3CXGA

Crystal structure of plasmodium falciparum thioredoxin, pfi0790w
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
123
structure length
122
Chain Sequence
SGRENLYFQGQSIYIELKNTGSLNQVFSSQNSSIVIKFGAVWCKPCNKIKEYFKNQLNYYYVTLVDIDVDIHPKLNDQHNIKALPTFEFYFNLNNEWVLVHTVEGANQNDIEKAFQKYCLEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Putative thioredoxin
publication title Crystal structure of Plasmodium falciparum thioredoxin, PFI0790w.
rcsb
source organism Plasmodium falciparum
total genus 37
structure length 122
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3cxgA00
3P7XA 1PX7A 2NDOA 3KTLA 3G9BA 2X99A 3TRXA 3UBLA 3H8QA 1IYHA 3ZYWA 4MH3A 2IL3A 2ON7A 1BG5A 3GMFA 5AIXA 4WETA 3TKQA 3RAZA 4ZB6A 5ELGA 4IJ3A 1R26A 1K0MA 5F0GA 1XWAA 3IBHA 5DCGA 4ZL9A 2N5FA 1XW9A 1K0BA 4RQRA 2V6KA 1ZGNA 4HS1A 2FY6A 1BJXA 3D5JA 4N0ZA 2DJ2A 4OD7A 2GZZA 2JACA 1AC1A 3W6GA 4MP4A 2C4JA 4I97A 1KEBA 3DRNA 2YV9A 4POBA 5D8IA 2H75A 2HZEB 4WXTA 1K0DA 2MMZA 2GSQA 1R7HA 3TJKA 2LS5A 4K0GA 1THOA 1XIYA 3QOUA 2I1UA 4V1Ag 3UIWA 1XWCA 4Q5FA 3GX0A 3ME7A 1K0AA 2DJJA 3F63A 5IOWA 4JRRA 4Z7XA 5IPGA 1X9WB 2WCIA 2O7KA 2YPMA 4Q5QA 2BJXA 1V2AA 4K7NA 1SU9A 3I43A 2H1GA 5H5RA 4IVFA 2DJ0A 3LYPA 1YZXA 4J57E 1KTEA 2GS3A 1Z3EA 2IJYA 1PGTA 3UOMA 4K9ZA 12GSA 1K3OA 3QAWA 1PKWA 3HYPA 2DIYA 3VWWA 5ECRB 2F8AA 3LQ7A 4F0BA 1XW6A 1WPIA 1M99A 3AY8A 2ON5A 1VF2A 1GTBA 3GTUA 3HVSA 5FWGA 3GKNA 3UVHA 4PNGA 4KX4A 2CVKA 5G30A 4YQMA 1I5GA 2V6OA 4LL1B 5AIVA 2I9HA 3KEBA 3GYKA 1XVWA 1HQOA 4FH8A 4X0XA 4BWQA 2WULA 3GHAA 3TCOA 3D6IA 1AQXA 2O87A 5ECOB 3EC3A 3IDVA 4DEJA 3F4SA 1TW9A 3CRTA 2RM5A 5J5NA 3HZ4A 4KCAA 2PN8A 3GV1A 2FWFA 4P3YB 5J41A 4IN0A 1FHEA 2PPTA 3C73A 3M0FA 4AJ7A 3NZNA 4POMA 2B5XA 1LJRA 1EEJA 1XCCA 2B1KA 2VCVA 1K3LA 2GVPA 3FYGA 2LTKA 1OC9B 3QD9A 3D4TA 3ZIJA 1A2JA 1GLPA 4O92A 1J9BA 1YF1A 5DQYA 2L57A 2HRNA 4PX1A 2O8VB 3C1SA 5C00A 2LRCA 2PVQA 5ECQB 2R2JA 1E6BA 4JBBA 2E0QA 1NHOA 3IOSA 4H86A 4EXJA 3GSTA 2DJ3A 4L5OA 3ZVJD 5IMFA 4KA0A 2GGTA 2LRTA 3DMLA 1WOUA 1PD21 3RPPA 5F06A 2H73A 4DSSB 2YN1A 3TRQA 2VL3A 3MNGA 3GRXA 3VWUA 4QL9A 1SYXA 2K9FA 4XS6A 2HT9A 2K6VA 6GSVA 3WGEA 2ZUPA 3KH7A 3HVXA 2VM1A 5KN2A 1K3YA 3NIVA 4DVCA 3GFKA 4MK3A 3TUEA 3EMPA 4I6XA 3U5RE 1YY7A 3GL3A 1M2BA 4IW9A 1T4ZA 4KH7A 1GULA 5GSSA 3FZ4A 3N5OA 4TXOB 1FOVA 3HDCA 4JEDA 4HEA2 2WZ9A 2XPEA 3HXSA 2DBCA 2F9SA 5JCGA 2AAWA 2CAIA 1GSEA 3DKSA 3HKRA 4WF5A 3FEUA 5IOXA 2DLXA 2G2QA 5L71A 1Q98A 3KXOA 1PQNA 1A2LA 3M8NA 2ZCTA 5DJLA 1B9XC 1OC9A 4HQZA 1C72A 3KMNA 3FR6A 5ABRA 2YZUA 4NAXA 1G6YA 1A8YA 1SL0B 2H72A 1UC7A 2L6DA 5LNKe 2EIOA 1DSBA 1ERWA 1YJ6A 1NSWA 2MBSA 2B3SA 4NPBA 2JL4A 4F2IA 5C04A 3LORA 1F9MA 4YAPA 3BCIA 3BD2A 4JZQA 2VCTA 4BWSA 4DSRA 4BL7A 2YWIA 3GSSA 2OACA 4HQSA 4OO4A 4N0VA 4DSSA 3FZ5A 2H70A 3HA9A 4MPFA 2FCHA 2VD1A 4FYCA 1AQWA 4EVMA 4MPGA 2M72A 3LFLA 1ST9A 2OE3A 3E0UA 5GAND 3BOAA 3TRPA 3FHKA 1EP8A 5DAKB 4MLYA 4YH2A 2IIYA 3F3QA 1BX9A 4K0NA 2WGRA 1ON4A 1T1VA 2LEGA 1OVNA 2PMTA 2IMIA 4HZ2A 3DWVA 5ID2B 3CBUA 2LNTA 1XVQA 4NV5A 1X5EA 2EIRA 2MMAA 2H74A 3GIXA 1TKDB 4TXOA 1TTZA 3L0HA 1GSUA 3LGCA 2K8VA 3H4KA 2YP6A 5ENUA 1M2DA 1THXA 3KD0A 4HDEA 4KE3A 4WR5A 2YCDA 1WE0A 1RK4A 3HCZA 3M3MA 5HR1A 2EIQA 4PQHA 4QQ7A 1XOAA 4PGTA 4KDYA 3DIEA 5J9CA 4YQUA 1A2MA 4PXOA 5F8BA 1A23A 3FR3A 1PKZA 5ECSA 3APQA 1GUMA 3R2QA 1BQ7A 3LXTA 2R6KA 2BMXA 4TR1A 4AJ6A 3F4TA 3C7MA 3RHCA 1GNEA 5ECPB 6GSTA 1E2YA 5GZZB 3TJFA 3Q19A 2HSHA 1GSQA 3MAKA 1ZZYA 2H19A 1O8XA 5J9BA 1O6JA 2GSSA 3EVIA 3DGQA 5EY6A 2M46A 1JLVA 1S3DA 3CTFA 5DJMA 1XPVA 1GTIA 4HOJA 3EURA 5F05A 2GLRA 1PL1A 4EE0A 3G7YA 3GUSA 3SBCA 1I9DA 2C3QA 1EEMA 2C8UA 5GSTA 1ZOFA 5JWRB 1U3IA 3PGTA 3CXGA 4YQVA 3UMAA 3HZ8A 3EE2A 1AXDA 5E59A 1FB0A 2DMMA 4XCSA 3KIJA 4PQIA 2REMA 4MJEA 4MZBA 1GUHA 1O85A 1G7EA 4Q5RA 5G1KA 1GSSA 4TKYA 2IMEA 3TOTA 4CHSA 5ECLB 2KP1A 1WRYA 4JR4A 3QAVA 5G1LA 11GSA 3TJBA 1TU7A 2VCXA 2YJ7A 3F3RA 4IHUA 5DDLA 1H75A 4OO5A 4LMVA 1H4OA 2AUVA 2OKAA 4K2DA 5D9VA 3EMXA 1FB6A 1PA3A 5CP1A 1TK8B 4EO3A 6GSUA 4RUVA 5KN3A 4N30A 3OR5A 3GTUB 5JWOB 3LEFA 1QFNA 1Z7PA 4OFMA 5F07A 2C3TA 3UL3A 2RUEA 1YKAA 4HI7A 1FG4A 3PH9A 5H5QA 4YAVA 2LKUA 2FUG2 2QC7A 5IQYA 1Z7RA 1X9MB 1GSDA 4IBPA 2L5LA 2P0GA 2LJAA 5KEJA 1QXHA 1GUKA 4XS4A 3HJOA 4KNDA 2R37A 3LYKA 4L5LA 5ECNB 2ALBA 2PWJA 3MWHA 2PGTA 1ABAA 2YWOA 4AJ8A 2B7JA 4J56E 5EL8A 5DALB 2MBTA 3GL5A 1JZOA 3VFIA 2L5OA 4XTSA 2GDRA 3KP9A 2C0GA 2DJ1A 5B6NA 3EINA 1AQVA 4HZ4A 1TXXA 1BAYA 2FGXA 3QMXA 1V58A 1BYEA 4XRAA 1XBSA 4TR4A 3FW2A 1B48A 5HFIA 4F0CA 4GQFA 4MABA 3MDKA 3A3TA 4OCEA 5AN1A 1UN2A 2N5AA 4FYBA 2ES7A 2L6CA 5B8AA 3CRUA 2NVLA 4HU9A 1TI3A 1N2AA 3D22A 1X0RA 3ZMKA 5DCHA 2H66A 4GSSA 1DBYA 1M7TA 2I81A 1XWBA 1JZRA 6GSWA 2PVOC 1TU8A 5B8BA 4BVYA 2VUPA 3QFBC 4NWYA 2O89A 1WWJA 3EYTA 5CO3A 2VO4A 14GSA 3ISOA 5J4UA 3BJ5A 3I6AA 1JZWA 4ACSA 1KBNA 3H79A 3ZVJA 4LMWA 1HNCA 2LUSA 2RLIA 1ML6A 4GCIA 2V2GA 2P5RA 22GSA 1XWGA 5CRGA 4POKA 2GQLA 3D0ZA 4MJAA 4K6XA 1EV4A 3CSHA 3LJRA 3A2VA 4MF6A 2H0HA 2AHEA 5DALA 2DC5A 4N11A 1O7UA 3BCKA 1GNWA 1HD2A 1YDKA 3MSZA 1GH2A 1PSQA 3TKPA 3DVWA 4JE1A 2IN3A 2XC2A 4MF5A 3JCML 2HZFA 1YQ1A 2GQKA 1QQ2A 3IR4A 4GF0A 3GH9A 4XS1A 4O32A 5IMAA 2C0EA 4HJMA 2CZ2A 4ML1A 4PNFA 2F8FA 4V1Ap 1SL2B 1F3BA 4CDOA 3L9SA 3TKRA 1T8EB 2HLSA 2H1DA 4EKZA 4Q5NA 3FRCA 4EUYA 1JFUA 1SD9A 2B6MA 2CQ9A 3Q74A 5D96A 3WT2A 5AISA 2FWHA 3M1GA 1R5PA 1MD3A 2JSZA 3WD6A 1F37A 2H1AA 2RUFA 3IK9A 4RI7A 2I4AA 5HFGA 1TRUA 3TKSC 2B5EA 1URMA 7GSSA 3F9UA 1UVZA 4E8EA 3D21A 2WDUA 2V1MA 5LCZA 1TOFA 1GTAA 2E7PA 2HSYA 2RM6A 3A5WA 4G9HA 1X5CA 1DE2A 2TRCP 1SJZA 2E2GA 6GSSA 3QPMA 2NBSA 1JHBA 2HYXA 5DQSA 1RW1A 3GKXA 4IQ1A 1T3BA 1LU4A 1O8WA 4WBJA 4IGJA 3FY7A 3ZMLA 3U6VA 3GURA 3ZITA 1W89A 4ZILA 3O6TA 3TKSA 2OADA 2AV4A 3P2AA 2TIRA 2DMLA 4HU7A 5IO0A 5HQPA 2OJLA 2H71A 2PUKC 3VI7A 2CAQA 1EOGA 2IFQA 1RQMA 2QGVA 1TI1A 1S3AA 4TR1B 2H1BA 2AYTA 5D9WA 2VLUA 4GWRA 2PERA 3J7Yb 3CMIA 3F8UA 5HR3A 1EGRA 2XPDA 2CX4A 3QCPA 4NHZA 4WBRD 3LWAA 1USBA 2WFCA 5G5FA 2VLTA 2I3YA 3ZRDA 4ZBDA 2YWNA 5IMVA 1GSFA 2A2RA 3GNJA 2WRTA 2L59A 2MMNA 1GSYA 3ED3A 2KP2A 1SKSB 4JR6A 2KHPA 4CW9A 3EU3A 1CQGA 1JLWA 1SJIA 4TR3A 4ZB9A 4MDCA 1Z9HA 2V32A 1XFLA 4I8BA 3HJMA 5IMZA 4XIHA 4OWYA 4KGIA 4OMVA 4MCUA 2YOIA 4TR0A 2FA8A 3VPTA 1O81A 5FHIA 4GSTA 4MJCA 2JU5A 4QL7A 2GZYA 4KDUA 5IM9A 4G19A 2OBIA 4GQCA 1AW9A 5DBQA 1X5DA 2P31A 4I2TA 2B7KA 2GQMA 1TJDA 1AAZA 1OC8A 3KM6A 3P8WA 4PQ1A 2IMFA 1YEXA 4K7IA 6GSYA 3M9KA 4GTUA 4WF4A 9GSSA 3VURA 1GL8A 1J0FA 1M9BA 5JCWA 2IMKA 2H6XA 3PR8A 2JZRA 4RQXA 2C3NA 3QR6A 1GTUA 3QFAC 3IK7A 2C80A 1EOHA 3H1NA 1PN9A 3GN3A 1QGVA 3VWVA 2C0FA 1ZMAA 4V2NA 2QSIA 4XS4B 1VF1A 1Z6MA 1XWKA 4KUNA 1SKWB 3UARA 2VL2C 3C1RA 4TRXA 2AJQB 4IP6A 3TDGA 5AGYA 5IPHA 3KTBA 3E9JB 3ZFLA 5EPFA 5COHA 4AGSA 1AIUA 4EC0A 4MH2A 2QKEA 5CRDA 1TK5B 4PURA 4I2UA 2NPBA 2CVBA 5IIZA 3RHBA 3DYRA 1QUWA 3L4NA 3C8EA 3L9VA 1IYIA 2HRFA 3IHQA 1G6WA 1SKRB 3VK9A 1M0UA 13GSA 20GSA 5J3RA 1OKTA 3C71A 1F2EA 4G10A 1B4QA 1V57A 3VI5A 4IELA 4FYUA 1T7PB 3HHVA 16GSA 2IWTA 3S9FA 2LJRA 5HFKA 3KCMA 5LD0A 2CT6A 1K0NA 2V41A 1OE7A 3I69A 1EWXA 3TJJA 3G7IA 3O3TA 5B7CA 1XW5A 1A0RP 1JZDA 3WGXA 3ERGA 2J9HA 1FO5A 2IPAA 1GRXA 1PL2A 3UEMA 5G2ZA 1A0FA 4XHMA 5CNWA 3UJ1A 4JU5A 2F51A 4X43A 4WKWA 2OA7A 2A2SA 8GSSA 3GX8A 4O7HA 1OYJA 2VCQA 5A4VA 1HYUA 2XBQA 17GSA 1LBKA 1O73A 2B5YA 1ERVA 1FAAA 3UAPA 4F82A 1X9SB 1FW1A 1G0TA 1PMTA 4RI6A 1NW2A 5EVOA 2J23A 2H8LA 3LG6A 2VL9A 2GTUA 1J08A 4D73B 1TRSA 4ML6A 3VPQA 3APOA 2O85A 3FZ9A 1TRVA 3BBYA 4OFTA 5D73A 3HD5A 4WEYA 3UVTA 1MDKA 3N9JA 2H76A 4IQAA 1M9AA 3EWLA 4K1FA 4ZB8A 1K0OA 5ECHB 4L0UA 3QDNA 1Z5YE 2D2ZA 1Q4JA 4V2MA 3WT1A 1SENA 1MDIA 4MZCA 4MZWA 4ZL8A 3A2WA 5ECMB 4K8MA 2OBKA 2YJHA 2YZHA 3KMOA 4LA1A 4OFNA 2M80A 1VGLA 4ILFA 3F6DA 2HNLA 2RIIA 1XXUA 3GH6A 2KLXA 1U88A 4BPYA 2AB6A 3DEXA 3RBTA 2OE1A 3WGDA 1ZCPA 2H01A 1SK1A 1WJKA 1R4WA 3ZIVA 4E8HA 3TJGA 3ERFA 3SWLA 2LNSA 2K18A 4O5RA 4F03A 5IMCA 1M2AA 1TP9A 18GSA 2MZCA 2JZTA 2XBIA 4NMUA 2GSRA 1GP1A 1K0CA 2FWGA 1B4PA 2ZNMA 1VF3A 4ISDA 5G5EA 2HE3A 1TK0B 2C0DA 2E2MA 2L4CA 3KZQA 4TVEA 4ZIJA 2R3XA 3KGKA 4IKHA 3J7Yk 5KN0A 4D73A 3WYWA 4ZL7A 2DIZA 2PU9C 1G7OA 2HZEA 1AUCA 1KNGA 2JZSA 3K8NA 1XZOA 5GAPD 2IFQB 2GT5A 1TDIA 2GT6A 4IJIA 5CREA 2C1YA 1FVKA 4TOPA 5CRHA 3ZREA 2JADA 4I5QA 3UBKA 3TOUA 3FKFA 3KP8A 2CVDA 4BA7A 1V9WA 1F3AA 2TRXA 1ACVA 2X8GA 1MD4A 4TXVA 4ZXGA 1SJ6A 3EU4A 5CRWA 3VWXA 2H6ZA 2VCZA 5HR2A 1UA5A 3DXBA 2LSTA 2FHEA 1PRXA 3Q6OA 4IS0A 3ZL5A 3TB2A 3ZTLA 2FD3A 4ECCA 1WP0A 3IV4A 3GKMA 5E4WA 2VIMA 5ELAA 3RPNA 4IP1A 2X8HA 1ERUA 2FWEA 4K7OA 3Q18A 1Y6EA 3L9UA 1OC3A 1EGOA 2CA8A 2YNXA 5A5KA 3CYNA 2HXKA 2P5QA 3F6FA 5D93A 5FT3A 2FA4A 5H5SA 1MEKA 4OCFA 3VLNA 3HVVA 5G31A 6GSXA 1HNBA 1WMJA 3F4RA 4PUFC 2H0IA 4FIWA 1XOBA 1OKDA 4BVXA 2CX3A 3W8SA 3HJPA 3IXRA 2EC4A 1NHYA 3FZAA 4TN8A 4AF2A 4L8EA 3ZZXA 1FVJA 1QMVA 1SYRA 3IAS2 3QAGA 1MDJA 4L0WA 4V2LA 5A4WA 1ZYQB 4KSMA 1DE1A 1EP7A 4NXIA 1SD8A 4GRFA 3FR9A 3LXZA 3GA4A 3DD3A 4KB3A 3ZLPA 2GSTA 3V1WA 4G2EA 3KJYA 4MJBA 2DSAA 4ZBBA 2VD0A 4HUAA 3HY2A 3IPZA 2PBJA 4J2FA 2B1LA 4KDXA 2OE0A 5HR0A 1T4YA 4EDYA 5INYA 1EV9A 3TGZA 2X8CA 2KOKA 3LSZA 4ID0A 2Z9SA 1VF4A 1GLQA 2HFDA 3W8JA 1Y25A 3RDWA 1NM3A 2A4VA 1B8XA 4HJ2A 4MA9A 3G7JA 4MMMA 1SK0A 2XHFA 5B6MA 1ERTA 2VM2A 5D9TA 2YV7A 3O76A 3IRAA 2GZPA 3DVXA 2CV4A 5A4UA 3D4MA 4PUAA 2LJKA 4X1UA 4MF7A 1V40A 2H0GA 4ECBA 5JWQB 19GSA 2VOCA 2YANA 4KSOA 2HI7A 5IO2A 4LLRA 3F0IA 2H6YA 2X64A 2LQQA 2IMDA 2FNOA 3US3A 4ZBAA 4FO5A 5IMDA 1U87A 2N5BA 4LL4B 4GSNA 3E3EA 3H93A 1T00A 3I9V2 1ZYEA 3IAM2 3IE3A 1V98A 5ECIB 4EL1A 2WJUA 2JSYA 3IA1A 5DVBA 1ILOA 3NOFA 1F6MC 2K8SA 4EDZA 4ECIA 4ULXA 4KW6A 5ECKB 2LRNA 3GKKA 5JCUA 1PX6A 2MYGA 3L78A 3CSJA 4NV2A 2VLVA 1YKCA 3P90A 3APSA 1SK2A 3IC4A 1DUGA 3ZFBA 4KAEA 1OAZA 2WS2A 3ME8A 3CSIA 1ZL9A 2R4VA 4GLTA 4DSQA 1GWCA 2H30A 1MTCA 4EF0A 4POLA 5KN1A 3FK8A 3M9JA 1U3AA 4XRDA 3KH9A 3A2XA 1WIKA 2YWMA 4WR4A 1VRSD 3CTGA 1OE8A 1A8LA 5CYYA 10GSA 2NTOA 1R5AA 1YEPA 2DJKA 2BTOT 1BEDA 4GXZA 1TRWA 1CQHA 4F9ZA 5DAKA 2LQOA 3ERWA 1EZKA 2G0FA 3PINA 2VL2A 4KCEA 5ID2A 1B9YC 2MMOA 1SL1B 1QK8A 2FLSA 4TW5A 4ECJA 5D9XA 2R5GA 1S3CA 1W4VA 2VCWA 2WB9A 1HNAA 2CZ3A 1Z6NA 5CAXA 1YF0A 4N10A 2KUCA 2F3MA 3TKSE 1U6TA 4NHWA 1N8JA 2L4QA 1A24A 2VAFA 2LV3A
