZA 1SJIA 2M46A 2GZYA 2CQ9A 3KCMA 1GLPA 2DJKA 1PX6A 2H1AA 2YWIA 1MDIA 4KDUA 3I6AA 2HLSA 5ECNB 3VWUA 1SJZA 1ZYNA 3DRNA 4AF2A 2E2GA 2TRXA 5HFGA 4I5QA 4ZILA 1H75A 4DSSB 2YWNA 1ZYQB 4EO3A 2BJXA 4N11A 3BBYA 2YNXA 4PQ1A 3FKFA 2RLIA 4TVEA 3CTGA 3O6TA 2CV4A 2VL9A 2OACA 2GSSA 1Z6MA 3APQA 2FWGA 4LMWA 1THXA 1TP9A 3EPTA 3CBUA 3QAVA 1FO5A 3P7XA 4HUAA 3CMIA 1FG4A 5FHIA 3ZYWA 2JACA 3UAPA 1XVQA 2FCHA 2DKIA 4BVYA 5D9WA 1SD9A 2FNOA 1TW9A 4PNGA 2F51A 3GUSA 3I43A 5ECKB 2VCXA 3EINA 2I81A 2NDOA 1ERVA 4FH8A 1M7TA 2OBKA 6GSTA 2FGXA 2HSHA 3A5IA 2VL2C 2KLXA 1PD21 4KX4A 4CY8A 1WP0A 1JLVA 5AISA 2HRFA 2E0QA 5DCGA 4BWSA 3F0IA 1X9SB 3M9JA 3FR6A 3HYPA 3DD3A 1G0TA 3KMOA 1YKCA 5C04A 2HRAA 3J7Yb 1GL8A 3KM6A 4OMVA 4A5PA 2QA2A 5JCWA 1RQMA 2H73A 2IMFA 1SKWB 2E7PA 1Y25A 3FRCA 3TJJA 3EVIA 2JZSA 1C72A 1X5CA 2OBIA 3DYRA 4JEDA 4WKWA 5ECMB 2H6XA 2X8GA 1WE0A 1TU7A 3BJ5A 1WJKA 3EYTA 4RI7A 1GWCA 3QPMA 4GLTA 2P31A 1B48A 5G31A 1SKSB 4DSRA 3IHGA 3L9VA 2IMIA 2FWHA 3Q74A 1AC1A 1ML6A 4XCSA 1X5EA 2AB6A 4H86A 1ZOFA 1X0RA 3W6GA 4FIWA 1V40A 5CP1A 3IK7A 4WR4A 2DJJA 5DAKA 4MK3A 4O92A 4EC0A 1ZGNA 3WGDA 1HNAA 1B9XC 4WF4A 4TW5A 3F4TA 3ME8A 2AAWA 5JWOB 4RQRA 2L4CA 2EC4A 3RPNA 3BCKA 5B7CA 1DE1A 1NM3A 2YJ7A 5A4VA 3FZAA 3L4NA 4GQCA 1XWCA 3A2WA 2IFQA 2CZ3A 3PH9A 2V6KA 4ZBDA 3TJGA 2ZUPA 4Z2RA 1SU9A 2J9HA 3MDKA 1ZZYA 3TKSC 3TJFA 4O5UA 2DLXA 1Z7RA 4ZL7A 3A5WA 2H6ZA 4JR6A 2HZEB 2CZ2A 4PTSA 2GQMA 4ICYA 2LNSA 4IJIA 2VCVA 5KN2A 1X9MB 4KCEA 5A4UA 3GV1A 3GYKA 4KDXA 5B8AA 1O81A 3IAM2 1GUHA 1YF1A 4J56E 3Q18A 2V1MA 2B7JA 3BD2A 3CSHA 4NAXA 4YQUA 1AUCA 2G2QA 2HFDA 1GTAA 3F3RA 4ZXGA 3HKRA 3DGQA 1VF1A 4KF9A 1PX7A 4PX1A 2FY6A 4Q5FA 5HR1A 3DMLA 3L78A 2IFQB 4PNFA 2C3QA 1ZCPA 2JSYA 2LQOA 1RW1A 1XW5A 2LJKA 3DVWA 1TOFA 1XCCA 3VI5A 3KJYA 4G0IA 4IELA 1CQHA 2VCWA 4F82A 2GSRA 2R37A 4CW9A 2L5OA 2YJHA 1GLQA 2OE1A 4OWYA 2G0FA 4PURA 4X0XA 1A2JA 5KOXA 3ZREA 1T00A 3U6VA 1F2EA 22GSA 3ED3A 3O3TA 4Q5QA 3ZMKA 3H79A 4IQ1A 3L9UA 2ON5A 5JWRB 1W4VA 4EIQA 5GSSA 1EV9A 4LLRA 1A0FA 3D6IA 2CAQA 1U6TA 2DBCA 4HS1A 1O7UA 1XWKA 3GKMA 4WETA 2R4VA 1N2AA 4MLYA 2P5QA 1TRUA 1DUGA 1F3AA 2DSAA 5CRDA 1VRSD 5IO0A 2RM6A 4LL4B 4BL7A 1K3LA 2IIYA 4MPGA 1JZDA 2MYGA 1A2LA 1T1VA 1Q4JA 1V98A 2NPBA 5D9TA 2MBSA 4ECIA 2YOIA 2HYXA 2IPAA 2PGTA 2OADA 3WGXA 5C00A 4ILFA 2R0CA 4OFTA 4TR1A 3US3A 2KOKA 1V2AA 4ECCA 1PGTA 1KEBA 4G19A 1TK5B 1M2DA 4ID0A 3IA1A 4OCEA 2PVOC 3GHAA 4EXJA 3APOA 1M9BA 3LSZA 1YDKA 3V1WA 4E8HA 2A2RA 2VLTA 3LJRA 4NV5A 2C0FA 4MJBA 2TRCP 3F63A 3GL3A 4ZBAA 4GF0A 1ACVA 3GX8A 4ML6A 4X1UA 4D73A 4KNDA 3EU4A 3LXZA 3UEMA 2MZCA 4IGJA 3D0ZA 4WEYA 2GLRA 2PWJA 1SYXA 2GVPA 2OE3A 3G7IA 4MPFA 2O7KA 1XVWA 4L8EA 4K2XA 3EU3A 2VIMA 1MD3A 5IIZA 3S9FA 5FWGA 2XBQA 2AUVA 2V32A 4EIPA 2ZNMA 3M3MA 1E2YA 1GULA 1T3BA 2I1UA 5A5KA 2GDRA 1TK0B 2YZUA 4MJCA 1GNEA 2ES7A 4ZBBA 2B7KA 3HZ8A 4G9HA 3MWHA 1B8XA 3M9KA 1DSBA 4DSSA 2RUEA 3RDWA 4LMVA 2VM1A 1K3OA 1FAAA 3LG6A 3GH9A 1R5AA 1N8JA 4QL9A 2UZ8A 3E9JB 1AW9A 2WDUA 4FYCA 2C3TA 1NSWA 4WBJA 3M0FA 5KN3A 3D5JA 4AJ6A 10GSA 2R6KA 3ERFA 4N0ZA 3ZVJA 2C80A 2H0HA 2H66A 5AIXA 3A2VA 3K8NA 3QFAC 3IDVA 4TXVA 1GUMA 2DMLA 20GSA 1O6JA 1WMJA 1XIYA 4AGSA 3NIVA 1V9WA 4CDOA 3FYGA 1HNBA 3SBCA 2K9FA 1QUWA 2V2GA 1UC7A 1SK0A 5IMDA 4IVFA 4XHMA 3GMFA 2RIIA 1FW1A 1GSEA 3VPQA 3TRPA 2LSTA 3GKNA 4MA9A 5E4WA 2XPDA 2MMOA 2AV4A 1ERWA 4TXOB 1XPVA 6GSYA 1T4ZA 1MTCA 4XRAA 1OVNA 1TJDA 1DE2A 3F6DA 1SK1A 5DVBA 2AHEA 2O85A 5CYYA 2X8CA 3TKQA 2ZCTA 1B4PA 3G9BA 1SENA 3HJMA 1K3YA 2PBJA 2AJQB 2JSZA 5H5RA 4KGIA 4F9ZA 2JADA 3MAKA 4L0WA 3HJPA 3I69A 1GTBA 3WGEA 4TN8A 1U3IA 3LYPA 2HRKA 4ZL9A 1E6BA 2GTUA 3ZITA 3ZIVA 4MABA 2H0IA 3G7JA 3GX0A 3D4MA 2TIRA 3IR4A 7GSSA 4PQIA 2C1YA 1UVZA 3VWVA 3LFLA 5ECPB 2F9SA 2IMKA 5F8BA 1FVKA 2A2PA 1AQVA 1G7EA 2V6OA 14GSA 3W8JA 2H19A 2NTOA 3I9V2 5HR0A 4I6XA 2R3XA 3TRQA 4EKZA 3FZ9A 2JL4A 2CAIA 2QA1A 3KP9A 1BQ7A 2LQQA 4QL7A 2K6VA 3LEFA 3HZ4A 2HE3A 4MZCA 3UVHA 5INYA 2CT6A 1EOGA 2H70A 1K0OA 2GSQA 3P8WA 4G10A 4MZWA 3VURA 6GSUA 2M72A 1KNGA 3CXGA 3HDCA 2YCDA 4K2DA 5B6NA 1LJRA 2V41A 4RUVA 2ON7A 5HQPA 2K8VA 1W89A 3FHKA 1B4QA 4HI7A 4CY6A 1T4YA 4TR0A 1M2BA 5GZZB 2BTOT 3WT1A 4O7HA 3C7MA 1U3AA 1EEMA 2R0GA 1JZRA 3C71A 1A0RP 1BJXA 5H5QA 5HFKA 3UL3A 5J41A 3TJKA 3VFIA 1URMA 4HJMA 4WXTA 4K7OA 4TRXA 5ABRA 3GSSA 2HZEA 3WYWA 3E3EA 3EMPA 1O85A 4JR4A 4MF6A 2HXKA 4K7NA 1PQNA 3RAZA 4KB3A 4HEA2 4NV2A 5AGYA 2GS3A 3VWXA 3FZ4A 2X99A 2LRTA 1SD8A 4BA7A 3ZFBA 2VCTA 1PMTA 4V2NA 5H5SA 3CSJA 4POMA 1BG5A 2EIQA 1YEPA 1OC9A 3SWLA 2WFCA 4IS0A 4V2MA 1FOHA 1KTEA 3TB2A 4YQMA 1GRXA 4I2TA 5CO3A 5ECQB 2RM5A 1THOA 4Z7XA 2DJ3A 3HVXA 3BCIA 5ECHB 3DKSA 4GCIA 3M8NA 2H8LA 1F3BA 2KP1A 4K5RA 4ZB8A 2P5RA 4PUFC 2B6MA 5CRGA 5IOXA 1YKAA 2LJAA 2YWMA 2C4JA 1XW6A 1EEJA 2WB9A 2VCQA 1SKRB 2NVLA 5G1LA 3GRXA 1JFUA 5FT3A 3VLNA 2REMA 4O5QA 2MMNA 1OC9B 1EGOA 4IP1A 2OE0A 3KZQA 5KN0A 3EWLA 5F06A 3EURA 3GTUB 1MD4A 1MEKA 1OE8A 4OFNA 1X5DA 2H76A 1VF3A 4L5LA 5EY6A 3FMWA 1SL0B 3UOMA 3RHCA 2H71A 3IHQA 4ZL8A 2JU5A 2N5FA 3KH9A 1U87A 2H75A 2WGRA 1WOUA 2K18A 4ULXA 1JZWA 2HZFA 1AAZA 3GL5A 2O89A 3C1SA 5CRWA 1I5GA 2R5GA 5DBQA 3G7YA 4KDYA 2LRCA 1GSDA 2O87A 3DVXA 4JE1A 4K1FA 1OC3A 1XBSA 2B5XA 2NBSA 5D8IA 3KP8A 2GQKA 2C0EA 1HYUA 5DJLA 2CA8A 1ZMAA 2GZPA 5F05A 4FO5A 4CHSA 1WPIA 1Z9HA 1G7OA 2FD3A 1J0FA 1TU8A 1PN9A 4J2FA 2H01A 4PQHA 1AIUA 4HU9A 3TCOA 3ZIJA 4GSNA 2C0DA 5ID2A 3TOUA 1OAZA 4L5OA 3QR6A 4X4JA 2FWEA 1TRVA 4PXOA 3A3TA 1Z3EA 9GSSA 3DEXA 3TKPA 3H1NA 5DQSA 2YP6A 5CNWA 3J7Yk 1A2MA 4F0CA 18GSA 2KUCA 4IQAA 3KTBA 2PPTA 3PR8A 4HOJA 1M99A 4WF5A 4Z2TA 1K0BA 1LU4A 3HVSA 5IMCA 3LXTA 1Z6NA 3C73A 2LV3A 3GH6A 3HHVA 3PGTA 1R5PA 2IL3A 3TOTA 3KTLA 3UBKA 4NWYA 2EIOA 2WCIA 2PMTA 3HD5A 5LD0A 2H1GA 1F37A 1XWAA 3TKSA 2H0GA 2H74A 4MP4A 3IK9A 3DIEA 4ISDA 4K0GA 2HNLA 5J5NA 2A4VA 2HSMA 2KP2A 4EE0A 2QSIA 3RPPA 1K0MA 4PUAA 4JBBA 1PRXA 2LS5A 5ID2B 1S3CA 1XXUA 19GSA 4XTSA 3ZMLA 2K8SA 4BWQA 4EDZA 5D73A 1GNWA 3KD0A 1AQWA 4USSA 1O8XA 2IWTA 2CVKA 2X49A 4V2LA 1VF4A 1T7PB 3NZNA 5IMAA 1TTZA 4YKGA 3IBHA 5GSTA 1JLWA 4K8MA 2X4AA 4XS4B 4KAEA 3VPTA 1TDIA 1ABAA 1WIKA 4O32A 2YANA 3U5RE 3ZL5A 5D93A 3TKSE 4IW9A 2B1KA 1S3DA 3GA4A 1WWJA 3C8EA 4POKA 1GSFA 1TRWA 3QMXA 2WRTA 1FHEA 3UBLA 1TK8B 5CREA 4ZB9A 1QGVA 1TXXA 3UMAA 4V1Ap 5AN1A 1PN0A 2N5AA 1KBNA 4TXOA 3NOFA 3F8UA 4KH7A 3EMXA 5IMFA 2HI7A 2VLUA 3W8SA 4OD7A 3C1RA 1XOAA 2PERA 2YV7A 2H6YA 4OO5A 16GSA 4Q5RA 2XC2A 3QAGA 2B5EA 1R26A 3TRXA 5GAND 2ALBA 4IBPA 1IYHA 2OKAA 4MZBA 2A4HA 2FUG2 5DCHA 5F0GA 1LBKA 3GURA 1OKDA 1UA5A 2B1LA 5L71A 3RHBA 4GXZA 3IE3A 2GQLA 2LNTA 3N9JA 4POBA 3CSIA 4IKHA 6GSWA 1GP1A 4DEJA 3TUEA 4DVCA 1VGLA 2H1BA 3A2XA 3R3EA 4LA1A 5G5EA 4LL1B 4ZIJA 3IC4A 4KCAA 2L5LA 4I2UA 1EP7A 3O76A 1V58A 3IAS2 3GIXA 4WR5A 3D4TA 4HQSA 5BRTA 1UN2A 3FK8A 4K9ZA 2O8VB 5J9CA 3F3QA 3QOUA 2QGVA 5KOWA 2PU9C 2FA8A 4EF0A 3ERWA 