4HU7A

E. coli thioredoxin variant with pro76 as single proline residue
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
107
structure length
107
Chain Sequence
SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGACKMIAAILDEIADEYQGKLTVAKLNIDQNAGTAAKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Thioredoxin-1
publication title (4R)- and (4S)-Fluoroproline in the Conserved cis-Prolyl Peptide Bond of the Thioredoxin Fold: Tertiary Structure Context Dictates Ring Puckering.
pubmed doi rcsb
source organism Escherichia coli
total genus 30
structure length 107
sequence length 107
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4hu7A00
2C3TA 4MF6A 1FW1A 2V1MA 2YV7A 3WT2A 3LORA 3W8JA 2IMKA 4OFMA 1UA5A 1GNWA 2YZUA 3BBYA 3M8NA 3VLNA 2IFQB 5KN2A 4LL4B 4RQXA 1VF1A 2MYGA 1NSWA 2C80A 2H1BA 4MJEA 5FT3A 5DDLA 1F9MA 2JSZA 1FB0A 4IP1A 1SJZA 4GSNA 4K1FA 3GL5A 2HE3A 4ZB6A 4MDCA 4TKYA 3VFIA 4XCSA 2GDRA 3CSHA 4F82A 2PN8A 2B5EA 4V2NA 3F4RA 1OC3A 2YWMA 3GSTA 3QFBC 2MMAA 5JWRB 2LNSA 3GKMA 3UVHA 5IMFA 2IL3A 1ML6A 4IVFA 3J7Yk 5IMDA 4KX4A 1XW6A 3FHKA 2MMOA 5ID2A 4CHSA 2CAIA 2LJRA 1J08A 2F3MA 3EURA 3TJKA 1EP8A 3LXTA 1GTBA 2FUG2 2OACA 4F9ZA 4LLRA 2LRCA 3VWXA 2KP1A 3TOTA 2R5GA 1EP7A 2I1UA 1GRXA 3VURA 2VLVA 1PSQA 2VLUA 2WB9A 1PD21 3KIJA 5ENUA 4XIHA 5D9WA 2CZ2A 2HNLA 5G1LA 3A2WA 3VPQA 4POMA 2GZPA 2MBTA 3EYTA 3GKNA 5D9VA 2LUSA 1QFNA 2WFCA 3RPPA 4EXJA 2MMNA 3F4TA 10GSA 3LYKA 1S3CA 3M0FA 3ERFA 2AJQB 4TVEA 2ALBA 2QC7A 3TCOA 3ME7A 4GQFA 5ECQB 2KP2A 4XS4A 1JZDA 1EGRA 1THXA 2PGTA 3KMNA 1ZYQB 1QK8A 2DMLA 3VWUA 1VRSD 4GTUA 1B48A 2PBJA 2P5RA 1AC1A 2DJ3A 2RM6A 2OKAA 1GLPA 3UBKA 3GKKA 4X1UA 1X9SB 2IMDA 5ECMB 1WE0A 4V2MA 2C0DA 4FYBA 1TI1A 4NMUA 1TOFA 4F03A 5LNKe 1XIYA 3GHAA 2HXKA 3ZTLA 3AY8A 3GX8A 3G7IA 3DIEA 1XBSA 3TGZA 1FHEA 4ID0A 4MMMA 2GQMA 3I9V2 1WJKA 4OD7A 3TJJA 1OC9A 2C0GA 4IELA 1SYRA 1TI3A 2PMTA 2V32A 5J3RA 1M2AA 4ECIA 1PX6A 3GUSA 2Z9SA 5GAPD 3ZYWA 1TK8B 2K18A 2IWTA 2D2ZA 1VF2A 2B1LA 2RLIA 4NV5A 1TP9A 2JZRA 1X5DA 1ZMAA 2GGTA 4WBRD 5DALB 5D9TA 1I9DA 1PL1A 1X0RA 5JWQB 1YKCA 4I8BA 4KCAA 5ECRB 1SKWB 3GURA 3M9JA 4NPBA 4KAEA 4OFTA 1PQNA 3FZ5A 2DJ2A 2IMEA 1DSBA 4OMVA 1SD9A 1ABAA 1RW1A 1TW9A 1HD2A 4I2TA 4PQHA 3ED3A 1MD4A 1IYHA 1TJDA 3DXBA 4FH8A 2EIQA 6GSWA 2OE3A 4CDOA 1XW9A 3O6TA 5ECLB 3WGEA 4KDXA 3RAZA 3DD3A 2XBQA 2H70A 4PUAA 2WRTA 1GUMA 3PH9A 1S3AA 3IR4A 1PRXA 1LBKA 4ZILA 1K0AA 5J4UA 2L5LA 12GSA 2RIIA 3Q19A 2KHPA 1OAZA 2WJUA 1FB6A 3HZ8A 1R26A 3C73A 3VWVA 2PVQA 3APSA 5C04A 1GSQA 2HZEB 3VWWA 17GSA 4G9HA 1TRWA 2WZ9A 4CW9A 4DSSB 2NTOA 2VD0A 4MF5A 1JLWA 3TDGA 5GSSA 2L4QA 3DRNA 4H86A 1EGOA 3IHQA 5IMZA 1BX9A 1ILOA 3E3EA 1TKDB 2FCHA 3GIXA 5EY6A 2C3QA 4XRAA 4TXOA 4IJIA 5GAND 5DCHA 5AGYA 3KCMA 2HLSA 2OJLA 4YAVA 4KDYA 5CREA 1ZGNA 2CV4A 1ERWA 1K0MA 2IN3A 1R5PA 2B7JA 2KOKA 4D73A 1O73A 2DJ0A 2R2JA 5CNWA 1GTAA 1O8WA 4XS1A 1J0FA 4MP4A 1A0FA 5B8BA 4PNGA 4BL7A 1MEKA 1PKWA 4QQ7A 4K7NA 2CZ3A 5IIZA 2GSRA 5IMAA 5J9CA 2I3YA 1URMA 3UARA 4K7IA 2FWGA 2VLTA 3HYPA 4P3YB 1M2DA 1K0OA 2JU5A 4KB3A 2K6VA 4O32A 3RBTA 4XS4B 1A2LA 3UAPA 1BQ7A 1MTCA 4GRFA 4WR4A 5H5QA 5ECNB 2LV3A 3TOUA 4PGTA 2CA8A 3TUEA 2VIMA 3K8NA 1TU8A 2OADA 3APQA 1N2AA 3TKSC 4X43A 1BYEA 1NM3A 4TN8A 6GSVA 1K0BA 18GSA 3F0IA 1XCCA 4PX1A 1G0TA 1SD8A 4ML6A 3MSZA 4OO5A 4EDYA 1OC9B 2E2MA 1WMJA 3ZFLA 4EUYA 2E7PA 3E9JB 2IPAA 1PGTA 3U6VA 4TRXA 2BTOT 4ZL9A 2AV4A 2KLXA 3F3QA 1EOHA 2E0QA 4PXOA 5DAKB 4O92A 4YQMA 2LRTA 1CQGA 2IIYA 2JSYA 2VCWA 3TRPA 3HXSA 1TTZA 1CQHA 1YEXA 3KP9A 3BOAA 5LCZA 1GSEA 1DUGA 2LNTA 3ZREA 2DJ1A 2OBKA 3FZ9A 5HFGA 1OC8A 2YV9A 1V40A 4ZBDA 4TR0A 1O85A 1B4PA 2V6OA 1TRUA 4J56E 1SL2B 2H74A 1SK0A 1HYUA 2PU9C 3EC3A 5CRDA 1E2YA 22GSA 1O6JA 2DSAA 2DIYA 2YJ7A 1GSFA 3F4SA 5DQSA 1XPVA 2FY6A 1JHBA 2HI7A 5CRGA 5HR2A 2AHEA 1TK0B 2CQ9A 3O3TA 3PR8A 1FG4A 13GSA 2A2SA 2AAWA 3GYKA 3KH9A 2TRCP 3Q6OA 3UIWA 2X8HA 1PKZA 1Y25A 3TJGA 3EWLA 3D4MA 1EWXA 3L9UA 1XZOA 3SBCA 4F2IA 4Q5RA 1DBYA 3D4TA 2YANA 3CMIA 1UN2A 2ZNMA 3D21A 1YZXA 1QUWA 5DJLA 4EE0A 3ZFBA 3BCKA 2MMZA 1O8XA 1FAAA 3C1SA 1GNEA 1Y6EA 2VCQA 3IOSA 5ECSA 2HRNA 3F3RA 5CRWA 3CTFA 4L0WA 5JCUA 1AQVA 1Q4JA 1G7EA 2O8VB 2GZZA 2H76A 2VCZA 3QDNA 2GLRA 1HQOA 4YH2A 4BA7A 3WGXA 4KNDA 3HZ4A 1ZYEA 2M72A 2OBIA 4KA0A 2L57A 8GSSA 5B6NA 3J7Yb 1GL8A 2L4CA 1U3AA 4MA9A 4FIWA 5L71A 1A24A 3QCPA 2HSYA 2DLXA 4GSSA 2XHFA 1THOA 3DVWA 3FR9A 2JZSA 3I69A 1G7OA 3VPTA 2XPDA 3US3A 2FWEA 1H75A 4LMWA 4TR1A 2E2GA 3IAS2 4V2LA 2CT6A 3CRTA 1XWBA 1G6WA 2ZCTA 3FZAA 1B8XA 4MCUA 4KGIA 1V2AA 2R3XA 3CRUA 3TJFA 4AJ7A 2BJXA 5LD0A 4YQUA 3DWVA 4NHWA 2AUVA 4IHUA 1F37A 3HCZA 3ZLPA 5F05A 4IP6A 3TB2A 2FWHA 4JE1A 5ELAA 2H1GA 1Z3EA 1VGLA 3TJBA 1V58A 2ON5A 4MZBA 1O7UA 4ULXA 1HNAA 2EIRA 3L9VA 6GSTA 4K0GA 2GZYA 5D93A 4L0UA 1V9WA 3P90A 1XXUA 1GLQA 3CSIA 4HQSA 2H8LA 2F8AA 4FYCA 4NHZA 2GQLA 4G19A 4HJ2A 3CXGA 2VCXA 1BEDA 3LJRA 4MZCA 2C1YA 4ISDA 4X0XA 2N5BA 4J2FA 2B5YA 3QFAC 4IJ3A 4PUFC 3ZVJA 3HA9A 2H71A 5H5RA 2EIOA 3L78A 1AQXA 3C1RA 3KH7A 1ERTA 3D0ZA 2I4AA 2PPTA 2CAQA 1M2BA 3U5RE 1T8EB 4I5QA 2R37A 3GNJA 1K3LA 3P2AA 1YF0A 3DEXA 5D8IA 3HVVA 3H93A 3KXOA 3GH9A 4EVMA 2DMMA 2H72A 3D5JA 4ZL8A 2C3NA 1EOGA 1DE2A 1S3DA 1JZRA 3QOUA 2H1DA 1KEBA 4GSTA 1WWJA 5FWGA 3DMLA 5B6MA 5G5EA 5JCWA 3GA4A 3M1GA 3G7JA 3LFLA 5ECKB 3GN3A 1SL1B 4MK3A 1SKRB 1RK4A 3FY7A 4IN0A 4NXIA 5DCGA 2O87A 1KTEA 2AYTA 4KSMA 5COHA 5IOXA 5G31A 1GUKA 1B9XC 1Z6NA 3IDVA 4IS0A 2ON7A 4Z7XA 1SYXA 4XS6A 3WYWA 4ML1A 2VL2C 1VF4A 4MH3A 1W89A 1R7HA 5J9BA 4G10A 6GSYA 5EVOA 4Q5FA 2WULA 4MH2A 2P5QA 4GWRA 3IBHA 1BAYA 1XVWA 4WBJA 1SKSB 1SK1A 1XOAA 3KTBA 1WPIA 1YJ6A 3QD9A 4GXZA 3HJPA 3VI7A 5EPFA 2CX3A 5DBQA 1G6YA 4MJCA 3C71A 4OFNA 2JZTA 5CRHA 4ZIJA 2XC2A 2GT5A 4ZBAA 1A0RP 3ZIVA 2XPEA 4F0CA 3QAGA 5IOWA 1EZKA 4E8HA 5D96A 5ABRA 2BMXA 3N5OA 1X9MB 6GSUA 4ZB8A 5F07A 5A4UA 4DSQA 4TR4A 4HJMA 4HZ4A 5ID2B 4L5OA 5KN0A 1N8JA 5A5KA 3F8UA 1U87A 2VCVA 2QGVA 1M9AA 2VUPA 3C8EA 2PERA 3LG6A 4JU5A 1YDKA 2GVPA 4POLA 5HR3A 1TXXA 4KCEA 1U3IA 1AUCA 2WCIA 5B7CA 3TKSA 5KN3A 4ZXGA 1U88A 2HT9A 1Z9HA 2V6KA 3H8QA 3MAKA 1RQMA 1U6TA 4EL1A 1HNBA 4I6XA 1F2EA 1XW5A 2VAFA 4DSRA 4FO5A 3F6FA 3TKSE 4OCEA 2GS3A 5HFIA 2A2RA 4RI6A 4IW9A 5HQPA 3E0UA 3FYGA 3WD6A 3SWLA 4JEDA 4XRDA 16GSA 1USBA 1B9YC 7GSSA 3FKFA 5B8AA 4HOJA 1OYJA 5G2ZA 4PQIA 4K9ZA 5AISA 2YCDA 5ECIB 1GULA 4K6XA 2FHEA 2FGXA 4MPFA 1TU7A 4FYUA 4MPGA 3GTUA 4JZQA 2VL3A 2H0HA 1MDIA 2X64A 1YF1A 1JFUA 4KH7A 3ZZXA 3HJMA 2CVBA 4F0BA 4TXVA 4WF5A 3TRXA 1H4OA 4I97A 2WDUA 1R5AA 1PN9A 5AIVA 3IC4A 1M0UA 2YN1A 2PWJA 5F0GA 1UVZA 2B7KA 2B5XA 3KM6A 3WGDA 4WXTA 1WP0A 2YNXA 2H73A 2H75A 3EMXA 3W8SA 3HD5A 3FK8A 3ZRDA 3FRCA 2REMA 3IXRA 3PGTA 3FZ4A 5DQYA 5IO2A 1AIUA 1YQ1A 3HVXA 4EF0A 4OCFA 4KUNA 4RQRA 3EE2A 1OVNA 1T4ZA 3KMOA 1GWCA 4QL7A 3A5WA 1O81A 1GH2A 2C0EA 1SENA 2H6ZA 2HRFA 3H4KA 3HHVA 5ECOB 3ERGA 2VD1A 2OE1A 4HU7A 1A23A 2H66A 2NDOA 2WS2A 5DVBA 1TK5B 5D73A 2X8GA 4BPYA 3H1NA 5IM9A 3GX0A 2YWIA 4HS1A 1EV4A 3FW2A 1ERUA 1QXHA 3ISOA 4V1Ag 2XBIA 3WT1A 3KZQA 2JACA 2K8VA 4RUVA 1LJRA 4BVXA 4G2EA 1Z7PA 2WGRA 4N30A 4JR4A 4E8EA 4TR3A 1ZOFA 2DJKA 2LJKA 2FA8A 2C0FA 4XHMA 4KDUA 1XWKA 1GSDA 3ZL5A 3KTLA 3A3TA 2YPMA 3Q18A 3RPNA 1YKAA 2FLSA 3VK9A 1T3BA 4ACSA 4POKA 2NBSA 3IPZA 5GZZB 2H1AA 3RHCA 1I5GA 5EL8A 3GV1A 3UOMA 2C4JA 4N11A 2H30A 2ZUPA 1XOBA 4WEYA 1GTUA 3LXZA 4YAPA 4ECCA 1PL2A 2B6MA 3R2QA 3EU3A 3GFKA 4DVCA 4ECJA 2FD3A 1F3BA 1GTIA 3UL3A 5HR1A 4HQZA 4KW6A 2HZEA 3V1WA 1MDKA 4TXOB 3JCML 2YP6A 1GSYA 1AQWA 2R4VA 3HVSA 4DSSA 1SU9A 3ZVJD 3FR6A 2VOCA 4ILFA 3TKRA 4AJ6A 4WETA 2AB6A 4D73B 4PURA 3QPMA 3LWAA 5A4VA 2IJYA 3C7MA 3KGKA 2J9HA 3GSSA 2LTKA 2C8UA 1TRSA 1AXDA 2I81A 4WKWA 3TKPA 3EMPA 3TRQA 1AAZA 4NWYA 2V2GA 3CYNA 2CVDA 5IPGA 1A2JA 3BD2A 1WOUA 2RUFA 3IA1A 3UBLA 1X5EA 5INYA 1M99A 4K0NA 3L4NA 1PMTA 5IMVA 5F8BA 4YQVA 3IV4A 2QSIA 4KE3A 3LGCA 4EKZA 5GSTA 4IQAA 2VM2A 4J57E 4TOPA 1SJ6A 3GTUB 5H5SA 2OA7A 2OE0A 4MABA 2J23A 4HEA2 1ST9A 2GQKA 1YY7A 5D9XA 2GSTA 4N0ZA 3L0HA 3G9BA 1OKDA 1V57A 2CX4A 4V1Ap 2JADA 5HR0A 1VF3A 1K0DA 3M3MA 2PVOC 3FEUA 2B1KA 1A8LA 1NW2A 1FO5A 5ECHB 3IRAA 1AW9A 3N9JA 5ELGA 1XFLA 4NV2A 4NAXA 2MZCA 5JCGA 9GSSA 4GQCA 1GUHA 2R6KA 1K0CA 4N0VA 2L6DA 1Z7RA 3F63A 1HNCA 1T4YA 4IKHA 5E4WA 3QAWA 3TKQA 1E6BA 2VL2A 1V98A 2H0GA 2HZFA 2MBSA 3H79A 1NHYA 4TW5A 4HI7A 5AIXA 1X5CA 3D22A 14GSA 3L9SA 4K2DA 1M9BA 3A2XA 19GSA 5DAKA 3W6GA 1Z6MA 2G0FA 4IBPA 4Q5NA 2GT6A 4L8EA 1SK2A 4JBBA 2M46A 2DC5A 3DVXA 1J9BA 3HY2A 3S9FA 1XVQA 4LA1A 5FHIA 3D6IA 1FOVA 3KD0A 1GP1A 1QMVA 3DKSA 1T1VA 5G30A 5AN1A 2DBCA 3NOFA 1EEMA 2DJJA 2FNOA 1DE1A 3IK9A 3UJ1A 1K0NA 1OE7A 1OE8A 4DEJA 1BG5A 5DJMA 2V41A 1PA3A 2F9SA 3CBUA 3EINA 3CTGA 11GSA 4JRRA 1XWCA 2NVLA 3P8WA 3Q74A 3FR3A 1K3YA 2G2QA 2LS5A 1ZL9A 1XWGA 3ZMKA 4WR5A 1F6MC 5KN1A 5CP1A 1T00A 3GL3A 1KNGA 3HDCA 2DIZA 1Z5YE 1GSUA 1JLVA 2O7KA 3A2VA 4MZWA 2O85A 1MDJA 1ERVA 1TDIA 2JL4A 1EV9A 3GKXA 2IFQA 3GRXA 2VCTA 2N5FA 2YZHA 3QMXA 1B4QA 1LU4A 2M80A 3MDKA 4AGSA 3BJ5A 2VM1A 5CO3A 2L6CA 2NPBA 5IQYA 3RHBA 1K3OA 4WF4A 4GCIA 3MNGA 3KJYA 3KP8A 4Q5QA 1C72A 3DYRA 2K8SA 2CVKA 3IK7A 5J5NA 1MD3A 4RI7A 4IGJA 2L5OA 4ZB9A 6GSSA 2HYXA 4EDZA 3ZIJA 2LQQA 3EU4A 4TR1B 2EC4A 3P7XA 3ZITA 1IYIA 2VL9A 3OR5A 2GSSA 2YOIA 5IO0A 1BJXA 3RDWA 2FA4A 4MF7A 1WIKA 1JZWA 2P31A 3ZMLA 4AF2A 4K8MA 4MJBA 3APOA 4I2UA 4EO3A 4GF0A 3F9UA 4AJ8A 5G1KA 4MLYA 2H19A 2L59A 3LYPA 3EVIA 3GH6A 2LQOA 2PUKC 6GSXA 2KUCA 3I6AA 3I43A 3PINA 1ZCPA 2HFDA 2IMIA 2LEGA 3UEMA 3IAM2 4QL9A 4POBA 1WRYA 3VI5A 2HSHA 4HZ2A 4N10A 1FVKA 5F06A 2GSQA 5E59A 3QR6A 1R4WA 2N5AA 3ME8A 2H6XA 5C00A 2F51A 1ZZYA 2LSTA 4HUAA 2H01A 5J41A 1XWAA 5CYYA 4L5LA 2RM5A 4PNFA 5A4WA 4MJAA 2QKEA 2X8CA 3LEFA 2FWFA 2H6YA 4ZL7A 4ECBA 4LL1B 4ZBBA 1W4VA 2IMFA 4HDEA 3QAVA 5IPHA 2TRXA 2O89A 4OWYA 1FVJA 1UC7A 1ACVA 1QQ2A 2ES7A 1Q98A 1QGVA 3UMAA 2YJHA 2I9HA 1YEPA 4HU9A 2LJAA 2VO4A 5CAXA 2F8FA 1KBNA 2X99A 1A8YA 1NHOA 1F3AA 4BWSA 4OO4A 4IQ1A 3LQ7A 2H0IA 3NIVA 4O7HA 1SJIA 20GSA 3BCIA 4KSOA 1X9WB 4GLTA 4XTSA 1SL0B 1OKTA 2A4VA 3DGQA 1ON4A 5JWOB 3LSZA 2YWNA 1A2MA 4O5RA 4JR6A 1EEJA 5G5FA 5IMCA 1JZOA 3HKRA 3CSJA 1PX7A 3M9KA 3ERWA 4LMVA 2GTUA 3IE3A 2P0GA 2B3SA 4EC0A 2TIRA 3UVTA 4K7OA 5ECPB 1T7PB 5KEJA 3GMFA 3NZNA 4BWQA 3KEBA 2K9FA 4BVYA 3F6DA 2LRNA 3O76A 1TRVA 5DALA 3HJOA 2LKUA 4PQ1A 1GSSA 2RUEA 3MWHA 5HFKA 2YWOA 3G7YA 1M7TA