chains in the Genus database with same CATH superfamily
3P7XA 1PX7A 2NDOA 3KTLA 3G9BA 2X99A 3TRXA 3UBLA 3H8QA 1IYHA 3ZYWA 4MH3A 2IL3A 2ON7A 4X4JA 1BG5A 3GMFA 5AIXA 4WETA 3TKQA 3RAZA 4ZB6A 5ELGA 4IJ3A 1R26A 1K0MA 5F0GA 1XWAA 3IBHA 5DCGA 4ZL9A 2N5FA 1XW9A 1K0BA 4RQRA 2V6KA 1ZGNA 4HS1A 2FY6A 1BJXA 3D5JA 3MIXA 2DJ2A 4N0ZA 4OD7A 2GZZA 2JACA 1AC1A 3W6GA 4MP4A 2C4JA 4I97A 2X49A 2A2PA 1KEBA 3DRNA 2YV9A 4POBA 5D8IA 2H75A 2HZEB 4WXTA 1K0DA 2MMZA 2GSQA 1R7HA 3TJKA 2LS5A 4K2XA 4K0GA 1THOA 1XIYA 3QOUA 2I1UA 4V1Ag 3UIWA 1XWCA 4Q5FA 3GX0A 3ME7A 1K0AA 2DJJA 3F63A 5IOWA 4JRRA 4Z7XA 5IPGA 1X9WB 2WCIA 2O7KA 2YPMA 4Q5QA 2BJXA 1V2AA 4K7NA 1SU9A 3I43A 2H1GA 5H5RA 4IVFA 2DJ0A 3LYPA 1YZXA 4J57E 1KTEA 2GS3A 1Z3EA 2IJYA 1PGTA 3UOMA 4K9ZA 12GSA 1K3OA 3QAWA 1PKWA 3HYPA 2DIYA 3VWWA 5ECRB 2F8AA 3LQ7A 4F0BA 1XW6A 1WPIA 1M99A 3AY8A 2ON5A 1VF2A 1GTBA 3GTUA 3HVSA 5FWGA 2DKHA 3GKNA 3UVHA 4PNGA 4KX4A 2CVKA 5G30A 4YQMA 1I5GA 2V6OA 4LL1B 5AIVA 2I9HA 3KEBA 3GYKA 1XVWA 1HQOA 4FH8A 4X0XA 4BWQA 2WULA 3GHAA 3TCOA 3D6IA 1AQXA 2O87A 5ECOB 3EC3A 3IDVA 4DEJA 3F4SA 1TW9A 3CRTA 2RM5A 5J5NA 3HZ4A 4KCAA 2PN8A 3GV1A 2FWFA 4P3YB 5KOWA 4HSCX 4IN0A 1FHEA 2PPTA 5J41A 3C73A 3M0FA 4AJ7A 3NZNA 4POMA 2B5XA 1LJRA 1EEJA 1XCCA 2B1KA 2VCVA 1K3LA 2GVPA 3FYGA 2LTKA 1OC9B 3QD9A 3D4TA 3ZIJA 1A2JA 1GLPA 4O92A 1J9BA 1YF1A 5DQYA 2L57A 2HRNA 4PX1A 2O8VB 3C1SA 5C00A 2LRCA 2PVQA 5ECQB 2R2JA 1E6BA 4JBBA 2E0QA 1NHOA 3IOSA 4H86A 4EXJA 3GSTA 2DJ3A 4L5OA 3ZVJD 5IMFA 4KA0A 2GGTA 2LRTA 2QA1A 3DMLA 1WOUA 1PD21 3RPPA 5F06A 2H73A 4DSSB 2YN1A 3TRQA 2VL3A 3MNGA 3GRXA 3VWUA 4QL9A 1SYXA 2K9FA 4XS6A 2HT9A 2K6VA 6GSVA 3WGEA 2ZUPA 3KH7A 3HVXA 2VM1A 5KN2A 1K3YA 3NIVA 4DVCA 3GFKA 4MK3A 3TUEA 3EMPA 4I6XA 3U5RE 1YY7A 3GL3A 1M2BA 4IW9A 1T4ZA 4KH7A 1GULA 5GSSA 3FZ4A 3N5OA 4TXOB 1FOVA 3HDCA 4JEDA 4HEA2 2WZ9A 2XPEA 3IHGA 3HXSA 2DBCA 2F9SA 5JCGA 2AAWA 2CAIA 3LW9A 1GSEA 3DKSA 3HKRA 4WF5A 3FEUA 5IOXA 2DLXA 2G2QA 5L71A 1Q98A 3KXOA 1PQNA 1A2LA 3M8NA 2ZCTA 5DJLA 1B9XC 1OC9A 4HQZA 1C72A 3KMNA 3FR6A 5ABRA 2YZUA 4NAXA 1G6YA 1A8YA 1SL0B 2H72A 1UC7A 2L6DA 5LNKe 2EIOA 1DSBA 1ERWA 1YJ6A 1NSWA 2MBSA 2B3SA 4NPBA 2JL4A 4F2IA 5C04A 3LORA 1F9MA 4YAPA 3BCIA 3BD2A 4JZQA 2VCTA 4BWSA 4DSRA 4BL7A 2YWIA 3GSSA 2OACA 4HQSA 4OO4A 4N0VA 4DSSA 3FZ5A 2H70A 3HA9A 4MPFA 2FCHA 2VD1A 4FYCA 1AQWA 4EVMA 4MPGA 2M72A 3LFLA 1ST9A 2OE3A 3E0UA 5GAND 3BOAA 3TRPA 3FHKA 1EP8A 4CY8A 5DAKB 4MLYA 4YH2A 2IIYA 3F3QA 1BX9A 4K0NA 2WGRA 1ON4A 1T1VA 2LEGA 1OVNA 2PMTA 2IMIA 4HZ2A 3DWVA 5ID2B 3CBUA 2LNTA 1XVQA 4NV5A 1X5EA 2EIRA 2MMAA 2H74A 3GIXA 1TKDB 4TXOA 1TTZA 3L0HA 1GSUA 3LGCA 2K8VA 3H4KA 2YP6A 5ENUA 1M2DA 1THXA 3KD0A 4HDEA 4KE3A 4WR5A 2YCDA 1WE0A 1RK4A 3HCZA 1FOHA 3M3MA 5HR1A 2EIQA 4PQHA 4QQ7A 1XOAA 4PGTA 4KDYA 3DIEA 5J9CA 4YQUA 1A2MA 4PXOA 5F8BA 1A23A 3FR3A 1PKZA 5ECSA 3APQA 1GUMA 3R2QA 1BQ7A 3LXTA 2R6KA 2BMXA 4TR1A 4AJ6A 3F4TA 3C7MA 3RHCA 1GNEA 5ECPB 4EIPA 6GSTA 1E2YA 5GZZB 3TJFA 3Q19A 2HSHA 1GSQA 3MAKA 5BMUA 1ZZYA 2H19A 1O8XA 1PN0A 5J9BA 1O6JA 2GSSA 3EVIA 3DGQA 5EY6A 2M46A 1JLVA 1S3DA 3CTFA 5DJMA 1XPVA 1GTIA 4HOJA 3EURA 5F05A 2GLRA 4A5PA 1PL1A 4EE0A 3G7YA 3GUSA 3SBCA 1I9DA 2C3QA 1EEMA 2C8UA 5GSTA 2HRKA 1ZOFA 5JWRB 1U3IA 3PGTA 3CXGA 4YQVA 3UMAA 3HZ8A 3EE2A 2R0PA 1AXDA 5E59A 1FB0A 2DMMA 4XCSA 3KIJA 4PQIA 2REMA 4MJEA 4MZBA 1GUHA 1O85A 1G7EA 4Q5RA 5G1KA 3HVNA 1GSSA 4TKYA 2IMEA 3TOTA 4CHSA 5ECLB 2KP1A 1WRYA 4JR4A 3QAVA 5G1LA 11GSA 3TJBA 1TU7A 2VCXA 2YJ7A 3F3RA 4IHUA 5DDLA 1H75A 4OO5A 4LMVA 1H4OA 2AUVA 2OKAA 4K2DA 5D9VA 3EMXA 1FB6A 1PA3A 5CP1A 1TK8B 4EO3A 6GSUA 4RUVA 5KN3A 4O5QA 4N30A 3OR5A 3GTUB 5JWOB 3LEFA 1QFNA 1Z7PA 4OFMA 5F07A 2C3TA 3UL3A 2RUEA 1YKAA 4HI7A 1FG4A 3PH9A 2HSMA 5H5QA 4YAVA 2LKUA 2FUG2 1PFOA 2QC7A 5IQYA 1Z7RA 1X9MB 1GSDA 4IBPA 2L5LA 2P0GA 2LJAA 5KEJA 1QXHA 1GUKA 4XS4A 3HJOA 4KNDA 2R37A 3LYKA 4L5LA 5ECNB 2ALBA 2PWJA 3MWHA 2PGTA 1ABAA 2YWOA 4AJ8A 2B7JA 4J56E 5EL8A 5DALB 2MBTA 3GL5A 1JZOA 3VFIA 2L5OA 4XTSA 2GDRA 3KP9A 2C0GA 2DJ1A 4K5RA 5B6NA 3EINA 1AQVA 4HZ4A 1TXXA 1BAYA 2FGXA 3QMXA 1V58A 1BYEA 4XRAA 1XBSA 4TR4A 3FW2A 1B48A 5HFIA 4F0CA 4Z2UA 4GQFA 4MABA 3MDKA 3A3TA 4OCEA 5AN1A 1UN2A 2N5AA 4FYBA 2ES7A 2L6CA 5B8AA 3CRUA 2NVLA 4HU9A 1TI3A 1N2AA 3D22A 1X0RA 3ZMKA 5DCHA 2H66A 4GSSA 1DBYA 1M7TA 2I81A 1XWBA 1JZRA 6GSWA 2PVOC 1TU8A 5B8BA 4BVYA 2VUPA 3QFBC 4NWYA 2O89A 1WWJA 3EYTA 5CO3A 2VO4A 14GSA 3ISOA 5J4UA 3BJ5A 3I6AA 1JZWA 4ACSA 1KBNA 3H79A 3ZVJA 4LMWA 1HNCA 2LUSA 5BRTA 2RLIA 1ML6A 4GCIA 2V2GA 2P5RA 22GSA 1XWGA 5CRGA 4POKA 2GQLA 3D0ZA 4MJAA 4K6XA 1EV4A 3CSHA 3LJRA 3A2VA 4MF6A 2H0HA 2AHEA 3CQFA 5DALA 2DC5A 4N11A 1O7UA 3BCKA 1GNWA 1HD2A 1YDKA 3MSZA 1GH2A 1PSQA 3TKPA 3DVWA 4JE1A 2IN3A 2XC2A 4MF5A 3JCML 2HZFA 1YQ1A 2GQKA 1QQ2A 3IR4A 4GF0A 3GH9A 4XS1A 4O32A 5IMAA 2C0EA 4HJMA 2CZ2A 4ML1A 4PNFA 2F8FA 3PPUA 4V1Ap 1SL2B 1F3BA 4CDOA 3L9SA 3TKRA 1T8EB 2HLSA 2H1DA 4EKZA 4Q5NA 3FRCA 4EUYA 1JFUA 1SD9A 2B6MA 2CQ9A 3Q74A 5D96A 3WT2A 5AISA 2FWHA 3M1GA 1R5PA 1MD3A 2JSZA 4BL7B 3WD6A 1F37A 2H1AA 2RUFA 2R0GA 3IK9A 4RI7A 2I4AA 5HFGA 1TRUA 3TKSC 2B5EA 1URMA 7GSSA 3F9UA 1UVZA 4E8EA 3D21A 2WDUA 2V1MA 5LCZA 1TOFA 1GTAA 2E7PA 2HSYA 2RM6A 3A5WA 4G9HA 1X5CA 1DE2A 2TRCP 1SJZA 2E2GA 6GSSA 3QPMA 2NBSA 1JHBA 2HYXA 5DQSA 1RW1A 3GKXA 4IQ1A 1T3BA 1LU4A 1O8WA 4WBJA 4IGJA 3FY7A 3ZMLA 3U6VA 3GURA 3ZITA 1W89A 4ZILA 3O6TA 2R0CA 3TKSA 2OADA 2AV4A 3P2AA 2TIRA 2DMLA 4HU7A 5IO0A 5HQPA 2OJLA 2H71A 4PTSA 2PUKC 3VI7A 2CAQA 1EOGA 2IFQA 1RQMA 2QGVA 1TI1A 1S3AA 4TR1B 2H1BA 2AYTA 5D9WA 2VLUA 4GWRA 2PERA 3J7Yb 3CMIA 3F8UA 5HR3A 1EGRA 2XPDA 2CX4A 3QCPA 4NHZA 4WBRD 1XG8A 3LWAA 1USBA 2WFCA 5G5FA 2VLTA 2I3YA 3ZRDA 4ZBDA 2YWNA 5IMVA 1GSFA 2A2RA 3GNJA 4KF9A 2WRTA 2L59A 2MMNA 1GSYA 3ED3A 2KP2A 1SKSB 4JR6A 4YKFA 4G0KA 2KHPA 4CW9A 3EU3A 1CQGA 1JLWA 1SJIA 4TR3A 4ZB9A 4MDCA 1Z9HA 2V32A 1XFLA 4I8BA 3HJMA 5IMZA 4XIHA 4OWYA 4KGIA 4OMVA 4MCUA 2YOIA 2QA2A 4TR0A 2FA8A 3VPTA 1O81A 5FHIA 4GSTA 4MJCA 2JU5A 4QL7A 2GZYA 4KDUA 5IM9A 4G19A 2OBIA 4GQCA 1AW9A 5DBQA 1X5DA 2P31A 4I2TA 2B7KA 2GQMA 1TJDA 1AAZA 1OC8A 3KM6A 3P8WA 4PQ1A 2IMFA 1YEXA 4K7IA 6GSYA 3M9KA 4GTUA 4WF4A 9GSSA 3VURA 2UZ8A 1GL8A 1J0FA 1M9BA 5JCWA 2IMKA 2H6XA 1M3IA 3PR8A 2JZRA 4RQXA 2C3NA 3QR6A 1GTUA 3QFAC 3IK7A 4USSA 2C80A 1EOHA 3H1NA 1PN9A 3GN3A 1QGVA 3VWVA 2C0FA 1ZMAA 4V2NA 2QSIA 4XS4B 1VF1A 4YKGA 1Z6MA 1XWKA 4KUNA 1SKWB 3UARA 2VL2C 3C1RA 4TRXA 2AJQB 4IP6A 3TDGA 5AGYA 5IPHA 3KTBA 3E9JB 3ZFLA 5EPFA 5COHA 4AGSA 1AIUA 4EC0A 4MH2A 2QKEA 5CRDA 1TK5B 4PURA 4I2UA 2NPBA 2CVBA 5IIZA 3RHBA 3DYRA 1QUWA 3L4NA 3C8EA 3L9VA 1IYIA 2HRFA 3IHQA 1G6WA 1SKRB 3VK9A 1M0UA 13GSA 20GSA 5J3RA 1OKTA 3C71A 1F2EA 4G10A 1B4QA 1V57A 3VI5A 4IELA 4FYUA 1T7PB 3HHVA 16GSA 2IWTA 3S9FA 2LJRA 5HFKA 3KCMA 5LD0A 2CT6A 4FQUA 1K0NA 2V41A 3A5IA 1OE7A 3I69A 1EWXA 3TJJA 3G7IA 4BVYB 3O3TA 5B7CA 1XW5A 1A0RP 1JZDA 3WGXA 3ERGA 2J9HA 1FO5A 2IPAA 1GRXA 1PL2A 3UEMA 5G2ZA 1A0FA 4XHMA 5CNWA 3UJ1A 4JU5A 2F51A 4X43A 4WKWA 2OA7A 2A2SA 8GSSA 3GX8A 4G0IA 4O7HA 1OYJA 2VCQA 4O5UA 5A4VA 1HYUA 2XBQA 17GSA 1LBKA 1O73A 2B5YA 1ERVA 1FAAA 3UAPA 4F82A 1X9SB 1FW1A 1G0TA 1PMTA 4RI6A 1NW2A 5EVOA 2J23A 2H8LA 3LG6A 2VL9A 2GTUA 1J08A 4D73B 1TRSA 4ML6A 3VPQA 3APOA 2O85A 3FZ9A 1TRVA 3BBYA 4OFTA 5D73A 3HD5A 4WEYA 3UVTA 1MDKA 3N9JA 2H76A 4IQAA 1M9AA 3EWLA 4K1FA 4ZB8A 1K0OA 5ECHB 4L0UA 4Z2RA 3QDNA 1Z5YE 2D2ZA 1Q4JA 4V2MA 3WT1A 1SENA 1MDIA 4MZCA 4MZWA 4ZL8A 3A2WA 5ECMB 4K8MA 2OBKA 2YJHA 2YZHA 2HRAA 3KMOA 4LA1A 4OFNA 2M80A 1VGLA 4ILFA 3F6DA 2HNLA 2RIIA 1XXUA 3GH6A 2KLXA 1U88A 4BPYA 2AB6A 3DEXA 3RBTA 2OE1A 3WGDA 1ZCPA 2H01A 1SK1A 1WJKA 1R4WA 3ZIVA 4E8HA 3TJGA 3ERFA 3SWLA 2LNSA 2K18A 4EIQA 4O5RA 4F03A 5IMCA 1M2AA 1TP9A 18GSA 2MZCA 2X4AA 2JZTA 2XBIA 4NMUA 2GSRA 1GP1A 1K0CA 2FWGA 1M3JA 1B4PA 2ZNMA 1VF3A 1ZYNA 4ISDA 5G5EA 2HE3A 1TK0B 2C0DA 2E2MA 2L4CA 3KZQA 4TVEA 4ZIJA 2R3XA 3KGKA 4IKHA 3J7Yk 4BVXB 5KN0A 4D73A 3WYWA 4ZL7A 2DIZA 2PU9C 1G7OA 2HZEA 1AUCA 1KNGA 2JZSA 3K8NA 1XZOA 5GAPD 2IFQB 2GT5A 1TDIA 2GT6A 4IJIA 5CREA 2C1YA 1FVKA 4TOPA 5CRHA 3ZREA 4K5SA 5KOXA 2JADA 4I5QA 3UBKA 3TOUA 3FKFA 3KP8A 2CVDA 4BA7A 1V9WA 1F3AA 2TRXA 1ACVA 2X8GA 1MD4A 4TXVA 4ZXGA 1SJ6A 3EU4A 5CRWA 3VWXA 2H6ZA 2VCZA 5HR2A 1UA5A 3DXBA 2LSTA 2FHEA 1PRXA 3Q6OA 4IS0A 3ZL5A 3TB2A 3ZTLA 2FD3A 1ZYPA 4ECCA 1WP0A 3IV4A 3GKMA 5E4WA 2VIMA 5ELAA 3RPNA 4IP1A 2X8HA 1ERUA 2FWEA 4K7OA 3Q18A 1Y6EA 3L9UA 1OC3A 4ICYA 1EGOA 2CA8A 2YNXA 5A5KA 3CYNA 2HXKA 2P5QA 3F6FA 5D93A 5FT3A 2FA4A 5H5SA 1MEKA 4OCFA 3VLNA 3HVVA 5G31A 6GSXA 1HNBA 1WMJA 3F4RA 4PUFC 2H0IA 4FIWA 1XOBA 1OKDA 4BVXA 