2LRNA 3VK9A 3UIWA 1U88A 4POLA 4V1Ag 4TR3A 3HY2A 5ECIB 3LW9A 3F4RA 5ELGA 5IO2A 2VO4A 5IPGA 2MMAA 2KHPA 4FQUA 3H8QA 3F6FA 5ELAA 3D21A 3HVVA 4JU5A 5HFIA 2DC5A 4RQXA 2J23A 1GSSA 2VD0A 2YN1A 4BVXB 2H72A 3Q6OA 3ZTLA 4P3YB 1USBA 3ISOA 3ZRDA 3E0UA 3JCML 6GSVA 4GRFA 2DIZA 1XW9A 3QCPA 1QQ2A 2M80A 2HSYA 4MMMA 4G2EA 4MJEA 3GN3A 2C3NA 1AQXA 4GSSA 5CAXA 4I97A 4K0NA 4HU7A 5ECRB 5GAPD 3GFKA 1O73A 5G30A 5EVOA 4BPYA 2IN3A 1V57A 2RUFA 1TI3A 1EP8A 3APSA 5JCUA 4AJ8A 2FA4A 3GKKA 1EWXA 3KMNA 5IMZA 4MJAA 6GSXA 1RK4A 2VOCA 4KE3A 2L6DA 3L0HA 2OJLA 1ERUA 5KEJA 3D22A 2I4AA 3H93A 4HQZA 2VAFA 2JZTA 1ZYPA 3CTFA 3H4KA 4MNNA 4IP6A 5D9VA 1A23A 2R0PA 2I9HA 5ECOB 4JRRA 2F8FA 5J4UA 3F9UA 3QD9A 1FVJA 2CX3A 2GT5A 1GSQA 5DJMA 3DXBA 4HZ4A 1BEDA 2PUKC 3QFBC 1S3AA 1VF2A 4F2IA 4BVYB 3ME7A 1QMVA 3HA9A 4TR4A 2B5YA 4GTUA 4G0KA 1M2AA 3LWAA 1Z7PA 2QC7A 3IOSA 1J9BA 3LQ7A 2JZRA 3P2AA 1FB6A 2FWFA 5JCGA 2HT9A 4KW6A 3VI7A 1A24A 4L0UA 4MF5A 4TOPA 2F3MA 1Z5YE 4FYBA 2VL3A 1K0NA 1XWBA 5HR3A 1G6YA 1SYRA 4IHUA 2P0GA 4MCUA 1GH2A 4GQFA 2CVDA 2DIYA 1GSYA 1H4OA 3EC3A 5J3RA 2X8HA 3ZLPA 1K0AA 2DKHA 5IPHA 1YEXA 1YY7A 3GTUA 1O8WA 1PL1A 4F0BA 4YH2A 3ZFLA 3IC8A 3HJOA 3UVTA 5EL8A 5F07A 4YAVA 2C0GA 3HXSA 2EIRA 5JWQB 4J57E 1F6MC 1A8YA 2IMEA 1GUKA 1NHYA 4IJ3A 1YJ6A 4G0LA 4EUYA 13GSA 5AIVA 2L59A 2HRNA 17GSA 3UARA 1OE7A 5G1KA 2IJYA 3ZVJD 5IM9A 4QQ7A 1M0UA 1PL2A 3IXRA 3TKRA 4XS1A 5DDLA 2VL2A 1OYJA 3CYNA 4MF7A 5DALA 5DAKB 1YZXA 2L57A 3M1GA 4EL1A 3IRAA 2B3SA 1SK2A 4YQVA 4NPBA 3EE2A 2YWOA 3LORA 3F4SA 11GSA 1HQOA 4AJ7A 2LJRA 1FB0A 4HDEA 1GSUA 3FR3A 4NMUA 5KN1A 3GNJA 4Z2UA 5E59A 3IV4A 3UJ1A 2LEGA 2F8AA 3Q19A 4I8BA 3AY8A 2CVBA 2OA7A 5BMUA 1WRYA 4GWRA 1NHOA 1GTIA 2WJUA 4N10A 2PVQA 4HZ2A 4RI6A 6GSSA 4NXIA 4EDYA 1M9AA 3N5OA 3GSTA 5J9BA 12GSA 1XOBA 5B6MA 5ECLB 3FY7A 3ZZXA 1A8LA 1AXDA 1Q98A 4GSTA 5IOWA 1BAYA 4HJ2A 2X64A 3P90A 4O5RA 2LUSA 4EVMA 4F03A 5DALB 1SJ6A 4MH2A 1XWGA 3BOAA 3LGCA 3R2QA 3WT2A 1SL2B 2IMDA 4OO4A 3KEBA 1R7HA 4YKFA 4ACSA 1JHBA 4KA0A 4XS6A 2DJ0A 1F9MA 2Z9SA 3TDGA 1R4WA 3MNGA 3KH7A 4KSOA 2WS2A 1BX9A 2WULA 1J08A 2WZ9A 3DWVA 1G6WA 2VD1A 4JZQA 5IQYA 4ECJA 1OKTA 3WD6A 2GSTA 3LYKA 1T8EB 4IN0A 1ON4A 3CRUA 4KUNA 5HR2A 2R2JA 4YAPA 2XBIA 2YZHA 3L9SA 1ZYEA 1BYEA 2E2MA 3MYDA 2N5BA 5LNKe 4OCFA 4DSQA 3ERGA 4XS4A 2LKUA 4WBRD 1EOHA 4FYUA 1Y6EA 5ENUA 4ZB6A 2L6CA 5A4WA 2MMZA 1FOVA 3FR9A 5CRHA 2A2SA 2YPMA 2VLVA 1TI1A 3FZ5A 2H30A 5D9XA 1PKZA 1EZKA 2MBTA 5G2ZA 1ST9A 1XFLA 4PGTA 5D96A 2BMXA 2L4QA 3FW2A 5IMVA 4E8EA 2DJ2A 3QAWA 1ZL9A 5ECSA 2DMMA 2GT6A 1QFNA 3OR5A 1HNCA 3RBTA 2CX4A 1I9DA 3PPUA 1PSQA 4NHWA 1X9WB 1DBYA 2XHFA 5EPFA 4N30A 2DJ1A 2C8UA 4XIHA 4BL7B 5LCZA 3VWWA 5COHA 4X43A 3HCZA 1HD2A 3MIXA 2LTKA 3TJBA 1MDKA 1B9YC 2D2ZA 2VCZA 3KGKA 2FLSA 3QDNA 3KIJA 4TR1B 1PA3A 2H1DA 1YQ1A 4ECBA 1CQGA 5B8BA 1PKWA 1K0DA 2YV9A 1GTUA 4KSMA 4XRDA 3MSZA 1OC8A 1MDJA 1EGRA 4MH3A 4N0VA 3KXOA 1IYIA 3CRTA 1TKDB 1JZOA 5G5FA 1XZOA 2PN8A 1K0CA 2I3YA 1NW2A 4ML1A 4D73B 4K7IA 4K6XA 4K5SA 2VUPA 4NHZA 4TKYA 1YF0A 2FHEA 4OFMA 4Q5NA 4MDCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ILO A;  8GSS A;  1SL1 B;  1TRS A;  2AYT A;  1QXH A;  2VM2 A;  2GZZ A;  3PIN A;  1QK8 A;  2GGT A;  1ERT A;  3GKX A;  3IPZ A;  4BVX A;  2XPE A;  1EV4 A;  5DQY A;  2QKE A;  3FEU A;  3TGZ A;  1SJI A;  2M46 A;  2GZY A;  2CQ9 A;  3KCM A;  1GLP A;  2DJK A;  1PX6 A;  2H1A A;  2YWI A;  1MDI A;  4KDU A;  3I6A A;  2HLS A;  5ECN B;  3VWU A;  1SJZ A;  3DRN A;  4AF2 A;  2E2G A;  2TRX A;  5HFG A;  4I5Q A;  4ZIL A;  1H75 A;  4DSS B;  2YWN A;  1ZYQ B;  4EO3 A;  2BJX A;  4N11 A;  3BBY A;  2YNX A;  4PQ1 A;  3FKF A;  2RLI A;  4TVE A;  3CTG A;  3O6T A;  2CV4 A;  2VL9 A;  2OAC A;  2GSS A;  1Z6M A;  3APQ A;  2FWG A;  4LMW A;  1THX A;  1TP9 A;  3CBU A;  3QAV A;  1FO5 A;  3P7X A;  4HUA A;  3CMI A;  1FG4 A;  5FHI A;  3ZYW A;  2JAC A;  3UAP A;  1XVQ A;  2FCH A;  4BVY A;  5D9W A;  1SD9 A;  2FNO A;  1TW9 A;  4PNG A;  2F51 A;  3GUS A;  3I43 A;  5ECK B;  2VCX A;  3EIN A;  2I81 A;  2NDO A;  1ERV A;  4FH8 A;  1M7T A;  2OBK A;  6GST A;  2FGX A;  2HSH A;  2VL2 C;  2KLX A;  1PD2 1;  4KX4 A;  1WP0 A;  1JLV A;  5AIS A;  2HRF A;  2E0Q A;  5DCG A;  4BWS A;  3F0I A;  1X9S B;  3M9J A;  3FR6 A;  3HYP A;  3DD3 A;  1G0T A;  3KMO A;  1YKC A;  5C04 A;  3J7Y b;  1GL8 A;  3KM6 A;  4OMV A;  5JCW A;  1RQM A;  2H73 A;  2IMF A;  1SKW B;  2E7P A;  1Y25 A;  3FRC A;  3TJJ A;  3EVI A;  2JZS A;  1C72 A;  1X5C A;  2OBI A;  3DYR A;  4JED A;  4WKW A;  5ECM B;  2H6X A;  2X8G A;  1WE0 A;  1TU7 A;  3BJ5 A;  1WJK A;  3EYT A;  4RI7 A;  1GWC A;  3QPM A;  4GLT A;  2P31 A;  1B48 A;  5G31 A;  1SKS B;  4DSR A;  3L9V A;  2IMI A;  2FWH A;  3Q74 A;  1AC1 A;  1ML6 A;  4XCS A;  1X5E A;  2AB6 A;  4H86 A;  1ZOF A;  1X0R A;  3W6G A;  4FIW A;  1V40 A;  5CP1 A;  3IK7 A;  4WR4 A;  2DJJ A;  5DAK A;  4MK3 A;  4O92 A;  4EC0 A;  1ZGN A;  3WGD A;  1HNA A;  1B9X C;  4WF4 A;  4TW5 A;  3F4T A;  3ME8 A;  2AAW A;  5JWO B;  4RQR A;  2L4C A;  2EC4 A;  3RPN A;  3BCK A;  5B7C A;  1DE1 A;  1NM3 A;  2YJ7 A;  5A4V A;  3FZA A;  3L4N A;  4GQC A;  1XWC A;  3A2W A;  2IFQ A;  2CZ3 A;  3PH9 A;  2V6K A;  4ZBD A;  3TJG A;  2ZUP A;  1SU9 A;  2J9H A;  3MDK A;  1ZZY A;  3TKS C;  3TJF A;  2DLX A;  1Z7R A;  4ZL7 A;  3A5W A;  2H6Z A;  4JR6 A;  2HZE B;  2CZ2 A;  2GQM A;  2LNS A;  4IJI A;  2VCV A;  5KN2 A;  1X9M B;  4KCE A;  5A4U A;  3GV1 A;  3GYK A;  4KDX A;  5B8A A;  1O81 A;  3IAM 2;  1GUH A;  1YF1 A;  4J56 E;  3Q18 A;  2V1M A;  2B7J A;  3BD2 A;  3CSH A;  4NAX A;  4YQU A;  1AUC A;  2G2Q A;  2HFD A;  1GTA A;  3F3R A;  4ZXG A;  3HKR A;  3DGQ A;  1VF1 A;  1PX7 A;  4PX1 A;  2FY6 A;  4Q5F A;  5HR1 A;  3DML A;  3L78 A;  2IFQ B;  4PNF A;  2C3Q A;  1ZCP A;  2JSY A;  2LQO A;  1RW1 A;  1XW5 A;  2LJK A;  3DVW A;  1TOF A;  1XCC A;  3VI5 A;  3KJY A;  4IEL A;  1CQH A;  2VCW A;  4F82 A;  2GSR A;  2R37 A;  4CW9 A;  2L5O A;  2YJH A;  1GLQ A;  2OE1 A;  4OWY A;  2G0F A;  4PUR A;  4X0X A;  1A2J A;  3ZRE A;  1T00 A;  3U6V A;  1F2E A;  22GS A;  3ED3 A;  3O3T A;  4Q5Q A;  3ZMK A;  3H79 A;  4IQ1 A;  3L9U A;  2ON5 A;  5JWR B;  1W4V A;  5GSS A;  1EV9 A;  4LLR A;  1A0F A;  3D6I A;  2CAQ A;  1U6T A;  2DBC A;  4HS1 A;  1O7U A;  1XWK A;  3GKM A;  4WET A;  2R4V A;  1N2A A;  4MLY A;  2P5Q A;  1TRU A;  1DUG A;  1F3A A;  2DSA A;  5CRD A;  1VRS D;  5IO0 A;  2RM6 A;  4LL4 B;  4BL7 A;  1K3L A;  2IIY A;  4MPG A;  1JZD A;  2MYG A;  1A2L A;  1T1V A;  1Q4J A;  1V98 A;  2NPB A;  5D9T A;  2MBS A;  4ECI A;  2YOI A;  2HYX A;  2IPA A;  2PGT A;  2OAD A;  3WGX A;  5C00 A;  4ILF A;  4OFT A;  4TR1 A;  3US3 A;  2KOK A;  1V2A A;  4ECC A;  1PGT A;  1KEB A;  4G19 A;  1TK5 B;  1M2D A;  4ID0 A;  3IA1 A;  4OCE A;  2PVO C;  3GHA A;  4EXJ A;  3APO A;  1M9B A;  3LSZ A;  1YDK A;  3V1W A;  4E8H A;  2A2R A;  2VLT A;  