5DCHA

Crystal structure of pseudomonas aeruginosa dsba e82i in complex with mips-0000851 (3-[(2-methylbenzyl)sulfanyl]-4h-1,2,4-triazol-4-amine)
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
187
structure length
187
Chain Sequence
DYTAGKEYVELSSPVPVSQPGKIEVVELFWYGCPHCYAFEPTIVPWSEKLPADVHFVRLPALFGGIWNVHGQMFLTLISMGVEHDVHNAVFEAIHKEHKKLATPEEMADFLAGKGVDKEKFLSTYNSFAIKGQMEKAKKLAMAYQVTGVPTMVVNGKYRFDIGSAGGPEETLKLADYLIEKERAAAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Thiol:disulfide interchange protein DsbA
publication title Fragment library screening identifies hits that bind to the non-catalytic surface of Pseudomonas aeruginosa DsbA1.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 63
structure length 187
sequence length 187
ec nomenclature
pdb deposition date 2015-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01323 DSBA DSBA-like thioredoxin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5dchA00
3NIVA 4K0GA 1GH2A 1G6YA 5HQPA 1ERUA 5CO3A 3IOSA 2GZZA 4NPBA 2BMXA 1BEDA 1BQ7A 2VAFA 2O85A 2H19A 5IPHA 3MDKA 1SL2B 3A2WA 4KSOA 1J9BA 1N2AA 2AYTA 3A3TA 1MDIA 1IYHA 4QQ7A 2RM5A 3APQA 4ACSA 5ECOB 1GL8A 4DVCA 2WCIA 1T4YA 4K9ZA 1F3AA 5G5FA 3P8WA 3QCPA 2R5GA 4XTSA 3LJRA 2K6VA 4DEJA 5C00A 3SBCA 1HNAA 3I9V2 3QMXA 3DEXA 1H75A 3ISOA 3R2QA 1GSFA 2I3YA 3DRNA 4F2IA 4YQVA 3KZQA 2LUSA 2O8VB 5DVBA 2HRNA 5F8BA 4GLTA 3LFLA 4O92A 3WGEA 3F8UA 2V41A 3Q19A 2LJAA 3VLNA 2C80A 3BOAA 1EGOA 2LNSA 4D73B 1TW9A 5AIXA 4MH2A 4IVFA 3HA9A 1FOVA 4KDXA 4NHWA 2LJKA 1OE8A 2WB9A 3PINA 3DVWA 1TU7A 3KMNA 1A8LA 1K0DA 4KAEA 1TKDB 3QAWA 4TRXA 2GSQA 1PN9A 4HOJA 2GQKA 1XVQA 1K0CA 2DMMA 2GVPA 5KEJA 2XC2A 5AN1A 3ZIVA 3IAM2 1V9WA 2DSAA 3ZMKA 2LQOA 1JHBA 3JCML 1V57A 5LNKe 1O73A 4V1Ag 5ECMB 2J23A 6GSTA 1SK1A 4IS0A 3D4TA 1O6JA 5GSSA 5KN0A 4EC0A 1GULA 1YJ6A 2CV4A 1AIUA 2AB6A 3D0ZA 3CTGA 2E0QA 1GLQA 1WWJA 2VL2A 3TKSA 2P31A 1F2EA 1OE7A 2YANA 1ZMAA 4IHUA 1K3OA 6GSWA 3GUSA 2YJ7A 4WR5A 2YN1A 3RPNA 4GSTA 3FR9A 1EP8A 1SU9A 3DWVA 2IFQA 1TU8A 3KM6A 3UJ1A 1MD3A 2H72A 2HFDA 2X8GA 3VPQA 5ABRA 2OE3A 2H76A 3LEFA 2FGXA 1TOFA 2VD0A 9GSSA 2P5RA 3ERWA 1G6WA 1Z7PA 2H1BA 2VUPA 1TXXA 2XBIA 3HXSA 4EE0A 3QOUA 4NXIA 6GSVA 2JSYA 2MZCA 3KJYA 1BG5A 1YKCA 4ZILA 2V6KA 5F07A 10GSA 1X5EA 4MH3A 4GWRA 3BD2A 2ON5A 5CRWA 1F9MA 2NTOA 2VLVA 1HNBA 3FW2A 2FWFA 2WS2A 4PX1A 5HR2A 4Q5FA 1BAYA 1WIKA 5DCGA 4J2FA 6GSUA 1THXA 2B1KA 4MABA 2MMAA 1NHYA 3HHVA 4ULXA 1UA5A 1B8XA 3SWLA 1GSQA 4DSSB 5D73A 4E8HA 5GZZB 1V40A 5HR1A 5J4UA 3CMIA 2PPTA 3TKSC 2F3MA 4KE3A 4NV5A 2XPEA 1LU4A 4IP6A 3KEBA 1K0NA 1R5AA 3FRCA 5AISA 4J56E 2C0FA 5G31A 5IM9A 3GH6A 2DBCA 3BCIA 2VL9A 4I2TA 1VGLA 1JZRA 4HI7A 4EUYA 1TRSA 3CXGA 3O76A 2CX4A 1T4ZA 2MMZA 3GA4A 4XS4A 2VL3A 3LSZA 3GHAA 3V1WA 3GKKA 1UVZA 4K1FA 5ECSA 4K7OA 2YWOA 1YF1A 1JZOA 1T00A 2RUFA 2LRNA 3TOTA 2EIOA 3IK9A 4F9ZA 4MF7A 2BTOT 2YWIA 2VO4A 4RQXA 4FYUA 2CQ9A 1EOHA 3F6FA 1J0FA 1OKDA 5IMCA 3QR6A 1GSEA 3MAKA 5A4UA 4X0XA 5A5KA 4OD7A 5LCZA 1QFNA 4Z7XA 3DYRA 2L6CA 2MMOA 2HLSA 3GURA 5EL8A 4ZL8A 3DMLA 2L5LA 2JU5A 3TB2A 4MPFA 2H66A 2H30A 1TRVA 1X9WB 4HEA2 4OCEA 1B4QA 2CVBA 4LLRA 5IMAA 1XW5A 1XBSA 1GRXA 3IA1A 19GSA 1RW1A 4O7HA 5IMZA 3E0UA 1FVKA 4IGJA 2IMFA 2PWJA 4ISDA 5IMFA 2H6YA 1TTZA 2OBIA 3ZREA 4NWYA 1XWCA 3IR4A 4JBBA 6GSSA 3MNGA 4EO3A 1K0MA 4RQRA 1F37A 1PX6A 2IMIA 2I9HA 2DJ1A 2HZFA 5HFGA 3UARA 4POBA 1MTCA 3F0IA 2B7KA 4PGTA 4I6XA 3LXZA 1M9AA 4KB3A 20GSA 1QGVA 3GRXA 4IKHA 1FG4A 3A2VA 3QFAC 2AUVA 2K18A 4EDYA 2GTUA 2FCHA 3UVTA 1GUMA 3C7MA 1XWGA 1Q98A 1THOA 1SL0B 5HFIA 2R37A 2IJYA 3TKPA 3S9FA 1A8YA 4L0WA 1IYIA 1XW6A 3VWVA 5H5RA 2X8HA 3HZ8A 3IV4A 4WF4A 5HR0A 1KTEA 3HZ4A 2PGTA 5IO0A 2YJHA 5J3RA 4POKA 3UBKA 5EY6A 1KBNA 1KNGA 1O85A 4LA1A 2F8AA 4O32A 3ZIJA 1ZL9A 3C8EA 3LYKA 1XPVA 1YZXA 3Q6OA 4V2LA 4KW6A 2LSTA 2HZEA 2OE0A 4XIHA 5DALB 5CRGA 3KMOA 3KTLA 5COHA 3W6GA 1FVJA 4PQ1A 3GKMA 4N0VA 3UOMA 4I5QA 3TRXA 5D9XA 3GFKA 1M2DA 4PUAA 3HJMA 2AAWA 17GSA 4IP1A 4JEDA 4NHZA 3ME7A 5B6MA 1B9XC 2FLSA 2IPAA 1A0RP 4ILFA 4KUNA 1QUWA 1SYXA 3C71A 3M1GA 2C0DA 1OC9A 2V32A 1GTUA 1A0FA 2F51A 1YEXA 2NVLA 4GTUA 4G19A 2OE1A 3KTBA 2A4VA 4OFTA 1FHEA 1HNCA 2D2ZA 4TR1A 4L5OA 4WEYA 4ZB6A 4KSMA 1W4VA 2YPMA 3GNJA 1ERWA 5ID2B 2I1UA 4GSSA 2XPDA 2JADA 3ED3A 2FA8A 4TR0A 2Z9SA 3TJGA 3MWHA 1X5DA 3WT2A 2H0GA 2IMKA 1OKTA 1G7EA 4HQZA 5F0GA 4O5RA 3ZYWA 3ZVJA 1O7UA 1GTBA 3GTUA 3VI7A 4XCSA 3UEMA 3L9UA 4N11A 1PD21 1SD8A 3Q74A 2KP1A 2CT6A 4JU5A 1PL1A 1PKWA 3WGDA 2C0EA 3D4MA 1GSUA 3EU3A 3L9SA 1TK8B 3FKFA 3PH9A 2GZYA 1TP9A 1AQXA 2H0HA 2H01A 1XVWA 2HXKA 3TJKA 4TXOB 2L4CA 1ACVA 2GGTA 3QPMA 2IMDA 2HYXA 1EEMA 2XBQA 5A4WA 5CRDA 3KD0A 2KUCA 4HZ4A 4XS1A 3FZAA 1K0OA 2HE3A 3KXOA 5JWOB 2FD3A 1XFLA 4RI7A 2VM2A 2GSTA 1OC3A 3HKRA 3EYTA 3C73A 4OFNA 3TUEA 1XOBA 2NDOA 2O87A 4CW9A 2JL4A 5CP1A 8GSSA 3ZVJD 5DCHA 4ZBAA 5DJMA 1QXHA 3FZ5A 2LQQA 3IXRA 3KCMA 3QAGA 1T7PB 1MEKA 3HYPA 3EINA 3VI5A 2H6XA 1FAAA 3IDVA 2H74A 4PUFC 4K7IA 5G30A 1GNWA 2H75A 4FIWA 2OACA 2WFCA 3M3MA 3EU4A 2G2QA 3BBYA 3TKRA 1JZDA 2AV4A 3HJPA 4ECJA 2EIRA 4F03A 3Q18A 2KLXA 2GSRA 5L71A 2GS3A 1MDKA 1GSYA 1J08A 1AC1A 2R2JA 2FUG2 2RIIA 4BL7A 4KDUA 4WETA 2E2MA 3VFIA 4YQUA 4MPGA 2NBSA 2VLUA 3TGZA 5IMDA 1FW1A 1S3AA 5A4VA 5CYYA 1ABAA 2A2RA 3EE2A 2P0GA 1PSQA 2YP6A 1U3AA 1Z5YE 4ZL7A 1FB6A 4I8BA 5H5SA 3F4TA 3D21A 2DC5A 3H4KA 5G2ZA 3K8NA 1GTIA 2K8VA 6GSYA 2YV7A 4X1UA 1F6MC 18GSA 2MMNA 3TKSE 1PX7A 2B3SA 3CTFA 5CREA 1VF3A 2JZSA 4WKWA 4ECCA 2E2GA 4MP4A 5ECPB 5IOWA 1SL1B 3GN3A 2GT5A 1R4WA 5DAKA 5G1LA 3I69A 1B9YC 2DJJA 1NW2A 1C72A 1ZYEA 4ZBBA 4G2EA 3IC4A 3WGXA 1SKRB 4AJ7A 1K3LA 4WBRD 3J7Yk 4GQFA 1B4PA 1USBA 2QSIA 4GRFA 2OBKA 3FEUA 4K7NA 4HUAA 1YQ1A 2V6OA 3CSIA 4GCIA 4G9HA 4V2MA 5GSTA 2IFQB 1ZOFA 2ZNMA 1E6BA 2NPBA 2CZ3A 1X9MB 4KA0A 4TOPA 2ALBA 3EURA 2N5BA 4NAXA 1MDJA 5GAPD 1Z6MA 2VL2C 1OAZA 4V2NA 3IK7A 3GKXA 2B1LA 3APOA 4TN8A 3E3EA 1EV4A 4K8MA 3KP9A 2CX3A 1BX9A 4ML6A 1LBKA 1V2AA 2OJLA 2JSZA 3HD5A 2DJ3A 2RUEA 4WXTA 2TRXA 4E8EA 5KN2A 3P90A 1GLPA 2I4AA 2H8LA 2VCQA 3D22A 5FT3A 2LTKA 2YV9A 3BCKA 1O8XA 3ZFLA 2HI7A 5J9CA 3LQ7A 4MCUA 3TJBA 4MZCA 3GV1A 3DXBA 4K0NA 5IPGA 3ERFA 2H0IA 1O8WA 2CA8A 1TRUA 2WDUA 2JZRA 3KH9A 1HD2A 1O81A 2MBSA 2X8CA 4X43A 3H1NA 4HU9A 2PMTA 4MZWA 4F0CA 2LJRA 3G9BA 3OR5A 3VURA 3O6TA 3L9VA 1W89A 1T8EB 4ECIA 5DBQA 4N0ZA 1M0UA 1SJ6A 5CAXA 2V2GA 4XS4B 2M46A 4KDYA 2I81A 3HY2A 2VCZA 3ZITA 2LRTA 3QDNA 4BVYA 2OADA 4OO5A 1QMVA 2G0FA 2PVQA 1V58A 2N5AA 4Q5QA 4TR4A 3A5WA 4POMA 3NOFA 4P3YB 2C8UA 1Q4JA 1GUKA 2YNXA 3QD9A 2PUKC 4L8EA 1YEPA 1Y6EA 2EC4A 3ME8A 2L4QA 3GX8A 3GL5A 22GSA 2FWGA 3L0HA 2ZCTA 2HSYA 1UN2A 2FWHA 1YF0A 4MJCA 4TW5A 3RHBA 5JCWA 3BJ5A 2LNTA 3WT1A 1R7HA 5G1KA 3F3QA 4LMWA 1ON4A 5D93A 1TJDA 4RUVA 2H73A 3LORA 1EGRA 2EIQA 2V1MA 4ZB8A 2LEGA 3QAVA 1WRYA 3UMAA 2VD1A 4MJEA 3VPTA 3W8JA 2WGRA 3CBUA 3ZL5A 4ZXGA 3VWWA 3GL3A 3O3TA 1M9BA 5ECQB 4N30A 3GMFA 4L0UA 3P2AA 1XWKA 5IOXA 4POLA 1A23A 1R5PA 5JWQB 2F8FA 2YWNA 4BA7A 4IBPA 4NMUA 1VF1A 1BJXA 1VF2A 4JR6A 16GSA 3FZ9A 2IN3A 3L78A 3RPPA 3NZNA 4EL1A 3DD3A 3FK8A 2L57A 2C3QA 2JACA 1LJRA 1ML6A 3F9UA 1GSSA 3M9JA 3ZRDA 2C1YA 1TI1A 4GXZA 5JCUA 2ZUPA 1WOUA 5AIVA 2L5OA 1ST9A 1Z9HA 1EZKA 2L6DA 1WP0A 4ZL9A 2GLRA 1K3YA 5IQYA 4JRRA 2R4VA 4MF5A 1YKAA 4BWQA 14GSA 5LD0A 2HZEB 1URMA 3EVIA 5B7CA 2A2SA 1NM3A 5ECRB 1M2BA 4G10A 4MJBA 2PN8A 1CQHA 1ZZYA 5ECNB 4D73A 2M72A 1ZYQB 3H8QA 1TK5B 4MMMA 5ELGA 3U5RE 2VCVA 2B6MA 1DE2A 3ERGA 3U6VA 1EP7A 3TJFA 3EC3A 4IW9A 5AGYA 4XHMA 3IBHA 4EF0A 4HS1A 4H86A 3WD6A 2WRTA 3E9JB 2LKUA 4MDCA 4TXVA 1SJIA 1G7OA 1AQVA 4MK3A 1OC9B 5F06A 7GSSA 2L59A 4CHSA 1HYUA 3RAZA 4HJMA 1EOGA 3UAPA 4JR4A 1TK0B 3RHCA 2HRFA 5JCGA 2O89A 3IE3A 2R3XA 2OA7A 1E2YA 3TKQA 2LRCA 2C3TA 4TR1B 3G7IA 5D9WA 5FHIA 4KNDA 4Q5RA 1SKSB 5ECKB 3FHKA 1A2LA 3FZ4A 3LG6A 1K0BA 2YWMA 3ZLPA 1A2MA 1I9DA 1XW9A 4HQSA 2LS5A 2TRCP 4BPYA 1M99A 1QK8A 3FR3A 2VM1A 2HNLA 2CAIA 1KEBA 1RK4A 2REMA 1ZGNA 3EMPA 4FH8A 1VF4A 2J9HA 3KGKA 3F63A 1SK2A 5E4WA 2PERA 3GSSA 3GYKA 4K2DA 2H1DA 3GTUB 4NV2A 3M8NA 2YZUA 2K8SA 4FYBA 4WF5A 4YAPA 1U88A 3IHQA 1U87A 4KCEA 3H79A 2DIZA 12GSA 3QFBC 3DIEA 4PURA 4QL9A 2PU9C 1DBYA 2VLTA 1DSBA 1CQGA 5EPFA 3TRQA 2B5XA 5ELAA 5H5QA 5ECIB 1Y25A 3KH7A 4F0BA 2VIMA 1GP1A 2H1AA 1YDKA 2F9SA 3CSJA 2YZHA 3F3RA 2XHFA 4MJAA 4YAVA 3LWAA 11GSA 2MYGA 2B7JA 1X9SB 1I5GA 4IN0A 4OFMA 3GX0A 5GAND 3HVVA 4F82A 1PGTA 3H93A 1WMJA 5C04A 3D6IA 3J7Yb 2RM6A 2HSHA 5B6NA 4TVEA 1AQWA 1UC7A 4IQAA 1A2JA 1PRXA 2WULA 4J57E 3G7JA 3M9KA 2O7KA 4KX4A 1JZWA 13GSA 1GSDA 3F6DA 2GT6A 4WR4A 5ECHB 4TR3A 3KP8A 4PXOA 4DSSA 2PBJA 2CAQA 3US3A 2KOKA 3VWXA 1HQOA 4XS6A 1OVNA 2M80A 2FHEA 5CNWA 2QKEA 4OWYA 4OMVA 5HFKA 3CRTA 4JZQA 1X5CA 2CVDA 4GSNA 3UIWA 2CVKA 2KHPA 3TOUA 1ILOA 1AXDA 1X0RA 1JLWA 4V1Ap 2IL3A 5DJLA 5D8IA 1EWXA 4GQCA 2RLIA 1ERTA 1YY7A 1TDIA 2YOIA 4PNFA 2P5QA 3MSZA 2FNOA 4EXJA 4ECBA 5CRHA 4KGIA 3DKSA 2N5FA 1M7TA 1GNEA 1PL2A 2WZ9A 3G7YA 3CRUA 2DJ0A 1ZCPA 1SYRA 3W8SA 5E59A 1GWCA 2GQLA 4HZ2A 4OCFA 4ML1A 1XWAA 2BJXA 2LV3A 4ZBDA 4EDZA 3GH9A 1SENA 2JZTA 2DLXA 1Z6NA 1MD4A 4BWSA 1PKZA 3EMXA 1JFUA 3GIXA 3ZZXA 2DJ2A 5DAKB 4MA9A 3RDWA 3HJOA 3L4NA 1WPIA 1PMTA 3C1SA 1OC8A 2FA4A 5IMVA 1GUHA 4MLYA 1XCCA 1B48A 1EEJA 4KCAA 1DE1A 5J41A 1SK0A 4IJ3A 5INYA 2IWTA 2K9FA 3P7XA 1T3BA 3FYGA 3DGQA 2H71A 1RQMA 2QGVA 4ZIJA 3VK9A 4LMVA 3IPZA 4PNGA 3TJJA 1VRSD 2X64A 2C0GA 3F4SA 3WYWA 5HR3A 3AY8A 2H1GA 3D5JA 3UL3A 2VOCA 4XRAA 1DUGA 5JWRB 2C4JA 1U6TA 4DSQA 1NSWA 4N10A 3EWLA 3ZTLA 4HJ2A 3LYPA 4CDOA 2VCTA 2ES7A 2AJQB 1XZOA 4FO5A 5IIZA 4YQMA 4BVXA 2PVOC 5EVOA 3FY7A 3GKNA 4YH2A 1JLVA 3PR8A 3M0FA 4IJIA 2DMLA 2MBTA 1SKWB 5KN3A 2GSSA 2VCXA 2ON7A 3PGTA 2H6ZA 2GZPA 4EKZA 4EVMA 3F4RA 6GSXA 4HU7A 2TIRA 1S3CA 1F3BA 2KP2A 1G0TA 1SD9A 5B8BA 1N8JA 2IMEA 4AJ8A 5DALA 2DIYA 3C1RA 1QQ2A 1R26A 4Q5NA 4I2UA 2AHEA 3ZFBA 1AUCA 4RI6A 5ENUA 3A2XA 5G5EA 4AGSA 1TI3A 4KH7A 5KN1A 4OO4A 3TDGA 3CSHA 3HCZA 5FWGA 1WJKA 1SJZA 1A24A 1EV9A 1K0AA 1XOAA 1BYEA 4DSRA 1XIYA 2VCWA 4MZBA 1FO5A 3IAS2 2QC7A 2FWEA 1T1VA 5IO2A 3TCOA 5ECLB 1XWBA 5J5NA 1S3DA 1AW9A 3LGCA 3TRPA 1WE0A 1M2AA 4IQ1A 3IRAA 4FYCA 1ERVA 5DQYA 5D9TA 4ID0A 4PQHA 3HVXA 4L5LA 1OYJA 5DQSA 1TRWA 5ID2A 1PQNA 4TKYA 3GSTA 5J9BA 1FB0A 2E7PA 1XXUA 4ZB9A 4PQIA 3UBLA 3KIJA 2B5YA 1PA3A 5F05A 4IELA 1Z7RA 4WBJA 2H70A 2FY6A 4I97A 4LL1B 3VWUA 2R6KA 3HDCA 4JE1A 4LL4B 3APSA 1NHOA 4HDEA 5D96A 3N5OA 2B5EA 4QL7A 2GQMA 3I6AA 4GF0A 5D9VA 3HVSA 1AAZA 3RBTA 3N9JA 2GDRA 2IIYA 4AJ6A 1V98A 3I43A 2DJKA 2WJUA 2X99A 4XRDA 4MF6A 2HT9A 1Z3EA 1GTAA 4K6XA 4TXOA 4AF2A 2C3NA 2YCDA 1H4OA 2CZ2A 2OKAA 5B8AA 1U3IA 3DVXA 3ZMLA 3UVHA 3FR6A 5DDLA 3LXTA 3CYNA
