4HU7A

E. coli thioredoxin variant with pro76 as single proline residue
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
107
structure length
107
Chain Sequence
SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGACKMIAAILDEIADEYQGKLTVAKLNIDQNAGTAAKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thioredoxin-1
publication title (4R)- and (4S)-Fluoroproline in the Conserved cis-Prolyl Peptide Bond of the Thioredoxin Fold: Tertiary Structure Context Dictates Ring Puckering.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 30
structure length 107
sequence length 107
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4hu7A00
2KHPA 4TVEA 1SL1B 4L0WA 2VCZA 5GSSA 5L71A 5DAKB 2HLSA 1B48A 2K18A 3UVHA 4MZWA 3JCML 3BJ5A 2VUPA 3CYNA 1FW1A 1MD3A 5ECOB 2E7PA 3ZREA 2RM5A 4KDUA 5CO3A 2H6XA 5ID2B 5KN3A 1V2AA 1VF1A 2YZUA 3VWUA 1RW1A 1RQMA 2JZSA 1XOAA 1WPIA 1VRSD 2LNSA 1PQNA 4HDEA 3QOUA 3Q18A 2ALBA 1A23A 2M80A 2LKUA 2ON5A 4MLYA 4K7IA 1RK4A 1OE8A 1Z3EA 2FNOA 4KSMA 5CRHA 1FVKA 2GDRA 1XW6A 1WJKA 1S3AA 5ID2A 5H5QA 4K1FA 1LU4A 1NHOA 5F06A 4QL7A 3IR4A 4LA1A 4YQMA 3GURA 1O81A 2CX4A 2VL2C 4MH3A 3KMNA 1M7TA 5CAXA 4TXOB 4IKHA 2HRNA 1USBA 2V41A 1IYHA 2FD3A 3DXBA 4HOJA 1GLPA 5CYYA 3HVVA 2VOCA 1DSBA 1ZZYA 4AJ7A 2GVPA 3HZ4A 2R3XA 5A5KA 1BJXA 2C0DA 1TKDB 13GSA 2GQMA 1G7OA 1GSUA 3PINA 1FB0A 1B9YC 1H75A 1U6TA 2X99A 4K0NA 2CX3A 1EV9A 1T7PB 3R2QA 3QAVA 4KGIA 2PUKC 2YJHA 3VURA 1ZGNA 2JADA 4NAXA 2GT6A 1BYEA 3PR8A 2OACA 1SD8A 3TKPA 2GTUA 3UL3A 1THOA 1W89A 3GYKA 1HNBA 4MDCA 3FZ5A 3F4TA 3CSJA 2FWGA 8GSSA 3ZFBA 5AGYA 1WOUA 1SK0A 4J2FA 17GSA 5IMVA 2GT5A 3MNGA 4KCAA 3U5RE 4L8EA 4V2MA 5C04A 3TJJA 3GV1A 2DJKA 2V32A 2F8AA 3RHCA 3CRTA 7GSSA 3TOUA 2GQKA 5B6NA 3HHVA 3HJOA 4Q5QA 4RUVA 5A4VA 3IC4A 4NPBA 5CRDA 2NPBA 5CRWA 5F07A 4MA9A 3KP8A 4MZBA 1YJ6A 1XXUA 4GCIA 4AGSA 4V1Ag 2L6CA 3C7MA 5JCWA 2B5EA 3E0UA 3TKRA 2PVQA 4HI7A 1WRYA 3F4SA 1GSEA 3VPTA 1OKDA 2CVDA 3N5OA 2ZUPA 1SK1A 1U87A 3S9FA 2D2ZA 2LNTA 3LYPA 3DKSA 3D22A 2HI7A 2IMKA 2I9HA 4ZIJA 1SKWB 3IAM2 3QDNA 3D4TA 3ZTLA 1K0DA 2TRCP 4XRAA 2K9FA 2L57A 4HJMA 1GSQA 4EDYA 3ME8A 4RI7A 4LMWA 3UBKA 4GTUA 1CQGA 1YKAA 4ML1A 2B3SA 4FYBA 2K8SA 3QPMA 2XPEA 3UEMA 1UA5A 5IO2A 1K0OA 2BTOT 3FEUA 3TJFA 1MTCA 3NZNA 3KTBA 3W8JA 10GSA 4MPGA 3M9KA 1AC1A 1VF4A 1NSWA 2B5XA 4WBJA 2DBCA 5J9CA 4IVFA 4KA0A 3H1NA 2MZCA 3MAKA 4ZB8A 3GTUA 4IP1A 2X64A 2YWOA 1G7EA 1XW9A 3LORA 3GUSA 3LQ7A 4KE3A 3QR6A 3UVTA 2X8CA 1XW5A 2REMA 4N30A 2GZZA 1R26A 1Z6NA 4H86A 3TKSC 3VWXA 5D9XA 1Y25A 3IV4A 1X9MB 1XPVA 4JRRA 5G1KA 5IMAA 3WD6A 1C72A 2WULA 5ELAA 2HFDA 1O8XA 1SYRA 3N9JA 2WB9A 4BPYA 1ERTA 3GX0A 3VI7A 4HQSA 3G9BA 3M3MA 3GIXA 2N5BA 2KLXA 2R2JA 2HT9A 2V1MA 4OFNA 1GSYA 3CSIA 4QL9A 4HS1A 1R5PA 3IAS2 1EP7A 4Q5RA 4ZL7A 3IHQA 5FT3A 3ZIJA 4YAVA 2B5YA 1XCCA 3ZZXA 5HR1A 2YOIA 4J57E 2DJ2A 4JR6A 3GH6A 2R4VA 5DJMA 2PMTA 1XFLA 2GZYA 2FUG2 2F9SA 4TKYA 1QMVA 2IMIA 3PGTA 2C4JA 4XS4A 3ZIVA 1HNCA 2OA7A 3W8SA 2L4QA 3C1SA 2CQ9A 3ZVJA 1R5AA 2VL9A 4TN8A 20GSA 5KN0A 5AN1A 4POBA 1GRXA 3F3RA 4NHWA 2AJQB 1X9SB 1PMTA 3TRXA 1R4WA 2H0GA 3HY2A 4NWYA 4AF2A 3FKFA 1OC9B 1SKSB 4MF5A 1YDKA 4IQAA 1AW9A 3EINA 1XIYA 3MWHA 1XBSA 1ST9A 1FB6A 1J9BA 3HXSA 1NHYA 4MK3A 4LLRA 4PNGA 2OKAA 1YEPA 3QAGA 1X0RA 1FOVA 1TI3A 5J41A 1ZMAA 1T4ZA 1F3BA 5G30A 2VCXA 1PSQA 5B7CA 1A0FA 3QFAC 4N10A 3EC3A 4XTSA 2IIYA 2WZ9A 1Z7PA 3TUEA 3VWVA 2IN3A 4I8BA 3U6VA 5IIZA 4YQUA 2HRFA 5DQYA 4HU7A 1G0TA 3ED3A 3IXRA 4RQRA 5EL8A 3GRXA 1TK5B 4F2IA 2C3QA 3NOFA 3LEFA 2B7JA 2CVBA 1E2YA 3TJBA 1XWAA 1YEXA 5DCHA 1TRVA 5ECKB 1K3OA 1WIKA 4F0CA 5G1LA 2GGTA 5HR3A 1TU8A 3CRUA 4ZL8A 5A4WA 4IP6A 1XWCA 3RPPA 3VLNA 3FRCA 3EU4A 3KM6A 3FW2A 2H76A 1VF3A 3M9JA 3O76A 3QFBC 4BA7A 3GHAA 1A2LA 2E0QA 1EP8A 5JWQB 4F9ZA 4CW9A 2B1KA 4IJ3A 1A24A 2O8VB 4ECBA 4WETA 4OCFA 4IS0A 3CBUA 2H1GA 5D93A 5GAND 1WE0A 1OKTA 3AY8A 3KEBA 2DJ0A 2LV3A 4TR1B 1SENA 1MD4A 4PUFC 5G2ZA 4EKZA 2PPTA 2MMNA 5DALB 3KGKA 3FR3A 1G6YA 3HYPA 2R6KA 3IBHA 3GL5A 4PX1A 1ERWA 2O7KA 4D73B 1THXA 11GSA 1T8EB 2OADA 3L9UA 2V6OA 4POMA 1ABAA 1M2DA 4WBRD 1PRXA 4GLTA 4GXZA 4EL1A 1ERVA 2RIIA 4TR1A 4HJ2A 2FCHA 1TXXA 1K3LA 2N5AA 5LD0A 3UOMA 4EVMA 3RPNA 6GSSA 3MSZA 3DIEA 4F82A 4F0BA 1JZDA 2H6ZA 3A2WA 1V98A 5ECNB 5KN1A 4OD7A 4JU5A 1TP9A 2WJUA 5DAKA 1GLQA 1GULA 4ZL9A 22GSA 1AQWA 3KD0A 5INYA 1TOFA 3F8UA 1MEKA 3EE2A 4WXTA 1K0CA 2EIRA 1AQVA 5CP1A 2IFQB 3EWLA 2DSAA 1XOBA 3FK8A 3DYRA 1M9AA 1V40A 3LSZA 2JSZA 1MDIA 2F51A 2H1AA 1JLWA 1S3CA 3CTGA 2DC5A 1XVQA 4ZB6A 2QKEA 3FZ4A 1TDIA 2HZFA 5IOWA 3DD3A 4HUAA 2I4AA 3F0IA 4G10A 5HR2A 2L6DA 3GSTA 2IFQA 2AV4A 4PGTA 4DSSB 2HZEB 4I2TA 1ZYEA 4TXOA 4WR4A 2LQQA 4OWYA 3FZ9A 2CT6A 5IMDA 3G7YA 3KH9A 1FO5A 2GZPA 5G5EA 2XBQA 4KDYA 2GS3A 3Q74A 5HFIA 3PH9A 5J3RA 4K8MA 2B6MA 4IQ1A 3D5JA 2KP1A 5LNKe 3H8QA 1YF0A 5GSTA 3HCZA 3D6IA 4BVYA 3IA1A 3O6TA 4N0ZA 5A4UA 3LJRA 2LSTA 1Z6MA 2L4CA 3HVXA 1EZKA 4ZBDA 2MMOA 3F3QA 1EOHA 2B1LA 5B8BA 1DE2A 5DQSA 5ABRA 2DMMA 4GSNA 2LRCA 2GSRA 2YV7A 4EDZA 1YY7A 2C8UA 2VL3A 3VFIA 4EC0A 6GSXA 4V2LA 1EGOA 1SJZA 5HFGA 3E3EA 5ECSA 1I5GA 2H71A 3TRPA 3DVWA 3UMAA 1F37A 2JU5A 4TRXA 2OE1A 4HQZA 2LRTA 4OMVA 4TXVA 3DMLA 5G31A 1KTEA 2YWNA 3ZITA 2C80A 4ZBAA 3IPZA 1SJ6A 1FHEA 5JCUA 5E4WA 5F8BA 3P8WA 4ECIA 1GSDA 4Q5NA 3L9SA 1R7HA 3GL3A 4MJBA 3F9UA 1EV4A 1K3YA 4FO5A 1Y6EA 1OE7A 2CV4A 1PKZA 1K0BA 1K0AA 4G2EA 3I43A 1ON4A 2KP2A 4ECCA 3WYWA 1HD2A 3L4NA 2C0EA 5DVBA 1YQ1A 5DBQA 4BL7A 1JZRA 1B9XC 2L5LA 1HQOA 1PL1A 1T4YA 3TGZA 1ZOFA 2KOKA 1UN2A 1WMJA 1O8WA 4YH2A 4PUAA 5H5SA 1V57A 1OC3A 2VD0A 1GWCA 1KEBA 2O85A 4BWQA 1Z9HA 3CTFA 1SYXA 1PD21 1T00A 1O7UA 2L5OA 4EE0A 3GN3A 3LFLA 1WWJA 1X5CA 1A0RP 1SU9A 2K6VA 1M99A 2IMFA 1B4PA 4K7OA 1ILOA 4JBBA 3ZL5A 4K6XA 2H8LA 4HZ4A 3KIJA 1GTUA 5D9TA 1PL2A 3EVIA 3GX8A 3IOSA 3C1RA 2FY6A 4L5OA 2RLIA 4OO4A 3IK9A 1K0MA 2DIYA 14GSA 5LCZA 2AB6A 1YF1A 5IM9A 5F05A 2FWHA 1PGTA 3RBTA 4KAEA 5DCGA 4KB3A 5D9WA 1M2AA 5AIXA 2IWTA 4XS1A 2ZNMA 3ZMKA 2HXKA 1ERUA 5JWOB 4ML6A 1N8JA 3V1WA 1G6WA 5AIVA 1MDJA 1OYJA 3A2VA 2XHFA 1GUHA 1AIUA 5GZZB 3HJPA 2HE3A 4PNFA 2H73A 4NV2A 3UAPA 3D0ZA 3P90A 1V58A 4GQCA 3F6DA 3G7IA 4GSSA 4IN0A 1M0UA 3EU3A 2OJLA 2MMAA 2VAFA 2H1DA 3MDKA 3QMXA 2H0HA 1AUCA 5KEJA 4ULXA 2ZCTA 3TKSA 3RAZA 2E2MA 2A2SA 4K9ZA 2WS2A 5IPHA 3H79A 4IGJA 2CZ3A 1X5EA 2WGRA 2JACA 4MJAA 1E6BA 4HZ2A 1F6MC 2MBTA 1TRUA 4RQXA 4KUNA 2VIMA 4DEJA 4CDOA 1B8XA 1TJDA 1F2EA 4I5QA 2VM1A 4MH2A 3IRAA 3BD2A 5B6MA 2YV9A 4CHSA 1OC9A 3WGEA 2RUEA 4EF0A 1O6JA 3C8EA 2H1BA 2E2GA 4NXIA 4HEA2 5ECQB 3LWAA 5IQYA 2L59A 2VO4A 3ERFA 2MBSA 3ERGA 3LG6A 4YAPA 2V2GA 2NVLA 2O89A 2JL4A 3DWVA 2FLSA 3KP9A 4NHZA 2LS5A 1TRSA 3BOAA 2H74A 5IO0A 16GSA 4POKA 1URMA 1JLVA 3VWWA 4PURA 4MJEA 5D9VA 4P3YB 3VI5A 2C0FA 3ZMLA 3FR9A 3P2AA 1AXDA 4AJ8A 1PKWA 2IL3A 1A8YA 1SL2B 3GKNA 5JCGA 2YZHA 2DLXA 4MZCA 4EUYA 2WCIA 2V6KA 5ECHB 2LQOA 4NV5A 3D21A 3LGCA 4IBPA 4GRFA 4X43A 1DE1A 1GTIA 4MJCA 1TTZA 2AYTA 4KSOA 2DJJA 3EMPA 2J9HA 2M72A 2TIRA 5FHIA 2VCQA 4KW6A 1ZYQB 2GSQA 2LRNA 4KX4A 4XRDA 1QXHA 6GSWA 5KN2A 1M2BA 1N2AA 3TKQA 2P5QA 2F3MA 4FH8A 1QK8A 4PQHA 4LMVA 1NM3A 1T3BA 5C00A 2FGXA 2RM6A 1BG5A 2NBSA 5J5NA 3IDVA 2AHEA 2P31A 4ISDA 1GH2A 5ECLB 1PN9A 4O92A 4PXOA 5IPGA 3UBLA 1U88A 3W6GA 3DEXA 4FYCA 3DRNA 2I1UA 5ECPB 2TRXA 3M0FA 5ECRB 4WF4A 2AUVA 3CXGA 2PBJA 3M8NA 3QCPA 5G5FA 1FVJA 3P7XA 2DMLA 3J7Yk 3CMIA 2BMXA 4MCUA 3HVSA 3L9VA 3BBYA 1U3AA 5ENUA 2EIOA 2N5FA 3TDGA 5DALA 4JEDA 2LJKA 5D8IA 2DJ3A 2I3YA 4XS6A 2ON7A 1TU7A 1F3AA 19GSA 4D73A 3Q6OA 3VK9A 2H19A 2LJRA 2CAIA 2FA8A 4NMUA 2LEGA 3QD9A 1BAYA 1CQHA 4Z7XA 2ES7A 3GKMA 1M9BA 4HU9A 1GNWA 3QAWA 3I9V2 2NTOA 3C73A 3US3A 2LTKA 2P5RA 1J08A 2HSYA 1BEDA 5ECMB 2X8GA 1FG4A 1DBYA 4G9HA 3WT1A 4K0GA 1YKCA 5ELGA 5HR0A 3H93A 1WP0A 2WDUA 2GSSA 3UARA 5F0GA 3RHBA 2NDOA 3TJGA 2YJ7A 1XZOA 3ZVJD 2IMDA 1YZXA 1BQ7A 1HNAA 3F63A 4FYUA 2YCDA 5J9BA 3WT2A 3DVXA 1GP1A 1ZCPA 3APOA 3OR5A 3D4MA 2BJXA 3L78A 1X5DA 4OFTA 2IMEA 2DIZA 1A8LA 4N11A 2VLUA 2YN1A 2C3TA 3BCKA 2YANA 4POLA 2XPDA 2H0IA 4DSSA 2LJAA 3F6FA 4ZB9A 2HZEA 1LBKA 3HD5A 4EO3A 1AQXA 4GWRA 2RUFA 2VL2A 4I2UA 3TKSE 3DGQA 4ECJA 2G2QA 2WRTA 3KXOA 4MF7A 3HJMA 2DJ1A 2X8HA 2YPMA 4L5LA 4K7NA 1ACVA 3TB2A 1Q98A 1HYUA 4EXJA 4O32A 2OE3A 5EY6A 2CA8A 1TK8B 2G0FA 2H75A 2VM2A 2OBIA 2C1YA 3GSSA 4WF5A 2PERA 2CZ2A 2GQLA 5H5RA 4K2DA 6GSYA 4IJIA 4GQFA 4BWSA 3EURA 2M46A 3CSHA 3WGDA 3ZLPA 2OBKA 4AJ6A 6GSVA 1OVNA 5CREA 2O87A 1UC7A 3SBCA 2IPAA 1XWGA 2YP6A 1PX6A 1OC8A 5CRGA 2H66A 2LUSA 3TOTA 1NW2A 4ACSA 2YWMA 2J23A 1A2JA 4X1UA 3C71A 2EIQA 1IYIA 4WR5A 2AAWA 2P0GA 3GKXA 4PQIA 2VCVA 4WKWA 4F03A 3GTUB 3TCOA 2FA4A 4V1Ap 4PQ1A 5FWGA 3O3TA 1F9MA 2VD1A 4MPFA 4MABA 3K8NA 1W4VA 2H6YA 18GSA 1SJIA 5CNWA 5EPFA 3GKKA 3I6AA 2A2RA 9GSSA 5E59A 3GNJA 2H72A 1MDKA 1QUWA 4TOPA 4MF6A 4DSQA 3ERWA 4J56E 1A2MA 4XIHA 5IMCA 4E8HA 1BX9A 3TJKA 3KMOA 5HFKA 4X0XA 2F8FA 4TR0A 4O7HA 1GSFA 5D96A 4XHMA 2XBIA 5IOXA 2MYGA 3KTLA 4XCSA 1GL8A 1JHBA 1JZWA 1VF2A 1Q4JA 1UVZA 2QGVA 1PX7A 5DJLA 3KJYA 2CAQA 1JFUA 1TK0B 2YWIA 1JZOA 2JZRA 4KH7A 1XWBA 4XS4B 1AAZA 1OAZA 2WFCA 1O73A 2C0GA 3GFKA 1SKRB 3NIVA 1EWXA 3KCMA 2PGTA 3WGXA 1I9DA 3APQA 3A3TA 3SWLA 3UJ1A 3BCIA 1XVWA 4FIWA 2MMZA 1LJRA 1QQ2A 2VCWA 1TRWA 3ZFLA 3FYGA 5IMZA 1VGLA 1GTBA 1SK2A 6GSTA 2HSHA 4TW5A 2FWEA 2R37A 1GTAA 3LYKA 3FZAA 3A2XA 2FHEA 3I69A 4ILFA 4OO5A 3GMFA 4N0VA 2IJYA 3A5WA 1S3DA 2K8VA 5B8AA 5COHA 2VLTA 4IW9A 4JE1A 3HKRA 1EGRA 3RDWA 1DUGA 1EEMA 4MP4A 4ZILA 2YNXA 5JWRB 3IK7A 3LXTA 4IHUA 1K0NA 1T1VA 12GSA 1ZL9A 4ID0A 1GSSA 4OCEA 1O85A 4QQ7A 3GH9A 3ZRDA 1SD9A 2B7KA 4O5RA 4KDXA 1GUKA 3J7Yb 5D73A 1KBNA 2XC2A 5IMFA 4LL4B 4BVXA 2GLRA 1QFNA 2PVOC 2GSTA 4TR4A 3UIWA 1XWKA 4L0UA 4GSTA 5J4UA 3APSA 4MMMA 4Q5FA 1PA3A 1ML6A 5GAPD 2H70A 1Z7RA 3FHKA 1GNEA 3GA4A 3HA9A 4DSRA 1U3IA 2VLVA 4ZXGA 2JZTA 3M1GA 2PU9C 4GF0A 5AISA 4RI6A 4ZBBA 1FAAA 4WEYA 1QGVA 1X9WB 2PN8A 5EVOA 5HQPA 3F4RA 4TR3A 4JZQA 2C3NA 3TRQA 2H01A 3Q19A 3VPQA 2CVKA 2EC4A 2A4VA 2I81A 4G19A 3FY7A 2Z9SA 1KNGA 3L0HA 3EYTA 3HZ8A 3KZQA 1B4QA 2JSYA 1SL0B 2VCTA 4V2NA 3E9JB 2QC7A 5DDLA 3EMXA 2FWFA 1H4OA 3ISOA 2PWJA 1J0FA 4JR4A 3ZYWA 1TW9A 5ECIB 2R5GA 3HDCA 4I97A 2H30A 3FR6A 4IELA 3H4KA 4I6XA 3ME7A 1Z5YE 1V9WA 3KH7A 3G7JA 2HYXA 3LXZA 4KNDA 2HNLA 2OE0A 3IE3A 1EOGA 2KUCA 4E8EA 1EEJA 1TI1A 4OFMA 2QSIA 4LL1B 4DVCA 6GSUA 4YQVA 1GUMA 4KCEA