3LJR A;  4NV5 A;  2C0F A;  4MJB A;  2TRC P;  3F63 A;  3GL3 A;  4ZBA A;  4GF0 A;  1ACV A;  3GX8 A;  4ML6 A;  4X1U A;  4D73 A;  4KND A;  3EU4 A;  3LXZ A;  3UEM A;  2MZC A;  4IGJ A;  3D0Z A;  4WEY A;  2GLR A;  2PWJ A;  1SYX A;  2GVP A;  2OE3 A;  3G7I A;  4MPF A;  2O7K A;  1XVW A;  4L8E A;  3EU3 A;  2VIM A;  1MD3 A;  5IIZ A;  3S9F A;  5FWG A;  2XBQ A;  2AUV A;  2V32 A;  2ZNM A;  3M3M A;  1E2Y A;  1GUL A;  1T3B A;  2I1U A;  5A5K A;  2GDR A;  1TK0 B;  2YZU A;  4MJC A;  1GNE A;  2ES7 A;  4ZBB A;  2B7K A;  3HZ8 A;  4G9H A;  3MWH A;  1B8X A;  3M9K A;  1DSB A;  4DSS A;  2RUE A;  3RDW A;  4LMV A;  2VM1 A;  1K3O A;  1FAA A;  3LG6 A;  3GH9 A;  1R5A A;  1N8J A;  4QL9 A;  3E9J B;  1AW9 A;  2WDU A;  4FYC A;  2C3T A;  1NSW A;  4WBJ A;  3M0F A;  5KN3 A;  3D5J A;  4AJ6 A;  10GS A;  2R6K A;  3ERF A;  4N0Z A;  3ZVJ A;  2C80 A;  2H0H A;  2H66 A;  5AIX A;  3A2V A;  3K8N A;  3QFA C;  3IDV A;  4TXV A;  1GUM A;  2DML A;  20GS A;  1O6J A;  1WMJ A;  1XIY A;  4AGS A;  3NIV A;  1V9W A;  4CDO A;  3FYG A;  1HNB A;  3SBC A;  2K9F A;  1QUW A;  2V2G A;  1UC7 A;  1SK0 A;  5IMD A;  4IVF A;  4XHM A;  3GMF A;  2RII A;  1FW1 A;  1GSE A;  3VPQ A;  3TRP A;  2LST A;  3GKN A;  4MA9 A;  5E4W A;  2XPD A;  2MMO A;  2AV4 A;  1ERW A;  4TXO B;  1XPV A;  6GSY A;  1T4Z A;  1MTC A;  4XRA A;  1OVN A;  1TJD A;  1DE2 A;  3F6D A;  1SK1 A;  5DVB A;  2AHE A;  2O85 A;  5CYY A;  2X8C A;  3TKQ A;  2ZCT A;  1B4P A;  3G9B A;  1SEN A;  3HJM A;  1K3Y A;  2PBJ A;  2AJQ B;  2JSZ A;  5H5R A;  4KGI A;  4F9Z A;  2JAD A;  3MAK A;  4L0W A;  3HJP A;  3I69 A;  1GTB A;  3WGE A;  4TN8 A;  1U3I A;  3LYP A;  4ZL9 A;  1E6B A;  2GTU A;  3ZIT A;  3ZIV A;  4MAB A;  2H0I A;  3G7J A;  3GX0 A;  3D4M A;  2TIR A;  3IR4 A;  7GSS A;  4PQI A;  2C1Y A;  1UVZ A;  3VWV A;  3LFL A;  5ECP B;  2F9S A;  2IMK A;  5F8B A;  1FVK A;  1AQV A;  1G7E A;  2V6O A;  14GS A;  3W8J A;  2H19 A;  2NTO A;  3I9V 2;  5HR0 A;  4I6X A;  2R3X A;  3TRQ A;  4EKZ A;  3FZ9 A;  2JL4 A;  2CAI A;  3KP9 A;  1BQ7 A;  2LQQ A;  4QL7 A;  2K6V A;  3LEF A;  3HZ4 A;  2HE3 A;  4MZC A;  3UVH A;  5INY A;  2CT6 A;  1EOG A;  2H70 A;  1K0O A;  2GSQ A;  3P8W A;  4G10 A;  4MZW A;  3VUR A;  6GSU A;  2M72 A;  1KNG A;  3CXG A;  3HDC A;  2YCD A;  4K2D A;  5B6N A;  1LJR A;  2V41 A;  4RUV A;  2ON7 A;  5HQP A;  2K8V A;  1W89 A;  3FHK A;  1B4Q A;  4HI7 A;  1T4Y A;  4TR0 A;  1M2B A;  5GZZ B;  2BTO T;  3WT1 A;  4O7H A;  3C7M A;  1U3A A;  1EEM A;  1JZR A;  3C71 A;  1A0R P;  1BJX A;  5H5Q A;  5HFK A;  3UL3 A;  5J41 A;  3TJK A;  3VFI A;  1URM A;  4HJM A;  4WXT A;  4K7O A;  4TRX A;  5ABR A;  3GSS A;  2HZE A;  3WYW A;  3E3E A;  3EMP A;  1O85 A;  4JR4 A;  4MF6 A;  2HXK A;  4K7N A;  1PQN A;  3RAZ A;  4KB3 A;  4HEA 2;  4NV2 A;  5AGY A;  2GS3 A;  3VWX A;  3FZ4 A;  2X99 A;  2LRT A;  1SD8 A;  4BA7 A;  3ZFB A;  2VCT A;  1PMT A;  4V2N A;  5H5S A;  3CSJ A;  4POM A;  1BG5 A;  2EIQ A;  1YEP A;  1OC9 A;  3SWL A;  2WFC A;  4IS0 A;  4V2M A;  1KTE A;  3TB2 A;  4YQM A;  1GRX A;  4I2T A;  5CO3 A;  5ECQ B;  2RM5 A;  1THO A;  4Z7X A;  2DJ3 A;  3HVX A;  3BCI A;  5ECH B;  3DKS A;  4GCI A;  3M8N A;  2H8L A;  1F3B A;  2KP1 A;  4ZB8 A;  2P5R A;  4PUF C;  2B6M A;  5CRG A;  5IOX A;  1YKA A;  2LJA A;  2YWM A;  2C4J A;  1XW6 A;  1EEJ A;  2WB9 A;  2VCQ A;  1SKR B;  2NVL A;  5G1L A;  3GRX A;  1JFU A;  5FT3 A;  3VLN A;  2REM A;  2MMN A;  1OC9 B;  1EGO A;  4IP1 A;  2OE0 A;  3KZQ A;  5KN0 A;  3EWL A;  5F06 A;  3EUR A;  3GTU B;  1MD4 A;  1MEK A;  1OE8 A;  4OFN A;  1X5D A;  2H76 A;  1VF3 A;  4L5L A;  5EY6 A;  1SL0 B;  3UOM A;  3RHC A;  2H71 A;  3IHQ A;  4ZL8 A;  2JU5 A;  2N5F A;  3KH9 A;  1U87 A;  2H75 A;  2WGR A;  1WOU A;  2K18 A;  4ULX A;  1JZW A;  2HZF A;  1AAZ A;  3GL5 A;  2O89 A;  3C1S A;  5CRW A;  1I5G A;  2R5G A;  5DBQ A;  3G7Y A;  4KDY A;  2LRC A;  1GSD A;  2O87 A;  3DVX A;  4JE1 A;  4K1F A;  1OC3 A;  1XBS A;  2B5X A;  2NBS A;  5D8I A;  3KP8 A;  2GQK A;  2C0E A;  1HYU A;  5DJL A;  2CA8 A;  1ZMA A;  2GZP A;  5F05 A;  4FO5 A;  4CHS A;  1WPI A;  1Z9H A;  1G7O A;  2FD3 A;  1J0F A;  1TU8 A;  1PN9 A;  4J2F A;  2H01 A;  4PQH A;  1AIU A;  4HU9 A;  3TCO A;  3ZIJ A;  4GSN A;  2C0D A;  5ID2 A;  3TOU A;  1OAZ A;  4L5O A;  3QR6 A;  2FWE A;  1TRV A;  4PXO A;  3A3T A;  1Z3E A;  9GSS A;  3DEX A;  3TKP A;  3H1N A;  5DQS A;  2YP6 A;  5CNW A;  3J7Y k;  1A2M A;  4F0C A;  18GS A;  2KUC A;  4IQA A;  3KTB A;  2PPT A;  3PR8 A;  4HOJ A;  1M99 A;  4WF5 A;  1K0B A;  1LU4 A;  3HVS A;  5IMC A;  3LXT A;  1Z6N A;  3C73 A;  2LV3 A;  3GH6 A;  3HHV A;  3PGT A;  1R5P A;  2IL3 A;  3TOT A;  3KTL A;  3UBK A;  4NWY A;  2EIO A;  2WCI A;  2PMT A;  3HD5 A;  5LD0 A;  2H1G A;  1F37 A;  1XWA A;  3TKS A;  2H0G A;  2H74 A;  4MP4 A;  3IK9 A;  3DIE A;  4ISD A;  4K0G A;  2HNL A;  5J5N A;  2A4V A;  2KP2 A;  4EE0 A;  2QSI A;  3RPP A;  1K0M A;  4PUA A;  4JBB A;  1PRX A;  2LS5 A;  5ID2 B;  1S3C A;  1XXU A;  19GS A;  4XTS A;  3ZML A;  2K8S A;  4BWQ A;  4EDZ A;  5D73 A;  1GNW A;  3KD0 A;  1AQW A;  1O8X A;  2IWT A;  2CVK A;  4V2L A;  1VF4 A;  1T7P B;  3NZN A;  5IMA A;  1TTZ A;  3IBH A;  5GST A;  1JLW A;  4K8M A;  4XS4 B;  4KAE A;  3VPT A;  1TDI A;  1ABA A;  1WIK A;  4O32 A;  2YAN A;  3U5R E;  3ZL5 A;  5D93 A;  3TKS E;  4IW9 A;  2B1K A;  1S3D A;  3GA4 A;  1WWJ A;  3C8E A;  4POK A;  1GSF A;  1TRW A;  3QMX A;  2WRT A;  1FHE A;  3UBL A;  1TK8 B;  5CRE A;  4ZB9 A;  1QGV A;  1TXX A;  3UMA A;  4V1A p;  5AN1 A;  2N5A A;  1KBN A;  4TXO A;  3NOF A;  3F8U A;  4KH7 A;  3EMX A;  5IMF A;  2HI7 A;  2VLU A;  3W8S A;  4OD7 A;  3C1R A;  1XOA A;  2PER A;  2YV7 A;  2H6Y A;  4OO5 A;  16GS A;  4Q5R A;  2XC2 A;  3QAG A;  2B5E A;  1R26 A;  3TRX A;  5GAN D;  2ALB A;  4IBP A;  1IYH A;  2OKA A;  4MZB A;  2FUG 2;  5DCH A;  5F0G A;  1LBK A;  3GUR A;  1OKD A;  1UA5 A;  2B1L A;  5L71 A;  3RHB A;  4GXZ A;  3IE3 A;  2GQL A;  2LNT A;  3N9J A;  4POB A;  3CSI A;  4IKH A;  6GSW A;  1GP1 A;  4DEJ A;  3TUE A;  4DVC A;  1VGL A;  2H1B A;  3A2X A;  4LA1 A;  5G5E A;  4LL1 B;  4ZIJ A;  3IC4 A;  4KCA A;  2L5L A;  4I2U A;  1EP7 A;  3O76 A;  1V58 A;  3IAS 2;  3GIX A;  4WR5 A;  3D4T A;  4HQS A;  1UN2 A;  3FK8 A;  4K9Z A;  2O8V B;  5J9C A;  3F3Q A;  3QOU A;  2QGV A;  2PU9 C;  2FA8 A;  4EF0 A;  3ERW A;  2LRN A;  3VK9 A;  3UIW A;  1U88 A;  4POL A;  4V1A g;  4TR3 A;  3HY2 A;  5ECI B;  3F4R A;  5ELG A;  5IO2 A;  2VO4 A;  5IPG A;  2MMA A;  2KHP A;  3H8Q A;  3F6F A;  5ELA A;  3D21 A;  3HVV A;  4JU5 A;  5HFI A;  2DC5 A;  4RQX A;  2J23 A;  1GSS A;  2VD0 A;  2YN1 A;  2H72 A;  3Q6O A;  3ZTL A;  4P3Y B;  1USB A;  3ISO A;  3ZRD A;  3E0U A;  3JCM L;  6GSV A;  4GRF A;  2DIZ A;  1XW9 A;  3QCP A;  1QQ2 A;  2M80 A;  2HSY A;  4MMM A;  4G2E A;  4MJE A;  3GN3 A;  2C3N A;  1AQX A;  4GSS A;  5CAX A;  4I97 