chains in the Genus database with same CATH superfamily
3NIVA 4K0GA 1GH2A 1G6YA 5HQPA 1ERUA 5CO3A 3IOSA 2GZZA 4NPBA 2BMXA 1BEDA 1BQ7A 2VAFA 2O85A 2H19A 5IPHA 3MDKA 1SL2B 3A2WA 4KSOA 1J9BA 1N2AA 2AYTA 3A3TA 1MDIA 1IYHA 4Z2UA 4QQ7A 2RM5A 3APQA 4ACSA 5ECOB 4G0KA 1GL8A 4DVCA 2WCIA 1T4YA 4K9ZA 1F3AA 5G5FA 3P8WA 3QCPA 2R5GA 4XTSA 3LJRA 2K6VA 4DEJA 5C00A 3SBCA 1HNAA 3I9V2 3QMXA 3DEXA 1H75A 1XG8A 3ISOA 3R2QA 1GSFA 2I3YA 3DRNA 4F2IA 4YQVA 3KZQA 2LUSA 2O8VB 5DVBA 2HRNA 5F8BA 4GLTA 3LFLA 4O92A 3WGEA 3F8UA 2V41A 3Q19A 2QA1A 2LJAA 3VLNA 2C80A 4BIKA 3BOAA 1EGOA 2LNSA 4D73B 1TW9A 5AIXA 4MH2A 4IVFA 3HA9A 1FOVA 4KDXA 4NHWA 2LJKA 1OE8A 2WB9A 3PINA 3CQFA 3DVWA 1TU7A 3KMNA 1A8LA 1K0DA 4KAEA 1TKDB 3QAWA 4TRXA 4EIQA 2GSQA 1PN9A 4HOJA 2GQKA 1XVQA 1K0CA 2DMMA 2GVPA 5KEJA 2XC2A 5AN1A 3ZIVA 3IAM2 1V9WA 2DSAA 3ZMKA 2LQOA 1JHBA 3JCML 1V57A 5LNKe 1O73A 4V1Ag 4K5RA 5ECMB 2J23A 6GSTA 1PFOA 1SK1A 4IS0A 3D4TA 1O6JA 2A2PA 5GSSA 5KN0A 4EC0A 1GULA 1YJ6A 2CV4A 1AIUA 2AB6A 3D0ZA 3CTGA 2E0QA 1GLQA 1WWJA 2VL2A 3TKSA 2P31A 4EIPA 1F2EA 1OE7A 2YANA 1ZMAA 4IHUA 1K3OA 6GSWA 3GUSA 2YJ7A 4WR5A 2YN1A 3RPNA 4GSTA 3FR9A 1EP8A 1SU9A 3DWVA 2IFQA 1TU8A 3KM6A 3UJ1A 1MD3A 2H72A 2HFDA 2X8GA 3VPQA 5ABRA 2OE3A 2H76A 3LEFA 2FGXA 1TOFA 2VD0A 9GSSA 2P5RA 3ERWA 1G6WA 1Z7PA 2H1BA 2VUPA 1TXXA 2XBIA 3HXSA 4EE0A 3QOUA 4NXIA 6GSVA 2JSYA 2MZCA 3KJYA 1BG5A 1YKCA 4ZILA 2V6KA 5F07A 10GSA 1X5EA 4MH3A 4GWRA 3BD2A 2ON5A 5CRWA 1PN0A 1F9MA 2NTOA 2VLVA 1HNBA 3FW2A 2FWFA 2WS2A 4PX1A 5HR2A 4Q5FA 1BAYA 5BRTA 1WIKA 5DCGA 4J2FA 6GSUA 1THXA 2B1KA 4MABA 2MMAA 1NHYA 3HHVA 4ULXA 1UA5A 1B8XA 3SWLA 1GSQA 4DSSB 5D73A 4E8HA 5GZZB 1V40A 5HR1A 5J4UA 3CMIA 2PPTA 3TKSC 2F3MA 4KE3A 4NV5A 2XPEA 1LU4A 4IP6A 3KEBA 1K0NA 1R5AA 3FRCA 5AISA 4J56E 2C0FA 5G31A 5IM9A 3GH6A 2DBCA 3BCIA 2VL9A 4I2TA 1VGLA 1JZRA 4HI7A 4EUYA 1TRSA 3CXGA 3O76A 2CX4A 1T4ZA 2MMZA 3GA4A 4XS4A 2VL3A 3LSZA 3GHAA 3V1WA 3GKKA 1UVZA 4K1FA 5ECSA 4K7OA 2YWOA 1YF1A 1JZOA 1T00A 2RUFA 2LRNA 3TOTA 2EIOA 3IK9A 4F9ZA 4MF7A 2BTOT 3PPUA 2YWIA 2VO4A 4RQXA 4FYUA 2CQ9A 1EOHA 3F6FA 1J0FA 1OKDA 4YKGA 5IMCA 3QR6A 1GSEA 3MAKA 5A4UA 4X0XA 5A5KA 4OD7A 5LCZA 1QFNA 4Z7XA 3DYRA 2L6CA 2MMOA 2HLSA 3GURA 4Z2TA 5EL8A 4ZL8A 3DMLA 2L5LA 2JU5A 3TB2A 4MPFA 2H66A 2H30A 1TRVA 1X9WB 4HEA2 5KOWA 4OCEA 1B4QA 2CVBA 4LLRA 5IMAA 1XW5A 1XBSA 1GRXA 3IA1A 2HRKA 19GSA 1RW1A 4O7HA 5IMZA 3E0UA 1FVKA 4IGJA 2IMFA 2PWJA 4PTSA 4ISDA 5IMFA 2H6YA 1TTZA 2OBIA 3ZREA 4NWYA 1XWCA 3IR4A 4JBBA 6GSSA 3MNGA 4EO3A 1K0MA 4RQRA 1F37A 1PX6A 2IMIA 2I9HA 2DJ1A 2HZFA 5HFGA 3UARA 4POBA 1MTCA 3F0IA 2B7KA 4PGTA 4I6XA 3LXZA 1M9AA 4KB3A 20GSA 1QGVA 3GRXA 4IKHA 1FG4A 3A2VA 3QFAC 2AUVA 2K18A 4EDYA 2GTUA 2FCHA 3UVTA 1GUMA 3C7MA 4BVXB 1XWGA 1Q98A 1THOA 1SL0B 5HFIA 2R37A 2IJYA 3TKPA 3S9FA 1A8YA 4L0WA 1IYIA 1XW6A 3VWVA 5H5RA 2X8HA 3HZ8A 3IV4A 4WF4A 5HR0A 1KTEA 3HZ4A 2PGTA 5IO0A 2YJHA 5J3RA 4POKA 3UBKA 5EY6A 1KBNA 1KNGA 1O85A 4LA1A 2F8AA 4O32A 3ZIJA 1ZL9A 3C8EA 3LYKA 1XPVA 1YZXA 3Q6OA 4V2LA 4KW6A 2LSTA 2HZEA 2OE0A 4XIHA 5DALB 5CRGA 3KMOA 3KTLA 5COHA 2R0GA 3W6GA 1FVJA 4PQ1A 3GKMA 4N0VA 3UOMA 4I5QA 3TRXA 5D9XA 3GFKA 1M2DA 4PUAA 5KOXA 3HJMA 3LW9A 2AAWA 17GSA 4IP1A 4JEDA 4NHZA 3ME7A 5B6MA 1B9XC 2FLSA 2IPAA 1A0RP 4ILFA 4KUNA 1QUWA 1SYXA 3C71A 3M1GA 2C0DA 1OC9A 2V32A 1GTUA 1A0FA 2F51A 1YEXA 2NVLA 4GTUA 4G19A 2OE1A 3KTBA 2A4VA 4OFTA 4O5QA 1FHEA 1HNCA 2D2ZA 4TR1A 4L5OA 4WEYA 4ZB6A 4KSMA 1W4VA 2YPMA 3GNJA 1ERWA 5ID2B 2I1UA 4GSSA 2XPDA 2JADA 3ED3A 2FA8A 4TR0A 2Z9SA 3TJGA 3MWHA 1X5DA 3WT2A 2H0GA 2IMKA 1OKTA 1G7EA 4HQZA 5F0GA 4O5RA 3ZYWA 3ZVJA 1O7UA 1GTBA 3GTUA 3VI7A 4XCSA 3UEMA 3L9UA 4N11A 1PD21 1SD8A 3Q74A 2KP1A 2CT6A 4JU5A 1PL1A 1PKWA 3R3EA 3WGDA 2C0EA 3D4MA 4G0IA 1GSUA 3EU3A 3L9SA 1TK8B 3FKFA 3PH9A 1FOHA 2GZYA 1TP9A 1AQXA 2H0HA 2H01A 1XVWA 2HXKA 3TJKA 4TXOB 2L4CA 1ACVA 2GGTA 3QPMA 2IMDA 2HYXA 1EEMA 2XBQA 5A4WA 5CRDA 3KD0A 2KUCA 4HZ4A 4XS1A 3FZAA 1K0OA 2HE3A 3KXOA 5JWOB 2FD3A 1XFLA 4RI7A 2VM2A 2GSTA 1OC3A 3HKRA 3EYTA 3C73A 4OFNA 3TUEA 1XOBA 2NDOA 2O87A 4CW9A 2JL4A 5CP1A 8GSSA 3ZVJD 5DCHA 4ZBAA 5DJMA 1QXHA 3FZ5A 2LQQA 2X49A 3IXRA 3KCMA 3QAGA 1T7PB 1MEKA 3HYPA 3EINA 3VI5A 2H6XA 1FAAA 3IDVA 2H74A 4PUFC 4K2XA 4K7IA 5G30A 1GNWA 2H75A 4FIWA 2OACA 2WFCA 3M3MA 3EU4A 2G2QA 3BBYA 3TKRA 1JZDA 2AV4A 3HJPA 4ECJA 2EIRA 4F03A 3Q18A 2KLXA 2GSRA 5L71A 2GS3A 1MDKA 1GSYA 1J08A 1AC1A 2R2JA 3HVNA 2FUG2 2RIIA 4BL7A 4KDUA 4WETA 2E2MA 4KF9A 3VFIA 4YQUA 4MPGA 2NBSA 2VLUA 3TGZA 5IMDA 1FW1A 1S3AA 5A4VA 3FMWA 5CYYA 2HRAA 5BMUA 1ABAA 2A2RA 3EE2A 2P0GA 1PSQA 2YP6A 1U3AA 1Z5YE 4ZL7A 1FB6A 4I8BA 5H5SA 3F4TA 3D21A 2DC5A 3H4KA 5G2ZA 3K8NA 1GTIA 2K8VA 6GSYA 2YV7A 4X1UA 1F6MC 18GSA 2MMNA 3TKSE 1PX7A 2B3SA 3CTFA 5CREA 1VF3A 2JZSA 4WKWA 4ECCA 2E2GA 4MP4A 5ECPB 5IOWA 1SL1B 3GN3A 2GT5A 1R4WA 5DAKA 5G1LA 3I69A 1B9YC 2DJJA 1NW2A 1C72A 1ZYEA 4ZBBA 4G2EA 3IC4A 3WGXA 1SKRB 4AJ7A 1K3LA 4WBRD 3J7Yk 4GQFA 1B4PA 1USBA 2QSIA 4GRFA 2OBKA 3FEUA 4K7NA 4HUAA 2R0CA 1YQ1A 2V6OA 3CSIA 4GCIA 4G9HA 4V2MA 5GSTA 2IFQB 1ZOFA 2ZNMA 1E6BA 2NPBA 2CZ3A 1X9MB 4KA0A 4TOPA 2ALBA 3EURA 2N5BA 4NAXA 1MDJA 5GAPD 1Z6MA 2VL2C 1OAZA 4V2NA 3IK7A 3GKXA 2B1LA 3APOA 4TN8A 3E3EA 1EV4A 4K8MA 3KP9A 2CX3A 1BX9A 4ML6A 1LBKA 1V2AA 2OJLA 2JSZA 3HD5A 2DJ3A 2RUEA 4G0LA 4WXTA 2TRXA 4E8EA 5KN2A 3P90A 1GLPA 2I4AA 2H8LA 2VCQA 3D22A 5FT3A 2LTKA 2YV9A 3BCKA 1O8XA 3ZFLA 2HI7A 5J9CA 4USSA 3LQ7A 4MCUA 3TJBA 3IHGA 4MZCA 3GV1A 3DXBA 4K0NA 5IPGA 3ERFA 2H0IA 1O8WA 2CA8A 1TRUA 2WDUA 2JZRA 3KH9A 1HD2A 1O81A 2MBSA 2X8CA 4X43A 4A5PA 3H1NA 4HU9A 2PMTA 4MZWA 4F0CA 2LJRA 4HSCX 3G9BA 3OR5A 3VURA 3O6TA 3L9VA 1W89A 1T8EB 2DKIA 4ECIA 5DBQA 4N0ZA 1ZYPA 1M0UA 1SJ6A 5CAXA 2V2GA 4XS4B 2M46A 4KDYA 2I81A 3HY2A 2VCZA 3ZITA 2LRTA 3QDNA 4BVYA 2OADA 4OO5A 1QMVA 2G0FA 2PVQA 1V58A 2N5AA 4Q5QA 4TR4A 3A5WA 4POMA 3NOFA 4P3YB 2C8UA 1Q4JA 1GUKA 2YNXA 3QD9A 2PUKC 4L8EA 1YEPA 2DKHA 1Y6EA 2EC4A 3ME8A 2L4QA 3GX8A 3GL5A 22GSA 2FWGA 3L0HA 2ZCTA 2HSYA 1UN2A 2FWHA 1YF0A 4MJCA 4TW5A 3RHBA 5JCWA 3BJ5A 2LNTA 3WT1A 1R7HA 5G1KA 3F3QA 4LMWA 1ON4A 5D93A 1TJDA 4RUVA 2H73A 3LORA 1EGRA 2EIQA 2V1MA 4ZB8A 2LEGA 3QAVA 1WRYA 3UMAA 2VD1A 4MJEA 3VPTA 3W8JA 2WGRA 3CBUA 3ZL5A 4YKFA 4X4JA 4ZXGA 3VWWA 3GL3A 3O3TA 1M9BA 5ECQB 4N30A 3GMFA 4L0UA 3P2AA 1XWKA 5IOXA 4POLA 1A23A 1R5PA 5JWQB 2F8FA 2YWNA 4BA7A 4IBPA 4NMUA 1VF1A 1BJXA 2R0PA 1VF2A 4JR6A 16GSA 3FZ9A 2IN3A 3L78A 3RPPA 1M3IA 4FQUA 3NZNA 4EL1A 3DD3A 3FK8A 2L57A 2C3QA 2JACA 1LJRA 1ML6A 3F9UA 1GSSA 3M9JA 3ZRDA 2C1YA 1TI1A 4GXZA 5JCUA 2ZUPA 1WOUA 5AIVA 2L5OA 1ST9A 1Z9HA 1EZKA 2L6DA 1WP0A 4ZL9A 2GLRA 1K3YA 5IQYA 4JRRA 2R4VA 4MF5A 1YKAA 4BWQA 14GSA 5LD0A 2HZEB 1URMA 3EVIA 5B7CA 2A2SA 1NM3A 5ECRB 1M2BA 4G10A 4MJBA 2PN8A 1CQHA 1ZZYA 5ECNB 4D73A 2M72A 1ZYQB 3H8QA 1TK5B 4MMMA 5ELGA 3U5RE 2VCVA 2B6MA 1DE2A 3ERGA 3U6VA 1EP7A 3TJFA 3EC3A 4IW9A 5AGYA 4XHMA 3IBHA 4EF0A 4HS1A 4H86A 3WD6A 2WRTA 3E9JB 2LKUA 4MDCA 4TXVA 1SJIA 1G7OA 1AQVA 4MK3A 1OC9B 5F06A 7GSSA 2L59A 4CHSA 1HYUA 3RAZA 4HJMA 1EOGA 3UAPA 4JR4A 1TK0B 3RHCA 2HRFA 5JCGA 2O89A 3IE3A 2R3XA 2OA7A 1E2YA 3TKQA 2LRCA 2C3TA 4TR1B 3G7IA 5D9WA 5FHIA 4KNDA 4Q5RA 1SKSB 5ECKB 3FHKA 1A2LA 3FZ4A 3LG6A 1K0BA 2X4AA 2YWMA 1A2MA 3ZLPA 1I9DA 1XW9A 4HQSA 2LS5A 2TRCP 4BPYA 1M99A 1QK8A 3FR3A 2VM1A 2HNLA 2CAIA 1KEBA 1RK4A 2REMA 1ZGNA 3EMPA 4FH8A 1VF4A 2J9HA 3KGKA 3F63A 1SK2A 5E4WA 2PERA 3GSSA 3GYKA 4K2DA 2H1DA 3GTUB 4NV2A 3M8NA 2YZUA 2K8SA 4FYBA 4WF5A 4YAPA 1U88A 3IHQA 2UZ8A 1U87A 4KCEA 3H79A 2DIZA 3EPTA 12GSA 3QFBC 3DIEA 4PURA 4QL9A 2PU9C 1DBYA 2VLTA 1DSBA 1CQGA 5EPFA 3TRQA 2B5XA 5ELAA 5H5QA 5ECIB 1Y25A 3KH7A 2QA2A 4F0BA 2VIMA 1GP1A 2H1AA 1YDKA 2F9SA 3CSJA 2YZHA 3F3RA 2XHFA 4MJAA 4YAVA 3LWAA 11GSA 2MYGA 2B7JA 1X9SB 1I5GA 4IN0A 4OFMA 3GX0A 5GAND 3HVVA 4F82A 4Z2RA 1PGTA 3H93A 1WMJA 5C04A 3D6IA 3J7Yb 2RM6A 2HSHA 5B6NA 4TVEA 1AQWA 1UC7A 4IQAA 1A2JA 3MIXA 1PRXA 2WULA 4J57E 3G7JA 3M9KA 2O7KA 4KX4A 1JZWA 13GSA 1GSDA 3F6DA 2GT6A 4WR4A 5ECHB 4TR3A 3KP8A 4PXOA 4DSSA 2PBJA 2CAQA 3US3A 2KOKA 3VWXA 1HQOA 4XS6A 1OVNA 2M80A 2FHEA 5CNWA 2QKEA 4OWYA 4OMVA 5HFKA 3CRTA 4JZQA 1X5CA 2CVDA 4GSNA 3UIWA 2CVKA 2KHPA 3TOUA 1ILOA 1AXDA 1X0RA 1JLWA 4V1Ap 2IL3A 5DJLA 4BL7B 5D8IA 1EWXA 4GQCA 2RLIA 1ERTA 1YY7A 1TDIA 2YOIA 4PNFA 2P5QA 3MSZA 2FNOA 4EXJA 4ECBA 5CRHA 