1T8EB

T7 dna polymerase ternary complex with dctp at the insertion site.
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
106
structure length
106
Chain Sequence
DKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/electron transport/dna
molecule keywords 5'-D(P*CP*GP*AP*AP*AP*AP*CP*GP*AP*CP*GP*GP*CP*CP*AP*GP*TP*GP
publication title Structural basis for the dual coding potential of 8-oxoguanosine by a high-fidelity DNA polymerase.
pubmed doi rcsb
source organism Enterobacteria phage t7
total genus 24
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2004-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1t8eB00
3MDKA 5EPFA 3KD0A 2L4QA 3I69A 4BA7A 3N9JA 1X9SB 4HEA2 2YJ7A 4KGIA 2MMZA 1A23A 1TU8A 2VCTA 4ZL8A 1SL2B 3MWHA 4DEJA 3KM6A 4K1FA 2B1LA 3OR5A 2AUVA 3VWWA 5IMCA 1SD8A 2JU5A 3EWLA 4G19A 3KZQA 2E7PA 4CDOA 4O7HA 2HLSA 2LNTA 1LJRA 1TP9A 3G9BA 3RBTA 4RUVA 1PGTA 4IJ3A 1TRVA 2AAWA 4YAPA 1H4OA 1V2AA 1PA3A 2H6XA 2RLIA 1F6MC 1Q98A 3LYPA 2H30A 4KSMA 4IN0A 6GSWA 3ZMLA 1S3AA 4DSSA 4EF0A 5J4UA 1V40A 4TN8A 3GV1A 4POMA 4EUYA 1RQMA 4F82A 2F9SA 3FR9A 4ULXA 1XWKA 2D2ZA 1U3IA 4NV2A 2XC2A 1O85A 2OE1A 3GUSA 1JZRA 3ERGA 2OACA 3TKSA 4WR5A 3TJJA 1A2JA 2EIOA 2I9HA 1ABAA 1BG5A 3F4RA 3M1GA 4HS1A 3KP8A 1Z5YE 2DLXA 5D9TA 5J9CA 3SBCA 2OE0A 1RK4A 4EDZA 3D6IA 3GYKA 3VURA 2BTOT 2VL9A 4O32A 4GLTA 5G5FA 4DSRA 3WT2A 4WEYA 4IP1A 3P90A 3IR4A 4BVXA 4MP4A 2J9HA 4MF6A 1PL2A 1OC3A 2PN8A 1EGRA 4OFMA 1M2AA 2YV9A 4I2UA 2B3SA 2DC5A 2YZHA 4PQIA 2FGXA 3KP9A 2XBQA 1PL1A 4F0CA 1ERTA 2NDOA 1R5PA 4HQSA 1AQVA 1M0UA 4AJ6A 5D96A 2RIIA 1UVZA 1K0NA 3HD5A 4BVYA 5IMZA 1HNBA 4OCFA 5F07A 1B4QA 4XS4B 3F8UA 1GLQA 3GX0A 4YQUA 4TR3A 2FD3A 2YWNA 1OAZA 1ON4A 3EE2A 3TOTA 3KJYA 2VCWA 5GAPD 2KUCA 3GKKA 3HA9A 3VI5A 4KDUA 4MLYA 1HNCA 4MJCA 5ECRB 1SD9A 2ZUPA 3BJ5A 3DRNA 1B8XA 2IN3A 3KCMA 2R3XA 2CVDA 1J0FA 3UBLA 3E9JB 2R2JA 4NPBA 1XXUA 2R37A 2WRTA 2HZEB 2WDUA 3A5WA 5IMVA 4ZIJA 2IPAA 2CAQA 2P5RA 4BPYA 4ZL9A 3UAPA 6GSYA 5DCGA 4BWSA 2XPDA 4F03A 1J08A 1YF0A 4WBJA 4GF0A 3GSTA 1TKDB 4KCAA 17GSA 3TGZA 2EIQA 3J7Yb 3DD3A 1OC9A 3P2AA 3QR6A 5AIXA 1GSSA 2LJAA 2GSTA 3DGQA 5CRWA 1G6YA 2H6ZA 4HZ4A 5ECOB 4HU9A 5AISA 4XRDA 4GXZA 2N5FA 2N5BA 1M7TA 2WB9A 1E2YA 2C0EA 2L5OA 1GSDA 2X8HA 2OA7A 1OVNA 4N0ZA 3DEXA 2ALBA 5EVOA 1MTCA 2IJYA 2IMEA 3UJ1A 1OE8A 2REMA 4F2IA 2JZTA 2IFQA 1VRSD 