A;  4K0N A;  4HU7 A;  5ECR B;  5GAP D;  3GFK A;  1O73 A;  5G30 A;  5EVO A;  4BPY A;  2IN3 A;  1V57 A;  2RUF A;  1TI3 A;  1EP8 A;  3APS A;  5JCU A;  4AJ8 A;  2FA4 A;  3GKK A;  1EWX A;  3KMN A;  5IMZ A;  4MJA A;  6GSX A;  1RK4 A;  2VOC A;  4KE3 A;  2L6D A;  3L0H A;  2OJL A;  1ERU A;  5KEJ A;  3D22 A;  2I4A A;  3H93 A;  4HQZ A;  2VAF A;  2JZT A;  3CTF A;  3H4K A;  4IP6 A;  5D9V A;  1A23 A;  2I9H A;  5ECO B;  4JRR A;  2F8F A;  5J4U A;  3F9U A;  3QD9 A;  1FVJ A;  2CX3 A;  2GT5 A;  1GSQ A;  5DJM A;  3DXB A;  4HZ4 A;  1BED A;  2PUK C;  3QFB C;  1S3A A;  1VF2 A;  4F2I A;  3ME7 A;  1QMV A;  3HA9 A;  4TR4 A;  2B5Y A;  4GTU A;  1M2A A;  3LWA A;  1Z7P A;  2QC7 A;  3IOS A;  1J9B A;  3LQ7 A;  2JZR A;  3P2A A;  1FB6 A;  2FWF A;  5JCG A;  2HT9 A;  4KW6 A;  3VI7 A;  1A24 A;  4L0U A;  4MF5 A;  4TOP A;  2F3M A;  1Z5Y E;  4FYB A;  2VL3 A;  1K0N A;  1XWB A;  5HR3 A;  1G6Y A;  1SYR A;  4IHU A;  2P0G A;  4MCU A;  1GH2 A;  4GQF A;  2CVD A;  2DIY A;  1GSY A;  1H4O A;  3EC3 A;  5J3R A;  2X8H A;  3ZLP A;  1K0A A;  5IPH A;  1YEX A;  1YY7 A;  3GTU A;  1O8W A;  1PL1 A;  4F0B A;  4YH2 A;  3ZFL A;  3HJO A;  3UVT A;  5EL8 A;  5F07 A;  4YAV A;  2C0G A;  3HXS A;  2EIR A;  5JWQ B;  4J57 E;  1F6M C;  1A8Y A;  2IME A;  1GUK A;  1NHY A;  4IJ3 A;  1YJ6 A;  4EUY A;  13GS A;  5AIV A;  2L59 A;  2HRN A;  17GS A;  3UAR A;  1OE7 A;  5G1K A;  2IJY A;  3ZVJ D;  5IM9 A;  4QQ7 A;  1M0U A;  1PL2 A;  3IXR A;  3TKR A;  4XS1 A;  5DDL A;  2VL2 A;  1OYJ A;  3CYN A;  4MF7 A;  5DAL A;  5DAK B;  1YZX A;  2L57 A;  3M1G A;  4EL1 A;  3IRA A;  2B3S A;  1SK2 A;  4YQV A;  4NPB A;  3EE2 A;  2YWO A;  3LOR A;  3F4S A;  11GS A;  1HQO A;  4AJ7 A;  2LJR A;  1FB0 A;  4HDE A;  1GSU A;  3FR3 A;  4NMU A;  5KN1 A;  3GNJ A;  5E59 A;  3IV4 A;  3UJ1 A;  2LEG A;  2F8A A;  3Q19 A;  4I8B A;  3AY8 A;  2CVB A;  2OA7 A;  1WRY A;  4GWR A;  1NHO A;  1GTI A;  2WJU A;  4N10 A;  2PVQ A;  4HZ2 A;  4RI6 A;  6GSS A;  4NXI A;  4EDY A;  1M9A A;  3N5O A;  3GST A;  5J9B A;  12GS A;  1XOB A;  5B6M A;  5ECL B;  3FY7 A;  3ZZX A;  1A8L A;  1AXD A;  1Q98 A;  4GST A;  5IOW A;  1BAY A;  4HJ2 A;  2X64 A;  3P90 A;  4O5R A;  2LUS A;  4EVM A;  4F03 A;  5DAL B;  1SJ6 A;  4MH2 A;  1XWG A;  3BOA A;  3LGC A;  3R2Q A;  3WT2 A;  1SL2 B;  2IMD A;  4OO4 A;  3KEB A;  1R7H A;  4ACS A;  1JHB A;  4KA0 A;  4XS6 A;  2DJ0 A;  1F9M A;  2Z9S A;  3TDG A;  1R4W A;  3MNG A;  3KH7 A;  4KSO A;  2WS2 A;  1BX9 A;  2WUL A;  1J08 A;  2WZ9 A;  3DWV A;  1G6W A;  2VD1 A;  4JZQ A;  5IQY A;  4ECJ A;  1OKT A;  3WD6 A;  2GST A;  3LYK A;  1T8E B;  4IN0 A;  1ON4 A;  3CRU A;  4KUN A;  5HR2 A;  2R2J A;  4YAP A;  2XBI A;  2YZH A;  3L9S A;  1ZYE A;  1BYE A;  2E2M A;  2N5B A;  5LNK e;  4OCF A;  4DSQ A;  3ERG A;  4XS4 A;  2LKU A;  4WBR D;  1EOH A;  4FYU A;  1Y6E A;  5ENU A;  4ZB6 A;  2L6C A;  5A4W A;  2MMZ A;  1FOV A;  3FR9 A;  5CRH A;  2A2S A;  2YPM A;  2VLV A;  1TI1 A;  3FZ5 A;  2H30 A;  5D9X A;  1PKZ A;  1EZK A;  2MBT A;  5G2Z A;  1ST9 A;  1XFL A;  4PGT A;  5D96 A;  2BMX A;  2L4Q A;  3FW2 A;  5IMV A;  4E8E A;  2DJ2 A;  3QAW A;  1ZL9 A;  5ECS A;  2DMM A;  2GT6 A;  1QFN A;  3OR5 A;  1HNC A;  3RBT A;  2CX4 A;  1I9D A;  1PSQ A;  4NHW A;  1X9W B;  1DBY A;  2XHF A;  5EPF A;  4N30 A;  2DJ1 A;  2C8U A;  4XIH A;  5LCZ A;  3VWW A;  5COH A;  4X43 A;  3HCZ A;  1HD2 A;  2LTK A;  3TJB A;  1MDK A;  1B9Y C;  2D2Z A;  2VCZ A;  3KGK A;  2FLS A;  3QDN A;  3KIJ A;  4TR1 B;  1PA3 A;  2H1D A;  1YQ1 A;  4ECB A;  1CQG A;  5B8B A;  1PKW A;  1K0D A;  2YV9 A;  1GTU A;  4KSM A;  4XRD A;  3MSZ A;  1OC8 A;  1MDJ A;  1EGR A;  4MH3 A;  4N0V A;  3KXO A;  1IYI A;  3CRT A;  1TKD B;  1JZO A;  5G5F A;  1XZO A;  2PN8 A;  1K0C A;  2I3Y A;  1NW2 A;  4ML1 A;  4D73 B;  4K7I A;  4K6X A;  2VUP A;  4NHZ A;  4TKY A;  1YF0 A;  2FHE A;  4OFM A;  4Q5N A;  4MDC A; 
#chains in the Genus database with same CATH topology
 1ILO A;  8GSS A;  1SL1 B;  1TRS A;  2AYT A;  1QXH A;  2VM2 A;  2GZZ A;  3PIN A;  1QK8 A;  2GGT A;  1ERT A;  3GKX A;  3IPZ A;  4BVX A;  2XPE A;  1EV4 A;  5DQY A;  2QKE A;  3FEU A;  3TGZ A;  1SJI A;  2M46 A;  2GZY A;  2CQ9 A;  3KCM A;  1GLP A;  2DJK A;  3HVN A;  1PX6 A;  2H1A A;  2YWI A;  1MDI A;  4KDU A;  3I6A A;  2HLS A;  5ECN B;  3VWU A;  1SJZ A;  1ZYN A;  3DRN A;  4AF2 A;  2E2G A;  2TRX A;  5HFG A;  4I5Q A;  4ZIL A;  1H75 A;  4DSS B;  2YWN A;  1ZYQ B;  4EO3 A;  2BJX A;  4N11 A;  3BBY A;  2YNX A;  4PQ1 A;  3FKF A;  2RLI A;  4TVE A;  3CTG A;  3O6T A;  2CV4 A;  2VL9 A;  2OAC A;  2GSS A;  1Z6M A;  3APQ A;  2FWG A;  4LMW A;  1THX A;  1TP9 A;  3EPT A;  3CBU A;  3QAV A;  1FO5 A;  3P7X A;  4HUA A;  3CMI A;  1FG4 A;  5FHI A;  3ZYW A;  2JAC A;  3UAP A;  1XVQ A;  2FCH A;  2DKI A;  4BVY A;  5D9W A;  1SD9 A;  2FNO A;  1TW9 A;  4PNG A;  2F51 A;  3GUS A;  3I43 A;  5ECK B;  2VCX A;  3EIN A;  2I81 A;  2NDO A;  1ERV A;  4FH8 A;  1M7T A;  2OBK A;  6GST A;  2FGX A;  2HSH A;  3A5I A;  2VL2 C;  2KLX A;  1PD2 1;  4KX4 A;  4CY8 A;  1WP0 A;  1JLV A;  5AIS A;  2HRF A;  2E0Q A;  5DCG A;  4BWS A;  3F0I A;  1X9S B;  3M9J A;  3FR6 A;  3HYP A;  3DD3 A;  1G0T A;  3KMO A;  1YKC A;  5C04 A;  2HRA A;  3J7Y b;  1GL8 A;  3KM6 A;  4OMV A;  4A5P A;  2QA2 A;  5JCW A;  1RQM A;  2H73 A;  2IMF A;  1SKW B;  2E7P A;  1Y25 A;  3FRC A;  3TJJ A;  3EVI A;  2JZS A;  1C72 A;  1X5C A;  2OBI A;  3DYR A;  4JED A;  4WKW A;  5ECM B;  1M3J A;  2H6X A;  2X8G A;  1WE0 A;  1TU7 A;  3BJ5 A;  1WJK A;  3EYT A;  4RI7 A;  1GWC A;  3QPM A;  4GLT A;  2P31 A;  1B48 A;  5G31 A;  1SKS B;  4DSR A;  3IHG A;  3L9V A;  2IMI A;  2FWH A;  3Q74 A;  1AC1 A;  1ML6 A;  4XCS A;  1X5E A;  2AB6 A;  4H86 A;  1ZOF A;  1X0R A;  3W6G A;  4FIW A;  1V40 A;  5CP1 A;  3IK7 A;  4WR4 A;  2DJJ A;  5DAK A;  4MK3 A;  4O92 A;  4EC0 A;  1ZGN A;  3WGD A;  1HNA A;  1B9X C;  4WF4 A;  4TW5 A;  3F4T A;  3ME8 A;  2AAW A;  5JWO B;  4RQR A;  2L4C A;  2EC4 A;  3RPN A;  3BCK A;  5B7C A;  1DE1 A;  1NM3 A;  2YJ7 A;  5A4V A;  3FZA A;  3L4N A;  4GQC A;  1XWC A;  3A2W A;  2IFQ A;  2CZ3 A;  3PH9 A;  2V6K A;  4ZBD A;  3TJG A;  2ZUP A;  4Z2R A;  1SU9 A;  2J9H A;  3MDK A;  1ZZY A;  3TKS C;  3TJF A;  4O5U A;  2DLX A;  1Z7R A;  4ZL7 A;  3A5W A;  2H6Z A;  4JR6 A;  2HZE B;  2CZ2 A;  4PTS A;  2GQM A;  4ICY A;  2LNS A;  4IJI A;  2VCV A;  5KN2 A;  1X9M B;  4KCE A;  5A4U A;  3GV1 A;  3GYK A;  4KDX A;  5B8A A;  1O81 A;  3IAM 2;  1GUH A;  1YF1 A;  4J56 E;  3Q18 A;  2V1M A;  2B7J A;  3BD2 A;  3CSH A;  4NAX A;  4YQU A;  1AUC A;  2G2Q A;  2HFD A;  1GTA A;  3F3R A;  4ZXG A;  3HKR A;  3DGQ A;  1VF1 A;  4KF9 A;  1PX7 A;  4PX1 A;  2FY6 A;  4Q5F A;  5HR1 A;  3DML A;  3L78 A;  2IFQ B;  4PNF A;  2C3Q A;  1ZCP A;  2JSY A;  2LQO A;  1RW1 A;  1XW5 A;  2LJK A;  3DVW A;  1TOF A;  1XCC A;  3VI5 A;  3KJY A;  4G0I A;  4IEL