chains in the Genus database with same CATH superfamily
2C3TA 4MF6A 1FW1A 2V1MA 4YKFA 2YV7A 3WT2A 3LORA 3W8JA 2IMKA 4OFMA 1UA5A 1GNWA 2YZUA 3HVNA 3BBYA 3M8NA 3VLNA 2IFQB 5KN2A 4LL4B 4RQXA 1PFOA 1VF1A 2MYGA 1NSWA 2C80A 2H1BA 4MJEA 5FT3A 5DDLA 1F9MA 2JSZA 1FB0A 4IP1A 1SJZA 4GSNA 4K1FA 3GL5A 2HE3A 4ZB6A 4MDCA 4TKYA 3VFIA 4XCSA 2GDRA 3CSHA 4F82A 2PN8A 2B5EA 4V2NA 3F4RA 1OC3A 2YWMA 3GSTA 3QFBC 2MMAA 5JWRB 2LNSA 3GKMA 3UVHA 5IMFA 2IL3A 1ML6A 4FQUA 4IVFA 3J7Yk 5IMDA 4KX4A 4O5QA 1XW6A 3FHKA 2MMOA 5ID2A 4CHSA 2CAIA 2LJRA 1J08A 2F3MA 3EURA 3TJKA 1EP8A 3LXTA 1GTBA 2FUG2 2OACA 4F9ZA 4LLRA 2LRCA 3VWXA 2KP1A 3TOTA 2R5GA 1EP7A 2I1UA 1GRXA 3VURA 2VLVA 1PSQA 2VLUA 2WB9A 1PD21 3KIJA 5ENUA 4XIHA 5D9WA 2QA2A 2CZ2A 2HNLA 5G1LA 5KOXA 3A2WA 3VPQA 4POMA 2GZPA 2MBTA 3EYTA 3GKNA 5D9VA 2LUSA 4K2XA 1QFNA 2WFCA 3RPPA 2HSMA 4EXJA 2MMNA 3F4TA 10GSA 3LYKA 1S3CA 3M0FA 3ERFA 2AJQB 4TVEA 2ALBA 2QC7A 3TCOA 3ME7A 4GQFA 5ECQB 2KP2A 4XS4A 1JZDA 1EGRA 1THXA 2PGTA 3KMNA 1ZYQB 1QK8A 2DMLA 3VWUA 1VRSD 4GTUA 1B48A 2PBJA 2P5RA 1AC1A 2DJ3A 2RM6A 2OKAA 1GLPA 3UBKA 3GKKA 4X1UA 1X9SB 2IMDA 5ECMB 1WE0A 4V2MA 2C0DA 4FYBA 1TI1A 4NMUA 1TOFA 4F03A 5LNKe 1XIYA 3GHAA 2HXKA 3ZTLA 3AY8A 3GX8A 3G7IA 3DIEA 1XBSA 3TGZA 1FHEA 4ID0A 4MMMA 2GQMA 3I9V2 1WJKA 4OD7A 3TJJA 1OC9A 2C0GA 4IELA 1SYRA 1TI3A 2PMTA 2V32A 5J3RA 1M2AA 4ECIA 1PX6A 3GUSA 2Z9SA 5GAPD 3ZYWA 1TK8B 2K18A 2IWTA 2D2ZA 1VF2A 2B1LA 2RLIA 4NV5A 1TP9A 2JZRA 1X5DA 1ZMAA 2GGTA 4WBRD 5DALB 5D9TA 1I9DA 1PL1A 1X0RA 5JWQB 1YKCA 4I8BA 4KCAA 5ECRB 1SKWB 3GURA 3M9JA 4NPBA 4KAEA 4OFTA 1PQNA 3FZ5A 2DJ2A 2DKIA 2IMEA 1DSBA 4OMVA 1SD9A 1ABAA 1RW1A 1TW9A 1HD2A 4I2TA 4PQHA 3ED3A 1MD4A 1IYHA 1TJDA 3DXBA 4FH8A 2EIQA 6GSWA 2OE3A 4CDOA 1XW9A 3O6TA 5ECLB 3WGEA 4KDXA 3RAZA 3DD3A 2XBQA 2H70A 4PUAA 2WRTA 1GUMA 3PH9A 1S3AA 3IR4A 1PRXA 1LBKA 4ZILA 1K0AA 5J4UA 2L5LA 12GSA 2RIIA 3Q19A 2KHPA 1OAZA 2WJUA 1FB6A 3HZ8A 1R26A 3C73A 4ICYA 3VWVA 2PVQA 3APSA 5C04A 1GSQA 2HZEB 3VWWA 17GSA 4G9HA 4EIQA 1TRWA 2WZ9A 4CW9A 4DSSB 4BIKA 2NTOA 2VD0A 4MF5A 1JLWA 3TDGA 5GSSA 2L4QA 3DRNA 4H86A 1EGOA 3IHQA 5IMZA 2A4HA 1BX9A 1ILOA 3E3EA 1TKDB 2FCHA 3GIXA 5EY6A 2C3QA 4XRAA 4TXOA 4IJIA 5GAND 5DCHA 5AGYA 3KCMA 2HLSA 2OJLA 4YAVA 4KDYA 5CREA 1ZGNA 3FMWA 2CV4A 1ERWA 1K0MA 2IN3A 1R5PA 2B7JA 2KOKA 4D73A 1O73A 2DJ0A 1S3RA 2R2JA 5CNWA 1GTAA 1O8WA 4XS1A 1J0FA 4MP4A 1A0FA 5B8BA 4PNGA 5BMUA 4BL7A 1MEKA 1PKWA 4QQ7A 4K7NA 2CZ3A 5IIZA 2GSRA 5IMAA 5J9CA 3EPTA 2I3YA 1URMA 3UARA 4K7IA 2FWGA 2VLTA 3HYPA 4P3YB 1M2DA 1K0OA 2JU5A 4KB3A 2K6VA 4O32A 3RBTA 4XS4B 1A2LA 3UAPA 1BQ7A 1MTCA 4GRFA 4WR4A 5H5QA 5ECNB 2LV3A 3TOUA 4PGTA 2CA8A 3TUEA 2VIMA 3K8NA 1TU8A 2OADA 3APQA 1N2AA 3TKSC 4X43A 1BYEA 1NM3A 4TN8A 6GSVA 1K0BA 18GSA 3F0IA 1XCCA 4PX1A 1G0TA 1SD8A 4ML6A 3MSZA 4OO5A 4EDYA 3IC8A 1OC9B 2E2MA 1WMJA 3ZFLA 4EUYA 1XG8A 2E7PA 3E9JB 2IPAA 1PGTA 3U6VA 4TRXA 2BTOT 4ZL9A 2AV4A 2KLXA 3F3QA 4Z2RA 1EOHA 2E0QA 4PXOA 5DAKB 4O92A 4YQMA 2LRTA 1CQGA 2IIYA 2JSYA 2VCWA 3TRPA 3HXSA 1TTZA 1CQHA 1YEXA 3KP9A 3BOAA 5LCZA 1GSEA 1DUGA 2LNTA 3ZREA 2DJ1A 2OBKA 3FZ9A 5HFGA 2X4AA 1OC8A 2YV9A 1V40A 4ZBDA 4TR0A 1O85A 1B4PA 2V6OA 1TRUA 4J56E 1SL2B 3MYDA 2H74A 1SK0A 1HYUA 2PU9C 4X4JA 3EC3A 5CRDA 1E2YA 22GSA 1O6JA 2DSAA 4O5UA 2DIYA 2YJ7A 1GSFA 3F4SA 5DQSA 4HSCX 1XPVA 2FY6A 1JHBA 2HI7A 5CRGA 5HR2A 2AHEA 1TK0B 2CQ9A 3O3TA 3PR8A 1FG4A 13GSA 2A2SA 2AAWA 3GYKA 3KH9A 2TRCP 3Q6OA 3UIWA 2X8HA 1PKZA 1Y25A 3TJGA 3EWLA 3D4MA 1EWXA 3L9UA 1XZOA 3SBCA 4F2IA 4Q5RA 1DBYA 3D4TA 2YANA 3CMIA 1UN2A 2ZNMA 3D21A 1YZXA 1QUWA 5DJLA 4EE0A 3ZFBA 3BCKA 2MMZA 1O8XA 3IHGA 1FAAA 3C1SA 1GNEA 1Y6EA 2VCQA 3IOSA 4MNNA 5ECSA 2HRNA 3F3RA 5CRWA 3CTFA 4L0WA 5JCUA 1AQVA 1Q4JA 1G7EA 2O8VB 2GZZA 2H76A 2VCZA 3QDNA 4YKGA 2GLRA 1HQOA 4YH2A 4BA7A 3WGXA 4KNDA 3HZ4A 1ZYEA 2M72A 2OBIA 4KA0A 2L57A 8GSSA 5B6NA 3J7Yb 1GL8A 2L4CA 1U3AA 4MA9A 4FIWA 5L71A 1A24A 3QCPA 3CQFA 2HSYA 2DLXA 4GSSA 2XHFA 1THOA 3DVWA 3FR9A 2JZSA 3I69A 1G7OA 3VPTA 2XPDA 3US3A 2FWEA 1H75A 4LMWA 4TR1A 2E2GA 3IAS2 4V2LA 2CT6A 3CRTA 1XWBA 1M3IA 1G6WA 2ZCTA 3FZAA 1B8XA 4MCUA 4KGIA 1V2AA 2R3XA 3CRUA 3TJFA 4AJ7A 2BJXA 5LD0A 4YQUA 3DWVA 4NHWA 2AUVA 4IHUA 1F37A 3HCZA 3ZLPA 5F05A 4IP6A 3TB2A 2FWHA 4JE1A 5ELAA 2H1GA 1Z3EA 1VGLA 3TJBA 1V58A 2ON5A 4MZBA 1O7UA 4ULXA 1HNAA 2EIRA 3L9VA 6GSTA 4K0GA 2GZYA 5D93A 4L0UA 2HRAA 1V9WA 3P90A 1XXUA 1GLQA 3CSIA 4HQSA 2H8LA 2F8AA 4FYCA 4NHZA 2GQLA 4G19A 4HJ2A 3CXGA 2VCXA 1BEDA 3LJRA 4MZCA 2C1YA 4ISDA 4X0XA 2N5BA 4J2FA 4CY6A 2B5YA 3QFAC 4IJ3A 4PUFC 3ZVJA 3HA9A 2H71A 5H5RA 2EIOA 3L78A 1AQXA 3C1RA 3KH7A 1ERTA 3D0ZA 2I4AA 2PPTA 2CAQA 1M2BA 3U5RE 1T8EB 4I5QA 2R37A 3GNJA 1K3LA 3P2AA 1YF0A 3DEXA 5D8IA 3HVVA 3H93A 3KXOA 3GH9A 4EVMA 2DMMA 2H72A 3D5JA 4ZL8A 2C3NA 1EOGA 1DE2A 1S3DA 1JZRA 3QOUA 2H1DA 1KEBA 4GSTA 4Z2TA 1WWJA 5FWGA 3DMLA 5B6MA 5G5EA 5JCWA 3GA4A 3M1GA 3G7JA 4BVYB 3LFLA 5ECKB 3GN3A 1SL1B 4MK3A 1SKRB 1RK4A 3FY7A 4IN0A 4NXIA 5DCGA 2O87A 1KTEA 2AYTA 4KSMA 5COHA 5IOXA 5G31A 1GUKA 1B9XC 1Z6NA 3IDVA 4IS0A 2ON7A 4Z7XA 1SYXA 4XS6A 3WYWA 4ML1A 2VL2C 1VF4A 4MH3A 1W89A 1R7HA 5J9BA 4G10A 6GSYA 5EVOA 4Q5FA 2WULA 4MH2A 2P5QA 4GWRA 3IBHA 1BAYA 1XVWA 4WBJA 1SKSB 1SK1A 1XOAA 3KTBA 1WPIA 1YJ6A 3QD9A 4GXZA 3HJPA 3VI7A 5EPFA 2CX3A 5DBQA 1G6YA 4MJCA 3C71A 4G0LA 4OFNA 2JZTA 5CRHA 4ZIJA 2XC2A 2GT5A 4ZBAA 1A0RP 3ZIVA 2XPEA 4F0CA 3QAGA 4USSA 5IOWA 1EZKA 4E8HA 5D96A 5ABRA 2BMXA 3N5OA 1X9MB 6GSUA 4ZB8A 5F07A 5A4UA 4DSQA 4TR4A 4HJMA 4HZ4A 5ID2B 4L5OA 5KN0A 1N8JA 5A5KA 3F8UA 1U87A 2VCVA 2QGVA 1M9AA 2VUPA 3C8EA 2PERA 3LG6A 4JU5A 2DKHA 1YDKA 2GVPA 4POLA 4G0KA 5HR3A 1TXXA 4KCEA 1U3IA 1AUCA 2WCIA 5B7CA 3TKSA 5KN3A 4ZXGA 1U88A 2HT9A 1Z9HA 2V6KA 3H8QA 3MAKA 1RQMA 1U6TA 4EL1A 1HNBA 4I6XA 1F2EA 1XW5A 2VAFA 4DSRA 4FO5A 3F6FA 3TKSE 4OCEA 2GS3A 5HFIA 2A2RA 4RI6A 4IW9A 5HQPA 3E0UA 3FYGA 3WD6A 3SWLA 4JEDA 4XRDA 16GSA 1USBA 1B9YC 7GSSA 3FKFA 5B8AA 4HOJA 1OYJA 5G2ZA 4PQIA 4K9ZA 5AISA 2YCDA 5ECIB 1GULA 3PPUA 4K6XA 2FHEA 2FGXA 4MPFA 1TU7A 4FYUA 4MPGA 3GTUA 3MIXA 4JZQA 2VL3A 2H0HA 1MDIA 2X64A 1PN0A 1YF1A 1JFUA 4KH7A 3ZZXA 3HJMA 2CVBA 4F0BA 4TXVA 4WF5A 3TRXA 1H4OA 4I97A 2WDUA 1R5AA 1PN9A 5AIVA 3IC4A 1M0UA 2YN1A 2PWJA 5F0GA 1UVZA 2B7KA 2B5XA 3KM6A 3WGDA 4WXTA 1WP0A 2YNXA 2H73A 2H75A 3EMXA 3W8SA 3HD5A 3FK8A 3ZRDA 3FRCA 2REMA 4PTSA 3IXRA 3PGTA 3FZ4A 5DQYA 5IO2A 1AIUA 1YQ1A 3HVXA 4EF0A 4OCFA 4KUNA 4RQRA 3EE2A 1OVNA 1T4ZA 3KMOA 1GWCA 4QL7A 3A5WA 1O81A 1GH2A 2C0EA 1SENA 2H6ZA 2HRFA 3H4KA 3HHVA 5ECOB 3ERGA 2VD1A 2OE1A 4HU7A 1A23A 2H66A 2NDOA 2WS2A 4CY8A 5DVBA 1TK5B 5D73A 2X8GA 4BPYA 3H1NA 5IM9A 3GX0A 2YWIA 4HS1A 1EV4A 3FW2A 1ERUA 1QXHA 3ISOA 4V1Ag 2XBIA 3WT1A 3KZQA 2JACA 2K8VA 4RUVA 1LJRA 4BVXA 4G2EA 2R0PA 1Z7PA 2WGRA 4N30A 4JR4A 4E8EA 4KF9A 4TR3A 1ZOFA 2DJKA 2LJKA 2FA8A 2C0FA 4XHMA 4KDUA 1XWKA 1GSDA 3ZL5A 2R0GA 3KTLA 3A3TA 2YPMA 3Q18A 3RPNA 1YKAA 2FLSA 3VK9A 1T3BA 4ACSA 4POKA 2NBSA 3IPZA 5GZZB 2H1AA 3RHCA 4K5RA 1I5GA 5EL8A 3GV1A 3UOMA 2C4JA 4N11A 2H30A 2ZUPA 1XOBA 4WEYA 3LW9A 1GTUA 3LXZA 4YAPA 4ECCA 1PL2A 2B6MA 3R2QA 3EU3A 3GFKA 2HRKA 4DVCA 4ECJA 2FD3A 1F3BA 1ZYNA 1GTIA 3UL3A 5HR1A 4HQZA 4KW6A 2HZEA 3V1WA 1MDKA 4TXOB 3A5IA 3JCML 2YP6A 1GSYA 1AQWA 2R4VA 3HVSA 4DSSA 1SU9A 3ZVJD 3FR6A 2VOCA 4ILFA 3TKRA 4AJ6A 4WETA 2AB6A 4Z2UA 4D73B 4PURA 3QPMA 3LWAA 2QA1A 5A4VA 2IJYA 3C7MA 3KGKA 2J9HA 3GSSA 4BL7B 2LTKA 2C8UA 1TRSA 1AXDA 2I81A 4WKWA 3TKPA 3EMPA 3TRQA 1AAZA 4NWYA 2V2GA 3CYNA 2CVDA 5IPGA 1A2JA 3BD2A 1WOUA 2RUFA 3IA1A 3UBLA 1X5EA 5INYA 1M99A 4K0NA 3L4NA 1PMTA 5IMVA 5F8BA 4YQVA 3IV4A 2QSIA 4KE3A 3LGCA 4EKZA 5GSTA 4IQAA 2VM2A 4J57E 4TOPA 1SJ6A 3GTUB 5H5SA 2OA7A 2OE0A 4MABA 2J23A 4HEA2 1ST9A 2GQKA 1YY7A 5D9XA 2GSTA 4N0ZA 3L0HA 3G9BA 1OKDA 1V57A 2CX4A 4V1Ap 2JADA 5HR0A 1VF3A 1K0DA 3M3MA 2PVOC 3FEUA 2B1KA 1A8LA 1NW2A 1FO5A 5ECHB 3IRAA 1AW9A 3N9JA 5ELGA 1XFLA 4NV2A 4NAXA 2MZCA 5JCGA 9GSSA 4GQCA 1GUHA 2R6KA 1K0CA 4N0VA 2L6DA 1Z7RA 3F63A 4EIPA 1HNCA 1T4YA 4IKHA 5E4WA 3QAWA 3TKQA 5KOWA 1E6BA 2VL2A 1V98A 2H0GA 2HZFA 2MBSA 3H79A 1NHYA 4TW5A 4HI7A 5AIXA 1X5CA 3D22A 14GSA 3L9SA 4K2DA 1M9BA 3A2XA 19GSA 5DAKA 3W6GA 1Z6MA 2G0FA 4IBPA 4Q5NA 2GT6A 4L8EA 1FOHA 1SK2A 4JBBA 2M46A 2DC5A 3DVXA 1J9BA 3HY2A 3S9FA 1XVQA 4LA1A 5FHIA 3D6IA 1FOVA 3KD0A 1GP1A 1QMVA 3DKSA 1T1VA 5G30A 5AN1A 2DBCA 3NOFA 1EEMA 2DJJA 2FNOA 4BVXB 1DE1A 3IK9A 3UJ1A 1K0NA 1OE7A 1OE8A 4DEJA 1BG5A 5DJMA 2V41A 1PA3A 2F9SA 3CBUA 3EINA 3CTGA 11GSA 4JRRA 1XWCA 2NVLA 3P8WA 3Q74A 3FR3A 1K3YA 2R0CA 2G2QA 2LS5A 1ZL9A 1XWGA 3ZMKA 4WR5A 