1U3AA 3L9VA 2VD0A 5H5RA 1U87A 3MSZA 3G7JA 4EDYA 1GUKA 1SK0A 2OJLA 3FR6A 3GRXA 1A2LA 5HFGA 5ECHB 3FHKA 4ECIA 1X5EA 2V2GA 4LL1B 3RAZA 3BD2A 4Q5FA 1SL0B 1U6TA 3GURA 2X64A 5G30A 3IC4A 2MMAA 4G9HA 2L6DA 1TRWA 1MEKA 2H0IA 4KUNA 1R7HA 4AJ7A 1S3DA 1TI1A 2DMMA 4XCSA 1BYEA 3CTGA 3LFLA 4I5QA 4ZXGA 3A2WA 1OYJA 3APOA 1URMA 4HJMA 2A4VA 3ZZXA 2H1GA 3E3EA 2JSYA 4XHMA 1TXXA 4PNGA 5FWGA 3RHCA 5G5EA 1K0OA 4MF7A 2YPMA 4P3YB 1FOVA 1TJDA 1THXA 3VWXA 3H8QA 6GSTA 22GSA 4DSSB 2ZCTA 4PXOA 1R5AA 5F06A 2GZYA 8GSSA 5LNKe 4AJ8A 1WOUA 3IRAA 4X1UA 5AN1A 3PINA 5DQSA 4EE0A 3TJKA 2FA4A 1EOGA 2YV7A 3KGKA 4IKHA 3MAKA 5D8IA 3VFIA 1I9DA 1SYXA 4NAXA 4TR0A 1F3AA 2H74A 2O8VB 1M9AA 5JWRB 4XS6A 3FZ4A 5AIVA 5LD0A 4WR4A 5G31A 2GZZA 3ME7A 3C7MA 4YAVA 1WP0A 1O8WA 4K7NA 3DWVA 4HDEA 2GGTA 2IMFA 2LV3A 5G1KA 2NPBA 1PD21 1AQWA 2R5GA 5D93A 1THOA 3EVIA 3UARA 1M2DA 2FA8A 2ON7A 4I6XA 1XCCA 4CW9A 1UA5A 3LQ7A 3S9FA 4QL9A 1A24A 3L9UA 5J5NA 4ID0A 2GT5A 2H71A 2VD1A 5ECNB 2VCZA 2AB6A 3Q74A 4WF5A 3F3QA 2C0FA 2V6OA 2C0GA 5L71A 1UN2A 3TB2A 3VPQA 4IP6A 3VWVA 3KTBA 3EU4A 5G2ZA 3WT1A 1TK0B 2H6YA 5IO0A 3W8SA 1Z6NA 4V2LA 5DQYA 3H4KA 4HOJA 2XPEA 4IJIA 4L5LA 3HJPA 3FZ5A 1DSBA 4EO3A 4HQZA 3L78A 1SU9A 2K6VA 3W6GA 4KW6A 3GKXA 2O7KA 4Z7XA 2X8GA 4CHSA 5JWOB 1TI3A 3UL3A 1EV9A 2L6CA 1TRUA 3VWUA 2CX3A 1EV4A 2H66A 2OE3A 4GSNA 1RW1A 3TOUA 4YH2A 2WFCA 4PQ1A 1ZYQB 3ZLPA 2QKEA 1A8YA 3IAM2 3TKRA 4NHZA 2Z9SA 4EL1A 2B5XA 3C73A 1EGOA 5HFIA 2ZNMA 4NMUA 2WCIA 4I97A 3UOMA 1OC9B 4OMVA 4IVFA 2MMNA 3F6FA 1ERVA 2HSYA 5DALA 5HFKA 4E8HA 1XFLA 1XOAA 3IK7A 3ZFBA 2WGRA 1QQ2A 2K8VA 3O6TA 4PUFC 3US3A 3G7YA 3H79A 1VF1A 1EEJA 1K0DA 4Q5QA 4TXOA 4MJBA 1BEDA 1JZWA 4PX1A 3IOSA 4NWYA 2AV4A 3APSA 3LJRA 5D9VA 2IFQB 1HNAA 5HR2A 2FNOA 1YY7A 3QAVA 5G1LA 3BBYA 4GSSA 4PNFA 4TR4A 4WXTA 4FO5A 1ZOFA 1FW1A 4V1Ag 2XBIA 2G2QA 1N2AA 3TJGA 3VI7A 2CQ9A 1AC1A 1IYIA 2VL3A 1WJKA 1ZMAA 4J57E 1SKWB 2HSHA 2YCDA 1T1VA 4XRAA 1KEBA 1HD2A 4WBRD 2A2SA 5A4VA 3BOAA 3RHBA 2LSTA 2GSSA 2PUKC 3EU3A 3QFAC 2KLXA 1X9WB 2PERA 5C04A 2V41A 2VL2C 3LWAA 4K0NA 4DVCA 2JADA 3RPPA 1A8LA 3LXZA 1O6JA 1GSYA 5JCWA 3IXRA 5CO3A 1SENA 5ECQB 6GSSA 4IELA 1SJIA 1XOBA 3CSJA 1XVWA 3FYGA 3R2QA 2H72A 2FY6A 3I6AA 4K2DA 2N5AA 1GTUA 4ZBAA 1JLVA 2HRNA 2MYGA 2OBKA 2I81A 4JBBA 10GSA 1K0MA 4L0WA 3DXBA 4FYBA 5EY6A 3QDNA 5KN1A 2FWHA 2H01A 2GSRA 3NZNA 3UIWA 5DAKA 1VGLA 5B8AA 3FY7A 