A;  1CQH A;  2VCW A;  4F82 A;  2GSR A;  2R37 A;  4CW9 A;  2L5O A;  2YJH A;  1GLQ A;  2OE1 A;  4OWY A;  2G0F A;  4PUR A;  4X0X A;  1A2J A;  5KOX A;  3ZRE A;  1T00 A;  3U6V A;  1F2E A;  22GS A;  3ED3 A;  3O3T A;  4Q5Q A;  3ZMK A;  3H79 A;  4IQ1 A;  3L9U A;  2ON5 A;  5JWR B;  1W4V A;  4EIQ A;  5GSS A;  1EV9 A;  4LLR A;  1A0F A;  3D6I A;  2CAQ A;  1U6T A;  2DBC A;  4HS1 A;  1O7U A;  1XWK A;  3GKM A;  4WET A;  2R4V A;  1N2A A;  4MLY A;  2P5Q A;  1TRU A;  1DUG A;  1F3A A;  2DSA A;  5CRD A;  1VRS D;  5IO0 A;  2RM6 A;  4LL4 B;  4BL7 A;  1K3L A;  2IIY A;  4MPG A;  1JZD A;  2MYG A;  1A2L A;  1T1V A;  1Q4J A;  1V98 A;  2NPB A;  5D9T A;  2MBS A;  4ECI A;  2YOI A;  2HYX A;  2IPA A;  2PGT A;  2OAD A;  3WGX A;  5C00 A;  4ILF A;  2R0C A;  4OFT A;  4TR1 A;  3US3 A;  2KOK A;  1V2A A;  4ECC A;  1PGT A;  1KEB A;  4G19 A;  1TK5 B;  1M2D A;  4ID0 A;  3IA1 A;  4OCE A;  2PVO C;  3GHA A;  4EXJ A;  3APO A;  1M9B A;  3LSZ A;  1YDK A;  3V1W A;  4E8H A;  2A2R A;  2VLT A;  3LJR A;  4NV5 A;  2C0F A;  4MJB A;  2TRC P;  3F63 A;  3GL3 A;  4ZBA A;  4GF0 A;  1ACV A;  3GX8 A;  4ML6 A;  4X1U A;  4D73 A;  4KND A;  3EU4 A;  3LXZ A;  3UEM A;  2MZC A;  4IGJ A;  3D0Z A;  4WEY A;  2GLR A;  2PWJ A;  1SYX A;  2GVP A;  2OE3 A;  3G7I A;  4MPF A;  2O7K A;  1XVW A;  4L8E A;  4K2X A;  3EU3 A;  2VIM A;  1MD3 A;  5IIZ A;  3S9F A;  5FWG A;  2XBQ A;  2AUV A;  2V32 A;  4EIP A;  2ZNM A;  3M3M A;  1E2Y A;  1GUL A;  1T3B A;  2I1U A;  5A5K A;  2GDR A;  1TK0 B;  2YZU A;  4MJC A;  1GNE A;  2ES7 A;  4ZBB A;  2B7K A;  3HZ8 A;  4G9H A;  3MWH A;  1B8X A;  3M9K A;  1DSB A;  4DSS A;  2RUE A;  3RDW A;  4LMV A;  2VM1 A;  1K3O A;  1FAA A;  3LG6 A;  3GH9 A;  1R5A A;  1N8J A;  4QL9 A;  2UZ8 A;  3E9J B;  1AW9 A;  2WDU A;  4FYC A;  2C3T A;  1NSW A;  4WBJ A;  3M0F A;  5KN3 A;  3D5J A;  4AJ6 A;  10GS A;  2R6K A;  3ERF A;  4N0Z A;  3ZVJ A;  2C80 A;  2H0H A;  2H66 A;  5AIX A;  3A2V A;  3K8N A;  3QFA C;  3IDV A;  4TXV A;  1GUM A;  2DML A;  20GS A;  1O6J A;  1WMJ A;  1XIY A;  4AGS A;  3NIV A;  1V9W A;  4CDO A;  3FYG A;  1HNB A;  3SBC A;  2K9F A;  1QUW A;  2V2G A;  1UC7 A;  1SK0 A;  5IMD A;  4IVF A;  4XHM A;  3GMF A;  2RII A;  1FW1 A;  1GSE A;  4HSC X;  3VPQ A;  3TRP A;  2LST A;  3GKN A;  4MA9 A;  5E4W A;  2XPD A;  2MMO A;  2AV4 A;  1ERW A;  4TXO B;  1XPV A;  4BIK A;  6GSY A;  1T4Z A;  1MTC A;  4XRA A;  1OVN A;  1TJD A;  1DE2 A;  3F6D A;  1SK1 A;  5DVB A;  2AHE A;  2O85 A;  5CYY A;  2X8C A;  3TKQ A;  2ZCT A;  1B4P A;  3G9B A;  1SEN A;  3HJM A;  1K3Y A;  2PBJ A;  2AJQ B;  2JSZ A;  5H5R A;  4KGI A;  4F9Z A;  2JAD A;  3MAK A;  4L0W A;  3HJP A;  3I69 A;  1GTB A;  3WGE A;  4TN8 A;  1U3I A;  3LYP A;  2HRK A;  4ZL9 A;  1E6B A;  2GTU A;  3ZIT A;  3ZIV A;  4MAB A;  2H0I A;  3G7J A;  3GX0 A;  3D4M A;  2TIR A;  3IR4 A;  7GSS A;  4PQI A;  2C1Y A;  1UVZ A;  3VWV A;  3LFL A;  5ECP B;  2F9S A;  2IMK A;  5F8B A;  1FVK A;  2A2P A;  1AQV A;  1G7E A;  2V6O A;  14GS A;  3W8J A;  2H19 A;  2NTO A;  3I9V 2;  5HR0 A;  4I6X A;  2R3X A;  3TRQ A;  4EKZ A;  3FZ9 A;  2JL4 A;  2CAI A;  2QA1 A;  3KP9 A;  1BQ7 A;  2LQQ A;  4QL7 A;  2K6V A;  3LEF A;  3HZ4 A;  2HE3 A;  4MZC A;  3UVH A;  5INY A;  2CT6 A;  1EOG A;  2H70 A;  1K0O A;  2GSQ A;  3P8W A;  4G10 A;  4MZW A;  3VUR A;  6GSU A;  2M72 A;  1KNG A;  3CXG A;  3HDC A;  2YCD A;  4K2D A;  5B6N A;  1LJR A;  2V41 A;  4RUV A;  2ON7 A;  5HQP A;  2K8V A;  1W89 A;  3FHK A;  1B4Q A;  4HI7 A;  4CY6 A;  1T4Y A;  4TR0 A;  1M2B A;  5GZZ B;  2BTO T;  3WT1 A;  4O7H A;  3C7M A;  1U3A A;  1EEM A;  2R0G A;  1JZR A;  3C71 A;  1A0R P;  1BJX A;  5H5Q A;  5HFK A;  3UL3 A;  5J41 A;  3TJK A;  3VFI A;  1URM A;  4HJM A;  4WXT A;  4K7O A;  4TRX A;  5ABR A;  3GSS A;  2HZE A;  3WYW A;  3E3E A;  3EMP A;  1O85 A;  4JR4 A;  4MF6 A;  2HXK A;  4K7N A;  1PQN A;  3RAZ A;  4KB3 A;  4HEA 2;  4NV2 A;  5AGY A;  2GS3 A;  3VWX A;  3FZ4 A;  2X99 A;  2LRT A;  1SD8 A;  4BA7 A;  3ZFB A;  2VCT A;  1PMT A;  4V2N A;  5H5S A;  3CSJ A;  4POM A;  1BG5 A;  2EIQ A;  1YEP A;  1OC9 A;  3SWL A;  2WFC A;  4IS0 A;  4V2M A;  1FOH A;  1KTE A;  3TB2 A;  4YQM A;  1GRX A;  4I2T A;  5CO3 A;  5ECQ B;  2RM5 A;  1THO A;  4Z7X A;  2DJ3 A;  3HVX A;  3BCI A;  5ECH B;  3DKS A;  4GCI A;  3M8N A;  2H8L A;  1F3B A;  2KP1 A;  4K5R A;  4ZB8 A;  2P5R A;  4PUF C;  2B6M A;  5CRG A;  5IOX A;  1YKA A;  2LJA A;  2YWM A;  2C4J A;  1XW6 A;  1EEJ A;  2WB9 A;  2VCQ A;  1SKR B;  2NVL A;  5G1L A;  3GRX A;  1JFU A;  5FT3 A;  3VLN A;  2REM A;  4O5Q A;  1S3R A;  2MMN A;  1OC9 B;  3CQF A;  1EGO A;  4IP1 A;  2OE0 A;  3KZQ A;  5KN0 A;  3EWL A;  5F06 A;  3EUR A;  3GTU B;  1MD4 A;  1MEK A;  1OE8 A;  4OFN A;  1X5D A;  2H76 A;  1VF3 A;  4L5L A;  5EY6 A;  3FMW A;  1SL0 B;  3UOM A;  3RHC A;  2H71 A;  3IHQ A;  4ZL8 A;  2JU5 A;  2N5F A;  3KH9 A;  1U87 A;  2H75 A;  2WGR A;  1WOU A;  2K18 A;  4ULX A;  1JZW A;  2HZF A;  1AAZ A;  3GL5 A;  2O89 A;  3C1S A;  5CRW A;  1I5G A;  2R5G A;  5DBQ A;  3G7Y A;  4KDY A;  2LRC A;  1GSD A;  2O87 A;  3DVX A;  4JE1 A;  4K1F A;  1OC3 A;  1XBS A;  2B5X A;  2NBS A;  5D8I A;  3KP8 A;  2GQK A;  2C0E A;  1HYU A;  5DJL A;  2CA8 A;  1ZMA A;  2GZP A;  5F05 A;  4FO5 A;  4CHS A;  1WPI A;  1Z9H A;  1G7O A;  2FD3 A;  1J0F A;  1TU8 A;  1PN9 A;  4J2F A;  2H01 A;  4PQH A;  1AIU A;  4HU9 A;  3TCO A;  3ZIJ A;  4GSN A;  2C0D A;  5ID2 A;  3TOU A;  1OAZ A;  4L5O A;  3QR6 A;  4X4J A;  2FWE A;  1TRV A;  4PXO A;  3A3T A;  1Z3E A;  9GSS A;  3DEX A;  3TKP A;  3H1N A;  5DQS A;  2YP6 A;  5CNW A;  3J7Y k;  1A2M A;  4F0C A;  18GS A;  2KUC A;  4IQA A;  3KTB A;  2PPT A;  3PR8 A;  4HOJ A;  1M99 A;  4WF5 A;  4Z2T A;  1K0B A;  1LU4 A;  3HVS A;  5IMC A;  3LXT A;  1Z6N A;  3C73 A;  2LV3 A;  3GH6 A;  3HHV A;  3PGT A;  1R5P A;  2IL3 A;  3TOT A;  3KTL A;  3UBK A;  4NWY A;  2EIO A;  2WCI A;  2PMT A;  3HD5 A;  5LD0 A;  2H1G A;  1F37 A;  1XWA A;  3TKS A;  2H0G A;  2H74 A;  4MP4 A;  3IK9 A;  3DIE A;  4ISD A;  4K0G A;  2HNL A;  5J5N A;  2A4V A;  2HSM A;  2KP2 A;  4EE0 A;  2QSI A;  3RPP A;  1K0M A;  4PUA A;  4JBB A;  1PRX A;  2LS5 A;  5ID2 B;  1S3C A;  1XXU A;  19GS A;  4XTS A;  3ZML A;  2K8S A;  4BWQ A;  4EDZ A;  5D73 A;  1GNW A;  3KD0 A;  1AQW A;  4USS A;  1O8X A;  2IWT A;  2CVK A;  2X49 A;  4V2L A;  1VF4 A;  1T7P B;  3NZN A;  5IMA A;  1TTZ A;  4YKG A;  3IBH A;  5GST A;  1XG8 A;  1JLW A;  4K8M A;  2X4A A;  4XS4 B;  4KAE A;  3VPT A;  1TDI A;  1ABA A;  1WIK A;  4O32 A;  2YAN A;  3U5R E;  3ZL5 A;  5D93 A;  3TKS E;  4IW9 A;  2B1K A;  1S3D A;  3GA4 A;  1WWJ A;  3C8E A;  4POK A;  1GSF A;  1TRW A;  3QMX A;  2WRT A;  1FHE A;  3UBL A;  1TK8 B;  5CRE A;  4ZB9 A;  1QGV A;  1TXX A;  3UMA A;  4V1A p;  5AN1 A;  1PN0 A;  2N5A A;  1KBN A;  4TXO A;  3NOF A;  3F8U A;  4KH7 A;  3EMX A;  5IMF A;  