4KGIA 3DKSA 2N5FA 1M7TA 1GNEA 1PL2A 2WZ9A 3G7YA 3CRUA 2DJ0A 1ZCPA 1SYRA 3W8SA 5E59A 1GWCA 2GQLA 4HZ2A 4OCFA 4ML1A 1XWAA 2BJXA 2LV3A 4ZBDA 4EDZA 3GH9A 1SENA 2JZTA 2DLXA 1Z6NA 1MD4A 4BWSA 1PKZA 3EMXA 1JFUA 3GIXA 3ZZXA 2DJ2A 5DAKB 4MA9A 3RDWA 3HJOA 3L4NA 1WPIA 1PMTA 3C1SA 1OC8A 2FA4A 5IMVA 1GUHA 4MLYA 1XCCA 1B48A 1EEJA 4KCAA 1DE1A 5J41A 1SK0A 4IJ3A 5INYA 2IWTA 2K9FA 2HSMA 3P7XA 1T3BA 3FYGA 3DGQA 2H71A 1RQMA 2QGVA 4ZIJA 3VK9A 4LMVA 3IPZA 4PNGA 3TJJA 1VRSD 2X64A 2C0GA 3F4SA 3WYWA 5HR3A 3AY8A 2H1GA 3D5JA 3UL3A 2VOCA 4XRAA 1DUGA 5JWRB 2C4JA 1U6TA 4DSQA 1NSWA 4N10A 3EWLA 3ZTLA 4HJ2A 3LYPA 4CDOA 2VCTA 2ES7A 2AJQB 1XZOA 4FO5A 5IIZA 4YQMA 4BVXA 2PVOC 5EVOA 3FY7A 2A4HA 3GKNA 4YH2A 1JLVA 3PR8A 3M0FA 4IJIA 2DMLA 2MBTA 1SKWB 5KN3A 2GSSA 2VCXA 2ON7A 3PGTA 4O5UA 2H6ZA 2GZPA 4EKZA 4EVMA 3F4RA 1S3RA 6GSXA 4HU7A 2TIRA 1S3CA 1F3BA 2KP2A 1G0TA 1SD9A 5B8BA 1N8JA 2IMEA 4AJ8A 5DALA 2DIYA 3C1RA 1QQ2A 1R26A 4Q5NA 4I2UA 2AHEA 3ZFBA 1AUCA 4RI6A 5ENUA 3A2XA 5G5EA 4AGSA 4CY6A 1TI3A 3IC8A 4KH7A 5KN1A 4OO4A 3TDGA 3CSHA 3HCZA 5FWGA 1WJKA 4CY8A 1SJZA 1A24A 1EV9A 1K0AA 1XOAA 1BYEA 4DSRA 1XIYA 2VCWA 4MZBA 1FO5A 3IAS2 2QC7A 2FWEA 1T1VA 5IO2A 4K5SA 3TCOA 5ECLB 1M3JA 1XWBA 5J5NA 1S3DA 1AW9A 3LGCA 3TRPA 1WE0A 1M2AA 4IQ1A 3IRAA 4FYCA 1ERVA 4MNNA 5DQYA 4BVYB 5D9TA 4ID0A 4ICYA 4PQHA 3HVXA 4L5LA 1OYJA 5DQSA 1TRWA 5ID2A 1PQNA 4TKYA 3GSTA 5J9BA 1FB0A 1ZYNA 2E7PA 1XXUA 4ZB9A 4PQIA 3UBLA 3KIJA 2B5YA 1PA3A 5F05A 4IELA 1Z7RA 4WBJA 2H70A 2FY6A 4I97A 4LL1B 3VWUA 2R6KA 3HDCA 4JE1A 4LL4B 3APSA 1NHOA 4HDEA 3MYDA 5D96A 3N5OA 2B5EA 4QL7A 2GQMA 3I6AA 4GF0A 5D9VA 3HVSA 1AAZA 3RBTA 3N9JA 2GDRA 2IIYA 4AJ6A 1V98A 3I43A 2DJKA 2WJUA 2X99A 3A5IA 4XRDA 4MF6A 2HT9A 1Z3EA 1GTAA 4K6XA 4TXOA 4AF2A 2C3NA 2YCDA 1H4OA 2CZ2A 2OKAA 5B8AA 1U3IA 3DVXA 3ZMLA 3UVHA 3FR6A 5DDLA 3LXTA 3CYNA
chains in the Genus database with same CATH topology
3NIVA 4K0GA 1GH2A 1G6YA 5HQPA 1ERUA 5CO3A 3IOSA 2GZZA 4NPBA 2BMXA 1BEDA 1BQ7A 2VAFA 2O85A 2H19A 5IPHA 3MDKA 1SL2B 3A2WA 4KSOA 1J9BA 1N2AA 2AYTA 3A3TA 1MDIA 1IYHA 4Z2UA 4QQ7A 2RM5A 3APQA 4ACSA 5ECOB 4G0KA 1GL8A 4DVCA 2WCIA 1T4YA 4K9ZA 1F3AA 5G5FA 3P8WA 3QCPA 2R5GA 4XTSA 3LJRA 2K6VA 4DEJA 5C00A 3SBCA 1HNAA 3I9V2 3QMXA 3DEXA 1H75A 3ISOA 3R2QA 1GSFA 2I3YA 3DRNA 4F2IA 4YQVA 3KZQA 2LUSA 2O8VB 5DVBA 2HRNA 5F8BA 4GLTA 3LFLA 4O92A 3WGEA 3F8UA 2V41A 3Q19A 2QA1A 2LJAA 3VLNA 2C80A 3BOAA 1EGOA 2LNSA 4D73B 1TW9A 5AIXA 4MH2A 4IVFA 3HA9A 1FOVA 4KDXA 4NHWA 2LJKA 1OE8A 2WB9A 3PINA 3DVWA 1TU7A 3KMNA 1A8LA 1K0DA 4KAEA 1TKDB 3QAWA 4TRXA 4EIQA 2GSQA 1PN9A 4HOJA 2GQKA 1XVQA 1K0CA 2DMMA 2GVPA 5KEJA 2XC2A 5AN1A 3ZIVA 3IAM2 1V9WA 2DSAA 3ZMKA 2LQOA 1JHBA 3JCML 1V57A 5LNKe 1O73A 4V1Ag 4K5RA 5ECMB 2J23A 6GSTA 1SK1A 4IS0A 3D4TA 1O6JA 2A2PA 5GSSA 5KN0A 4EC0A 1GULA 1YJ6A 2CV4A 1AIUA 2AB6A 3D0ZA 3CTGA 2E0QA 1GLQA 1WWJA 2VL2A 3TKSA 2P31A 4EIPA 1F2EA 1OE7A 2YANA 1ZMAA 4IHUA 1K3OA 6GSWA 3GUSA 2YJ7A 4WR5A 2YN1A 3RPNA 4GSTA 3FR9A 1EP8A 1SU9A 3DWVA 2IFQA 1TU8A 3KM6A 3UJ1A 1MD3A 2H72A 2HFDA 2X8GA 3VPQA 5ABRA 2OE3A 2H76A 3LEFA 2FGXA 1TOFA 2VD0A 9GSSA 2P5RA 3ERWA 1G6WA 1Z7PA 2H1BA 2VUPA 1TXXA 2XBIA 3HXSA 4EE0A 3QOUA 4NXIA 6GSVA 2JSYA 2MZCA 3KJYA 1BG5A 1YKCA 4ZILA 2V6KA 5F07A 10GSA 1X5EA 4MH3A 4GWRA 3BD2A 2ON5A 5CRWA 1PN0A 1F9MA 2NTOA 2VLVA 1HNBA 3FW2A 2FWFA 2WS2A 4PX1A 5HR2A 4Q5FA 1BAYA 5BRTA 1WIKA 5DCGA 4J2FA 6GSUA 1THXA 2B1KA 4MABA 2MMAA 1NHYA 3HHVA 4ULXA 1UA5A 1B8XA 3SWLA 1GSQA 4DSSB 5D73A 4E8HA 5GZZB 1V40A 5HR1A 5J4UA 3CMIA 2PPTA 3TKSC 2F3MA 4KE3A 4NV5A 2XPEA 1LU4A 4IP6A 3KEBA 1K0NA 1R5AA 3FRCA 5AISA 4J56E 2C0FA 5G31A 5IM9A 3GH6A 2DBCA 3BCIA 2VL9A 4I2TA 1VGLA 1JZRA 4HI7A 4EUYA 1TRSA 3CXGA 3O76A 2CX4A 1T4ZA 2MMZA 3GA4A 4XS4A 2VL3A 3LSZA 3GHAA 3V1WA 3GKKA 1UVZA 4K1FA 5ECSA 4K7OA 2YWOA 1YF1A 1JZOA 1T00A 2RUFA 2LRNA 3TOTA 2EIOA 3IK9A 4F9ZA 4MF7A 2BTOT 3PPUA 2YWIA 2VO4A 4RQXA 4FYUA 2CQ9A 1EOHA 3F6FA 1J0FA 1OKDA 4YKGA 5IMCA 3QR6A 1GSEA 3MAKA 5A4UA 4X0XA 5A5KA 4OD7A 5LCZA 1QFNA 4Z7XA 3DYRA 2L6CA 2MMOA 2HLSA 3GURA 4Z2TA 5EL8A 4ZL8A 3DMLA 2L5LA 2JU5A 3TB2A 4MPFA 2H66A 2H30A 1TRVA 1X9WB 4HEA2 5KOWA 4OCEA 1B4QA 2CVBA 4LLRA 5IMAA 1XW5A 1XBSA 1GRXA 3IA1A 2HRKA 19GSA 1RW1A 4O7HA 5IMZA 3E0UA 1FVKA 4IGJA 2IMFA 2PWJA 4PTSA 4ISDA 5IMFA 2H6YA 1TTZA 2OBIA 3ZREA 4NWYA 1XWCA 3IR4A 4JBBA 6GSSA 3MNGA 4EO3A 1K0MA 4RQRA 1F37A 1PX6A 2IMIA 2I9HA 2DJ1A 2HZFA 5HFGA 3UARA 4POBA 1MTCA 3F0IA 2B7KA 4PGTA 4I6XA 3LXZA 1M9AA 4KB3A 20GSA 1QGVA 3GRXA 4IKHA 1FG4A 3A2VA 3QFAC 2AUVA 2K18A 4EDYA 2GTUA 2FCHA 3UVTA 1GUMA 3C7MA 4BVXB 1XWGA 1Q98A 1THOA 1SL0B 5HFIA 2R37A 2IJYA 3TKPA 3S9FA 1A8YA 4L0WA 1IYIA 1XW6A 3VWVA 5H5RA 2X8HA 3HZ8A 3IV4A 4WF4A 5HR0A 1KTEA 3HZ4A 2PGTA 5IO0A 2YJHA 5J3RA 4POKA 3UBKA 5EY6A 1KBNA 1KNGA 1O85A 4LA1A 2F8AA 4O32A 3ZIJA 1ZL9A 3C8EA 3LYKA 1XPVA 1YZXA 3Q6OA 4V2LA 4KW6A 2LSTA 2HZEA 2OE0A 4XIHA 5DALB 5CRGA 3KMOA 3KTLA 5COHA 2R0GA 3W6GA 1FVJA 4PQ1A 3GKMA 4N0VA 3UOMA 4I5QA 3TRXA 5D9XA 3GFKA 1M2DA 4PUAA 5KOXA 3HJMA 3LW9A 2AAWA 17GSA 4IP1A 4JEDA 4NHZA 3ME7A 5B6MA 1B9XC 2FLSA 2IPAA 1A0RP 4ILFA 4KUNA 1QUWA 1SYXA 3C71A 3M1GA 2C0DA 1OC9A 2V32A 1GTUA 1A0FA 2F51A 1YEXA 2NVLA 4GTUA 4G19A 2OE1A 3KTBA 2A4VA 4OFTA 4O5QA 1FHEA 1HNCA 2D2ZA 4TR1A 4L5OA 4WEYA 4ZB6A 4KSMA 1W4VA 2YPMA 3GNJA 1ERWA 5ID2B 2I1UA 4GSSA 2XPDA 2JADA 3ED3A 2FA8A 4TR0A 2Z9SA 3TJGA 3MWHA 1X5DA 3WT2A 2H0GA 2IMKA 1OKTA 1G7EA 4HQZA 5F0GA 4O5RA 3ZYWA 3ZVJA 1O7UA 1GTBA 3GTUA 3VI7A 4XCSA 3UEMA 3L9UA 4N11A 1PD21 1SD8A 3Q74A 2KP1A 2CT6A 4JU5A 1PL1A 1PKWA 3R3EA 3WGDA 2C0EA 3D4MA 4G0IA 1GSUA 3EU3A 3L9SA 1TK8B 3FKFA 3PH9A 1FOHA 2GZYA 1TP9A 1AQXA 2H0HA 2H01A 1XVWA 2HXKA 3TJKA 4TXOB 2L4CA 1ACVA 2GGTA 3QPMA 2IMDA 2HYXA 1EEMA 2XBQA 5A4WA 5CRDA 3KD0A 2KUCA 4HZ4A 4XS1A 3FZAA 1K0OA 2HE3A 3KXOA 5JWOB 2FD3A 1XFLA 4RI7A 2VM2A 2GSTA 1OC3A 3HKRA 3EYTA 3C73A 4OFNA 3TUEA 1XOBA 2NDOA 2O87A 4CW9A 2JL4A 5CP1A 8GSSA 3ZVJD 5DCHA 4ZBAA 5DJMA 1QXHA 3FZ5A 2LQQA 2X49A 3IXRA 3KCMA 3QAGA 1T7PB 1MEKA 3HYPA 3EINA 3VI5A 2H6XA 1FAAA 3IDVA 2H74A 4PUFC 4K2XA 4K7IA 5G30A 1GNWA 2H75A 4FIWA 2OACA 2WFCA 3M3MA 3EU4A 2G2QA 3BBYA 3TKRA 1JZDA 2AV4A 3HJPA 4ECJA 2EIRA 4F03A 3Q18A 2KLXA 2GSRA 5L71A 2GS3A 1MDKA 1GSYA 1J08A 1AC1A 2R2JA 2FUG2 2RIIA 4BL7A 4KDUA 4WETA 2E2MA 4KF9A 3VFIA 4YQUA 4MPGA 2NBSA 2VLUA 3TGZA 5IMDA 1FW1A 1S3AA 5A4VA 3FMWA 5CYYA 2HRAA 5BMUA 1ABAA 2A2RA 3EE2A 2P0GA 1PSQA 2YP6A 1U3AA 1Z5YE 4ZL7A 1FB6A 4I8BA 5H5SA 3F4TA 3D21A 2DC5A 3H4KA 5G2ZA 3K8NA 1GTIA 2K8VA 6GSYA 2YV7A 4X1UA 1F6MC 18GSA 2MMNA 3TKSE 1PX7A 2B3SA 3CTFA 5CREA 1VF3A 2JZSA 4WKWA 4ECCA 2E2GA 4MP4A 5ECPB 5IOWA 1SL1B 3GN3A 2GT5A 1R4WA 5DAKA 5G1LA 3I69A 1B9YC 2DJJA 1NW2A 1C72A 1ZYEA 4ZBBA 4G2EA 3IC4A 3WGXA 1SKRB 4AJ7A 1K3LA 4WBRD 3J7Yk 4GQFA 1B4PA 1USBA 2QSIA 4GRFA 2OBKA 3FEUA 4K7NA 4HUAA 2R0CA 1YQ1A 2V6OA 3CSIA 4GCIA 4G9HA 4V2MA 5GSTA 2IFQB 1ZOFA 2ZNMA 1E6BA 2NPBA 2CZ3A 1X9MB 4KA0A 4TOPA 2ALBA 3EURA 2N5BA 4NAXA 1MDJA 5GAPD 1Z6MA 2VL2C 1OAZA 4V2NA 3IK7A 3GKXA 2B1LA 3APOA 4TN8A 3E3EA 1EV4A 4K8MA 3KP9A 2CX3A 1BX9A 4ML6A 1LBKA 1V2AA 2OJLA 2JSZA 3HD5A 2DJ3A 2RUEA 4G0LA 4WXTA 2TRXA 4E8EA 5KN2A 3P90A 1GLPA 2I4AA 2H8LA 2VCQA 3D22A 5FT3A 2LTKA 2YV9A 3BCKA 1O8XA 3ZFLA 2HI7A 5J9CA 4USSA 3LQ7A 4MCUA 3TJBA 3IHGA 4MZCA 3GV1A 3DXBA 4K0NA 5IPGA 3ERFA 2H0IA 1O8WA 2CA8A 1TRUA 2WDUA 2JZRA 3KH9A 1HD2A 1O81A 2MBSA 2X8CA 4X43A 4A5PA 3H1NA 4HU9A 2PMTA 4MZWA 4F0CA 2LJRA 3G9BA 3OR5A 3VURA 3O6TA 3L9VA 1W89A 1T8EB 2DKIA 4ECIA 5DBQA 4N0ZA 1ZYPA 1M0UA 1SJ6A 5CAXA 2V2GA 4XS4B 2M46A 4KDYA 2I81A 3HY2A 2VCZA 3ZITA 2LRTA 3QDNA 4BVYA 2OADA 4OO5A 1QMVA 2G0FA 2PVQA 1V58A 2N5AA 4Q5QA 4TR4A 3A5WA 4POMA 3NOFA 4P3YB 2C8UA 1Q4JA 1GUKA 2YNXA 3QD9A 2PUKC 4L8EA 1YEPA 2DKHA 1Y6EA 2EC4A 3ME8A 2L4QA 3GX8A 3GL5A 22GSA 2FWGA 3L0HA 2ZCTA 2HSYA 1UN2A 2FWHA 1YF0A 4MJCA 4TW5A 3RHBA 5JCWA 3BJ5A 2LNTA 3WT1A 1R7HA 5G1KA 3F3QA 4LMWA 1ON4A 5D93A 1TJDA 4RUVA 2H73A 3LORA 1EGRA 2EIQA 2V1MA 4ZB8A 2LEGA 3QAVA 1WRYA 3UMAA 2VD1A 4MJEA 3VPTA 3W8JA 2WGRA 3CBUA 3ZL5A 4YKFA 4X4JA 4ZXGA 3VWWA 3GL3A 3O3TA 1M9BA 5ECQB 4N30A 3GMFA 4L0UA 3P2AA 1XWKA 5IOXA 4POLA 1A23A 1R5PA 5JWQB 2F8FA 2YWNA 4BA7A 4IBPA 4NMUA 1VF1A 1BJXA 2R0PA 1VF2A 4JR6A 16GSA 3FZ9A 2IN3A 3L78A 3RPPA 4FQUA 3NZNA 4EL1A 3DD3A 3FK8A 2L57A 2C3QA 2JACA 1LJRA 1ML6A 3F9UA 1GSSA 3M9JA 3ZRDA 2C1YA 1TI1A 4GXZA 5JCUA 2ZUPA 1WOUA 5AIVA 2L5OA 1ST9A 1Z9HA 1EZKA 2L6DA 1WP0A 4ZL9A 2GLRA 1K3YA 5IQYA 4JRRA 2R4VA 4MF5A 1YKAA 4BWQA 14GSA 5LD0A 2HZEB 1URMA 3EVIA 5B7CA 2A2SA 1NM3A 5ECRB 1M2BA 4G10A 4MJBA 2PN8A 1CQHA 1ZZYA 5ECNB 4D73A 2M72A 1ZYQB 3H8QA 1TK5B 4MMMA 5ELGA 3U5RE 2VCVA 2B6MA 1DE2A 3ERGA 3U6VA 1EP7A 3TJFA 3EC3A 4IW9A 5AGYA 4XHMA 3IBHA 4EF0A 4HS1A 4H86A 3WD6A 2WRTA 3E9JB 2LKUA 4MDCA 4TXVA 1SJIA 1G7OA 1AQVA 4MK3A 1OC9B 5F06A 7GSSA 2L59A 4CHSA 1HYUA 3RAZA 4HJMA 1EOGA 3UAPA 4JR4A 1TK0B 3RHCA 2HRFA 5JCGA 2O89A 3IE3A 2R3XA 2OA7A 1E2YA 3TKQA 2LRCA 2C3TA 4TR1B 3G7IA 5D9WA 5FHIA 4KNDA 4Q5RA 1SKSB 5ECKB 3FHKA 1A2LA 3FZ4A 3LG6A 1K0BA 2X4AA 2YWMA 1A2MA 3ZLPA 1I9DA 1XW9A 4HQSA 2LS5A 2TRCP 4BPYA 1M99A 1QK8A 3FR3A 2VM1A 2HNLA 2CAIA 1KEBA 1RK4A 2REMA 1ZGNA 3EMPA 4FH8A 1VF4A 2J9HA 3KGKA 3F63A 1SK2A 5E4WA 2PERA 3GSSA 3GYKA 4K2DA 2H1DA 3GTUB 4NV2A 3M8NA 2YZUA 2K8SA 4FYBA 4WF5A 4YAPA 1U88A 3IHQA 2UZ8A 1U87A 4KCEA 3H79A 2DIZA 3EPTA 12GSA 3QFBC 3DIEA 4PURA 4QL9A 2PU9C 1DBYA 2VLTA 1DSBA 1CQGA 5EPFA 3TRQA 2B5XA 5ELAA 5H5QA 5ECIB 1Y25A 3KH7A 2QA2A 4F0BA 2VIMA 1GP1A 2H1AA 1YDKA 2F9SA 