1EZKA 1BQ7A 4HUAA 4QQ7A 1Z7RA 2V32A 1J9BA 1ZZYA 3C1RA 3F4TA 4JEDA 2CVKA 5IIZA 3A2XA 4L5OA 3L9SA 3H93A 1WE0A 19GSA 2E2GA 4GQCA 3IAS2 1H75A 1YF1A 4AF2A 2EC4A 1YKAA 3DKSA 3QD9A 2VUPA 2CV4A 3GIXA 3ME8A 4ZB9A 4IQ1A 1GP1A 2YNXA 1JHBA 5B7CA 1MD4A 1LBKA 5COHA 5IO2A 4I8BA 2VM1A 3GSSA 1B48A 3LORA 3TRQA 2PMTA 5B6NA 1AIUA 3ZMKA 1T4ZA 2C3NA 3P8WA 4J56E 1MD3A 2C1YA 4TR1A 4V1Ap 4X0XA 5IOWA 3RPNA 4J2FA 5DDLA 2H1DA 3ZREA 2OBIA 1AUCA 1GL8A 4HZ2A 11GSA 1G7EA 2FUG2 1K3OA 3C8EA 3FEUA 2GQLA 4ZB8A 5F05A 2M80A 1YDKA 2R4VA 5HR0A 4EC0A 4ZB6A 1FG4A 4MABA 3M3MA 1WRYA 2VL2A 4ISDA 2B7JA 3KH7A 1UC7A 3TKSE 2GT6A 2JSZA 4PGTA 3ZIVA 2TRCP 2CZ2A 5GZZB 1NM3A 2P5QA 3VK9A 2BJXA 2H73A 4EXJA 4ZBBA 3KXOA 1V9WA 2B5EA 1GNEA 1HQOA 5DALB 2LKUA 1BJXA 2VLTA 1O81A 2KHPA 1CQGA 1Y25A 2CZ3A 4K9ZA 3U5RE 2H8LA 3F0IA 5LCZA 2WJUA 1WMJA 3F3RA 5CP1A 4TXOB 4JU5A 2PGTA 2DIZA 5CNWA 3Q18A 3F9UA 18GSA 3CYNA 3I43A 4KSOA 5KEJA 4E8EA 5KN0A 2MBSA 4G10A 2MMOA 3IHQA 1XW6A 1YKCA 2GLRA 2B7KA 3KTLA 3ZFLA 3IBHA 4TW5A 3HY2A 4OD7A 3H1NA 2DJJA 2DBCA 2VOCA 1X9MB 4RQRA 3GKNA 3UVHA 1OKTA 14GSA 4KDYA 3GN3A 2HE3A 3EC3A 4OWYA 4ML6A 3WD6A 3UEMA 1GLPA 2RM6A 5J9BA 4NV5A 3ZRDA 2L57A 5CRHA 2PWJA 2EIRA 1QGVA 1XWCA 3DMLA 2VCVA 4PQHA 3WGXA 1USBA 1EP7A 3SWLA 1XPVA 1M9BA 5CRDA 4KNDA 3K8NA 3CSIA 3W8JA 1NHYA 1WPIA 2OADA 2YZUA 2DJ2A 1XW9A 4LMWA 9GSSA 2HI7A 2IWTA 3QPMA 1A0FA 3MNGA 4JE1A 3NIVA 3TUEA 1PSQA 4N11A 3WYWA 2H75A 2I4AA 2YWOA 4YQMA 3QFBC 4TVEA 4LL4B 4JR4A 3IE3A 3ED3A 2FLSA 4MH2A 4PUAA 5DAKB 5FT3A 5H5QA 5E4WA 2YOIA 3KMNA 1K0BA 2KOKA 4BWQA 1JZDA 3O3TA 1W89A 3FZ9A 4FYUA 4ZBDA 1R26A 3C71A 2RUFA 2CX4A 3N5OA 2VO4A 4TXVA 1FO5A 4KCEA 3PGTA 4NXIA 3QMXA 1ACVA 5ELAA 3AY8A 2F8FA 3GL3A 1V57A 2DIYA 4IS0A 1W4VA 1ZCPA 3C1SA 2QC7A 1Y6EA 1QUWA 1GSUA 2O87A 1T00A 4MJAA 3QCPA 1K0AA 5ID2A 4JR6A 1XZOA 3M0FA 4I2TA 1GWCA 2YANA 3EURA 3TRXA 1A0RP 3WGDA 1GTIA 1X0RA 1T3BA 3HHVA 3LGCA 3ZYWA 3KMOA 5IOXA 4V2NA 4N30A 4DSQA 3TJFA 4TR1B 4OCEA 2GS3A 3ERFA 4MPFA 3GTUA 5DJMA 2NTOA 4RI7A 1QMVA 2FHEA 5C00A 1ZGNA 1PX7A 3HYPA 4HU7A 3E0UA 1TU7A 5B6MA 3HJMA 1ILOA 3GFKA 1QXHA 1WIKA 1F2EA 2QGVA 1K3YA 1B9YC 5AGYA 1CQHA 1M2BA 2PBJA 4Q5NA 4MCUA 4QL7A 4KA0A 1XVQA 5IPGA 4MK3A 1DUGA 3J7Yk 4K0GA 3LEFA 1YEPA 3F6DA 3IDVA 4LA1A 2LRTA 4K7IA 4ACSA 1ZYEA 5ENUA 2IMIA 5INYA 1MDJA 2H76A 2CVBA 1VF3A 2VIMA 2DJ0A 2IMDA 3NOFA 2TRXA 1B4PA 2H0GA 2L59A 