1F6MC 5KN1A 5CP1A 1T00A 3GL3A 4G0IA 1KNGA 3HDCA 2DIZA 1Z5YE 1GSUA 1JLVA 2O7KA 3A2VA 4MZWA 2O85A 1MDJA 1ERVA 1TDIA 2JL4A 1EV9A 3GKXA 2IFQA 3GRXA 2VCTA 2N5FA 2YZHA 3QMXA 1B4QA 1LU4A 2M80A 3MDKA 4AGSA 3BJ5A 2VM1A 5CO3A 2L6CA 2NPBA 5IQYA 3RHBA 1K3OA 4WF4A 4GCIA 3MNGA 3KJYA 3KP8A 4Q5QA 1C72A 2A2PA 3DYRA 2K8SA 2CVKA 3IK7A 5J5NA 1MD3A 4RI7A 4IGJA 2L5OA 4ZB9A 6GSSA 2HYXA 4EDZA 3ZIJA 2LQQA 3EU4A 4TR1B 1ZYPA 3P7XA 2EC4A 3ZITA 1M3JA 1IYIA 2VL9A 3OR5A 2GSSA 2YOIA 5IO0A 1BJXA 3RDWA 2FA4A 4MF7A 1WIKA 1JZWA 2P31A 3ZMLA 4AF2A 4K8MA 4MJBA 3APOA 4I2UA 4EO3A 4GF0A 3F9UA 4AJ8A 5G1KA 4MLYA 2H19A 2L59A 3LYPA 3EVIA 3GH6A 2LQOA 2PUKC 6GSXA 2KUCA 3I6AA 3I43A 3PINA 1ZCPA 2HFDA 2IMIA 2LEGA 3UEMA 3IAM2 4QL9A 4POBA 1WRYA 3VI5A 2HSHA 4HZ2A 5BRTA 4N10A 1FVKA 5F06A 2GSQA 5E59A 3QR6A 1R4WA 2N5AA 3ME8A 2H6XA 5C00A 2F51A 1ZZYA 2LSTA 4HUAA 2H01A 5J41A 1XWAA 5CYYA 4L5LA 2RM5A 4PNFA 5A4WA 4MJAA 2QKEA 2X8CA 3LEFA 2FWFA 2H6YA 4ZL7A 4ECBA 4LL1B 4ZBBA 1W4VA 2IMFA 4HDEA 3QAVA 5IPHA 2TRXA 4K5SA 2O89A 4OWYA 1FVJA 1UC7A 1ACVA 1QQ2A 2ES7A 1Q98A 1QGVA 3UMAA 2YJHA 2I9HA 1YEPA 4HU9A 2LJAA 2VO4A 5CAXA 2F8FA 1KBNA 2X99A 1A8YA 1NHOA 3R3EA 1F3AA 4BWSA 4OO4A 4IQ1A 3LQ7A 2H0IA 3NIVA 4O7HA 1SJIA 20GSA 3BCIA 4KSOA 1X9WB 4GLTA 4XTSA 1SL0B 1OKTA 2A4VA 3DGQA 1ON4A 5JWOB 3LSZA 2YWNA 1A2MA 4O5RA 4JR6A 1EEJA 5G5FA 5IMCA 1JZOA 3HKRA 3CSJA 2X49A 1PX7A 3M9KA 3ERWA 4LMVA 2GTUA 3IE3A 2P0GA 2B3SA 4EC0A 2TIRA 3UVTA 4K7OA 5ECPB 1T7PB 5KEJA 2UZ8A 3GMFA 3NZNA 4BWQA 3KEBA 2K9FA 4BVYA 4A5PA 3F6DA 2LRNA 3O76A 1TRVA 5DALA 3HJOA 2LKUA 4PQ1A 1GSSA 2RUEA 3MWHA 5HFKA 2YWOA 3G7YA 1M7TA
chains in the Genus database with same CATH topology
2C3TA 4MF6A 1FW1A 2V1MA 4YKFA 2YV7A 3WT2A 3LORA 3W8JA 2IMKA 4OFMA 1UA5A 1GNWA 2YZUA 3BBYA 3M8NA 3VLNA 2IFQB 5KN2A 4LL4B 4RQXA 1VF1A 2MYGA 1NSWA 2C80A 2H1BA 4MJEA 5FT3A 5DDLA 1F9MA 2JSZA 1FB0A 4IP1A 1SJZA 4GSNA 4K1FA 3GL5A 2HE3A 4ZB6A 4MDCA 4TKYA 3VFIA 4XCSA 2GDRA 3CSHA 4F82A 2PN8A 2B5EA 4V2NA 3F4RA 1OC3A 2YWMA 3GSTA 3QFBC 2MMAA 5JWRB 2LNSA 3GKMA 3UVHA 5IMFA 2IL3A 1ML6A 4FQUA 4IVFA 3J7Yk 5IMDA 4KX4A 4O5QA 1XW6A 3FHKA 2MMOA 5ID2A 4CHSA 2CAIA 2LJRA 1J08A 2F3MA 3EURA 3TJKA 1EP8A 3LXTA 1GTBA 2FUG2 2OACA 4F9ZA 4LLRA 2LRCA 3VWXA 2KP1A 3TOTA 2R5GA 1EP7A 2I1UA 1GRXA 3VURA 2VLVA 1PSQA 2VLUA 2WB9A 1PD21 3KIJA 5ENUA 4XIHA 5D9WA 2QA2A 2CZ2A 2HNLA 5G1LA 5KOXA 3A2WA 3VPQA 4POMA 2GZPA 2MBTA 3EYTA 3GKNA 5D9VA 2LUSA 4K2XA 1QFNA 2WFCA 3RPPA 2HSMA 4EXJA 2MMNA 3F4TA 10GSA 3LYKA 1S3CA 3M0FA 3ERFA 2AJQB 4TVEA 2ALBA 2QC7A 3TCOA 3ME7A 4GQFA 5ECQB 2KP2A 4XS4A 1JZDA 1EGRA 1THXA 2PGTA 3KMNA 1ZYQB 1QK8A 2DMLA 3VWUA 1VRSD 4GTUA 1B48A 2PBJA 2P5RA 1AC1A 2DJ3A 2RM6A 2OKAA 1GLPA 3UBKA 3GKKA 4X1UA 1X9SB 2IMDA 5ECMB 1WE0A 4V2MA 2C0DA 4FYBA 1TI1A 4NMUA 1TOFA 4F03A 5LNKe 1XIYA 3GHAA 2HXKA 3ZTLA 3AY8A 3GX8A 3G7IA 3DIEA 1XBSA 3TGZA 1FHEA 4ID0A 4MMMA 2GQMA 3I9V2 1WJKA 4OD7A 3TJJA 1OC9A 2C0GA 4IELA 1SYRA 1TI3A 2PMTA 2V32A 5J3RA 1M2AA 4ECIA 1PX6A 3GUSA 2Z9SA 5GAPD 3ZYWA 1TK8B 2K18A 2IWTA 2D2ZA 1VF2A 2B1LA 2RLIA 4NV5A 1TP9A 2JZRA 1X5DA 1ZMAA 2GGTA 4WBRD 5DALB 5D9TA 1I9DA 1PL1A 1X0RA 5JWQB 1YKCA 4I8BA 4KCAA 5ECRB 1SKWB 3GURA 3M9JA 4NPBA 4KAEA 4OFTA 1PQNA 3FZ5A 2DJ2A 2DKIA 2IMEA 1DSBA 4OMVA 1SD9A 1ABAA 1RW1A 1TW9A 1HD2A 4I2TA 4PQHA 3ED3A 1MD4A 1IYHA 1TJDA 3DXBA 4FH8A 2EIQA 6GSWA 2OE3A 4CDOA 1XW9A 3O6TA 5ECLB 3WGEA 4KDXA 3RAZA 3DD3A 2XBQA 2H70A 4PUAA 2WRTA 1GUMA 3PH9A 1S3AA 3IR4A 1PRXA 1LBKA 4ZILA 1K0AA 5J4UA 2L5LA 12GSA 2RIIA 3Q19A 2KHPA 1OAZA 2WJUA 1FB6A 3HZ8A 1R26A 3C73A 4ICYA 3VWVA 2PVQA 3APSA 5C04A 1GSQA 2HZEB 3VWWA 17GSA 4G9HA 4EIQA 1TRWA 2WZ9A 4CW9A 4DSSB 2NTOA 2VD0A 4MF5A 1JLWA 3TDGA 5GSSA 2L4QA 3DRNA 4H86A 1EGOA 3IHQA 5IMZA 2A4HA 1BX9A 1ILOA 3E3EA 1TKDB 2FCHA 3GIXA 5EY6A 2C3QA 4XRAA 4TXOA 4IJIA 5GAND 5DCHA 5AGYA 3KCMA 2HLSA 2OJLA 4YAVA 4KDYA 5CREA 1ZGNA 3FMWA 2CV4A 1ERWA 1K0MA 2IN3A 1R5PA 2B7JA 2KOKA 4D73A 1O73A 2DJ0A 2R2JA 5CNWA 1GTAA 1O8WA 4XS1A 1J0FA 4MP4A 1A0FA 5B8BA 4PNGA 5BMUA 4BL7A 1MEKA 1PKWA 4QQ7A 4K7NA 2CZ3A 5IIZA 2GSRA 5IMAA 5J9CA 3EPTA 2I3YA 1URMA 3UARA 4K7IA 2FWGA 2VLTA 3HYPA 4P3YB 1M2DA 1K0OA 2JU5A 4KB3A 2K6VA 4O32A 3RBTA 4XS4B 1A2LA 3UAPA 1BQ7A 1MTCA 4GRFA 4WR4A 5H5QA 5ECNB 2LV3A 3TOUA 4PGTA 2CA8A 3TUEA 2VIMA 3K8NA 1TU8A 2OADA 3APQA 1N2AA 3TKSC 4X43A 1BYEA 1NM3A 4TN8A 6GSVA 1K0BA 18GSA 3F0IA 1XCCA 4PX1A 1G0TA 1SD8A 4ML6A 3MSZA 4OO5A 4EDYA 3IC8A 1OC9B 2E2MA 1WMJA 3ZFLA 4EUYA 2E7PA 3E9JB 2IPAA 1PGTA 3U6VA 4TRXA 2BTOT 4ZL9A 2AV4A 2KLXA 3F3QA 4Z2RA 1EOHA 2E0QA 4PXOA 5DAKB 4O92A 4YQMA 2LRTA 1CQGA 2IIYA 2JSYA 2VCWA 3TRPA 3HXSA 1TTZA 1CQHA 1YEXA 3KP9A 3BOAA 5LCZA 1GSEA 1DUGA 2LNTA 3ZREA 2DJ1A 2OBKA 3FZ9A 5HFGA 2X4AA 1OC8A 2YV9A 1V40A 4ZBDA 4TR0A 1O85A 1B4PA 2V6OA 1TRUA 4J56E 1SL2B 3MYDA 2H74A 1SK0A 1HYUA 2PU9C 4X4JA 3EC3A 5CRDA 1E2YA 22GSA 1O6JA 2DSAA 4O5UA 2DIYA 2YJ7A 1GSFA 3F4SA 5DQSA 1XPVA 2FY6A 1JHBA 2HI7A 5CRGA 5HR2A 2AHEA 1TK0B 2CQ9A 3O3TA 3PR8A 1FG4A 13GSA 2A2SA 2AAWA 3GYKA 3KH9A 2TRCP 3Q6OA 3UIWA 2X8HA 1PKZA 1Y25A 3TJGA 3EWLA 3D4MA 1EWXA 3L9UA 1XZOA 3SBCA 4F2IA 4Q5RA 1DBYA 3D4TA 2YANA 3CMIA 1UN2A 2ZNMA 3D21A 1YZXA 1QUWA 5DJLA 4EE0A 3ZFBA 3BCKA 2MMZA 1O8XA 3IHGA 1FAAA 3C1SA 1GNEA 1Y6EA 2VCQA 3IOSA 4MNNA 5ECSA 2HRNA 3F3RA 5CRWA 3CTFA 4L0WA 5JCUA 1AQVA 1Q4JA 1G7EA 2O8VB 2GZZA 2H76A 2VCZA 3QDNA 4YKGA 2GLRA 1HQOA 4YH2A 4BA7A 3WGXA 4KNDA 3HZ4A 1ZYEA 2M72A 2OBIA 4KA0A 2L57A 8GSSA 5B6NA 3J7Yb 1GL8A 2L4CA 1U3AA 4MA9A 4FIWA 5L71A 1A24A 3QCPA 2HSYA 2DLXA 4GSSA 2XHFA 1THOA 3DVWA 3FR9A 2JZSA 3I69A 1G7OA 3VPTA 2XPDA 3US3A 2FWEA 1H75A 4LMWA 4TR1A 2E2GA 3IAS2 4V2LA 2CT6A 3CRTA 1XWBA 1G6WA 2ZCTA 3FZAA 1B8XA 4MCUA 4KGIA 1V2AA 2R3XA 3CRUA 3TJFA 4AJ7A 2BJXA 5LD0A 4YQUA 3DWVA 4NHWA 2AUVA 4IHUA 1F37A 3HCZA 3ZLPA 5F05A 4IP6A 3TB2A 2FWHA 4JE1A 5ELAA 2H1GA 1Z3EA 1VGLA 3TJBA 1V58A 2ON5A 4MZBA 1O7UA 4ULXA 1HNAA 2EIRA 3L9VA 6GSTA 4K0GA 2GZYA 5D93A 4L0UA 2HRAA 1V9WA 3P90A 1XXUA 1GLQA 3CSIA 4HQSA 2H8LA 2F8AA 4FYCA 4NHZA 2GQLA 4G19A 4HJ2A 3CXGA 2VCXA 1BEDA 3LJRA 4MZCA 2C1YA 4ISDA 4X0XA 2N5BA 4J2FA 4CY6A 2B5YA 3QFAC 4IJ3A 4PUFC 3ZVJA 3HA9A 2H71A 5H5RA 2EIOA 3L78A 1AQXA 3C1RA 3KH7A 1ERTA 3D0ZA 2I4AA 2PPTA 2CAQA 1M2BA 3U5RE 1T8EB 4I5QA 2R37A 3GNJA 1K3LA 3P2AA 1YF0A 3DEXA 5D8IA 3HVVA 3H93A 3KXOA 3GH9A 4EVMA 2DMMA 2H72A 3D5JA 4ZL8A 2C3NA 1EOGA 1DE2A 1S3DA 1JZRA 3QOUA 2H1DA 1KEBA 4GSTA 4Z2TA 1WWJA 5FWGA 3DMLA 5B6MA 5G5EA 5JCWA 3GA4A 3M1GA 3G7JA 4BVYB 3LFLA 5ECKB 3GN3A 1SL1B 4MK3A 1SKRB 1RK4A 3FY7A 4IN0A 4NXIA 5DCGA 2O87A 1KTEA 2AYTA 4KSMA 5COHA 5IOXA 5G31A 1GUKA 1B9XC 1Z6NA 3IDVA 4IS0A 2ON7A 4Z7XA 1SYXA 4XS6A 3WYWA 4ML1A 2VL2C 1VF4A 4MH3A 1W89A 1R7HA 5J9BA 4G10A 6GSYA 5EVOA 4Q5FA 2WULA 4MH2A 2P5QA 4GWRA 3IBHA 1BAYA 1XVWA 4WBJA 1SKSB 1SK1A 1XOAA 3KTBA 1WPIA 1YJ6A 3QD9A 4GXZA 3HJPA 3VI7A 5EPFA 2CX3A 5DBQA 1G6YA 4MJCA 3C71A 4G0LA 4OFNA 2JZTA 5CRHA 4ZIJA 2XC2A 2GT5A 4ZBAA 1A0RP 3ZIVA 2XPEA 4F0CA 3QAGA 4USSA 5IOWA 1EZKA 4E8HA 5D96A 5ABRA 2BMXA 3N5OA 1X9MB 6GSUA 4ZB8A 5F07A 5A4UA 4DSQA 4TR4A 4HJMA 4HZ4A 5ID2B 4L5OA 5KN0A 1N8JA 5A5KA 3F8UA 1U87A 2VCVA 2QGVA 1M9AA 2VUPA 3C8EA 2PERA 3LG6A 4JU5A 2DKHA 1YDKA 2GVPA 4POLA 4G0KA 5HR3A 1TXXA 4KCEA 1U3IA 1AUCA 2WCIA 5B7CA 3TKSA 5KN3A 4ZXGA 1U88A 2HT9A 1Z9HA 2V6KA 3H8QA 3MAKA 1RQMA 1U6TA 4EL1A 1HNBA 4I6XA 1F2EA 1XW5A 2VAFA 4DSRA 4FO5A 3F6FA 3TKSE 4OCEA 2GS3A 5HFIA 2A2RA 4RI6A 4IW9A 5HQPA 3E0UA 3FYGA 3WD6A 3SWLA 4JEDA 4XRDA 16GSA 1USBA 1B9YC 7GSSA 3FKFA 5B8AA 4HOJA 1OYJA 5G2ZA 4PQIA 4K9ZA 5AISA 2YCDA 5ECIB 1GULA 3PPUA 4K6XA 2FHEA 2FGXA 4MPFA 1TU7A 4FYUA 4MPGA 3GTUA 3MIXA 4JZQA 2VL3A 2H0HA 1MDIA 2X64A 1PN0A 1YF1A 1JFUA 4KH7A 3ZZXA 3HJMA 2CVBA 4F0BA 4TXVA 4WF5A 3TRXA 1H4OA 4I97A 2WDUA 1R5AA 1PN9A 5AIVA 3IC4A 1M0UA 2YN1A 2PWJA 5F0GA 1UVZA 2B7KA 2B5XA 3KM6A 3WGDA 4WXTA 1WP0A 2YNXA 2H73A 2H75A 3EMXA 3W8SA 3HD5A 3FK8A 3ZRDA 3FRCA 2REMA 4PTSA 3IXRA 3PGTA 3FZ4A 5DQYA 5IO2A 1AIUA 1YQ1A 3HVXA 4EF0A 4OCFA 4KUNA 4RQRA 3EE2A 1OVNA 1T4ZA 3KMOA 1GWCA 4QL7A 3A5WA 1O81A 1GH2A 2C0EA 1SENA 2H6ZA 2HRFA 3H4KA 3HHVA 5ECOB 3ERGA 2VD1A 2OE1A 4HU7A 1A23A 2H66A 2NDOA 2WS2A 4CY8A 5DVBA 1TK5B 5D73A 2X8GA 4BPYA 3H1NA 5IM9A 3GX0A 2YWIA 4HS1A 1EV4A 3FW2A 1ERUA 1QXHA 3ISOA 4V1Ag 2XBIA 3WT1A 3KZQA 2JACA 2K8VA 4RUVA 1LJRA 4BVXA 4G2EA 2R0PA 1Z7PA 2WGRA 4N30A 4JR4A 4E8EA 4KF9A 4TR3A 1ZOFA 2DJKA 2LJKA 2FA8A 2C0FA 4XHMA 4KDUA 1XWKA 1GSDA 3ZL5A 2R0GA 3KTLA 3A3TA 2YPMA 3Q18A 3RPNA 1YKAA 2FLSA 3VK9A 1T3BA 4ACSA 4POKA 2NBSA 3IPZA 5GZZB 2H1AA 3RHCA 4K5RA 1I5GA 5EL8A 3GV1A 3UOMA 2C4JA 4N11A 2H30A 2ZUPA 1XOBA 4WEYA 3LW9A 1GTUA 3LXZA 4YAPA 4ECCA 1PL2A 2B6MA 3R2QA 3EU3A 3GFKA 2HRKA 4DVCA 4ECJA 2FD3A 1F3BA 1ZYNA 1GTIA 3UL3A 5HR1A 4HQZA 4KW6A 2HZEA 3V1WA 1MDKA 4TXOB 3A5IA 3JCML 2YP6A 1GSYA 1AQWA 2R4VA 3HVSA 4DSSA 1SU9A 3ZVJD 3FR6A 2VOCA 4ILFA 3TKRA 4AJ6A 4WETA 2AB6A 4Z2UA 4D73B 4PURA 3QPMA 3LWAA 2QA1A 5A4VA 2IJYA 3C7MA 3KGKA 2J9HA 3GSSA 4BL7B 2LTKA 2C8UA 1TRSA 1AXDA 2I81A 4WKWA 3TKPA 3EMPA 3TRQA 1AAZA 4NWYA 2V2GA 3CYNA 2CVDA 5IPGA 1A2JA 3BD2A 1WOUA 2RUFA 3IA1A 3UBLA 1X5EA 5INYA 1M99A 4K0NA 3L4NA 1PMTA 5IMVA 5F8BA 4YQVA 3IV4A 2QSIA 4KE3A 3LGCA 4EKZA 5GSTA 4IQAA 2VM2A 4J57E 4TOPA 1SJ6A 3GTUB 5H5SA 2OA7A 2OE0A 4MABA 2J23A 4HEA2 1ST9A 2GQKA 1YY7A 5D9XA 2GSTA 4N0ZA 3L0HA 3G9BA 1OKDA 1V57A 2CX4A 4V1Ap 2JADA 5HR0A 1VF3A 1K0DA 3M3MA 2PVOC 3FEUA 2B1KA 1A8LA 1NW2A 1FO5A 5ECHB 3IRAA 1AW9A 3N9JA 5ELGA 1XFLA 4NV2A 4NAXA 