3CSJA 2YZHA 3F3RA 2XHFA 4MJAA 4YAVA 3LWAA 11GSA 2MYGA 2B7JA 1X9SB 1I5GA 4IN0A 4OFMA 3GX0A 5GAND 3HVVA 4F82A 4Z2RA 1PGTA 3H93A 1WMJA 5C04A 3D6IA 3J7Yb 2RM6A 2HSHA 5B6NA 4TVEA 1AQWA 1UC7A 4IQAA 1A2JA 3MIXA 1PRXA 2WULA 4J57E 3G7JA 3M9KA 2O7KA 4KX4A 1JZWA 13GSA 1GSDA 3F6DA 2GT6A 4WR4A 5ECHB 4TR3A 3KP8A 4PXOA 4DSSA 2PBJA 2CAQA 3US3A 2KOKA 3VWXA 1HQOA 4XS6A 1OVNA 2M80A 2FHEA 5CNWA 2QKEA 4OWYA 4OMVA 5HFKA 3CRTA 4JZQA 1X5CA 2CVDA 4GSNA 3UIWA 2CVKA 2KHPA 3TOUA 1ILOA 1AXDA 1X0RA 1JLWA 4V1Ap 2IL3A 5DJLA 4BL7B 5D8IA 1EWXA 4GQCA 2RLIA 1ERTA 1YY7A 1TDIA 2YOIA 4PNFA 2P5QA 3MSZA 2FNOA 4EXJA 4ECBA 5CRHA 4KGIA 3DKSA 2N5FA 1M7TA 1GNEA 1PL2A 2WZ9A 3G7YA 3CRUA 2DJ0A 1ZCPA 1SYRA 3W8SA 5E59A 1GWCA 2GQLA 4HZ2A 4OCFA 4ML1A 1XWAA 2BJXA 2LV3A 4ZBDA 4EDZA 3GH9A 1SENA 2JZTA 2DLXA 1Z6NA 1MD4A 4BWSA 1PKZA 3EMXA 1JFUA 3GIXA 3ZZXA 2DJ2A 5DAKB 4MA9A 3RDWA 3HJOA 3L4NA 1WPIA 1PMTA 3C1SA 1OC8A 2FA4A 5IMVA 1GUHA 4MLYA 1XCCA 1B48A 1EEJA 4KCAA 1DE1A 5J41A 1SK0A 4IJ3A 5INYA 2IWTA 2K9FA 2HSMA 3P7XA 1T3BA 3FYGA 3DGQA 2H71A 1RQMA 2QGVA 4ZIJA 3VK9A 4LMVA 3IPZA 4PNGA 3TJJA 1VRSD 2X64A 2C0GA 3F4SA 3WYWA 5HR3A 3AY8A 2H1GA 3D5JA 3UL3A 2VOCA 4XRAA 1DUGA 5JWRB 2C4JA 1U6TA 4DSQA 1NSWA 4N10A 3EWLA 3ZTLA 4HJ2A 3LYPA 4CDOA 2VCTA 2ES7A 2AJQB 1XZOA 4FO5A 5IIZA 4YQMA 4BVXA 2PVOC 5EVOA 3FY7A 2A4HA 3GKNA 4YH2A 1JLVA 3PR8A 3M0FA 4IJIA 2DMLA 2MBTA 1SKWB 5KN3A 2GSSA 2VCXA 2ON7A 3PGTA 4O5UA 2H6ZA 2GZPA 4EKZA 4EVMA 3F4RA 6GSXA 4HU7A 2TIRA 1S3CA 1F3BA 2KP2A 1G0TA 1SD9A 5B8BA 1N8JA 2IMEA 4AJ8A 5DALA 2DIYA 3C1RA 1QQ2A 1R26A 4Q5NA 4I2UA 2AHEA 3ZFBA 1AUCA 4RI6A 5ENUA 3A2XA 5G5EA 4AGSA 4CY6A 1TI3A 3IC8A 4KH7A 5KN1A 4OO4A 3TDGA 3CSHA 3HCZA 5FWGA 1WJKA 4CY8A 1SJZA 1A24A 1EV9A 1K0AA 1XOAA 1BYEA 4DSRA 1XIYA 2VCWA 4MZBA 1FO5A 3IAS2 2QC7A 2FWEA 1T1VA 5IO2A 4K5SA 3TCOA 5ECLB 1XWBA 5J5NA 1S3DA 1AW9A 3LGCA 3TRPA 1WE0A 1M2AA 4IQ1A 3IRAA 4FYCA 1ERVA 4MNNA 5DQYA 4BVYB 5D9TA 4ID0A 4ICYA 4PQHA 3HVXA 4L5LA 1OYJA 5DQSA 1TRWA 5ID2A 1PQNA 4TKYA 3GSTA 5J9BA 1FB0A 1ZYNA 2E7PA 1XXUA 4ZB9A 4PQIA 3UBLA 3KIJA 2B5YA 1PA3A 5F05A 4IELA 1Z7RA 4WBJA 2H70A 2FY6A 4I97A 4LL1B 3VWUA 2R6KA 3HDCA 4JE1A 4LL4B 3APSA 1NHOA 4HDEA 3MYDA 5D96A 3N5OA 2B5EA 4QL7A 2GQMA 3I6AA 4GF0A 5D9VA 3HVSA 1AAZA 3RBTA 3N9JA 2GDRA 2IIYA 4AJ6A 1V98A 3I43A 2DJKA 2WJUA 2X99A 3A5IA 4XRDA 4MF6A 2HT9A 1Z3EA 1GTAA 4K6XA 4TXOA 4AF2A 2C3NA 2YCDA 1H4OA 2CZ2A 2OKAA 5B8AA 1U3IA 3DVXA 3ZMLA 3UVHA 3FR6A 5DDLA 3LXTA 3CYNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NIV A;  4K0G A;  1GH2 A;  1G6Y A;  5HQP A;  1ERU A;  5CO3 A;  3IOS A;  2GZZ A;  4NPB A;  2BMX A;  1BED A;  1BQ7 A;  2VAF A;  2O85 A;  2H19 A;  5IPH A;  3MDK A;  1SL2 B;  3A2W A;  4KSO A;  1J9B A;  1N2A A;  2AYT A;  3A3T A;  1MDI A;  1IYH A;  4QQ7 A;  2RM5 A;  3APQ A;  4ACS A;  5ECO B;  1GL8 A;  4DVC A;  2WCI A;  1T4Y A;  4K9Z A;  1F3A A;  5G5F A;  3P8W A;  3QCP A;  2R5G A;  4XTS A;  3LJR A;  2K6V A;  4DEJ A;  5C00 A;  3SBC A;  1HNA A;  3I9V 2;  3QMX A;  3DEX A;  1H75 A;  3ISO A;  3R2Q A;  1GSF A;  2I3Y A;  3DRN A;  4F2I A;  4YQV A;  3KZQ A;  2LUS A;  2O8V B;  5DVB A;  2HRN A;  5F8B A;  4GLT A;  3LFL A;  4O92 A;  3WGE A;  3F8U A;  2V41 A;  3Q19 A;  2LJA A;  3VLN A;  2C80 A;  3BOA A;  1EGO A;  2LNS A;  4D73 B;  1TW9 A;  5AIX A;  4MH2 A;  4IVF A;  3HA9 A;  1FOV A;  4KDX A;  4NHW A;  2LJK A;  1OE8 A;  2WB9 A;  3PIN A;  3DVW A;  1TU7 A;  3KMN A;  1A8L A;  1K0D A;  4KAE A;  1TKD B;  3QAW A;  4TRX A;  2GSQ A;  1PN9 A;  4HOJ A;  2GQK A;  1XVQ A;  1K0C A;  2DMM A;  2GVP A;  5KEJ A;  2XC2 A;  5AN1 A;  3ZIV A;  3IAM 2;  1V9W A;  2DSA A;  3ZMK A;  2LQO A;  1JHB A;  3JCM L;  1V57 A;  5LNK e;  1O73 A;  4V1A g;  5ECM B;  2J23 A;  6GST A;  1SK1 A;  4IS0 A;  3D4T A;  1O6J A;  5GSS A;  5KN0 A;  4EC0 A;  1GUL A;  1YJ6 A;  2CV4 A;  1AIU A;  2AB6 A;  3D0Z A;  3CTG A;  2E0Q A;  1GLQ A;  1WWJ A;  2VL2 A;  3TKS A;  2P31 A;  1F2E A;  1OE7 A;  2YAN A;  1ZMA A;  4IHU A;  1K3O A;  6GSW A;  3GUS A;  2YJ7 A;  4WR5 A;  2YN1 A;  3RPN A;  4GST A;  3FR9 A;  1EP8 A;  1SU9 A;  3DWV A;  2IFQ A;  1TU8 A;  3KM6 A;  3UJ1 A;  1MD3 A;  2H72 A;  2HFD A;  2X8G A;  3VPQ A;  5ABR A;  2OE3 A;  2H76 A;  3LEF A;  2FGX A;  1TOF A;  2VD0 A;  9GSS A;  2P5R A;  3ERW A;  1G6W A;  1Z7P A;  2H1B A;  2VUP A;  1TXX A;  2XBI A;  3HXS A;  4EE0 A;  3QOU A;  4NXI A;  6GSV A;  2JSY A;  2MZC A;  3KJY A;  1BG5 A;  1YKC A;  4ZIL A;  2V6K A;  5F07 A;  10GS A;  1X5E A;  4MH3 A;  4GWR A;  3BD2 A;  2ON5 A;  5CRW A;  1F9M A;  2NTO A;  2VLV A;  1HNB A;  3FW2 A;  2FWF A;  2WS2 A;  4PX1 A;  5HR2 A;  4Q5F A;  1BAY A;  1WIK A;  5DCG A;  4J2F A;  6GSU A;  1THX A;  2B1K A;  4MAB A;  2MMA A;  1NHY A;  3HHV A;  4ULX A;  1UA5 A;  1B8X A;  3SWL A;  1GSQ A;  4DSS B;  5D73 A;  4E8H A;  5GZZ B;  1V40 A;  5HR1 A;  5J4U A;  3CMI A;  2PPT A;  3TKS C;  2F3M A;  4KE3 A;  4NV5 A;  2XPE A;  1LU4 A;  4IP6 A;  3KEB A;  1K0N A;  1R5A A;  3FRC A;  5AIS A;  4J56 E;  2C0F A;  5G31 A;  5IM9 A;  3GH6 A;  2DBC A;  3BCI A;  2VL9 A;  4I2T A;  1VGL A;  1JZR A;  4HI7 A;  4EUY A;  1TRS A;  3CXG A;  3O76 A;  2CX4 A;  1T4Z A;  2MMZ A;  3GA4 A;  4XS4 A;  2VL3 A;  3LSZ A;  3GHA A;  3V1W A;  3GKK A;  1UVZ A;  4K1F A;  5ECS A;  4K7O A;  2YWO A;  1YF1 A;  1JZO A;  1T00 A;  2RUF A;  2LRN A;  3TOT A;  2EIO A;  3IK9 A;  4F9Z A;  4MF7 A;  2BTO T;  2YWI A;  2VO4 A;  4RQX A;  4FYU A;  2CQ9 A;  1EOH A;  3F6F A;  1J0F A;  1OKD A;  5IMC A;  3QR6 A;  1GSE A;  3MAK A;  5A4U A;  4X0X A;  5A5K A;  4OD7 A;  5LCZ A;  1QFN A;  4Z7X A;  3DYR A;  2L6C A;  2MMO A;  2HLS A;  3GUR A;  5EL8 A;  4ZL8 A;  3DML A;  2L5L A;  2JU5 A;  3TB2 A;  4MPF A;  2H66 A;  2H30 A;  1TRV A;  1X9W B;  4HEA 2;  4OCE A;  1B4Q A;  2CVB A;  4LLR A;  5IMA A;  1XW5 A;  1XBS A;  1GRX A;  3IA1 A;  19GS A;  1RW1 A;  4O7H A;  5IMZ A;  3E0U A;  1FVK A;  4IGJ A;  2IMF A;  2PWJ A;  4ISD A;  5IMF A;  2H6Y A;  1TTZ A;  2OBI A;  3ZRE A;  4NWY A;  1XWC A;  3IR4 A;  4JBB A;  6GSS A;  3MNG A;  4EO3 A;  1K0M A;  4RQR A;  1F37 A;  1PX6 A;  2IMI A;  2I9H A;  2DJ1 A;  2HZF A;  5HFG A;  3UAR A;  4POB A;  1MTC A;  3F0I A;  2B7K A;  4PGT A;  4I6X A;  3LXZ A;  1M9A A;  4KB3 A;  20GS A;  1QGV A;  3GRX A;  4IKH A;  1FG4 A;  3A2V A;  3QFA C;  2AUV A;  2K18 A;  4EDY A;  2GTU A;  2FCH A;  3UVT A;  1GUM A;  3C7M A;  1XWG A;  1Q98 A;  1THO A;  1SL0 B;  5HFI A;  2R37 A;  2IJY A;  3TKP A;  3S9F A;  1A8Y A;  4L0W A;  1IYI A;  1XW6 A;  3VWV A;  5H5R A;  2X8H A;  3HZ8 A;  3IV4 A;  4WF4 A;  5HR0 A;  1KTE A;  3HZ4 A;  2PGT A;  5IO0 A;  2YJH A;  5J3R A;  4POK A;  3UBK A;  5EY6 A;  1KBN A;  1KNG A;  1O85 A;  4LA1 A;  2F8A A;  4O32 A;  3ZIJ A;  1ZL9 A;  3C8E A;  3LYK A;  1XPV A;  1YZX A;  3Q6O A;  4V2L A;  4KW6 A;  2LST A;  2HZE A;  2OE0 A;  4XIH A;  5DAL B;  5CRG A;  3KMO A;  3KTL A;  5COH A;  3W6G A;  1FVJ A;  4PQ1 A;  3GKM A;  4N0V A;  3UOM A;  4I5Q A;  3TRX A;  5D9X A;  3GFK A;  1M2D A;  4PUA A;  3HJM A;  2AAW A;  17GS A;  4IP1 A;  4JED A;  4NHZ A;  3ME7 A;  5B6M A;  1B9X C;  2FLS A;  2IPA A;  1A0R P;  4ILF A;  4KUN A;  1QUW A;  1SYX A;  3C71 A;  3M1G A;  2C0D A;  1OC9 A;  2V32 A;  1GTU A;  1A0F A;  2F51 A;  1YEX A;  2NVL A;  4GTU A;  4G19 A;  2OE1 A;  3KTB A;  2A4V A;  4OFT A;  1FHE A;  1HNC A;  2D2Z A;  4TR1 A;  4L5O A;  4WEY A;  4ZB6 A;  4KSM A;  1W4V A;  2YPM A;  3GNJ A;  1ERW A;  5ID2 B;  2I1U A;  4GSS A;  2XPD A;  2JAD A;  3ED3 A;  2FA8 A;  4TR0 A;  2Z9S A;  3TJG A;  3MWH A;  1X5D A;  3WT2 A;  2H0G A;  2IMK A;  1OKT A;  1G7E A;  4HQZ A;  5F0G A;  4O5R A;  3ZYW A;  3ZVJ A;  1O7U A;  1GTB A;  3GTU A;  3VI7 A;  4XCS A;  3UEM A;  3L9U A;  4N11 A;  1PD2 1;  1SD8 A;  3Q74 A;  2KP1 A;  2CT6 A;  4JU5 A;  1PL1 A;  1PKW A;  3WGD A;  2C0E A;  3D4M A;  1GSU A;  3EU3 A;  3L9S A;  1TK8 B;  3FKF A;  3PH9 A;  2GZY A;  1TP9 A;  1AQX A;  2H0H A;  2H01 A;  1XVW A;  2HXK A;  3TJK A;  4TXO B;  2L4C A;  1ACV A;  2GGT A;  3QPM A;  2IMD A;  2HYX A;  1EEM A;  2XBQ A;  5A4W A;  5CRD A;  3KD0 A;  2KUC A;  4HZ4 A;  4XS1 A;  3FZA A;  1K0O A;  2HE3 A;  3KXO A;  5JWO B;  2FD3 A;  1XFL A;  4RI7 A;  2VM2 A;  2GST A;  1OC3 A;  3HKR A;  3EYT A;  3C73 A;  4OFN A;  3TUE A;  1XOB A;  2NDO A;  2O87 A;  4CW9 A;  2JL4 A;  5CP1 A;  8GSS A;  3ZVJ D;  5DCH A;  4ZBA A;  5DJM A;  1QXH A;  3FZ5 A;  2LQQ A;  3IXR A;  3KCM A;  3QAG A;  1T7P B;  1MEK A;  3HYP A;  3EIN A;  3VI5 A;  2H6X A;  1FAA A;  3IDV A;  2H74 A;  4PUF C;  4K7I A;  5G30 A;  1GNW A;  2H75 A;  4FIW A;  2OAC A;  2WFC A;  3M3M A;  3EU4 A;  2G2Q A;  3BBY A;  3TKR A;  1JZD A;  2AV4 A;  3HJP A;  4ECJ A;  2EIR A;  4F03 A;  3Q18 A;  2KLX A;  2GSR A;  5L71 A;  2GS3 A;  1MDK A;  1GSY A;  1J08 A;  1AC1 A;  2R2J A;  2FUG 2;  2RII A;  4BL7 A;  4KDU A;  4WET A;  2E2M A;  3VFI A;  4YQU A;  4MPG A;  2NBS A;  2VLU A;  3TGZ A;  5IMD A;  1FW1 A;  1S3A A;  5A4V A;  5CYY A;  1ABA A;  2A2R A;  3EE2 A;  2P0G A;  1PSQ A;  2YP6 A;  1U3A A;  1Z5Y E;  4ZL7 A;  1FB6 A;  4I8B A;  5H5S A;  3F4T A;  3D21 A;  2DC5 A;  3H4K A;  5G2Z A;  3K8N A;  1GTI A;  2K8V A;  6GSY A;  2YV7 A;  4X1U A;  1F6M C;  18GS A;  2MMN A;  3TKS E;  1PX7 A;  2B3S A;  3CTF A;  5CRE A;  1VF3 A;  2JZS A;  4WKW A;  4ECC A;  2E2G A;  4MP4 A;  5ECP B;  5IOW A;  1SL1 B;  3GN3 A;  2GT5 A;  1R4W A;  5DAK A;  5G1L A;  3I69 A;  1B9Y C;  2DJJ A;  1NW2 A;  1C72 A;  1ZYE A;  4ZBB A;  4G2E A;  3IC4 A;  3WGX A;  1SKR B;  4AJ7 A;  