2HI7 A;  2VLU A;  3W8S A;  4OD7 A;  3C1R A;  1XOA A;  2PER A;  2YV7 A;  2H6Y A;  4OO5 A;  16GS A;  4Q5R A;  2XC2 A;  3QAG A;  2B5E A;  1R26 A;  3TRX A;  5GAN D;  2ALB A;  4IBP A;  1IYH A;  2OKA A;  4MZB A;  2A4H A;  2FUG 2;  5DCH A;  5F0G A;  1LBK A;  3GUR A;  1UA5 A;  1OKD A;  2B1L A;  5L71 A;  3RHB A;  4GXZ A;  3IE3 A;  2GQL A;  2LNT A;  3N9J A;  4POB A;  3CSI A;  4IKH A;  6GSW A;  1GP1 A;  4DEJ A;  3TUE A;  4DVC A;  1VGL A;  2H1B A;  3A2X A;  3R3E A;  4LA1 A;  5G5E A;  4LL1 B;  4ZIJ A;  3IC4 A;  4KCA A;  2L5L A;  4I2U A;  1EP7 A;  3O76 A;  1V58 A;  3IAS 2;  3GIX A;  4WR5 A;  3D4T A;  4HQS A;  5BRT A;  1UN2 A;  3FK8 A;  4K9Z A;  2O8V B;  5J9C A;  3F3Q A;  3QOU A;  2QGV A;  5KOW A;  2PU9 C;  2FA8 A;  4EF0 A;  3ERW A;  2LRN A;  3VK9 A;  3UIW A;  1U88 A;  4POL A;  4V1A g;  4TR3 A;  3HY2 A;  5ECI B;  3LW9 A;  3F4R A;  5ELG A;  5IO2 A;  2VO4 A;  5IPG A;  2MMA A;  2KHP A;  4FQU A;  3H8Q A;  3F6F A;  5ELA A;  3D21 A;  3HVV A;  4JU5 A;  5HFI A;  2DC5 A;  4RQX A;  2J23 A;  1GSS A;  2VD0 A;  2YN1 A;  4BVX B;  2H72 A;  3Q6O A;  3ZTL A;  4P3Y B;  1USB A;  3ISO A;  3ZRD A;  3E0U A;  3JCM L;  6GSV A;  4GRF A;  2DIZ A;  1XW9 A;  3QCP A;  1M3I A;  1QQ2 A;  2M80 A;  2HSY A;  4MMM A;  4G2E A;  4MJE A;  3GN3 A;  2C3N A;  1AQX A;  4GSS A;  5CAX A;  4I97 A;  4K0N A;  4HU7 A;  5ECR B;  5GAP D;  3GFK A;  1O73 A;  5G30 A;  5EVO A;  4BPY A;  2IN3 A;  1V57 A;  2RUF A;  1TI3 A;  1EP8 A;  3APS A;  5JCU A;  4AJ8 A;  2FA4 A;  3GKK A;  1EWX A;  3KMN A;  5IMZ A;  4MJA A;  6GSX A;  1RK4 A;  2VOC A;  4KE3 A;  2L6D A;  3L0H A;  2OJL A;  1ERU A;  5KEJ A;  3D22 A;  2I4A A;  3H93 A;  4HQZ A;  2VAF A;  2JZT A;  1ZYP A;  3CTF A;  3H4K A;  4MNN A;  4IP6 A;  5D9V A;  1A23 A;  2R0P A;  2I9H A;  5ECO B;  4JRR A;  2F8F A;  5J4U A;  3F9U A;  3QD9 A;  1FVJ A;  2CX3 A;  2GT5 A;  1GSQ A;  5DJM A;  3DXB A;  4HZ4 A;  1BED A;  2PUK C;  3QFB C;  1S3A A;  1VF2 A;  4F2I A;  4BVY B;  3ME7 A;  1QMV A;  3HA9 A;  4TR4 A;  2B5Y A;  4GTU A;  4G0K A;  1M2A A;  3LWA A;  1Z7P A;  2QC7 A;  3IOS A;  1J9B A;  3LQ7 A;  2JZR A;  3P2A A;  1FB6 A;  2FWF A;  5JCG A;  2HT9 A;  4KW6 A;  3VI7 A;  1A24 A;  4L0U A;  4MF5 A;  4TOP A;  2F3M A;  1Z5Y E;  4FYB A;  2VL3 A;  1K0N A;  1XWB A;  5HR3 A;  1G6Y A;  1SYR A;  4IHU A;  2P0G A;  4MCU A;  1GH2 A;  4GQF A;  2CVD A;  2DIY A;  1GSY A;  1H4O A;  3EC3 A;  5J3R A;  2X8H A;  3ZLP A;  1K0A A;  2DKH A;  5IPH A;  1YEX A;  1YY7 A;  3GTU A;  1O8W A;  1PL1 A;  4F0B A;  4YH2 A;  3ZFL A;  3IC8 A;  3HJO A;  3UVT A;  5EL8 A;  5F07 A;  4YAV A;  2C0G A;  3HXS A;  2EIR A;  5JWQ B;  4J57 E;  1F6M C;  1A8Y A;  2IME A;  1GUK A;  1NHY A;  4IJ3 A;  1YJ6 A;  4G0L A;  4EUY A;  13GS A;  5AIV A;  2L59 A;  2HRN A;  17GS A;  3UAR A;  1OE7 A;  5G1K A;  2IJY A;  3ZVJ D;  5IM9 A;  4QQ7 A;  1M0U A;  1PL2 A;  3IXR A;  3TKR A;  4XS1 A;  5DDL A;  2VL2 A;  1OYJ A;  3CYN A;  4MF7 A;  5DAL A;  5DAK B;  1YZX A;  2L57 A;  3M1G A;  4EL1 A;  3IRA A;  2B3S A;  1SK2 A;  4YQV A;  4NPB A;  3EE2 A;  2YWO A;  3LOR A;  3F4S A;  11GS A;  1HQO A;  4AJ7 A;  2LJR A;  1FB0 A;  4HDE A;  1GSU A;  3FR3 A;  4NMU A;  5KN1 A;  3GNJ A;  4Z2U A;  5E59 A;  3IV4 A;  3UJ1 A;  2LEG A;  2F8A A;  3Q19 A;  4I8B A;  3AY8 A;  2CVB A;  2OA7 A;  5BMU A;  1WRY A;  4GWR A;  1NHO A;  1GTI A;  2WJU A;  4N10 A;  2PVQ A;  4HZ2 A;  4RI6 A;  6GSS A;  4NXI A;  4EDY A;  1M9A A;  3N5O A;  3GST A;  5J9B A;  12GS A;  1XOB A;  5B6M A;  5ECL B;  3FY7 A;  3ZZX A;  1A8L A;  1AXD A;  1Q98 A;  4GST A;  5IOW A;  1BAY A;  4HJ2 A;  2X64 A;  3P90 A;  4O5R A;  2LUS A;  4EVM A;  4F03 A;  5DAL B;  1SJ6 A;  4MH2 A;  1XWG A;  3BOA A;  3LGC A;  3R2Q A;  3WT2 A;  1SL2 B;  2IMD A;  4OO4 A;  3KEB A;  1R7H A;  4YKF A;  4ACS A;  1JHB A;  4KA0 A;  4XS6 A;  2DJ0 A;  1F9M A;  2Z9S A;  3TDG A;  1R4W A;  3MNG A;  3KH7 A;  4KSO A;  2WS2 A;  1BX9 A;  2WUL A;  1J08 A;  2WZ9 A;  3DWV A;  1G6W A;  2VD1 A;  4JZQ A;  5IQY A;  4ECJ A;  1OKT A;  1PFO A;  3WD6 A;  2GST A;  3LYK A;  1T8E B;  4IN0 A;  1ON4 A;  3CRU A;  4KUN A;  5HR2 A;  2R2J A;  4YAP A;  2XBI A;  2YZH A;  3L9S A;  1ZYE A;  1BYE A;  2E2M A;  3MYD A;  2N5B A;  5LNK e;  4OCF A;  4DSQ A;  3ERG A;  4XS4 A;  2LKU A;  4WBR D;  1EOH A;  4FYU A;  1Y6E A;  5ENU A;  4ZB6 A;  2L6C A;  5A4W A;  2MMZ A;  1FOV A;  3FR9 A;  5CRH A;  2A2S A;  2YPM A;  2VLV A;  1TI1 A;  3FZ5 A;  2H30 A;  5D9X A;  1PKZ A;  1EZK A;  2MBT A;  5G2Z A;  1ST9 A;  1XFL A;  4PGT A;  5D96 A;  2BMX A;  2L4Q A;  3FW2 A;  5IMV A;  4E8E A;  2DJ2 A;  3QAW A;  1ZL9 A;  5ECS A;  2DMM A;  2GT6 A;  1QFN A;  3OR5 A;  1HNC A;  3RBT A;  2CX4 A;  1I9D A;  3PPU A;  1PSQ A;  4NHW A;  1X9W B;  1DBY A;  2XHF A;  5EPF A;  4N30 A;  2DJ1 A;  2C8U A;  4XIH A;  4BL7 B;  5LCZ A;  3VWW A;  5COH A;  4X43 A;  3HCZ A;  1HD2 A;  3MIX A;  2LTK A;  3TJB A;  1MDK A;  1B9Y C;  2D2Z A;  2VCZ A;  3KGK A;  2FLS A;  3QDN A;  3KIJ A;  4TR1 B;  1PA3 A;  2H1D A;  1YQ1 A;  4ECB A;  1CQG A;  5B8B A;  1PKW A;  1K0D A;  2YV9 A;  1GTU A;  4KSM A;  4XRD A;  3MSZ A;  1OC8 A;  1MDJ A;  1EGR A;  4MH3 A;  4N0V A;  3KXO A;  1IYI A;  3CRT A;  1TKD B;  1JZO A;  5G5F A;  1XZO A;  2PN8 A;  1K0C A;  2I3Y A;  1NW2 A;  4ML1 A;  4D73 B;  4K7I A;  4K6X A;  4K5S A;  2VUP A;  4NHZ A;  4TKY A;  1YF0 A;  2FHE A;  4OFM A;  4Q5N A;  4MDC A; 
#chains in the Genus database with same CATH homology
 1ILO A;  8GSS A;  1SL1 B;  1TRS A;  2AYT A;  1QXH A;  2VM2 A;  2GZZ A;  3PIN A;  1QK8 A;  2GGT A;  1ERT A;  3GKX A;  3IPZ A;  4BVX A;  2XPE A;  1EV4 A;  5DQY A;  2QKE A;  3FEU A;  3TGZ A;  1SJI A;  2M46 A;  2GZY A;  2CQ9 A;  3KCM A;  1GLP A;  2DJK A;  1PX6 A;  2H1A A;  2YWI A;  1MDI A;  4KDU A;  3I6A A;  2HLS A;  5ECN B;  3VWU A;  1SJZ A;  1ZYN A;  3DRN A;  4AF2 A;  2E2G A;  2TRX A;  5HFG A;  4I5Q A;  4ZIL A;  1H75 A;  4DSS B;  2YWN A;  1ZYQ B;  4EO3 A;  2BJX A;  4N11 A;  3BBY A;  2YNX A;  4PQ1 A;  3FKF A;  2RLI A;  4TVE A;  3CTG A;  3O6T A;  2CV4 A;  2VL9 A;  2OAC A;  2GSS A;  1Z6M A;  3APQ A;  2FWG A;  4LMW A;  1THX A;  1TP9 A;  3EPT A;  3CBU A;  3QAV A;  1FO5 A;  3P7X A;  4HUA A;  3CMI A;  1FG4 A;  5FHI A;  3ZYW A;  2JAC A;  3UAP A;  1XVQ A;  2FCH A;  2DKI A;  4BVY A;  5D9W A;  1SD9 A;  2FNO A;  1TW9 A;  4PNG A;  2F51 A;  3GUS A;  3I43 A;  5ECK B;  2VCX A;  3EIN A;  2I81 A;  2NDO A;  1ERV A;  4FH8 A;  1M7T A;  2OBK A;  6GST A;  2FGX A;  2HSH A;  3A5I A;  2VL2 C;  2KLX A;  1PD2 1;  4KX4 A;  4CY8 A;  1WP0 A;  1JLV A;  5AIS A;  2HRF A;  2E0Q A;  5DCG A;  4BWS A;  3F0I A;  1X9S B;  3M9J A;  3FR6 A;  3HYP A;  3DD3 A;  1G0T A;  3KMO A;  1YKC A;  5C04 A;  2HRA A;  3J7Y b;  1GL8 A;  3KM6 A;  4OMV A;  4A5P A;  2QA2 A;  5JCW A;  1RQM A;  2H73 A;  2IMF A;  1SKW B;  2E7P A;  1Y25 A;  3FRC A;  3TJJ A;  3EVI A;  