5KN2A 1S3CA 1KBNA 1G6WA 1GUMA 3TCOA 4FH8A 4GSTA 2WZ9A 4Q5RA 3EYTA 4ZL7A 16GSA 6GSUA 1BX9A 2QSIA 1MDKA 2DJ3A 3L4NA 3EMPA 3VLNA 2M72A 1XWAA 4FIWA 5CAXA 2GVPA 4IHUA 3CBUA 3LXTA 3FRCA 3QAGA 4O92A 3CSHA 3LSZA 2HRFA 1TW9A 4K8MA 2JZSA 1FVKA 5ELGA 2VM2A 1ERUA 4IW9A 2FCHA 5IMFA 4KH7A 3BCIA 1ZL9A 1XW5A 5B8BA 1GRXA 1NW2A 2A2RA 4G2EA 5JWQB 5IMAA 2LS5A 1GH2A 3IPZA 2KP1A 1VF4A 3A2VA 1Q4JA 2DJ1A 5J3RA 5F8BA 1SK2A 2IL3A 1YZXA 4KDXA 1I5GA 2YWMA 1WWJA 4WETA 5HR3A 4F9ZA 2K9FA 2ON5A 5JCGA 5D9XA 3HKRA 2K8SA 3FK8A 2LRCA 3HVXA 2JZRA 2CA8A 1Z7PA 3A3TA 4EVMA 1EOHA 2V6KA 2H19A 3HXSA 4MJEA 5J41A 1AW9A 1KTEA 2VCXA 3DYRA 1SYRA 2DMLA 1K0CA 4KAEA 5CYYA 1DBYA 3QAWA 3LG6A 2L4CA 2H0HA 2GSQA 3GNJA 1JZOA 3HZ8A 2HT9A 5D73A 1O73A 2P31A 2LJKA 4ILFA 1X5CA 2C3QA 3UMAA 4OFTA 2G0FA 1V58A 1NSWA 2H1BA 4FYCA 3GH6A 1R4WA 4GCIA 5ID2B 1TK8B 3IK9A 1O7UA 4GWRA 3FW2A 1YQ1A 3DIEA 4D73A 3D22A 3GHAA 3GKMA 5ECSA 2F51A 3HVVA 2PVOC 4MF5A 3G7IA 3EMXA 2FWEA 2PVQA 4POLA 1Z3EA 1XIYA 1SL1B 3ZITA 5JCUA 2YN1A 5ECLB 4WKWA 2YJHA 6GSVA 2LRNA 3GA4A 3HZ4A 3UVTA 5DVBA 5ECPB 4GRFA 1GTAA 2B1KA 5A5KA 4HJ2A 3GTUB 4OO5A 3KH9A 4K7OA 1YJ6A 1VF2A 5ABRA 2O89A 3TKPA 2GDRA 1O8XA 4HI7A 2AHEA 4OO4A 2C4JA 3L0HA 2VAFA 7GSSA 1FHEA 2RM5A 3CTFA 3CXGA 1AAZA 1SKSB 4ZILA 1Z6MA 5D9WA 2RUEA 4POKA 4IQAA 1T7PB 4OFNA 3O76A 2GTUA 3QOUA 2X99A 5CREA 5DJLA 2HYXA 2MZCA 2HXKA 3TDGA 2E0QA 1SJ6A 6GSXA 1EEMA 5ECMB 2IMKA 1FB6A 1KNGA 3CRTA 1PN9A 2YWIA 2PPTA 3WGEA 3VPTA 3FR3A 1FB0A 3TJBA 2HNLA 1TK5B 4YQVA 2K18A 1OC8A 2VLVA 4AGSA 1E6BA 2WULA 4ECCA 4XS1A 3D0ZA 3BCKA 4N0VA 3EINA 3M9KA 3GL5A 2I1UA 5KN3A 1PRXA 2BMXA 1XWGA 3DVWA 5A4WA 3Q19A 4O5RA 1OE7A 4GQFA 1M99A 3ZL5A 3ERWA 4NHWA 3TRPA 1F3BA 4KE3A 1EP8A 3KEBA 3ZTLA 1PQNA 3ZVJA 1QFNA 4XIHA 5GSSA 1Z9HA 2NBSA 4WF4A 1A2MA 4GTUA 5A4UA 2I3YA 5GAND 3RDWA 1IYHA 2AJQB 4MMMA 3ISOA 5DBQA 2KP2A 2AYTA 2LEGA 2GZPA 2M46A 4MZWA 2GQMA 4PURA 3F63A 4MDCA 3LYKA 1GUHA 2L5LA 1MDIA 1JLWA 3P7XA 2YP6A 3PR8A 1XWBA 3Q6OA 4IBPA 2C0DA 3D5JA 5F0GA 3DVXA 3FKFA 1B9XC 4TKYA 3M9JA 3D4MA 1HYUA 2DJKA 4MPGA 2MBTA 1XBSA 2H1AA 3PH9A 3HVSA 4H86A 2CAIA 2F3MA 5H5SA 1AQXA 1TOFA 2CT6A 20GSA 2B6MA 1TRSA 2OKAA 3D21A 3CMIA 3ZVJD 3GH9A 1NHOA 4K6XA 13GSA 12GSA 1SKRB 4RQXA 2J23A 2X8CA 2V1MA 1U88A 1FAAA 1V98A 1DE1A 1SK1A 4L0UA 1JFUA 5ECKB 1LU4A 3JCML 2C3TA 1BAYA 4ML1A 4ECBA 2VCQA 2P0GA 1QK8A 5IQYA 2B5YA 4MZBA 5IPHA 4TRXA 1PX6A 4EKZA 5HR1A 4TOPA 1DE2A 5EL8A 1OKDA 4V2MA 4N10A 1SJZA 4RI6A 1F9MA 1ERWA 4X43A 1PKZA 3APQA 2LJRA 4KX4A 4XS4A 3ZIJA 2TIRA 2VLUA 2IIYA 5FHIA 2C8UA 2C80A 4POBA 3V1WA 4LLRA 3HJOA 2LQQA 1PMTA 2HFDA 4L8EA 4KB3A 2PU9C 4XTSA 3KIJA 2LNSA 2ES7A 3HDCA 1YEXA 4IGJA 4MH3A 3CRUA 3TKQA 3UBKA 2JACA 1ST9A 3HCZA 1G0TA 1X5DA 4F0BA 1GSQA 2DSAA 5E59A 2HZFA 2GQKA 5GSTA 4JZQA 2R6KA 2F8AA 1F37A 5IM9A 1ML6A 3TKSC 3I9V2 2LQOA 4D73B 2HZEA 5IMDA 2E2MA 1GSEA 2JL4A 5ECIB 3F4SA 2LUSA 1T8EB 5CRGA 4MA9A 1FVJA 2NVLA 1T4YA 2FWGA 1EWXA 3M8NA 2FWFA 3FZAA 4JRRA 4ECJA 2XHFA 1GSFA 5DCHA 2O85A 2H70A 3GX8A 1TTZA 1N8JA 2LTKA 3U6VA 3D4TA 1AXDA 4MZCA 1G7OA 5HQPA 1TDIA 1PKWA 1GULA 1GNWA 4BL7A 1K3LA 2WS2A 1C72A 3GMFA 4LMVA 1GTBA 3IV4A 3IA1A
chains in the Genus database with same CATH superfamily
3MDKA 4PTSA 5EPFA 3KD0A 2L4QA 3I69A 4BA7A 3N9JA 1X9SB 4HEA2 2YJ7A 4KGIA 2MMZA 1A23A 1TU8A 2A4HA 3MIXA 2VCTA 4ZL8A 1SL2B 2R0GA 3MWHA 4DEJA 3KM6A 4K1FA 2B1LA 3OR5A 2AUVA 3VWWA 5IMCA 1SD8A 2JU5A 3EWLA 4G19A 3KZQA 2E7PA 4CDOA 4O7HA 2HLSA 2LNTA 1LJRA 1TP9A 3G9BA 3RBTA 4RUVA 1PGTA 4IJ3A 1TRVA 2AAWA 4YAPA 1H4OA 1V2AA 1PA3A 2H6XA 2RLIA 1F6MC 3A5IA 1Q98A 3LYPA 4O5UA 4K5SA 4YKGA 2H30A 4KSMA 4IN0A 6GSWA 3ZMLA 1S3AA 4DSSA 4EF0A 5J4UA 1V40A 4TN8A 3GV1A 4POMA 4EUYA 1RQMA 4F82A 2F9SA 3FR9A 4ULXA 1XWKA 2D2ZA 1U3IA 4NV2A 2XC2A 1O85A 2OE1A 3GUSA 1JZRA 3ERGA 2OACA 3TKSA 4WR5A 3TJJA 1A2JA 2EIOA 2I9HA 1ABAA 1BG5A 3F4RA 3M1GA 4HS1A 3KP8A 1Z5YE 2DLXA 5D9TA 5J9CA 3SBCA 2OE0A 1RK4A 4EDZA 3D6IA 3GYKA 3VURA 2BTOT 2VL9A 4O32A 4GLTA 5G5FA 4DSRA 3WT2A 4WEYA 4IP1A 3P90A 3IR4A 4BVXA 4MP4A 2J9HA 4MF6A 1PL2A 1OC3A 2PN8A 1EGRA 4OFMA 1M2AA 2YV9A 4I2UA 2B3SA 2DC5A 2YZHA 4PQIA 2FGXA 3KP9A 2XBQA 1PL1A 4F0CA 1ERTA 2NDOA 1R5PA 2DKHA 4HQSA 1AQVA 1M0UA 4AJ6A 5D96A 2RIIA 1UVZA 1K0NA 3HD5A 4BVYA 5IMZA 1HNBA 4OCFA 5F07A 1B4QA 4XS4B 3F8UA 1GLQA 3GX0A 4YQUA 4TR3A 2FD3A 2YWNA 1OAZA 1ON4A 3EE2A 3TOTA 3KJYA 2VCWA 5GAPD 2KUCA 3GKKA 3HA9A 3VI5A 4KDUA 4MLYA 1HNCA 4MJCA 5ECRB 1SD9A 2ZUPA 3BJ5A 3DRNA 1B8XA 2IN3A 3KCMA 2R3XA 2CVDA 1J0FA 3UBLA 3E9JB 2R2JA 4NPBA 1XXUA 2R37A 2WRTA 2HZEB 2WDUA 3A5WA 5IMVA 4ZIJA 2IPAA 2CAQA 2P5RA 4BPYA 4ZL9A 3UAPA 6GSYA 5DCGA 4BWSA 1S3RA 2XPDA 4F03A 1J08A 1YF0A 4WBJA 4GF0A 3GSTA 1TKDB 4KCAA 17GSA 3TGZA 2EIQA 3J7Yb 3DD3A 1OC9A 3P2AA 3QR6A 5AIXA 1GSSA 2LJAA 2GSTA 3DGQA 5CRWA 