1K3L A;  4WBR D;  3J7Y k;  4GQF A;  1B4P A;  1USB A;  2QSI A;  4GRF A;  2OBK A;  3FEU A;  4K7N A;  4HUA A;  1YQ1 A;  2V6O A;  3CSI A;  4GCI A;  4G9H A;  4V2M A;  5GST A;  2IFQ B;  1ZOF A;  2ZNM A;  1E6B A;  2NPB A;  2CZ3 A;  1X9M B;  4KA0 A;  4TOP A;  2ALB A;  3EUR A;  2N5B A;  4NAX A;  1MDJ A;  5GAP D;  1Z6M A;  2VL2 C;  1OAZ A;  4V2N A;  3IK7 A;  3GKX A;  2B1L A;  3APO A;  4TN8 A;  3E3E A;  1EV4 A;  4K8M A;  3KP9 A;  2CX3 A;  1BX9 A;  4ML6 A;  1LBK A;  1V2A A;  2OJL A;  2JSZ A;  3HD5 A;  2DJ3 A;  2RUE A;  4WXT A;  2TRX A;  4E8E A;  5KN2 A;  3P90 A;  1GLP A;  2I4A A;  2H8L A;  2VCQ A;  3D22 A;  5FT3 A;  2LTK A;  2YV9 A;  3BCK A;  1O8X A;  3ZFL A;  2HI7 A;  5J9C A;  3LQ7 A;  4MCU A;  3TJB A;  4MZC A;  3GV1 A;  3DXB A;  4K0N A;  5IPG A;  3ERF A;  2H0I A;  1O8W A;  2CA8 A;  1TRU A;  2WDU A;  2JZR A;  3KH9 A;  1HD2 A;  1O81 A;  2MBS A;  2X8C A;  4X43 A;  3H1N A;  4HU9 A;  2PMT A;  4MZW A;  4F0C A;  2LJR A;  3G9B A;  3OR5 A;  3VUR A;  3O6T A;  3L9V A;  1W89 A;  1T8E B;  4ECI A;  5DBQ A;  4N0Z A;  1M0U A;  1SJ6 A;  5CAX A;  2V2G A;  4XS4 B;  2M46 A;  4KDY A;  2I81 A;  3HY2 A;  2VCZ A;  3ZIT A;  2LRT A;  3QDN A;  4BVY A;  2OAD A;  4OO5 A;  1QMV A;  2G0F A;  2PVQ A;  1V58 A;  2N5A A;  4Q5Q A;  4TR4 A;  3A5W A;  4POM A;  3NOF A;  4P3Y B;  2C8U A;  1Q4J A;  1GUK A;  2YNX A;  3QD9 A;  2PUK C;  4L8E A;  1YEP A;  1Y6E A;  2EC4 A;  3ME8 A;  2L4Q A;  3GX8 A;  3GL5 A;  22GS A;  2FWG A;  3L0H A;  2ZCT A;  2HSY A;  1UN2 A;  2FWH A;  1YF0 A;  4MJC A;  4TW5 A;  3RHB A;  5JCW A;  3BJ5 A;  2LNT A;  3WT1 A;  1R7H A;  5G1K A;  3F3Q A;  4LMW A;  1ON4 A;  5D93 A;  1TJD A;  4RUV A;  2H73 A;  3LOR A;  1EGR A;  2EIQ A;  2V1M A;  4ZB8 A;  2LEG A;  3QAV A;  1WRY A;  3UMA A;  2VD1 A;  4MJE A;  3VPT A;  3W8J A;  2WGR A;  3CBU A;  3ZL5 A;  4ZXG A;  3VWW A;  3GL3 A;  3O3T A;  1M9B A;  5ECQ B;  4N30 A;  3GMF A;  4L0U A;  3P2A A;  1XWK A;  5IOX A;  4POL A;  1A23 A;  1R5P A;  5JWQ B;  2F8F A;  2YWN A;  4BA7 A;  4IBP A;  4NMU A;  1VF1 A;  1BJX A;  1VF2 A;  4JR6 A;  16GS A;  3FZ9 A;  2IN3 A;  3L78 A;  3RPP A;  3NZN A;  4EL1 A;  3DD3 A;  3FK8 A;  2L57 A;  2C3Q A;  2JAC A;  1LJR A;  1ML6 A;  3F9U A;  1GSS A;  3M9J A;  3ZRD A;  2C1Y A;  1TI1 A;  4GXZ A;  5JCU A;  2ZUP A;  1WOU A;  5AIV A;  2L5O A;  1ST9 A;  1Z9H A;  1EZK A;  2L6D A;  1WP0 A;  4ZL9 A;  2GLR A;  1K3Y A;  5IQY A;  4JRR A;  2R4V A;  4MF5 A;  1YKA A;  4BWQ A;  14GS A;  5LD0 A;  2HZE B;  1URM A;  3EVI A;  5B7C A;  2A2S A;  1NM3 A;  5ECR B;  1M2B A;  4G10 A;  4MJB A;  2PN8 A;  1CQH A;  1ZZY A;  5ECN B;  4D73 A;  2M72 A;  1ZYQ B;  3H8Q A;  1TK5 B;  4MMM A;  5ELG A;  3U5R E;  2VCV A;  2B6M A;  1DE2 A;  3ERG A;  3U6V A;  1EP7 A;  3TJF A;  3EC3 A;  4IW9 A;  5AGY A;  4XHM A;  3IBH A;  4EF0 A;  4HS1 A;  4H86 A;  3WD6 A;  2WRT A;  3E9J B;  2LKU A;  4MDC A;  4TXV A;  1SJI A;  1G7O A;  1AQV A;  4MK3 A;  1OC9 B;  5F06 A;  7GSS A;  2L59 A;  4CHS A;  1HYU A;  3RAZ A;  4HJM A;  1EOG A;  3UAP A;  4JR4 A;  1TK0 B;  3RHC A;  2HRF A;  5JCG A;  2O89 A;  3IE3 A;  2R3X A;  2OA7 A;  1E2Y A;  3TKQ A;  2LRC A;  2C3T A;  4TR1 B;  3G7I A;  5D9W A;  5FHI A;  4KND A;  4Q5R A;  1SKS B;  5ECK B;  3FHK A;  1A2L A;  3FZ4 A;  3LG6 A;  1K0B A;  2YWM A;  3ZLP A;  1A2M A;  1I9D A;  1XW9 A;  4HQS A;  2LS5 A;  2TRC P;  4BPY A;  1M99 A;  1QK8 A;  3FR3 A;  2VM1 A;  2HNL A;  2CAI A;  1KEB A;  1RK4 A;  2REM A;  1ZGN A;  3EMP A;  4FH8 A;  1VF4 A;  2J9H A;  3KGK A;  3F63 A;  1SK2 A;  5E4W A;  2PER A;  3GSS A;  3GYK A;  4K2D A;  2H1D A;  3GTU B;  4NV2 A;  3M8N A;  2YZU A;  2K8S A;  4FYB A;  4WF5 A;  4YAP A;  1U88 A;  3IHQ A;  1U87 A;  4KCE A;  3H79 A;  2DIZ A;  12GS A;  3QFB C;  3DIE A;  4PUR A;  4QL9 A;  2PU9 C;  1DBY A;  2VLT A;  1DSB A;  1CQG A;  5EPF A;  3TRQ A;  2B5X A;  5ELA A;  5H5Q A;  5ECI B;  1Y25 A;  3KH7 A;  4F0B A;  2VIM A;  1GP1 A;  2H1A A;  1YDK A;  2F9S A;  3CSJ A;  2YZH A;  3F3R A;  2XHF A;  4MJA A;  4YAV A;  3LWA A;  11GS A;  2MYG A;  2B7J A;  1X9S B;  1I5G A;  4IN0 A;  4OFM A;  3GX0 A;  5GAN D;  3HVV A;  4F82 A;  1PGT A;  3H93 A;  1WMJ A;  5C04 A;  3D6I A;  3J7Y b;  2RM6 A;  2HSH A;  5B6N A;  4TVE A;  1AQW A;  1UC7 A;  4IQA A;  1A2J A;  1PRX A;  2WUL A;  4J57 E;  3G7J A;  3M9K A;  2O7K A;  4KX4 A;  1JZW A;  13GS A;  1GSD A;  3F6D A;  2GT6 A;  4WR4 A;  5ECH B;  4TR3 A;  3KP8 A;  4PXO A;  4DSS A;  2PBJ A;  2CAQ A;  3US3 A;  2KOK A;  3VWX A;  1HQO A;  4XS6 A;  1OVN A;  2M80 A;  2FHE A;  5CNW A;  2QKE A;  4OWY A;  4OMV A;  5HFK A;  3CRT A;  4JZQ A;  1X5C A;  2CVD A;  4GSN A;  3UIW A;  2CVK A;  2KHP A;  3TOU A;  1ILO A;  1AXD A;  1X0R A;  1JLW A;  4V1A p;  2IL3 A;  5DJL A;  5D8I A;  1EWX A;  4GQC A;  2RLI A;  1ERT A;  1YY7 A;  1TDI A;  2YOI A;  4PNF A;  2P5Q A;  3MSZ A;  2FNO A;  4EXJ A;  4ECB A;  5CRH A;  4KGI A;  3DKS A;  2N5F A;  1M7T A;  1GNE A;  1PL2 A;  2WZ9 A;  3G7Y A;  3CRU A;  2DJ0 A;  1ZCP A;  1SYR A;  3W8S A;  5E59 A;  1GWC A;  2GQL A;  4HZ2 A;  4OCF A;  4ML1 A;  1XWA A;  2BJX A;  2LV3 A;  4ZBD A;  4EDZ A;  3GH9 A;  1SEN A;  2JZT A;  2DLX A;  1Z6N A;  1MD4 A;  4BWS A;  1PKZ A;  3EMX A;  1JFU A;  3GIX A;  3ZZX A;  2DJ2 A;  5DAK B;  4MA9 A;  3RDW A;  3HJO A;  3L4N A;  1WPI A;  1PMT A;  3C1S A;  1OC8 A;  2FA4 A;  5IMV A;  1GUH A;  4MLY A;  1XCC A;  1B48 A;  1EEJ A;  4KCA A;  1DE1 A;  5J41 A;  1SK0 A;  4IJ3 A;  5INY A;  2IWT A;  2K9F A;  3P7X A;  1T3B A;  3FYG A;  3DGQ A;  2H71 A;  1RQM A;  2QGV A;  4ZIJ A;  3VK9 A;  4LMV A;  3IPZ A;  4PNG A;  3TJJ A;  1VRS D;  2X64 A;  2C0G A;  3F4S A;  3WYW A;  5HR3 A;  3AY8 A;  2H1G A;  3D5J A;  3UL3 A;  2VOC A;  4XRA A;  1DUG A;  5JWR B;  2C4J A;  1U6T A;  4DSQ A;  1NSW A;  4N10 A;  3EWL A;  3ZTL A;  4HJ2 A;  3LYP A;  4CDO A;  2VCT A;  2ES7 A;  2AJQ B;  1XZO A;  4FO5 A;  5IIZ A;  4YQM A;  4BVX A;  2PVO C;  5EVO A;  3FY7 A;  3GKN A;  4YH2 A;  1JLV A;  3PR8 A;  3M0F A;  4IJI A;  2DML A;  2MBT A;  1SKW B;  5KN3 A;  2GSS A;  2VCX A;  2ON7 A;  3PGT A;  2H6Z A;  2GZP A;  4EKZ A;  4EVM A;  3F4R A;  6GSX A;  4HU7 A;  2TIR A;  1S3C A;  1F3B A;  2KP2 A;  1G0T A;  1SD9 A;  5B8B A;  1N8J A;  2IME A;  4AJ8 A;  5DAL A;  2DIY A;  3C1R A;  1QQ2 A;  1R26 A;  4Q5N A;  4I2U A;  2AHE A;  3ZFB A;  1AUC A;  4RI6 A;  5ENU A;  3A2X A;  5G5E A;  4AGS A;  1TI3 A;  4KH7 A;  5KN1 A;  4OO4 A;  3TDG A;  3CSH A;  3HCZ A;  5FWG A;  1WJK A;  1SJZ A;  1A24 A;  1EV9 A;  1K0A A;  1XOA A;  1BYE A;  4DSR A;  1XIY A;  2VCW A;  4MZB A;  1FO5 A;  3IAS 2;  2QC7 A;  2FWE A;  1T1V A;  5IO2 A;  3TCO A;  5ECL B;  1XWB A;  5J5N A;  1S3D A;  1AW9 A;  3LGC A;  3TRP A;  1WE0 A;  1M2A A;  4IQ1 A;  3IRA A;  4FYC A;  1ERV A;  5DQY A;  5D9T A;  4ID0 A;  4PQH A;  3HVX A;  4L5L A;  1OYJ A;  5DQS A;  1TRW A;  5ID2 A;  1PQN A;  4TKY A;  3GST A;  5J9B A;  1FB0 A;  2E7P A;  1XXU A;  4ZB9 A;  4PQI A;  3UBL A;  3KIJ A;  2B5Y A;  1PA3 A;  5F05 A;  4IEL A;  1Z7R A;  4WBJ A;  2H70 A;  2FY6 A;  4I97 A;  4LL1 B;  3VWU A;  2R6K A;  3HDC A;  4JE1 A;  4LL4 B;  3APS A;  1NHO A;  4HDE A;  5D96 A;  3N5O A;  2B5E A;  4QL7 A;  2GQM A;  3I6A A;  4GF0 A;  5D9V A;  3HVS A;  1AAZ A;  3RBT A;  3N9J A;  2GDR A;  2IIY A;  4AJ6 A;  1V98 A;  3I43 A;  2DJK A;  2WJU A;  2X99 A;  4XRD A;  4MF6 A;  2HT9 A;  1Z3E A;  1GTA A;  4K6X A;  4TXO A;  4AF2 A;  2C3N A;  2YCD A;  1H4O A;  2CZ2 A;  2OKA A;  5B8A A;  1U3I A;  3DVX A;  3ZML A;  3UVH A;  3FR6 A;  5DDL A;  3LXT A;  3CYN A; 
#chains in the Genus database with same CATH topology
 3NIV A;  4K0G A;  1GH2 A;  1G6Y A;  5HQP A;  1ERU A;  5CO3 A;  3IOS A;  2GZZ A;  4NPB A;  2BMX A;  1BED A;  1BQ7 A;  2VAF A;  2O85 A;  2H19 A;  5IPH A;  3MDK A;  1SL2 B;  3A2W A;  4KSO A;  1J9B A;  1N2A A;  2AYT A;  3A3T A;  1MDI A;  1IYH A;  4Z2U A;  4QQ7 A;  2RM5 A;  3APQ A;  4ACS A;  5ECO B;  4G0K A;  1GL8 A;  4DVC A;  2WCI A;  1T4Y A;  4K9Z A;  1F3A A;  5G5F A;  3P8W A;  3QCP A;  2R5G A;  4XTS A;  3LJR A;  2K6V A;  4DEJ A;  5C00 A;  3SBC A;  1HNA A;  3I9V 2;  3QMX A;  3DEX A;  1H75 A;  1XG8 A;  3ISO A;  3R2Q A;  1GSF A;  2I3Y A;  3DRN A;  4F2I A;  4YQV A;  3KZQ A;  2LUS A;  2O8V B;  5DVB A;  2HRN A;  5F8B A;  4GLT A;  3LFL A;  4O92 A;  3WGE A;  3F8U A;  2V41 A;  3Q19 A;  2QA1 A;  2LJA A;  3VLN A;  2C80 A;  4BIK A;  3BOA A;  1EGO A;  2LNS A;  4D73 B;  1TW9 A;  5AIX A;  4MH2 A;  4IVF A;  3HA9 A;  1FOV A;  4KDX A;  4NHW A;  2LJK A;  1OE8 A;  2WB9 A;  3PIN A;  3CQF A;  3DVW A;  1TU7 A;  3KMN A;  1A8L A;  1K0D A;  4KAE A;  1TKD B;  3QAW A;  4TRX A;  4EIQ A;  2GSQ A;  1PN9 A;  4HOJ A;  2GQK A;  1XVQ A;  1K0C A;  2DMM A;  2GVP A;  5KEJ A;  2XC2 A;  5AN1 A;  3ZIV A;  3IAM 2;  1V9W A;  2DSA A;  3ZMK A;  2LQO A;  1JHB A;  3JCM L;  1V57 A;  5LNK e;  1O73 A;  4V1A g;  4K5R A;  5ECM B;  2J23 A;  6GST A;  1PFO A;  1SK1 A;  4IS0 A;  3D4T A;  1O6J A;  2A2P A;  5GSS A;  5KN0 A;  4EC0 A;  1GUL A;  1YJ6 A;  2CV4 A;  1AIU A;  2AB6 A;  3D0Z A;  3CTG A;  2E0Q A;  1GLQ A;  1WWJ A;  2VL2 A;  3TKS A;  2P31 A;  4EIP A;  1F2E A;  1OE7 A;  2YAN A;  1ZMA A;  4IHU A;  1K3O A;  6GSW A;  3GUS A;  2YJ7 A;  4WR5 A;  2YN1 A;  3RPN A;  4GST A;  3FR9 A;  1EP8 A;  1SU9 A;  3DWV A;  2IFQ A;  1TU8 A;  3KM6 A;  3UJ1 A;  1MD3 A;  2H72 A;  2HFD A;  2X8G A;  3VPQ A;  5ABR A;  2OE3 A;  2H76 A;  3LEF A;  2FGX A;  1TOF A;  2VD0 A;  9GSS A;  2P5R A;  3ERW A;  1G6W A;  1Z7P A;  2H1B A;  