4BIKA 2CX3A 3W8SA 3HJPA 3IXRA 2EC4A 1NHYA 3FZAA 4TN8A 4AF2A 4L8EA 3ZZXA 1FVJA 1QMVA 1SYRA 3IAS2 3QAGA 1MDJA 4L0WA 4V2LA 5A4WA 1ZYQB 4KSMA 1DE1A 1EP7A 4NXIA 1SD8A 4GRFA 3FR9A 3LXZA 3GA4A 3DD3A 4KB3A 3ZLPA 2GSTA 3V1WA 4G2EA 3KJYA 4MJBA 2DSAA 4ZBBA 2VD0A 4HUAA 3HY2A 3IPZA 2PBJA 4J2FA 2B1LA 4KDXA 2OE0A 3IC8A 5HR0A 1T4YA 4EDYA 5INYA 1EV9A 3TGZA 2X8CA 2KOKA 3LSZA 4ID0A 2Z9SA 1VF4A 3R3EA 1GLQA 2HFDA 3W8JA 1Y25A 3RDWA 1NM3A 2A4VA 1B8XA 4HJ2A 4MA9A 3G7JA 4MMMA 1SK0A 2XHFA 5B6MA 1ERTA 2VM2A 5D9TA 2YV7A 3O76A 3IRAA 2GZPA 3DVXA 2CV4A 5A4UA 3D4MA 4PUAA 2LJKA 4X1UA 4MF7A 1V40A 2H0GA 4ECBA 5JWQB 19GSA 4MNNA 2VOCA 2YANA 4KSOA 2HI7A 5IO2A 4LLRA 3F0IA 2H6YA 2X64A 2LQQA 2IMDA 2FNOA 3US3A 4ZBAA 4FO5A 5IMDA 1U87A 2N5BA 4LL4B 4GSNA 3E3EA 3H93A 1T00A 3I9V2 1ZYEA 3IAM2 3IE3A 1V98A 5ECIB 4EL1A 2WJUA 2JSYA 3IA1A 5DVBA 1ILOA 3NOFA 1F6MC 2K8SA 4EDZA 4ECIA 4ULXA 4KW6A 5ECKB 2LRNA 4Z2TA 3GKKA 5JCUA 4G0LA 1PX6A 2MYGA 3L78A 3CSJA 4NV2A 2VLVA 1YKCA 3P90A 3APSA 1SK2A 1S3RA 3IC4A 1DUGA 3ZFBA 4KAEA 1OAZA 2WS2A 3ME8A 3FMWA 3CSIA 1ZL9A 2R4VA 4GLTA 4DSQA 1GWCA 2H30A 1MTCA 4EF0A 4POLA 5KN1A 3FK8A 3M9JA 1U3AA 4XRDA 3KH9A 3A2XA 1WIKA 2YWMA 4WR4A 1VRSD 3CTGA 1OE8A 4CY6A 1A8LA 5CYYA 10GSA 2NTOA 1R5AA 1YEPA 2DJKA 2BTOT 1BEDA 4GXZA 3MYDA 1TRWA 1CQHA 4F9ZA 5DAKA 2LQOA 3ERWA 1EZKA 2G0FA 3PINA 2VL2A 4KCEA 5ID2A 1B9YC 2MMOA 1SL1B 1QK8A 2FLSA 4TW5A 3EPTA 4ECJA 5D9XA 2R5GA 1S3CA 1W4VA 2VCWA 2WB9A 1HNAA 2CZ3A 1Z6NA 2A4HA 5CAXA 1YF0A 4N10A 2DKIA 2KUCA 2F3MA 3TKSE 1U6TA 4NHWA 1N8JA 2L4QA 1A24A 2VAFA 2LV3A
chains in the Genus database with same CATH topology
3P7XA 1PX7A 2NDOA 3KTLA 3G9BA 2X99A 3TRXA 3UBLA 3H8QA 1IYHA 3ZYWA 4MH3A 2IL3A 2ON7A 4X4JA 1BG5A 3GMFA 5AIXA 4WETA 3TKQA 3RAZA 4ZB6A 5ELGA 4IJ3A 1R26A 1K0MA 5F0GA 1XWAA 3IBHA 5DCGA 4ZL9A 2N5FA 1XW9A 1K0BA 4RQRA 2V6KA 1ZGNA 4HS1A 2FY6A 1BJXA 3D5JA 3MIXA 2DJ2A 4N0ZA 4OD7A 2GZZA 2JACA 1AC1A 3W6GA 4MP4A 2C4JA 4I97A 2X49A 2A2PA 1KEBA 3DRNA 2YV9A 4POBA 5D8IA 2H75A 2HZEB 4WXTA 1K0DA 2MMZA 2GSQA 1R7HA 3TJKA 2LS5A 4K2XA 4K0GA 1THOA 1XIYA 3QOUA 2I1UA 4V1Ag 3UIWA 1XWCA 4Q5FA 3GX0A 3ME7A 1K0AA 2DJJA 3F63A 5IOWA 4JRRA 4Z7XA 5IPGA 1X9WB 2WCIA 2O7KA 2YPMA 4Q5QA 2BJXA 1V2AA 4K7NA 1SU9A 3I43A 2H1GA 5H5RA 4IVFA 2DJ0A 3LYPA 1YZXA 4J57E 1KTEA 2GS3A 1Z3EA 2IJYA 1PGTA 3UOMA 4K9ZA 12GSA 1K3OA 3QAWA 1PKWA 3HYPA 2DIYA 3VWWA 5ECRB 2F8AA 3LQ7A 4F0BA 1XW6A 1WPIA 1M99A 3AY8A 2ON5A 1VF2A 1GTBA 3GTUA 3HVSA 5FWGA 2DKHA 3GKNA 3UVHA 4PNGA 4KX4A 2CVKA 5G30A 4YQMA 1I5GA 2V6OA 4LL1B 5AIVA 2I9HA 3KEBA 3GYKA 1XVWA 1HQOA 4FH8A 4X0XA 4BWQA 2WULA 3GHAA 3TCOA 3D6IA 1AQXA 2O87A 5ECOB 3EC3A 3IDVA 4DEJA 3F4SA 1TW9A 3CRTA 2RM5A 5J5NA 3HZ4A 4KCAA 2PN8A 3GV1A 2FWFA 4P3YB 5KOWA 5J41A 4IN0A 1FHEA 2PPTA 3C73A 3M0FA 4AJ7A 3NZNA 4POMA 2B5XA 1LJRA 1EEJA 1XCCA 2B1KA 2VCVA 1K3LA 2GVPA 3FYGA 2LTKA 1OC9B 3QD9A 3D4TA 3ZIJA 1A2JA 1GLPA 4O92A 1J9BA 1YF1A 5DQYA 2L57A 2HRNA 4PX1A 2O8VB 3C1SA 5C00A 2LRCA 2PVQA 5ECQB 2R2JA 1E6BA 4JBBA 2E0QA 1NHOA 3IOSA 4H86A 4EXJA 3GSTA 2DJ3A 4L5OA 3ZVJD 5IMFA 4KA0A 2GGTA 2LRTA 2QA1A 3DMLA 1WOUA 1PD21 3RPPA 5F06A 2H73A 4DSSB 2YN1A 3TRQA 2VL3A 3MNGA 3GRXA 3VWUA 4QL9A 1SYXA 2K9FA 4XS6A 2HT9A 2K6VA 6GSVA 3WGEA 2ZUPA 3KH7A 3HVXA 2VM1A 5KN2A 1K3YA 3NIVA 4DVCA 3GFKA 4MK3A 3TUEA 3EMPA 4I6XA 3U5RE 1YY7A 3GL3A 1M2BA 4IW9A 1T4ZA 4KH7A 1GULA 5GSSA 3FZ4A 3N5OA 4TXOB 1FOVA 3HDCA 4JEDA 4HEA2 2WZ9A 2XPEA 3IHGA 3HXSA 2DBCA 2F9SA 5JCGA 2AAWA 2CAIA 3LW9A 1GSEA 3DKSA 3HKRA 4WF5A 3FEUA 5IOXA 2DLXA 2G2QA 5L71A 1Q98A 3KXOA 1PQNA 1A2LA 3M8NA 2ZCTA 5DJLA 1B9XC 1OC9A 4HQZA 1C72A 3KMNA 3FR6A 5ABRA 2YZUA 4NAXA 1G6YA 1A8YA 1SL0B 2H72A 1UC7A 2L6DA 5LNKe 2EIOA 1DSBA 1ERWA 1YJ6A 1NSWA 2MBSA 2B3SA 4NPBA 2JL4A 4F2IA 5C04A 3LORA 1F9MA 4YAPA 3BCIA 3BD2A 4JZQA 2VCTA 4BWSA 4DSRA 4BL7A 2YWIA 3GSSA 2OACA 4HQSA 4OO4A 4N0VA 4DSSA 3FZ5A 2H70A 3HA9A 4MPFA 2FCHA 2VD1A 4FYCA 1AQWA 4EVMA 4MPGA 2M72A 3LFLA 1ST9A 2OE3A 3E0UA 5GAND 3BOAA 3TRPA 3FHKA 1EP8A 4CY8A 5DAKB 4MLYA 4YH2A 2IIYA 3F3QA 1BX9A 4K0NA 2WGRA 1ON4A 1T1VA 2LEGA 1OVNA 2PMTA 2IMIA 4HZ2A 3DWVA 5ID2B 3CBUA 2LNTA 1XVQA 4NV5A 1X5EA 2EIRA 2MMAA 2H74A 3GIXA 1TKDB 4TXOA 1TTZA 3L0HA 1GSUA 3LGCA 2K8VA 3H4KA 2YP6A 5ENUA 1M2DA 1THXA 3KD0A 4HDEA 4KE3A 4WR5A 2YCDA 1WE0A 1RK4A 3HCZA 1FOHA 3M3MA 5HR1A 2EIQA 4PQHA 4QQ7A 1XOAA 4PGTA 4KDYA 3DIEA 5J9CA 4YQUA 1A2MA 4PXOA 5F8BA 1A23A 3FR3A 1PKZA 5ECSA 3APQA 1GUMA 3R2QA 1BQ7A 3LXTA 2R6KA 2BMXA 4TR1A 4AJ6A 3F4TA 3C7MA 3RHCA 1GNEA 5ECPB 4EIPA 6GSTA 1E2YA 5GZZB 3TJFA 3Q19A 2HSHA 1GSQA 3MAKA 5BMUA 1ZZYA 2H19A 1O8XA 1PN0A 5J9BA 1O6JA 2GSSA 3EVIA 3DGQA 5EY6A 2M46A 1JLVA 1S3DA 3CTFA 5DJMA 1XPVA 1GTIA 4HOJA 3EURA 5F05A 2GLRA 4A5PA 1PL1A 4EE0A 3G7YA 3GUSA 3SBCA 1I9DA 2C3QA 1EEMA 2C8UA 5GSTA 2HRKA 1ZOFA 5JWRB 1U3IA 3PGTA 3CXGA 4YQVA 3UMAA 3HZ8A 3EE2A 2R0PA 1AXDA 5E59A 1FB0A 2DMMA 4XCSA 3KIJA 4PQIA 2REMA 4MJEA 4MZBA 1GUHA 1O85A 1G7EA 4Q5RA 5G1KA 1GSSA 4TKYA 2IMEA 3TOTA 4CHSA 5ECLB 2KP1A 1WRYA 4JR4A 3QAVA 5G1LA 11GSA 3TJBA 1TU7A 2VCXA 2YJ7A 3F3RA 4IHUA 5DDLA 1H75A 4OO5A 4LMVA 1H4OA 2AUVA 2OKAA 4K2DA 5D9VA 3EMXA 1FB6A 1PA3A 5CP1A 1TK8B 4EO3A 6GSUA 4RUVA 5KN3A 4O5QA 4N30A 3OR5A 3GTUB 5JWOB 3LEFA 1QFNA 1Z7PA 4OFMA 5F07A 2C3TA 3UL3A 2RUEA 1YKAA 4HI7A 1FG4A 3PH9A 2HSMA 5H5QA 4YAVA 2LKUA 2FUG2 2QC7A 5IQYA 1Z7RA 1X9MB 1GSDA 4IBPA 2L5LA 2P0GA 2LJAA 5KEJA 1QXHA 1GUKA 4XS4A 3HJOA 4KNDA 2R37A 3LYKA 4L5LA 5ECNB 2ALBA 2PWJA 3MWHA 2PGTA 1ABAA 2YWOA 4AJ8A 2B7JA 4J56E 5EL8A 5DALB 2MBTA 3GL5A 1JZOA 3VFIA 2L5OA 4XTSA 2GDRA 3KP9A 2C0GA 2DJ1A 4K5RA 5B6NA 3EINA 1AQVA 4HZ4A 1TXXA 1BAYA 2FGXA 3QMXA 1V58A 1BYEA 4XRAA 1XBSA 4TR4A 3FW2A 1B48A 5HFIA 4F0CA 4Z2UA 4GQFA 4MABA 3MDKA 3A3TA 4OCEA 5AN1A 1UN2A 2N5AA 4FYBA 2ES7A 2L6CA 5B8AA 3CRUA 2NVLA 4HU9A 1TI3A 1N2AA 3D22A 1X0RA 3ZMKA 5DCHA 2H66A 4GSSA 1DBYA 1M7TA 2I81A 1XWBA 1JZRA 6GSWA 2PVOC 1TU8A 5B8BA 4BVYA 2VUPA 3QFBC 4NWYA 2O89A 1WWJA 3EYTA 5CO3A 2VO4A 14GSA 3ISOA 5J4UA 3BJ5A 3I6AA 1JZWA 4ACSA 1KBNA 3H79A 3ZVJA 4LMWA 1HNCA 2LUSA 5BRTA 2RLIA 1ML6A 4GCIA 2V2GA 2P5RA 22GSA 1XWGA 5CRGA 4POKA 2GQLA 3D0ZA 4MJAA 4K6XA 1EV4A 3CSHA 3LJRA 3A2VA 4MF6A 2H0HA 2AHEA 5DALA 2DC5A 4N11A 1O7UA 3BCKA 1GNWA 1HD2A 1YDKA 3MSZA 1GH2A 1PSQA 3TKPA 3DVWA 4JE1A 2IN3A 2XC2A 4MF5A 3JCML 2HZFA 1YQ1A 2GQKA 1QQ2A 3IR4A 4GF0A 3GH9A 4XS1A 4O32A 5IMAA 2C0EA 4HJMA 2CZ2A 4ML1A 4PNFA 2F8FA 3PPUA 4V1Ap 1SL2B 1F3BA 4CDOA 3L9SA 3TKRA 1T8EB 2HLSA 2H1DA 4EKZA 4Q5NA 3FRCA 4EUYA 1JFUA 1SD9A 2B6MA 2CQ9A 3Q74A 5D96A 3WT2A 5AISA 2FWHA 3M1GA 1R5PA 1MD3A 2JSZA 4BL7B 3WD6A 1F37A 2H1AA 2RUFA 2R0GA 3IK9A 4RI7A 2I4AA 5HFGA 1TRUA 3TKSC 2B5EA 1URMA 7GSSA 3F9UA 1UVZA 4E8EA 3D21A 2WDUA 2V1MA 5LCZA 1TOFA 1GTAA 2E7PA 2HSYA 2RM6A 3A5WA 4G9HA 1X5CA 1DE2A 2TRCP 1SJZA 2E2GA 6GSSA 3QPMA 2NBSA 1JHBA 2HYXA 5DQSA 1RW1A 3GKXA 4IQ1A 1T3BA 1LU4A 1O8WA 4WBJA 4IGJA 3FY7A 3ZMLA 3U6VA 3GURA 3ZITA 1W89A 4ZILA 3O6TA 2R0CA 3TKSA 2OADA 2AV4A 3P2AA 2TIRA 2DMLA 4HU7A 5IO0A 5HQPA 2OJLA 2H71A 4PTSA 2PUKC 3VI7A 2CAQA 1EOGA 2IFQA 1RQMA 2QGVA 1TI1A 1S3AA 4TR1B 2H1BA 2AYTA 5D9WA 2VLUA 4GWRA 2PERA 3J7Yb 3CMIA 3F8UA 5HR3A 1EGRA 2XPDA 2CX4A 3QCPA 4NHZA 4WBRD 3LWAA 1USBA 2WFCA 5G5FA 2VLTA 2I3YA 3ZRDA 4ZBDA 2YWNA 5IMVA 1GSFA 2A2RA 3GNJA 4KF9A 2WRTA 2L59A 2MMNA 1GSYA 3ED3A 2KP2A 1SKSB 4JR6A 4YKFA 4G0KA 2KHPA 4CW9A 3EU3A 1CQGA 1JLWA 1SJIA 4TR3A 4ZB9A 4MDCA 1Z9HA 2V32A 1XFLA 4I8BA 3HJMA 5IMZA 4XIHA 4OWYA 4KGIA 4OMVA 4MCUA 2YOIA 2QA2A 4TR0A 2FA8A 3VPTA 1O81A 5FHIA 4GSTA 4MJCA 2JU5A 4QL7A 2GZYA 4KDUA 5IM9A 4G19A 2OBIA 4GQCA 1AW9A 5DBQA 1X5DA 2P31A 4I2TA 2B7KA 2GQMA 1TJDA 1AAZA 1OC8A 3KM6A 3P8WA 4PQ1A 2IMFA 1YEXA 4K7IA 6GSYA 3M9KA 4GTUA 4WF4A 9GSSA 3VURA 2UZ8A 1GL8A 1J0FA 1M9BA 5JCWA 2IMKA 2H6XA 3PR8A 2JZRA 4RQXA 2C3NA 3QR6A 1GTUA 3QFAC 3IK7A 4USSA 2C80A 1EOHA 3H1NA 1PN9A 3GN3A 1QGVA 3VWVA 2C0FA 1ZMAA 4V2NA 2QSIA 4XS4B 1VF1A 4YKGA 1Z6MA 1XWKA 4KUNA 1SKWB 3UARA 2VL2C 3C1RA 4TRXA 2AJQB 4IP6A 3TDGA 5AGYA 5IPHA 3KTBA 3E9JB 3ZFLA 5EPFA 5COHA 4AGSA 1AIUA 4EC0A 4MH2A 2QKEA 5CRDA 1TK5B 4PURA 4I2UA 2NPBA 2CVBA 5IIZA 3RHBA 3DYRA 1QUWA 3L4NA 3C8EA 3L9VA 1IYIA 2HRFA 3IHQA 1G6WA 1SKRB 3VK9A 1M0UA 13GSA 20GSA 5J3RA 1OKTA 3C71A 1F2EA 4G10A 1B4QA 1V57A 3VI5A 4IELA 4FYUA 1T7PB 3HHVA 16GSA 2IWTA 3S9FA 2LJRA 5HFKA 3KCMA 5LD0A 2CT6A 4FQUA 1K0NA 2V41A 3A5IA 1OE7A 3I69A 1EWXA 3TJJA 3G7IA 4BVYB 3O3TA 5B7CA 1XW5A 1A0RP 1JZDA 3WGXA 3ERGA 2J9HA 1FO5A 2IPAA 1GRXA 1PL2A 3UEMA 5G2ZA 1A0FA 4XHMA 5CNWA 3UJ1A 4JU5A 2F51A 4X43A 4WKWA 2OA7A 2A2SA 8GSSA 3GX8A 4G0IA 4O7HA 1OYJA 2VCQA 4O5UA 5A4VA 1HYUA 2XBQA 17GSA 1LBKA 1O73A 2B5YA 1ERVA 1FAAA 3UAPA 4F82A 1X9SB 1FW1A 1G0TA 1PMTA 4RI6A 1NW2A 5EVOA 2J23A 2H8LA 3LG6A 2VL9A 2GTUA 1J08A 4D73B 1TRSA 4ML6A 3VPQA 3APOA 2O85A 3FZ9A 1TRVA 3BBYA 4OFTA 5D73A 3HD5A 4WEYA 3UVTA 1MDKA 3N9JA 2H76A 4IQAA 1M9AA 3EWLA 4K1FA 4ZB8A 1K0OA 5ECHB 4L0UA 4Z2RA 3QDNA 1Z5YE 2D2ZA 1Q4JA 4V2MA 3WT1A 1SENA 1MDIA 4MZCA 4MZWA 4ZL8A 3A2WA 5ECMB 4K8MA 2OBKA 2YJHA 2YZHA 2HRAA 3KMOA 4LA1A 4OFNA 2M80A 1VGLA 4ILFA 3F6DA 2HNLA 2RIIA 1XXUA 3GH6A 2KLXA 1U88A 4BPYA 2AB6A 3DEXA 3RBTA 2OE1A 3WGDA 1ZCPA 2H01A 1SK1A 1WJKA 1R4WA 3ZIVA 4E8HA 3TJGA 3ERFA 3SWLA 2LNSA 2K18A 4EIQA 4O5RA 4F03A 5IMCA 1M2AA 1TP9A 18GSA 2MZCA 2X4AA 2JZTA 2XBIA 4NMUA 2GSRA 1GP1A 1K0CA 2FWGA 1B4PA 2ZNMA 1VF3A 1ZYNA 4ISDA 5G5EA 2HE3A 1TK0B 2C0DA 2E2MA 2L4CA 3KZQA 4TVEA 4ZIJA 2R3XA 3KGKA 4IKHA 3J7Yk 4BVXB 5KN0A 