2MZCA 5JCGA 9GSSA 4GQCA 1GUHA 2R6KA 1K0CA 4N0VA 2L6DA 1Z7RA 3F63A 4EIPA 1HNCA 1T4YA 4IKHA 5E4WA 3QAWA 3TKQA 5KOWA 1E6BA 2VL2A 1V98A 2H0GA 2HZFA 2MBSA 3H79A 1NHYA 4TW5A 4HI7A 5AIXA 1X5CA 3D22A 14GSA 3L9SA 4K2DA 1M9BA 3A2XA 19GSA 5DAKA 3W6GA 1Z6MA 2G0FA 4IBPA 4Q5NA 2GT6A 4L8EA 1FOHA 1SK2A 4JBBA 2M46A 2DC5A 3DVXA 1J9BA 3HY2A 3S9FA 1XVQA 4LA1A 5FHIA 3D6IA 1FOVA 3KD0A 1GP1A 1QMVA 3DKSA 1T1VA 5G30A 5AN1A 2DBCA 3NOFA 1EEMA 2DJJA 2FNOA 4BVXB 1DE1A 3IK9A 3UJ1A 1K0NA 1OE7A 1OE8A 4DEJA 1BG5A 5DJMA 2V41A 1PA3A 2F9SA 3CBUA 3EINA 3CTGA 11GSA 4JRRA 1XWCA 2NVLA 3P8WA 3Q74A 3FR3A 1K3YA 2R0CA 2G2QA 2LS5A 1ZL9A 1XWGA 3ZMKA 4WR5A 1F6MC 5KN1A 5CP1A 1T00A 3GL3A 4G0IA 1KNGA 3HDCA 2DIZA 1Z5YE 1GSUA 1JLVA 2O7KA 3A2VA 4MZWA 2O85A 1MDJA 1ERVA 1TDIA 2JL4A 1EV9A 3GKXA 2IFQA 3GRXA 2VCTA 2N5FA 2YZHA 3QMXA 1B4QA 1LU4A 2M80A 3MDKA 4AGSA 3BJ5A 2VM1A 5CO3A 2L6CA 2NPBA 5IQYA 3RHBA 1K3OA 4WF4A 4GCIA 3MNGA 3KJYA 3KP8A 4Q5QA 1C72A 2A2PA 3DYRA 2K8SA 2CVKA 3IK7A 5J5NA 1MD3A 4RI7A 4IGJA 2L5OA 4ZB9A 6GSSA 2HYXA 4EDZA 3ZIJA 2LQQA 3EU4A 4TR1B 1ZYPA 2EC4A 3P7XA 3ZITA 1IYIA 2VL9A 3OR5A 2GSSA 2YOIA 5IO0A 1BJXA 3RDWA 2FA4A 4MF7A 1WIKA 1JZWA 2P31A 3ZMLA 4AF2A 4K8MA 4MJBA 3APOA 4I2UA 4EO3A 4GF0A 3F9UA 4AJ8A 5G1KA 4MLYA 2H19A 2L59A 3LYPA 3EVIA 3GH6A 2LQOA 2PUKC 6GSXA 2KUCA 3I6AA 3I43A 3PINA 1ZCPA 2HFDA 2IMIA 2LEGA 3UEMA 3IAM2 4QL9A 4POBA 1WRYA 3VI5A 2HSHA 4HZ2A 5BRTA 4N10A 1FVKA 5F06A 2GSQA 5E59A 3QR6A 1R4WA 2N5AA 3ME8A 2H6XA 5C00A 2F51A 1ZZYA 2LSTA 4HUAA 2H01A 5J41A 1XWAA 5CYYA 4L5LA 2RM5A 4PNFA 5A4WA 4MJAA 2QKEA 2X8CA 3LEFA 2FWFA 2H6YA 4ZL7A 4ECBA 4LL1B 4ZBBA 1W4VA 2IMFA 4HDEA 3QAVA 5IPHA 2TRXA 4K5SA 2O89A 4OWYA 1FVJA 1UC7A 1ACVA 1QQ2A 2ES7A 1Q98A 1QGVA 3UMAA 2YJHA 2I9HA 1YEPA 4HU9A 2LJAA 2VO4A 5CAXA 2F8FA 1KBNA 2X99A 1A8YA 1NHOA 3R3EA 1F3AA 4BWSA 4OO4A 4IQ1A 3LQ7A 2H0IA 3NIVA 4O7HA 1SJIA 20GSA 3BCIA 4KSOA 1X9WB 4GLTA 4XTSA 1SL0B 1OKTA 2A4VA 3DGQA 1ON4A 5JWOB 3LSZA 2YWNA 1A2MA 4O5RA 4JR6A 1EEJA 5G5FA 5IMCA 1JZOA 3HKRA 3CSJA 2X49A 1PX7A 3M9KA 3ERWA 4LMVA 2GTUA 3IE3A 2P0GA 2B3SA 4EC0A 2TIRA 3UVTA 4K7OA 5ECPB 1T7PB 5KEJA 2UZ8A 3GMFA 3NZNA 4BWQA 3KEBA 2K9FA 4BVYA 4A5PA 3F6DA 2LRNA 3O76A 1TRVA 5DALA 3HJOA 2LKUA 4PQ1A 1GSSA 2RUEA 3MWHA 5HFKA 2YWOA 3G7YA 1M7TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C3T A;  4MF6 A;  1FW1 A;  2V1M A;  2YV7 A;  3WT2 A;  3LOR A;  3W8J A;  2IMK A;  4OFM A;  1UA5 A;  1GNW A;  2YZU A;  3BBY A;  3M8N A;  3VLN A;  2IFQ B;  5KN2 A;  4LL4 B;  4RQX A;  1VF1 A;  2MYG A;  1NSW A;  2C80 A;  2H1B A;  4MJE A;  5FT3 A;  5DDL A;  1F9M A;  2JSZ A;  1FB0 A;  4IP1 A;  1SJZ A;  4GSN A;  4K1F A;  3GL5 A;  2HE3 A;  4ZB6 A;  4MDC A;  4TKY A;  3VFI A;  4XCS A;  2GDR A;  3CSH A;  4F82 A;  2PN8 A;  2B5E A;  4V2N A;  3F4R A;  1OC3 A;  2YWM A;  3GST A;  3QFB C;  2MMA A;  5JWR B;  2LNS A;  3GKM A;  3UVH A;  5IMF A;  2IL3 A;  1ML6 A;  4IVF A;  3J7Y k;  5IMD A;  4KX4 A;  1XW6 A;  3FHK A;  2MMO A;  5ID2 A;  4CHS A;  2CAI A;  2LJR A;  1J08 A;  2F3M A;  3EUR A;  3TJK A;  1EP8 A;  3LXT A;  1GTB A;  2FUG 2;  2OAC A;  4F9Z A;  4LLR A;  2LRC A;  3VWX A;  2KP1 A;  3TOT A;  2R5G A;  1EP7 A;  2I1U A;  1GRX A;  3VUR A;  2VLV A;  1PSQ A;  2VLU A;  2WB9 A;  1PD2 1;  3KIJ A;  5ENU A;  4XIH A;  5D9W A;  2CZ2 A;  2HNL A;  5G1L A;  3A2W A;  3VPQ A;  4POM A;  2GZP A;  2MBT A;  3EYT A;  3GKN A;  5D9V A;  2LUS A;  1QFN A;  2WFC A;  3RPP A;  4EXJ A;  2MMN A;  3F4T A;  10GS A;  3LYK A;  1S3C A;  3M0F A;  3ERF A;  2AJQ B;  4TVE A;  2ALB A;  2QC7 A;  3TCO A;  3ME7 A;  4GQF A;  5ECQ B;  2KP2 A;  4XS4 A;  1JZD A;  1EGR A;  1THX A;  2PGT A;  3KMN A;  1ZYQ B;  1QK8 A;  2DML A;  3VWU A;  1VRS D;  4GTU A;  1B48 A;  2PBJ A;  2P5R A;  1AC1 A;  2DJ3 A;  2RM6 A;  2OKA A;  1GLP A;  3UBK A;  3GKK A;  4X1U A;  1X9S B;  2IMD A;  5ECM B;  1WE0 A;  4V2M A;  2C0D A;  4FYB A;  1TI1 A;  4NMU A;  1TOF A;  4F03 A;  5LNK e;  1XIY A;  3GHA A;  2HXK A;  3ZTL A;  3AY8 A;  3GX8 A;  3G7I A;  3DIE A;  1XBS A;  3TGZ A;  1FHE A;  4ID0 A;  4MMM A;  2GQM A;  3I9V 2;  1WJK A;  4OD7 A;  3TJJ A;  1OC9 A;  2C0G A;  4IEL A;  1SYR A;  1TI3 A;  2PMT A;  2V32 A;  5J3R A;  1M2A A;  4ECI A;  1PX6 A;  3GUS A;  2Z9S A;  5GAP D;  3ZYW A;  1TK8 B;  2K18 A;  2IWT A;  2D2Z A;  1VF2 A;  2B1L A;  2RLI A;  4NV5 A;  1TP9 A;  2JZR A;  1X5D A;  1ZMA A;  2GGT A;  4WBR D;  5DAL B;  5D9T A;  1I9D A;  1PL1 A;  1X0R A;  5JWQ B;  1YKC A;  4I8B A;  4KCA A;  5ECR B;  1SKW B;  3GUR A;  3M9J A;  4NPB A;  4KAE A;  4OFT A;  1PQN A;  3FZ5 A;  2DJ2 A;  2IME A;  1DSB A;  4OMV A;  1SD9 A;  1ABA A;  1RW1 A;  1TW9 A;  1HD2 A;  4I2T A;  4PQH A;  3ED3 A;  1MD4 A;  1IYH A;  1TJD A;  3DXB A;  4FH8 A;  2EIQ A;  6GSW A;  2OE3 A;  4CDO A;  1XW9 A;  3O6T A;  5ECL B;  3WGE A;  4KDX A;  3RAZ A;  3DD3 A;  2XBQ A;  2H70 A;  4PUA A;  2WRT A;  1GUM A;  3PH9 A;  1S3A A;  3IR4 A;  1PRX A;  1LBK A;  4ZIL A;  1K0A A;  5J4U A;  2L5L A;  12GS A;  2RII A;  3Q19 A;  2KHP A;  1OAZ A;  2WJU A;  1FB6 A;  3HZ8 A;  1R26 A;  3C73 A;  3VWV A;  2PVQ A;  3APS A;  5C04 A;  1GSQ A;  2HZE B;  3VWW A;  17GS A;  4G9H A;  1TRW A;  2WZ9 A;  4CW9 A;  4DSS B;  2NTO A;  2VD0 A;  4MF5 A;  1JLW A;  3TDG A;  5GSS A;  2L4Q A;  3DRN A;  4H86 A;  1EGO A;  3IHQ A;  5IMZ A;  1BX9 A;  1ILO A;  3E3E A;  1TKD B;  2FCH A;  3GIX A;  5EY6 A;  2C3Q A;  4XRA A;  4TXO A;  4IJI A;  5GAN D;  5DCH A;  5AGY A;  3KCM A;  2HLS A;  2OJL A;  4YAV A;  4KDY A;  5CRE A;  1ZGN A;  2CV4 A;  1ERW A;  1K0M A;  2IN3 A;  1R5P A;  2B7J A;  2KOK A;  4D73 A;  1O73 A;  2DJ0 A;  2R2J A;  5CNW A;  1GTA A;  1O8W A;  4XS1 A;  1J0F A;  4MP4 A;  1A0F A;  5B8B A;  4PNG A;  4BL7 A;  1MEK A;  1PKW A;  4QQ7 A;  4K7N A;  2CZ3 A;  5IIZ A;  2GSR A;  5IMA A;  5J9C A;  2I3Y A;  1URM A;  3UAR A;  4K7I A;  2FWG A;  2VLT A;  3HYP A;  4P3Y B;  1M2D A;  1K0O A;  2JU5 A;  4KB3 A;  2K6V A;  4O32 A;  3RBT A;  4XS4 B;  1A2L A;  3UAP A;  1BQ7 A;  1MTC A;  4GRF A;  4WR4 A;  5H5Q A;  5ECN B;  2LV3 A;  3TOU A;  4PGT A;  2CA8 A;  3TUE A;  2VIM A;  3K8N A;  1TU8 A;  2OAD A;  3APQ A;  1N2A A;  3TKS C;  4X43 A;  1BYE A;  1NM3 A;  4TN8 A;  6GSV A;  1K0B A;  18GS A;  3F0I A;  1XCC A;  4PX1 A;  1G0T A;  1SD8 A;  4ML6 A;  3MSZ A;  4OO5 A;  4EDY A;  1OC9 B;  2E2M A;  1WMJ A;  3ZFL A;  4EUY A;  2E7P A;  3E9J B;  2IPA A;  1PGT A;  3U6V A;  4TRX A;  2BTO T;  4ZL9 A;  2AV4 A;  2KLX A;  3F3Q A;  1EOH A;  2E0Q A;  4PXO A;  5DAK B;  4O92 A;  4YQM A;  2LRT A;  1CQG A;  2IIY A;  2JSY A;  2VCW A;  3TRP A;  3HXS A;  1TTZ A;  1CQH A;  1YEX A;  3KP9 A;  3BOA A;  5LCZ A;  1GSE A;  1DUG A;  2LNT A;  3ZRE A;  2DJ1 A;  2OBK A;  3FZ9 A;  5HFG A;  1OC8 A;  2YV9 A;  1V40 A;  4ZBD A;  4TR0 A;  1O85 A;  1B4P A;  2V6O A;  1TRU A;  4J56 E;  1SL2 B;  2H74 A;  1SK0 A;  1HYU A;  2PU9 C;  3EC3 A;  5CRD A;  1E2Y A;  22GS A;  1O6J A;  2DSA A;  2DIY A;  2YJ7 A;  1GSF A;  3F4S A;  5DQS A;  1XPV A;  2FY6 A;  1JHB A;  2HI7 A;  5CRG A;  5HR2 A;  2AHE A;  1TK0 B;  2CQ9 A;  3O3T A;  3PR8 A;  1FG4 A;  13GS A;  2A2S A;  2AAW A;  3GYK A;  3KH9 A;  2TRC P;  3Q6O A;  3UIW A;  2X8H A;  1PKZ A;  1Y25 A;  3TJG A;  3EWL A;  3D4M A;  1EWX A;  3L9U A;  1XZO A;  3SBC A;  4F2I A;  4Q5R A;  1DBY A;  3D4T A;  2YAN A;  3CMI A;  1UN2 A;  2ZNM A;  3D21 A;  1YZX A;  1QUW A;  5DJL A;  4EE0 A;  3ZFB A;  3BCK A;  2MMZ A;  1O8X A;  1FAA A;  3C1S A;  1GNE A;  1Y6E A;  2VCQ A;  3IOS A;  5ECS A;  2HRN A;  3F3R A;  5CRW A;  3CTF A;  4L0W A;  5JCU A;  1AQV A;  1Q4J A;  1G7E A;  2O8V B;  2GZZ A;  2H76 A;  2VCZ A;  3QDN A;  2GLR A;  1HQO A;  4YH2 A;  4BA7 A;  3WGX A;  4KND A;  3HZ4 A;  1ZYE A;  2M72 A;  2OBI A;  4KA0 A;  2L57 A;  8GSS A;  5B6N A;  3J7Y b;  1GL8 A;  2L4C A;  1U3A A;  4MA9 A;  4FIW A;  5L71 A;  1A24 A;  3QCP A;  2HSY A;  2DLX A;  4GSS A;  2XHF A;  1THO A;  3DVW A;  3FR9 A;  2JZS A;  3I69 A;  1G7O A;  3VPT A;  2XPD A;  3US3 A;  2FWE A;  1H75 A;  4LMW A;  4TR1 A;  2E2G A;  3IAS 2;  4V2L A;  2CT6 A;  3CRT A;  1XWB A;  1G6W A;  2ZCT A;  3FZA A;  1B8X A;  4MCU A;  4KGI A;  1V2A A;  2R3X A;  3CRU A;  3TJF A;  4AJ7 A;  2BJX A;  5LD0 A;  4YQU A;  3DWV A;  4NHW A;  2AUV A;  4IHU A;  1F37 A;  3HCZ A;  3ZLP A;  5F05 A;  4IP6 A;  3TB2 A;  2FWH A;  4JE1 A;  5ELA A;  2H1G A;  1Z3E A;  1VGL A;  3TJB A;  1V58 A;  2ON5 A;  4MZB A;  1O7U A;  4ULX A;  1HNA A;  2EIR A;  3L9V A;  6GST A;  4K0G A;  2GZY A;  5D93 A;  4L0U A;  1V9W A;  3P90 A;  1XXU A;  1GLQ A;  3CSI A;  4HQS A;  2H8L A;  2F8A A;  4FYC A;  4NHZ A;  2GQL A;  4G19 A;  4HJ2 A;  3CXG A;  2VCX A;  1BED A;  3LJR A;  4MZC A;  2C1Y A;  4ISD A;  4X0X A;  2N5B A;  4J2F A;  2B5Y A;  3QFA C;  4IJ3 A;  4PUF C;  3ZVJ A;  3HA9 A;  2H71 A;  5H5R A;  2EIO A;  3L78 A;  1AQX A;  3C1R A;  3KH7 A;  1ERT A;  3D0Z A;  2I4A A;  2PPT A;  2CAQ A;  1M2B A;  3U5R E;  1T8E B;  4I5Q A;  2R37 A;  3GNJ A;  1K3L A;  3P2A A;  1YF0 A;  3DEX A;  5D8I A;  3HVV A;  3H93 A;  3KXO A;  3GH9 A;  4EVM A;  2DMM A;  2H72 A;  3D5J A;  4ZL8 A;  2C3N A;  1EOG A;  1DE2 A;  1S3D A;  1JZR A;  3QOU A;  2H1D A;  1KEB A;  4GST A;  1WWJ A;  5FWG A;  3DML A;  5B6M A;  5G5E A;  5JCW A;  3GA4 A;  3M1G A;  3G7J A;  3LFL A;  5ECK B;  3GN3 A;  1SL1 B;  4MK3 A;  1SKR B;  1RK4 A;  3FY7 A;  4IN0 A;  4NXI A;  5DCG A;  2O87 A;  1KTE A;  2AYT A;  4KSM A;  5COH A;  5IOX A;  5G31 A;  1GUK A;  1B9X C;  1Z6N