2VUP A;  1TXX A;  2XBI A;  3HXS A;  4EE0 A;  3QOU A;  4NXI A;  6GSV A;  2JSY A;  2MZC A;  3KJY A;  1BG5 A;  1YKC A;  4ZIL A;  2V6K A;  5F07 A;  10GS A;  1X5E A;  4MH3 A;  4GWR A;  3BD2 A;  2ON5 A;  5CRW A;  1PN0 A;  1F9M A;  2NTO A;  2VLV A;  1HNB A;  3FW2 A;  2FWF A;  2WS2 A;  4PX1 A;  5HR2 A;  4Q5F A;  1BAY A;  5BRT A;  1WIK A;  5DCG A;  4J2F A;  6GSU A;  1THX A;  2B1K A;  4MAB A;  2MMA A;  1NHY A;  3HHV A;  4ULX A;  1UA5 A;  1B8X A;  3SWL A;  1GSQ A;  4DSS B;  5D73 A;  4E8H A;  5GZZ B;  1V40 A;  5HR1 A;  5J4U A;  3CMI A;  2PPT A;  3TKS C;  2F3M A;  4KE3 A;  4NV5 A;  2XPE A;  1LU4 A;  4IP6 A;  3KEB A;  1K0N A;  1R5A A;  3FRC A;  5AIS A;  4J56 E;  2C0F A;  5G31 A;  5IM9 A;  3GH6 A;  2DBC A;  3BCI A;  2VL9 A;  4I2T A;  1VGL A;  1JZR A;  4HI7 A;  4EUY A;  1TRS A;  3CXG A;  3O76 A;  2CX4 A;  1T4Z A;  2MMZ A;  3GA4 A;  4XS4 A;  2VL3 A;  3LSZ A;  3GHA A;  3V1W A;  3GKK A;  1UVZ A;  4K1F A;  5ECS A;  4K7O A;  2YWO A;  1YF1 A;  1JZO A;  1T00 A;  2RUF A;  2LRN A;  3TOT A;  2EIO A;  3IK9 A;  4F9Z A;  4MF7 A;  2BTO T;  3PPU A;  2YWI A;  2VO4 A;  4RQX A;  4FYU A;  2CQ9 A;  1EOH A;  3F6F A;  1J0F A;  1OKD A;  4YKG A;  5IMC A;  3QR6 A;  1GSE A;  3MAK A;  5A4U A;  4X0X A;  5A5K A;  4OD7 A;  5LCZ A;  1QFN A;  4Z7X A;  3DYR A;  2L6C A;  2MMO A;  2HLS A;  3GUR A;  4Z2T A;  5EL8 A;  4ZL8 A;  3DML A;  2L5L A;  2JU5 A;  3TB2 A;  4MPF A;  2H66 A;  2H30 A;  1TRV A;  1X9W B;  4HEA 2;  5KOW A;  4OCE A;  1B4Q A;  2CVB A;  4LLR A;  5IMA A;  1XW5 A;  1XBS A;  1GRX A;  3IA1 A;  2HRK A;  19GS A;  1RW1 A;  4O7H A;  5IMZ A;  3E0U A;  1FVK A;  4IGJ A;  2IMF A;  2PWJ A;  4PTS A;  4ISD A;  5IMF A;  2H6Y A;  1TTZ A;  2OBI A;  3ZRE A;  4NWY A;  1XWC A;  3IR4 A;  4JBB A;  6GSS A;  3MNG A;  4EO3 A;  1K0M A;  4RQR A;  1F37 A;  1PX6 A;  2IMI A;  2I9H A;  2DJ1 A;  2HZF A;  5HFG A;  3UAR A;  4POB A;  1MTC A;  3F0I A;  2B7K A;  4PGT A;  4I6X A;  3LXZ A;  1M9A A;  4KB3 A;  20GS A;  1QGV A;  3GRX A;  4IKH A;  1FG4 A;  3A2V A;  3QFA C;  2AUV A;  2K18 A;  4EDY A;  2GTU A;  2FCH A;  3UVT A;  1GUM A;  3C7M A;  4BVX B;  1XWG A;  1Q98 A;  1THO A;  1SL0 B;  5HFI A;  2R37 A;  2IJY A;  3TKP A;  3S9F A;  1A8Y A;  4L0W A;  1IYI A;  1XW6 A;  3VWV A;  5H5R A;  2X8H A;  3HZ8 A;  3IV4 A;  4WF4 A;  5HR0 A;  1KTE A;  3HZ4 A;  2PGT A;  5IO0 A;  2YJH A;  5J3R A;  4POK A;  3UBK A;  5EY6 A;  1KBN A;  1KNG A;  1O85 A;  4LA1 A;  2F8A A;  4O32 A;  3ZIJ A;  1ZL9 A;  3C8E A;  3LYK A;  1XPV A;  1YZX A;  3Q6O A;  4V2L A;  4KW6 A;  2LST A;  2HZE A;  2OE0 A;  4XIH A;  5DAL B;  5CRG A;  3KMO A;  3KTL A;  5COH A;  2R0G A;  3W6G A;  1FVJ A;  4PQ1 A;  3GKM A;  4N0V A;  3UOM A;  4I5Q A;  3TRX A;  5D9X A;  3GFK A;  1M2D A;  4PUA A;  5KOX A;  3HJM A;  3LW9 A;  2AAW A;  17GS A;  4IP1 A;  4JED A;  4NHZ A;  3ME7 A;  5B6M A;  1B9X C;  2FLS A;  2IPA A;  1A0R P;  4ILF A;  4KUN A;  1QUW A;  1SYX A;  3C71 A;  3M1G A;  2C0D A;  1OC9 A;  2V32 A;  1GTU A;  1A0F A;  2F51 A;  1YEX A;  2NVL A;  4GTU A;  4G19 A;  2OE1 A;  3KTB A;  2A4V A;  4OFT A;  4O5Q A;  1FHE A;  1HNC A;  2D2Z A;  4TR1 A;  4L5O A;  4WEY A;  4ZB6 A;  4KSM A;  1W4V A;  2YPM A;  3GNJ A;  1ERW A;  5ID2 B;  2I1U A;  4GSS A;  2XPD A;  2JAD A;  3ED3 A;  2FA8 A;  4TR0 A;  2Z9S A;  3TJG A;  3MWH A;  1X5D A;  3WT2 A;  2H0G A;  2IMK A;  1OKT A;  1G7E A;  4HQZ A;  5F0G A;  4O5R A;  3ZYW A;  3ZVJ A;  1O7U A;  1GTB A;  3GTU A;  3VI7 A;  4XCS A;  3UEM A;  3L9U A;  4N11 A;  1PD2 1;  1SD8 A;  3Q74 A;  2KP1 A;  2CT6 A;  4JU5 A;  1PL1 A;  1PKW A;  3R3E A;  3WGD A;  2C0E A;  3D4M A;  4G0I A;  1GSU A;  3EU3 A;  3L9S A;  1TK8 B;  3FKF A;  3PH9 A;  1FOH A;  2GZY A;  1TP9 A;  1AQX A;  2H0H A;  2H01 A;  1XVW A;  2HXK A;  3TJK A;  4TXO B;  2L4C A;  1ACV A;  2GGT A;  3QPM A;  2IMD A;  2HYX A;  1EEM A;  2XBQ A;  5A4W A;  5CRD A;  3KD0 A;  2KUC A;  4HZ4 A;  4XS1 A;  3FZA A;  1K0O A;  2HE3 A;  3KXO A;  5JWO B;  2FD3 A;  1XFL A;  4RI7 A;  2VM2 A;  2GST A;  1OC3 A;  3HKR A;  3EYT A;  3C73 A;  4OFN A;  3TUE A;  1XOB A;  2NDO A;  2O87 A;  4CW9 A;  2JL4 A;  5CP1 A;  8GSS A;  3ZVJ D;  5DCH A;  4ZBA A;  5DJM A;  1QXH A;  3FZ5 A;  2LQQ A;  2X49 A;  3IXR A;  3KCM A;  3QAG A;  1T7P B;  1MEK A;  3HYP A;  3EIN A;  3VI5 A;  2H6X A;  1FAA A;  3IDV A;  2H74 A;  4PUF C;  4K2X A;  4K7I A;  5G30 A;  1GNW A;  2H75 A;  4FIW A;  2OAC A;  2WFC A;  3M3M A;  3EU4 A;  2G2Q A;  3BBY A;  3TKR A;  1JZD A;  2AV4 A;  3HJP A;  4ECJ A;  2EIR A;  4F03 A;  3Q18 A;  2KLX A;  2GSR A;  5L71 A;  2GS3 A;  1MDK A;  1GSY A;  1J08 A;  1AC1 A;  2R2J A;  3HVN A;  2FUG 2;  2RII A;  4BL7 A;  4KDU A;  4WET A;  2E2M A;  4KF9 A;  3VFI A;  4YQU A;  4MPG A;  2NBS A;  2VLU A;  3TGZ A;  5IMD A;  1FW1 A;  1S3A A;  5A4V A;  3FMW A;  5CYY A;  2HRA A;  5BMU A;  1ABA A;  2A2R A;  3EE2 A;  2P0G A;  1PSQ A;  2YP6 A;  1U3A A;  1Z5Y E;  4ZL7 A;  1FB6 A;  4I8B A;  5H5S A;  3F4T A;  3D21 A;  2DC5 A;  3H4K A;  5G2Z A;  3K8N A;  1GTI A;  2K8V A;  6GSY A;  2YV7 A;  4X1U A;  1F6M C;  18GS A;  2MMN A;  3TKS E;  1PX7 A;  2B3S A;  3CTF A;  5CRE A;  1VF3 A;  2JZS A;  4WKW A;  4ECC A;  2E2G A;  4MP4 A;  5ECP B;  5IOW A;  1SL1 B;  3GN3 A;  2GT5 A;  1R4W A;  5DAK A;  5G1L A;  3I69 A;  1B9Y C;  2DJJ A;  1NW2 A;  1C72 A;  1ZYE A;  4ZBB A;  4G2E A;  3IC4 A;  3WGX A;  1SKR B;  4AJ7 A;  1K3L A;  4WBR D;  3J7Y k;  4GQF A;  1B4P A;  1USB A;  2QSI A;  4GRF A;  2OBK A;  3FEU A;  4K7N A;  4HUA A;  2R0C A;  1YQ1 A;  2V6O A;  3CSI A;  4GCI A;  4G9H A;  4V2M A;  5GST A;  2IFQ B;  1ZOF A;  2ZNM A;  1E6B A;  2NPB A;  2CZ3 A;  1X9M B;  4KA0 A;  4TOP A;  2ALB A;  3EUR A;  2N5B A;  4NAX A;  1MDJ A;  5GAP D;  1Z6M A;  2VL2 C;  1OAZ A;  4V2N A;  3IK7 A;  3GKX A;  2B1L A;  3APO A;  4TN8 A;  3E3E A;  1EV4 A;  4K8M A;  3KP9 A;  2CX3 A;  1BX9 A;  4ML6 A;  1LBK A;  1V2A A;  2OJL A;  2JSZ A;  3HD5 A;  2DJ3 A;  2RUE A;  4G0L A;  4WXT A;  2TRX A;  4E8E A;  5KN2 A;  3P90 A;  1GLP A;  2I4A A;  2H8L A;  2VCQ A;  3D22 A;  5FT3 A;  2LTK A;  2YV9 A;  3BCK A;  1O8X A;  3ZFL A;  2HI7 A;  5J9C A;  4USS A;  3LQ7 A;  4MCU A;  3TJB A;  3IHG A;  4MZC A;  3GV1 A;  3DXB A;  4K0N A;  5IPG A;  3ERF A;  2H0I A;  1O8W A;  2CA8 A;  1TRU A;  2WDU A;  2JZR A;  3KH9 A;  1HD2 A;  1O81 A;  2MBS A;  2X8C A;  4X43 A;  4A5P A;  3H1N A;  4HU9 A;  2PMT A;  4MZW A;  4F0C A;  2LJR A;  4HSC X;  3G9B A;  3OR5 A;  3VUR A;  3O6T A;  3L9V A;  1W89 A;  1T8E B;  2DKI A;  4ECI A;  5DBQ A;  4N0Z A;  1ZYP A;  1M0U A;  1SJ6 A;  5CAX A;  2V2G A;  4XS4 B;  2M46 A;  4KDY A;  2I81 A;  3HY2 A;  2VCZ A;  3ZIT A;  2LRT A;  3QDN A;  4BVY A;  2OAD A;  4OO5 A;  1QMV A;  2G0F A;  2PVQ A;  1V58 A;  2N5A A;  4Q5Q A;  4TR4 A;  3A5W A;  4POM A;  3NOF A;  4P3Y B;  2C8U A;  1Q4J A;  1GUK A;  2YNX A;  3QD9 A;  2PUK C;  4L8E A;  1YEP A;  2DKH A;  1Y6E A;  2EC4 A;  3ME8 A;  2L4Q A;  3GX8 A;  3GL5 A;  22GS A;  2FWG A;  3L0H A;  2ZCT A;  2HSY A;  1UN2 A;  2FWH A;  1YF0 A;  4MJC A;  4TW5 A;  3RHB A;  5JCW A;  3BJ5 A;  2LNT A;  3WT1 A;  1R7H A;  5G1K A;  3F3Q A;  4LMW A;  1ON4 A;  5D93 A;  1TJD A;  4RUV A;  2H73 A;  3LOR A;  1EGR A;  2EIQ A;  2V1M A;  4ZB8 A;  2LEG A;  3QAV A;  1WRY A;  3UMA A;  2VD1 A;  4MJE A;  3VPT A;  3W8J A;  2WGR A;  3CBU A;  3ZL5 A;  4YKF A;  4X4J A;  4ZXG A;  3VWW A;  3GL3 A;  3O3T A;  1M9B A;  5ECQ B;  4N30 A;  3GMF A;  4L0U A;  3P2A A;  1XWK A;  5IOX A;  4POL A;  1A23 A;  1R5P A;  5JWQ B;  2F8F A;  2YWN A;  4BA7 A;  4IBP A;  4NMU A;  1VF1 A;  1BJX A;  2R0P A;  1VF2 A;  4JR6 A;  16GS A;  3FZ9 A;  2IN3 A;  3L78 A;  3RPP A;  1M3I A;  4FQU A;  3NZN A;  4EL1 A;  3DD3 A;  3FK8 A;  2L57 A;  2C3Q A;  2JAC A;  1LJR A;  1ML6 A;  3F9U A;  1GSS A;  3M9J A;  3ZRD A;  2C1Y A;  1TI1 A;  4GXZ A;  5JCU A;  2ZUP A;  1WOU A;  5AIV A;  2L5O A;  1ST9 A;  1Z9H A;  1EZK A;  2L6D A;  1WP0 A;  4ZL9 A;  2GLR A;  1K3Y A;  5IQY A;  4JRR A;  2R4V A;  4MF5 A;  1YKA A;  4BWQ A;  14GS A;  5LD0 A;  2HZE B;  1URM A;  3EVI A;  5B7C A;  2A2S A;  1NM3 A;  5ECR B;  1M2B A;  4G10 A;  4MJB A;  2PN8 A;  1CQH A;  1ZZY A;  5ECN B;  4D73 A;  2M72 A;  1ZYQ B;  3H8Q A;  1TK5 B;  4MMM A;  5ELG A;  3U5R E;  2VCV A;  2B6M A;  1DE2 A;  3ERG A;  3U6V A;  1EP7 A;  3TJF A;  3EC3 A;  4IW9 A;  5AGY A;  4XHM A;  3IBH A;  4EF0 A;  4HS1 A;  4H86 A;  3WD6 A;  2WRT A;  3E9J B;  2LKU A;  4MDC A;  4TXV A;  1SJI A;  1G7O A;  1AQV A;  4MK3 A;  1OC9 B;  5F06 A;  7GSS A;  2L59 A;  4CHS A;  1HYU A;  3RAZ A;  4HJM A;  1EOG A;  3UAP A;  4JR4 A;  1TK0 B;  3RHC A;  2HRF A;  5JCG A;  2O89 A;  3IE3 A;  2R3X A;  2OA7 A;  1E2Y A;  3TKQ A;  2LRC A;  2C3T A;  4TR1 B;  3G7I A;  5D9W A;  5FHI A;  4KND A;  4Q5R A;  1SKS B;  5ECK B;  3FHK A;  1A2L A;  3FZ4 A;  3LG6 A;  1K0B A;  2X4A A;  2YWM A;  1A2M A;  3ZLP A;  1I9D A;  1XW9 A;  4HQS A;  2LS5 A;  2TRC P;  4BPY A;  1M99 A;  1QK8 A;  3FR3 A;  2VM1 A;  2HNL A;  2CAI A;  1KEB A;  1RK4 A;  2REM A;  1ZGN A;  3EMP A;  4FH8 A;  1VF4 A;  2J9H A;  3KGK A;  3F63 A;  1SK2 A;  5E4W A;  2PER A;  3GSS A;  3GYK A;  4K2D A;  2H1D A;  3GTU B;  4NV2 A;  3M8N A;  2YZU A;  2K8S A;  4FYB A;  4WF5 A;  4YAP A;  1U88 A;  3IHQ A;  2UZ8 A;  1U87 A;  4KCE A;  3H79 A;  2DIZ A;  3EPT A;  12GS A;  3QFB C;  3DIE A;  4PUR A;  4QL9 A;  2PU9 C;  1DBY A;  2VLT A;  1DSB A;  1CQG A;  5EPF A;  3TRQ A;  2B5X A;  5ELA A;  5H5Q A;  5ECI B;  1Y25 A;  3KH7 A;  2QA2 A;  4F0B A;  2VIM A;  1GP1 A;  2H1A A;  1YDK A;  2F9S A;  3CSJ A;  2YZH A;  3F3R A;  2XHF A;  4MJA A;  4YAV A;  3LWA A;  11GS A;  2MYG A;  2B7J A;  1X9S B;  1I5G A;  4IN0 A;  4OFM A;  3GX0 A;  5GAN D;  3HVV A;  4F82 A;  4Z2R A;  1PGT A;  3H93 A;  1WMJ A;  5C04 A;  3D6I A;  3J7Y b;  2RM6 A;  2HSH A;  5B6N A;  4TVE A;  1AQW A;  1UC7 A;  4IQA A;  1A2J A;  3MIX A;  1PRX A;  2WUL A;  4J57 E;  3G7J A;  3M9K A;  2O7K A;  4KX4 A;  1JZW A;  13GS A;  1GSD A;  3F6D A;  2GT6 A;  4WR4 A;  5ECH B;  4TR3 A;  3KP8 A;  4PXO A;  4DSS A;  2PBJ A;  2CAQ A;  3US3 A;  2KOK A;  3VWX A;  1HQO A;  4XS6 A;  1OVN A;  2M80 A;  2FHE A;  5CNW A;  2QKE A;  4OWY A;  4OMV A;  5HFK A;  3CRT A;  4JZQ A;  1X5C A;  2CVD A;  4GSN A;  3UIW A;  2CVK A;  2KHP A;  3TOU A;  1ILO A;  1AXD A;  1X0R A;  1JLW A;  4V1A p;  2IL3 A;  5DJL A;  4BL7 B;  5D8I A;  1EWX A;  4GQC A;  2RLI A;  1ERT A;  1YY7 A;  1TDI A;  2YOI A;  4PNF A;  2P5Q A;  3MSZ A;  2FNO A;  4EXJ A;  4ECB A;  5CRH A;  4KGI A;  3DKS A;  2N5F A;  1M7T A;  1GNE A;  1PL2 A;  2WZ9 A;  3G7Y A;  3CRU A;  2DJ0 A;  1ZCP A;  1SYR A;  3W8S A;  5E59 A;  1GWC A;  2GQL A;  4HZ2 A;  4OCF A;  4ML1 A;  1XWA A;  2BJX A;  2LV3 A;  4ZBD A;  4EDZ A;  3GH9 A;  1SEN A;  2JZT A;  2DLX A;  1Z6N A;  1MD4 A;  4BWS A;  1PKZ A;  3EMX A;  1JFU A;  3GIX A;  3ZZX A;  2DJ2 A;  5DAK B;  4MA9 A;  3RDW A;  3HJO A;  3L4N A;  1WPI A;  1PMT A;  3C1S A;  1OC8 A;  2FA4 A;  5IMV A;  1GUH A;  4MLY A;  1XCC A;  1B48 A;  1EEJ A;  4KCA A;  1DE1 A;  5J41 A;  1SK0 A;  4IJ3 A;  5INY A;  2IWT A;  2K9F A;  2HSM A;  3P7X A;  1T3B A;  3FYG A;  3DGQ A;  2H71 A;  1RQM A;  2QGV A;  4ZIJ A;  3VK9 A;  4LMV A;  3IPZ A;  4PNG A;  3TJJ A;  1VRS D;  2X64 A;  2C0G A;  3F4S A;  3WYW A;  5HR3 A;  3AY8 A;  2H1G A;  3D5J A;  3UL3 A;  2VOC A;  4XRA A;  1DUG A;  5JWR B;  2C4J A;  1U6T A;  4DSQ A;  1NSW A;  4N10 A;  3EWL A;  3ZTL A;  4HJ2 A;  3LYP A;  4CDO A;  2VCT A;  2ES7 A;  2AJQ B;  1XZO A;  4FO5 A;  5IIZ A;  4YQM A;  4BVX A;  2PVO C;  5EVO A;  3FY7 A;  2A4H A;  3GKN A;  4YH2 A;  1JLV A;  3PR8 A;  3M0F A;  4IJI A;  2DML A;  2MBT A;  1SKW B;  5KN3 A;  2GSS A;  2VCX A;  2ON7 A;  3PGT A;  4O5U A;  2H6Z A;  2GZP A;  4EKZ A;  4EVM A;  3F4R A;  1S3R A;  6GSX A;  4HU7 A;  2TIR A;  1S3C A;  1F3B A;  2KP2 A;  1G0T A;  1SD9 A;  5B8B A;  1N8J A;  2IME A;  4AJ8 A;  5DAL A;  2DIY A;  3C1R A;  1QQ2 A;  1R26 A;  4Q5N A;  4I2U A;  2AHE A;  3ZFB A;  1AUC A;  4RI6 A;  5ENU A;  3A2X A;  5G5E A;  4AGS A;  4CY6 A;  1TI3 A;  3IC8 A;  4KH7 A;  5KN1 A;  4OO4 A;  3TDG A;  3CSH A;  3HCZ A;  5FWG A;  1WJK A;  4CY8 A;  1SJZ A;  1A24 A;  1EV9 A;  1K0A A;  1XOA A;  1BYE A;  4DSR A;  1XIY A;  2VCW A;  4MZB A;  1FO5 A;  3IAS 2;  2QC7 A;  2FWE A;  1T1V A;  5IO2 A;  4K5S A;  3TCO A;  5ECL B;  1M3J A;  1XWB A;  5J5N A;  1S3D A;  1AW9 A;  3LGC A;  3TRP A;  1WE0 A;  1M2A A;  4IQ1 A;  3IRA A;  4FYC A;  1ERV A;  4MNN A;  5DQY A;  4BVY B;  5D9T A;  4ID0 A;  4ICY A;  4PQH A;  3HVX A;  4L5L A;  1OYJ A;  5DQS A;  1TRW A;  5ID2 A;  1PQN A;  4TKY A;  3GST A;  5J9B A;  1FB0 A;  1ZYN A;  2E7P A;  1XXU A;  4ZB9 A;  4PQI A;  3UBL A;  3KIJ A;  2B5Y A;  1PA3 A;  5F05 A;  4IEL A;  1Z7R A;  4WBJ A;  2H70 A;  2FY6 A;  4I97 A;  4LL1 B;  3VWU A;  2R6K A;  3HDC A;  4JE1 A;  4LL4 B;  3APS A;  1NHO A;  4HDE A;  3MYD A;  5D96 A;  3N5O A;  2B5E A;  4QL7 A;  2GQM A;  3I6A A;  4GF0 A;  5D9V A;  3HVS A;  1AAZ A;  3RBT A;  3N9J A;  2GDR A;  2IIY A;  4AJ6 A;  1V98 A;  3I43 A;  2DJK A;  2WJU A;  2X99 A;  3A5I A;  4XRD A;  4MF6 A;  2HT9 A;  1Z3E A;  1GTA A;  4K6X A;  4TXO A;  4AF2 A;  2C3N A;  2YCD A;  1H4O A;  2CZ2 A;  2OKA A;  5B8A A;  1U3I A;  3DVX A;  3ZML A;  3UVH A;  3FR6 A;  5DDL A;  3LXT A;  3CYN A; 
#chains in the Genus database with same CATH homology
 3NIV A;  4K0G A;  1GH2 A;  1G6Y A;  5HQP A;  1ERU A;  5CO3 A;  3IOS A;  2GZZ A;  4NPB A;  2BMX A;  1BED A;  1BQ7 A;  2VAF A;  2O85 A;  2H19 A;  5IPH A;  3MDK A;  1SL2 B;  3A2W A;  4KSO A;  1J9B A;  1N2A A;  2AYT A;  3A3T A;  1MDI A;  1IYH A;  4Z2U A;  4QQ7 A;  2RM5 A;  3APQ A;  4ACS A;  5ECO B;  4G0K A;  1GL8 A;  4DVC A;  2WCI A;  1T4Y A;  4K9Z A;  1F3A A;  5G5F A;  3P8W A;  3QCP A;  2R5G A;  4XTS A;  3LJR A;  2K6V A;  4DEJ A;  5C00 A;  3SBC A;  1HNA A;  3I9V 2;  3QMX A;  3DEX A;  1H75 A;  3ISO A;  3R2Q A;  1GSF A;  2I3Y A;  3DRN A;  4F2I A;  4YQV A;  3KZQ A;  2LUS A;  2O8V B;  5DVB A;  2HRN A;  5F8B A;  4GLT A;  3LFL A;  4O92 A;  3WGE A;  3F8U A;  2V41 A;  3Q19 A;  2QA1 A;  2LJA A;  3VLN A;  2C80 A;  3BOA A;  1EGO A;  2LNS A;  4D73 B;  1TW9 A;  5AIX A;  4MH2 A;  4IVF A;  3HA9 A;  1FOV A;  4KDX A;  4NHW A;  2LJK A;  1OE8 A;  2WB9 A;  3PIN A;  3DVW A;  1TU7 A;  3KMN A;  1A8L A;  1K0D A;  4KAE A;  1TKD B;  3QAW A;  4TRX A;  4EIQ A;  2GSQ A;  1PN9 A;  4HOJ A;  2GQK A;  1XVQ A;  1K0C A;  2DMM A;  2GVP A;  5KEJ A;  2XC2 A;  5AN1 A;  3ZIV A;  3IAM 2;  1V9W A;  2DSA A;  3ZMK A;  2LQO A;  1JHB A;  3JCM L;  1V57 A;  5LNK e;  1O73 A;  4V1A g;  4K5R A;  5ECM B;  2J23 A;  6GST A;  1SK1 A;  4IS0 A;  3D4T A;  1O6J A;  2A2P A;  5GSS A;  5KN0 A;  4EC0 A;  1GUL A;  1YJ6 A;  2CV4 A;  1AIU A;  2AB6 A;  3D0Z A;  3CTG A;  2E0Q A;  1GLQ A;  1WWJ A;  2VL2 A;  3TKS A;  2P31 A;  4EIP A;  1F2E A;  1OE7 A;  2YAN A;  1ZMA A;  4IHU A;  1K3O A;  6GSW A;  3GUS A;  2YJ7 A;  4WR5 A;  2YN1 A;  3RPN A;  4GST A;  3FR9 A;  1EP8 A;  1SU9 A;  3DWV A;  2IFQ A;  1TU8 A;  3KM6 A;  3UJ1 A;  1MD3 A;  2H72 A;  2HFD A;  2X8G A;  3VPQ A;  5ABR A;  2OE3 A;  2H76 A;  3LEF A;  2FGX A;  1TOF A;  2VD0 A;  9GSS A;  2P5R A;  3ERW A;  1G6W A;  1Z7P A;  2H1B A;  2VUP A;  1TXX A;  2XBI A;  3HXS A;  4EE0 A;  3QOU A;  4NXI A;  6GSV A;  2JSY A;  2MZC A;  3KJY A;  1BG5 A;  1YKC A;  4ZIL A;  2V6K A;  5F07 A;  10GS A;  1X5E A;  4MH3 A;  4GWR A;  3BD2 A;  2ON5 A;  5CRW A;  1PN0 A;  1F9M A;  2NTO A;  2VLV A;  1HNB A;  3FW2 A;  2FWF A;  2WS2 A;  4PX1 A;  5HR2 A;  4Q5F A;  1BAY A;  5BRT A;  1WIK A;  5DCG A;  4J2F A;  6GSU A;  1THX A;  2B1K A;  4MAB A;  2MMA A;  1NHY A;  3HHV A;  4ULX A;  1UA5 A;  1B8X A;  3SWL A;  1GSQ A;  4DSS B;  5D73 A;  4E8H A;  5GZZ B;  1V40 A;  5HR1 A;  5J4U A;  3CMI A;  2PPT A;  3TKS C;  2F3M A;  4KE3 A;  4NV5 A;  2XPE A;  1LU4 A;  4IP6 A;  3KEB A;  1K0N A;  1R5A A;  3FRC A;  5AIS A;  4J56 E;  2C0F A;  5G31 A;  5IM9 A;  3GH6 A;  2DBC A;  3BCI A;  2VL9 A;  4I2T A;  1VGL A;  1JZR A;  4HI7 A;  4EUY A;  1TRS A;  3CXG A;  3O76 A;  2CX4 A;  1T4Z A;  2MMZ A;  3GA4 A;  4XS4 A;  2VL3 A;  3LSZ A;  3GHA A;  3V1W A;  3GKK A;  1UVZ A;  4K1F A;  5ECS A;  4K7O A;  2YWO A;  1YF1 A;  1JZO A;  1T00 A;  2RUF A;  2LRN A;  3TOT A;  2EIO A;  3IK9 A;  4F9Z A;  4MF7 A;  2BTO T;  3PPU A;  2YWI A;  2VO4 A;  4RQX A;  4FYU A;  2CQ9 A;  1EOH A;  3F6F A;  1J0F A;  1OKD A;  4YKG A;  5IMC A;  3QR6 A;  1GSE A;  3MAK A;  5A4U A;  4X0X A;  5A5K A;  4OD7 A;  5LCZ A;  1QFN A;  4Z7X A;  3DYR A;  2L6C A;  2MMO A;  2HLS A;  3GUR A;  4Z2T A;  5EL8 A;  4ZL8 A;  3DML A;  2L5L A;  2JU5 A;  3TB2 A;  4MPF A;  2H66 A;  2H30 A;  1TRV A;  1X9W B;  4HEA 2;  5KOW A;  4OCE A;  1B4Q A;  2CVB A;  4LLR A;  5IMA A;  1XW5 A;  1XBS A;  1GRX A;  3IA1 A;  2HRK A;  19GS A;  1RW1 A;  4O7H A;  5IMZ A;  3E0U A;  1FVK A;  4IGJ A;  2IMF A;  2PWJ A;  4PTS A;  4ISD A;  5IMF A;  2H6Y A;  1TTZ A;  2OBI A;  3ZRE A;  4NWY A;  1XWC A;  3IR4 A;  4JBB A;  6GSS A;  3MNG A;  4EO3 A;  1K0M A;  4RQR A;  1F37 A;  1PX6 A;  2IMI A;  2I9H A;  2DJ1 A;  2HZF A;  5HFG A;  3UAR A;  4POB A;  1MTC A;  3F0I A;  2B7K A;  4PGT A;  4I6X A;  3LXZ A;  1M9A A;  4KB3 A;  20GS A;  1QGV A;  3GRX A;  4IKH A;  1FG4 A;  3A2V A;  3QFA C;  2AUV A;  2K18 A;  4EDY A;  2GTU A;  2FCH A;  3UVT A;  1GUM A;  3C7M A;  4BVX B;  1XWG A;  1Q98 A;  1THO A;  1SL0 B;  5HFI A;  2R37 A;  2IJY A;  3TKP A;  3S9F A;  1A8Y A;  4L0W A;  1IYI A;  1XW6 A;  3VWV A;  5H5R A;  2X8H A;  3HZ8 A;  3IV4 A;  4WF4 A;  5HR0 A;  1KTE A;  3HZ4 A;  2PGT A;  5IO0 A;  2YJH A;  5J3R A;  4POK A;  3UBK A;  5EY6 A;  1KBN A;  1KNG A;  1O85 A;  4LA1 A;  2F8A A;  4O32 A;  3ZIJ A;  1ZL9 A;  3C8E A;  3LYK A;  1XPV A;  1YZX A;  3Q6O A;  4V2L A;  4KW6 A;  2LST A;  2HZE A;  2OE0 A;  4XIH A;  5DAL B;  5CRG A;  3KMO A;  3KTL A;  5COH A;  2R0G A;  3W6G A;  1FVJ A;  4PQ1 A;  3GKM A;  4N0V A;  3UOM A;  4I5Q A;  3TRX A;  5D9X A;  3GFK A;  1M2D A;  4PUA A;  5KOX A;  3HJM A;  3LW9 A;  2AAW A;  17GS A;  4IP1 A;  4JED A;  4NHZ A;  3ME7 A;  5B6M A;  1B9X C;  2FLS A;  2IPA A;  1A0R P;  4ILF A;  4KUN A;  1QUW A;  1SYX A;  3C71 A;  3M1G A;  2C0D A;  1OC9 A;  2V32 A;  1GTU A;  1A0F A;  2F51 A;  1YEX A;  2NVL A;  4GTU A;  4G19 A;  2OE1 A;  3KTB A;  2A4V A;  4OFT A;  4O5Q A;  1FHE A;  1HNC A;  2D2Z A;  4TR1 A;  4L5O A;  4WEY A;  4ZB6 A;  4KSM A;  1W4V A;  2YPM A;  3GNJ A;  1ERW A;  5ID2 B;  2I1U A;  4GSS A;  2XPD A;  2JAD A;  3ED3 A;  2FA8 A;  4TR0 A;  2Z9S A;  3TJG A;  3MWH A;  1X5D A;  3WT2 A;  2H0G A;  2IMK A;  1OKT A;  1G7E A;  4HQZ A;  5F0G A;  4O5R A;  3ZYW A;  3ZVJ A;  1O7U A;  1GTB A;  3GTU A;  3VI7 A;  4XCS A;  3UEM A;  3L9U A;  4N11 A;  1PD2 1;  1SD8 A;  3Q74 A;  2KP1 A;  2CT6 A;  4JU5 A;  1PL1 A;  1PKW A;  3R3E A;  3WGD A;  2C0E A;  3D4M A;  4G0I A;  1GSU A;  3EU3 A;  3L9S A;  1TK8 B;  3FKF A;  3PH9 A;  1FOH A;  2GZY A;  1TP9 A;  1AQX A;  2H0H A;  2H01 A;  1XVW A;  2HXK A;  3TJK A;  4TXO