1G6YA 2H6ZA 4HZ4A 5ECOB 4HU9A 5AISA 4G0KA 4XRDA 4GXZA 2N5FA 2N5BA 1M7TA 2WB9A 1E2YA 2C0EA 2L5OA 1GSDA 2X8HA 2OA7A 1OVNA 4N0ZA 4KF9A 3DEXA 2ALBA 5EVOA 1MTCA 2IJYA 2IMEA 4BL7B 3UJ1A 1OE8A 2REMA 4F2IA 5KOWA 2JZTA 2IFQA 1VRSD 1U3AA 3L9VA 2VD0A 5H5RA 1U87A 3MSZA 3G7JA 4EDYA 1GUKA 1SK0A 2OJLA 3FR6A 3GRXA 1A2LA 5HFGA 5ECHB 3FHKA 4ECIA 1X5EA 2V2GA 4LL1B 3RAZA 3BD2A 4Q5FA 1SL0B 1U6TA 3GURA 2X64A 5G30A 3IC4A 2MMAA 4G9HA 2L6DA 1TRWA 1MEKA 2H0IA 4KUNA 1R7HA 4AJ7A 1S3DA 1TI1A 2DMMA 3EPTA 4XCSA 1BYEA 3CTGA 3LFLA 4I5QA 4ZXGA 3A2WA 1OYJA 3APOA 1URMA 4HJMA 2A4VA 3ZZXA 2H1GA 3E3EA 2JSYA 4XHMA 1TXXA 4PNGA 5FWGA 3RHCA 5G5EA 1K0OA 4MF7A 2YPMA 4P3YB 1FOVA 1TJDA 1THXA 3VWXA 3H8QA 6GSTA 22GSA 4DSSB 2ZCTA 4PXOA 1R5AA 5F06A 2GZYA 8GSSA 4FQUA 5LNKe 4AJ8A 1WOUA 3IRAA 4X1UA 5AN1A 4HSCX 3PINA 5DQSA 4EE0A 3TJKA 2FA4A 3HVNA 1EOGA 2YV7A 3KGKA 4IKHA 3MAKA 5D8IA 3VFIA 1I9DA 1SYXA 4NAXA 4TR0A 1F3AA 2H74A 2O8VB 1M9AA 5JWRB 4XS6A 3FZ4A 5AIVA 5LD0A 4WR4A 5G31A 2GZZA 3ME7A 3C7MA 4YAVA 1WP0A 1O8WA 4K7NA 3DWVA 4HDEA 2GGTA 2IMFA 4BVXB 4G0LA 2LV3A 5G1KA 2NPBA 1PD21 1AQWA 2R5GA 5D93A 1THOA 3EVIA 3UARA 1M2DA 2FA8A 2ON7A 4I6XA 1XCCA 4CW9A 1UA5A 3LQ7A 3S9FA 4QL9A 1A24A 3L9UA 5J5NA 4ID0A 2GT5A 2H71A 2VD1A 5ECNB 2VCZA 2AB6A 3Q74A 4WF5A 3F3QA 2C0FA 2V6OA 2C0GA 5L71A 1UN2A 3TB2A 3VPQA 4IP6A 3VWVA 3KTBA 3EU4A 5G2ZA 3WT1A 1TK0B 2H6YA 5IO0A 4Z2RA 3W8SA 1Z6NA 4V2LA 5DQYA 3H4KA 4HOJA 2XPEA 4IJIA 4L5LA 3HJPA 3FZ5A 1DSBA 4EO3A 4HQZA 3L78A 1SU9A 2K6VA 3W6GA 4KW6A 2HRAA 3GKXA 2O7KA 4Z7XA 2X8GA 4CHSA 5JWOB 1TI3A 3UL3A 1EV9A 2L6CA 1TRUA 3VWUA 2CX3A 1EV4A 2H66A 2OE3A 4GSNA 1RW1A 3TOUA 4YH2A 2WFCA 4PQ1A 1ZYQB 4EIQA 3ZLPA 2QKEA 1A8YA 3IAM2 3TKRA 4NHZA 2Z9SA 4EL1A 2B5XA 3C73A 1EGOA 5HFIA 2ZNMA 4NMUA 2WCIA 4I97A 3UOMA 1OC9B 4OMVA 4IVFA 2MMNA 3F6FA 1ERVA 2HSYA 3FMWA 5DALA 5HFKA 4E8HA 1XFLA 1XOAA 3IK7A 3ZFBA 2WGRA 1QQ2A 2K8VA 3O6TA 4PUFC 3US3A 3G7YA 3H79A 1VF1A 1EEJA 1K0DA 4Q5QA 4TXOA 4MJBA 1BEDA 1JZWA 4PX1A 3IOSA 4NWYA 2AV4A 3APSA 3LJRA 5D9VA 2IFQB 1HNAA 5HR2A 2FNOA 1YY7A 3QAVA 5G1LA 3BBYA 4GSSA 4PNFA 4TR4A 4WXTA 4FO5A 1ZOFA 1FW1A 4V1Ag 2XBIA 2G2QA 1N2AA 3TJGA 3VI7A 2CQ9A 1AC1A 1IYIA 2VL3A 1WJKA 1ZMAA 4J57E 1SKWB 2HSHA 2YCDA 1T1VA 4XRAA 1KEBA 1HD2A 4WBRD 2A2SA 5A4VA 4CY8A 1M3IA 3BOAA 3RHBA 1PFOA 4MNNA 2LSTA 2GSSA 2PUKC 3EU3A 3QFAC 2KLXA 1X9WB 2PERA 5C04A 2V41A 2VL2C 3LWAA 