chains in the Genus database with same CATH superfamily
2KHPA 4TVEA 1SL1B 4L0WA 2VCZA 5GSSA 5L71A 5DAKB 2HLSA 1B48A 2K18A 3UVHA 4MZWA 3JCML 3BJ5A 2VUPA 3CYNA 1FW1A 1MD3A 5ECOB 2E7PA 3ZREA 2RM5A 4KDUA 5CO3A 2H6XA 3IHGA 5ID2B 5KN3A 1V2AA 1VF1A 2YZUA 3VWUA 1RW1A 1RQMA 2JZSA 1XOAA 1WPIA 1VRSD 4BIKA 2LNSA 1PQNA 4HDEA 3R3EA 3QOUA 3Q18A 2ALBA 1A23A 2M80A 2LKUA 2ON5A 4MLYA 4K7IA 1RK4A 1OE8A 1Z3EA 2FNOA 4KSMA 5CRHA 1FVKA 1PN0A 2GDRA 1XW6A 1WJKA 1S3AA 5ID2A 5H5QA 4K1FA 1LU4A 1NHOA 5F06A 4QL7A 3IR4A 4LA1A 4YQMA 3GURA 1O81A 2CX4A 2VL2C 4MH3A 3KMNA 1M7TA 5CAXA 4TXOB 4IKHA 2HRNA 1USBA 2V41A 1IYHA 2FD3A 3DXBA 4HOJA 1GLPA 4HSCX 5CYYA 3HVVA 2VOCA 1DSBA 1ZZYA 4AJ7A 4Z2TA 2GVPA 3HZ4A 2R3XA 4CY6A 5A5KA 1BJXA 2DKIA 2C0DA 1TKDB 13GSA 2GQMA 1G7OA 1GSUA 3PINA 1FB0A 4BVYB 1B9YC 1H75A 1U6TA 2X99A 4K0NA 2CX3A 1EV9A 1T7PB 3R2QA 3QAVA 4KGIA 2PUKC 2YJHA 3VURA 1ZGNA 2JADA 4NAXA 2GT6A 1BYEA 3PR8A 2OACA 1SD8A 3TKPA 2GTUA 2X4AA 3UL3A 4A5PA 1THOA 1W89A 3GYKA 1HNBA 4MDCA 3FZ5A 3F4TA 3CSJA 2FWGA 8GSSA 3ZFBA 5AGYA 1WOUA 1SK0A 4J2FA 17GSA 5IMVA 2GT5A 3MNGA 4KCAA 3U5RE 4L8EA 4V2MA 5C04A 3TJJA 3GV1A 2DJKA 2V32A 2F8AA 3RHCA 5KOWA 3CRTA 7GSSA 3TOUA 2GQKA 5B6NA 3LW9A 3HHVA 3HJOA 4Q5QA 4RUVA 5A4VA 3IC4A 4NPBA 5CRDA 2NPBA 5CRWA 5F07A 4MA9A 3KP8A 4MZBA 1YJ6A 1XXUA 4GCIA 4AGSA 4V1Ag 2L6CA 3C7MA 5JCWA 2B5EA 3E0UA 3TKRA 2PVQA 4HI7A 1WRYA 3F4SA 1GSEA 3VPTA 1OKDA 2CVDA 3N5OA 2ZUPA 4KF9A 1SK1A 1U87A 3S9FA 2D2ZA 2LNTA 3LYPA 3DKSA 3D22A 2HI7A 4K2XA 2IMKA 2I9HA 4ZIJA 1SKWB 3IAM2 3QDNA 3D4TA 3ZTLA 1K0DA 2TRCP 4XRAA 2K9FA 2L57A 4HJMA 1GSQA 4EDYA 3ME8A 4RI7A 4LMWA 3UBKA 4GTUA 1CQGA 1YKAA 4ML1A 2B3SA 4FYBA 2K8SA 3QPMA 2XPEA 3UEMA 1UA5A 5IO2A 1K0OA 2BTOT 3FEUA 3TJFA 1MTCA 2HRAA 3NZNA 3KTBA 3W8JA 10GSA 4MPGA 3M9KA 1AC1A 1VF4A 1NSWA 2B5XA 4WBJA 2DBCA 5J9CA 4IVFA 4KA0A 3H1NA 2MZCA 3MAKA 4ZB8A 3GTUA 4IP1A 2X64A 2YWOA 1G7EA 1XW9A 3LORA 3GUSA 3LQ7A 4KE3A 3QR6A 3UVTA 2X8CA 1XW5A 2REMA 4N30A 2GZZA 1R26A 1Z6NA 4H86A 3TKSC 3VWXA 5D9XA 1Y25A 2R0CA 3IV4A 4K5SA 1X9MB 1XPVA 4JRRA 2X49A 5G1KA 5IMAA 3WD6A 1C72A 2WULA 5ELAA 2HFDA 1O8XA 1SYRA 3N9JA 2WB9A 4BPYA 1ERTA 3GX0A 3VI7A 4HQSA 3G9BA 3M3MA 3GIXA 2N5BA 2A4HA 2KLXA 2R2JA 2HT9A 2V1MA 4OFNA 1GSYA 3CSIA 4QL9A 4HS1A 1R5PA 3IAS2 1PFOA 1EP7A 4Q5RA 4ZL7A 3IHQA 5FT3A 3ZIJA 4YAVA 2B5YA 1XCCA 3ZZXA 5HR1A 2YOIA 4J57E 2DJ2A 4JR6A 3GH6A 2R4VA 5DJMA 2PMTA 1XFLA 2GZYA 2FUG2 2F9SA 4TKYA 1QMVA 2IMIA 3PGTA 2C4JA 4XS4A 3ZIVA 1HNCA 2OA7A 3W8SA 2L4QA 3C1SA 2CQ9A 3ZVJA 1R5AA 2VL9A 4TN8A 4G0LA 20GSA 5KN0A 5AN1A 4POBA 1GRXA 3F3RA 4NHWA 2AJQB 1X9SB 1PMTA 3TRXA 1R4WA 2H0GA 3HY2A 4NWYA 4AF2A 3FKFA 1OC9B 1SKSB 4MF5A 1YDKA 1S3RA 4IQAA 1AW9A 3EINA 1XIYA 3MWHA 1XBSA 1ST9A 1FB6A 1J9BA 3HXSA 1NHYA 4MK3A 4LLRA 4PNGA 2OKAA 1YEPA 3QAGA 1X0RA 1FOVA 1TI3A 3MYDA 5J41A 1ZMAA 1T4ZA 4O5QA 1F3BA 5G30A 2VCXA 1PSQA 5B7CA 1A0FA 3QFAC 4N10A 3EC3A 4XTSA 5BMUA 2IIYA 2WZ9A 1Z7PA 3TUEA 3VWVA 1M3IA 2IN3A 4I8BA 3U6VA 5IIZA 4YQUA 2HRFA 5DQYA 4HU7A 1G0TA 3ED3A 3HVNA 3IXRA 4RQRA 5EL8A 3GRXA 1TK5B 4F2IA 2C3QA 3NOFA 3LEFA 2B7JA 2CVBA 1E2YA 3TJBA 1XWAA 1YEXA 5DCHA 1TRVA 5ECKB 1K3OA 1WIKA 4F0CA 5G1LA 2GGTA 5HR3A 1TU8A 3CRUA 4ZL8A 5A4WA 4IP6A 1XWCA 3RPPA 3VLNA 3FRCA 3EU4A 3KM6A 3FW2A 2H76A 1VF3A 3M9JA 3O76A 3QFBC 4BA7A 3GHAA 1A2LA 2E0QA 1EP8A 5JWQB 4F9ZA 4CW9A 2B1KA 4IJ3A 1A24A 2O8VB 4ECBA 4WETA 4OCFA 4IS0A 3CBUA 2H1GA 5D93A 5GAND 1WE0A 1OKTA 3AY8A 3KEBA 2DJ0A 2LV3A 4TR1B 1SENA 1MD4A 4PUFC 5G2ZA 4EKZA 2PPTA 2MMNA 5DALB 3KGKA 3FR3A 1G6YA 3HYPA 2R6KA 3IBHA 3GL5A 4PX1A 1ERWA 2O7KA 4D73B 1THXA 11GSA 1T8EB 2OADA 3L9UA 2V6OA 4POMA 1ABAA 1M2DA 4WBRD 1PRXA 4GLTA 4GXZA 4EL1A 1ERVA 2RIIA 4TR1A 4HJ2A 2FCHA 1TXXA 1K3LA 2N5AA 5LD0A 3UOMA 4EVMA 3RPNA 6GSSA 3MSZA 3DIEA 4F82A 4F0BA 1JZDA 2H6ZA 1FOHA 3A2WA 1V98A 5ECNB 5KN1A 4USSA 4OD7A 4JU5A 1TP9A 2WJUA 5DAKA 1GLQA 1GULA 4ZL9A 22GSA 1AQWA 3KD0A 5INYA 1TOFA 3F8UA 1MEKA 3EE2A 4WXTA 1K0CA 2EIRA 1AQVA 5CP1A 2IFQB 3EWLA 2DSAA 1XOBA 3FK8A 3DYRA 1M9AA 1V40A 3LSZA 2JSZA 1MDIA 2F51A 2H1AA 1JLWA 1S3CA 3CTGA 2DC5A 1XVQA 4ZB6A 2QKEA 3FZ4A 1TDIA 2HZFA 5IOWA 3DD3A 4HUAA 2I4AA 3F0IA 4G10A 3MIXA 5HR2A 2L6DA 3GSTA 2IFQA 2AV4A 4PGTA 4DSSB 2HZEB 4I2TA 1ZYEA 4TXOA 4WR4A 2UZ8A 2LQQA 4OWYA 3FZ9A 2CT6A 5IMDA 3G7YA 3KH9A 1FO5A 2GZPA 5G5EA 2XBQA 4KDYA 2GS3A 3Q74A 5HFIA 3PH9A 5J3RA 4K8MA 2B6MA 4IQ1A 3D5JA 2KP1A 5LNKe 3H8QA 1YF0A 5GSTA 3HCZA 3D6IA 4BVYA 3IA1A 3O6TA 4N0ZA 5A4UA 3LJRA 2LSTA 1Z6MA 2L4CA 3HVXA 1EZKA 4ZBDA 2MMOA 3F3QA 1EOHA 2B1LA 5B8BA 1DE2A 5DQSA 5ABRA 2DMMA 4GSNA 2LRCA 2GSRA 2YV7A 4EDZA 1YY7A 2C8UA 2VL3A 3VFIA 4EC0A 6GSXA 4V2LA 1EGOA 1SJZA 1ZYPA 5HFGA 3E3EA 5ECSA 1I5GA 2H71A 3TRPA 3DVWA 3UMAA 1F37A 2JU5A 4TRXA 4BL7B 2OE1A 4HQZA 2LRTA 4O5UA 4OMVA 4TXVA 3DMLA 5G31A 1KTEA 2YWNA 3ZITA 2C80A 4ZBAA 3IPZA 1SJ6A 1FHEA 5JCUA 5E4WA 5F8BA 3P8WA 4YKFA 1GSDA 4ECIA 4Q5NA 3L9SA 1R7HA 3GL3A 4MJBA 3F9UA 1EV4A 1K3YA 4FO5A 1Y6EA 1OE7A 2CV4A 1PKZA 1K0BA 2DKHA 1K0AA 4G2EA 3I43A 1ON4A 2KP2A 4ECCA 3WYWA 1HD2A 3L4NA 2C0EA 5DVBA 1YQ1A 5DBQA 4BL7A 1JZRA 1B9XC 2L5LA 1HQOA 1PL1A 1T4YA 3TGZA 1ZOFA 2HRKA 2KOKA 1UN2A 1WMJA 1O8WA 4YH2A 4PUAA 5H5SA 1V57A 1OC3A 2VD0A 1GWCA 1KEBA 2O85A 4BWQA 1Z9HA 3CTFA 1SYXA 1PD21 1T00A 1O7UA 2L5OA 4EE0A 3GN3A 3LFLA 4YKGA 1WWJA 1X5CA 1A0RP 1SU9A 2K6VA 1M99A 2IMFA 1B4PA 4K7OA 1ILOA 4JBBA 3ZL5A 4K6XA 2H8LA 4HZ4A 3KIJA 1GTUA 5D9TA 1PL2A 3EVIA 3GX8A 3IOSA 3C1RA 2FY6A 4L5OA 2RLIA 4OO4A 3IK9A 1K0MA 2DIYA 14GSA 5LCZA 2AB6A 1YF1A 5IM9A 5F05A 2FWHA 1PGTA 3RBTA 4KAEA 5DCGA 4KB3A 5D9WA 1M2AA 5AIXA 2IWTA 4XS1A 2ZNMA 3ZMKA 2HXKA 1ERUA 5JWOB 4ML6A 1N8JA 3V1WA 1G6WA 5AIVA 1MDJA 1OYJA 3A2VA 2XHFA 1GUHA 1AIUA 5GZZB 3HJPA 2HE3A 4PNFA 2H73A 4NV2A 3UAPA 3D0ZA 3P90A 1V58A 4GQCA 3F6DA 3G7IA 4GSSA 4IN0A 1M0UA 3EU3A 2OJLA 2MMAA 2VAFA 3CQFA 2H1DA 3MDKA 3QMXA 2H0HA 1AUCA 3IC8A 5KEJA 4ULXA 2ZCTA 3TKSA 3RAZA 2E2MA 2A2SA 4K9ZA 2WS2A 5IPHA 3H79A 4IGJA 2CZ3A 1X5EA 2WGRA 2JACA 4MJAA 1E6BA 4HZ2A 1F6MC 2MBTA 1TRUA 4RQXA 4KUNA 2VIMA 4DEJA 4CDOA 1B8XA 1TJDA 1F2EA 4I5QA 2VM1A 4MH2A 3IRAA 3BD2A 5B6MA 3FMWA 2YV9A 4CHSA 1OC9A 3WGEA 2RUEA 4EF0A 1O6JA 3C8EA 2H1BA 2E2GA 4NXIA 4HEA2 5ECQB 3LWAA 5IQYA 2L59A 2VO4A 3ERFA 2MBSA 3ERGA 3LG6A 4YAPA 2V2GA 2NVLA 2O89A 2JL4A 3DWVA 2FLSA 3KP9A 4NHZA 2LS5A 1TRSA 3BOAA 2H74A 5IO0A 16GSA 4POKA 1URMA 1JLVA 3VWWA 4PURA 4MJEA 4EIQA 5D9VA 4P3YB 3VI5A 2C0FA 3ZMLA 3FR9A 3P2AA 4PTSA 1AXDA 4EIPA 4AJ8A 1PKWA 2IL3A 1A8YA 1SL2B 3GKNA 5JCGA 2YZHA 2DLXA 4MZCA 4EUYA 2WCIA 2V6KA 5ECHB 2LQOA 4NV5A 3D21A 3LGCA 4IBPA 4GRFA 4Z2RA 4X43A 4ICYA 4FQUA 1DE1A 1GTIA 4MJCA 1TTZA 2AYTA 4KSOA 2DJJA 3EMPA 2J9HA 2M72A 2TIRA 5FHIA 2VCQA 4KW6A 1ZYQB 2GSQA 2R0PA 2LRNA 4KX4A 4XRDA 1QXHA 6GSWA 5KN2A 1M2BA 1N2AA 3TKQA 2P5QA 2F3MA 4FH8A 1QK8A 4PQHA 4LMVA 1NM3A 1T3BA 5C00A 2FGXA 2RM6A 1BG5A 4G0IA 2NBSA 5J5NA 3IDVA 2AHEA 2P31A 4ISDA 1GH2A 5ECLB 1PN9A 4O92A 4PXOA 5IPGA 3UBLA 1U88A 3W6GA 3DEXA 4FYCA 3DRNA 2I1UA 5KOXA 5ECPB 2TRXA 3M0FA 5ECRB 4WF4A 2AUVA 4CY8A 3CXGA 2PBJA 3M8NA 3QCPA 5G5FA 1FVJA 3P7XA 2DMLA 3J7Yk 3CMIA 2BMXA 4MCUA 3HVSA 3L9VA 3BBYA 1U3AA 5ENUA 2EIOA 2N5FA 3TDGA 5DALA 4JEDA 2LJKA 1ZYNA 2DJ3A 5D8IA 2I3YA 4XS6A 2ON7A 2QA2A 1TU7A 1F3AA 19GSA 4D73A 3Q6OA 3VK9A 2H19A 2LJRA 2CAIA 2FA8A 4NMUA 2R0GA 2LEGA 3QD9A 1BAYA 1CQHA 4Z7XA 2ES7A 3GKMA 1M9BA 4HU9A 1GNWA 3QAWA 3I9V2 2NTOA 3C73A 3US3A 2LTKA 2P5RA 1J08A 2HSYA 1BEDA 5ECMB 2X8GA 1FG4A 1DBYA 4G9HA 3WT1A 4K0GA 1YKCA 5ELGA 5HR0A 3H93A 1WP0A 2WDUA 2GSSA 3UARA 5F0GA 3RHBA 2NDOA 4G0KA 3TJGA 2YJ7A 1XZOA 3EPTA 3ZVJD 2IMDA 1YZXA 1BQ7A 1HNAA 3F63A 4FYUA 2YCDA 5J9BA 3WT2A 3DVXA 1GP1A 1ZCPA 3APOA 3OR5A 3D4MA 2BJXA 3L78A 1X5DA 4OFTA 2IMEA 2DIZA 1A8LA 4N11A 2VLUA 2YN1A 2C3TA 3BCKA 2YANA 4POLA 4X4JA 2XPDA 2H0IA 4DSSA 2LJAA 3F6FA 4ZB9A 2HZEA 1LBKA 3HD5A 4EO3A 1AQXA 4GWRA 2RUFA 2VL2A 4I2UA 3TKSE 3DGQA 4ECJA 2G2QA 2WRTA 3KXOA 4MF7A 3HJMA 2DJ1A 2X8HA 2YPMA 4L5LA 4K7NA 1ACVA 3TB2A 1Q98A 1HYUA 4EXJA 4O32A 2OE3A 5EY6A 2CA8A 1TK8B 2G0FA 2H75A 2VM2A 2OBIA 2C1YA 3GSSA 4WF5A 2PERA 2CZ2A 2GQLA 5H5RA 4K2DA 6GSYA 4IJIA 4GQFA 4BWSA 3EURA 2M46A 3CSHA 3WGDA 3ZLPA 2OBKA 4AJ6A 6GSVA 1OVNA 5CREA 2O87A 1UC7A 3SBCA 5BRTA 2IPAA 1XWGA 2YP6A 1PX6A 1OC8A 5CRGA 2H66A 2LUSA 3TOTA 1NW2A 4ACSA 2YWMA 2J23A 1A2JA 4X1UA 3C71A 2EIQA 1IYIA 4WR5A 2AAWA 2P0GA 3GKXA 4PQIA 2VCVA 4WKWA 4F03A 3GTUB 3TCOA 2FA4A 4V1Ap 4PQ1A 5FWGA 3O3TA 1F9MA 2VD1A 4MPFA 4MABA 3K8NA 1W4VA 2H6YA 18GSA 1SJIA 3PPUA 5CNWA 5EPFA 4Z2UA 3GKKA 3I6AA 2A2RA 9GSSA 5E59A 3GNJA 2H72A 1MDKA 