2JZS A;  1C72 A;  1X5C A;  2OBI A;  3DYR A;  4JED A;  4WKW A;  5ECM B;  2H6X A;  2X8G A;  1WE0 A;  1TU7 A;  3BJ5 A;  1WJK A;  3EYT A;  4RI7 A;  1GWC A;  3QPM A;  4GLT A;  2P31 A;  1B48 A;  5G31 A;  1SKS B;  4DSR A;  3IHG A;  3L9V A;  2IMI A;  2FWH A;  3Q74 A;  1AC1 A;  1ML6 A;  4XCS A;  1X5E A;  2AB6 A;  4H86 A;  1ZOF A;  1X0R A;  3W6G A;  4FIW A;  1V40 A;  5CP1 A;  3IK7 A;  4WR4 A;  2DJJ A;  5DAK A;  4MK3 A;  4O92 A;  4EC0 A;  1ZGN A;  3WGD A;  1HNA A;  1B9X C;  4WF4 A;  4TW5 A;  3F4T A;  3ME8 A;  2AAW A;  5JWO B;  4RQR A;  2L4C A;  2EC4 A;  3RPN A;  3BCK A;  5B7C A;  1DE1 A;  1NM3 A;  2YJ7 A;  5A4V A;  3FZA A;  3L4N A;  4GQC A;  1XWC A;  3A2W A;  2IFQ A;  2CZ3 A;  3PH9 A;  2V6K A;  4ZBD A;  3TJG A;  2ZUP A;  4Z2R A;  1SU9 A;  2J9H A;  3MDK A;  1ZZY A;  3TKS C;  3TJF A;  4O5U A;  2DLX A;  1Z7R A;  4ZL7 A;  3A5W A;  2H6Z A;  4JR6 A;  2HZE B;  2CZ2 A;  4PTS A;  2GQM A;  4ICY A;  2LNS A;  4IJI A;  2VCV A;  5KN2 A;  1X9M B;  4KCE A;  5A4U A;  3GV1 A;  3GYK A;  4KDX A;  5B8A A;  1O81 A;  3IAM 2;  1GUH A;  1YF1 A;  4J56 E;  3Q18 A;  2V1M A;  2B7J A;  3BD2 A;  3CSH A;  4NAX A;  4YQU A;  1AUC A;  2G2Q A;  2HFD A;  1GTA A;  3F3R A;  4ZXG A;  3HKR A;  3DGQ A;  1VF1 A;  4KF9 A;  1PX7 A;  4PX1 A;  2FY6 A;  4Q5F A;  5HR1 A;  3DML A;  3L78 A;  2IFQ B;  4PNF A;  2C3Q A;  1ZCP A;  2JSY A;  2LQO A;  1RW1 A;  1XW5 A;  2LJK A;  3DVW A;  1TOF A;  1XCC A;  3VI5 A;  3KJY A;  4G0I A;  4IEL A;  1CQH A;  2VCW A;  4F82 A;  2GSR A;  2R37 A;  4CW9 A;  2L5O A;  2YJH A;  1GLQ A;  2OE1 A;  4OWY A;  2G0F A;  4PUR A;  4X0X A;  1A2J A;  5KOX A;  3ZRE A;  1T00 A;  3U6V A;  1F2E A;  22GS A;  3ED3 A;  3O3T A;  4Q5Q A;  3ZMK A;  3H79 A;  4IQ1 A;  3L9U A;  2ON5 A;  5JWR B;  1W4V A;  4EIQ A;  5GSS A;  1EV9 A;  4LLR A;  1A0F A;  3D6I A;  2CAQ A;  1U6T A;  2DBC A;  4HS1 A;  1O7U A;  1XWK A;  3GKM A;  4WET A;  2R4V A;  1N2A A;  4MLY A;  2P5Q A;  1TRU A;  1DUG A;  1F3A A;  2DSA A;  5CRD A;  1VRS D;  5IO0 A;  2RM6 A;  4LL4 B;  4BL7 A;  1K3L A;  2IIY A;  4MPG A;  1JZD A;  2MYG A;  1A2L A;  1T1V A;  1Q4J A;  1V98 A;  2NPB A;  5D9T A;  2MBS A;  4ECI A;  2YOI A;  2HYX A;  2IPA A;  2PGT A;  2OAD A;  3WGX A;  5C00 A;  4ILF A;  2R0C A;  4OFT A;  4TR1 A;  3US3 A;  2KOK A;  1V2A A;  4ECC A;  1PGT A;  1KEB A;  4G19 A;  1TK5 B;  1M2D A;  4ID0 A;  3IA1 A;  4OCE A;  2PVO C;  3GHA A;  4EXJ A;  3APO A;  1M9B A;  3LSZ A;  1YDK A;  3V1W A;  4E8H A;  2A2R A;  2VLT A;  3LJR A;  4NV5 A;  2C0F A;  4MJB A;  2TRC P;  3F63 A;  3GL3 A;  4ZBA A;  4GF0 A;  1ACV A;  3GX8 A;  4ML6 A;  4X1U A;  4D73 A;  4KND A;  3EU4 A;  3LXZ A;  3UEM A;  2MZC A;  4IGJ A;  3D0Z A;  4WEY A;  2GLR A;  2PWJ A;  1SYX A;  2GVP A;  2OE3 A;  3G7I A;  4MPF A;  2O7K A;  1XVW A;  4L8E A;  4K2X A;  3EU3 A;  2VIM A;  1MD3 A;  5IIZ A;  3S9F A;  5FWG A;  2XBQ A;  2AUV A;  2V32 A;  4EIP A;  2ZNM A;  3M3M A;  1E2Y A;  1GUL A;  1T3B A;  2I1U A;  5A5K A;  2GDR A;  1TK0 B;  2YZU A;  4MJC A;  1GNE A;  2ES7 A;  4ZBB A;  2B7K A;  3HZ8 A;  4G9H A;  3MWH A;  1B8X A;  3M9K A;  1DSB A;  4DSS A;  2RUE A;  3RDW A;  4LMV A;  2VM1 A;  1K3O A;  1FAA A;  3LG6 A;  3GH9 A;  1R5A A;  1N8J A;  4QL9 A;  2UZ8 A;  3E9J B;  1AW9 A;  2WDU A;  4FYC A;  2C3T A;  1NSW A;  4WBJ A;  3M0F A;  5KN3 A;  3D5J A;  4AJ6 A;  10GS A;  2R6K A;  3ERF A;  4N0Z A;  3ZVJ A;  2C80 A;  2H0H A;  2H66 A;  5AIX A;  3A2V A;  3K8N A;  3QFA C;  3IDV A;  4TXV A;  1GUM A;  2DML A;  20GS A;  1O6J A;  1WMJ A;  1XIY A;  4AGS A;  3NIV A;  1V9W A;  4CDO A;  3FYG A;  1HNB A;  3SBC A;  2K9F A;  1QUW A;  2V2G A;  1UC7 A;  1SK0 A;  5IMD A;  4IVF A;  4XHM A;  3GMF A;  2RII A;  1FW1 A;  1GSE A;  3VPQ A;  3TRP A;  2LST A;  3GKN A;  4MA9 A;  5E4W A;  2XPD A;  2MMO A;  2AV4 A;  1ERW A;  4TXO B;  1XPV A;  6GSY A;  1T4Z A;  1MTC A;  4XRA A;  1OVN A;  1TJD A;  1DE2 A;  3F6D A;  1SK1 A;  5DVB A;  2AHE A;  2O85 A;  5CYY A;  2X8C A;  3TKQ A;  2ZCT A;  1B4P A;  3G9B A;  1SEN A;  3HJM A;  1K3Y A;  2PBJ A;  2AJQ B;  2JSZ A;  5H5R A;  4KGI A;  4F9Z A;  2JAD A;  3MAK A;  4L0W A;  3HJP A;  3I69 A;  1GTB A;  3WGE A;  4TN8 A;  1U3I A;  3LYP A;  2HRK A;  4ZL9 A;  1E6B A;  2GTU A;  3ZIT A;  3ZIV A;  4MAB A;  2H0I A;  3G7J A;  3GX0 A;  3D4M A;  2TIR A;  3IR4 A;  7GSS A;  4PQI A;  2C1Y A;  1UVZ A;  3VWV A;  3LFL A;  5ECP B;  2F9S A;  2IMK A;  5F8B A;  1FVK A;  2A2P A;  1AQV A;  1G7E A;  2V6O A;  14GS A;  3W8J A;  2H19 A;  2NTO A;  3I9V 2;  5HR0 A;  4I6X A;  2R3X A;  3TRQ A;  4EKZ A;  3FZ9 A;  2JL4 A;  2CAI A;  2QA1 A;  3KP9 A;  1BQ7 A;  2LQQ A;  4QL7 A;  2K6V A;  3LEF A;  3HZ4 A;  2HE3 A;  4MZC A;  3UVH A;  5INY A;  2CT6 A;  1EOG A;  2H70 A;  1K0O A;  2GSQ A;  3P8W A;  4G10 A;  4MZW A;  3VUR A;  6GSU A;  2M72 A;  1KNG A;  3CXG A;  3HDC A;  2YCD A;  4K2D A;  5B6N A;  1LJR A;  2V41 A;  4RUV A;  2ON7 A;  5HQP A;  2K8V A;  1W89 A;  3FHK A;  1B4Q A;  4HI7 A;  4CY6 A;  1T4Y A;  4TR0 A;  1M2B A;  5GZZ B;  2BTO T;  3WT1 A;  4O7H A;  3C7M A;  1U3A A;  1EEM A;  2R0G A;  1JZR A;  3C71 A;  1A0R P;  1BJX A;  5H5Q A;  5HFK A;  3UL3 A;  5J41 A;  3TJK A;  3VFI A;  1URM A;  4HJM A;  4WXT A;  4K7O A;  4TRX A;  5ABR A;  3GSS A;  2HZE A;  3WYW A;  3E3E A;  3EMP A;  1O85 A;  4JR4 A;  4MF6 A;  2HXK A;  4K7N A;  1PQN A;  3RAZ A;  4KB3 A;  4HEA 2;  4NV2 A;  5AGY A;  2GS3 A;  3VWX A;  3FZ4 A;  2X99 A;  2LRT A;  1SD8 A;  4BA7 A;  3ZFB A;  2VCT A;  1PMT A;  4V2N A;  5H5S A;  3CSJ A;  4POM A;  1BG5 A;  2EIQ A;  1YEP A;  1OC9 A;  3SWL A;  2WFC A;  4IS0 A;  4V2M A;  1FOH A;  1KTE A;  3TB2 A;  4YQM A;  1GRX A;  4I2T A;  5CO3 A;  5ECQ B;  2RM5 A;  1THO A;  4Z7X A;  2DJ3 A;  3HVX A;  3BCI A;  5ECH B;  3DKS A;  4GCI A;  3M8N A;  2H8L A;  1F3B A;  2KP1 A;  4K5R A;  4ZB8 A;  2P5R A;  4PUF C;  2B6M A;  5CRG A;  5IOX A;  1YKA A;  2LJA A;  2YWM A;  2C4J A;  1XW6 A;  1EEJ A;  2WB9 A;  2VCQ A;  1SKR B;  2NVL A;  5G1L A;  3GRX A;  1JFU A;  5FT3 A;  3VLN A;  2REM A;  4O5Q A;  2MMN A;  1OC9 B;  1EGO A;  4IP1 A;  2OE0 A;  3KZQ A;  5KN0 A;  3EWL A;  5F06 A;  3EUR A;  3GTU B;  1MD4 A;  1MEK A;  1OE8 A;  4OFN A;  1X5D A;  2H76 A;  1VF3 A;  4L5L A;  5EY6 A;  3FMW A;  1SL0 B;  3UOM A;  3RHC A;  2H71 A;  3IHQ A;  4ZL8 A;  2JU5 A;  2N5F A;  3KH9 A;  1U87 A;  2H75 A;  2WGR A;  1WOU A;  2K18 A;  4ULX A;  1JZW A;  2HZF A;  1AAZ A;  3GL5 A;  2O89 A;  3C1S A;  5CRW A;  1I5G A;  2R5G A;  5DBQ A;  3G7Y A;  4KDY A;  2LRC A;  1GSD A;  2O87 A;  3DVX A;  4JE1 A;  4K1F A;  1OC3 A;  1XBS A;  2B5X A;  2NBS A;  5D8I A;  3KP8 A;  2GQK A;  2C0E A;  1HYU A;  5DJL A;  2CA8 A;  1ZMA A;  2GZP A;  5F05 A;  4FO5 A;  4CHS A;  1WPI A;  1Z9H A;  1G7O A;  2FD3 A;  1J0F A;  1TU8 A;  1PN9 A;  4J2F A;  2H01 A;  4PQH A;  1AIU A;  4HU9 A;  3TCO A;  3ZIJ A;  4GSN A;  2C0D A;  