4K0NA 4DVCA 2JADA 3RPPA 1A8LA 3LXZA 1O6JA 1GSYA 5JCWA 3IXRA 5CO3A 1SENA 5ECQB 6GSSA 4IELA 1SJIA 1XOBA 3CSJA 1XVWA 3FYGA 3R2QA 2H72A 2FY6A 3I6AA 4K2DA 2N5AA 1GTUA 4ZBAA 1JLVA 2HRNA 2MYGA 2OBKA 2I81A 4JBBA 10GSA 1K0MA 4L0WA 3DXBA 4FYBA 5EY6A 3QDNA 5KN1A 2FWHA 2H01A 2GSRA 3NZNA 3UIWA 5DAKA 1VGLA 5B8AA 3FY7A 1EZKA 1BQ7A 4HUAA 4QQ7A 1Z7RA 2V32A 1J9BA 1ZZYA 3C1RA 3F4TA 4JEDA 2CVKA 5IIZA 3A2XA 4L5OA 3L9SA 3H93A 1WE0A 19GSA 2E2GA 4GQCA 3IAS2 1H75A 1YF1A 4AF2A 1XG8A 2EC4A 1YKAA 3DKSA 3QD9A 2VUPA 2CV4A 3GIXA 3ME8A 4ZB9A 4IQ1A 1GP1A 2YNXA 1JHBA 5B7CA 1MD4A 2HRKA 1LBKA 5COHA 5IO2A 4I8BA 2VM1A 3GSSA 1B48A 3LORA 3TRQA 2PMTA 5B6NA 1AIUA 3ZMKA 1T4ZA 2C3NA 3P8WA 4J56E 1MD3A 2C1YA 4TR1A 4V1Ap 4X0XA 5IOWA 3RPNA 4J2FA 5DDLA 2H1DA 3ZREA 2OBIA 1AUCA 1GL8A 4HZ2A 11GSA 1G7EA 2FUG2 1K3OA 3C8EA 3FEUA 4X4JA 2GQLA 4ZB8A 5F05A 2M80A 1YDKA 2R4VA 5HR0A 4EC0A 5BMUA 4ZB6A 3LW9A 1FG4A 4MABA 3M3MA 1WRYA 1ZYPA 2VL2A 4ISDA 2B7JA 3KH7A 1UC7A 2DKIA 2GT6A 3TKSE 2JSZA 4PGTA 3ZIVA 2TRCP 2CZ2A 5GZZB 1NM3A 2P5QA 3VK9A 2BJXA 2H73A 4EXJA 4ZBBA 3KXOA 1V9WA 2B5EA 1GNEA 1HQOA 5DALB 4K5RA 2LKUA 1BJXA 2VLTA 1O81A 2KHPA 1CQGA 1Y25A 2CZ3A 4K9ZA 3U5RE 2H8LA 3F0IA 5LCZA 2WJUA 1WMJA 5BRTA 3F3RA 5CP1A 4TXOB 4JU5A 2PGTA 2DIZA 5CNWA 3Q18A 3F9UA 18GSA 3CYNA 3I43A 4KSOA 5KEJA 4E8EA 5KN0A 2MBSA 4G10A 2MMOA 3IHQA 1XW6A 1YKCA 2GLRA 2B7KA 3KTLA 1ZYNA 3ZFLA 3IBHA 4TW5A 3HY2A 4OD7A 3H1NA 2DJJA 4O5QA 2DBCA 2VOCA 1X9MB 4RQRA 3GKNA 3UVHA 1OKTA 14GSA 4KDYA 3GN3A 2HE3A 3EC3A 4OWYA 4ML6A 3WD6A 3UEMA 1GLPA 2RM6A 5J9BA 4NV5A 3ZRDA 2L57A 5CRHA 2PWJA 2EIRA 1QGVA 4K2XA 1XWCA 3DMLA 2VCVA 4PQHA 3WGXA 1USBA 1EP7A 3SWLA 1XPVA 1M9BA 5CRDA 4KNDA 3K8NA 3CSIA 3W8JA 1NHYA 1WPIA 2OADA 3PPUA 2YZUA 2DJ2A 1XW9A 4LMWA 9GSSA 2HI7A 2IWTA 3QPMA 1A0FA 4EIPA 3MNGA 4JE1A 3NIVA 3TUEA 1PSQA 4N11A 3WYWA 2H75A 2I4AA 2YWOA 4YQMA 3QFBC 4TVEA 4LL4B 4JR4A 3IE3A 3ED3A 2FLSA 4MH2A 4PUAA 5DAKB 5FT3A 5H5QA 5E4WA 2YOIA 3KMNA 1K0BA 2KOKA 4BWQA 1JZDA 3O3TA 1W89A 3FZ9A 4FYUA 4ZBDA 4USSA 1R26A 3C71A 2RUFA 2CX4A 3N5OA 2VO4A 4TXVA 4BVYB 1FO5A 4KCEA 3PGTA 4NXIA 3QMXA 1ACVA 5ELAA 3AY8A 2F8FA 3GL3A 1V57A 2DIYA 4IS0A 1W4VA 1ZCPA 3C1SA 2QC7A 1Y6EA 1QUWA 1GSUA 2O87A 1T00A 4MJAA 3QCPA 1K0AA 5ID2A 4JR6A 1XZOA 3M0FA 4I2TA 1GWCA 2YANA 3EURA 3TRXA 1A0RP 3WGDA 1GTIA 1X0RA 1T3BA 3HHVA 3LGCA 3ZYWA 3KMOA 5IOXA 4V2NA 4N30A 4DSQA 3TJFA 