1QUWA 4TOPA 4MF6A 4DSQA 3ERWA 4J56E 1A2MA 4XIHA 5IMCA 4E8HA 1BX9A 3TJKA 3KMOA 5HFKA 4X0XA 2F8FA 4TR0A 4O7HA 1GSFA 5D96A 4XHMA 2XBIA 5IOXA 2MYGA 3KTLA 4XCSA 1GL8A 1JHBA 1JZWA 1VF2A 1Q4JA 4MNNA 1UVZA 2QGVA 1PX7A 5DJLA 3KJYA 2CAQA 1JFUA 1TK0B 2YWIA 1JZOA 2JZRA 4KH7A 1XWBA 4XS4B 1AAZA 1M3JA 1OAZA 2WFCA 1O73A 2C0GA 3GFKA 1SKRB 3NIVA 1EWXA 3KCMA 2PGTA 1XG8A 3WGXA 1I9DA 3APQA 3A3TA 3SWLA 3UJ1A 3BCIA 1XVWA 4FIWA 2MMZA 1LJRA 1QQ2A 2VCWA 1TRWA 3ZFLA 3FYGA 5IMZA 1VGLA 1GTBA 1SK2A 6GSTA 2HSHA 4TW5A 2FWEA 2R37A 1GTAA 3LYKA 3FZAA 3A2XA 2FHEA 3I69A 4ILFA 4OO5A 3GMFA 4N0VA 2IJYA 3A5WA 1S3DA 2K8VA 5B8AA 5COHA 2VLTA 4IW9A 4JE1A 3HKRA 1EGRA 4BVXB 3RDWA 1DUGA 1EEMA 4MP4A 4ZILA 2YNXA 5JWRB 3IK7A 3LXTA 4IHUA 1K0NA 1T1VA 12GSA 1ZL9A 4ID0A 1GSSA 2HSMA 4OCEA 1O85A 4QQ7A 3GH9A 3ZRDA 1SD9A 2B7KA 4O5RA 4KDXA 1GUKA 3J7Yb 5D73A 1KBNA 2XC2A 5IMFA 4LL4B 4BVXA 2GLRA 1QFNA 2PVOC 2GSTA 4TR4A 3UIWA 1XWKA 4L0UA 4GSTA 5J4UA 3APSA 4MMMA 4Q5FA 1PA3A 1ML6A 5GAPD 2H70A 1Z7RA 3FHKA 1GNEA 3GA4A 3HA9A 4DSRA 1U3IA 2VLVA 4ZXGA 2JZTA 3M1GA 2PU9C 2QA1A 4GF0A 5AISA 4RI6A 4ZBBA 1FAAA 4WEYA 1QGVA 1X9WB 2A2PA 2PN8A 5EVOA 5HQPA 3F4RA 4TR3A 4JZQA 2C3NA 3TRQA 2H01A 3Q19A 3VPQA 2CVKA 2EC4A 2A4VA 2I81A 4G19A 3FY7A 2Z9SA 1KNGA 3L0HA 3EYTA 3HZ8A 3KZQA 1B4QA 2JSYA 1SL0B 2VCTA 4V2NA 3E9JB 2QC7A 5DDLA 4K5RA 3EMXA 2FWFA 1H4OA 3ISOA 2PWJA 1J0FA 4JR4A 3ZYWA 1TW9A 5ECIB 2R5GA 3HDCA 4I97A 2H30A 3FR6A 4IELA 3H4KA 4I6XA 3ME7A 1Z5YE 1V9WA 3KH7A 3G7JA 2HYXA 3LXZA 4KNDA 3A5IA 2HNLA 2OE0A 3IE3A 1EOGA 2KUCA 4E8EA 1EEJA 1TI1A 4OFMA 2QSIA 4LL1B 4DVCA 6GSUA 4YQVA 1GUMA 4KCEA
chains in the Genus database with same CATH topology
2KHPA 4TVEA 1SL1B 4L0WA 2VCZA 5GSSA 5L71A 5DAKB 2HLSA 1B48A 2K18A 3UVHA 4MZWA 3JCML 3BJ5A 2VUPA 3CYNA 1FW1A 1MD3A 5ECOB 2E7PA 3ZREA 2RM5A 4KDUA 5CO3A 2H6XA 3IHGA 5ID2B 5KN3A 1V2AA 1VF1A 2YZUA 3VWUA 1RW1A 1RQMA 2JZSA 1XOAA 1WPIA 1VRSD 2LNSA 1PQNA 4HDEA 3R3EA 3QOUA 3Q18A 2ALBA 1A23A 2M80A 2LKUA 2ON5A 4MLYA 4K7IA 1RK4A 1OE8A 1Z3EA 2FNOA 4KSMA 5CRHA 1FVKA 1PN0A 2GDRA 1XW6A 1WJKA 1S3AA 5ID2A 5H5QA 4K1FA 1LU4A 1NHOA 5F06A 4QL7A 3IR4A 4LA1A 4YQMA 3GURA 1O81A 2CX4A 2VL2C 4MH3A 3KMNA 1M7TA 5CAXA 4TXOB 4IKHA 2HRNA 1USBA 2V41A 1IYHA 2FD3A 3DXBA 4HOJA 1GLPA 5CYYA 3HVVA 2VOCA 1DSBA 1ZZYA 4AJ7A 4Z2TA 2GVPA 3HZ4A 2R3XA 4CY6A 5A5KA 1BJXA 2DKIA 2C0DA 1TKDB 13GSA 2GQMA 1G7OA 1GSUA 3PINA 1FB0A 4BVYB 1B9YC 1H75A 1U6TA 2X99A 4K0NA 2CX3A 1EV9A 1T7PB 3R2QA 3QAVA 4KGIA 2PUKC 2YJHA 3VURA 1ZGNA 2JADA 4NAXA 2GT6A 1BYEA 3PR8A 2OACA 1SD8A 3TKPA 2GTUA 2X4AA 3UL3A 4A5PA 1THOA 1W89A 3GYKA 1HNBA 4MDCA 3FZ5A 3F4TA 3CSJA 2FWGA 8GSSA 3ZFBA 5AGYA 1WOUA 1SK0A 4J2FA 17GSA 5IMVA 2GT5A 3MNGA 4KCAA 3U5RE 4L8EA 4V2MA 5C04A 3TJJA 3GV1A 2DJKA 2V32A 2F8AA 3RHCA 5KOWA 3CRTA 7GSSA 3TOUA 2GQKA 5B6NA 3LW9A 3HHVA 3HJOA 4Q5QA 4RUVA 5A4VA 3IC4A 4NPBA 5CRDA 2NPBA 5CRWA 5F07A 4MA9A 3KP8A 4MZBA 1YJ6A 1XXUA 4GCIA 4AGSA 4V1Ag 2L6CA 3C7MA 5JCWA 2B5EA 3E0UA 3TKRA 2PVQA 4HI7A 1WRYA 3F4SA 1GSEA 3VPTA 1OKDA 2CVDA 3N5OA 2ZUPA 4KF9A 1SK1A 1U87A 3S9FA 2D2ZA 2LNTA 3LYPA 3DKSA 3D22A 2HI7A 4K2XA 2IMKA 2I9HA 4ZIJA 1SKWB 3IAM2 3QDNA 3D4TA 3ZTLA 1K0DA 2TRCP 4XRAA 2K9FA 2L57A 4HJMA 1GSQA 4EDYA 3ME8A 4RI7A 4LMWA 3UBKA 4GTUA 1CQGA 1YKAA 4ML1A 2B3SA 4FYBA 2K8SA 3QPMA 2XPEA 3UEMA 1UA5A 5IO2A 1K0OA 2BTOT 3FEUA 3TJFA 1MTCA 2HRAA 3NZNA 3KTBA 3W8JA 10GSA 4MPGA 3M9KA 1AC1A 1VF4A 1NSWA 2B5XA 4WBJA 2DBCA 5J9CA 4IVFA 4KA0A 3H1NA 2MZCA 3MAKA 4ZB8A 3GTUA 4IP1A 2X64A 2YWOA 1G7EA 1XW9A 3LORA 3GUSA 3LQ7A 4KE3A 3QR6A 3UVTA 2X8CA 1XW5A 2REMA 4N30A 2GZZA 1R26A 1Z6NA 4H86A 3TKSC 3VWXA 5D9XA 1Y25A 2R0CA 3IV4A 4K5SA 1X9MB 1XPVA 4JRRA 2X49A 5G1KA 5IMAA 3WD6A 1C72A 2WULA 5ELAA 2HFDA 1O8XA 1SYRA 3N9JA 2WB9A 4BPYA 1ERTA 3GX0A 3VI7A 4HQSA 3G9BA 3M3MA 3GIXA 2N5BA 2A4HA 2KLXA 2R2JA 2HT9A 2V1MA 4OFNA 1GSYA 3CSIA 4QL9A 4HS1A 1R5PA 3IAS2 1EP7A 4Q5RA 4ZL7A 3IHQA 5FT3A 3ZIJA 4YAVA 2B5YA 1XCCA 3ZZXA 5HR1A 2YOIA 4J57E 2DJ2A 4JR6A 3GH6A 2R4VA 5DJMA 2PMTA 1XFLA 2GZYA 2FUG2 2F9SA 4TKYA 1QMVA 2IMIA 3PGTA 2C4JA 4XS4A 3ZIVA 1HNCA 2OA7A 3W8SA 2L4QA 3C1SA 2CQ9A 3ZVJA 1R5AA 2VL9A 4TN8A 4G0LA 20GSA 5KN0A 5AN1A 4POBA 1GRXA 3F3RA 4NHWA 2AJQB 1X9SB 1PMTA 3TRXA 1R4WA 2H0GA 3HY2A 4NWYA 4AF2A 3FKFA 1OC9B 1SKSB 4MF5A 1YDKA 4IQAA 1AW9A 3EINA 1XIYA 3MWHA 1XBSA 1ST9A 1FB6A 1J9BA 3HXSA 1NHYA 4MK3A 4LLRA 4PNGA 2OKAA 1YEPA 3QAGA 1X0RA 1FOVA 1TI3A 3MYDA 5J41A 1ZMAA 1T4ZA 4O5QA 1F3BA 5G30A 2VCXA 1PSQA 5B7CA 1A0FA 3QFAC 4N10A 3EC3A 4XTSA 5BMUA 2IIYA 2WZ9A 1Z7PA 3TUEA 3VWVA 2IN3A 4I8BA 3U6VA 5IIZA 4YQUA 2HRFA 5DQYA 4HU7A 1G0TA 3ED3A 3IXRA 4RQRA 5EL8A 3GRXA 1TK5B 4F2IA 2C3QA 3NOFA 3LEFA 2B7JA 2CVBA 1E2YA 3TJBA 1XWAA 1YEXA 5DCHA 1TRVA 5ECKB 1K3OA 1WIKA 4F0CA 5G1LA 2GGTA 5HR3A 1TU8A 3CRUA 4ZL8A 5A4WA 4IP6A 1XWCA 3RPPA 3VLNA 3FRCA 3EU4A 3KM6A 3FW2A 2H76A 1VF3A 3M9JA 3O76A 3QFBC 4BA7A 3GHAA 1A2LA 2E0QA 1EP8A 5JWQB 4F9ZA 4CW9A 2B1KA 4IJ3A 1A24A 2O8VB 4ECBA 4WETA 4OCFA 4IS0A 3CBUA 2H1GA 5D93A 5GAND 1WE0A 1OKTA 3AY8A 3KEBA 2DJ0A 2LV3A 4TR1B 1SENA 1MD4A 4PUFC 5G2ZA 4EKZA 2PPTA 2MMNA 5DALB 3KGKA 3FR3A 1G6YA 3HYPA 2R6KA 3IBHA 3GL5A 4PX1A 1ERWA 2O7KA 4D73B 1THXA 11GSA 1T8EB 2OADA 3L9UA 2V6OA 4POMA 1ABAA 1M2DA 4WBRD 1PRXA 4GLTA 4GXZA 4EL1A 1ERVA 2RIIA 4TR1A 4HJ2A 2FCHA 1TXXA 1K3LA 2N5AA 5LD0A 3UOMA 4EVMA 3RPNA 6GSSA 3MSZA 3DIEA 4F82A 4F0BA 1JZDA 2H6ZA 1FOHA 3A2WA 1V98A 5ECNB 5KN1A 4USSA 4OD7A 4JU5A 1TP9A 2WJUA 5DAKA 1GLQA 1GULA 4ZL9A 22GSA 1AQWA 3KD0A 5INYA 1TOFA 3F8UA 1MEKA 3EE2A 4WXTA 1K0CA 2EIRA 1AQVA 5CP1A 2IFQB 3EWLA 2DSAA 1XOBA 3FK8A 3DYRA 1M9AA 1V40A 3LSZA 2JSZA 1MDIA 2F51A 2H1AA 1JLWA 1S3CA 3CTGA 2DC5A 1XVQA 4ZB6A 2QKEA 3FZ4A 1TDIA 2HZFA 5IOWA 3DD3A 4HUAA 2I4AA 3F0IA 4G10A 3MIXA 5HR2A 2L6DA 3GSTA 2IFQA 2AV4A 4PGTA 4DSSB 2HZEB 4I2TA 1ZYEA 4TXOA 4WR4A 2UZ8A 2LQQA 4OWYA 3FZ9A 2CT6A 5IMDA 3G7YA 3KH9A 1FO5A 2GZPA 5G5EA 2XBQA 4KDYA 2GS3A 3Q74A 5HFIA 3PH9A 5J3RA 4K8MA 2B6MA 4IQ1A 3D5JA 2KP1A 5LNKe 3H8QA 1YF0A 5GSTA 3HCZA 3D6IA 4BVYA 3IA1A 3O6TA 4N0ZA 5A4UA 3LJRA 2LSTA 1Z6MA 2L4CA 3HVXA 1EZKA 4ZBDA 2MMOA 3F3QA 1EOHA 2B1LA 5B8BA 1DE2A 5DQSA 5ABRA 2DMMA 4GSNA 2LRCA 2GSRA 2YV7A 4EDZA 1YY7A 2C8UA 2VL3A 3VFIA 4EC0A 6GSXA 4V2LA 1EGOA 1SJZA 1ZYPA 5HFGA 3E3EA 5ECSA 1I5GA 2H71A 3TRPA 3DVWA 3UMAA 1F37A 2JU5A 4TRXA 4BL7B 2OE1A 4HQZA 2LRTA 4O5UA 4OMVA 4TXVA 3DMLA 5G31A 1KTEA 2YWNA 3ZITA 2C80A 4ZBAA 3IPZA 1SJ6A 1FHEA 5JCUA 5E4WA 5F8BA 3P8WA 4YKFA 1GSDA 4ECIA 4Q5NA 3L9SA 1R7HA 3GL3A 4MJBA 3F9UA 1EV4A 1K3YA 4FO5A 1Y6EA 1OE7A 2CV4A 1PKZA 1K0BA 2DKHA 1K0AA 4G2EA 3I43A 1ON4A 2KP2A 4ECCA 3WYWA 1HD2A 3L4NA 2C0EA 5DVBA 1YQ1A 5DBQA 4BL7A 1JZRA 1B9XC 2L5LA 1HQOA 1PL1A 1T4YA 3TGZA 1ZOFA 2HRKA 2KOKA 1UN2A 1WMJA 1O8WA 4YH2A 4PUAA 5H5SA 1V57A 1OC3A 2VD0A 1GWCA 1KEBA 2O85A 4BWQA 1Z9HA 3CTFA 1SYXA 1PD21 1T00A 1O7UA 2L5OA 4EE0A 3GN3A 3LFLA 4YKGA 1WWJA 1X5CA 1A0RP 1SU9A 2K6VA 1M99A 2IMFA 1B4PA 4K7OA 1ILOA 4JBBA 3ZL5A 4K6XA 2H8LA 4HZ4A 3KIJA 1GTUA 5D9TA 1PL2A 3EVIA 3GX8A 3IOSA 3C1RA 2FY6A 4L5OA 2RLIA 4OO4A 3IK9A 1K0MA 2DIYA 14GSA 5LCZA 2AB6A 1YF1A 5IM9A 5F05A 2FWHA 1PGTA 3RBTA 4KAEA 5DCGA 4KB3A 5D9WA 1M2AA 5AIXA 2IWTA 4XS1A 2ZNMA 3ZMKA 2HXKA 1ERUA 5JWOB 4ML6A 1N8JA 3V1WA 1G6WA 5AIVA 1MDJA 1OYJA 3A2VA 2XHFA 1GUHA 1AIUA 5GZZB 3HJPA 2HE3A 4PNFA 2H73A 4NV2A 3UAPA 3D0ZA 3P90A 1V58A 4GQCA 3F6DA 3G7IA 4GSSA 4IN0A 1M0UA 3EU3A 2OJLA 2MMAA 2VAFA 2H1DA 3MDKA 3QMXA 2H0HA 1AUCA 3IC8A 5KEJA 4ULXA 2ZCTA 3TKSA 3RAZA 2E2MA 2A2SA 4K9ZA 2WS2A 5IPHA 3H79A 4IGJA 2CZ3A 1X5EA 2WGRA 2JACA 4MJAA 1E6BA 4HZ2A 1F6MC 2MBTA 1TRUA 4RQXA 4KUNA 2VIMA 4DEJA 4CDOA 1B8XA 1TJDA 1F2EA 4I5QA 2VM1A 4MH2A 3IRAA 3BD2A 5B6MA 3FMWA 2YV9A 4CHSA 1OC9A 3WGEA 2RUEA 4EF0A 1O6JA 3C8EA 2H1BA 2E2GA 4NXIA 4HEA2 5ECQB 3LWAA 5IQYA 2L59A 2VO4A 3ERFA 2MBSA 3ERGA 3LG6A 4YAPA 2V2GA 2NVLA 2O89A 2JL4A 3DWVA 2FLSA 3KP9A 4NHZA 2LS5A 1TRSA 3BOAA 2H74A 5IO0A 16GSA 4POKA 1URMA 1JLVA 3VWWA 4PURA 4MJEA 4EIQA 5D9VA 4P3YB 3VI5A 2C0FA 3ZMLA 3FR9A 3P2AA 4PTSA 1AXDA 4EIPA 4AJ8A 1PKWA 2IL3A 1A8YA 1SL2B 3GKNA 5JCGA 2YZHA 2DLXA 4MZCA 4EUYA 2WCIA 2V6KA 5ECHB 2LQOA 4NV5A 3D21A 3LGCA 4IBPA 4GRFA 4Z2RA 4X43A 4ICYA 4FQUA 1DE1A 1GTIA 4MJCA 1TTZA 2AYTA 4KSOA 2DJJA 3EMPA 2J9HA 2M72A 2TIRA 5FHIA 2VCQA 4KW6A 1ZYQB 2GSQA 2R0PA 2LRNA 4KX4A 4XRDA 1QXHA 6GSWA 5KN2A 1M2BA 1N2AA 3TKQA 2P5QA 2F3MA 4FH8A 1QK8A 4PQHA 4LMVA 1NM3A 1T3BA 5C00A 2FGXA 2RM6A 1BG5A 4G0IA 2NBSA 5J5NA 3IDVA 2AHEA 2P31A 4ISDA 1GH2A 5ECLB 1PN9A 4O92A 4PXOA 5IPGA 3UBLA 1U88A 3W6GA 3DEXA 4FYCA 3DRNA 2I1UA 5KOXA 5ECPB 2TRXA 3M0FA 5ECRB 4WF4A 2AUVA 4CY8A 3CXGA 2PBJA 3M8NA 3QCPA 5G5FA 1FVJA 3P7XA 2DMLA 3J7Yk 3CMIA 2BMXA 4MCUA 3HVSA 3L9VA 3BBYA 1U3AA 5ENUA 2EIOA 2N5FA 3TDGA 5DALA 4JEDA 2LJKA 1ZYNA 2DJ3A 5D8IA 2I3YA 4XS6A 2ON7A 2QA2A 1TU7A 1F3AA 19GSA 4D73A 3Q6OA 3VK9A 2H19A 2LJRA 2CAIA 2FA8A 4NMUA 2R0GA 2LEGA 3QD9A 1BAYA 1CQHA 4Z7XA 2ES7A 3GKMA 1M9BA 4HU9A 1GNWA 3QAWA 3I9V2 2NTOA 3C73A 3US3A 2LTKA 2P5RA 1J08A 2HSYA 1BEDA 5ECMB 2X8GA 1FG4A 1DBYA 4G9HA 3WT1A 4K0GA 1YKCA 5ELGA 5HR0A 3H93A 1WP0A 2WDUA 2GSSA 3UARA 5F0GA 3RHBA 2NDOA 4G0KA 3TJGA 2YJ7A 1XZOA 3EPTA 3ZVJD 2IMDA 1YZXA 1BQ7A 1HNAA 3F63A 4FYUA 2YCDA 5J9BA 3WT2A 3DVXA 1GP1A 1ZCPA 3APOA 3OR5A 3D4MA 2BJXA 3L78A 1X5DA 4OFTA 2IMEA 2DIZA 1A8LA 4N11A 2VLUA 2YN1A 2C3TA 3BCKA 2YANA 4POLA 4X4JA 2XPDA 2H0IA 4DSSA 2LJAA 3F6FA 4ZB9A 2HZEA 1LBKA 3HD5A 4EO3A 1AQXA 4GWRA 2RUFA 2VL2A 4I2UA 3TKSE 3DGQA 