4D73A 3WYWA 4ZL7A 2DIZA 2PU9C 1G7OA 2HZEA 1AUCA 1KNGA 2JZSA 3K8NA 1XZOA 5GAPD 2IFQB 2GT5A 1TDIA 2GT6A 4IJIA 5CREA 2C1YA 1FVKA 4TOPA 5CRHA 3ZREA 4K5SA 5KOXA 2JADA 4I5QA 3UBKA 3TOUA 3FKFA 3KP8A 2CVDA 4BA7A 1V9WA 1F3AA 2TRXA 1ACVA 2X8GA 1MD4A 4TXVA 4ZXGA 1SJ6A 3EU4A 5CRWA 3VWXA 2H6ZA 2VCZA 5HR2A 1UA5A 3DXBA 2LSTA 2FHEA 1PRXA 3Q6OA 4IS0A 3ZL5A 3TB2A 3ZTLA 2FD3A 1ZYPA 4ECCA 1WP0A 3IV4A 3GKMA 5E4WA 2VIMA 5ELAA 3RPNA 4IP1A 2X8HA 1ERUA 2FWEA 4K7OA 3Q18A 1Y6EA 3L9UA 1OC3A 4ICYA 1EGOA 2CA8A 2YNXA 5A5KA 3CYNA 2HXKA 2P5QA 3F6FA 5D93A 5FT3A 2FA4A 5H5SA 1MEKA 4OCFA 3VLNA 3HVVA 5G31A 6GSXA 1HNBA 1WMJA 3F4RA 4PUFC 2H0IA 4FIWA 1XOBA 1OKDA 4BVXA 2CX3A 3W8SA 3HJPA 3IXRA 2EC4A 1NHYA 3FZAA 4TN8A 4AF2A 4L8EA 3ZZXA 1FVJA 1QMVA 1SYRA 3IAS2 3QAGA 1MDJA 4L0WA 4V2LA 5A4WA 1ZYQB 4KSMA 1DE1A 1EP7A 4NXIA 1SD8A 4GRFA 3FR9A 3LXZA 3GA4A 3DD3A 4KB3A 3ZLPA 2GSTA 3V1WA 4G2EA 3KJYA 4MJBA 2DSAA 4ZBBA 2VD0A 4HUAA 3HY2A 3IPZA 2PBJA 4J2FA 2B1LA 4KDXA 2OE0A 3IC8A 5HR0A 1T4YA 4EDYA 5INYA 1EV9A 3TGZA 2X8CA 2KOKA 3LSZA 4ID0A 2Z9SA 1VF4A 3R3EA 1GLQA 2HFDA 3W8JA 1Y25A 3RDWA 1NM3A 2A4VA 1B8XA 4HJ2A 4MA9A 3G7JA 4MMMA 1SK0A 2XHFA 5B6MA 1ERTA 2VM2A 5D9TA 2YV7A 3O76A 3IRAA 2GZPA 3DVXA 2CV4A 5A4UA 3D4MA 4PUAA 2LJKA 4X1UA 4MF7A 1V40A 2H0GA 4ECBA 5JWQB 19GSA 4MNNA 2VOCA 2YANA 4KSOA 2HI7A 5IO2A 4LLRA 3F0IA 2H6YA 2X64A 2LQQA 2IMDA 2FNOA 3US3A 4ZBAA 4FO5A 5IMDA 1U87A 2N5BA 4LL4B 4GSNA 3E3EA 3H93A 1T00A 3I9V2 1ZYEA 3IAM2 3IE3A 1V98A 5ECIB 4EL1A 2WJUA 2JSYA 3IA1A 5DVBA 1ILOA 3NOFA 1F6MC 2K8SA 4EDZA 4ECIA 4ULXA 4KW6A 5ECKB 2LRNA 4Z2TA 3GKKA 5JCUA 4G0LA 1PX6A 2MYGA 3L78A 3CSJA 4NV2A 2VLVA 1YKCA 3P90A 3APSA 1SK2A 3IC4A 1DUGA 3ZFBA 4KAEA 1OAZA 2WS2A 3ME8A 3FMWA 3CSIA 1ZL9A 2R4VA 4GLTA 4DSQA 1GWCA 2H30A 1MTCA 4EF0A 4POLA 5KN1A 3FK8A 3M9JA 1U3AA 4XRDA 3KH9A 3A2XA 1WIKA 2YWMA 4WR4A 1VRSD 3CTGA 1OE8A 4CY6A 1A8LA 5CYYA 10GSA 2NTOA 1R5AA 1YEPA 2DJKA 2BTOT 1BEDA 4GXZA 3MYDA 1TRWA 1CQHA 4F9ZA 5DAKA 2LQOA 3ERWA 1EZKA 2G0FA 3PINA 2VL2A 4KCEA 5ID2A 1B9YC 2MMOA 1SL1B 1QK8A 2FLSA 4TW5A 3EPTA 4ECJA 5D9XA 2R5GA 1S3CA 1W4VA 2VCWA 2WB9A 1HNAA 2CZ3A 1Z6NA 2A4HA 5CAXA 1YF0A 4N10A 2DKIA 2KUCA 2F3MA 3TKSE 1U6TA 4NHWA 1N8JA 2L4QA 1A24A 2VAFA 2LV3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P7X A;  1PX7 A;  2NDO A;  3KTL A;  3G9B A;  2X99 A;  3TRX A;  3UBL A;  3H8Q A;  1IYH A;  3ZYW A;  4MH3 A;  2IL3 A;  2ON7 A;  1BG5 A;  3GMF A;  5AIX A;  4WET A;  3TKQ A;  3RAZ A;  4ZB6 A;  5ELG A;  4IJ3 A;  1R26 A;  1K0M A;  5F0G A;  1XWA A;  3IBH A;  5DCG A;  4ZL9 A;  2N5F A;  1XW9 A;  1K0B A;  4RQR A;  2V6K A;  1ZGN A;  4HS1 A;  2FY6 A;  1BJX A;  3D5J A;  4N0Z A;  2DJ2 A;  4OD7 A;  2GZZ A;  2JAC A;  1AC1 A;  3W6G A;  4MP4 A;  2C4J A;  4I97 A;  1KEB A;  3DRN A;  2YV9 A;  4POB A;  5D8I A;  2H75 A;  2HZE B;  4WXT A;  1K0D A;  2MMZ A;  2GSQ A;  1R7H A;  3TJK A;  2LS5 A;  4K0G A;  1THO A;  1XIY A;  3QOU A;  2I1U A;  4V1A g;  3UIW A;  1XWC A;  4Q5F A;  3GX0 A;  3ME7 A;  1K0A A;  2DJJ A;  3F63 A;  5IOW A;  4JRR A;  4Z7X A;  5IPG A;  1X9W B;  2WCI A;  2O7K A;  2YPM A;  4Q5Q A;  2BJX A;  1V2A A;  4K7N A;  1SU9 A;  3I43 A;  2H1G A;  5H5R A;  4IVF A;  2DJ0 A;  3LYP A;  1YZX A;  4J57 E;  1KTE A;  2GS3 A;  1Z3E A;  2IJY A;  1PGT A;  3UOM A;  4K9Z A;  12GS A;  1K3O A;  3QAW A;  1PKW A;  3HYP A;  2DIY A;  3VWW A;  5ECR B;  2F8A A;  3LQ7 A;  4F0B A;  1XW6 A;  1WPI A;  1M99 A;  3AY8 A;  2ON5 A;  1VF2 A;  1GTB A;  3GTU A;  3HVS A;  5FWG A;  3GKN A;  3UVH A;  4PNG A;  4KX4 A;  2CVK A;  5G30 A;  4YQM A;  1I5G A;  2V6O A;  4LL1 B;  5AIV A;  2I9H A;  3KEB A;  3GYK A;  1XVW A;  1HQO A;  4FH8 A;  4X0X A;  4BWQ A;  2WUL A;  3GHA A;  3TCO A;  3D6I A;  1AQX A;  2O87 A;  5ECO B;  3EC3 A;  3IDV A;  4DEJ A;  3F4S A;  1TW9 A;  3CRT A;  2RM5 A;  5J5N A;  3HZ4 A;  4KCA A;  2PN8 A;  3GV1 A;  2FWF A;  4P3Y B;  5J41 A;  4IN0 A;  1FHE A;  2PPT A;  3C73 A;  3M0F A;  4AJ7 A;  3NZN A;  4POM A;  2B5X A;  1LJR A;  1EEJ A;  1XCC A;  2B1K A;  2VCV A;  1K3L A;  2GVP A;  3FYG A;  2LTK A;  1OC9 B;  3QD9 A;  3D4T A;  3ZIJ A;  1A2J A;  1GLP A;  4O92 A;  1J9B A;  1YF1 A;  5DQY A;  2L57 A;  2HRN A;  4PX1 A;  2O8V B;  3C1S A;  5C00 A;  2LRC A;  2PVQ A;  5ECQ B;  2R2J A;  1E6B A;  4JBB A;  2E0Q A;  1NHO A;  3IOS A;  4H86 A;  4EXJ A;  3GST A;  2DJ3 A;  4L5O A;  3ZVJ D;  5IMF A;  4KA0 A;  2GGT A;  2LRT A;  3DML A;  1WOU A;  1PD2 1;  3RPP A;  5F06 A;  2H73 A;  4DSS B;  2YN1 A;  3TRQ A;  2VL3 A;  3MNG A;  3GRX A;  3VWU A;  4QL9 A;  1SYX A;  2K9F A;  4XS6 A;  2HT9 A;  2K6V A;  6GSV A;  3WGE A;  2ZUP A;  3KH7 A;  3HVX A;  2VM1 A;  5KN2 A;  1K3Y A;  3NIV A;  4DVC A;  3GFK A;  4MK3 A;  3TUE A;  3EMP A;  4I6X A;  3U5R E;  1YY7 A;  3GL3 A;  1M2B A;  4IW9 A;  1T4Z A;  4KH7 A;  1GUL A;  5GSS A;  3FZ4 A;  3N5O A;  4TXO B;  1FOV A;  3HDC A;  4JED A;  4HEA 2;  2WZ9 A;  2XPE A;  3HXS A;  2DBC A;  2F9S A;  5JCG A;  2AAW A;  2CAI A;  1GSE A;  3DKS A;  3HKR A;  4WF5 A;  3FEU A;  5IOX A;  2DLX A;  2G2Q A;  5L71 A;  1Q98 A;  3KXO A;  1PQN A;  1A2L A;  3M8N A;  2ZCT A;  5DJL A;  1B9X C;  1OC9 A;  4HQZ A;  1C72 A;  3KMN A;  3FR6 A;  5ABR A;  2YZU A;  4NAX A;  1G6Y A;  1A8Y A;  1SL0 B;  2H72 A;  1UC7 A;  2L6D A;  5LNK e;  2EIO A;  1DSB A;  1ERW A;  1YJ6 A;  1NSW A;  2MBS A;  2B3S A;  4NPB A;  2JL4 A;  4F2I A;  5C04 A;  3LOR A;  1F9M A;  4YAP A;  3BCI A;  3BD2 A;  4JZQ A;  2VCT A;  4BWS A;  4DSR A;  4BL7 A;  2YWI A;  3GSS A;  2OAC A;  4HQS A;  4OO4 A;  4N0V A;  4DSS A;  3FZ5 A;  2H70 A;  3HA9 A;  4MPF A;  2FCH A;  2VD1 A;  4FYC A;  1AQW A;  4EVM A;  4MPG A;  2M72 A;  3LFL A;  1ST9 A;  2OE3 A;  3E0U A;  5GAN D;  3BOA A;  3TRP A;  3FHK A;  1EP8 A;  5DAK B;  4MLY A;  4YH2 A;  2IIY A;  3F3Q A;  1BX9 A;  4K0N A;  2WGR A;  1ON4 A;  1T1V A;  2LEG A;  1OVN A;  2PMT A;  2IMI A;  4HZ2 A;  3DWV A;  5ID2 B;  3CBU A;  2LNT A;  1XVQ A;  4NV5 A;  1X5E A;  2EIR A;  2MMA A;  2H74 A;  3GIX A;  1TKD B;  4TXO A;  1TTZ A;  3L0H A;  1GSU A;  3LGC A;  2K8V A;  3H4K A;  2YP6 A;  5ENU A;  1M2D A;  1THX A;  3KD0 A;  4HDE A;  4KE3 A;  4WR5 A;  2YCD A;  1WE0 A;  1RK4 A;  3HCZ A;  3M3M A;  5HR1 A;  2EIQ A;  4PQH A;  4QQ7 A;  1XOA A;  4PGT A;  4KDY A;  3DIE A;  5J9C A;  4YQU A;  1A2M A;  4PXO A;  5F8B A;  1A23 A;  3FR3 A;  1PKZ A;  5ECS A;  3APQ A;  1GUM A;  3R2Q A;  1BQ7 A;  3LXT A;  2R6K A;  2BMX A;  4TR1 A;  4AJ6 A;  3F4T A;  3C7M A;  3RHC A;  1GNE A;  5ECP B;  6GST A;  1E2Y A;  5GZZ B;  3TJF A;  3Q19 A;  2HSH A;  1GSQ A;  3MAK A;  1ZZY A;  2H19 A;  1O8X A;  5J9B A;  1O6J A;  2GSS A;  3EVI A;  3DGQ A;  5EY6 A;  2M46 A;  1JLV A;  1S3D A;  3CTF A;  5DJM A;  1XPV A;  1GTI A;  4HOJ A;  3EUR A;  5F05 A;  2GLR A;  1PL1 A;  4EE0 A;  3G7Y A;  3GUS A;  3SBC A;  1I9D A;  2C3Q A;  1EEM A;  2C8U A;  5GST A;  1ZOF A;  5JWR B;  1U3I A;  3PGT A;  3CXG A;  4YQV A;  3UMA A;  3HZ8 A;  3EE2 A;  1AXD A;  5E59 A;  1FB0 A;  2DMM A;  4XCS A;  3KIJ A;  4PQI A;  2REM A;  4MJE A;  4MZB A;  1GUH A;  1O85 A;  1G7E A;  4Q5R A;  5G1K A;  1GSS A;  4TKY A;  2IME A;  3TOT A;  4CHS A;  5ECL B;  2KP1 A;  1WRY A;  4JR4 A;  3QAV A;  5G1L A;  11GS A;  3TJB A;  1TU7 A;  2VCX A;  2YJ7 A;  3F3R A;  4IHU A;  5DDL A;  1H75 A;  4OO5 A;  4LMV A;  1H4O A;  2AUV A;  2OKA A;  4K2D A;  5D9V A;  3EMX A;  1FB6 A;  1PA3 A;  5CP1 A;  1TK8 B;  4EO3 A;  6GSU A;  4RUV A;  5KN3 A;  4N30 A;  3OR5 A;  3GTU B;  5JWO B;  3LEF A;  1QFN A;  1Z7P A;  4OFM A;  5F07 A;  2C3T A;  3UL3 A;  2RUE A;  1YKA A;  4HI7 A;  1FG4 A;  3PH9 A;  5H5Q A;  4YAV A;  2LKU A;  2FUG 2;  2QC7 A;  5IQY A;  1Z7R A;  1X9M B;  1GSD A;  4IBP A;  2L5L A;  2P0G A;  2LJA A;  5KEJ A;  1QXH A;  1GUK A;  4XS4 A;  3HJO A;  4KND A;  2R37 A;  3LYK A;  4L5L A;  5ECN B;  2ALB A;  2PWJ A;  3MWH A;  2PGT A;  1ABA A;  2YWO A;  4AJ8 A;  2B7J A;  4J56 E;  5EL8 A;  5DAL B;  2MBT A;  3GL5 A;  1JZO A;  3VFI A;  2L5O A;  4XTS A;  2GDR A;  3KP9 A;  2C0G A;  2DJ1 A;  5B6N A;  3EIN A;  1AQV A;  4HZ4 A;  1TXX A;  1BAY A;  2FGX A;  3QMX A;  1V58 A;  1BYE A;  4XRA A;  1XBS A;  4TR4 A;  3FW2 A;  1B48 A;  5HFI A;  4F0C A;  4GQF A;  4MAB A;  3MDK A;  3A3T A;  4OCE A;  5AN1 A;  1UN2 A;  2N5A A;  4FYB A;  2ES7 A;  2L6C A;  5B8A A;  3CRU A;  2NVL A;  4HU9 A;  1TI3 A;  1N2A A;  3D22 A;  1X0R A;  3ZMK A;  5DCH A;  2H66 A;  4GSS A;  1DBY A;  1M7T A;  2I81 A;  1XWB A;  1JZR A;  6GSW A;  2PVO C;  1TU8 A;  5B8B A;  4BVY A;  2VUP A;  3QFB C;  4NWY A;  2O89 A;  1WWJ A;  3EYT A;  5CO3 A;  2VO4 A;  14GS A;  3ISO A;  5J4U A;  3BJ5 A;  3I6A A;  1JZW A;  4ACS A;  1KBN A;  3H79 A;  3ZVJ A;  4LMW A;  1HNC A;  2LUS A;  2RLI A;  1ML6 A;  4GCI A;  2V2G A;  2P5R A;  22GS A;  1XWG A;  5CRG A;  4POK A;  2GQL A;  3D0Z A;  4MJA A;  4K6X A;  1EV4 A;  3CSH A;  3LJR A;  3A2V A;  4MF6 A;  2H0H A;  2AHE A;  5DAL A;  2DC5 A;  4N11 A;  1O7U A;  3BCK A;  1GNW A;  1HD2 A;  1YDK A;  3MSZ A;  1GH2 A;  1PSQ A;  3TKP A;  3DVW A;  4JE1 A;  2IN3 A;  2XC2 A;  4MF5 A;  3JCM L;  2HZF A;  1YQ1 A;  2GQK A;  1QQ2 A;  3IR4 A;  4GF0 A;  3GH9 A;  4XS1 A;  4O32 A;  5IMA A;  2C0E A;  4HJM A;  2CZ2 A;  4ML1 A;  4PNF A;  2F8F A;  4V1A p;  1SL2 B;  1F3B A;  4CDO A;  3L9S A;  3TKR A;  1T8E B;  2HLS A;  2H1D A;  4EKZ A;  4Q5N A;  3FRC A;  4EUY A;  1JFU A;  1SD9 A;  2B6M A;  2CQ9 A;  3Q74 A;  5D96 A;  3WT2 A;  5AIS A;  2FWH A;  3M1G A;  1R5P