A;  3IDV A;  4IS0 A;  2ON7 A;  4Z7X A;  1SYX A;  4XS6 A;  3WYW A;  4ML1 A;  2VL2 C;  1VF4 A;  4MH3 A;  1W89 A;  1R7H A;  5J9B A;  4G10 A;  6GSY A;  5EVO A;  4Q5F A;  2WUL A;  4MH2 A;  2P5Q A;  4GWR A;  3IBH A;  1BAY A;  1XVW A;  4WBJ A;  1SKS B;  1SK1 A;  1XOA A;  3KTB A;  1WPI A;  1YJ6 A;  3QD9 A;  4GXZ A;  3HJP A;  3VI7 A;  5EPF A;  2CX3 A;  5DBQ A;  1G6Y A;  4MJC A;  3C71 A;  4OFN A;  2JZT A;  5CRH A;  4ZIJ A;  2XC2 A;  2GT5 A;  4ZBA A;  1A0R P;  3ZIV A;  2XPE A;  4F0C A;  3QAG A;  5IOW A;  1EZK A;  4E8H A;  5D96 A;  5ABR A;  2BMX A;  3N5O A;  1X9M B;  6GSU A;  4ZB8 A;  5F07 A;  5A4U A;  4DSQ A;  4TR4 A;  4HJM A;  4HZ4 A;  5ID2 B;  4L5O A;  5KN0 A;  1N8J A;  5A5K A;  3F8U A;  1U87 A;  2VCV A;  2QGV A;  1M9A A;  2VUP A;  3C8E A;  2PER A;  3LG6 A;  4JU5 A;  1YDK A;  2GVP A;  4POL A;  5HR3 A;  1TXX A;  4KCE A;  1U3I A;  1AUC A;  2WCI A;  5B7C A;  3TKS A;  5KN3 A;  4ZXG A;  1U88 A;  2HT9 A;  1Z9H A;  2V6K A;  3H8Q A;  3MAK A;  1RQM A;  1U6T A;  4EL1 A;  1HNB A;  4I6X A;  1F2E A;  1XW5 A;  2VAF A;  4DSR A;  4FO5 A;  3F6F A;  3TKS E;  4OCE A;  2GS3 A;  5HFI A;  2A2R A;  4RI6 A;  4IW9 A;  5HQP A;  3E0U A;  3FYG A;  3WD6 A;  3SWL A;  4JED A;  4XRD A;  16GS A;  1USB A;  1B9Y C;  7GSS A;  3FKF A;  5B8A A;  4HOJ A;  1OYJ A;  5G2Z A;  4PQI A;  4K9Z A;  5AIS A;  2YCD A;  5ECI B;  1GUL A;  4K6X A;  2FHE A;  2FGX A;  4MPF A;  1TU7 A;  4FYU A;  4MPG A;  3GTU A;  4JZQ A;  2VL3 A;  2H0H A;  1MDI A;  2X64 A;  1YF1 A;  1JFU A;  4KH7 A;  3ZZX A;  3HJM A;  2CVB A;  4F0B A;  4TXV A;  4WF5 A;  3TRX A;  1H4O A;  4I97 A;  2WDU A;  1R5A A;  1PN9 A;  5AIV A;  3IC4 A;  1M0U A;  2YN1 A;  2PWJ A;  5F0G A;  1UVZ A;  2B7K A;  2B5X A;  3KM6 A;  3WGD A;  4WXT A;  1WP0 A;  2YNX A;  2H73 A;  2H75 A;  3EMX A;  3W8S A;  3HD5 A;  3FK8 A;  3ZRD A;  3FRC A;  2REM A;  3IXR A;  3PGT A;  3FZ4 A;  5DQY A;  5IO2 A;  1AIU A;  1YQ1 A;  3HVX A;  4EF0 A;  4OCF A;  4KUN A;  4RQR A;  3EE2 A;  1OVN A;  1T4Z A;  3KMO A;  1GWC A;  4QL7 A;  3A5W A;  1O81 A;  1GH2 A;  2C0E A;  1SEN A;  2H6Z A;  2HRF A;  3H4K A;  3HHV A;  5ECO B;  3ERG A;  2VD1 A;  2OE1 A;  4HU7 A;  1A23 A;  2H66 A;  2NDO A;  2WS2 A;  5DVB A;  1TK5 B;  5D73 A;  2X8G A;  4BPY A;  3H1N A;  5IM9 A;  3GX0 A;  2YWI A;  4HS1 A;  1EV4 A;  3FW2 A;  1ERU A;  1QXH A;  3ISO A;  4V1A g;  2XBI A;  3WT1 A;  3KZQ A;  2JAC A;  2K8V A;  4RUV A;  1LJR A;  4BVX A;  4G2E A;  1Z7P A;  2WGR A;  4N30 A;  4JR4 A;  4E8E A;  4TR3 A;  1ZOF A;  2DJK A;  2LJK A;  2FA8 A;  2C0F A;  4XHM A;  4KDU A;  1XWK A;  1GSD A;  3ZL5 A;  3KTL A;  3A3T A;  2YPM A;  3Q18 A;  3RPN A;  1YKA A;  2FLS A;  3VK9 A;  1T3B A;  4ACS A;  4POK A;  2NBS A;  3IPZ A;  5GZZ B;  2H1A A;  3RHC A;  1I5G A;  5EL8 A;  3GV1 A;  3UOM A;  2C4J A;  4N11 A;  2H30 A;  2ZUP A;  1XOB A;  4WEY A;  1GTU A;  3LXZ A;  4YAP A;  4ECC A;  1PL2 A;  2B6M A;  3R2Q A;  3EU3 A;  3GFK A;  4DVC A;  4ECJ A;  2FD3 A;  1F3B A;  1GTI A;  3UL3 A;  5HR1 A;  4HQZ A;  4KW6 A;  2HZE A;  3V1W A;  1MDK A;  4TXO B;  3JCM L;  2YP6 A;  1GSY A;  1AQW A;  2R4V A;  3HVS A;  4DSS A;  1SU9 A;  3ZVJ D;  3FR6 A;  2VOC A;  4ILF A;  3TKR A;  4AJ6 A;  4WET A;  2AB6 A;  4D73 B;  4PUR A;  3QPM A;  3LWA A;  5A4V A;  2IJY A;  3C7M A;  3KGK A;  2J9H A;  3GSS A;  2LTK A;  2C8U A;  1TRS A;  1AXD A;  2I81 A;  4WKW A;  3TKP A;  3EMP A;  3TRQ A;  1AAZ A;  4NWY A;  2V2G A;  3CYN A;  2CVD A;  5IPG A;  1A2J A;  3BD2 A;  1WOU A;  2RUF A;  3IA1 A;  3UBL A;  1X5E A;  5INY A;  1M99 A;  4K0N A;  3L4N A;  1PMT A;  5IMV A;  5F8B A;  4YQV A;  3IV4 A;  2QSI A;  4KE3 A;  3LGC A;  4EKZ A;  5GST A;  4IQA A;  2VM2 A;  4J57 E;  4TOP A;  1SJ6 A;  3GTU B;  5H5S A;  2OA7 A;  2OE0 A;  4MAB A;  2J23 A;  4HEA 2;  1ST9 A;  2GQK A;  1YY7 A;  5D9X A;  2GST A;  4N0Z A;  3L0H A;  3G9B A;  1OKD A;  1V57 A;  2CX4 A;  4V1A p;  2JAD A;  5HR0 A;  1VF3 A;  1K0D A;  3M3M A;  2PVO C;  3FEU A;  2B1K A;  1A8L A;  1NW2 A;  1FO5 A;  5ECH B;  3IRA A;  1AW9 A;  3N9J A;  5ELG A;  1XFL A;  4NV2 A;  4NAX A;  2MZC A;  5JCG A;  9GSS A;  4GQC A;  1GUH A;  2R6K A;  1K0C A;  4N0V A;  2L6D A;  1Z7R A;  3F63 A;  1HNC A;  1T4Y A;  4IKH A;  5E4W A;  3QAW A;  3TKQ A;  1E6B A;  2VL2 A;  1V98 A;  2H0G A;  2HZF A;  2MBS A;  3H79 A;  1NHY A;  4TW5 A;  4HI7 A;  5AIX A;  1X5C A;  3D22 A;  14GS A;  3L9S A;  4K2D A;  1M9B A;  3A2X A;  19GS A;  5DAK A;  3W6G A;  1Z6M A;  2G0F A;  4IBP A;  4Q5N A;  2GT6 A;  4L8E A;  1SK2 A;  4JBB A;  2M46 A;  2DC5 A;  3DVX A;  1J9B A;  3HY2 A;  3S9F A;  1XVQ A;  4LA1 A;  5FHI A;  3D6I A;  1FOV A;  3KD0 A;  1GP1 A;  1QMV A;  3DKS A;  1T1V A;  5G30 A;  5AN1 A;  2DBC A;  3NOF A;  1EEM A;  2DJJ A;  2FNO A;  1DE1 A;  3IK9 A;  3UJ1 A;  1K0N A;  1OE7 A;  1OE8 A;  4DEJ A;  1BG5 A;  5DJM A;  2V41 A;  1PA3 A;  2F9S A;  3CBU A;  3EIN A;  3CTG A;  11GS A;  4JRR A;  1XWC A;  2NVL A;  3P8W A;  3Q74 A;  3FR3 A;  1K3Y A;  2G2Q A;  2LS5 A;  1ZL9 A;  1XWG A;  3ZMK A;  4WR5 A;  1F6M C;  5KN1 A;  5CP1 A;  1T00 A;  3GL3 A;  1KNG A;  3HDC A;  2DIZ A;  1Z5Y E;  1GSU A;  1JLV A;  2O7K A;  3A2V A;  4MZW A;  2O85 A;  1MDJ A;  1ERV A;  1TDI A;  2JL4 A;  1EV9 A;  3GKX A;  2IFQ A;  3GRX A;  2VCT A;  2N5F A;  2YZH A;  3QMX A;  1B4Q A;  1LU4 A;  2M80 A;  3MDK A;  4AGS A;  3BJ5 A;  2VM1 A;  5CO3 A;  2L6C A;  2NPB A;  5IQY A;  3RHB A;  1K3O A;  4WF4 A;  4GCI A;  3MNG A;  3KJY A;  3KP8 A;  4Q5Q A;  1C72 A;  3DYR A;  2K8S A;  2CVK A;  3IK7 A;  5J5N A;  1MD3 A;  4RI7 A;  4IGJ A;  2L5O A;  4ZB9 A;  6GSS A;  2HYX A;  4EDZ A;  3ZIJ A;  2LQQ A;  3EU4 A;  4TR1 B;  2EC4 A;  3P7X A;  3ZIT A;  1IYI A;  2VL9 A;  3OR5 A;  2GSS A;  2YOI A;  5IO0 A;  1BJX A;  3RDW A;  2FA4 A;  4MF7 A;  1WIK A;  1JZW A;  2P31 A;  3ZML A;  4AF2 A;  4K8M A;  4MJB A;  3APO A;  4I2U A;  4EO3 A;  4GF0 A;  3F9U A;  4AJ8 A;  5G1K A;  4MLY A;  2H19 A;  2L59 A;  3LYP A;  3EVI A;  3GH6 A;  2LQO A;  2PUK C;  6GSX A;  2KUC A;  3I6A A;  3I43 A;  3PIN A;  1ZCP A;  2HFD A;  2IMI A;  2LEG A;  3UEM A;  3IAM 2;  4QL9 A;  4POB A;  1WRY A;  3VI5 A;  2HSH A;  4HZ2 A;  4N10 A;  1FVK A;  5F06 A;  2GSQ A;  5E59 A;  3QR6 A;  1R4W A;  2N5A A;  3ME8 A;  2H6X A;  5C00 A;  2F51 A;  1ZZY A;  2LST A;  4HUA A;  2H01 A;  5J41 A;  1XWA A;  5CYY A;  4L5L A;  2RM5 A;  4PNF A;  5A4W A;  4MJA A;  2QKE A;  2X8C A;  3LEF A;  2FWF A;  2H6Y A;  4ZL7 A;  4ECB A;  4LL1 B;  4ZBB A;  1W4V A;  2IMF A;  4HDE A;  3QAV A;  5IPH A;  2TRX A;  2O89 A;  4OWY A;  1FVJ A;  1UC7 A;  1ACV A;  1QQ2 A;  2ES7 A;  1Q98 A;  1QGV A;  3UMA A;  2YJH A;  2I9H A;  1YEP A;  4HU9 A;  2LJA A;  2VO4 A;  5CAX A;  2F8F A;  1KBN A;  2X99 A;  1A8Y A;  1NHO A;  1F3A A;  4BWS A;  4OO4 A;  4IQ1 A;  3LQ7 A;  2H0I A;  3NIV A;  4O7H A;  1SJI A;  20GS A;  3BCI A;  4KSO A;  1X9W B;  4GLT A;  4XTS A;  1SL0 B;  1OKT A;  2A4V A;  3DGQ A;  1ON4 A;  5JWO B;  3LSZ A;  2YWN A;  1A2M A;  4O5R A;  4JR6 A;  1EEJ A;  5G5F A;  5IMC A;  1JZO A;  3HKR A;  3CSJ A;  1PX7 A;  3M9K A;  3ERW A;  4LMV A;  2GTU A;  3IE3 A;  2P0G A;  2B3S A;  4EC0 A;  2TIR A;  3UVT A;  4K7O A;  5ECP B;  1T7P B;  5KEJ A;  3GMF A;  3NZN A;  4BWQ A;  3KEB A;  2K9F A;  4BVY A;  3F6D A;  2LRN A;  3O76 A;  1TRV A;  5DAL A;  3HJO A;  2LKU A;  4PQ1 A;  1GSS A;  2RUE A;  3MWH A;  5HFK A;  2YWO A;  3G7Y A;  1M7T A; 
#chains in the Genus database with same CATH topology
 2C3T A;  4MF6 A;  1FW1 A;  2V1M A;  4YKF A;  2YV7 A;  3WT2 A;  3LOR A;  3W8J A;  2IMK A;  4OFM A;  1UA5 A;  1GNW A;  2YZU A;  3HVN A;  3BBY A;  3M8N A;  3VLN A;  2IFQ B;  5KN2 A;  4LL4 B;  4RQX A;  1PFO A;  1VF1 A;  2MYG A;  1NSW A;  2C80 A;  2H1B A;  4MJE A;  5FT3 A;  5DDL A;  1F9M A;  2JSZ A;  1FB0 A;  4IP1 A;  1SJZ A;  4GSN A;  4K1F A;  3GL5 A;  2HE3 A;  4ZB6 A;  4MDC A;  4TKY A;  3VFI A;  4XCS A;  2GDR A;  3CSH A;  4F82 A;  2PN8 A;  2B5E A;  4V2N A;  3F4R A;  1OC3 A;  2YWM A;  3GST A;  3QFB C;  2MMA A;  5JWR B;  2LNS A;  3GKM A;  3UVH A;  5IMF A;  2IL3 A;  1ML6 A;  4FQU A;  4IVF A;  3J7Y k;  5IMD A;  4KX4 A;  4O5Q A;  1XW6 A;  3FHK A;  2MMO A;  5ID2 A;  4CHS A;  2CAI A;  2LJR A;  1J08 A;  2F3M A;  3EUR A;  3TJK A;  1EP8 A;  3LXT A;  1GTB A;  2FUG 2;  2OAC A;  4F9Z A;  4LLR A;  2LRC A;  3VWX A;  2KP1 A;  3TOT A;  2R5G A;  1EP7 A;  2I1U A;  1GRX A;  3VUR A;  2VLV A;  1PSQ A;  2VLU A;  2WB9 A;  1PD2 1;  3KIJ A;  5ENU A;  4XIH A;  5D9W A;  2QA2 A;  2CZ2 A;  2HNL A;  5G1L A;  5KOX A;  3A2W A;  3VPQ A;  4POM A;  2GZP A;  2MBT A;  3EYT A;  3GKN A;  5D9V A;  2LUS A;  4K2X A;  1QFN A;  2WFC A;  3RPP A;  2HSM A;  4EXJ A;  2MMN A;  3F4T A;  10GS A;  3LYK A;  1S3C A;  3M0F A;  3ERF A;  2AJQ B;  4TVE A;  2ALB A;  2QC7 A;  3TCO A;  3ME7 A;  4GQF A;  5ECQ B;  2KP2 A;  4XS4 A;  1JZD A;  1EGR A;  1THX A;  2PGT A;  3KMN A;  1ZYQ B;  1QK8 A;  2DML A;  3VWU A;  1VRS D;  4GTU A;  1B48 A;  2PBJ A;  2P5R A;  1AC1 A;  2DJ3 A;  2RM6 A;  2OKA A;  1GLP A;  3UBK A;  3GKK A;  4X1U A;  1X9S B;  2IMD A;  5ECM B;  1WE0 A;  4V2M A;  2C0D A;  4FYB A;  1TI1 A;  4NMU A;  1TOF A;  4F03 A;  5LNK e;  1XIY A;  3GHA A;  2HXK A;  3ZTL A;  3AY8 A;  3GX8 A;  3G7I A;  3DIE A;  1XBS A;  3TGZ A;  1FHE A;  4ID0 A;  4MMM A;  2GQM A;  3I9V 2;  1WJK A;  4OD7 A;  3TJJ A;  1OC9 A;  2C0G A;  4IEL A;  1SYR A;  1TI3 A;  2PMT A;  2V32 A;  5J3R A;  1M2A A;  4ECI A;  1PX6 A;  3GUS A;  2Z9S A;  5GAP