5ID2 A;  3TOU A;  1OAZ A;  4L5O A;  3QR6 A;  4X4J A;  2FWE A;  1TRV A;  4PXO A;  3A3T A;  1Z3E A;  9GSS A;  3DEX A;  3TKP A;  3H1N A;  5DQS A;  2YP6 A;  5CNW A;  3J7Y k;  1A2M A;  4F0C A;  18GS A;  2KUC A;  4IQA A;  3KTB A;  2PPT A;  3PR8 A;  4HOJ A;  1M99 A;  4WF5 A;  4Z2T A;  1K0B A;  1LU4 A;  3HVS A;  5IMC A;  3LXT A;  1Z6N A;  3C73 A;  2LV3 A;  3GH6 A;  3HHV A;  3PGT A;  1R5P A;  2IL3 A;  3TOT A;  3KTL A;  3UBK A;  4NWY A;  2EIO A;  2WCI A;  2PMT A;  3HD5 A;  5LD0 A;  2H1G A;  1F37 A;  1XWA A;  3TKS A;  2H0G A;  2H74 A;  4MP4 A;  3IK9 A;  3DIE A;  4ISD A;  4K0G A;  2HNL A;  5J5N A;  2A4V A;  2HSM A;  2KP2 A;  4EE0 A;  2QSI A;  3RPP A;  1K0M A;  4PUA A;  4JBB A;  1PRX A;  2LS5 A;  5ID2 B;  1S3C A;  1XXU A;  19GS A;  4XTS A;  3ZML A;  2K8S A;  4BWQ A;  4EDZ A;  5D73 A;  1GNW A;  3KD0 A;  1AQW A;  4USS A;  1O8X A;  2IWT A;  2CVK A;  2X49 A;  4V2L A;  1VF4 A;  1T7P B;  3NZN A;  5IMA A;  1TTZ A;  4YKG A;  3IBH A;  5GST A;  1JLW A;  4K8M A;  2X4A A;  4XS4 B;  4KAE A;  3VPT A;  1TDI A;  1ABA A;  1WIK A;  4O32 A;  2YAN A;  3U5R E;  3ZL5 A;  5D93 A;  3TKS E;  4IW9 A;  2B1K A;  1S3D A;  3GA4 A;  1WWJ A;  3C8E A;  4POK A;  1GSF A;  1TRW A;  3QMX A;  2WRT A;  1FHE A;  3UBL A;  1TK8 B;  5CRE A;  4ZB9 A;  1QGV A;  1TXX A;  3UMA A;  4V1A p;  5AN1 A;  1PN0 A;  2N5A A;  1KBN A;  4TXO A;  3NOF A;  3F8U A;  4KH7 A;  3EMX A;  5IMF A;  2HI7 A;  2VLU A;  3W8S A;  4OD7 A;  3C1R A;  1XOA A;  2PER A;  2YV7 A;  2H6Y A;  4OO5 A;  16GS A;  4Q5R A;  2XC2 A;  3QAG A;  2B5E A;  1R26 A;  3TRX A;  5GAN D;  2ALB A;  4IBP A;  1IYH A;  2OKA A;  4MZB A;  2A4H A;  2FUG 2;  5DCH A;  5F0G A;  1LBK A;  3GUR A;  1OKD A;  1UA5 A;  2B1L A;  5L71 A;  3RHB A;  4GXZ A;  3IE3 A;  2GQL A;  2LNT A;  3N9J A;  4POB A;  3CSI A;  4IKH A;  6GSW A;  1GP1 A;  4DEJ A;  3TUE A;  4DVC A;  1VGL A;  2H1B A;  3A2X A;  3R3E A;  4LA1 A;  5G5E A;  4LL1 B;  4ZIJ A;  3IC4 A;  4KCA A;  2L5L A;  4I2U A;  1EP7 A;  3O76 A;  1V58 A;  3IAS 2;  3GIX A;  4WR5 A;  3D4T A;  4HQS A;  5BRT A;  1UN2 A;  3FK8 A;  4K9Z A;  2O8V B;  5J9C A;  3F3Q A;  3QOU A;  2QGV A;  5KOW A;  2PU9 C;  2FA8 A;  4EF0 A;  3ERW A;  2LRN A;  3VK9 A;  3UIW A;  1U88 A;  4POL A;  4V1A g;  4TR3 A;  3HY2 A;  5ECI B;  3LW9 A;  3F4R A;  5ELG A;  5IO2 A;  2VO4 A;  5IPG A;  2MMA A;  2KHP A;  4FQU A;  3H8Q A;  3F6F A;  5ELA A;  3D21 A;  3HVV A;  4JU5 A;  5HFI A;  2DC5 A;  4RQX A;  2J23 A;  1GSS A;  2VD0 A;  2YN1 A;  4BVX B;  2H72 A;  3Q6O A;  3ZTL A;  4P3Y B;  1USB A;  3ISO A;  3ZRD A;  3E0U A;  3JCM L;  6GSV A;  4GRF A;  2DIZ A;  1XW9 A;  3QCP A;  1QQ2 A;  2M80 A;  2HSY A;  4MMM A;  4G2E A;  4MJE A;  3GN3 A;  2C3N A;  1AQX A;  4GSS A;  5CAX A;  4I97 A;  4K0N A;  4HU7 A;  5ECR B;  5GAP D;  3GFK A;  1O73 A;  5G30 A;  5EVO A;  4BPY A;  2IN3 A;  1V57 A;  2RUF A;  1TI3 A;  1EP8 A;  3APS A;  5JCU A;  4AJ8 A;  2FA4 A;  3GKK A;  1EWX A;  3KMN A;  5IMZ A;  4MJA A;  6GSX A;  1RK4 A;  2VOC A;  4KE3 A;  2L6D A;  3L0H A;  2OJL A;  1ERU A;  5KEJ A;  3D22 A;  2I4A A;  3H93 A;  4HQZ A;  2VAF A;  2JZT A;  1ZYP A;  3CTF A;  3H4K A;  4MNN A;  4IP6 A;  5D9V A;  1A23 A;  2R0P A;  2I9H A;  5ECO B;  4JRR A;  2F8F A;  5J4U A;  3F9U A;  3QD9 A;  1FVJ A;  2CX3 A;  2GT5 A;  1GSQ A;  5DJM A;  3DXB A;  4HZ4 A;  1BED A;  2PUK C;  3QFB C;  1S3A A;  1VF2 A;  4F2I A;  4BVY B;  3ME7 A;  1QMV A;  3HA9 A;  4TR4 A;  2B5Y A;  4GTU A;  4G0K A;  1M2A A;  3LWA A;  1Z7P A;  2QC7 A;  3IOS A;  1J9B A;  3LQ7 A;  2JZR A;  3P2A A;  1FB6 A;  2FWF A;  5JCG A;  2HT9 A;  4KW6 A;  3VI7 A;  1A24 A;  4L0U A;  4MF5 A;  4TOP A;  2F3M A;  1Z5Y E;  4FYB A;  2VL3 A;  1K0N A;  1XWB A;  5HR3 A;  1G6Y A;  1SYR A;  4IHU A;  2P0G A;  4MCU A;  1GH2 A;  4GQF A;  2CVD A;  2DIY A;  1GSY A;  1H4O A;  3EC3 A;  5J3R A;  2X8H A;  3ZLP A;  1K0A A;  2DKH A;  5IPH A;  1YEX A;  1YY7 A;  3GTU A;  1O8W A;  1PL1 A;  4F0B A;  4YH2 A;  3ZFL A;  3IC8 A;  3HJO A;  3UVT A;  5EL8 A;  5F07 A;  4YAV A;  2C0G A;  3HXS A;  2EIR A;  5JWQ B;  4J57 E;  1F6M C;  1A8Y A;  2IME A;  1GUK A;  1NHY A;  4IJ3 A;  1YJ6 A;  4G0L A;  4EUY A;  13GS A;  5AIV A;  2L59 A;  2HRN A;  17GS A;  3UAR A;  1OE7 A;  5G1K A;  2IJY A;  3ZVJ D;  5IM9 A;  4QQ7 A;  1M0U A;  1PL2 A;  3IXR A;  3TKR A;  4XS1 A;  5DDL A;  2VL2 A;  1OYJ A;  3CYN A;  4MF7 A;  5DAL A;  5DAK B;  1YZX A;  2L57 A;  3M1G A;  4EL1 A;  3IRA A;  2B3S A;  1SK2 A;  4YQV A;  4NPB A;  3EE2 A;  2YWO A;  3LOR A;  3F4S A;  11GS A;  1HQO A;  4AJ7 A;  2LJR A;  1FB0 A;  4HDE A;  1GSU A;  3FR3 A;  4NMU A;  5KN1 A;  3GNJ A;  4Z2U A;  5E59 A;  3IV4 A;  3UJ1 A;  2LEG A;  2F8A A;  3Q19 A;  4I8B A;  3AY8 A;  2CVB A;  2OA7 A;  5BMU A;  1WRY A;  4GWR A;  1NHO A;  1GTI A;  2WJU A;  4N10 A;  2PVQ A;  4HZ2 A;  4RI6 A;  6GSS A;  4NXI A;  4EDY A;  1M9A A;  3N5O A;  3GST A;  5J9B A;  12GS A;  1XOB A;  5B6M A;  5ECL B;  3FY7 A;  3ZZX A;  1A8L A;  1AXD A;  1Q98 A;  4GST A;  5IOW A;  1BAY A;  4HJ2 A;  2X64 A;  3P90 A;  4O5R A;  2LUS A;  4EVM A;  4F03 A;  5DAL B;  1SJ6 A;  4MH2 A;  1XWG A;  3BOA A;  3LGC A;  3R2Q A;  3WT2 A;  1SL2 B;  2IMD A;  4OO4 A;  3KEB A;  1R7H A;  4YKF A;  4ACS A;  1JHB A;  4KA0 A;  4XS6 A;  2DJ0 A;  1F9M A;  2Z9S A;  3TDG A;  1R4W A;  3MNG A;  3KH7 A;  4KSO A;  2WS2 A;  1BX9 A;  2WUL A;  1J08 A;  2WZ9 A;  3DWV A;  1G6W A;  2VD1 A;  4JZQ A;  5IQY A;  4ECJ A;  1OKT A;  3WD6 A;  2GST A;  3LYK A;  1T8E B;  4IN0 A;  1ON4 A;  3CRU A;  4KUN A;  5HR2 A;  2R2J A;  4YAP A;  2XBI A;  2YZH A;  3L9S A;  1ZYE A;  1BYE A;  2E2M A;  3MYD A;  2N5B A;  5LNK e;  4OCF A;  4DSQ A;  3ERG A;  4XS4 A;  2LKU A;  4WBR D;  1EOH A;  4FYU A;  1Y6E A;  5ENU A;  4ZB6 A;  2L6C A;  5A4W A;  2MMZ A;  1FOV A;  3FR9 A;  5CRH A;  2A2S A;  2YPM A;  2VLV A;  1TI1 A;  3FZ5 A;  2H30 A;  5D9X A;  1PKZ A;  1EZK A;  2MBT A;  5G2Z A;  1ST9 A;  1XFL A;  4PGT A;  5D96 A;  2BMX A;  2L4Q A;  3FW2 A;  5IMV A;  4E8E A;  2DJ2 A;  3QAW A;  1ZL9 A;  5ECS A;  2DMM A;  2GT6 A;  1QFN A;  3OR5 A;  1HNC A;  3RBT A;  2CX4 A;  1I9D A;  3PPU A;  1PSQ A;  4NHW A;  1X9W B;  1DBY A;  2XHF A;  5EPF A;  4N30 A;  2DJ1 A;  2C8U A;  4XIH A;  4BL7 B;  5LCZ A;  3VWW A;  5COH A;  4X43 A;  3HCZ A;  1HD2 A;  3MIX A;  2LTK A;  3TJB A;  1MDK A;  1B9Y C;  2D2Z A;  2VCZ A;  3KGK A;  2FLS A;  3QDN A;  3KIJ A;  4TR1 B;  1PA3 A;  2H1D A;  1YQ1 A;  4ECB A;  1CQG A;  5B8B A;  1PKW A;  1K0D A;  2YV9 A;  1GTU A;  4KSM A;  4XRD A;  3MSZ A;  1OC8 A;  1MDJ A;  1EGR A;  4MH3 A;  4N0V A;  3KXO A;  1IYI A;  3CRT A;  1TKD B;  1JZO A;  5G5F A;  1XZO A;  2PN8 A;  1K0C A;  2I3Y A;  1NW2 A;  4ML1 A;  4D73 B;  4K7I A;  4K6X A;  4K5S A;  2VUP A;  4NHZ A;  4TKY A;  1YF0 A;  2FHE A;  4OFM A;  4Q5N A;  4MDC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...