4ECJA 2G2QA 2WRTA 3KXOA 4MF7A 3HJMA 2DJ1A 2X8HA 2YPMA 4L5LA 4K7NA 1ACVA 3TB2A 1Q98A 1HYUA 4EXJA 4O32A 2OE3A 5EY6A 2CA8A 1TK8B 2G0FA 2H75A 2VM2A 2OBIA 2C1YA 3GSSA 4WF5A 2PERA 2CZ2A 2GQLA 5H5RA 4K2DA 6GSYA 4IJIA 4GQFA 4BWSA 3EURA 2M46A 3CSHA 3WGDA 3ZLPA 2OBKA 4AJ6A 6GSVA 1OVNA 5CREA 2O87A 1UC7A 3SBCA 5BRTA 2IPAA 1XWGA 2YP6A 1PX6A 1OC8A 5CRGA 2H66A 2LUSA 3TOTA 1NW2A 4ACSA 2YWMA 2J23A 1A2JA 4X1UA 3C71A 2EIQA 1IYIA 4WR5A 2AAWA 2P0GA 3GKXA 4PQIA 2VCVA 4WKWA 4F03A 3GTUB 3TCOA 2FA4A 4V1Ap 4PQ1A 5FWGA 3O3TA 1F9MA 2VD1A 4MPFA 4MABA 3K8NA 1W4VA 2H6YA 18GSA 1SJIA 3PPUA 5CNWA 5EPFA 4Z2UA 3GKKA 3I6AA 2A2RA 9GSSA 5E59A 3GNJA 2H72A 1MDKA 1QUWA 4TOPA 4MF6A 4DSQA 3ERWA 4J56E 1A2MA 4XIHA 5IMCA 4E8HA 1BX9A 3TJKA 3KMOA 5HFKA 4X0XA 2F8FA 4TR0A 4O7HA 1GSFA 5D96A 4XHMA 2XBIA 5IOXA 2MYGA 3KTLA 4XCSA 1GL8A 1JHBA 1JZWA 1VF2A 1Q4JA 4MNNA 1UVZA 2QGVA 1PX7A 5DJLA 3KJYA 2CAQA 1JFUA 1TK0B 2YWIA 1JZOA 2JZRA 4KH7A 1XWBA 4XS4B 1AAZA 1OAZA 2WFCA 1O73A 2C0GA 3GFKA 1SKRB 3NIVA 1EWXA 3KCMA 2PGTA 3WGXA 1I9DA 3APQA 3A3TA 3SWLA 3UJ1A 3BCIA 1XVWA 4FIWA 2MMZA 1LJRA 1QQ2A 2VCWA 1TRWA 3ZFLA 3FYGA 5IMZA 1VGLA 1GTBA 1SK2A 6GSTA 2HSHA 4TW5A 2FWEA 2R37A 1GTAA 3LYKA 3FZAA 3A2XA 2FHEA 3I69A 4ILFA 4OO5A 3GMFA 4N0VA 2IJYA 3A5WA 1S3DA 2K8VA 5B8AA 5COHA 2VLTA 4IW9A 4JE1A 3HKRA 1EGRA 4BVXB 3RDWA 1DUGA 1EEMA 4MP4A 4ZILA 2YNXA 5JWRB 3IK7A 3LXTA 4IHUA 1K0NA 1T1VA 12GSA 1ZL9A 4ID0A 1GSSA 2HSMA 4OCEA 1O85A 4QQ7A 3GH9A 3ZRDA 1SD9A 2B7KA 4O5RA 4KDXA 1GUKA 3J7Yb 5D73A 1KBNA 2XC2A 5IMFA 4LL4B 4BVXA 2GLRA 1QFNA 2PVOC 2GSTA 4TR4A 3UIWA 1XWKA 4L0UA 4GSTA 5J4UA 3APSA 4MMMA 4Q5FA 1PA3A 1ML6A 5GAPD 2H70A 1Z7RA 3FHKA 1GNEA 3GA4A 3HA9A 4DSRA 1U3IA 2VLVA 4ZXGA 2JZTA 3M1GA 2PU9C 2QA1A 4GF0A 5AISA 4RI6A 4ZBBA 1FAAA 4WEYA 1QGVA 1X9WB 2A2PA 2PN8A 5EVOA 5HQPA 3F4RA 4TR3A 4JZQA 2C3NA 3TRQA 2H01A 3Q19A 3VPQA 2CVKA 2EC4A 2A4VA 2I81A 4G19A 3FY7A 2Z9SA 1KNGA 3L0HA 3EYTA 3HZ8A 3KZQA 1B4QA 2JSYA 1SL0B 2VCTA 4V2NA 3E9JB 2QC7A 5DDLA 4K5RA 3EMXA 2FWFA 1H4OA 3ISOA 2PWJA 1J0FA 4JR4A 3ZYWA 1TW9A 5ECIB 2R5GA 3HDCA 4I97A 2H30A 3FR6A 4IELA 3H4KA 4I6XA 3ME7A 1Z5YE 1V9WA 3KH7A 3G7JA 2HYXA 3LXZA 4KNDA 3A5IA 2HNLA 2OE0A 3IE3A 1EOGA 2KUCA 4E8EA 1EEJA 1TI1A 4OFMA 2QSIA 4LL1B 4DVCA 6GSUA 4YQVA 1GUMA 4KCEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KHP A;  4TVE A;  1SL1 B;  4L0W A;  2VCZ A;  5GSS A;  5L71 A;  5DAK B;  2HLS A;  1B48 A;  2K18 A;  3UVH A;  4MZW A;  3JCM L;  3BJ5 A;  2VUP A;  3CYN A;  1FW1 A;  1MD3 A;  5ECO B;  2E7P A;  3ZRE A;  2RM5 A;  4KDU A;  5CO3 A;  2H6X A;  5ID2 B;  5KN3 A;  1V2A A;  1VF1 A;  2YZU A;  3VWU A;  1RW1 A;  1RQM A;  2JZS A;  1XOA A;  1WPI A;  1VRS D;  2LNS A;  1PQN A;  4HDE A;  3QOU A;  3Q18 A;  2ALB A;  1A23 A;  2M80 A;  2LKU A;  2ON5 A;  4MLY A;  4K7I A;  1RK4 A;  1OE8 A;  1Z3E A;  2FNO A;  4KSM A;  5CRH A;  1FVK A;  2GDR A;  1XW6 A;  1WJK A;  1S3A A;  5ID2 A;  5H5Q A;  4K1F A;  1LU4 A;  1NHO A;  5F06 A;  4QL7 A;  3IR4 A;  4LA1 A;  4YQM A;  3GUR A;  1O81 A;  2CX4 A;  2VL2 C;  4MH3 A;  3KMN A;  1M7T A;  5CAX A;  4TXO B;  4IKH A;  2HRN A;  1USB A;  2V41 A;  1IYH A;  2FD3 A;  3DXB A;  4HOJ A;  1GLP A;  5CYY A;  3HVV A;  2VOC A;  1DSB A;  1ZZY A;  4AJ7 A;  2GVP A;  3HZ4 A;  2R3X A;  5A5K A;  1BJX A;  2C0D A;  1TKD B;  13GS A;  2GQM A;  1G7O A;  1GSU A;  3PIN A;  1FB0 A;  1B9Y C;  1H75 A;  1U6T A;  2X99 A;  4K0N A;  2CX3 A;  1EV9 A;  1T7P B;  3R2Q A;  3QAV A;  4KGI A;  2PUK C;  2YJH A;  3VUR A;  1ZGN A;  2JAD A;  4NAX A;  2GT6 A;  1BYE A;  3PR8 A;  2OAC A;  1SD8 A;  3TKP A;  2GTU A;  3UL3 A;  1THO A;  1W89 A;  3GYK A;  1HNB A;  4MDC A;  3FZ5 A;  3F4T A;  3CSJ A;  2FWG A;  8GSS A;  3ZFB A;  5AGY A;  1WOU A;  1SK0 A;  4J2F A;  17GS A;  5IMV A;  2GT5 A;  3MNG A;  4KCA A;  3U5R E;  4L8E A;  4V2M A;  5C04 A;  3TJJ A;  3GV1 A;  2DJK A;  2V32 A;  2F8A A;  3RHC A;  3CRT A;  7GSS A;  3TOU A;  2GQK A;  5B6N A;  3HHV A;  3HJO A;  4Q5Q A;  4RUV A;  5A4V A;  3IC4 A;  4NPB A;  5CRD A;  2NPB A;  5CRW A;  5F07 A;  4MA9 A;  3KP8 A;  4MZB A;  1YJ6 A;  1XXU A;  4GCI A;  4AGS A;  4V1A g;  2L6C A;  3C7M A;  5JCW A;  2B5E A;  3E0U A;  3TKR A;  2PVQ A;  4HI7 A;  1WRY A;  3F4S A;  1GSE A;  3VPT A;  1OKD A;  2CVD A;  3N5O A;  2ZUP A;  1SK1 A;  1U87 A;  3S9F A;  2D2Z A;  2LNT A;  3LYP A;  3DKS A;  3D22 A;  2HI7 A;  2IMK A;  2I9H A;  4ZIJ A;  1SKW B;  3IAM 2;  3QDN A;  3D4T A;  3ZTL A;  1K0D A;  2TRC P;  4XRA A;  2K9F A;  2L57 A;  4HJM A;  1GSQ A;  4EDY A;  3ME8 A;  4RI7 A;  4LMW A;  3UBK A;  4GTU A;  1CQG A;  1YKA A;  4ML1 A;  2B3S A;  4FYB A;  2K8S A;  3QPM A;  2XPE A;  3UEM A;  1UA5 A;  5IO2 A;  1K0O A;  2BTO T;  3FEU A;  3TJF A;  1MTC A;  3NZN A;  3KTB A;  3W8J A;  10GS A;  4MPG A;  3M9K A;  1AC1 A;  1VF4 A;  1NSW A;  2B5X A;  4WBJ A;  2DBC A;  5J9C A;  4IVF A;  4KA0 A;  3H1N A;  2MZC A;  3MAK A;  4ZB8 A;  3GTU A;  4IP1 A;  2X64 A;  2YWO A;  1G7E A;  1XW9 A;  3LOR A;  3GUS A;  3LQ7 A;  4KE3 A;  3QR6 A;  3UVT A;  2X8C A;  1XW5 A;  2REM A;  4N30 A;  2GZZ A;  1R26 A;  1Z6N A;  4H86 A;  3TKS C;  3VWX A;  5D9X A;  1Y25 A;  3IV4 A;  1X9M B;  1XPV A;  4JRR A;  5G1K A;  5IMA A;  3WD6 A;  1C72 A;  2WUL A;  5ELA A;  2HFD A;  1O8X A;  1SYR A;  3N9J A;  2WB9 A;  4BPY A;  1ERT A;  3GX0 A;  3VI7 A;  4HQS A;  3G9B A;  3M3M A;  3GIX A;  2N5B A;  2KLX A;  2R2J A;  2HT9 A;  2V1M A;  4OFN A;  1GSY A;  3CSI A;  4QL9 A;  4HS1 A;  1R5P A;  3IAS 2;  1EP7 A;  4Q5R A;  4ZL7 A;  3IHQ A;  5FT3 A;  3ZIJ A;  4YAV A;  2B5Y A;  1XCC A;  3ZZX A;  5HR1 A;  2YOI A;  4J57 E;  2DJ2 A;  4JR6 A;  3GH6 A;  2R4V A;  5DJM A;  2PMT A;  1XFL A;  2GZY A;  2FUG 2;  2F9S A;  4TKY A;  1QMV A;  2IMI A;  3PGT A;  2C4J A;  4XS4 A;  3ZIV A;  1HNC A;  2OA7 A;  3W8S A;  2L4Q A;  3C1S A;  2CQ9 A;  3ZVJ A;  1R5A A;  2VL9 A;  4TN8 A;  20GS A;  5KN0 A;  5AN1 A;  4POB A;  1GRX A;  3F3R A;  4NHW A;  2AJQ B;  1X9S B;  1PMT A;  3TRX A;  1R4W A;  2H0G A;  3HY2 A;  4NWY A;  4AF2 A;  3FKF A;  1OC9 B;  1SKS B;  4MF5 A;  1YDK A;  4IQA A;  1AW9 A;  3EIN A;  1XIY A;  3MWH A;  1XBS A;  1ST9 A;  1FB6 A;  1J9B A;  3HXS A;  1NHY A;  4MK3 A;  4LLR A;  4PNG A;  2OKA A;  1YEP A;  3QAG A;  1X0R A;  1FOV A;  1TI3 A;  5J41 A;  1ZMA A;  1T4Z A;  1F3B A;  5G30 A;  2VCX A;  1PSQ A;  5B7C A;  1A0F A;  3QFA C;  4N10 A;  3EC3 A;  4XTS A;  2IIY A;  2WZ9 A;  1Z7P A;  3TUE A;  3VWV A;  2IN3 A;  4I8B A;  3U6V A;  5IIZ A;  4YQU A;  2HRF A;  5DQY A;  4HU7 A;  1G0T A;  3ED3 A;  3IXR A;  4RQR A;  5EL8 A;  3GRX A;  1TK5 B;  4F2I A;  2C3Q A;  3NOF A;  3LEF A;  2B7J A;  2CVB A;  1E2Y A;  3TJB A;  1XWA A;  1YEX A;  5DCH A;  1TRV A;  5ECK B;  1K3O A;  1WIK A;  4F0C A;  5G1L A;  2GGT A;  5HR3 A;  1TU8 A;  3CRU A;  4ZL8 A;  5A4W A;  4IP6 A;  1XWC A;  3RPP A;  3VLN A;  3FRC A;  3EU4 A;  3KM6 A;  3FW2 A;  2H76 A;  1VF3 A;  3M9J A;  3O76 A;  3QFB C;  4BA7 A;  3GHA A;  1A2L A;  2E0Q A;  1EP8 A;  5JWQ B;  4F9Z A;  4CW9 A;  2B1K A;  4IJ3 A;  1A24 A;  2O8V B;  4ECB A;  4WET A;  4OCF A;  4IS0 A;  3CBU A;  2H1G A;  5D93 A;  5GAN D;  1WE0 A;  1OKT A;  3AY8 A;  3KEB A;  2DJ0 A;  2LV3 A;  4TR1 B;  1SEN A;  1MD4 A;  4PUF C;  5G2Z A;  4EKZ A;  2PPT A;  2MMN A;  5DAL B;  3KGK A;  3FR3 A;  1G6Y A;  3HYP A;  2R6K A;  3IBH A;  3GL5 A;  4PX1 A;  1ERW A;  2O7K A;  4D73 B;  1THX A;  11GS A;  1T8E B;  2OAD A;  3L9U A;  2V6O A;  4POM A;  1ABA A;  1M2D A;  4WBR D;  1PRX A;  4GLT A;  4GXZ A;  4EL1 A;  1ERV A;  2RII A;  4TR1 A;  4HJ2 A;  2FCH A;  1TXX A;  1K3L A;  2N5A A;  5LD0 A;  3UOM A;  4EVM A;  3RPN A;  6GSS A;  3MSZ A;  3DIE A;  4F82 A;  4F0B A;  1JZD A;  2H6Z A;  3A2W A;  1V98 A;  5ECN B;  5KN1 A;  4OD7 A;  4JU5 A;  1TP9 A;  2WJU A;  5DAK A;  1GLQ A;  1GUL A;  4ZL9 A;  22GS A;  1AQW A;  3KD0 A;  5INY A;  1TOF A;  3F8U A;  1MEK A;  3EE2 A;  4WXT A;  1K0C A;  2EIR A;  1AQV A;  5CP1 A;  2IFQ B;  3EWL A;  2DSA A;  1XOB A;  3FK8 A;  3DYR A;  1M9A A;  1V40 A;  3LSZ A;  2JSZ A;  1MDI A;  2F51 A;  2H1A A;  1JLW A;  1S3C A;  3CTG A;  2DC5 A;  1XVQ A;  4ZB6 A;  2QKE A;  3FZ4 A;  1TDI A;  2HZF A;  5IOW A;  3DD3 A;  4HUA A;  2I4A A;  3F0I A;  4G10 A;  5HR2 A;  2L6D A;  3GST A;  2IFQ A;  2AV4 A;  4PGT A;  4DSS B;  2HZE B;  4I2T A;  1ZYE A;  4TXO A;  4WR4 A;  2LQQ A;  4OWY A;  3FZ9 A;  2CT6 A;  5IMD A;  3G7Y A;  3KH9 A;  1FO5 A;  2GZP A;  5G5E A;  2XBQ A;  4KDY A;  2GS3 A;  3Q74 A;  5HFI A;  3PH9 A;  5J3R A;  4K8M A;  2B6M A;  4IQ1 A;  3D5J A;  2KP1 A;  5LNK e;  3H8Q A;  1YF0 A;  5GST A;  3HCZ A;  3D6I A;  4BVY A;  3IA1 A;  3O6T A;  4N0Z A;  5A4U A;  3LJR A;  2LST A;  1Z6M A;  2L4C A;  3HVX A;  1EZK A;  4ZBD A;  2MMO A;  3F3Q A;  1EOH A;  2B1L A;  5B8B A;  1DE2 A;  5DQS A;  5ABR A;  2DMM A;  4GSN A;  2LRC A;  2GSR A;  2YV7 A;  4EDZ A;  1YY7 A;  2C8U A;  2VL3 A;  3VFI A;  4EC0 A;  6GSX A;  4V2L A;  1EGO A;  1SJZ A;  5HFG A;  3E3E A;  5ECS A;  1I5G A;  2H71 A;  3TRP A;  3DVW A;  3UMA A;  1F37 A;  2JU5 A;  4TRX A;  2OE1 A;  4HQZ A;  2LRT A;  4OMV A;  4TXV A;  3DML A;  5G31 A;  1KTE A;  2YWN A;  3ZIT A;  2C80 A;  4ZBA A;  3IPZ A;  1SJ6 A;  1FHE A;  5JCU A;  5E4W A;  5F8B A;  3P8W A;  4ECI A;  1GSD A;  4Q5N A;  3L9S A;  1R7H A;  3GL3 A;  4MJB A;  3F9U A;  1EV4 A;  1K3Y A;  4FO5 A;  1Y6E A;  1OE7 A;  2CV4 A;  1PKZ A;  1K0B A;  1K0A A;  4G2E A;  3I43 A;  1ON4 A;  2KP2 A;  4ECC A;  3WYW A;  1HD2 A;  3L4N A;  