D;  3ZYW A;  1TK8 B;  2K18 A;  2IWT A;  2D2Z A;  1VF2 A;  2B1L A;  2RLI A;  4NV5 A;  1TP9 A;  2JZR A;  1X5D A;  1ZMA A;  2GGT A;  4WBR D;  5DAL B;  5D9T A;  1I9D A;  1PL1 A;  1X0R A;  5JWQ B;  1YKC A;  4I8B A;  4KCA A;  5ECR B;  1SKW B;  3GUR A;  3M9J A;  4NPB A;  4KAE A;  4OFT A;  1PQN A;  3FZ5 A;  2DJ2 A;  2DKI A;  2IME A;  1DSB A;  4OMV A;  1SD9 A;  1ABA A;  1RW1 A;  1TW9 A;  1HD2 A;  4I2T A;  4PQH A;  3ED3 A;  1MD4 A;  1IYH A;  1TJD A;  3DXB A;  4FH8 A;  2EIQ A;  6GSW A;  2OE3 A;  4CDO A;  1XW9 A;  3O6T A;  5ECL B;  3WGE A;  4KDX A;  3RAZ A;  3DD3 A;  2XBQ A;  2H70 A;  4PUA A;  2WRT A;  1GUM A;  3PH9 A;  1S3A A;  3IR4 A;  1PRX A;  1LBK A;  4ZIL A;  1K0A A;  5J4U A;  2L5L A;  12GS A;  2RII A;  3Q19 A;  2KHP A;  1OAZ A;  2WJU A;  1FB6 A;  3HZ8 A;  1R26 A;  3C73 A;  4ICY A;  3VWV A;  2PVQ A;  3APS A;  5C04 A;  1GSQ A;  2HZE B;  3VWW A;  17GS A;  4G9H A;  4EIQ A;  1TRW A;  2WZ9 A;  4CW9 A;  4DSS B;  4BIK A;  2NTO A;  2VD0 A;  4MF5 A;  1JLW A;  3TDG A;  5GSS A;  2L4Q A;  3DRN A;  4H86 A;  1EGO A;  3IHQ A;  5IMZ A;  2A4H A;  1BX9 A;  1ILO A;  3E3E A;  1TKD B;  2FCH A;  3GIX A;  5EY6 A;  2C3Q A;  4XRA A;  4TXO A;  4IJI A;  5GAN D;  5DCH A;  5AGY A;  3KCM A;  2HLS A;  2OJL A;  4YAV A;  4KDY A;  5CRE A;  1ZGN A;  3FMW A;  2CV4 A;  1ERW A;  1K0M A;  2IN3 A;  1R5P A;  2B7J A;  2KOK A;  4D73 A;  1O73 A;  2DJ0 A;  1S3R A;  2R2J A;  5CNW A;  1GTA A;  1O8W A;  4XS1 A;  1J0F A;  4MP4 A;  1A0F A;  5B8B A;  4PNG A;  5BMU A;  4BL7 A;  1MEK A;  1PKW A;  4QQ7 A;  4K7N A;  2CZ3 A;  5IIZ A;  2GSR A;  5IMA A;  5J9C A;  3EPT A;  2I3Y A;  1URM A;  3UAR A;  4K7I A;  2FWG A;  2VLT A;  3HYP A;  4P3Y B;  1M2D A;  1K0O A;  2JU5 A;  4KB3 A;  2K6V A;  4O32 A;  3RBT A;  4XS4 B;  1A2L A;  3UAP A;  1BQ7 A;  1MTC A;  4GRF A;  4WR4 A;  5H5Q A;  5ECN B;  2LV3 A;  3TOU A;  4PGT A;  2CA8 A;  3TUE A;  2VIM A;  3K8N A;  1TU8 A;  2OAD A;  3APQ A;  1N2A A;  3TKS C;  4X43 A;  1BYE A;  1NM3 A;  4TN8 A;  6GSV A;  1K0B A;  18GS A;  3F0I A;  1XCC A;  4PX1 A;  1G0T A;  1SD8 A;  4ML6 A;  3MSZ A;  4OO5 A;  4EDY A;  3IC8 A;  1OC9 B;  2E2M A;  1WMJ A;  3ZFL A;  4EUY A;  1XG8 A;  2E7P A;  3E9J B;  2IPA A;  1PGT A;  3U6V A;  4TRX A;  2BTO T;  4ZL9 A;  2AV4 A;  2KLX A;  3F3Q A;  4Z2R A;  1EOH A;  2E0Q A;  4PXO A;  5DAK B;  4O92 A;  4YQM A;  2LRT A;  1CQG A;  2IIY A;  2JSY A;  2VCW A;  3TRP A;  3HXS A;  1TTZ A;  1CQH A;  1YEX A;  3KP9 A;  3BOA A;  5LCZ A;  1GSE A;  1DUG A;  2LNT A;  3ZRE A;  2DJ1 A;  2OBK A;  3FZ9 A;  5HFG A;  2X4A A;  1OC8 A;  2YV9 A;  1V40 A;  4ZBD A;  4TR0 A;  1O85 A;  1B4P A;  2V6O A;  1TRU A;  4J56 E;  1SL2 B;  3MYD A;  2H74 A;  1SK0 A;  1HYU A;  2PU9 C;  4X4J A;  3EC3 A;  5CRD A;  1E2Y A;  22GS A;  1O6J A;  2DSA A;  4O5U A;  2DIY A;  2YJ7 A;  1GSF A;  3F4S A;  5DQS A;  4HSC X;  1XPV A;  2FY6 A;  1JHB A;  2HI7 A;  5CRG A;  5HR2 A;  2AHE A;  1TK0 B;  2CQ9 A;  3O3T A;  3PR8 A;  1FG4 A;  13GS A;  2A2S A;  2AAW A;  3GYK A;  3KH9 A;  2TRC P;  3Q6O A;  3UIW A;  2X8H A;  1PKZ A;  1Y25 A;  3TJG A;  3EWL A;  3D4M A;  1EWX A;  3L9U A;  1XZO A;  3SBC A;  4F2I A;  4Q5R A;  1DBY A;  3D4T A;  2YAN A;  3CMI A;  1UN2 A;  2ZNM A;  3D21 A;  1YZX A;  1QUW A;  5DJL A;  4EE0 A;  3ZFB A;  3BCK A;  2MMZ A;  1O8X A;  3IHG A;  1FAA A;  3C1S A;  1GNE A;  1Y6E A;  2VCQ A;  3IOS A;  4MNN A;  5ECS A;  2HRN A;  3F3R A;  5CRW A;  3CTF A;  4L0W A;  5JCU A;  1AQV A;  1Q4J A;  1G7E A;  2O8V B;  2GZZ A;  2H76 A;  2VCZ A;  3QDN A;  4YKG A;  2GLR A;  1HQO A;  4YH2 A;  4BA7 A;  3WGX A;  4KND A;  3HZ4 A;  1ZYE A;  2M72 A;  2OBI A;  4KA0 A;  2L57 A;  8GSS A;  5B6N A;  3J7Y b;  1GL8 A;  2L4C A;  1U3A A;  4MA9 A;  4FIW A;  5L71 A;  1A24 A;  3QCP A;  3CQF A;  2HSY A;  2DLX A;  4GSS A;  2XHF A;  1THO A;  3DVW A;  3FR9 A;  2JZS A;  3I69 A;  1G7O A;  3VPT A;  2XPD A;  3US3 A;  2FWE A;  1H75 A;  4LMW A;  4TR1 A;  2E2G A;  3IAS 2;  4V2L A;  2CT6 A;  3CRT A;  1XWB A;  1M3I A;  1G6W A;  2ZCT A;  3FZA A;  1B8X A;  4MCU A;  4KGI A;  1V2A A;  2R3X A;  3CRU A;  3TJF A;  4AJ7 A;  2BJX A;  5LD0 A;  4YQU A;  3DWV A;  4NHW A;  2AUV A;  4IHU A;  1F37 A;  3HCZ A;  3ZLP A;  5F05 A;  4IP6 A;  3TB2 A;  2FWH A;  4JE1 A;  5ELA A;  2H1G A;  1Z3E A;  1VGL A;  3TJB A;  1V58 A;  2ON5 A;  4MZB A;  1O7U A;  4ULX A;  1HNA A;  2EIR A;  3L9V A;  6GST A;  4K0G A;  2GZY A;  5D93 A;  4L0U A;  2HRA A;  1V9W A;  3P90 A;  1XXU A;  1GLQ A;  3CSI A;  4HQS A;  2H8L A;  2F8A A;  4FYC A;  4NHZ A;  2GQL A;  4G19 A;  4HJ2 A;  3CXG A;  2VCX A;  1BED A;  3LJR A;  4MZC A;  2C1Y A;  4ISD A;  4X0X A;  2N5B A;  4J2F A;  4CY6 A;  2B5Y A;  3QFA C;  4IJ3 A;  4PUF C;  3ZVJ A;  3HA9 A;  2H71 A;  5H5R A;  2EIO A;  3L78 A;  1AQX A;  3C1R A;  3KH7 A;  1ERT A;  3D0Z A;  2I4A A;  2PPT A;  2CAQ A;  1M2B A;  3U5R E;  1T8E B;  4I5Q A;  2R37 A;  3GNJ A;  1K3L A;  3P2A A;  1YF0 A;  3DEX A;  5D8I A;  3HVV A;  3H93 A;  3KXO A;  3GH9 A;  4EVM A;  2DMM A;  2H72 A;  3D5J A;  4ZL8 A;  2C3N A;  1EOG A;  1DE2 A;  1S3D A;  1JZR A;  3QOU A;  2H1D A;  1KEB A;  4GST A;  4Z2T A;  1WWJ A;  5FWG A;  3DML A;  5B6M A;  5G5E A;  5JCW A;  3GA4 A;  3M1G A;  3G7J A;  4BVY B;  3LFL A;  5ECK B;  3GN3 A;  1SL1 B;  4MK3 A;  1SKR B;  1RK4 A;  3FY7 A;  4IN0 A;  4NXI A;  5DCG A;  2O87 A;  1KTE A;  2AYT A;  4KSM A;  5COH A;  5IOX A;  5G31 A;  1GUK A;  1B9X C;  1Z6N A;  3IDV A;  4IS0 A;  2ON7 A;  4Z7X A;  1SYX A;  4XS6 A;  3WYW A;  4ML1 A;  2VL2 C;  1VF4 A;  4MH3 A;  1W89 A;  1R7H A;  5J9B A;  4G10 A;  6GSY A;  5EVO A;  4Q5F A;  2WUL A;  4MH2 A;  2P5Q A;  4GWR A;  3IBH A;  1BAY A;  1XVW A;  4WBJ A;  1SKS B;  1SK1 A;  1XOA A;  3KTB A;  1WPI A;  1YJ6 A;  3QD9 A;  4GXZ A;  3HJP A;  3VI7 A;  5EPF A;  2CX3 A;  5DBQ A;  1G6Y A;  4MJC A;  3C71 A;  4G0L A;  4OFN A;  2JZT A;  5CRH A;  4ZIJ A;  2XC2 A;  2GT5 A;  4ZBA A;  1A0R P;  3ZIV A;  2XPE A;  4F0C A;  3QAG A;  4USS A;  5IOW A;  1EZK A;  4E8H A;  5D96 A;  5ABR A;  2BMX A;  3N5O A;  1X9M B;  6GSU A;  4ZB8 A;  5F07 A;  5A4U A;  4DSQ A;  4TR4 A;  4HJM A;  4HZ4 A;  5ID2 B;  4L5O A;  5KN0 A;  1N8J A;  5A5K A;  3F8U A;  1U87 A;  2VCV A;  2QGV A;  1M9A A;  2VUP A;  3C8E A;  2PER A;  3LG6 A;  4JU5 A;  2DKH A;  1YDK A;  2GVP A;  4POL A;  4G0K A;  5HR3 A;  1TXX A;  4KCE A;  1U3I A;  1AUC A;  2WCI A;  5B7C A;  3TKS A;  5KN3 A;  4ZXG A;  1U88 A;  2HT9 A;  1Z9H A;  2V6K A;  3H8Q A;  3MAK A;  1RQM A;  1U6T A;  4EL1 A;  1HNB A;  4I6X A;  1F2E A;  1XW5 A;  2VAF A;  4DSR A;  4FO5 A;  3F6F A;  3TKS E;  4OCE A;  2GS3 A;  5HFI A;  2A2R A;  4RI6 A;  4IW9 A;  5HQP A;  3E0U A;  3FYG A;  3WD6 A;  3SWL A;  4JED A;  4XRD A;  16GS A;  1USB A;  1B9Y C;  7GSS A;  3FKF A;  5B8A A;  4HOJ A;  1OYJ A;  5G2Z A;  4PQI A;  4K9Z A;  5AIS A;  2YCD A;  5ECI B;  1GUL A;  3PPU A;  4K6X A;  2FHE A;  2FGX A;  4MPF A;  1TU7 A;  4FYU A;  4MPG A;  3GTU A;  3MIX A;  4JZQ A;  2VL3 A;  2H0H A;  1MDI A;  2X64 A;  1PN0 A;  1YF1 A;  1JFU A;  4KH7 A;  3ZZX A;  3HJM A;  2CVB A;  4F0B A;  4TXV A;  4WF5 A;  3TRX A;  1H4O A;  4I97 A;  2WDU A;  1R5A A;  1PN9 A;  5AIV A;  3IC4 A;  1M0U A;  2YN1 A;  2PWJ A;  5F0G A;  1UVZ A;  2B7K A;  2B5X A;  3KM6 A;  3WGD A;  4WXT A;  1WP0 A;  2YNX A;  2H73 A;  2H75 A;  3EMX A;  3W8S A;  3HD5 A;  3FK8 A;  3ZRD A;  3FRC A;  2REM A;  4PTS A;  3IXR A;  3PGT A;  3FZ4 A;  5DQY A;  5IO2 A;  1AIU A;  1YQ1 A;  3HVX A;  4EF0 A;  4OCF A;  4KUN A;  4RQR A;  3EE2 A;  1OVN A;  1T4Z A;  3KMO A;  1GWC A;  4QL7 A;  3A5W A;  1O81 A;  1GH2 A;  2C0E A;  1SEN A;  2H6Z A;  2HRF A;  3H4K A;  3HHV A;  5ECO B;  3ERG A;  2VD1 A;  2OE1 A;  4HU7 A;  1A23 A;  2H66 A;  2NDO A;  2WS2 A;  4CY8 A;  5DVB A;  1TK5 B;  5D73 A;  2X8G A;  4BPY A;  3H1N A;  5IM9 A;  3GX0 A;  2YWI A;  4HS1 A;  1EV4 A;  3FW2 A;  1ERU A;  1QXH A;  3ISO A;  4V1A g;  2XBI A;  3WT1 A;  3KZQ A;  2JAC A;  2K8V A;  4RUV A;  1LJR A;  4BVX A;  4G2E A;  2R0P A;  1Z7P A;  2WGR A;  4N30 A;  4JR4 A;  4E8E A;  4KF9 A;  4TR3 A;  1ZOF A;  2DJK A;  2LJK A;  2FA8 A;  2C0F A;  4XHM A;  4KDU A;  1XWK A;  1GSD A;  3ZL5 A;  2R0G A;  3KTL A;  3A3T A;  2YPM A;  3Q18 A;  3RPN A;  1YKA A;  2FLS A;  3VK9 A;  1T3B A;  4ACS A;  4POK A;  2NBS A;  3IPZ A;  5GZZ B;  2H1A A;  3RHC A;  4K5R A;  1I5G A;  5EL8 A;  3GV1 A;  3UOM A;  2C4J A;  4N11 A;  2H30 A;  2ZUP A;  1XOB A;  4WEY A;  3LW9 A;  1GTU A;  3LXZ A;  4YAP A;  4ECC A;  1PL2 A;  2B6M A;  3R2Q A;  3EU3 A;  3GFK A;  2HRK A;  4DVC A;  4ECJ A;  2FD3 A;  1F3B A;  1ZYN A;  1GTI A;  3UL3 A;  5HR1 A;  4HQZ A;  4KW6 A;  2HZE A;  3V1W A;  1MDK A;  4TXO B;  3A5I A;  3JCM L;  2YP6 A;  1GSY A;  1AQW A;  2R4V A;  3HVS A;  4DSS A;  1SU9 A;  3ZVJ D;  3FR6 A;  2VOC A;  4ILF A;  3TKR A;  4AJ6 A;  4WET A;  2AB6 A;  4Z2U A;  4D73 B;  4PUR A;  3QPM A;  3LWA A;  2QA1 A;  5A4V A;  2IJY A;  3C7M A;  3KGK A;  2J9H A;  3GSS A;  4BL7 B;  2LTK A;  2C8U A;  1TRS A;  1AXD A;  2I81 A;  4WKW A;  3TKP A;  3EMP A;  3TRQ A;  1AAZ A;  4NWY A;  2V2G A;  3CYN A;  2CVD A;  5IPG A;  1A2J A;  3BD2 A;  1WOU A;  2RUF A;  3IA1 A;  3UBL A;  1X5E A;  5INY A;  1M99 A;  4K0N A;  3L4N A;  1PMT A;  5IMV A;  5F8B A;  4YQV A;  3IV4 A;  2QSI A;  4KE3 A;  3LGC A;  4EKZ A;  5GST A;  4IQA A;  2VM2 A;  4J57 E;  4TOP A;  1SJ6 A;  3GTU B;  5H5S A;  2OA7 A;  2OE0 A;  4MAB A;  2J23 A;  4HEA 2;  1ST9 A;  2GQK A;  1YY7 A;  