A;  1MD3 A;  2JSZ A;  3WD6 A;  1F37 A;  2H1A A;  2RUF A;  3IK9 A;  4RI7 A;  2I4A A;  5HFG A;  1TRU A;  3TKS C;  2B5E A;  1URM A;  7GSS A;  3F9U A;  1UVZ A;  4E8E A;  3D21 A;  2WDU A;  2V1M A;  5LCZ A;  1TOF A;  1GTA A;  2E7P A;  2HSY A;  2RM6 A;  3A5W A;  4G9H A;  1X5C A;  1DE2 A;  2TRC P;  1SJZ A;  2E2G A;  6GSS A;  3QPM A;  2NBS A;  1JHB A;  2HYX A;  5DQS A;  1RW1 A;  3GKX A;  4IQ1 A;  1T3B A;  1LU4 A;  1O8W A;  4WBJ A;  4IGJ A;  3FY7 A;  3ZML A;  3U6V A;  3GUR A;  3ZIT A;  1W89 A;  4ZIL A;  3O6T A;  3TKS A;  2OAD A;  2AV4 A;  3P2A A;  2TIR A;  2DML A;  4HU7 A;  5IO0 A;  5HQP A;  2OJL A;  2H71 A;  2PUK C;  3VI7 A;  2CAQ A;  1EOG A;  2IFQ A;  1RQM A;  2QGV A;  1TI1 A;  1S3A A;  4TR1 B;  2H1B A;  2AYT A;  5D9W A;  2VLU A;  4GWR A;  2PER A;  3J7Y b;  3CMI A;  3F8U A;  5HR3 A;  1EGR A;  2XPD A;  2CX4 A;  3QCP A;  4NHZ A;  4WBR D;  3LWA A;  1USB A;  2WFC A;  5G5F A;  2VLT A;  2I3Y A;  3ZRD A;  4ZBD A;  2YWN A;  5IMV A;  1GSF A;  2A2R A;  3GNJ A;  2WRT A;  2L59 A;  2MMN A;  1GSY A;  3ED3 A;  2KP2 A;  1SKS B;  4JR6 A;  2KHP A;  4CW9 A;  3EU3 A;  1CQG A;  1JLW A;  1SJI A;  4TR3 A;  4ZB9 A;  4MDC A;  1Z9H A;  2V32 A;  1XFL A;  4I8B A;  3HJM A;  5IMZ A;  4XIH A;  4OWY A;  4KGI A;  4OMV A;  4MCU A;  2YOI A;  4TR0 A;  2FA8 A;  3VPT A;  1O81 A;  5FHI A;  4GST A;  4MJC A;  2JU5 A;  4QL7 A;  2GZY A;  4KDU A;  5IM9 A;  4G19 A;  2OBI A;  4GQC A;  1AW9 A;  5DBQ A;  1X5D A;  2P31 A;  4I2T A;  2B7K A;  2GQM A;  1TJD A;  1AAZ A;  1OC8 A;  3KM6 A;  3P8W A;  4PQ1 A;  2IMF A;  1YEX A;  4K7I A;  6GSY A;  3M9K A;  4GTU A;  4WF4 A;  9GSS A;  3VUR A;  1GL8 A;  1J0F A;  1M9B A;  5JCW A;  2IMK A;  2H6X A;  3PR8 A;  2JZR A;  4RQX A;  2C3N A;  3QR6 A;  1GTU A;  3QFA C;  3IK7 A;  2C80 A;  1EOH A;  3H1N A;  1PN9 A;  3GN3 A;  1QGV A;  3VWV A;  2C0F A;  1ZMA A;  4V2N A;  2QSI A;  4XS4 B;  1VF1 A;  1Z6M A;  1XWK A;  4KUN A;  1SKW B;  3UAR A;  2VL2 C;  3C1R A;  4TRX A;  2AJQ B;  4IP6 A;  3TDG A;  5AGY A;  5IPH A;  3KTB A;  3E9J B;  3ZFL A;  5EPF A;  5COH A;  4AGS A;  1AIU A;  4EC0 A;  4MH2 A;  2QKE A;  5CRD A;  1TK5 B;  4PUR A;  4I2U A;  2NPB A;  2CVB A;  5IIZ A;  3RHB A;  3DYR A;  1QUW A;  3L4N A;  3C8E A;  3L9V A;  1IYI A;  2HRF A;  3IHQ A;  1G6W A;  1SKR B;  3VK9 A;  1M0U A;  13GS A;  20GS A;  5J3R A;  1OKT A;  3C71 A;  1F2E A;  4G10 A;  1B4Q A;  1V57 A;  3VI5 A;  4IEL A;  4FYU A;  1T7P B;  3HHV A;  16GS A;  2IWT A;  3S9F A;  2LJR A;  5HFK A;  3KCM A;  5LD0 A;  2CT6 A;  1K0N A;  2V41 A;  1OE7 A;  3I69 A;  1EWX A;  3TJJ A;  3G7I A;  3O3T A;  5B7C A;  1XW5 A;  1A0R P;  1JZD A;  3WGX A;  3ERG A;  2J9H A;  1FO5 A;  2IPA A;  1GRX A;  1PL2 A;  3UEM A;  5G2Z A;  1A0F A;  4XHM A;  5CNW A;  3UJ1 A;  4JU5 A;  2F51 A;  4X43 A;  4WKW A;  2OA7 A;  2A2S A;  8GSS A;  3GX8 A;  4O7H A;  1OYJ A;  2VCQ A;  5A4V A;  1HYU A;  2XBQ A;  17GS A;  1LBK A;  1O73 A;  2B5Y A;  1ERV A;  1FAA A;  3UAP A;  4F82 A;  1X9S B;  1FW1 A;  1G0T A;  1PMT A;  4RI6 A;  1NW2 A;  5EVO A;  2J23 A;  2H8L A;  3LG6 A;  2VL9 A;  2GTU A;  1J08 A;  4D73 B;  1TRS A;  4ML6 A;  3VPQ A;  3APO A;  2O85 A;  3FZ9 A;  1TRV A;  3BBY A;  4OFT A;  5D73 A;  3HD5 A;  4WEY A;  3UVT A;  1MDK A;  3N9J A;  2H76 A;  4IQA A;  1M9A A;  3EWL A;  4K1F A;  4ZB8 A;  1K0O A;  5ECH B;  4L0U A;  3QDN A;  1Z5Y E;  2D2Z A;  1Q4J A;  4V2M A;  3WT1 A;  1SEN A;  1MDI A;  4MZC A;  4MZW A;  4ZL8 A;  3A2W A;  5ECM B;  4K8M A;  2OBK A;  2YJH A;  2YZH A;  3KMO A;  4LA1 A;  4OFN A;  2M80 A;  1VGL A;  4ILF A;  3F6D A;  2HNL A;  2RII A;  1XXU A;  3GH6 A;  2KLX A;  1U88 A;  4BPY A;  2AB6 A;  3DEX A;  3RBT A;  2OE1 A;  3WGD A;  1ZCP A;  2H01 A;  1SK1 A;  1WJK A;  1R4W A;  3ZIV A;  4E8H A;  3TJG A;  3ERF A;  3SWL A;  2LNS A;  2K18 A;  4O5R A;  4F03 A;  5IMC A;  1M2A A;  1TP9 A;  18GS A;  2MZC A;  2JZT A;  2XBI A;  4NMU A;  2GSR A;  1GP1 A;  1K0C A;  2FWG A;  1B4P A;  2ZNM A;  1VF3 A;  4ISD A;  5G5E A;  2HE3 A;  1TK0 B;  2C0D A;  2E2M A;  2L4C A;  3KZQ A;  4TVE A;  4ZIJ A;  2R3X A;  3KGK A;  4IKH A;  3J7Y k;  5KN0 A;  4D73 A;  3WYW A;  4ZL7 A;  2DIZ A;  2PU9 C;  1G7O A;  2HZE A;  1AUC A;  1KNG A;  2JZS A;  3K8N A;  1XZO A;  5GAP D;  2IFQ B;  2GT5 A;  1TDI A;  2GT6 A;  4IJI A;  5CRE A;  2C1Y A;  1FVK A;  4TOP A;  5CRH A;  3ZRE A;  2JAD A;  4I5Q A;  3UBK A;  3TOU A;  3FKF A;  3KP8 A;  2CVD A;  4BA7 A;  1V9W A;  1F3A A;  2TRX A;  1ACV A;  2X8G A;  1MD4 A;  4TXV A;  4ZXG A;  1SJ6 A;  3EU4 A;  5CRW A;  3VWX A;  2H6Z A;  2VCZ A;  5HR2 A;  1UA5 A;  3DXB A;  2LST A;  2FHE A;  1PRX A;  3Q6O A;  4IS0 A;  3ZL5 A;  3TB2 A;  3ZTL A;  2FD3 A;  4ECC A;  1WP0 A;  3IV4 A;  3GKM A;  5E4W A;  2VIM A;  5ELA A;  3RPN A;  4IP1 A;  2X8H A;  1ERU A;  2FWE A;  4K7O A;  3Q18 A;  1Y6E A;  3L9U A;  1OC3 A;  1EGO A;  2CA8 A;  2YNX A;  5A5K A;  3CYN A;  2HXK A;  2P5Q A;  3F6F A;  5D93 A;  5FT3 A;  2FA4 A;  5H5S A;  1MEK A;  4OCF A;  3VLN A;  3HVV A;  5G31 A;  6GSX A;  1HNB A;  1WMJ A;  3F4R A;  4PUF C;  2H0I A;  4FIW A;  1XOB A;  1OKD A;  4BVX A;  2CX3 A;  3W8S A;  3HJP A;  3IXR A;  2EC4 A;  1NHY A;  3FZA A;  4TN8 A;  4AF2 A;  4L8E A;  3ZZX A;  1FVJ A;  1QMV A;  1SYR A;  3IAS 2;  3QAG A;  1MDJ A;  4L0W A;  4V2L A;  5A4W A;  1ZYQ B;  4KSM A;  1DE1 A;  1EP7 A;  4NXI A;  1SD8 A;  4GRF A;  3FR9 A;  3LXZ A;  3GA4 A;  3DD3 A;  4KB3 A;  3ZLP A;  2GST A;  3V1W A;  4G2E A;  3KJY A;  4MJB A;  2DSA A;  4ZBB A;  2VD0 A;  4HUA A;  3HY2 A;  3IPZ A;  2PBJ A;  4J2F A;  2B1L A;  4KDX A;  2OE0 A;  5HR0 A;  1T4Y A;  4EDY A;  5INY A;  1EV9 A;  3TGZ A;  2X8C A;  2KOK A;  3LSZ A;  4ID0 A;  2Z9S A;  1VF4 A;  1GLQ A;  2HFD A;  3W8J A;  1Y25 A;  3RDW A;  1NM3 A;  2A4V A;  1B8X A;  4HJ2 A;  4MA9 A;  3G7J A;  4MMM A;  1SK0 A;  2XHF A;  5B6M A;  1ERT A;  2VM2 A;  5D9T A;  2YV7 A;  3O76 A;  3IRA A;  2GZP A;  3DVX A;  2CV4 A;  5A4U A;  3D4M A;  4PUA A;  2LJK A;  4X1U A;  4MF7 A;  1V40 A;  2H0G A;  4ECB A;  5JWQ B;  19GS A;  2VOC A;  2YAN A;  4KSO A;  2HI7 A;  5IO2 A;  4LLR A;  3F0I A;  2H6Y A;  2X64 A;  2LQQ A;  2IMD A;  2FNO A;  3US3 A;  4ZBA A;  4FO5 A;  5IMD A;  1U87 A;  2N5B A;  4LL4 B;  4GSN A;  3E3E A;  3H93 A;  1T00 A;  3I9V 2;  1ZYE A;  3IAM 2;  3IE3 A;  1V98 A;  5ECI B;  4EL1 A;  2WJU A;  2JSY A;  3IA1 A;  5DVB A;  1ILO A;  3NOF A;  1F6M C;  2K8S A;  4EDZ A;  4ECI A;  4ULX A;  4KW6 A;  5ECK B;  2LRN A;  3GKK A;  5JCU A;  1PX6 A;  2MYG A;  3L78 A;  3CSJ A;  4NV2 A;  2VLV A;  1YKC A;  3P90 A;  3APS A;  1SK2 A;  3IC4 A;  1DUG A;  3ZFB A;  4KAE A;  1OAZ A;  2WS2 A;  3ME8 A;  3CSI A;  1ZL9 A;  2R4V A;  4GLT A;  4DSQ A;  1GWC A;  2H30 A;  1MTC A;  4EF0 A;  4POL A;  5KN1 A;  3FK8 A;  3M9J A;  1U3A A;  4XRD A;  3KH9 A;  3A2X A;  1WIK A;  2YWM A;  4WR4 A;  1VRS D;  3CTG A;  1OE8 A;  1A8L A;  5CYY A;  10GS A;  2NTO A;  1R5A A;  1YEP A;  2DJK A;  2BTO T;  1BED A;  4GXZ A;  1TRW A;  1CQH A;  4F9Z A;  5DAK A;  2LQO A;  3ERW A;  1EZK A;  2G0F A;  3PIN A;  2VL2 A;  4KCE A;  5ID2 A;  1B9Y C;  2MMO A;  1SL1 B;  1QK8 A;  2FLS A;  4TW5 A;  4ECJ A;  5D9X A;  2R5G A;  1S3C A;  1W4V A;  2VCW A;  2WB9 A;  1HNA A;  2CZ3 A;  1Z6N A;  5CAX A;  1YF0 A;  4N10 A;  2KUC A;  2F3M A;  3TKS E;  1U6T A;  4NHW A;  1N8J A;  2L4Q A;  1A24 A;  2VAF A;  2LV3 A; 
#chains in the Genus database with same CATH topology
 3P7X A;  1PX7 A;  2NDO A;  3KTL A;  3G9B A;  2X99 A;  3TRX A;  3UBL A;  3H8Q A;  1IYH A;  3ZYW A;  4MH3 A;  2IL3 A;  2ON7 A;  4X4J A;  1BG5 A;  3GMF A;  5AIX A;  4WET A;  3TKQ A;  3RAZ A;  4ZB6 A;  5ELG A;  4IJ3 A;  1R26 A;  1K0M A;  5F0G A;  1XWA A;  3IBH A;  5DCG A;  4ZL9 A;  2N5F A;  1XW9 A;  1K0B A;  4RQR A;  2V6K A;  1ZGN A;  4HS1 A;  2FY6 A;  1BJX A;  3D5J A;  3MIX A;  2DJ2 A;  4N0Z A;  4OD7 A;  2GZZ A;  2JAC A;  1AC1 A;  3W6G A;  4MP4 A;  2C4J A;  4I97 A;  2X49 A;  2A2P A;  1KEB A;  3DRN A;  2YV9 A;  4POB A;  5D8I A;  2H75 A;  2HZE B;  4WXT A;  1K0D A;  2MMZ A;  2GSQ A;  1R7H A;  3TJK A;  2LS5 A;  4K2X A;  4K0G A;  1THO A;  1XIY A;  3QOU A;  2I1U A;  4V1A g;  3UIW A;  1XWC A;  4Q5F A;  3GX0 A;  3ME7 A;  1K0A A;  2DJJ A;  3F63 A;  5IOW A;  4JRR A;  4Z7X A;  5IPG A;  1X9W B;  2WCI A;  2O7K A;  2YPM A;  4Q5Q A;  2BJX A;  1V2A A;  4K7N A;  1SU9 A;  3I43 A;  2H1G A;  5H5R A;  4IVF A;  2DJ0 A;  3LYP A;  1YZX A;  4J57 E;  1KTE A;  2GS3 A;  1Z3E A;  2IJY A;  1PGT A;  3UOM A;  4K9Z A;  12GS A;  1K3O A;  3QAW A;  1PKW A;  3HYP A;  2DIY A;  3VWW A;  5ECR B;  2F8A A;  3LQ7 A;  4F0B A;  1XW6 A;  1WPI A;  1M99 A;  3AY8 A;  2ON5 A;  1VF2 A;  1GTB A;  3GTU A;  3HVS A;  5FWG A;  2DKH A;  3GKN A;  3UVH A;  4PNG A;  4KX4 A;  2CVK A;  5G30 A;  4YQM A;  1I5G A;  2V6O A;  4LL1 B;  5AIV A;  2I9H A;  3KEB A;  3GYK A;  1XVW A;  1HQO A;  4FH8 A;  4X0X A;  4BWQ A;  2WUL A;  3GHA A;  3TCO A;  3D6I A;  1AQX A;  2O87 A;  5ECO B;  3EC3 A;  3IDV A;  4DEJ A;  3F4S A;  1TW9 A;  3CRT A;  2RM5 A;  5J5N A;  3HZ4 A;  4KCA A;  2PN8 A;  3GV1 A;  2FWF A;  4P3Y B;  5KOW A;  4HSC X;  4IN0 A;  1FHE A;  2PPT A;  5J41 A;  3C73 A;  3M0F A;  4AJ7 A;  3NZN A;  4POM A;  2B5X A;  1LJR A;  1EEJ A;  1XCC A;  2B1K A;  2VCV A;  1K3L A;  2GVP A;  3FYG A;  2LTK A;  1OC9 B;  3QD9 A;  3D4T A;  3ZIJ A;  1A2J A;  1GLP A;  4O92 A;  1J9B A;  1YF1 A;  5DQY A;  2L57 A;  2HRN A;  4PX1 A;  2O8V B;  3C1S A;  5C00 A;  2LRC A;  2PVQ A;  5ECQ B;  2R2J A;  1E6B A;  4JBB A;  2E0Q A;  1NHO A;  3IOS A;  4H86 A;  4EXJ A;  3GST A;  2DJ3 A;  4L5O A;  3ZVJ D;  5IMF A;  4KA0 A;  2GGT A;  2LRT A;  2QA1 A;  3DML A;  1WOU A;  1PD2 1;  3RPP A;  5F06 A;  2H73 A;  4DSS B;  2YN1 A;  3TRQ A;  2VL3 A;  3MNG A;  3GRX A;  3VWU A;  4QL9 A;  1SYX A;  2K9F A;  4XS6 A;  2HT9 A;  2K6V A;  6GSV A;  3WGE A;  2ZUP A;  3KH7 A;  3HVX A;  2VM1 A;  5KN2 A;  1K3Y A;  3NIV A;  4DVC A;  3GFK A;  4MK3 A;  3TUE A;  3EMP A;  4I6X A;  3U5R E;  1YY7 A;  3GL3 A;  1M2B A;  4IW9 A;  1T4Z A;  4KH7 A;  1GUL A;  5GSS A;  3FZ4 A;  3N5O A;  4TXO B;  1FOV A;  3HDC A;  4JED A;  4HEA 2;  2WZ9 A;  2XPE A;  3IHG A;  3HXS A;  2DBC A;  2F9S A;  5JCG A;  2AAW A;  2CAI A;  3LW9 A;  1GSE A;  3DKS A;  3HKR A;  4WF5 A;  3FEU A;  5IOX A;  2DLX A;  2G2Q A;  5L71 A;  1Q98 A;  3KXO A;  1PQN A;  1A2L A;  3M8N A;  2ZCT A;  5DJL A;  1B9X C;  1OC9 A;  4HQZ A;  1C72 A;  3KMN A;  3FR6 A;  5ABR A;  2YZU A;  4NAX A;  1G6Y A;  1A8Y A;  1SL0 B;  2H72 A;  1UC7 A;  2L6D A;  5LNK e;  2EIO A;  1DSB A;  1ERW A;  1YJ6 A;  1NSW A;  2MBS A;  2B3S A;  4NPB A;  2JL4 A;  4F2I A;  5C04 A;  3LOR A;  1F9M A;  4YAP A;  3BCI A;  3BD2 A;  4JZQ A;  2VCT A;  4BWS A;  4DSR A;  4BL7 A;  2YWI A;  3GSS A;  2OAC A;  4HQS A;  4OO4 A;  4N0V A;  4DSS A;  3FZ5 A;  2H70 A;  3HA9 A;  4MPF A;  2FCH A;  2VD1 A;  4FYC A;  1AQW A;  4EVM A;  4MPG A;  2M72 A;  3LFL A;  1ST9 A;  2OE3 A;  3E0U A;  5GAN D;  3BOA A;  3TRP A;  3FHK A;  1EP8 A;  4CY8 A;  5DAK B;  4MLY A;  4YH2 A;  2IIY A;  3F3Q A;  1BX9 A;  4K0N A;  2WGR A;  1ON4 A;  1T1V A;  2LEG A;  1OVN A;  2PMT A;  2IMI A;  4HZ2 A;  3DWV A;  5ID2 B;  3CBU A;  2LNT A;  1XVQ A;  4NV5 A;  1X5E A;  2EIR A;  2MMA A;  2H74 A;  3GIX A;  1TKD B;  4TXO A;  1TTZ A;  3L0H A;  1GSU A;  3LGC A;  2K8V A;  3H4K A;  2YP6 A;  5ENU A;  1M2D A;  1THX A;  3KD0 A;  4HDE A;  4KE3 A;  4WR5 A;  2YCD A;  1WE0 A;  1RK4 A;  3HCZ A;  1FOH A;  3M3M A;  5HR1 A;  2EIQ A;  4PQH A;  4QQ7 A;  1XOA A;  4PGT A;  4KDY A;  3DIE A;  5J9C A;  4YQU A;  1A2M A;  4PXO A;  5F8B A;  1A23 A;  3FR3 A;  1PKZ A;  5ECS A;  3APQ A;  1GUM A;  3R2Q A;  1BQ7 A;  3LXT A;  2R6K A;  2BMX A;  4TR1 A;  4AJ6 A;  3F4T A;  3C7M A;  3RHC A;  1GNE A;  5ECP B;  4EIP A;  6GST A;  1E2Y A;  5GZZ B;  3TJF A;  3Q19 A;  2HSH A;  1GSQ A;  3MAK A;  5BMU A;  1ZZY A;  2H19 A;  1O8X A;  1PN0 A;  5J9B A;  1O6J A;  2GSS A;  3EVI A;  3DGQ A;  5EY6 A;  2M46 A;  1JLV A;  1S3D A;  3CTF A;  5DJM A;  1XPV A;  1GTI A;  4HOJ A;  3EUR A;  5F05 A;  2GLR A;  4A5P A;  1PL1 A;  4EE0 A;  3G7Y A;  3GUS A;  3SBC A;  1I9D A;  2C3Q A;  1EEM A;  2C8U A;  5GST A;  2HRK A;  1ZOF A;  5JWR B;  1U3I A;  3PGT A;  3CXG A;  4YQV A;  3UMA A;  3HZ8 A;  3EE2 A;  2R0P A;  1AXD A;  5E59 A;  1FB0 A;  2DMM A;  4XCS A;  3KIJ A;  4PQI A;  2REM A;  4MJE A;  4MZB A;  1GUH A;  1O85 A;  1G7E A;  4Q5R A;  5G1K A;  3HVN A;  1GSS A;  4TKY A;  2IME A;  3TOT A;  4CHS A;  5ECL B;  2KP1 A;  1WRY A;  4JR4 A;  3QAV A;  5G1L A;  11GS A;  3TJB A;  1TU7 A;  2VCX A;  2YJ7 A;  3F3R A;  4IHU A;  5DDL A;  1H75 A;  4OO5 A;  4LMV A;  1H4O A;  2AUV A;  2OKA A;  4K2D A;  5D9V A;  3EMX A;  1FB6 A;  1PA3 A;  5CP1 A;  1TK8 B;  4EO3 A;  6GSU A;  4RUV A;  5KN3 A;  4O5Q A;  4N30 A;  3OR5 A;  3GTU B;  5JWO B;  3LEF A;  1QFN A;  1Z7P A;  4OFM A;  5F07 A;  2C3T A;  3UL3 A;  2RUE A;  1YKA A;  4HI7 A;  1FG4 A;  3PH9 A;  2HSM A;  5H5Q A;  4YAV A;  2LKU A;  2FUG 2;  1PFO A;  2QC7 A;  5IQY A;  1Z7R A;  1X9M B;  1GSD A;  4IBP A;  2L5L A;  2P0G A;  2LJA A;  5KEJ A;  1QXH A;  1GUK A;  4XS4 A;  3HJO A;  4KND A;  2R37 A;  3LYK A;  4L5L A;  5ECN B;  2ALB A;  2PWJ A;  3MWH A;  2PGT A;  1ABA A;  2YWO A;  4AJ8 A;  2B7J A;  4J56 E;  5EL8 A;  5DAL B;  2MBT A;  3GL5 A;  1JZO A;  3VFI A;  2L5O A;  4XTS A;  2GDR A;  3KP9 A;  2C0G A;  2DJ1 A;  4K5R A;  5B6N A;  3EIN A;  1AQV A;  4HZ4 A;  1TXX A;  1BAY A;  2FGX A;  3QMX A;  1V58 A;  1BYE A;  4XRA A;  1XBS A;  4TR4 A;  3FW2 A;  1B48 A;  5HFI A;  4F0C A;  4Z2U A;  4GQF A;  4MAB A;  3MDK A;  3A3T A;  4OCE A;  5AN1 A;  1UN2 A;  2N5A A;  4FYB A;  2ES7 A;  2L6C A;  5B8A A;  3CRU A;  2NVL A;  4HU9 A;  1TI3 A;  1N2A A;  3D22 A;  1X0R A;  3ZMK A;  5DCH A;  2H66 A;  4GSS A;  1DBY A;  1M7T A;  2I81 A;  1XWB A;  1JZR A;  6GSW A;  2PVO C;  1TU8 A;  5B8B A;  4BVY A;  2VUP A;  3QFB C;  4NWY A;  2O89 A;  1WWJ A;  3EYT A;  5CO3 A;  2VO4 A;  14GS A;  3ISO A;  5J4U A;  3BJ5 A;  3I6A A;  1JZW A;  4ACS A;  1KBN A;  3H79 A;  3ZVJ A;  4LMW A;  1HNC A;  2LUS A;  5BRT A;  2RLI A;  1ML6 A;  4GCI A;  2V2G A;  2P5R A;  22GS A;  1XWG A;  5CRG A;  4POK A;  2GQL A;  3D0Z A;  4MJA A;  4K6X A;  1EV4 A;  3CSH A;  3LJR A;  3A2V A;  4MF6 A;  2H0H A;  2AHE A;  3CQF A;  5DAL A;  2DC5 A;  4N11 A;  1O7U A;  3BCK A;  1GNW A;  1HD2 A;  1YDK A;  3MSZ A;  1GH2 A;  1PSQ A;  3TKP A;  3DVW A;  4JE1 A;  2IN3 A;  2XC2 A;  4MF5 A;  3JCM L;  2HZF A;  1YQ1 A;  2GQK A;  1QQ2 A;  3IR4 A;  4GF0 A;  3GH9 A;  4XS1 A;  4O32 A;  5IMA A;  2C0E A;  4HJM A;  2CZ2 A;  4ML1 A;  4PNF A;  2F8F A;  3PPU A;  4V1A p;  1SL2 B;  1F3B A;  4CDO A;  3L9S A;  3TKR A;  1T8E B;  2HLS A;  2H1D A;  4EKZ A;  4Q5N A;  3FRC A;  4EUY A;  1JFU A;  1SD9 A;  2B6M A;  2CQ9 A;  3Q74 A;  5D96 A;  3WT2 A;  5AIS A;  2FWH A;  3M1G A;  1R5P A;  1MD3 A;  2JSZ A;  4BL7 B;  3WD6 A;  1F37 A;  2H1A A;  2RUF A;  2R0G A;  3IK9 A;  4RI7 A;  2I4A A;  5HFG A;  1TRU A;  3TKS C;  2B5E A;  1URM A;  7GSS A;  3F9U A;  1UVZ A;  4E8E A;  3D21 A;  2WDU A;  2V1M A;  5LCZ A;  1TOF A;  1GTA A;  2E7P A;  2HSY A;  2RM6 A;  3A5W A;  4G9H A;  1X5C A;  1DE2 A;  2TRC P;  1SJZ A;  2E2G A;  6GSS A;  3QPM A;  2NBS A;  1JHB A;  2HYX A;  5DQS A;  1RW1 A;  3GKX A;  4IQ1 A;  1T3B A;  1LU4 A;  1O8W A;  4WBJ A;  4IGJ A;  3FY7 A;  3ZML A;  3U6V A;  3GUR A;  3ZIT A;  1W89 A;  4ZIL A;  3O6T A;  2R0C A;  3TKS A;  2OAD A;  2AV4 A;  3P2A A;  2TIR A;  2DML A;  4HU7 A;  5IO0 A;  5HQP A;  2OJL A;  2H71 A;  4PTS A;  2PUK C;  3VI7 A;  2CAQ A;  1EOG A;  2IFQ A;  1RQM A;  2QGV A;  1TI1 A;  1S3A A;  4TR1 B;  2H1B A;  2AYT A;  5D9W A;  2VLU A;  4GWR A;  2PER A;  3J7Y b;  3CMI A;  3F8U A;  5HR3 A;  1EGR A;  2XPD A;  2CX4 A;  3QCP A;  4NHZ A;  4WBR D;  1XG8 A;  3LWA A;  1USB A;  2WFC A;  5G5F A;  2VLT A;  2I3Y A;  3ZRD A;  4ZBD A;  2YWN A;  5IMV A;  1GSF A;  2A2R A;  3GNJ A;  4KF9 A;  2WRT A;  2L59 A;  2MMN A;  1GSY A;  3ED3 A;  2KP2 A;  1SKS B;  4JR6 A;  4YKF A;  4G0K A;  2KHP A;  4CW9 A;  3EU3 A;  1CQG A;  1JLW A;  1SJI A;  4TR3 A;  4ZB9 A;  4MDC A;  1Z9H A;  2V32 A;  1XFL A;  4I8B A;  3HJM A;  5IMZ A;  4XIH A;  4OWY A;  4KGI A;  4OMV A;  4MCU A;  2YOI A;  2QA2 A;  4TR0 A;  2FA8 A;  3VPT A;  1O81 A;  5FHI A;  4GST A;  4MJC A;  2JU5 A;  4QL7 A;  2GZY A;  4KDU A;  5IM9 A;  4G19 A;  2OBI A;  4GQC A;  1AW9 A;  5DBQ A;  1X5D A;  2P31 A;  4I2T A;  2B7K A;  2GQM A;  1TJD A;  1AAZ A;  1OC8 A;  3KM6 A;  3P8W A;  4PQ1 A;  2IMF A;  1YEX A;  4K7I A;  6GSY A;  3M9K A;  4GTU A;  4WF4 A;  9GSS A;  3VUR A;  2UZ8 A;  1GL8 A;  1J0F A;  1M9B A;  5JCW A;  2IMK A;  2H6X A;  1M3I A;  3PR8 A;  2JZR A;  4RQX A;  2C3N A;  3QR6 A;  1GTU A;  3QFA C;  3IK7 A;  4USS A;  2C80 A;  1EOH A;  3H1N A;  1PN9 A;  3GN3 A;  1QGV A;  3VWV A;  2C0F A;  1ZMA A;  4V2N A;  2QSI A;  4XS4 B;  1VF1 A;  4YKG A;  1Z6M A;  1XWK A;  4KUN A;  1SKW B;  3UAR A;  2VL2 C;  3C1R A;  4TRX A;  2AJQ B;  4IP6 A;  3TDG A;  5AGY A;  5IPH A;  3KTB A;  3E9J B;  3ZFL A;  5EPF A;  5COH A;  4AGS A;  1AIU A;  4EC0 A;  4MH2 A;  2QKE A;  5CRD A;  1TK5 B;  4PUR A;  4I2U A;  2NPB A;  2CVB A;  5IIZ A;  3RHB A;  3DYR A;  1QUW A;  3L4N A;  3C8E A;  3L9V A;  1IYI A;  2HRF A;  3IHQ A;  1G6W A;  1SKR B;  3VK9 A;  1M0U A;  13GS A;  20GS A;  5J3R A;  1OKT A;  3C71 A;  1F2E A;  4G10 A;  1B4Q A;  1V57 A;  3VI5 A;  4IEL A;  4FYU A;  1T7P B;  3HHV A;  16GS A;  2IWT A;  3S9F A;  2LJR A;  5HFK A;  3KCM A;  5LD0 A;  2CT6 A;  4FQU A;  1K0N A;  2V41 A;  3A5I A;  1OE7 A;  3I69 A;  1EWX A;  3TJJ A;  3G7I A;  4BVY B;  3O3T A;  5B7C A;  1XW5 A;  1A0R P;  1JZD A;  3WGX A;  3ERG A;  2J9H A;  1FO5 A;  2IPA A;  1GRX A;  1PL2 A;  3UEM A;  5G2Z A;  1A0F A;  4XHM A;  5CNW A;  3UJ1 A;  4JU5 A;  2F51 A;  4X43 A;  4WKW A;  2OA7 A;  2A2S A;  8GSS A;  3GX8 A;  4G0I A;  4O7H A;  1OYJ A;  2VCQ A;  4O5U A;  5A4V A;  1HYU A;  2XBQ A;  17GS A;  1LBK A;  1O73 A;  2B5Y A;  1ERV A;  1FAA A;  3UAP A;  4F82 A;  1X9S B;  1FW1 A;  1G0T A;  1PMT A;  4RI6 A;  1NW2 A;  5EVO A;  2J23 A;  2H8L A;  3LG6 A;  2VL9 A;  2GTU A;  1J08 A;  4D73 B;  1TRS A;  4ML6 A;  3VPQ A;  3APO A;  2O85 A;  3FZ9 A;  1TRV A;  3BBY A;  4OFT A;  5D73 A;  3HD5 A;  4WEY A;  3UVT A;  1MDK A;  3N9J A;  2H76 A;  4IQA A;  1M9A A;  3EWL A;  4K1F A;  4ZB8 A;  1K0O A;  5ECH B;  4L0U A;  4Z2R A;  3QDN A;  1Z5Y E;  2D2Z A;  1Q4J A;  4V2M A;  3WT1 A;  1SEN A;  1MDI A;  4MZC A;  4MZW A;  4ZL8 A;  3A2W A;  5ECM B;  4K8M A;  2OBK A;  2YJH A;  2YZH A;  2HRA A;  3KMO A;  4LA1 A;  4OFN A;  2M80 A;  1VGL A;  4ILF A;  3F6D A;  2HNL A;  2RII A;  1XXU A;  3GH6 A;  2KLX A;  1U88 A;  4BPY A;  2AB6 A;  3DEX A;  3RBT A;  2OE1 A;  3WGD A;  1ZCP A;  2H01 A;  1SK1 A;  1WJK A;  1R4W A;  3ZIV A;  4E8H A;  3TJG A;  3ERF A;  3SWL A;  2LNS A;  2K18 A;  4EIQ A;  4O5R A;  4F03 A;  5IMC A;  1M2A A;  