2C0E A;  5DVB A;  1YQ1 A;  5DBQ A;  4BL7 A;  1JZR A;  1B9X C;  2L5L A;  1HQO A;  1PL1 A;  1T4Y A;  3TGZ A;  1ZOF A;  2KOK A;  1UN2 A;  1WMJ A;  1O8W A;  4YH2 A;  4PUA A;  5H5S A;  1V57 A;  1OC3 A;  2VD0 A;  1GWC A;  1KEB A;  2O85 A;  4BWQ A;  1Z9H A;  3CTF A;  1SYX A;  1PD2 1;  1T00 A;  1O7U A;  2L5O A;  4EE0 A;  3GN3 A;  3LFL A;  1WWJ A;  1X5C A;  1A0R P;  1SU9 A;  2K6V A;  1M99 A;  2IMF A;  1B4P A;  4K7O A;  1ILO A;  4JBB A;  3ZL5 A;  4K6X A;  2H8L A;  4HZ4 A;  3KIJ A;  1GTU A;  5D9T A;  1PL2 A;  3EVI A;  3GX8 A;  3IOS A;  3C1R A;  2FY6 A;  4L5O A;  2RLI A;  4OO4 A;  3IK9 A;  1K0M A;  2DIY A;  14GS A;  5LCZ A;  2AB6 A;  1YF1 A;  5IM9 A;  5F05 A;  2FWH A;  1PGT A;  3RBT A;  4KAE A;  5DCG A;  4KB3 A;  5D9W A;  1M2A A;  5AIX A;  2IWT A;  4XS1 A;  2ZNM A;  3ZMK A;  2HXK A;  1ERU A;  5JWO B;  4ML6 A;  1N8J A;  3V1W A;  1G6W A;  5AIV A;  1MDJ A;  1OYJ A;  3A2V A;  2XHF A;  1GUH A;  1AIU A;  5GZZ B;  3HJP A;  2HE3 A;  4PNF A;  2H73 A;  4NV2 A;  3UAP A;  3D0Z A;  3P90 A;  1V58 A;  4GQC A;  3F6D A;  3G7I A;  4GSS A;  4IN0 A;  1M0U A;  3EU3 A;  2OJL A;  2MMA A;  2VAF A;  2H1D A;  3MDK A;  3QMX A;  2H0H A;  1AUC A;  5KEJ A;  4ULX A;  2ZCT A;  3TKS A;  3RAZ A;  2E2M A;  2A2S A;  4K9Z A;  2WS2 A;  5IPH A;  3H79 A;  4IGJ A;  2CZ3 A;  1X5E A;  2WGR A;  2JAC A;  4MJA A;  1E6B A;  4HZ2 A;  1F6M C;  2MBT A;  1TRU A;  4RQX A;  4KUN A;  2VIM A;  4DEJ A;  4CDO A;  1B8X A;  1TJD A;  1F2E A;  4I5Q A;  2VM1 A;  4MH2 A;  3IRA A;  3BD2 A;  5B6M A;  2YV9 A;  4CHS A;  1OC9 A;  3WGE A;  2RUE A;  4EF0 A;  1O6J A;  3C8E A;  2H1B A;  2E2G A;  4NXI A;  4HEA 2;  5ECQ B;  3LWA A;  5IQY A;  2L59 A;  2VO4 A;  3ERF A;  2MBS A;  3ERG A;  3LG6 A;  4YAP A;  2V2G A;  2NVL A;  2O89 A;  2JL4 A;  3DWV A;  2FLS A;  3KP9 A;  4NHZ A;  2LS5 A;  1TRS A;  3BOA A;  2H74 A;  5IO0 A;  16GS A;  4POK A;  1URM A;  1JLV A;  3VWW A;  4PUR A;  4MJE A;  5D9V A;  4P3Y B;  3VI5 A;  2C0F A;  3ZML A;  3FR9 A;  3P2A A;  1AXD A;  4AJ8 A;  1PKW A;  2IL3 A;  1A8Y A;  1SL2 B;  3GKN A;  5JCG A;  2YZH A;  2DLX A;  4MZC A;  4EUY A;  2WCI A;  2V6K A;  5ECH B;  2LQO A;  4NV5 A;  3D21 A;  3LGC A;  4IBP A;  4GRF A;  4X43 A;  1DE1 A;  1GTI A;  4MJC A;  1TTZ A;  2AYT A;  4KSO A;  2DJJ A;  3EMP A;  2J9H A;  2M72 A;  2TIR A;  5FHI A;  2VCQ A;  4KW6 A;  1ZYQ B;  2GSQ A;  2LRN A;  4KX4 A;  4XRD A;  1QXH A;  6GSW A;  5KN2 A;  1M2B A;  1N2A A;  3TKQ A;  2P5Q A;  2F3M A;  4FH8 A;  1QK8 A;  4PQH A;  4LMV A;  1NM3 A;  1T3B A;  5C00 A;  2FGX A;  2RM6 A;  1BG5 A;  2NBS A;  5J5N A;  3IDV A;  2AHE A;  2P31 A;  4ISD A;  1GH2 A;  5ECL B;  1PN9 A;  4O92 A;  4PXO A;  5IPG A;  3UBL A;  1U88 A;  3W6G A;  3DEX A;  4FYC A;  3DRN A;  2I1U A;  5ECP B;  2TRX A;  3M0F A;  5ECR B;  4WF4 A;  2AUV A;  3CXG A;  2PBJ A;  3M8N A;  3QCP A;  5G5F A;  1FVJ A;  3P7X A;  2DML A;  3J7Y k;  3CMI A;  2BMX A;  4MCU A;  3HVS A;  3L9V A;  3BBY A;  1U3A A;  5ENU A;  2EIO A;  2N5F A;  3TDG A;  5DAL A;  4JED A;  2LJK A;  5D8I A;  2DJ3 A;  2I3Y A;  4XS6 A;  2ON7 A;  1TU7 A;  1F3A A;  19GS A;  4D73 A;  3Q6O A;  3VK9 A;  2H19 A;  2LJR A;  2CAI A;  2FA8 A;  4NMU A;  2LEG A;  3QD9 A;  1BAY A;  1CQH A;  4Z7X A;  2ES7 A;  3GKM A;  1M9B A;  4HU9 A;  1GNW A;  3QAW A;  3I9V 2;  2NTO A;  3C73 A;  3US3 A;  2LTK A;  2P5R A;  1J08 A;  2HSY A;  1BED A;  5ECM B;  2X8G A;  1FG4 A;  1DBY A;  4G9H A;  3WT1 A;  4K0G A;  1YKC A;  5ELG A;  5HR0 A;  3H93 A;  1WP0 A;  2WDU A;  2GSS A;  3UAR A;  5F0G A;  3RHB A;  2NDO A;  3TJG A;  2YJ7 A;  1XZO A;  3ZVJ D;  2IMD A;  1YZX A;  1BQ7 A;  1HNA A;  3F63 A;  4FYU A;  2YCD A;  5J9B A;  3WT2 A;  3DVX A;  1GP1 A;  1ZCP A;  3APO A;  3OR5 A;  3D4M A;  2BJX A;  3L78 A;  1X5D A;  4OFT A;  2IME A;  2DIZ A;  1A8L A;  4N11 A;  2VLU A;  2YN1 A;  2C3T A;  3BCK A;  2YAN A;  4POL A;  2XPD A;  2H0I A;  4DSS A;  2LJA A;  3F6F A;  4ZB9 A;  2HZE A;  1LBK A;  3HD5 A;  4EO3 A;  1AQX A;  4GWR A;  2RUF A;  2VL2 A;  4I2U A;  3TKS E;  3DGQ A;  4ECJ A;  2G2Q A;  2WRT A;  3KXO A;  4MF7 A;  3HJM A;  2DJ1 A;  2X8H A;  2YPM A;  4L5L A;  4K7N A;  1ACV A;  3TB2 A;  1Q98 A;  1HYU A;  4EXJ A;  4O32 A;  2OE3 A;  5EY6 A;  2CA8 A;  1TK8 B;  2G0F A;  2H75 A;  2VM2 A;  2OBI A;  2C1Y A;  3GSS A;  4WF5 A;  2PER A;  2CZ2 A;  2GQL A;  5H5R A;  4K2D A;  6GSY A;  4IJI A;  4GQF A;  4BWS A;  3EUR A;  2M46 A;  3CSH A;  3WGD A;  3ZLP A;  2OBK A;  4AJ6 A;  6GSV A;  1OVN A;  5CRE A;  2O87 A;  1UC7 A;  3SBC A;  2IPA A;  1XWG A;  2YP6 A;  1PX6 A;  1OC8 A;  5CRG A;  2H66 A;  2LUS A;  3TOT A;  1NW2 A;  4ACS A;  2YWM A;  2J23 A;  1A2J A;  4X1U A;  3C71 A;  2EIQ A;  1IYI A;  4WR5 A;  2AAW A;  2P0G A;  3GKX A;  4PQI A;  2VCV A;  4WKW A;  4F03 A;  3GTU B;  3TCO A;  2FA4 A;  4V1A p;  4PQ1 A;  5FWG A;  3O3T A;  1F9M A;  2VD1 A;  4MPF A;  4MAB A;  3K8N A;  1W4V A;  2H6Y A;  18GS A;  1SJI A;  5CNW A;  5EPF A;  3GKK A;  3I6A A;  2A2R A;  9GSS A;  5E59 A;  3GNJ A;  2H72 A;  1MDK A;  1QUW A;  4TOP A;  4MF6 A;  4DSQ A;  3ERW A;  4J56 E;  1A2M A;  4XIH A;  5IMC A;  4E8H A;  1BX9 A;  3TJK A;  3KMO A;  5HFK A;  4X0X A;  2F8F A;  4TR0 A;  4O7H A;  1GSF A;  5D96 A;  4XHM A;  2XBI A;  5IOX A;  2MYG A;  3KTL A;  4XCS A;  1GL8 A;  1JHB A;  1JZW A;  1VF2 A;  1Q4J A;  1UVZ A;  2QGV A;  1PX7 A;  5DJL A;  3KJY A;  2CAQ A;  1JFU A;  1TK0 B;  2YWI A;  1JZO A;  2JZR A;  4KH7 A;  1XWB A;  4XS4 B;  1AAZ A;  1OAZ A;  2WFC A;  1O73 A;  2C0G A;  3GFK A;  1SKR B;  3NIV A;  1EWX A;  3KCM A;  2PGT A;  3WGX A;  1I9D A;  3APQ A;  3A3T A;  3SWL A;  3UJ1 A;  3BCI A;  1XVW A;  4FIW A;  2MMZ A;  1LJR A;  1QQ2 A;  2VCW A;  1TRW A;  3ZFL A;  3FYG A;  5IMZ A;  1VGL A;  1GTB A;  1SK2 A;  6GST A;  2HSH A;  4TW5 A;  2FWE A;  2R37 A;  1GTA A;  3LYK A;  3FZA A;  3A2X A;  2FHE A;  3I69 A;  4ILF A;  4OO5 A;  3GMF A;  4N0V A;  2IJY A;  3A5W A;  1S3D A;  2K8V A;  5B8A A;  5COH A;  2VLT A;  4IW9 A;  4JE1 A;  3HKR A;  1EGR A;  3RDW A;  1DUG A;  1EEM A;  4MP4 A;  4ZIL A;  2YNX A;  5JWR B;  3IK7 A;  3LXT A;  4IHU A;  1K0N A;  1T1V A;  12GS A;  1ZL9 A;  4ID0 A;  1GSS A;  4OCE A;  1O85 A;  4QQ7 A;  3GH9 A;  3ZRD A;  1SD9 A;  2B7K A;  4O5R A;  4KDX A;  1GUK A;  3J7Y b;  5D73 A;  1KBN A;  2XC2 A;  5IMF A;  4LL4 B;  4BVX A;  2GLR A;  1QFN A;  2PVO C;  2GST A;  4TR4 A;  3UIW A;  1XWK A;  4L0U A;  4GST A;  5J4U A;  3APS A;  4MMM A;  4Q5F A;  1PA3 A;  1ML6 A;  5GAP D;  2H70 A;  1Z7R A;  3FHK A;  1GNE A;  3GA4 A;  3HA9 A;  4DSR A;  1U3I A;  2VLV A;  4ZXG A;  2JZT A;  3M1G A;  2PU9 C;  4GF0 A;  5AIS A;  4RI6 A;  4ZBB A;  1FAA A;  4WEY A;  1QGV A;  1X9W B;  2PN8 A;  5EVO A;  5HQP A;  3F4R A;  4TR3 A;  4JZQ A;  2C3N A;  3TRQ A;  2H01 A;  3Q19 A;  3VPQ A;  2CVK A;  2EC4 A;  2A4V A;  2I81 A;  4G19 A;  3FY7 A;  2Z9S A;  1KNG A;  3L0H A;  3EYT A;  3HZ8 A;  3KZQ A;  1B4Q A;  2JSY A;  1SL0 B;  2VCT A;  4V2N A;  3E9J B;  2QC7 A;  5DDL A;  3EMX A;  2FWF A;  1H4O A;  3ISO A;  2PWJ A;  1J0F A;  4JR4 A;  3ZYW A;  1TW9 A;  5ECI B;  2R5G A;  3HDC A;  4I97 A;  2H30 A;  3FR6 A;  4IEL A;  3H4K A;  4I6X A;  3ME7 A;  1Z5Y E;  1V9W A;  3KH7 A;  3G7J A;  2HYX A;  3LXZ A;  4KND A;  2HNL A;  2OE0 A;  3IE3 A;  1EOG A;  2KUC A;  4E8E A;  1EEJ A;  1TI1 A;  4OFM A;  2QSI A;  4LL1 B;  4DVC A;  6GSU A;  4YQV A;  1GUM A;  4KCE A; 
#chains in the Genus database with same CATH topology
 2KHP A;  4TVE A;  1SL1 B;  4L0W A;  2VCZ A;  5GSS A;  5L71 A;  5DAK B;  2HLS A;  1B48 A;  2K18 A;  3UVH A;  4MZW A;  3JCM L;  3BJ5 A;  2VUP A;  3CYN A;  1FW1 A;  1MD3 A;  5ECO B;  2E7P A;  3ZRE A;  2RM5 A;  4KDU A;  5CO3 A;  2H6X A;  3IHG A;  5ID2 B;  5KN3 A;  1V2A A;  1VF1 A;  2YZU A;  3VWU A;  1RW1 A;  1RQM A;  2JZS A;  1XOA A;  1WPI A;  1VRS D;  4BIK A;  2LNS A;  1PQN A;  4HDE A;  3R3E A;  3QOU A;  3Q18 A;  2ALB A;  1A23 A;  2M80 A;  2LKU A;  2ON5 A;  4MLY A;  4K7I A;  1RK4 A;  1OE8 A;  1Z3E A;  2FNO A;  4KSM A;  5CRH A;  1FVK A;  1PN0 A;  2GDR A;  1XW6 A;  1WJK A;  1S3A A;  5ID2 A;  5H5Q A;  4K1F A;  1LU4 A;  1NHO A;  5F06 A;  4QL7 A;  3IR4 A;  4LA1 A;  4YQM A;  3GUR A;  1O81 A;  2CX4 A;  2VL2 C;  4MH3 A;  3KMN A;  1M7T A;  5CAX A;  4TXO B;  4IKH A;  2HRN A;  1USB A;  2V41 A;  1IYH A;  2FD3 A;  3DXB A;  4HOJ A;  1GLP A;  4HSC X;  5CYY A;  3HVV A;  2VOC A;  1DSB A;  1ZZY A;  4AJ7 A;  4Z2T A;  2GVP A;  3HZ4 A;  2R3X A;  4CY6 A;  5A5K A;  1BJX A;  2DKI A;  2C0D A;  1TKD B;  13GS A;  2GQM A;  1G7O A;  1GSU A;  3PIN A;  1FB0 A;  4BVY B;  1B9Y C;  1H75 A;  1U6T A;  2X99 A;  4K0N A;  2CX3 A;  1EV9 A;  1T7P B;  3R2Q A;  3QAV A;  4KGI A;  2PUK C;  2YJH A;  3VUR A;  1ZGN A;  2JAD A;  4NAX A;  2GT6 A;  1BYE A;  3PR8 A;  2OAC A;  1SD8 A;  3TKP A;  2GTU A;  2X4A A;  3UL3 A;  4A5P A;  1THO A;  1W89 A;  3GYK A;  1HNB A;  4MDC A;  3FZ5 A;  3F4T A;  3CSJ A;  2FWG A;  8GSS A;  3ZFB A;  5AGY A;  1WOU A;  1SK0 A;  4J2F A;  17GS A;  5IMV A;  2GT5 A;  3MNG A;  4KCA A;  3U5R E;  4L8E A;  4V2M A;  5C04 A;  3TJJ A;  3GV1 A;  2DJK A;  2V32 A;  2F8A A;  3RHC A;  5KOW A;  3CRT A;  7GSS A;  3TOU A;  2GQK A;  5B6N A;  3LW9 A;  3HHV A;  3HJO A;  4Q5Q A;  4RUV A;  5A4V A;  3IC4 A;  4NPB A;  5CRD A;  2NPB A;  5CRW A;  5F07 A;  4MA9 A;  3KP8 A;  4MZB A;  1YJ6 A;  1XXU A;  4GCI A;  4AGS A;  4V1A g;  2L6C A;  3C7M A;  5JCW A;  2B5E A;  3E0U A;  3TKR A;  2PVQ A;  4HI7 A;  1WRY A;  