5D9X A;  2GST A;  4N0Z A;  3L0H A;  3G9B A;  1OKD A;  1V57 A;  2CX4 A;  4V1A p;  2JAD A;  5HR0 A;  1VF3 A;  1K0D A;  3M3M A;  2PVO C;  3FEU A;  2B1K A;  1A8L A;  1NW2 A;  1FO5 A;  5ECH B;  3IRA A;  1AW9 A;  3N9J A;  5ELG A;  1XFL A;  4NV2 A;  4NAX A;  2MZC A;  5JCG A;  9GSS A;  4GQC A;  1GUH A;  2R6K A;  1K0C A;  4N0V A;  2L6D A;  1Z7R A;  3F63 A;  4EIP A;  1HNC A;  1T4Y A;  4IKH A;  5E4W A;  3QAW A;  3TKQ A;  5KOW A;  1E6B A;  2VL2 A;  1V98 A;  2H0G A;  2HZF A;  2MBS A;  3H79 A;  1NHY A;  4TW5 A;  4HI7 A;  5AIX A;  1X5C A;  3D22 A;  14GS A;  3L9S A;  4K2D A;  1M9B A;  3A2X A;  19GS A;  5DAK A;  3W6G A;  1Z6M A;  2G0F A;  4IBP A;  4Q5N A;  2GT6 A;  4L8E A;  1FOH A;  1SK2 A;  4JBB A;  2M46 A;  2DC5 A;  3DVX A;  1J9B A;  3HY2 A;  3S9F A;  1XVQ A;  4LA1 A;  5FHI A;  3D6I A;  1FOV A;  3KD0 A;  1GP1 A;  1QMV A;  3DKS A;  1T1V A;  5G30 A;  5AN1 A;  2DBC A;  3NOF A;  1EEM A;  2DJJ A;  2FNO A;  4BVX B;  1DE1 A;  3IK9 A;  3UJ1 A;  1K0N A;  1OE7 A;  1OE8 A;  4DEJ A;  1BG5 A;  5DJM A;  2V41 A;  1PA3 A;  2F9S A;  3CBU A;  3EIN A;  3CTG A;  11GS A;  4JRR A;  1XWC A;  2NVL A;  3P8W A;  3Q74 A;  3FR3 A;  1K3Y A;  2R0C A;  2G2Q A;  2LS5 A;  1ZL9 A;  1XWG A;  3ZMK A;  4WR5 A;  1F6M C;  5KN1 A;  5CP1 A;  1T00 A;  3GL3 A;  4G0I A;  1KNG A;  3HDC A;  2DIZ A;  1Z5Y E;  1GSU A;  1JLV A;  2O7K A;  3A2V A;  4MZW A;  2O85 A;  1MDJ A;  1ERV A;  1TDI A;  2JL4 A;  1EV9 A;  3GKX A;  2IFQ A;  3GRX A;  2VCT A;  2N5F A;  2YZH A;  3QMX A;  1B4Q A;  1LU4 A;  2M80 A;  3MDK A;  4AGS A;  3BJ5 A;  2VM1 A;  5CO3 A;  2L6C A;  2NPB A;  5IQY A;  3RHB A;  1K3O A;  4WF4 A;  4GCI A;  3MNG A;  3KJY A;  3KP8 A;  4Q5Q A;  1C72 A;  2A2P A;  3DYR A;  2K8S A;  2CVK A;  3IK7 A;  5J5N A;  1MD3 A;  4RI7 A;  4IGJ A;  2L5O A;  4ZB9 A;  6GSS A;  2HYX A;  4EDZ A;  3ZIJ A;  2LQQ A;  3EU4 A;  4TR1 B;  1ZYP A;  3P7X A;  2EC4 A;  3ZIT A;  1M3J A;  1IYI A;  2VL9 A;  3OR5 A;  2GSS A;  2YOI A;  5IO0 A;  1BJX A;  3RDW A;  2FA4 A;  4MF7 A;  1WIK A;  1JZW A;  2P31 A;  3ZML A;  4AF2 A;  4K8M A;  4MJB A;  3APO A;  4I2U A;  4EO3 A;  4GF0 A;  3F9U A;  4AJ8 A;  5G1K A;  4MLY A;  2H19 A;  2L59 A;  3LYP A;  3EVI A;  3GH6 A;  2LQO A;  2PUK C;  6GSX A;  2KUC A;  3I6A A;  3I43 A;  3PIN A;  1ZCP A;  2HFD A;  2IMI A;  2LEG A;  3UEM A;  3IAM 2;  4QL9 A;  4POB A;  1WRY A;  3VI5 A;  2HSH A;  4HZ2 A;  5BRT A;  4N10 A;  1FVK A;  5F06 A;  2GSQ A;  5E59 A;  3QR6 A;  1R4W A;  2N5A A;  3ME8 A;  2H6X A;  5C00 A;  2F51 A;  1ZZY A;  2LST A;  4HUA A;  2H01 A;  5J41 A;  1XWA A;  5CYY A;  4L5L A;  2RM5 A;  4PNF A;  5A4W A;  4MJA A;  2QKE A;  2X8C A;  3LEF A;  2FWF A;  2H6Y A;  4ZL7 A;  4ECB A;  4LL1 B;  4ZBB A;  1W4V A;  2IMF A;  4HDE A;  3QAV A;  5IPH A;  2TRX A;  4K5S A;  2O89 A;  4OWY A;  1FVJ A;  1UC7 A;  1ACV A;  1QQ2 A;  2ES7 A;  1Q98 A;  1QGV A;  3UMA A;  2YJH A;  2I9H A;  1YEP A;  4HU9 A;  2LJA A;  2VO4 A;  5CAX A;  2F8F A;  1KBN A;  2X99 A;  1A8Y A;  1NHO A;  3R3E A;  1F3A A;  4BWS A;  4OO4 A;  4IQ1 A;  3LQ7 A;  2H0I A;  3NIV A;  4O7H A;  1SJI A;  20GS A;  3BCI A;  4KSO A;  1X9W B;  4GLT A;  4XTS A;  1SL0 B;  1OKT A;  2A4V A;  3DGQ A;  1ON4 A;  5JWO B;  3LSZ A;  2YWN A;  1A2M A;  4O5R A;  4JR6 A;  1EEJ A;  5G5F A;  5IMC A;  1JZO A;  3HKR A;  3CSJ A;  2X49 A;  1PX7 A;  3M9K A;  3ERW A;  4LMV A;  2GTU A;  3IE3 A;  2P0G A;  2B3S A;  4EC0 A;  2TIR A;  3UVT A;  4K7O A;  5ECP B;  1T7P B;  5KEJ A;  2UZ8 A;  3GMF A;  3NZN A;  4BWQ A;  3KEB A;  2K9F A;  4BVY A;  4A5P A;  3F6D A;  2LRN A;  3O76 A;  1TRV A;  5DAL A;  3HJO A;  2LKU A;  4PQ1 A;  1GSS A;  2RUE A;  3MWH A;  5HFK A;  2YWO A;  3G7Y A;  1M7T A; 
#chains in the Genus database with same CATH homology
 2C3T A;  4MF6 A;  1FW1 A;  2V1M A;  4YKF A;  2YV7 A;  3WT2 A;  3LOR A;  3W8J A;  2IMK A;  4OFM A;  1UA5 A;  1GNW A;  2YZU A;  3BBY A;  3M8N A;  3VLN A;  2IFQ B;  5KN2 A;  4LL4 B;  4RQX A;  1VF1 A;  2MYG A;  1NSW A;  2C80 A;  2H1B A;  4MJE A;  5FT3 A;  5DDL A;  1F9M A;  2JSZ A;  1FB0 A;  4IP1 A;  1SJZ A;  4GSN A;  4K1F A;  3GL5 A;  2HE3 A;  4ZB6 A;  4MDC A;  4TKY A;  3VFI A;  4XCS A;  2GDR A;  3CSH A;  4F82 A;  2PN8 A;  2B5E A;  4V2N A;  3F4R A;  1OC3 A;  2YWM A;  3GST A;  3QFB C;  2MMA A;  5JWR B;  2LNS A;  3GKM A;  3UVH A;  5IMF A;  2IL3 A;  1ML6 A;  4FQU A;  4IVF A;  3J7Y k;  5IMD A;  4KX4 A;  4O5Q A;  1XW6 A;  3FHK A;  2MMO A;  5ID2 A;  4CHS A;  2CAI A;  2LJR A;  1J08 A;  2F3M A;  3EUR A;  3TJK A;  1EP8 A;  3LXT A;  1GTB A;  2FUG 2;  2OAC A;  4F9Z A;  4LLR A;  2LRC A;  3VWX A;  2KP1 A;  3TOT A;  2R5G A;  1EP7 A;  2I1U A;  1GRX A;  3VUR A;  2VLV A;  1PSQ A;  2VLU A;  2WB9 A;  1PD2 1;  3KIJ A;  5ENU A;  4XIH A;  5D9W A;  2QA2 A;  2CZ2 A;  2HNL A;  5G1L A;  5KOX A;  3A2W A;  3VPQ A;  4POM A;  2GZP A;  2MBT A;  3EYT A;  3GKN A;  5D9V A;  2LUS A;  4K2X A;  1QFN A;  2WFC A;  3RPP A;  2HSM A;  4EXJ A;  2MMN A;  3F4T A;  10GS A;  3LYK A;  1S3C A;  3M0F A;  3ERF A;  2AJQ B;  4TVE A;  2ALB A;  2QC7 A;  3TCO A;  3ME7 A;  4GQF A;  5ECQ B;  2KP2 A;  4XS4 A;  1JZD A;  1EGR A;  1THX A;  2PGT A;  3KMN A;  1ZYQ B;  1QK8 A;  2DML A;  3VWU A;  1VRS D;  4GTU A;  1B48 A;  2PBJ A;  2P5R A;  1AC1 A;  2DJ3 A;  2RM6 A;  2OKA A;  1GLP A;  3UBK A;  3GKK A;  4X1U A;  1X9S B;  2IMD A;  5ECM B;  1WE0 A;  4V2M A;  2C0D A;  4FYB A;  1TI1 A;  4NMU A;  1TOF A;  4F03 A;  5LNK e;  1XIY A;  3GHA A;  2HXK A;  3ZTL A;  3AY8 A;  3GX8 A;  3G7I A;  3DIE A;  1XBS A;  3TGZ A;  1FHE A;  4ID0 A;  4MMM A;  2GQM A;  3I9V 2;  1WJK A;  4OD7 A;  3TJJ A;  1OC9 A;  2C0G A;  4IEL A;  1SYR A;  1TI3 A;  2PMT A;  2V32 A;  5J3R A;  1M2A A;  4ECI A;  1PX6 A;  3GUS A;  2Z9S A;  5GAP D;  3ZYW A;  1TK8 B;  2K18 A;  2IWT A;  2D2Z A;  1VF2 A;  2B1L A;  2RLI A;  4NV5 A;  1TP9 A;  2JZR A;  1X5D A;  1ZMA A;  2GGT A;  4WBR D;  5DAL B;  5D9T A;  1I9D A;  1PL1 A;  1X0R A;  5JWQ B;  1YKC A;  4I8B A;  4KCA A;  5ECR B;  1SKW B;  3GUR A;  3M9J A;  4NPB A;  4KAE A;  4OFT A;  1PQN A;  3FZ5 A;  2DJ2 A;  2DKI A;  2IME A;  1DSB A;  4OMV A;  1SD9 A;  1ABA A;  1RW1 A;  1TW9 A;  1HD2 A;  4I2T A;  4PQH A;  3ED3 A;  1MD4 A;  1IYH A;  1TJD A;  3DXB A;  4FH8 A;  2EIQ A;  6GSW A;  2OE3 A;  4CDO A;  1XW9 A;  3O6T A;  5ECL B;  3WGE A;  4KDX A;  3RAZ A;  3DD3 A;  2XBQ A;  2H70 A;  4PUA A;  2WRT A;  1GUM A;  3PH9 A;  1S3A A;  3IR4 A;  1PRX A;  1LBK A;  4ZIL A;  1K0A A;  5J4U A;  2L5L A;  12GS A;  2RII A;  3Q19 A;  2KHP A;  1OAZ A;  2WJU A;  1FB6 A;  3HZ8 A;  1R26 A;  3C73 A;  4ICY A;  3VWV A;  2PVQ A;  3APS A;  5C04 A;  1GSQ A;  2HZE B;  3VWW A;  17GS A;  4G9H A;  4EIQ A;  1TRW A;  2WZ9 A;  4CW9 A;  4DSS B;  2NTO A;  2VD0 A;  4MF5 A;  1JLW A;  3TDG A;  5GSS A;  2L4Q A;  3DRN A;  4H86 A;  1EGO A;  3IHQ A;  5IMZ A;  2A4H A;  1BX9 A;  1ILO A;  3E3E A;  1TKD B;  2FCH A;  3GIX A;  5EY6 A;  2C3Q A;  4XRA A;  4TXO A;  4IJI A;  5GAN D;  5DCH A;  5AGY A;  3KCM A;  2HLS A;  2OJL A;  4YAV A;  4KDY A;  5CRE A;  1ZGN A;  3FMW A;  2CV4 A;  1ERW A;  1K0M A;  2IN3 A;  1R5P A;  2B7J A;  2KOK A;  4D73 A;  1O73 A;  2DJ0 A;  2R2J A;  5CNW A;  1GTA A;  1O8W A;  4XS1 A;  1J0F A;  4MP4 A;  1A0F A;  5B8B A;  4PNG A;  5BMU A;  4BL7 A;  1MEK A;  1PKW A;  4QQ7 A;  4K7N A;  2CZ3 A;  5IIZ A;  2GSR A;  5IMA A;  5J9C A;  3EPT A;  2I3Y A;  1URM A;  3UAR A;  4K7I A;  2FWG A;  2VLT A;  3HYP A;  4P3Y B;  1M2D A;  1K0O A;  2JU5 A;  4KB3 A;  2K6V A;  4O32 A;  3RBT A;  4XS4 B;  1A2L A;  3UAP A;  1BQ7 A;  1MTC A;  4GRF A;  4WR4 A;  5H5Q A;  5ECN B;  2LV3 A;  3TOU A;  4PGT A;  2CA8 A;  3TUE A;  2VIM A;  3K8N A;  1TU8 A;  2OAD A;  3APQ A;  1N2A A;  3TKS C;  4X43 A;  1BYE A;  1NM3 A;  4TN8 A;  6GSV A;  1K0B A;  18GS A;  3F0I A;  1XCC A;  4PX1 A;  1G0T A;  1SD8 A;  4ML6 A;  3MSZ A;  4OO5 A;  4EDY A;  3IC8 A;  1OC9 B;  2E2M A;  1WMJ A;  3ZFL A;  4EUY A;  2E7P A;  3E9J B;  2IPA A;  1PGT A;  3U6V A;  4TRX A;  2BTO T;  4ZL9 A;  2AV4 A;  2KLX A;  3F3Q A;  4Z2R A;  1EOH A;  2E0Q A;  4PXO A;  5DAK B;  4O92 A;  4YQM A;  2LRT A;  1CQG A;  2IIY A;  2JSY A;  2VCW A;  3TRP A;  3HXS A;  1TTZ A;  1CQH A;  1YEX A;  3KP9 A;  3BOA A;  5LCZ A;  1GSE A;  1DUG A;  2LNT A;  3ZRE A;  2DJ1 A;  2OBK A;  3FZ9 A;  5HFG A;  2X4A A;  1OC8 A;  2YV9 A;  1V40 A;  4ZBD A;  4TR0 A;  1O85 A;  1B4P A;  2V6O A;  1TRU A;  4J56 E;  1SL2 B;  3MYD A;  2H74 A;  1SK0 A;  1HYU A;  2PU9 C;  4X4J A;  3EC3 A;  5CRD A;  1E2Y A;  22GS A;  1O6J A;  2DSA A;  4O5U A;  2DIY A;  2YJ7 A;  1GSF A;  3F4S A;  5DQS A;  1XPV A;  2FY6 A;  1JHB A;  2HI7 A;  5CRG A;  5HR2 A;  2AHE A;  1TK0 B;  2CQ9 A;  3O3T A;  3PR8 A;  1FG4 A;  13GS A;  2A2S A;  2AAW A;  3GYK A;  3KH9 A;  2TRC P;  3Q6O A;  3UIW A;  2X8H A;  1PKZ A;  1Y25 A;  3TJG A;  3EWL A;  3D4M A;  1EWX A;  3L9U A;  1XZO A;  3SBC A;  4F2I A;  4Q5R A;  1DBY A;  3D4T A;  2YAN A;  3CMI A;  1UN2 A;  2ZNM A;  3D21 A;  1YZX A;  1QUW A;  5DJL A;  4EE0 A;  3ZFB A;  3BCK A;  2MMZ A;  1O8X A;  3IHG A;  1FAA A;  3C1S A;  1GNE A;  1Y6E A;  2VCQ A;  3IOS A;  4MNN A;  5ECS A;  2HRN A;  3F3R A;  5CRW A;  3CTF A;  4L0W A;  5JCU A;  1AQV A;  1Q4J A;  1G7E A;  2O8V B;  2GZZ A;  2H76 A;  2VCZ A;  3QDN A;  4YKG A;  2GLR A;  1HQO A;  4YH2 A;  4BA7 A;  3WGX A;  4KND A;  3HZ4 A;  1ZYE A;  2M72 A;  2OBI A;  4KA0 A;  2L57 A;  8GSS A;  5B6N A;  3J7Y b;  1GL8 A;  2L4C A;  1U3A A;  4MA9 