1TP9 A;  18GS A;  2MZC A;  2X4A A;  2JZT A;  2XBI A;  4NMU A;  2GSR A;  1GP1 A;  1K0C A;  2FWG A;  1M3J A;  1B4P A;  2ZNM A;  1VF3 A;  1ZYN A;  4ISD A;  5G5E A;  2HE3 A;  1TK0 B;  2C0D A;  2E2M A;  2L4C A;  3KZQ A;  4TVE A;  4ZIJ A;  2R3X A;  3KGK A;  4IKH A;  3J7Y k;  4BVX B;  5KN0 A;  4D73 A;  3WYW A;  4ZL7 A;  2DIZ A;  2PU9 C;  1G7O A;  2HZE A;  1AUC A;  1KNG A;  2JZS A;  3K8N A;  1XZO A;  5GAP D;  2IFQ B;  2GT5 A;  1TDI A;  2GT6 A;  4IJI A;  5CRE A;  2C1Y A;  1FVK A;  4TOP A;  5CRH A;  3ZRE A;  4K5S A;  5KOX A;  2JAD A;  4I5Q A;  3UBK A;  3TOU A;  3FKF A;  3KP8 A;  2CVD A;  4BA7 A;  1V9W A;  1F3A A;  2TRX A;  1ACV A;  2X8G A;  1MD4 A;  4TXV A;  4ZXG A;  1SJ6 A;  3EU4 A;  5CRW A;  3VWX A;  2H6Z A;  2VCZ A;  5HR2 A;  1UA5 A;  3DXB A;  2LST A;  2FHE A;  1PRX A;  3Q6O A;  4IS0 A;  3ZL5 A;  3TB2 A;  3ZTL A;  2FD3 A;  1ZYP A;  4ECC A;  1WP0 A;  3IV4 A;  3GKM A;  5E4W A;  2VIM A;  5ELA A;  3RPN A;  4IP1 A;  2X8H A;  1ERU A;  2FWE A;  4K7O A;  3Q18 A;  1Y6E A;  3L9U A;  1OC3 A;  4ICY A;  1EGO A;  2CA8 A;  2YNX A;  5A5K A;  3CYN A;  2HXK A;  2P5Q A;  3F6F A;  5D93 A;  5FT3 A;  2FA4 A;  5H5S A;  1MEK A;  4OCF A;  3VLN A;  3HVV A;  5G31 A;  6GSX A;  1HNB A;  1WMJ A;  3F4R A;  4PUF C;  2H0I A;  4FIW A;  1XOB A;  1OKD A;  4BVX A;  4BIK A;  2CX3 A;  3W8S A;  3HJP A;  3IXR A;  2EC4 A;  1NHY A;  3FZA A;  4TN8 A;  4AF2 A;  4L8E A;  3ZZX A;  1FVJ A;  1QMV A;  1SYR A;  3IAS 2;  3QAG A;  1MDJ A;  4L0W A;  4V2L A;  5A4W A;  1ZYQ B;  4KSM A;  1DE1 A;  1EP7 A;  4NXI A;  1SD8 A;  4GRF A;  3FR9 A;  3LXZ A;  3GA4 A;  3DD3 A;  4KB3 A;  3ZLP A;  2GST A;  3V1W A;  4G2E A;  3KJY A;  4MJB A;  2DSA A;  4ZBB A;  2VD0 A;  4HUA A;  3HY2 A;  3IPZ A;  2PBJ A;  4J2F A;  2B1L A;  4KDX A;  2OE0 A;  3IC8 A;  5HR0 A;  1T4Y A;  4EDY A;  5INY A;  1EV9 A;  3TGZ A;  2X8C A;  2KOK A;  3LSZ A;  4ID0 A;  2Z9S A;  1VF4 A;  3R3E A;  1GLQ A;  2HFD A;  3W8J A;  1Y25 A;  3RDW A;  1NM3 A;  2A4V A;  1B8X A;  4HJ2 A;  4MA9 A;  3G7J A;  4MMM A;  1SK0 A;  2XHF A;  5B6M A;  1ERT A;  2VM2 A;  5D9T A;  2YV7 A;  3O76 A;  3IRA A;  2GZP A;  3DVX A;  2CV4 A;  5A4U A;  3D4M A;  4PUA A;  2LJK A;  4X1U A;  4MF7 A;  1V40 A;  2H0G A;  4ECB A;  5JWQ B;  19GS A;  4MNN A;  2VOC A;  2YAN A;  4KSO A;  2HI7 A;  5IO2 A;  4LLR A;  3F0I A;  2H6Y A;  2X64 A;  2LQQ A;  2IMD A;  2FNO A;  3US3 A;  4ZBA A;  4FO5 A;  5IMD A;  1U87 A;  2N5B A;  4LL4 B;  4GSN A;  3E3E A;  3H93 A;  1T00 A;  3I9V 2;  1ZYE A;  3IAM 2;  3IE3 A;  1V98 A;  5ECI B;  4EL1 A;  2WJU A;  2JSY A;  3IA1 A;  5DVB A;  1ILO A;  3NOF A;  1F6M C;  2K8S A;  4EDZ A;  4ECI A;  4ULX A;  4KW6 A;  5ECK B;  2LRN A;  4Z2T A;  3GKK A;  5JCU A;  4G0L A;  1PX6 A;  2MYG A;  3L78 A;  3CSJ A;  4NV2 A;  2VLV A;  1YKC A;  3P90 A;  3APS A;  1SK2 A;  1S3R A;  3IC4 A;  1DUG A;  3ZFB A;  4KAE A;  1OAZ A;  2WS2 A;  3ME8 A;  3FMW A;  3CSI A;  1ZL9 A;  2R4V A;  4GLT A;  4DSQ A;  1GWC A;  2H30 A;  1MTC A;  4EF0 A;  4POL A;  5KN1 A;  3FK8 A;  3M9J A;  1U3A A;  4XRD A;  3KH9 A;  3A2X A;  1WIK A;  2YWM A;  4WR4 A;  1VRS D;  3CTG A;  1OE8 A;  4CY6 A;  1A8L A;  5CYY A;  10GS A;  2NTO A;  1R5A A;  1YEP A;  2DJK A;  2BTO T;  1BED A;  4GXZ A;  3MYD A;  1TRW A;  1CQH A;  4F9Z A;  5DAK A;  2LQO A;  3ERW A;  1EZK A;  2G0F A;  3PIN A;  2VL2 A;  4KCE A;  5ID2 A;  1B9Y C;  2MMO A;  1SL1 B;  1QK8 A;  2FLS A;  4TW5 A;  3EPT A;  4ECJ A;  5D9X A;  2R5G A;  1S3C A;  1W4V A;  2VCW A;  2WB9 A;  1HNA A;  2CZ3 A;  1Z6N A;  2A4H A;  5CAX A;  1YF0 A;  4N10 A;  2DKI A;  2KUC A;  2F3M A;  3TKS E;  1U6T A;  4NHW A;  1N8J A;  2L4Q A;  1A24 A;  2VAF A;  2LV3 A; 
#chains in the Genus database with same CATH homology
 3P7X A;  1PX7 A;  2NDO A;  3KTL A;  3G9B A;  2X99 A;  3TRX A;  3UBL A;  3H8Q A;  1IYH A;  3ZYW A;  4MH3 A;  2IL3 A;  2ON7 A;  4X4J A;  1BG5 A;  3GMF A;  5AIX A;  4WET A;  3TKQ A;  3RAZ A;  4ZB6 A;  5ELG A;  4IJ3 A;  1R26 A;  1K0M A;  5F0G A;  1XWA A;  3IBH A;  5DCG A;  4ZL9 A;  2N5F A;  1XW9 A;  1K0B A;  4RQR A;  2V6K A;  1ZGN A;  4HS1 A;  2FY6 A;  1BJX A;  3D5J A;  3MIX A;  2DJ2 A;  4N0Z A;  4OD7 A;  2GZZ A;  2JAC A;  1AC1 A;  3W6G A;  4MP4 A;  2C4J A;  4I97 A;  2X49 A;  2A2P A;  1KEB A;  3DRN A;  2YV9 A;  4POB A;  5D8I A;  2H75 A;  2HZE B;  4WXT A;  1K0D A;  2MMZ A;  2GSQ A;  1R7H A;  3TJK A;  2LS5 A;  4K2X A;  4K0G A;  1THO A;  1XIY A;  3QOU A;  2I1U A;  4V1A g;  3UIW A;  1XWC A;  4Q5F A;  3GX0 A;  3ME7 A;  1K0A A;  2DJJ A;  3F63 A;  5IOW A;  4JRR A;  4Z7X A;  5IPG A;  1X9W B;  2WCI A;  2O7K A;  2YPM A;  4Q5Q A;  2BJX A;  1V2A A;  4K7N A;  1SU9 A;  3I43 A;  2H1G A;  5H5R A;  4IVF A;  2DJ0 A;  3LYP A;  1YZX A;  4J57 E;  1KTE A;  2GS3 A;  1Z3E A;  2IJY A;  1PGT A;  3UOM A;  4K9Z A;  12GS A;  1K3O A;  3QAW A;  1PKW A;  3HYP A;  2DIY A;  3VWW A;  5ECR B;  2F8A A;  3LQ7 A;  4F0B A;  1XW6 A;  1WPI A;  1M99 A;  3AY8 A;  2ON5 A;  1VF2 A;  1GTB A;  3GTU A;  3HVS A;  5FWG A;  2DKH A;  3GKN A;  3UVH A;  4PNG A;  4KX4 A;  2CVK A;  5G30 A;  4YQM A;  1I5G A;  2V6O A;  4LL1 B;  5AIV A;  2I9H A;  3KEB A;  3GYK A;  1XVW A;  1HQO A;  4FH8 A;  4X0X A;  4BWQ A;  2WUL A;  3GHA A;  3TCO A;  3D6I A;  1AQX A;  2O87 A;  5ECO B;  3EC3 A;  3IDV A;  4DEJ A;  3F4S A;  1TW9 A;  3CRT A;  2RM5 A;  5J5N A;  3HZ4 A;  4KCA A;  2PN8 A;  3GV1 A;  2FWF A;  4P3Y B;  5KOW A;  5J41 A;  4IN0 A;  1FHE A;  2PPT A;  3C73 A;  3M0F A;  4AJ7 A;  3NZN A;  4POM A;  2B5X A;  1LJR A;  1EEJ A;  1XCC A;  2B1K A;  2VCV A;  1K3L A;  2GVP A;  3FYG A;  2LTK A;  1OC9 B;  3QD9 A;  3D4T A;  3ZIJ A;  1A2J A;  1GLP A;  4O92 A;  1J9B A;  1YF1 A;  5DQY A;  2L57 A;  2HRN A;  4PX1 A;  2O8V B;  3C1S A;  5C00 A;  2LRC A;  2PVQ A;  5ECQ B;  2R2J A;  1E6B A;  4JBB A;  2E0Q A;  1NHO A;  3IOS A;  4H86 A;  4EXJ A;  3GST A;  2DJ3 A;  4L5O A;  3ZVJ D;  5IMF A;  4KA0 A;  2GGT A;  2LRT A;  2QA1 A;  3DML A;  1WOU A;  1PD2 1;  3RPP A;  5F06 A;  2H73 A;  4DSS B;  2YN1 A;  3TRQ A;  2VL3 A;  3MNG A;  3GRX A;  3VWU A;  4QL9 A;  1SYX A;  2K9F A;  4XS6 A;  2HT9 A;  2K6V A;  6GSV A;  3WGE A;  2ZUP A;  3KH7 A;  3HVX A;  2VM1 A;  5KN2 A;  1K3Y A;  3NIV A;  4DVC A;  3GFK A;  4MK3 A;  3TUE A;  3EMP A;  4I6X A;  3U5R E;  1YY7 A;  3GL3 A;  1M2B A;  4IW9 A;  1T4Z A;  4KH7 A;  1GUL A;  5GSS A;  3FZ4 A;  3N5O A;  4TXO B;  1FOV A;  3HDC A;  4JED A;  4HEA 2;  2WZ9 A;  2XPE A;  3IHG A;  3HXS A;  2DBC A;  2F9S A;  5JCG A;  2AAW A;  2CAI A;  3LW9 A;  1GSE A;  3DKS A;  3HKR A;  4WF5 A;  3FEU A;  5IOX A;  2DLX A;  2G2Q A;  5L71 A;  1Q98 A;  3KXO A;  1PQN A;  1A2L A;  3M8N A;  2ZCT A;  5DJL A;  1B9X C;  1OC9 A;  4HQZ A;  1C72 A;  3KMN A;  3FR6 A;  5ABR A;  2YZU A;  4NAX A;  1G6Y A;  1A8Y A;  1SL0 B;  2H72 A;  1UC7 A;  2L6D A;  5LNK e;  2EIO A;  1DSB A;  1ERW A;  1YJ6 A;  1NSW A;  2MBS A;  2B3S A;  4NPB A;  2JL4 A;  4F2I A;  5C04 A;  3LOR A;  1F9M A;  4YAP A;  3BCI A;  3BD2 A;  4JZQ A;  2VCT A;  4BWS A;  4DSR A;  4BL7 A;  2YWI A;  3GSS A;  2OAC A;  4HQS A;  4OO4 A;  4N0V A;  4DSS A;  3FZ5 A;  2H70 A;  3HA9 A;  4MPF A;  2FCH A;  2VD1 A;  4FYC A;  1AQW A;  4EVM A;  4MPG A;  2M72 A;  3LFL A;  1ST9 A;  2OE3 A;  3E0U A;  5GAN D;  3BOA A;  3TRP A;  3FHK A;  1EP8 A;  4CY8 A;  5DAK B;  4MLY A;  4YH2 A;  2IIY A;  3F3Q A;  1BX9 A;  4K0N A;  2WGR A;  1ON4 A;  1T1V A;  2LEG A;  1OVN A;  2PMT A;  2IMI A;  4HZ2 A;  3DWV A;  5ID2 B;  3CBU A;  2LNT A;  1XVQ A;  4NV5 A;  1X5E A;  2EIR A;  2MMA A;  2H74 A;  3GIX A;  1TKD B;  4TXO A;  1TTZ A;  3L0H A;  1GSU A;  3LGC A;  2K8V A;  3H4K A;  2YP6 A;  5ENU A;  1M2D A;  1THX A;  3KD0 A;  4HDE A;  4KE3 A;  4WR5 A;  2YCD A;  1WE0 A;  1RK4 A;  3HCZ A;  1FOH A;  3M3M A;  5HR1 A;  2EIQ A;  4PQH A;  4QQ7 A;  1XOA A;  4PGT A;  4KDY A;  3DIE A;  5J9C A;  4YQU A;  1A2M A;  4PXO A;  5F8B A;  1A23 A;  3FR3 A;  1PKZ A;  5ECS A;  3APQ A;  1GUM A;  3R2Q A;  1BQ7 A;  3LXT A;  2R6K A;  2BMX A;  4TR1 A;  4AJ6 A;  3F4T A;  3C7M A;  3RHC A;  1GNE A;  5ECP B;  4EIP A;  6GST A;  1E2Y A;  5GZZ B;  3TJF A;  3Q19 A;  2HSH A;  1GSQ A;  3MAK A;  5BMU A;  1ZZY A;  2H19 A;  1O8X A;  1PN0 A;  5J9B A;  1O6J A;  2GSS A;  3EVI A;  3DGQ A;  5EY6 A;  2M46 A;  1JLV A;  1S3D A;  3CTF A;  5DJM A;  1XPV A;  1GTI A;  4HOJ A;  3EUR A;  5F05 A;  2GLR A;  4A5P A;  1PL1 A;  4EE0 A;  3G7Y A;  3GUS A;  3SBC A;  1I9D A;  2C3Q A;  1EEM A;  2C8U A;  5GST A;  2HRK A;  1ZOF A;  5JWR B;  1U3I A;  3PGT A;  3CXG A;  4YQV A;  3UMA A;  3HZ8 A;  3EE2 A;  2R0P A;  1AXD A;  5E59 A;  1FB0 A;  2DMM A;  4XCS A;  3KIJ A;  4PQI A;  2REM A;  4MJE A;  4MZB A;  1GUH A;  1O85 A;  1G7E A;  4Q5R A;  5G1K A;  1GSS A;  4TKY A;  2IME A;  3TOT A;  4CHS A;  5ECL B;  2KP1 A;  1WRY A;  4JR4 A;  3QAV A;  5G1L A;  11GS A;  3TJB A;  1TU7 A;  2VCX A;  2YJ7 A;  3F3R A;  4IHU A;  5DDL A;  1H75 A;  4OO5 A;  4LMV A;  1H4O A;  2AUV A;  2OKA A;  4K2D A;  5D9V A;  3EMX A;  1FB6 A;  1PA3 A;  5CP1 A;  1TK8 B;  4EO3 A;  6GSU A;  4RUV A;  5KN3 A;  4O5Q A;  4N30 A;  3OR5 A;  3GTU B;  5JWO B;  3LEF A;  1QFN A;  1Z7P A;  4OFM A;  5F07 A;  2C3T A;  3UL3 A;  2RUE A;  1YKA A;  4HI7 A;  1FG4 A;  3PH9 A;  2HSM A;  5H5Q A;  4YAV A;  2LKU A;  2FUG 2;  2QC7 A;  5IQY A;  1Z7R A;  1X9M B;  1GSD A;  4IBP A;  2L5L A;  2P0G A;  2LJA A;  5KEJ A;  1QXH A;  1GUK A;  4XS4 A;  3HJO A;  4KND A;  2R37 A;  3LYK A;  4L5L