B;  2L4C A;  1ACV A;  2GGT A;  3QPM A;  2IMD A;  2HYX A;  1EEM A;  2XBQ A;  5A4W A;  5CRD A;  3KD0 A;  2KUC A;  4HZ4 A;  4XS1 A;  3FZA A;  1K0O A;  2HE3 A;  3KXO A;  5JWO B;  2FD3 A;  1XFL A;  4RI7 A;  2VM2 A;  2GST A;  1OC3 A;  3HKR A;  3EYT A;  3C73 A;  4OFN A;  3TUE A;  1XOB A;  2NDO A;  2O87 A;  4CW9 A;  2JL4 A;  5CP1 A;  8GSS A;  3ZVJ D;  5DCH A;  4ZBA A;  5DJM A;  1QXH A;  3FZ5 A;  2LQQ A;  2X49 A;  3IXR A;  3KCM A;  3QAG A;  1T7P B;  1MEK A;  3HYP A;  3EIN A;  3VI5 A;  2H6X A;  1FAA A;  3IDV A;  2H74 A;  4PUF C;  4K2X A;  4K7I A;  5G30 A;  1GNW A;  2H75 A;  4FIW A;  2OAC A;  2WFC A;  3M3M A;  3EU4 A;  2G2Q A;  3BBY A;  3TKR A;  1JZD A;  2AV4 A;  3HJP A;  4ECJ A;  2EIR A;  4F03 A;  3Q18 A;  2KLX A;  2GSR A;  5L71 A;  2GS3 A;  1MDK A;  1GSY A;  1J08 A;  1AC1 A;  2R2J A;  2FUG 2;  2RII A;  4BL7 A;  4KDU A;  4WET A;  2E2M A;  4KF9 A;  3VFI A;  4YQU A;  4MPG A;  2NBS A;  2VLU A;  3TGZ A;  5IMD A;  1FW1 A;  1S3A A;  5A4V A;  3FMW A;  5CYY A;  2HRA A;  5BMU A;  1ABA A;  2A2R A;  3EE2 A;  2P0G A;  1PSQ A;  2YP6 A;  1U3A A;  1Z5Y E;  4ZL7 A;  1FB6 A;  4I8B A;  5H5S A;  3F4T A;  3D21 A;  2DC5 A;  3H4K A;  5G2Z A;  3K8N A;  1GTI A;  2K8V A;  6GSY A;  2YV7 A;  4X1U A;  1F6M C;  18GS A;  2MMN A;  3TKS E;  1PX7 A;  2B3S A;  3CTF A;  5CRE A;  1VF3 A;  2JZS A;  4WKW A;  4ECC A;  2E2G A;  4MP4 A;  5ECP B;  5IOW A;  1SL1 B;  3GN3 A;  2GT5 A;  1R4W A;  5DAK A;  5G1L A;  3I69 A;  1B9Y C;  2DJJ A;  1NW2 A;  1C72 A;  1ZYE A;  4ZBB A;  4G2E A;  3IC4 A;  3WGX A;  1SKR B;  4AJ7 A;  1K3L A;  4WBR D;  3J7Y k;  4GQF A;  1B4P A;  1USB A;  2QSI A;  4GRF A;  2OBK A;  3FEU A;  4K7N A;  4HUA A;  2R0C A;  1YQ1 A;  2V6O A;  3CSI A;  4GCI A;  4G9H A;  4V2M A;  5GST A;  2IFQ B;  1ZOF A;  2ZNM A;  1E6B A;  2NPB A;  2CZ3 A;  1X9M B;  4KA0 A;  4TOP A;  2ALB A;  3EUR A;  2N5B A;  4NAX A;  1MDJ A;  5GAP D;  1Z6M A;  2VL2 C;  1OAZ A;  4V2N A;  3IK7 A;  3GKX A;  2B1L A;  3APO A;  4TN8 A;  3E3E A;  1EV4 A;  4K8M A;  3KP9 A;  2CX3 A;  1BX9 A;  4ML6 A;  1LBK A;  1V2A A;  2OJL A;  2JSZ A;  3HD5 A;  2DJ3 A;  2RUE A;  4G0L A;  4WXT A;  2TRX A;  4E8E A;  5KN2 A;  3P90 A;  1GLP A;  2I4A A;  2H8L A;  2VCQ A;  3D22 A;  5FT3 A;  2LTK A;  2YV9 A;  3BCK A;  1O8X A;  3ZFL A;  2HI7 A;  5J9C A;  4USS A;  3LQ7 A;  4MCU A;  3TJB A;  3IHG A;  4MZC A;  3GV1 A;  3DXB A;  4K0N A;  5IPG A;  3ERF A;  2H0I A;  1O8W A;  2CA8 A;  1TRU A;  2WDU A;  2JZR A;  3KH9 A;  1HD2 A;  1O81 A;  2MBS A;  2X8C A;  4X43 A;  4A5P A;  3H1N A;  4HU9 A;  2PMT A;  4MZW A;  4F0C A;  2LJR A;  3G9B A;  3OR5 A;  3VUR A;  3O6T A;  3L9V A;  1W89 A;  1T8E B;  2DKI A;  4ECI A;  5DBQ A;  4N0Z A;  1ZYP A;  1M0U A;  1SJ6 A;  5CAX A;  2V2G A;  4XS4 B;  2M46 A;  4KDY A;  2I81 A;  3HY2 A;  2VCZ A;  3ZIT A;  2LRT A;  3QDN A;  4BVY A;  2OAD A;  4OO5 A;  1QMV A;  2G0F A;  2PVQ A;  1V58 A;  2N5A A;  4Q5Q A;  4TR4 A;  3A5W A;  4POM A;  3NOF A;  4P3Y B;  2C8U A;  1Q4J A;  1GUK A;  2YNX A;  3QD9 A;  2PUK C;  4L8E A;  1YEP A;  2DKH A;  1Y6E A;  2EC4 A;  3ME8 A;  2L4Q A;  3GX8 A;  3GL5 A;  22GS A;  2FWG A;  3L0H A;  2ZCT A;  2HSY A;  1UN2 A;  2FWH A;  1YF0 A;  4MJC A;  4TW5 A;  3RHB A;  5JCW A;  3BJ5 A;  2LNT A;  3WT1 A;  1R7H A;  5G1K A;  3F3Q A;  4LMW A;  1ON4 A;  5D93 A;  1TJD A;  4RUV A;  2H73 A;  3LOR A;  1EGR A;  2EIQ A;  2V1M A;  4ZB8 A;  2LEG A;  3QAV A;  1WRY A;  3UMA A;  2VD1 A;  4MJE A;  3VPT A;  3W8J A;  2WGR A;  3CBU A;  3ZL5 A;  4YKF A;  4X4J A;  4ZXG A;  3VWW A;  3GL3 A;  3O3T A;  1M9B A;  5ECQ B;  4N30 A;  3GMF A;  4L0U A;  3P2A A;  1XWK A;  5IOX A;  4POL A;  1A23 A;  1R5P A;  5JWQ B;  2F8F A;  2YWN A;  4BA7 A;  4IBP A;  4NMU A;  1VF1 A;  1BJX A;  2R0P A;  1VF2 A;  4JR6 A;  16GS A;  3FZ9 A;  2IN3 A;  3L78 A;  3RPP A;  4FQU A;  3NZN A;  4EL1 A;  3DD3 A;  3FK8 A;  2L57 A;  2C3Q A;  2JAC A;  1LJR A;  1ML6 A;  3F9U A;  1GSS A;  3M9J A;  3ZRD A;  2C1Y A;  1TI1 A;  4GXZ A;  5JCU A;  2ZUP A;  1WOU A;  5AIV A;  2L5O A;  1ST9 A;  1Z9H A;  1EZK A;  2L6D A;  1WP0 A;  4ZL9 A;  2GLR A;  1K3Y A;  5IQY A;  4JRR A;  2R4V A;  4MF5 A;  1YKA A;  4BWQ A;  14GS A;  5LD0 A;  2HZE B;  1URM A;  3EVI A;  5B7C A;  2A2S A;  1NM3 A;  5ECR B;  1M2B A;  4G10 A;  4MJB A;  2PN8 A;  1CQH A;  1ZZY A;  5ECN B;  4D73 A;  2M72 A;  1ZYQ B;  3H8Q A;  1TK5 B;  4MMM A;  5ELG A;  3U5R E;  2VCV A;  2B6M A;  1DE2 A;  3ERG A;  3U6V A;  1EP7 A;  3TJF A;  3EC3 A;  4IW9 A;  5AGY A;  4XHM A;  3IBH A;  4EF0 A;  4HS1 A;  4H86 A;  3WD6 A;  2WRT A;  3E9J B;  2LKU A;  4MDC A;  4TXV A;  1SJI A;  1G7O A;  1AQV A;  4MK3 A;  1OC9 B;  5F06 A;  7GSS A;  2L59 A;  4CHS A;  1HYU A;  3RAZ A;  4HJM A;  1EOG A;  3UAP A;  4JR4 A;  1TK0 B;  3RHC A;  2HRF A;  5JCG A;  2O89 A;  3IE3 A;  2R3X A;  2OA7 A;  1E2Y A;  3TKQ A;  2LRC A;  2C3T A;  4TR1 B;  3G7I A;  5D9W A;  5FHI A;  4KND A;  4Q5R A;  1SKS B;  5ECK B;  3FHK A;  1A2L A;  3FZ4 A;  3LG6 A;  1K0B A;  2X4A A;  2YWM A;  1A2M A;  3ZLP A;  1I9D A;  1XW9 A;  4HQS A;  2LS5 A;  2TRC P;  4BPY A;  1M99 A;  1QK8 A;  3FR3 A;  2VM1 A;  2HNL A;  2CAI A;  1KEB A;  1RK4 A;  2REM A;  1ZGN A;  3EMP A;  4FH8 A;  1VF4 A;  2J9H A;  3KGK A;  3F63 A;  1SK2 A;  5E4W A;  2PER A;  3GSS A;  3GYK A;  4K2D A;  2H1D A;  3GTU B;  4NV2 A;  3M8N A;  2YZU A;  2K8S A;  4FYB A;  4WF5 A;  4YAP A;  1U88 A;  3IHQ A;  2UZ8 A;  1U87 A;  4KCE A;  3H79 A;  2DIZ A;  3EPT A;  12GS A;  3QFB C;  3DIE A;  4PUR A;  4QL9 A;  2PU9 C;  1DBY A;  2VLT A;  1DSB A;  1CQG A;  5EPF A;  3TRQ A;  2B5X A;  5ELA A;  5H5Q A;  5ECI B;  1Y25 A;  3KH7 A;  2QA2 A;  4F0B A;  2VIM A;  1GP1 A;  2H1A A;  1YDK A;  2F9S A;  3CSJ A;  2YZH A;  3F3R A;  2XHF A;  4MJA A;  4YAV A;  3LWA A;  11GS A;  2MYG A;  2B7J A;  1X9S B;  1I5G A;  4IN0 A;  4OFM A;  3GX0 A;  5GAN D;  3HVV A;  4F82 A;  4Z2R A;  1PGT A;  3H93 A;  1WMJ A;  5C04 A;  3D6I A;  3J7Y b;  2RM6 A;  2HSH A;  5B6N A;  4TVE A;  1AQW A;  1UC7 A;  4IQA A;  1A2J A;  3MIX A;  1PRX A;  2WUL A;  4J57 E;  3G7J A;  3M9K A;  2O7K A;  4KX4 A;  1JZW A;  13GS A;  1GSD A;  3F6D A;  2GT6 A;  4WR4 A;  5ECH B;  4TR3 A;  3KP8 A;  4PXO A;  4DSS A;  2PBJ A;  2CAQ A;  3US3 A;  2KOK A;  3VWX A;  1HQO A;  4XS6 A;  1OVN A;  2M80 A;  2FHE A;  5CNW A;  2QKE A;  4OWY A;  4OMV A;  5HFK A;  3CRT A;  4JZQ A;  1X5C A;  2CVD A;  4GSN A;  3UIW A;  2CVK A;  2KHP A;  3TOU A;  1ILO A;  1AXD A;  1X0R A;  1JLW A;  4V1A p;  2IL3 A;  5DJL A;  4BL7 B;  5D8I A;  1EWX A;  4GQC A;  2RLI A;  1ERT A;  1YY7 A;  1TDI A;  2YOI A;  4PNF A;  2P5Q A;  3MSZ A;  2FNO A;  4EXJ A;  4ECB A;  5CRH A;  4KGI A;  3DKS A;  2N5F A;  1M7T A;  1GNE A;  1PL2 A;  2WZ9 A;  3G7Y A;  3CRU A;  2DJ0 A;  1ZCP A;  1SYR A;  3W8S A;  5E59 A;  1GWC A;  2GQL A;  4HZ2 A;  4OCF A;  4ML1 A;  1XWA A;  2BJX A;  2LV3 A;  4ZBD A;  4EDZ A;  3GH9 A;  1SEN A;  2JZT A;  2DLX A;  1Z6N A;  1MD4 A;  4BWS A;  1PKZ A;  3EMX A;  1JFU A;  3GIX A;  3ZZX A;  2DJ2 A;  5DAK B;  4MA9 A;  3RDW A;  3HJO A;  3L4N A;  1WPI A;  1PMT A;  3C1S A;  1OC8 A;  2FA4 A;  5IMV A;  1GUH A;  4MLY A;  1XCC A;  1B48 A;  1EEJ A;  4KCA A;  1DE1 A;  5J41 A;  1SK0 A;  4IJ3 A;  5INY A;  2IWT A;  2K9F A;  2HSM A;  3P7X A;  1T3B A;  3FYG A;  3DGQ A;  2H71 A;  1RQM A;  2QGV A;  4ZIJ A;  3VK9 A;  4LMV A;  3IPZ A;  4PNG A;  3TJJ A;  1VRS D;  2X64 A;  2C0G A;  3F4S A;  3WYW A;  5HR3 A;  3AY8 A;  2H1G A;  3D5J A;  3UL3 A;  2VOC A;  4XRA A;  1DUG A;  5JWR B;  2C4J A;  1U6T A;  4DSQ A;  1NSW A;  4N10 A;  3EWL A;  3ZTL A;  4HJ2 A;  3LYP A;  4CDO A;  2VCT A;  2ES7 A;  2AJQ B;  1XZO A;  4FO5 A;  5IIZ A;  4YQM A;  4BVX A;  2PVO C;  5EVO A;  3FY7 A;  2A4H A;  3GKN A;  4YH2 A;  1JLV A;  3PR8 A;  3M0F A;  4IJI A;  2DML A;  2MBT A;  1SKW B;  5KN3 A;  2GSS A;  2VCX A;  2ON7 A;  3PGT A;  4O5U A;  2H6Z A;  2GZP A;  4EKZ A;  4EVM A;  3F4R A;  6GSX A;  4HU7 A;  2TIR A;  1S3C A;  1F3B A;  2KP2 A;  1G0T A;  1SD9 A;  5B8B A;  1N8J A;  2IME A;  4AJ8 A;  5DAL A;  2DIY A;  3C1R A;  1QQ2 A;  1R26 A;  4Q5N A;  4I2U A;  2AHE A;  3ZFB A;  1AUC A;  4RI6 A;  5ENU A;  3A2X A;  5G5E A;  4AGS A;  4CY6 A;  1TI3 A;  3IC8 A;  4KH7 A;  5KN1 A;  4OO4 A;  3TDG A;  3CSH A;  3HCZ A;  5FWG A;  1WJK A;  4CY8 A;  1SJZ A;  1A24 A;  1EV9 A;  1K0A A;  1XOA A;  1BYE A;  4DSR A;  1XIY A;  2VCW A;  4MZB A;  1FO5 A;  3IAS 2;  2QC7 A;  2FWE A;  1T1V A;  5IO2 A;  4K5S A;  3TCO A;  5ECL B;  1XWB A;  5J5N A;  1S3D A;  1AW9 A;  3LGC A;  3TRP A;  1WE0 A;  1M2A A;  4IQ1 A;  3IRA A;  4FYC A;  1ERV A;  4MNN A;  5DQY A;  4BVY B;  5D9T A;  4ID0 A;  4ICY A;  4PQH A;  3HVX A;  4L5L A;  1OYJ A;  5DQS A;  1TRW A;  5ID2 A;  1PQN A;  4TKY A;  3GST A;  5J9B A;  1FB0 A;  1ZYN A;  2E7P A;  1XXU A;  4ZB9 A;  4PQI A;  3UBL A;  3KIJ A;  2B5Y A;  1PA3 A;  5F05 A;  4IEL A;  1Z7R A;  4WBJ A;  2H70 A;  2FY6 A;  4I97 A;  4LL1 B;  3VWU A;  2R6K A;  3HDC A;  4JE1 A;  4LL4 B;  3APS A;  1NHO A;  4HDE A;  3MYD A;  5D96 A;  3N5O A;  2B5E A;  4QL7 A;  2GQM A;  3I6A A;  4GF0 A;  5D9V A;  3HVS A;  1AAZ A;  3RBT A;  3N9J A;  2GDR A;  2IIY A;  4AJ6 A;  1V98 A;  3I43 A;  2DJK A;  2WJU A;  2X99 A;  3A5I A;  4XRD A;  4MF6 A;  2HT9 A;  1Z3E A;  1GTA A;  4K6X A;  4TXO A;  4AF2 A;  2C3N A;  2YCD A;  1H4O A;  2CZ2 A;  2OKA A;  5B8A A;  1U3I A;  3DVX A;  3ZML A;  3UVH A;  3FR6 A;  5DDL A;  3LXT A;  3CYN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...