3F4S A;  1GSE A;  3VPT A;  1OKD A;  2CVD A;  3N5O A;  2ZUP A;  4KF9 A;  1SK1 A;  1U87 A;  3S9F A;  2D2Z A;  2LNT A;  3LYP A;  3DKS A;  3D22 A;  2HI7 A;  4K2X A;  2IMK A;  2I9H A;  4ZIJ A;  1SKW B;  3IAM 2;  3QDN A;  3D4T A;  3ZTL A;  1K0D A;  2TRC P;  4XRA A;  2K9F A;  2L57 A;  4HJM A;  1GSQ A;  4EDY A;  3ME8 A;  4RI7 A;  4LMW A;  3UBK A;  4GTU A;  1CQG A;  1YKA A;  4ML1 A;  2B3S A;  4FYB A;  2K8S A;  3QPM A;  2XPE A;  3UEM A;  1UA5 A;  5IO2 A;  1K0O A;  2BTO T;  3FEU A;  3TJF A;  1MTC A;  2HRA A;  3NZN A;  3KTB A;  3W8J A;  10GS A;  4MPG A;  3M9K A;  1AC1 A;  1VF4 A;  1NSW A;  2B5X A;  4WBJ A;  2DBC A;  5J9C A;  4IVF A;  4KA0 A;  3H1N A;  2MZC A;  3MAK A;  4ZB8 A;  3GTU A;  4IP1 A;  2X64 A;  2YWO A;  1G7E A;  1XW9 A;  3LOR A;  3GUS A;  3LQ7 A;  4KE3 A;  3QR6 A;  3UVT A;  2X8C A;  1XW5 A;  2REM A;  4N30 A;  2GZZ A;  1R26 A;  1Z6N A;  4H86 A;  3TKS C;  3VWX A;  5D9X A;  1Y25 A;  2R0C A;  3IV4 A;  4K5S A;  1X9M B;  1XPV A;  4JRR A;  2X49 A;  5G1K A;  5IMA A;  3WD6 A;  1C72 A;  2WUL A;  5ELA A;  2HFD A;  1O8X A;  1SYR A;  3N9J A;  2WB9 A;  4BPY A;  1ERT A;  3GX0 A;  3VI7 A;  4HQS A;  3G9B A;  3M3M A;  3GIX A;  2N5B A;  2A4H A;  2KLX A;  2R2J A;  2HT9 A;  2V1M A;  4OFN A;  1GSY A;  3CSI A;  4QL9 A;  4HS1 A;  1R5P A;  3IAS 2;  1PFO A;  1EP7 A;  4Q5R A;  4ZL7 A;  3IHQ A;  5FT3 A;  3ZIJ A;  4YAV A;  2B5Y A;  1XCC A;  3ZZX A;  5HR1 A;  2YOI A;  4J57 E;  2DJ2 A;  4JR6 A;  3GH6 A;  2R4V A;  5DJM A;  2PMT A;  1XFL A;  2GZY A;  2FUG 2;  2F9S A;  4TKY A;  1QMV A;  2IMI A;  3PGT A;  2C4J A;  4XS4 A;  3ZIV A;  1HNC A;  2OA7 A;  3W8S A;  2L4Q A;  3C1S A;  2CQ9 A;  3ZVJ A;  1R5A A;  2VL9 A;  4TN8 A;  4G0L A;  20GS A;  5KN0 A;  5AN1 A;  4POB A;  1GRX A;  3F3R A;  4NHW A;  2AJQ B;  1X9S B;  1PMT A;  3TRX A;  1R4W A;  2H0G A;  3HY2 A;  4NWY A;  4AF2 A;  3FKF A;  1OC9 B;  1SKS B;  4MF5 A;  1YDK A;  1S3R A;  4IQA A;  1AW9 A;  3EIN A;  1XIY A;  3MWH A;  1XBS A;  1ST9 A;  1FB6 A;  1J9B A;  3HXS A;  1NHY A;  4MK3 A;  4LLR A;  4PNG A;  2OKA A;  1YEP A;  3QAG A;  1X0R A;  1FOV A;  1TI3 A;  3MYD A;  5J41 A;  1ZMA A;  1T4Z A;  4O5Q A;  1F3B A;  5G30 A;  2VCX A;  1PSQ A;  5B7C A;  1A0F A;  3QFA C;  4N10 A;  3EC3 A;  4XTS A;  5BMU A;  2IIY A;  2WZ9 A;  1Z7P A;  3TUE A;  3VWV A;  1M3I A;  2IN3 A;  4I8B A;  3U6V A;  5IIZ A;  4YQU A;  2HRF A;  5DQY A;  4HU7 A;  1G0T A;  3ED3 A;  3HVN A;  3IXR A;  4RQR A;  5EL8 A;  3GRX A;  1TK5 B;  4F2I A;  2C3Q A;  3NOF A;  3LEF A;  2B7J A;  2CVB A;  1E2Y A;  3TJB A;  1XWA A;  1YEX A;  5DCH A;  1TRV A;  5ECK B;  1K3O A;  1WIK A;  4F0C A;  5G1L A;  2GGT A;  5HR3 A;  1TU8 A;  3CRU A;  4ZL8 A;  5A4W A;  4IP6 A;  1XWC A;  3RPP A;  3VLN A;  3FRC A;  3EU4 A;  3KM6 A;  3FW2 A;  2H76 A;  1VF3 A;  3M9J A;  3O76 A;  3QFB C;  4BA7 A;  3GHA A;  1A2L A;  2E0Q A;  1EP8 A;  5JWQ B;  4F9Z A;  4CW9 A;  2B1K A;  4IJ3 A;  1A24 A;  2O8V B;  4ECB A;  4WET A;  4OCF A;  4IS0 A;  3CBU A;  2H1G A;  5D93 A;  5GAN D;  1WE0 A;  1OKT A;  3AY8 A;  3KEB A;  2DJ0 A;  2LV3 A;  4TR1 B;  1SEN A;  1MD4 A;  4PUF C;  5G2Z A;  4EKZ A;  2PPT A;  2MMN A;  5DAL B;  3KGK A;  3FR3 A;  1G6Y A;  3HYP A;  2R6K A;  3IBH A;  3GL5 A;  4PX1 A;  1ERW A;  2O7K A;  4D73 B;  1THX A;  11GS A;  1T8E B;  2OAD A;  3L9U A;  2V6O A;  4POM A;  1ABA A;  1M2D A;  4WBR D;  1PRX A;  4GLT A;  4GXZ A;  4EL1 A;  1ERV A;  2RII A;  4TR1 A;  4HJ2 A;  2FCH A;  1TXX A;  1K3L A;  2N5A A;  5LD0 A;  3UOM A;  4EVM A;  3RPN A;  6GSS A;  3MSZ A;  3DIE A;  4F82 A;  4F0B A;  1JZD A;  2H6Z A;  1FOH A;  3A2W A;  1V98 A;  5ECN B;  5KN1 A;  4USS A;  4OD7 A;  4JU5 A;  1TP9 A;  2WJU A;  5DAK A;  1GLQ A;  1GUL A;  4ZL9 A;  22GS A;  1AQW A;  3KD0 A;  5INY A;  1TOF A;  3F8U A;  1MEK A;  3EE2 A;  4WXT A;  1K0C A;  2EIR A;  1AQV A;  5CP1 A;  2IFQ B;  3EWL A;  2DSA A;  1XOB A;  3FK8 A;  3DYR A;  1M9A A;  1V40 A;  3LSZ A;  2JSZ A;  1MDI A;  2F51 A;  2H1A A;  1JLW A;  1S3C A;  3CTG A;  2DC5 A;  1XVQ A;  4ZB6 A;  2QKE A;  3FZ4 A;  1TDI A;  2HZF A;  5IOW A;  3DD3 A;  4HUA A;  2I4A A;  3F0I A;  4G10 A;  3MIX A;  5HR2 A;  2L6D A;  3GST A;  2IFQ A;  2AV4 A;  4PGT A;  4DSS B;  2HZE B;  4I2T A;  1ZYE A;  4TXO A;  4WR4 A;  2UZ8 A;  2LQQ A;  4OWY A;  3FZ9 A;  2CT6 A;  5IMD A;  3G7Y A;  3KH9 A;  1FO5 A;  2GZP A;  5G5E A;  2XBQ A;  4KDY A;  2GS3 A;  3Q74 A;  5HFI A;  3PH9 A;  5J3R A;  4K8M A;  2B6M A;  4IQ1 A;  3D5J A;  2KP1 A;  5LNK e;  3H8Q A;  1YF0 A;  5GST A;  3HCZ A;  3D6I A;  4BVY A;  3IA1 A;  3O6T A;  4N0Z A;  5A4U A;  3LJR A;  2LST A;  1Z6M A;  2L4C A;  3HVX A;  1EZK A;  4ZBD A;  2MMO A;  3F3Q A;  1EOH A;  2B1L A;  5B8B A;  1DE2 A;  5DQS A;  5ABR A;  2DMM A;  4GSN A;  2LRC A;  2GSR A;  2YV7 A;  4EDZ A;  1YY7 A;  2C8U A;  2VL3 A;  3VFI A;  4EC0 A;  6GSX A;  4V2L A;  1EGO A;  1SJZ A;  1ZYP A;  5HFG A;  3E3E A;  5ECS A;  1I5G A;  2H71 A;  3TRP A;  3DVW A;  3UMA A;  1F37 A;  2JU5 A;  4TRX A;  4BL7 B;  2OE1 A;  4HQZ A;  2LRT A;  4O5U A;  4OMV A;  4TXV A;  3DML A;  5G31 A;  1KTE A;  2YWN A;  3ZIT A;  2C80 A;  4ZBA A;  3IPZ A;  1SJ6 A;  1FHE A;  5JCU A;  5E4W A;  5F8B A;  3P8W A;  4YKF A;  1GSD A;  4ECI A;  4Q5N A;  3L9S A;  1R7H A;  3GL3 A;  4MJB A;  3F9U A;  1EV4 A;  1K3Y A;  4FO5 A;  1Y6E A;  1OE7 A;  2CV4 A;  1PKZ A;  1K0B A;  2DKH A;  1K0A A;  4G2E A;  3I43 A;  1ON4 A;  2KP2 A;  4ECC A;  3WYW A;  1HD2 A;  3L4N A;  2C0E A;  5DVB A;  1YQ1 A;  5DBQ A;  4BL7 A;  1JZR A;  1B9X C;  2L5L A;  1HQO A;  1PL1 A;  1T4Y A;  3TGZ A;  1ZOF A;  2HRK A;  2KOK A;  1UN2 A;  1WMJ A;  1O8W A;  4YH2 A;  4PUA A;  5H5S A;  1V57 A;  1OC3 A;  2VD0 A;  1GWC A;  1KEB A;  2O85 A;  4BWQ A;  1Z9H A;  3CTF A;  1SYX A;  1PD2 1;  1T00 A;  1O7U A;  2L5O A;  4EE0 A;  3GN3 A;  3LFL A;  4YKG A;  1WWJ A;  1X5C A;  1A0R P;  1SU9 A;  2K6V A;  1M99 A;  2IMF A;  1B4P A;  4K7O A;  1ILO A;  4JBB A;  3ZL5 A;  4K6X A;  2H8L A;  4HZ4 A;  3KIJ A;  1GTU A;  5D9T A;  1PL2 A;  3EVI A;  3GX8 A;  3IOS A;  3C1R A;  2FY6 A;  4L5O A;  2RLI A;  4OO4 A;  3IK9 A;  1K0M A;  2DIY A;  14GS A;  5LCZ A;  2AB6 A;  1YF1 A;  5IM9 A;  5F05 A;  2FWH A;  1PGT A;  3RBT A;  4KAE A;  5DCG A;  4KB3 A;  5D9W A;  1M2A A;  5AIX A;  2IWT A;  4XS1 A;  2ZNM A;  3ZMK A;  2HXK A;  1ERU A;  5JWO B;  4ML6 A;  1N8J A;  3V1W A;  1G6W A;  5AIV A;  1MDJ A;  1OYJ A;  3A2V A;  2XHF A;  1GUH A;  1AIU A;  5GZZ B;  3HJP A;  2HE3 A;  4PNF A;  2H73 A;  4NV2 A;  3UAP A;  3D0Z A;  3P90 A;  1V58 A;  4GQC A;  3F6D A;  3G7I A;  4GSS A;  4IN0 A;  1M0U A;  3EU3 A;  2OJL A;  2MMA A;  2VAF A;  3CQF A;  2H1D A;  3MDK A;  3QMX A;  2H0H A;  1AUC A;  3IC8 A;  5KEJ A;  4ULX A;  2ZCT A;  3TKS A;  3RAZ A;  2E2M A;  2A2S A;  4K9Z A;  2WS2 A;  5IPH A;  3H79 A;  4IGJ A;  2CZ3 A;  1X5E A;  2WGR A;  2JAC A;  4MJA A;  1E6B A;  4HZ2 A;  1F6M C;  2MBT A;  1TRU A;  4RQX A;  4KUN A;  2VIM A;  4DEJ A;  4CDO A;  1B8X A;  1TJD A;  1F2E A;  4I5Q A;  2VM1 A;  4MH2 A;  3IRA A;  3BD2 A;  5B6M A;  3FMW A;  2YV9 A;  4CHS A;  1OC9 A;  3WGE A;  2RUE A;  4EF0 A;  1O6J A;  3C8E A;  2H1B A;  2E2G A;  4NXI A;  4HEA 2;  5ECQ B;  3LWA A;  5IQY A;  2L59 A;  2VO4 A;  3ERF A;  2MBS A;  3ERG A;  3LG6 A;  4YAP A;  2V2G A;  2NVL A;  2O89 A;  2JL4 A;  3DWV A;  2FLS A;  3KP9 A;  4NHZ A;  2LS5 A;  1TRS A;  3BOA A;  2H74 A;  5IO0 A;  16GS A;  4POK A;  1URM A;  1JLV A;  3VWW A;  4PUR A;  4MJE A;  4EIQ A;  5D9V A;  4P3Y B;  3VI5 A;  2C0F A;  3ZML A;  3FR9 A;  3P2A A;  4PTS A;  1AXD A;  4EIP A;  4AJ8 A;  1PKW A;  2IL3 A;  1A8Y A;  1SL2 B;  3GKN A;  5JCG A;  2YZH A;  2DLX A;  4MZC A;  4EUY A;  2WCI A;  2V6K A;  5ECH B;  2LQO A;  4NV5 A;  3D21 A;  3LGC A;  4IBP A;  4GRF A;  4Z2R A;  4X43 A;  4ICY A;  4FQU A;  1DE1 A;  1GTI A;  4MJC A;  1TTZ A;  2AYT A;  4KSO A;  2DJJ A;  3EMP A;  2J9H A;  2M72 A;  2TIR A;  5FHI A;  2VCQ A;  4KW6 A;  1ZYQ B;  2GSQ A;  2R0P A;  2LRN A;  4KX4 A;  4XRD A;  1QXH A;  6GSW A;  5KN2 A;  1M2B A;  1N2A A;  3TKQ A;  2P5Q A;  2F3M A;  4FH8 A;  1QK8 A;  4PQH A;  4LMV A;  1NM3 A;  1T3B A;  5C00 A;  2FGX A;  2RM6 A;  1BG5 A;  4G0I A;  2NBS A;  5J5N A;  3IDV A;  2AHE A;  2P31 A;  4ISD A;  1GH2 A;  5ECL B;  1PN9 A;  4O92 A;  4PXO A;  5IPG A;  3UBL A;  1U88 A;  3W6G A;  3DEX A;  4FYC A;  3DRN A;  2I1U A;  5KOX A;  5ECP B;  2TRX A;  3M0F A;  5ECR B;  4WF4 A;  2AUV A;  4CY8 A;  3CXG A;  2PBJ A;  3M8N A;  3QCP A;  5G5F A;  1FVJ A;  3P7X A;  2DML A;  3J7Y k;  3CMI A;  2BMX A;  4MCU A;  3HVS A;  3L9V A;  3BBY A;  1U3A A;  5ENU A;  2EIO A;  2N5F A;  3TDG A;  5DAL A;  4JED A;  2LJK A;  1ZYN A;  2DJ3 A;  5D8I A;  2I3Y A;  4XS6 A;  2ON7 A;  2QA2 A;  1TU7 A;  1F3A A;  19GS A;  4D73 A;  3Q6O A;  3VK9 A;  2H19 A;  2LJR A;  2CAI A;  2FA8 A;  4NMU A;  2R0G A;  2LEG A;  3QD9 A;  1BAY A;  1CQH A;  4Z7X A;  2ES7 A;  3GKM A;  1M9B A;  4HU9 A;  1GNW A;  3QAW A;  3I9V 2;  2NTO A;  3C73 A;  3US3 A;  2LTK A;  2P5R A;  1J08 A;  2HSY A;  1BED A;  5ECM B;  2X8G A;  1FG4 A;  1DBY A;  4G9H A;  3WT1 A;  4K0G A;  1YKC A;  5ELG A;  5HR0 A;  3H93 A;  1WP0 A;  2WDU A;  2GSS A;  3UAR A;  5F0G A;  3RHB A;  2NDO A;  4G0K A;  3TJG A;  2YJ7 A;  1XZO A;  3EPT A;  3ZVJ D;  2IMD A;  1YZX A;  1BQ7 A;  1HNA A;  3F63 A;  4FYU A;  2YCD A;  5J9B A;  3WT2 A;  3DVX A;  1GP1 A;  1ZCP A;  3APO A;  3OR5 A;  3D4M A;  2BJX A;  3L78 A;  1X5D A;  4OFT A;  2IME A;  2DIZ A;  1A8L A;  4N11 A;  2VLU A;  2YN1 A;  2C3T A;  3BCK A;  2YAN A;  4POL A;  4X4J A;  2XPD A;  2H0I A;  4DSS A;  2LJA A;  3F6F A;  4ZB9 A;  2HZE A;  1LBK A;  3HD5 A;  4EO3 A;  1AQX A;  4GWR A;  2RUF A;  2VL2 A;  4I2U A;  3TKS E;  3DGQ A;  4ECJ A;  2G2Q A;  2WRT A;  3KXO A;  4MF7 A;  3HJM A;  2DJ1 A;  2X8H A;  2YPM A;  4L5L A;  4K7N A;  1ACV A;  3TB2 A;  1Q98 A;  1HYU A;  4EXJ A;  4O32 A;  2OE3 A;  5EY6 A;  2CA8 A;  1TK8 B;  2G0F A;  2H75 A;  2VM2 A;  2OBI A;  2C1Y A;  3GSS A;  4WF5 A;  2PER A;  2CZ2 A;  2GQL A;  5H5R A;  4K2D A;  6GSY A;  4IJI A;  4GQF A;  4BWS A;  3EUR A;  2M46 A;  3CSH A;  3WGD A;  3ZLP A;  2OBK A;  4AJ6 A;  6GSV A;  1OVN A;  5CRE A;  2O87 A;  1UC7 A;  3SBC A;  5BRT A;  2IPA A;  1XWG A;  2YP6 A;  1PX6 A;  1OC8 A;  5CRG A;  2H66 A;  2LUS A;  3TOT A;  1NW2 A;  4ACS A;  2YWM A;  2J23 A;  1A2J A;  4X1U A;  3C71 A;  2EIQ A;  1IYI A;  4WR5 A;  2AAW A;  2P0G A;  3GKX A;  4PQI A;  2VCV A;  4WKW A;  4F03 A;  3GTU B;  3TCO A;  2FA4 A;  4V1A p;  4PQ1 A;  5FWG A;  3O3T A;  1F9M A;  2VD1 A;  4MPF A;  4MAB A;  3K8N A;  1W4V A;  2H6Y A;  18GS A;  1SJI A;  3PPU A;  5CNW A;  5EPF A;  4Z2U A;  3GKK A;  3I6A A;  2A2R A;  9GSS A;  5E59 A;  3GNJ A;  2H72 A;  1MDK A;  1QUW A;  4TOP A;  4MF6 A;  4DSQ A;  3ERW A;  4J56 E;  1A2M A;  4XIH A;  5IMC A;  4E8H A;  1BX9 A;  3TJK A;  3KMO A;  5HFK A;  4X0X A;  2F8F A;  4TR0 A;  4O7H A;  1GSF A;  5D96 A;  4XHM A;  2XBI A;  5IOX A;  2MYG A;  3KTL A;  4XCS A;  1GL8 A;  1JHB A;  1JZW A;  1VF2 A;  1Q4J A;  4MNN A;  1UVZ A;  2QGV A;  1PX7 A;  5DJL A;  3KJY A;  2CAQ A;  1JFU A;  1TK0 B;  2YWI A;  1JZO A;  2JZR A;  4KH7 A;  1XWB A;  4XS4 B;  1AAZ A;  1M3J A;  1OAZ A;  2WFC A;  1O73 A;  2C0G A;  3GFK A;  1SKR B;  3NIV A;  1EWX A;  3KCM A;  2PGT A;  1XG8 A;  3WGX A;  1I9D A;  3APQ A;  3A3T A;  3SWL A;  3UJ1 A;  3BCI A;  1XVW A;  4FIW A;  2MMZ A;  1LJR A;  1QQ2 A;  2VCW A;  1TRW A;  3ZFL A;  3FYG A;  5IMZ A;  1VGL A;  1GTB A;  1SK2 A;  6GST A;  2HSH A;  4TW5 A;  2FWE A;  2R37 A;  1GTA A;  3LYK A;  3FZA A;  3A2X A;  2FHE A;  3I69 A;  4ILF A;  4OO5 A;  3GMF A;  4N0V A;  2IJY A;  3A5W A;  1S3D A;  2K8V A;  5B8A A;  5COH A;  2VLT A;  4IW9 A;  4JE1 A;  3HKR A;  1EGR A;  4BVX B;  3RDW A;  1DUG A;  1EEM A;  4MP4 A;  4ZIL A;  2YNX A;  5JWR B;  3IK7 A;  3LXT A;  4IHU A;  1K0N A;  1T1V A;  12GS A;  1ZL9 A;  4ID0 A;  1GSS A;  2HSM A;  4OCE A;  1O85 A;  4QQ7 A;  3GH9 A;  3ZRD A;  1SD9 A;  2B7K A;  4O5R A;  4KDX A;  1GUK A;  3J7Y b;  5D73 A;  1KBN A;  2XC2 A;  5IMF A;  4LL4 B;  4BVX A;  2GLR A;  1QFN A;  2PVO C;  2GST A;  4TR4 A;  3UIW A;  1XWK A;  4L0U A;  4GST A;  5J4U A;  3APS A;  4MMM A;  4Q5F A;  1PA3 A;  1ML6 A;  5GAP D;  2H70 A;  1Z7R A;  3FHK A;  1GNE A;  3GA4 A;  3HA9 A;  4DSR A;  1U3I A;  2VLV A;  4ZXG A;  2JZT A;  3M1G A;  2PU9 C;  2QA1 A;  4GF0 A;  5AIS A;  4RI6 A;  4ZBB A;  1FAA A;  4WEY A;  1QGV A;  1X9W B;  2A2P A;  2PN8 A;  5EVO A;  5HQP A;  3F4R A;  4TR3 A;  4JZQ A;  2C3N A;  3TRQ A;  2H01 A;  3Q19 A;  3VPQ A;  2CVK A;  2EC4 A;  2A4V A;  2I81 A;  4G19 A;  3FY7 A;  2Z9S A;  1KNG A;  3L0H A;  3EYT A;  3HZ8 A;  3KZQ A;  1B4Q A;  2JSY A;  1SL0 B;  2VCT A;  4V2N A;  3E9J B;  2QC7 A;  5DDL A;  4K5R A;  3EMX A;  2FWF A;  1H4O A;  3ISO A;  2PWJ A;  1J0F A;  4JR4 A;  3ZYW A;  1TW9 A;  5ECI B;  2R5G A;  3HDC A;  4I97 A;  2H30 A;  3FR6 A;  4IEL A;  3H4K A;  4I6X A;  3ME7 A;  1Z5Y E;  1V9W A;  3KH7 A;  3G7J A;  2HYX A;  3LXZ A;  4KND A;  3A5I A;  2HNL A;  2OE0 A;  3IE3 A;  1EOG A;  2KUC A;  4E8E A;  1EEJ A;  1TI1 A;  4OFM A;  2QSI A;  4LL1 B;  4DVC A;  6GSU A;  4YQV A;  1GUM A;  4KCE A; 
#chains in the Genus database with same CATH homology
 2KHP A;  4TVE A;  1SL1 B;  4L0W A;  2VCZ A;  5GSS A;  5L71 A;  5DAK B;  2HLS A;  1B48 A;  2K18 A;  3UVH A;  4MZW A;  3JCM L;  3BJ5 A;  2VUP A;  3CYN A;  1FW1 A;  1MD3 A;  5ECO B;  2E7P A;  3ZRE A;  2RM5 A;  4KDU A;  5CO3 A;  2H6X A;  3IHG A;  5ID2 B;  5KN3 A;  1V2A A;  1VF1 A;  2YZU A;  3VWU A;  1RW1 A;  1RQM A;  2JZS A;  1XOA A;  1WPI A;  1VRS D;  2LNS A;  1PQN A;  4HDE A;  3R3E A;  3QOU A;  3Q18 A;  2ALB A;  1A23 A;  2M80 A;  2LKU A;  2ON5 A;  4MLY A;  4K7I A;  1RK4 A;  1OE8 A;  1Z3E A;  2FNO A;  4KSM A;  5CRH A;  1FVK A;  1PN0 A;  2GDR A;  1XW6 A;  1WJK A;  1S3A A;  5ID2 A;  5H5Q A;  4K1F A;  1LU4 A;  1NHO A;  5F06 A;  4QL7 A;  3IR4 A;  4LA1 A;  4YQM A;  3GUR A;  1O81 A;  2CX4 A;  2VL2 C;  4MH3 A;  3KMN A;  1M7T A;  5CAX A;  4TXO B;  4IKH A;  2HRN A;  1USB A;  2V41 A;  1IYH A;  2FD3 A;  3DXB A;  4HOJ A;  1GLP A;  5CYY A;  3HVV A;  2VOC A;  1DSB A;  1ZZY A;  4AJ7 A;  4Z2T A;  2GVP A;  3HZ4 A;  2R3X A;  4CY6 A;  5A5K A;  1BJX A;  2DKI A;  2C0D A;  1TKD B;  13GS A;  2GQM A;  1G7O A;  1GSU A;  3PIN A;  1FB0 A;  4BVY B;  1B9Y C;  1H75 A;  1U6T A;  2X99 A;  4K0N A;  2CX3 A;  1EV9 A;  1T7P B;  3R2Q A;  3QAV A;  4KGI A;  2PUK C;  2YJH A;  3VUR A;  1ZGN A;  2JAD A;  4NAX A;  2GT6 A;  1BYE A;  3PR8 A;  2OAC A;  1SD8 A;  3TKP A;  2GTU A;  2X4A A;  3UL3 A;  4A5P A;  1THO A;  1W89 A;  3GYK A;  1HNB A;  4MDC A;  3FZ5 A;  3F4T A;  3CSJ A;  2FWG A;  8GSS A;  3ZFB A;  5AGY A;  1WOU A;  1SK0 A;  4J2F A;  17GS A;  5IMV A;  2GT5 A;  3MNG A;  4KCA A;  3U5R E;  4L8E A;  4V2M A;  5C04 A;  3TJJ A;  3GV1 A;  2DJK A;  2V32 A;  2F8A A;  3RHC A;  5KOW A;  3CRT A;  7GSS A;  3TOU A;  2GQK A;  5B6N A;  3LW9 A;  3HHV A;  3HJO A;  4Q5Q A;  4RUV A;  5A4V A;  3IC4 A;  4NPB A;  5CRD A;  2NPB A;  5CRW A;  5F07 A;  4MA9 A;  3KP8 A;  4MZB A;  1YJ6 A;  1XXU A;  4GCI A;  4AGS A;  4V1A g;  2L6C A;  3C7M A;  5JCW A;  2B5E A;  3E0U A;  3TKR A;  2PVQ A;  4HI7 A;  1WRY A;  3F4S A;  1GSE A;  3VPT A;  1OKD A;  2CVD A;  3N5O A;  2ZUP A;  4KF9 A;  1SK1 A;  1U87 A;  3S9F A;  2D2Z A;  2LNT A;  3LYP A;  3DKS A;  3D22 A;  2HI7 A;  4K2X A;  2IMK A;  2I9H A;  4ZIJ A;  1SKW B;  3IAM 2;  3QDN A;  3D4T A;  3ZTL A;  1K0D A;  2TRC P;  4XRA A;  2K9F A;  2L57 A;  4HJM A;  1GSQ A;  4EDY A;  3ME8 A;  4RI7 A;  4LMW A;  3UBK A;  4GTU A;  1CQG A;  1YKA A;  4ML1 A;  2B3S A;  4FYB A;  2K8S A;  3QPM A;  2XPE A;  3UEM A;  1UA5 A;  5IO2 A;  1K0O A;  2BTO T;  3FEU A;  3TJF A;  1MTC A;  2HRA A;  3NZN A;  3KTB A;  3W8J A;  10GS A;  4MPG A;  3M9K A;  1AC1 A;  1VF4 A;  1NSW A;  2B5X A;  4WBJ A;  2DBC A;  5J9C A;  4IVF A;  4KA0 A;  3H1N A;  2MZC A;  3MAK A;  4ZB8 A;  3GTU A;  4IP1 A;  2X64 A;  2YWO A;  1G7E A;  1XW9 A;  3LOR A;  3GUS A;  3LQ7 A;  4KE3 A;  3QR6 A;  3UVT A;  2X8C A;  1XW5 A;  2REM A;  4N30 A;  2GZZ A;  1R26 A;  1Z6N A;  4H86 A;  3TKS C;  3VWX A;  5D9X A;  1Y25 A;  2R0C A;  3IV4 A;  4K5S A;  1X9M B;  1XPV A;  4JRR A;  2X49 A;  5G1K A;  5IMA A;  3WD6 A;  1C72 A;  2WUL A;  5ELA A;  2HFD A;  1O8X A;  1SYR A;  3N9J A;  2WB9 A;  4BPY A;  1ERT A;  3GX0 A;  3VI7 A;  4HQS A;  3G9B A;  3M3M A;  3GIX A;  2N5B A;  2A4H A;  2KLX A;  2R2J A;  2HT9 A;  2V1M A;  4OFN A;  1GSY A;  3CSI A;  4QL9 A;  4HS1 A;  1R5P A;  3IAS 2;  1EP7 A;  4Q5R A;  4ZL7 A;  3IHQ A;  5FT3 A;  3ZIJ A;  4YAV A;  2B5Y A;  1XCC A;  3ZZX A;  5HR1 A;  2YOI A;  4J57 E;  2DJ2 A;  4JR6 A;  3GH6 A;  2R4V A;  5DJM A;  2PMT A;  1XFL A;  2GZY A;  2FUG 2;  2F9S A;  4TKY A;  1QMV A;  2IMI A;  3PGT A;  2C4J A;  4XS4 A;  3ZIV A;  1HNC A;  2OA7 A;  3W8S A;  2L4Q A;  3C1S A;  2CQ9 A;  3ZVJ A;  1R5A A;  2VL9 A;  4TN8 A;  4G0L A;  20GS A;  5KN0 A;  5AN1 A;  4POB A;  1GRX A;  3F3R A;  4NHW A;  2AJQ B;  1X9S B;  1PMT A;  3TRX A;  1R4W A;  2H0G A;  3HY2 A;  4NWY A;  4AF2 A;  3FKF A;  1OC9 B;  1SKS B;  4MF5 A;  1YDK A;  4IQA A;  1AW9 A;  3EIN A;  1XIY A;  3MWH A;  1XBS A;  1ST9 A;  1FB6 A;  1J9B A;  3HXS A;  1NHY A;  4MK3 A;  4LLR A;  4PNG A;  2OKA A;  1YEP A;  3QAG A;  1X0R A;  1FOV A;  1TI3 A;  3MYD A;  5J41 A;  1ZMA A;  1T4Z A;  4O5Q A;  1F3B A;  5G30 A;  2VCX A;  1PSQ A;  5B7C A;  1A0F A;  3QFA C;  4N10 A;  3EC3 A;  4XTS A;  5BMU A;  2IIY A;  2WZ9 A;  1Z7P A;  3TUE A;  3VWV A;  2IN3 A;  4I8B A;  3U6V A;  5IIZ A;  4YQU A;  2HRF A;  5DQY A;  4HU7 A;  1G0T A;  3ED3 A;  3IXR A;  4RQR A;  5EL8 A;  3GRX A;  1TK5 B;  4F2I A;  2C3Q A;  3NOF A;  3LEF A;  2B7J A;  2CVB A;  1E2Y A;  3TJB A;  1XWA A;  1YEX A;  5DCH A;  1TRV A;  5ECK B;  1K3O A;  1WIK A;  4F0C A;  5G1L A;  2GGT A;  5HR3 A;  1TU8 A;  3CRU A;  4ZL8 A;  5A4W A;  4IP6 A;  1XWC A;  3RPP A;  3VLN A;  3FRC A;  3EU4 A;  3KM6 A;  3FW2 A;  2H76 A;  1VF3 A;  3M9J A;  3O76 A;  3QFB C;  4BA7 A;  3GHA A;  1A2L A;  2E0Q A;  1EP8 A;  5JWQ B;  4F9Z A;  4CW9 A;  2B1K A;  4IJ3 A;  1A24 A;  2O8V B;  4ECB A;  4WET A;  4OCF A;  4IS0 A;  3CBU A;  2H1G A;  5D93 A;  5GAN D;  1WE0 A;  1OKT A;  3AY8 A;  3KEB A;  2DJ0 A;  2LV3 A;  4TR1 B;  1SEN A;  1MD4 A;  4PUF C;  5G2Z A;  4EKZ A;  2PPT A;  2MMN A;  5DAL B;  3KGK A;  3FR3 A;  1G6Y A;  3HYP A;  2R6K A;  3IBH A;  3GL5 A;  4PX1 A;  1ERW A;  2O7K A;  4D73 B;  1THX A;  11GS A;  1T8E B;  2OAD A;  3L9U A;  2V6O A;  4POM A;  1ABA A;  1M2D A;  4WBR D;  1PRX A;  4GLT A;  4GXZ A;  4EL1 A;  1ERV A;  2RII A;  4TR1 A;  4HJ2 A;  2FCH A;  1TXX A;  1K3L A;  2N5A A;  5LD0 A;  3UOM A;  4EVM A;  3RPN A;  6GSS A;  3MSZ A;  3DIE A;  4F82 A;  4F0B A;  1JZD A;  2H6Z A;  1FOH A;  3A2W A;  1V98 A;  5ECN B;  5KN1 A;  4USS A;  4OD7 A;  4JU5 A;  1TP9 A;  2WJU A;  5DAK A;  1GLQ A;  1GUL A;  4ZL9 