A;  4FIW A;  5L71 A;  1A24 A;  3QCP A;  2HSY A;  2DLX A;  4GSS A;  2XHF A;  1THO A;  3DVW A;  3FR9 A;  2JZS A;  3I69 A;  1G7O A;  3VPT A;  2XPD A;  3US3 A;  2FWE A;  1H75 A;  4LMW A;  4TR1 A;  2E2G A;  3IAS 2;  4V2L A;  2CT6 A;  3CRT A;  1XWB A;  1G6W A;  2ZCT A;  3FZA A;  1B8X A;  4MCU A;  4KGI A;  1V2A A;  2R3X A;  3CRU A;  3TJF A;  4AJ7 A;  2BJX A;  5LD0 A;  4YQU A;  3DWV A;  4NHW A;  2AUV A;  4IHU A;  1F37 A;  3HCZ A;  3ZLP A;  5F05 A;  4IP6 A;  3TB2 A;  2FWH A;  4JE1 A;  5ELA A;  2H1G A;  1Z3E A;  1VGL A;  3TJB A;  1V58 A;  2ON5 A;  4MZB A;  1O7U A;  4ULX A;  1HNA A;  2EIR A;  3L9V A;  6GST A;  4K0G A;  2GZY A;  5D93 A;  4L0U A;  2HRA A;  1V9W A;  3P90 A;  1XXU A;  1GLQ A;  3CSI A;  4HQS A;  2H8L A;  2F8A A;  4FYC A;  4NHZ A;  2GQL A;  4G19 A;  4HJ2 A;  3CXG A;  2VCX A;  1BED A;  3LJR A;  4MZC A;  2C1Y A;  4ISD A;  4X0X A;  2N5B A;  4J2F A;  4CY6 A;  2B5Y A;  3QFA C;  4IJ3 A;  4PUF C;  3ZVJ A;  3HA9 A;  2H71 A;  5H5R A;  2EIO A;  3L78 A;  1AQX A;  3C1R A;  3KH7 A;  1ERT A;  3D0Z A;  2I4A A;  2PPT A;  2CAQ A;  1M2B A;  3U5R E;  1T8E B;  4I5Q A;  2R37 A;  3GNJ A;  1K3L A;  3P2A A;  1YF0 A;  3DEX A;  5D8I A;  3HVV A;  3H93 A;  3KXO A;  3GH9 A;  4EVM A;  2DMM A;  2H72 A;  3D5J A;  4ZL8 A;  2C3N A;  1EOG A;  1DE2 A;  1S3D A;  1JZR A;  3QOU A;  2H1D A;  1KEB A;  4GST A;  4Z2T A;  1WWJ A;  5FWG A;  3DML A;  5B6M A;  5G5E A;  5JCW A;  3GA4 A;  3M1G A;  3G7J A;  4BVY B;  3LFL A;  5ECK B;  3GN3 A;  1SL1 B;  4MK3 A;  1SKR B;  1RK4 A;  3FY7 A;  4IN0 A;  4NXI A;  5DCG A;  2O87 A;  1KTE A;  2AYT A;  4KSM A;  5COH A;  5IOX A;  5G31 A;  1GUK A;  1B9X C;  1Z6N A;  3IDV A;  4IS0 A;  2ON7 A;  4Z7X A;  1SYX A;  4XS6 A;  3WYW A;  4ML1 A;  2VL2 C;  1VF4 A;  4MH3 A;  1W89 A;  1R7H A;  5J9B A;  4G10 A;  6GSY A;  5EVO A;  4Q5F A;  2WUL A;  4MH2 A;  2P5Q A;  4GWR A;  3IBH A;  1BAY A;  1XVW A;  4WBJ A;  1SKS B;  1SK1 A;  1XOA A;  3KTB A;  1WPI A;  1YJ6 A;  3QD9 A;  4GXZ A;  3HJP A;  3VI7 A;  5EPF A;  2CX3 A;  5DBQ A;  1G6Y A;  4MJC A;  3C71 A;  4G0L A;  4OFN A;  2JZT A;  5CRH A;  4ZIJ A;  2XC2 A;  2GT5 A;  4ZBA A;  1A0R P;  3ZIV A;  2XPE A;  4F0C A;  3QAG A;  4USS A;  5IOW A;  1EZK A;  4E8H A;  5D96 A;  5ABR A;  2BMX A;  3N5O A;  1X9M B;  6GSU A;  4ZB8 A;  5F07 A;  5A4U A;  4DSQ A;  4TR4 A;  4HJM A;  4HZ4 A;  5ID2 B;  4L5O A;  5KN0 A;  1N8J A;  5A5K A;  3F8U A;  1U87 A;  2VCV A;  2QGV A;  1M9A A;  2VUP A;  3C8E A;  2PER A;  3LG6 A;  4JU5 A;  2DKH A;  1YDK A;  2GVP A;  4POL A;  4G0K A;  5HR3 A;  1TXX A;  4KCE A;  1U3I A;  1AUC A;  2WCI A;  5B7C A;  3TKS A;  5KN3 A;  4ZXG A;  1U88 A;  2HT9 A;  1Z9H A;  2V6K A;  3H8Q A;  3MAK A;  1RQM A;  1U6T A;  4EL1 A;  1HNB A;  4I6X A;  1F2E A;  1XW5 A;  2VAF A;  4DSR A;  4FO5 A;  3F6F A;  3TKS E;  4OCE A;  2GS3 A;  5HFI A;  2A2R A;  4RI6 A;  4IW9 A;  5HQP A;  3E0U A;  3FYG A;  3WD6 A;  3SWL A;  4JED A;  4XRD A;  16GS A;  1USB A;  1B9Y C;  7GSS A;  3FKF A;  5B8A A;  4HOJ A;  1OYJ A;  5G2Z A;  4PQI A;  4K9Z A;  5AIS A;  2YCD A;  5ECI B;  1GUL A;  3PPU A;  4K6X A;  2FHE A;  2FGX A;  4MPF A;  1TU7 A;  4FYU A;  4MPG A;  3GTU A;  3MIX A;  4JZQ A;  2VL3 A;  2H0H A;  1MDI A;  2X64 A;  1PN0 A;  1YF1 A;  1JFU A;  4KH7 A;  3ZZX A;  3HJM A;  2CVB A;  4F0B A;  4TXV A;  4WF5 A;  3TRX A;  1H4O A;  4I97 A;  2WDU A;  1R5A A;  1PN9 A;  5AIV A;  3IC4 A;  1M0U A;  2YN1 A;  2PWJ A;  5F0G A;  1UVZ A;  2B7K A;  2B5X A;  3KM6 A;  3WGD A;  4WXT A;  1WP0 A;  2YNX A;  2H73 A;  2H75 A;  3EMX A;  3W8S A;  3HD5 A;  3FK8 A;  3ZRD A;  3FRC A;  2REM A;  4PTS A;  3IXR A;  3PGT A;  3FZ4 A;  5DQY A;  5IO2 A;  1AIU A;  1YQ1 A;  3HVX A;  4EF0 A;  4OCF A;  4KUN A;  4RQR A;  3EE2 A;  1OVN A;  1T4Z A;  3KMO A;  1GWC A;  4QL7 A;  3A5W A;  1O81 A;  1GH2 A;  2C0E A;  1SEN A;  2H6Z A;  2HRF A;  3H4K A;  3HHV A;  5ECO B;  3ERG A;  2VD1 A;  2OE1 A;  4HU7 A;  1A23 A;  2H66 A;  2NDO A;  2WS2 A;  4CY8 A;  5DVB A;  1TK5 B;  5D73 A;  2X8G A;  4BPY A;  3H1N A;  5IM9 A;  3GX0 A;  2YWI A;  4HS1 A;  1EV4 A;  3FW2 A;  1ERU A;  1QXH A;  3ISO A;  4V1A g;  2XBI A;  3WT1 A;  3KZQ A;  2JAC A;  2K8V A;  4RUV A;  1LJR A;  4BVX A;  4G2E A;  2R0P A;  1Z7P A;  2WGR A;  4N30 A;  4JR4 A;  4E8E A;  4KF9 A;  4TR3 A;  1ZOF A;  2DJK A;  2LJK A;  2FA8 A;  2C0F A;  4XHM A;  4KDU A;  1XWK A;  1GSD A;  3ZL5 A;  2R0G A;  3KTL A;  3A3T A;  2YPM A;  3Q18 A;  3RPN A;  1YKA A;  2FLS A;  3VK9 A;  1T3B A;  4ACS A;  4POK A;  2NBS A;  3IPZ A;  5GZZ B;  2H1A A;  3RHC A;  4K5R A;  1I5G A;  5EL8 A;  3GV1 A;  3UOM A;  2C4J A;  4N11 A;  2H30 A;  2ZUP A;  1XOB A;  4WEY A;  3LW9 A;  1GTU A;  3LXZ A;  4YAP A;  4ECC A;  1PL2 A;  2B6M A;  3R2Q A;  3EU3 A;  3GFK A;  2HRK A;  4DVC A;  4ECJ A;  2FD3 A;  1F3B A;  1ZYN A;  1GTI A;  3UL3 A;  5HR1 A;  4HQZ A;  4KW6 A;  2HZE A;  3V1W A;  1MDK A;  4TXO B;  3A5I A;  3JCM L;  2YP6 A;  1GSY A;  1AQW A;  2R4V A;  3HVS A;  4DSS A;  1SU9 A;  3ZVJ D;  3FR6 A;  2VOC A;  4ILF A;  3TKR A;  4AJ6 A;  4WET A;  2AB6 A;  4Z2U A;  4D73 B;  4PUR A;  3QPM A;  3LWA A;  2QA1 A;  5A4V A;  2IJY A;  3C7M A;  3KGK A;  2J9H A;  3GSS A;  4BL7 B;  2LTK A;  2C8U A;  1TRS A;  1AXD A;  2I81 A;  4WKW A;  3TKP A;  3EMP A;  3TRQ A;  1AAZ A;  4NWY A;  2V2G A;  3CYN A;  2CVD A;  5IPG A;  1A2J A;  3BD2 A;  1WOU A;  2RUF A;  3IA1 A;  3UBL A;  1X5E A;  5INY A;  1M99 A;  4K0N A;  3L4N A;  1PMT A;  5IMV A;  5F8B A;  4YQV A;  3IV4 A;  2QSI A;  4KE3 A;  3LGC A;  4EKZ A;  5GST A;  4IQA A;  2VM2 A;  4J57 E;  4TOP A;  1SJ6 A;  3GTU B;  5H5S A;  2OA7 A;  2OE0 A;  4MAB A;  2J23 A;  4HEA 2;  1ST9 A;  2GQK A;  1YY7 A;  5D9X A;  2GST A;  4N0Z A;  3L0H A;  3G9B A;  1OKD A;  1V57 A;  2CX4 A;  4V1A p;  2JAD A;  5HR0 A;  1VF3 A;  1K0D A;  3M3M A;  2PVO C;  3FEU A;  2B1K A;  1A8L A;  1NW2 A;  1FO5 A;  5ECH B;  3IRA A;  1AW9 A;  3N9J A;  5ELG A;  1XFL A;  4NV2 A;  4NAX A;  2MZC A;  5JCG A;  9GSS A;  4GQC A;  1GUH A;  2R6K A;  1K0C A;  4N0V A;  2L6D A;  1Z7R A;  3F63 A;  4EIP A;  1HNC A;  1T4Y A;  4IKH A;  5E4W A;  3QAW A;  3TKQ A;  5KOW A;  1E6B A;  2VL2 A;  1V98 A;  2H0G A;  2HZF A;  2MBS A;  3H79 A;  1NHY A;  4TW5 A;  4HI7 A;  5AIX A;  1X5C A;  3D22 A;  14GS A;  3L9S A;  4K2D A;  1M9B A;  3A2X A;  19GS A;  5DAK A;  3W6G A;  1Z6M A;  2G0F A;  4IBP A;  4Q5N A;  2GT6 A;  4L8E A;  1FOH A;  1SK2 A;  4JBB A;  2M46 A;  2DC5 A;  3DVX A;  1J9B A;  3HY2 A;  3S9F A;  1XVQ A;  4LA1 A;  5FHI A;  3D6I A;  1FOV A;  3KD0 A;  1GP1 A;  1QMV A;  3DKS A;  1T1V A;  5G30 A;  5AN1 A;  2DBC A;  3NOF A;  1EEM A;  2DJJ A;  2FNO A;  4BVX B;  1DE1 A;  3IK9 A;  3UJ1 A;  1K0N A;  1OE7 A;  1OE8 A;  4DEJ A;  1BG5 A;  5DJM A;  2V41 A;  1PA3 A;  2F9S A;  3CBU A;  3EIN A;  3CTG A;  11GS A;  4JRR A;  1XWC A;  2NVL A;  3P8W A;  3Q74 A;  3FR3 A;  1K3Y A;  2R0C A;  2G2Q A;  2LS5 A;  1ZL9 A;  1XWG A;  3ZMK A;  4WR5 A;  1F6M C;  5KN1 A;  5CP1 A;  1T00 A;  3GL3 A;  4G0I A;  1KNG A;  3HDC A;  2DIZ A;  1Z5Y E;  1GSU A;  1JLV A;  2O7K A;  3A2V A;  4MZW A;  2O85 A;  1MDJ A;  1ERV A;  1TDI A;  2JL4 A;  1EV9 A;  3GKX A;  2IFQ A;  3GRX A;  2VCT A;  2N5F A;  2YZH A;  3QMX A;  1B4Q A;  1LU4 A;  2M80 A;  3MDK A;  4AGS A;  3BJ5 A;  2VM1 A;  5CO3 A;  2L6C A;  2NPB A;  5IQY A;  3RHB A;  1K3O A;  4WF4 A;  4GCI A;  3MNG A;  3KJY A;  3KP8 A;  4Q5Q A;  1C72 A;  2A2P A;  3DYR A;  2K8S A;  2CVK A;  3IK7 A;  5J5N A;  1MD3 A;  4RI7 A;  4IGJ A;  2L5O A;  4ZB9 A;  6GSS A;  2HYX A;  4EDZ A;  3ZIJ A;  2LQQ A;  3EU4 A;  4TR1 B;  1ZYP A;  2EC4 A;  3P7X A;  3ZIT A;  1IYI A;  2VL9 A;  3OR5 A;  2GSS A;  2YOI A;  5IO0 A;  1BJX A;  3RDW A;  2FA4 A;  4MF7 A;  1WIK A;  1JZW A;  2P31 A;  3ZML A;  4AF2 A;  4K8M A;  4MJB A;  3APO A;  4I2U A;  4EO3 A;  4GF0 A;  3F9U A;  4AJ8 A;  5G1K A;  4MLY A;  2H19 A;  2L59 A;  3LYP A;  3EVI A;  3GH6 A;  2LQO A;  2PUK C;  6GSX A;  2KUC A;  3I6A A;  3I43 A;  3PIN A;  1ZCP A;  2HFD A;  2IMI A;  2LEG A;  3UEM A;  3IAM 2;  4QL9 A;  4POB A;  1WRY A;  3VI5 A;  2HSH A;  4HZ2 A;  5BRT A;  4N10 A;  1FVK A;  5F06 A;  2GSQ A;  5E59 A;  3QR6 A;  1R4W A;  2N5A A;  3ME8 A;  2H6X A;  5C00 A;  2F51 A;  1ZZY A;  2LST A;  4HUA A;  2H01 A;  5J41 A;  1XWA A;  5CYY A;  4L5L A;  2RM5 A;  4PNF A;  5A4W A;  4MJA A;  2QKE A;  2X8C A;  3LEF A;  2FWF A;  2H6Y A;  4ZL7 A;  4ECB A;  4LL1 B;  4ZBB A;  1W4V A;  2IMF A;  4HDE A;  3QAV A;  5IPH A;  2TRX A;  4K5S A;  2O89 A;  4OWY A;  1FVJ A;  1UC7 A;  1ACV A;  1QQ2 A;  2ES7 A;  1Q98 A;  1QGV A;  3UMA A;  2YJH A;  2I9H A;  1YEP A;  4HU9 A;  2LJA A;  2VO4 A;  5CAX A;  2F8F A;  1KBN A;  2X99 A;  1A8Y A;  1NHO A;  3R3E A;  1F3A A;  4BWS A;  4OO4 A;  4IQ1 A;  3LQ7 A;  2H0I A;  3NIV A;  4O7H A;  1SJI A;  20GS A;  3BCI A;  4KSO A;  1X9W B;  4GLT A;  4XTS A;  1SL0 B;  1OKT A;  2A4V A;  3DGQ A;  1ON4 A;  5JWO B;  3LSZ A;  2YWN A;  1A2M A;  4O5R A;  4JR6 A;  1EEJ A;  5G5F A;  5IMC A;  1JZO A;  3HKR A;  3CSJ A;  2X49 A;  1PX7 A;  3M9K A;  3ERW A;  4LMV A;  2GTU A;  3IE3 A;  2P0G A;  2B3S A;  4EC0 A;  2TIR A;  3UVT A;  4K7O A;  5ECP B;  1T7P B;  5KEJ A;  2UZ8 A;  3GMF A;  3NZN A;  4BWQ A;  3KEB A;  2K9F A;  4BVY A;  4A5P A;  3F6D A;  2LRN A;  3O76 A;  1TRV A;  5DAL A;  3HJO A;  2LKU A;  4PQ1 A;  1GSS A;  2RUE A;  3MWH A;  5HFK A;  2YWO A;  3G7Y A;  1M7T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...