A;  5ECN B;  2ALB A;  2PWJ A;  3MWH A;  2PGT A;  1ABA A;  2YWO A;  4AJ8 A;  2B7J A;  4J56 E;  5EL8 A;  5DAL B;  2MBT A;  3GL5 A;  1JZO A;  3VFI A;  2L5O A;  4XTS A;  2GDR A;  3KP9 A;  2C0G A;  2DJ1 A;  4K5R A;  5B6N A;  3EIN A;  1AQV A;  4HZ4 A;  1TXX A;  1BAY A;  2FGX A;  3QMX A;  1V58 A;  1BYE A;  4XRA A;  1XBS A;  4TR4 A;  3FW2 A;  1B48 A;  5HFI A;  4F0C A;  4Z2U A;  4GQF A;  4MAB A;  3MDK A;  3A3T A;  4OCE A;  5AN1 A;  1UN2 A;  2N5A A;  4FYB A;  2ES7 A;  2L6C A;  5B8A A;  3CRU A;  2NVL A;  4HU9 A;  1TI3 A;  1N2A A;  3D22 A;  1X0R A;  3ZMK A;  5DCH A;  2H66 A;  4GSS A;  1DBY A;  1M7T A;  2I81 A;  1XWB A;  1JZR A;  6GSW A;  2PVO C;  1TU8 A;  5B8B A;  4BVY A;  2VUP A;  3QFB C;  4NWY A;  2O89 A;  1WWJ A;  3EYT A;  5CO3 A;  2VO4 A;  14GS A;  3ISO A;  5J4U A;  3BJ5 A;  3I6A A;  1JZW A;  4ACS A;  1KBN A;  3H79 A;  3ZVJ A;  4LMW A;  1HNC A;  2LUS A;  5BRT A;  2RLI A;  1ML6 A;  4GCI A;  2V2G A;  2P5R A;  22GS A;  1XWG A;  5CRG A;  4POK A;  2GQL A;  3D0Z A;  4MJA A;  4K6X A;  1EV4 A;  3CSH A;  3LJR A;  3A2V A;  4MF6 A;  2H0H A;  2AHE A;  5DAL A;  2DC5 A;  4N11 A;  1O7U A;  3BCK A;  1GNW A;  1HD2 A;  1YDK A;  3MSZ A;  1GH2 A;  1PSQ A;  3TKP A;  3DVW A;  4JE1 A;  2IN3 A;  2XC2 A;  4MF5 A;  3JCM L;  2HZF A;  1YQ1 A;  2GQK A;  1QQ2 A;  3IR4 A;  4GF0 A;  3GH9 A;  4XS1 A;  4O32 A;  5IMA A;  2C0E A;  4HJM A;  2CZ2 A;  4ML1 A;  4PNF A;  2F8F A;  3PPU A;  4V1A p;  1SL2 B;  1F3B A;  4CDO A;  3L9S A;  3TKR A;  1T8E B;  2HLS A;  2H1D A;  4EKZ A;  4Q5N A;  3FRC A;  4EUY A;  1JFU A;  1SD9 A;  2B6M A;  2CQ9 A;  3Q74 A;  5D96 A;  3WT2 A;  5AIS A;  2FWH A;  3M1G A;  1R5P A;  1MD3 A;  2JSZ A;  4BL7 B;  3WD6 A;  1F37 A;  2H1A A;  2RUF A;  2R0G A;  3IK9 A;  4RI7 A;  2I4A A;  5HFG A;  1TRU A;  3TKS C;  2B5E A;  1URM A;  7GSS A;  3F9U A;  1UVZ A;  4E8E A;  3D21 A;  2WDU A;  2V1M A;  5LCZ A;  1TOF A;  1GTA A;  2E7P A;  2HSY A;  2RM6 A;  3A5W A;  4G9H A;  1X5C A;  1DE2 A;  2TRC P;  1SJZ A;  2E2G A;  6GSS A;  3QPM A;  2NBS A;  1JHB A;  2HYX A;  5DQS A;  1RW1 A;  3GKX A;  4IQ1 A;  1T3B A;  1LU4 A;  1O8W A;  4WBJ A;  4IGJ A;  3FY7 A;  3ZML A;  3U6V A;  3GUR A;  3ZIT A;  1W89 A;  4ZIL A;  3O6T A;  2R0C A;  3TKS A;  2OAD A;  2AV4 A;  3P2A A;  2TIR A;  2DML A;  4HU7 A;  5IO0 A;  5HQP A;  2OJL A;  2H71 A;  4PTS A;  2PUK C;  3VI7 A;  2CAQ A;  1EOG A;  2IFQ A;  1RQM A;  2QGV A;  1TI1 A;  1S3A A;  4TR1 B;  2H1B A;  2AYT A;  5D9W A;  2VLU A;  4GWR A;  2PER A;  3J7Y b;  3CMI A;  3F8U A;  5HR3 A;  1EGR A;  2XPD A;  2CX4 A;  3QCP A;  4NHZ A;  4WBR D;  3LWA A;  1USB A;  2WFC A;  5G5F A;  2VLT A;  2I3Y A;  3ZRD A;  4ZBD A;  2YWN A;  5IMV A;  1GSF A;  2A2R A;  3GNJ A;  4KF9 A;  2WRT A;  2L59 A;  2MMN A;  1GSY A;  3ED3 A;  2KP2 A;  1SKS B;  4JR6 A;  4YKF A;  4G0K A;  2KHP A;  4CW9 A;  3EU3 A;  1CQG A;  1JLW A;  1SJI A;  4TR3 A;  4ZB9 A;  4MDC A;  1Z9H A;  2V32 A;  1XFL A;  4I8B A;  3HJM A;  5IMZ A;  4XIH A;  4OWY A;  4KGI A;  4OMV A;  4MCU A;  2YOI A;  2QA2 A;  4TR0 A;  2FA8 A;  3VPT A;  1O81 A;  5FHI A;  4GST A;  4MJC A;  2JU5 A;  4QL7 A;  2GZY A;  4KDU A;  5IM9 A;  4G19 A;  2OBI A;  4GQC A;  1AW9 A;  5DBQ A;  1X5D A;  2P31 A;  4I2T A;  2B7K A;  2GQM A;  1TJD A;  1AAZ A;  1OC8 A;  3KM6 A;  3P8W A;  4PQ1 A;  2IMF A;  1YEX A;  4K7I A;  6GSY A;  3M9K A;  4GTU A;  4WF4 A;  9GSS A;  3VUR A;  2UZ8 A;  1GL8 A;  1J0F A;  1M9B A;  5JCW A;  2IMK A;  2H6X A;  3PR8 A;  2JZR A;  4RQX A;  2C3N A;  3QR6 A;  1GTU A;  3QFA C;  3IK7 A;  4USS A;  2C80 A;  1EOH A;  3H1N A;  1PN9 A;  3GN3 A;  1QGV A;  3VWV A;  2C0F A;  1ZMA A;  4V2N A;  2QSI A;  4XS4 B;  1VF1 A;  4YKG A;  1Z6M A;  1XWK A;  4KUN A;  1SKW B;  3UAR A;  2VL2 C;  3C1R A;  4TRX A;  2AJQ B;  4IP6 A;  3TDG A;  5AGY A;  5IPH A;  3KTB A;  3E9J B;  3ZFL A;  5EPF A;  5COH A;  4AGS A;  1AIU A;  4EC0 A;  4MH2 A;  2QKE A;  5CRD A;  1TK5 B;  4PUR A;  4I2U A;  2NPB A;  2CVB A;  5IIZ A;  3RHB A;  3DYR A;  1QUW A;  3L4N A;  3C8E A;  3L9V A;  1IYI A;  2HRF A;  3IHQ A;  1G6W A;  1SKR B;  3VK9 A;  1M0U A;  13GS A;  20GS A;  5J3R A;  1OKT A;  3C71 A;  1F2E A;  4G10 A;  1B4Q A;  1V57 A;  3VI5 A;  4IEL A;  4FYU A;  1T7P B;  3HHV A;  16GS A;  2IWT A;  3S9F A;  2LJR A;  5HFK A;  3KCM A;  5LD0 A;  2CT6 A;  4FQU A;  1K0N A;  2V41 A;  3A5I A;  1OE7 A;  3I69 A;  1EWX A;  3TJJ A;  3G7I A;  4BVY B;  3O3T A;  5B7C A;  1XW5 A;  1A0R P;  1JZD A;  3WGX A;  3ERG A;  2J9H A;  1FO5 A;  2IPA A;  1GRX A;  1PL2 A;  3UEM A;  5G2Z A;  1A0F A;  4XHM A;  5CNW A;  3UJ1 A;  4JU5 A;  2F51 A;  4X43 A;  4WKW A;  2OA7 A;  2A2S A;  8GSS A;  3GX8 A;  4G0I A;  4O7H A;  1OYJ A;  2VCQ A;  4O5U A;  5A4V A;  1HYU A;  2XBQ A;  17GS A;  1LBK A;  1O73 A;  2B5Y A;  1ERV A;  1FAA A;  3UAP A;  4F82 A;  1X9S B;  1FW1 A;  1G0T A;  1PMT A;  4RI6 A;  1NW2 A;  5EVO A;  2J23 A;  2H8L A;  3LG6 A;  2VL9 A;  2GTU A;  1J08 A;  4D73 B;  1TRS A;  4ML6 A;  3VPQ A;  3APO A;  2O85 A;  3FZ9 A;  1TRV A;  3BBY A;  4OFT A;  5D73 A;  3HD5 A;  4WEY A;  3UVT A;  1MDK A;  3N9J A;  2H76 A;  4IQA A;  1M9A A;  3EWL A;  4K1F A;  4ZB8 A;  1K0O A;  5ECH B;  4L0U A;  4Z2R A;  3QDN A;  1Z5Y E;  2D2Z A;  1Q4J A;  4V2M A;  3WT1 A;  1SEN A;  1MDI A;  4MZC A;  4MZW A;  4ZL8 A;  3A2W A;  5ECM B;  4K8M A;  2OBK A;  2YJH A;  2YZH A;  2HRA A;  3KMO A;  4LA1 A;  4OFN A;  2M80 A;  1VGL A;  4ILF A;  3F6D A;  2HNL A;  2RII A;  1XXU A;  3GH6 A;  2KLX A;  1U88 A;  4BPY A;  2AB6 A;  3DEX A;  3RBT A;  2OE1 A;  3WGD A;  1ZCP A;  2H01 A;  1SK1 A;  1WJK A;  1R4W A;  3ZIV A;  4E8H A;  3TJG A;  3ERF A;  3SWL A;  2LNS A;  2K18 A;  4EIQ A;  4O5R A;  4F03 A;  5IMC A;  1M2A A;  1TP9 A;  18GS A;  2MZC A;  2X4A A;  2JZT A;  2XBI A;  4NMU A;  2GSR A;  1GP1 A;  1K0C A;  2FWG A;  1B4P A;  2ZNM A;  1VF3 A;  1ZYN A;  4ISD A;  5G5E A;  2HE3 A;  1TK0 B;  2C0D A;  2E2M A;  2L4C A;  3KZQ A;  4TVE A;  4ZIJ A;  2R3X A;  3KGK A;  4IKH A;  3J7Y k;  4BVX B;  5KN0 A;  4D73 A;  3WYW A;  4ZL7 A;  2DIZ A;  2PU9 C;  1G7O A;  2HZE A;  1AUC A;  1KNG A;  2JZS A;  3K8N A;  1XZO A;  5GAP D;  2IFQ B;  2GT5 A;  1TDI A;  2GT6 A;  4IJI A;  5CRE A;  2C1Y A;  1FVK A;  4TOP A;  5CRH A;  3ZRE A;  4K5S A;  5KOX A;  2JAD A;  4I5Q A;  3UBK A;  3TOU A;  3FKF A;  3KP8 A;  2CVD A;  4BA7 A;  1V9W A;  1F3A A;  2TRX A;  1ACV A;  2X8G A;  1MD4 A;  4TXV A;  4ZXG A;  1SJ6 A;  3EU4 A;  5CRW A;  3VWX A;  2H6Z A;  2VCZ A;  5HR2 A;  1UA5 A;  3DXB A;  2LST A;  2FHE A;  1PRX A;  3Q6O A;  4IS0 A;  3ZL5 A;  3TB2 A;  3ZTL A;  2FD3 A;  1ZYP A;  4ECC A;  1WP0 A;  3IV4 A;  3GKM A;  5E4W A;  2VIM A;  5ELA A;  3RPN A;  4IP1 A;  2X8H A;  1ERU A;  2FWE A;  4K7O A;  3Q18 A;  1Y6E A;  3L9U A;  1OC3 A;  4ICY A;  1EGO A;  2CA8 A;  2YNX A;  5A5K A;  3CYN A;  2HXK A;  2P5Q A;  3F6F A;  5D93 A;  5FT3 A;  2FA4 A;  5H5S A;  1MEK A;  4OCF A;  3VLN A;  3HVV A;  5G31 A;  6GSX A;  1HNB A;  1WMJ A;  3F4R A;  4PUF C;  2H0I A;  4FIW A;  1XOB A;  1OKD A;  4BVX A;  2CX3 A;  3W8S A;  3HJP A;  3IXR A;  2EC4 A;  1NHY A;  3FZA A;  4TN8 A;  4AF2 A;  4L8E A;  3ZZX A;  1FVJ A;  1QMV A;  1SYR A;  3IAS 2;  3QAG A;  1MDJ A;  4L0W A;  4V2L A;  5A4W A;  1ZYQ B;  4KSM A;  1DE1 A;  1EP7 A;  4NXI A;  1SD8 A;  4GRF A;  3FR9 A;  3LXZ A;  3GA4 A;  3DD3 A;  4KB3 A;  3ZLP A;  2GST A;  3V1W A;  4G2E A;  3KJY A;  4MJB A;  2DSA A;  4ZBB A;  2VD0 A;  4HUA A;  3HY2 A;  3IPZ A;  2PBJ A;  4J2F A;  2B1L A;  4KDX A;  2OE0 A;  3IC8 A;  5HR0 A;  1T4Y A;  4EDY A;  5INY A;  1EV9 A;  3TGZ A;  2X8C A;  2KOK A;  3LSZ A;  4ID0 A;  2Z9S A;  1VF4 A;  3R3E A;  1GLQ A;  2HFD A;  3W8J A;  1Y25 A;  3RDW A;  1NM3 A;  2A4V A;  1B8X A;  4HJ2 A;  4MA9 A;  3G7J A;  4MMM A;  1SK0 A;  2XHF A;  5B6M A;  1ERT A;  2VM2 A;  5D9T A;  2YV7 A;  3O76 A;  3IRA A;  2GZP A;  3DVX A;  2CV4 A;  5A4U A;  3D4M A;  4PUA A;  2LJK A;  4X1U A;  4MF7 A;  1V40 A;  2H0G A;  4ECB A;  5JWQ B;  19GS A;  4MNN A;  2VOC A;  2YAN A;  4KSO A;  2HI7 A;  5IO2 A;  4LLR A;  3F0I A;  2H6Y A;  2X64 A;  2LQQ A;  2IMD A;  2FNO A;  3US3 A;  4ZBA A;  4FO5 A;  5IMD A;  1U87 A;  2N5B A;  4LL4 B;  4GSN A;  3E3E A;  3H93 A;  1T00 A;  3I9V 2;  1ZYE A;  3IAM 2;  3IE3 A;  1V98 A;  5ECI B;  4EL1 A;  2WJU A;  2JSY A;  3IA1 A;  5DVB A;  1ILO A;  3NOF A;  1F6M C;  2K8S A;  4EDZ A;  4ECI A;  4ULX A;  4KW6 A;  5ECK B;  2LRN A;  4Z2T A;  3GKK A;  5JCU A;  4G0L A;  1PX6 A;  2MYG A;  3L78 A;  3CSJ A;  4NV2 A;  2VLV A;  1YKC A;  3P90 A;  3APS A;  1SK2 A;  3IC4 A;  1DUG A;  3ZFB A;  4KAE A;  1OAZ A;  2WS2 A;  3ME8 A;  3FMW A;  3CSI A;  1ZL9 A;  2R4V A;  4GLT A;  4DSQ A;  1GWC A;  2H30 A;  1MTC A;  4EF0 A;  4POL A;  5KN1 A;  3FK8 A;  3M9J A;  1U3A A;  4XRD A;  3KH9 A;  3A2X A;  1WIK A;  2YWM A;  4WR4 A;  1VRS D;  3CTG A;  1OE8 A;  4CY6 A;  1A8L A;  5CYY A;  10GS A;  2NTO A;  1R5A A;  1YEP A;  2DJK A;  2BTO T;  1BED A;  4GXZ A;  3MYD A;  1TRW A;  1CQH A;  4F9Z A;  5DAK A;  2LQO A;  3ERW A;  1EZK A;  2G0F A;  3PIN A;  2VL2 A;  4KCE A;  5ID2 A;  1B9Y C;  2MMO A;  1SL1 B;  1QK8 A;  2FLS A;  4TW5 A;  3EPT A;  4ECJ A;  5D9X A;  2R5G A;  1S3C A;  1W4V A;  2VCW A;  2WB9 A;  1HNA A;  2CZ3 A;  1Z6N A;  2A4H A;  5CAX A;  1YF0 A;  4N10 A;  2DKI A;  2KUC A;  2F3M A;  3TKS E;  1U6T A;  4NHW A;  1N8J A;  2L4Q A;  1A24 A;  2VAF A;  2LV3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...