A;  22GS A;  1AQW A;  3KD0 A;  5INY A;  1TOF A;  3F8U A;  1MEK A;  3EE2 A;  4WXT A;  1K0C A;  2EIR A;  1AQV A;  5CP1 A;  2IFQ B;  3EWL A;  2DSA A;  1XOB A;  3FK8 A;  3DYR A;  1M9A A;  1V40 A;  3LSZ A;  2JSZ A;  1MDI A;  2F51 A;  2H1A A;  1JLW A;  1S3C A;  3CTG A;  2DC5 A;  1XVQ A;  4ZB6 A;  2QKE A;  3FZ4 A;  1TDI A;  2HZF A;  5IOW A;  3DD3 A;  4HUA A;  2I4A A;  3F0I A;  4G10 A;  3MIX A;  5HR2 A;  2L6D A;  3GST A;  2IFQ A;  2AV4 A;  4PGT A;  4DSS B;  2HZE B;  4I2T A;  1ZYE A;  4TXO A;  4WR4 A;  2UZ8 A;  2LQQ A;  4OWY A;  3FZ9 A;  2CT6 A;  5IMD A;  3G7Y A;  3KH9 A;  1FO5 A;  2GZP A;  5G5E A;  2XBQ A;  4KDY A;  2GS3 A;  3Q74 A;  5HFI A;  3PH9 A;  5J3R A;  4K8M A;  2B6M A;  4IQ1 A;  3D5J A;  2KP1 A;  5LNK e;  3H8Q A;  1YF0 A;  5GST A;  3HCZ A;  3D6I A;  4BVY A;  3IA1 A;  3O6T A;  4N0Z A;  5A4U A;  3LJR A;  2LST A;  1Z6M A;  2L4C A;  3HVX A;  1EZK A;  4ZBD A;  2MMO A;  3F3Q A;  1EOH A;  2B1L A;  5B8B A;  1DE2 A;  5DQS A;  5ABR A;  2DMM A;  4GSN A;  2LRC A;  2GSR A;  2YV7 A;  4EDZ A;  1YY7 A;  2C8U A;  2VL3 A;  3VFI A;  4EC0 A;  6GSX A;  4V2L A;  1EGO A;  1SJZ A;  1ZYP A;  5HFG A;  3E3E A;  5ECS A;  1I5G A;  2H71 A;  3TRP A;  3DVW A;  3UMA A;  1F37 A;  2JU5 A;  4TRX A;  4BL7 B;  2OE1 A;  4HQZ A;  2LRT A;  4O5U A;  4OMV A;  4TXV A;  3DML A;  5G31 A;  1KTE A;  2YWN A;  3ZIT A;  2C80 A;  4ZBA A;  3IPZ A;  1SJ6 A;  1FHE A;  5JCU A;  5E4W A;  5F8B A;  3P8W A;  4YKF A;  1GSD A;  4ECI A;  4Q5N A;  3L9S A;  1R7H A;  3GL3 A;  4MJB A;  3F9U A;  1EV4 A;  1K3Y A;  4FO5 A;  1Y6E A;  1OE7 A;  2CV4 A;  1PKZ A;  1K0B A;  2DKH A;  1K0A A;  4G2E A;  3I43 A;  1ON4 A;  2KP2 A;  4ECC A;  3WYW A;  1HD2 A;  3L4N A;  2C0E A;  5DVB A;  1YQ1 A;  5DBQ A;  4BL7 A;  1JZR A;  1B9X C;  2L5L A;  1HQO A;  1PL1 A;  1T4Y A;  3TGZ A;  1ZOF A;  2HRK A;  2KOK A;  1UN2 A;  1WMJ A;  1O8W A;  4YH2 A;  4PUA A;  5H5S A;  1V57 A;  1OC3 A;  2VD0 A;  1GWC A;  1KEB A;  2O85 A;  4BWQ A;  1Z9H A;  3CTF A;  1SYX A;  1PD2 1;  1T00 A;  1O7U A;  2L5O A;  4EE0 A;  3GN3 A;  3LFL A;  4YKG A;  1WWJ A;  1X5C A;  1A0R P;  1SU9 A;  2K6V A;  1M99 A;  2IMF A;  1B4P A;  4K7O A;  1ILO A;  4JBB A;  3ZL5 A;  4K6X A;  2H8L A;  4HZ4 A;  3KIJ A;  1GTU A;  5D9T A;  1PL2 A;  3EVI A;  3GX8 A;  3IOS A;  3C1R A;  2FY6 A;  4L5O A;  2RLI A;  4OO4 A;  3IK9 A;  1K0M A;  2DIY A;  14GS A;  5LCZ A;  2AB6 A;  1YF1 A;  5IM9 A;  5F05 A;  2FWH A;  1PGT A;  3RBT A;  4KAE A;  5DCG A;  4KB3 A;  5D9W A;  1M2A A;  5AIX A;  2IWT A;  4XS1 A;  2ZNM A;  3ZMK A;  2HXK A;  1ERU A;  5JWO B;  4ML6 A;  1N8J A;  3V1W A;  1G6W A;  5AIV A;  1MDJ A;  1OYJ A;  3A2V A;  2XHF A;  1GUH A;  1AIU A;  5GZZ B;  3HJP A;  2HE3 A;  4PNF A;  2H73 A;  4NV2 A;  3UAP A;  3D0Z A;  3P90 A;  1V58 A;  4GQC A;  3F6D A;  3G7I A;  4GSS A;  4IN0 A;  1M0U A;  3EU3 A;  2OJL A;  2MMA A;  2VAF A;  2H1D A;  3MDK A;  3QMX A;  2H0H A;  1AUC A;  3IC8 A;  5KEJ A;  4ULX A;  2ZCT A;  3TKS A;  3RAZ A;  2E2M A;  2A2S A;  4K9Z A;  2WS2 A;  5IPH A;  3H79 A;  4IGJ A;  2CZ3 A;  1X5E A;  2WGR A;  2JAC A;  4MJA A;  1E6B A;  4HZ2 A;  1F6M C;  2MBT A;  1TRU A;  4RQX A;  4KUN A;  2VIM A;  4DEJ A;  4CDO A;  1B8X A;  1TJD A;  1F2E A;  4I5Q A;  2VM1 A;  4MH2 A;  3IRA A;  3BD2 A;  5B6M A;  3FMW A;  2YV9 A;  4CHS A;  1OC9 A;  3WGE A;  2RUE A;  4EF0 A;  1O6J A;  3C8E A;  2H1B A;  2E2G A;  4NXI A;  4HEA 2;  5ECQ B;  3LWA A;  5IQY A;  2L59 A;  2VO4 A;  3ERF A;  2MBS A;  3ERG A;  3LG6 A;  4YAP A;  2V2G A;  2NVL A;  2O89 A;  2JL4 A;  3DWV A;  2FLS A;  3KP9 A;  4NHZ A;  2LS5 A;  1TRS A;  3BOA A;  2H74 A;  5IO0 A;  16GS A;  4POK A;  1URM A;  1JLV A;  3VWW A;  4PUR A;  4MJE A;  4EIQ A;  5D9V A;  4P3Y B;  3VI5 A;  2C0F A;  3ZML A;  3FR9 A;  3P2A A;  4PTS A;  1AXD A;  4EIP A;  4AJ8 A;  1PKW A;  2IL3 A;  1A8Y A;  1SL2 B;  3GKN A;  5JCG A;  2YZH A;  2DLX A;  4MZC A;  4EUY A;  2WCI A;  2V6K A;  5ECH B;  2LQO A;  4NV5 A;  3D21 A;  3LGC A;  4IBP A;  4GRF A;  4Z2R A;  4X43 A;  4ICY A;  4FQU A;  1DE1 A;  1GTI A;  4MJC A;  1TTZ A;  2AYT A;  4KSO A;  2DJJ A;  3EMP A;  2J9H A;  2M72 A;  2TIR A;  5FHI A;  2VCQ A;  4KW6 A;  1ZYQ B;  2GSQ A;  2R0P A;  2LRN A;  4KX4 A;  4XRD A;  1QXH A;  6GSW A;  5KN2 A;  1M2B A;  1N2A A;  3TKQ A;  2P5Q A;  2F3M A;  4FH8 A;  1QK8 A;  4PQH A;  4LMV A;  1NM3 A;  1T3B A;  5C00 A;  2FGX A;  2RM6 A;  1BG5 A;  4G0I A;  2NBS A;  5J5N A;  3IDV A;  2AHE A;  2P31 A;  4ISD A;  1GH2 A;  5ECL B;  1PN9 A;  4O92 A;  4PXO A;  5IPG A;  3UBL A;  1U88 A;  3W6G A;  3DEX A;  4FYC A;  3DRN A;  2I1U A;  5KOX A;  5ECP B;  2TRX A;  3M0F A;  5ECR B;  4WF4 A;  2AUV A;  4CY8 A;  3CXG A;  2PBJ A;  3M8N A;  3QCP A;  5G5F A;  1FVJ A;  3P7X A;  2DML A;  3J7Y k;  3CMI A;  2BMX A;  4MCU A;  3HVS A;  3L9V A;  3BBY A;  1U3A A;  5ENU A;  2EIO A;  2N5F A;  3TDG A;  5DAL A;  4JED A;  2LJK A;  1ZYN A;  2DJ3 A;  5D8I A;  2I3Y A;  4XS6 A;  2ON7 A;  2QA2 A;  1TU7 A;  1F3A A;  19GS A;  4D73 A;  3Q6O A;  3VK9 A;  2H19 A;  2LJR A;  2CAI A;  2FA8 A;  4NMU A;  2R0G A;  2LEG A;  3QD9 A;  1BAY A;  1CQH A;  4Z7X A;  2ES7 A;  3GKM A;  1M9B A;  4HU9 A;  1GNW A;  3QAW A;  3I9V 2;  2NTO A;  3C73 A;  3US3 A;  2LTK A;  2P5R A;  1J08 A;  2HSY A;  1BED A;  5ECM B;  2X8G A;  1FG4 A;  1DBY A;  4G9H A;  3WT1 A;  4K0G A;  1YKC A;  5ELG A;  5HR0 A;  3H93 A;  1WP0 A;  2WDU A;  2GSS A;  3UAR A;  5F0G A;  3RHB A;  2NDO A;  4G0K A;  3TJG A;  2YJ7 A;  1XZO A;  3EPT A;  3ZVJ D;  2IMD A;  1YZX A;  1BQ7 A;  1HNA A;  3F63 A;  4FYU A;  2YCD A;  5J9B A;  3WT2 A;  3DVX A;  1GP1 A;  1ZCP A;  3APO A;  3OR5 A;  3D4M A;  2BJX A;  3L78 A;  1X5D A;  4OFT A;  2IME A;  2DIZ A;  1A8L A;  4N11 A;  2VLU A;  2YN1 A;  2C3T A;  3BCK A;  2YAN A;  4POL A;  4X4J A;  2XPD A;  2H0I A;  4DSS A;  2LJA A;  3F6F A;  4ZB9 A;  2HZE A;  1LBK A;  3HD5 A;  4EO3 A;  1AQX A;  4GWR A;  2RUF A;  2VL2 A;  4I2U A;  3TKS E;  3DGQ A;  4ECJ A;  2G2Q A;  2WRT A;  3KXO A;  4MF7 A;  3HJM A;  2DJ1 A;  2X8H A;  2YPM A;  4L5L A;  4K7N A;  1ACV A;  3TB2 A;  1Q98 A;  1HYU A;  4EXJ A;  4O32 A;  2OE3 A;  5EY6 A;  2CA8 A;  1TK8 B;  2G0F A;  2H75 A;  2VM2 A;  2OBI A;  2C1Y A;  3GSS A;  4WF5 A;  2PER A;  2CZ2 A;  2GQL A;  5H5R A;  4K2D A;  6GSY A;  4IJI A;  4GQF A;  4BWS A;  3EUR A;  2M46 A;  3CSH A;  3WGD A;  3ZLP A;  2OBK A;  4AJ6 A;  6GSV A;  1OVN A;  5CRE A;  2O87 A;  1UC7 A;  3SBC A;  5BRT A;  2IPA A;  1XWG A;  2YP6 A;  1PX6 A;  1OC8 A;  5CRG A;  2H66 A;  2LUS A;  3TOT A;  1NW2 A;  4ACS A;  2YWM A;  2J23 A;  1A2J A;  4X1U A;  3C71 A;  2EIQ A;  1IYI A;  4WR5 A;  2AAW A;  2P0G A;  3GKX A;  4PQI A;  2VCV A;  4WKW A;  4F03 A;  3GTU B;  3TCO A;  2FA4 A;  4V1A p;  4PQ1 A;  5FWG A;  3O3T A;  1F9M A;  2VD1 A;  4MPF A;  4MAB A;  3K8N A;  1W4V A;  2H6Y A;  18GS A;  1SJI A;  3PPU A;  5CNW A;  5EPF A;  4Z2U A;  3GKK A;  3I6A A;  2A2R A;  9GSS A;  5E59 A;  3GNJ A;  2H72 A;  1MDK A;  1QUW A;  4TOP A;  4MF6 A;  4DSQ A;  3ERW A;  4J56 E;  1A2M A;  4XIH A;  5IMC A;  4E8H A;  1BX9 A;  3TJK A;  3KMO A;  5HFK A;  4X0X A;  2F8F A;  4TR0 A;  4O7H A;  1GSF A;  5D96 A;  4XHM A;  2XBI A;  5IOX A;  2MYG A;  3KTL A;  4XCS A;  1GL8 A;  1JHB A;  1JZW A;  1VF2 A;  1Q4J A;  4MNN A;  1UVZ A;  2QGV A;  1PX7 A;  5DJL A;  3KJY A;  2CAQ A;  1JFU A;  1TK0 B;  2YWI A;  1JZO A;  2JZR A;  4KH7 A;  1XWB A;  4XS4 B;  1AAZ A;  1OAZ A;  2WFC A;  1O73 A;  2C0G A;  3GFK A;  1SKR B;  3NIV A;  1EWX A;  3KCM A;  2PGT A;  3WGX A;  1I9D A;  3APQ A;  3A3T A;  3SWL A;  3UJ1 A;  3BCI A;  1XVW A;  4FIW A;  2MMZ A;  1LJR A;  1QQ2 A;  2VCW A;  1TRW A;  3ZFL A;  3FYG A;  5IMZ A;  1VGL A;  1GTB A;  1SK2 A;  6GST A;  2HSH A;  4TW5 A;  2FWE A;  2R37 A;  1GTA A;  3LYK A;  3FZA A;  3A2X A;  2FHE A;  3I69 A;  4ILF A;  4OO5 A;  3GMF A;  4N0V A;  2IJY A;  3A5W A;  1S3D A;  2K8V A;  5B8A A;  5COH A;  2VLT A;  4IW9 A;  4JE1 A;  3HKR A;  1EGR A;  4BVX B;  3RDW A;  1DUG A;  1EEM A;  4MP4 A;  4ZIL A;  2YNX A;  5JWR B;  3IK7 A;  3LXT A;  4IHU A;  1K0N A;  1T1V A;  12GS A;  1ZL9 A;  4ID0 A;  1GSS A;  2HSM A;  4OCE A;  1O85 A;  4QQ7 A;  3GH9 A;  3ZRD A;  1SD9 A;  2B7K A;  4O5R A;  4KDX A;  1GUK A;  3J7Y b;  5D73 A;  1KBN A;  2XC2 A;  5IMF A;  4LL4 B;  4BVX A;  2GLR A;  1QFN A;  2PVO C;  2GST A;  4TR4 A;  3UIW A;  1XWK A;  4L0U A;  4GST A;  5J4U A;  3APS A;  4MMM A;  4Q5F A;  1PA3 A;  1ML6 A;  5GAP D;  2H70 A;  1Z7R A;  3FHK A;  1GNE A;  3GA4 A;  3HA9 A;  4DSR A;  1U3I A;  2VLV A;  4ZXG A;  2JZT A;  3M1G A;  2PU9 C;  2QA1 A;  4GF0 A;  5AIS A;  4RI6 A;  4ZBB A;  1FAA A;  4WEY A;  1QGV A;  1X9W B;  2A2P A;  2PN8 A;  5EVO A;  5HQP A;  3F4R A;  4TR3 A;  4JZQ A;  2C3N A;  3TRQ A;  2H01 A;  3Q19 A;  3VPQ A;  2CVK A;  2EC4 A;  2A4V A;  2I81 A;  4G19 A;  3FY7 A;  2Z9S A;  1KNG A;  3L0H A;  3EYT A;  3HZ8 A;  3KZQ A;  1B4Q A;  2JSY A;  1SL0 B;  2VCT A;  4V2N A;  3E9J B;  2QC7 A;  5DDL A;  4K5R A;  3EMX A;  2FWF A;  1H4O A;  3ISO A;  2PWJ A;  1J0F A;  4JR4 A;  3ZYW A;  1TW9 A;  5ECI B;  2R5G A;  3HDC A;  4I97 A;  2H30 A;  3FR6 A;  4IEL A;  3H4K A;  4I6X A;  3ME7 A;  1Z5Y E;  1V9W A;  3KH7 A;  3G7J A;  2HYX A;  3LXZ A;  4KND A;  3A5I A;  2HNL A;  2OE0 A;  3IE3 A;  1EOG A;  2KUC A;  4E8E A;  1EEJ A;  1TI1 A;  4OFM A;  2QSI A;  4LL1 B;  4DVC A;  6GSU A;  4YQV A;  1GUM A;  4KCE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...