4TR1B 4OCEA 2GS3A 3ERFA 4MPFA 3GTUA 5DJMA 2NTOA 4RI7A 1QMVA 2FHEA 5C00A 5KOXA 1ZGNA 1PX7A 3HYPA 4HU7A 3E0UA 1TU7A 5B6MA 4BIKA 3HJMA 1ILOA 3GFKA 1QXHA 1WIKA 1F2EA 2QGVA 1K3YA 1B9YC 5AGYA 1CQHA 1M2BA 2PBJA 4Q5NA 4MCUA 4QL7A 4KA0A 1XVQA 5IPGA 4MK3A 1DUGA 3J7Yk 4K0GA 3LEFA 1YEPA 3F6DA 3IDVA 3IHGA 4LA1A 2LRTA 4K7IA 4ACSA 1ZYEA 5ENUA 2IMIA 2R0CA 5INYA 1MDJA 2H76A 2CVBA 1VF3A 2VIMA 2DJ0A 2IMDA 3NOFA 2TRXA 1B4PA 2H0GA 2L59A 5KN2A 1S3CA 1KBNA 1G6WA 1GUMA 3TCOA 4FH8A 4GSTA 2WZ9A 4Q5RA 3EYTA 4ZL7A 16GSA 6GSUA 1BX9A 2QSIA 1MDKA 2DJ3A 4CY6A 3L4NA 3EMPA 3VLNA 2M72A 1XWAA 4FIWA 4A5PA 5CAXA 2GVPA 4IHUA 3CBUA 3LXTA 3FRCA 3QAGA 4O92A 3CSHA 3LSZA 4Z2UA 2HRFA 1TW9A 4K8MA 2JZSA 1FVKA 5ELGA 2VM2A 1ERUA 4IW9A 2FCHA 5IMFA 4Z2TA 4KH7A 3BCIA 1ZL9A 1XW5A 5B8BA 1GRXA 1NW2A 2A2RA 4G2EA 5JWQB 5IMAA 2LS5A 2A2PA 1GH2A 3IPZA 2KP1A 1VF4A 3A2VA 1Q4JA 2DJ1A 5J3RA 5F8BA 1SK2A 2IL3A 1YZXA 4KDXA 1I5GA 2YWMA 1WWJA 4WETA 5HR3A 4F9ZA 2K9FA 2ON5A 5JCGA 5D9XA 3HKRA 2K8SA 3FK8A 2LRCA 3HVXA 2JZRA 2CA8A 1Z7PA 3A3TA 4EVMA 3CQFA 1EOHA 2V6KA 2H19A 3HXSA 4MJEA 5J41A 1AW9A 1KTEA 1FOHA 2VCXA 3DYRA 1SYRA 2DMLA 1K0CA 4KAEA 5CYYA 1DBYA 3QAWA 3LG6A 2L4CA 2H0HA 2GSQA 3GNJA 1JZOA 3HZ8A 2HT9A 5D73A 1O73A 2P31A 2LJKA 4ILFA 1X5CA 2C3QA 3UMAA 4OFTA 2G0FA 2X49A 1V58A 1NSWA 2H1BA 1PN0A 4FYCA 3GH6A 1R4WA 4GCIA 5ID2B 1TK8B 3IK9A 1O7UA 4GWRA 3FW2A 4G0IA 1YQ1A 3DIEA 4D73A 3D22A 1M3JA 3GHAA 3GKMA 5ECSA 2F51A 3HVVA 2PVOC 4MF5A 3G7IA 3EMXA 2FWEA 2PVQA 4POLA 1Z3EA 1XIYA 1SL1B 3ZITA 5JCUA 2YN1A 2HSMA 5ECLB 4WKWA 2YJHA 6GSVA 2LRNA 3GA4A 3HZ4A 3UVTA 5DVBA 4GRFA 1GTAA 5ECPB 2B1KA 5A5KA 4HJ2A 3GTUB 4OO5A 3KH9A 4K7OA 1YJ6A 1VF2A 5ABRA 2O89A 3TKPA 2GDRA 1O8XA 4HI7A 2AHEA 4OO4A 2C4JA 3L0HA 2VAFA 7GSSA 1FHEA 2RM5A 3CTFA 3CXGA 1AAZA 1SKSB 4ZILA 1Z6MA 5D9WA 2RUEA 4POKA 4IQAA 1T7PB 4OFNA 3O76A 2GTUA 3QOUA 2X99A 5CREA 5DJLA 2HYXA 2MZCA 2HXKA 3TDGA 2E0QA 1SJ6A 6GSXA 1EEMA 5ECMB 2IMKA 1FB6A 2X4AA 1KNGA 3CRTA 1PN9A 2YWIA 2PPTA 3WGEA 3VPTA 3FR3A 1FB0A 3TJBA 2HNLA 1TK5B 4YQVA 2K18A 1OC8A 2VLVA 4AGSA 2R0PA 1E6BA 2WULA 4ECCA 4XS1A 3D0ZA 3BCKA 4N0VA 3EINA 3M9KA 3GL5A 2I1UA 5KN3A 1PRXA 2BMXA 1XWGA 3DVWA 5A4WA 3Q19A 4O5RA 1OE7A 4GQFA 1M99A 3ZL5A 3ERWA 4NHWA 3IC8A 3TRPA 1F3BA 4KE3A 3R3EA 1EP8A 4YKFA 3KEBA 3ZTLA 1PQNA 2QA1A 3ZVJA 1QFNA 4XIHA 5GSSA 1Z9HA 2NBSA 4WF4A 1A2MA 4GTUA 5A4UA 2I3YA 5GAND 3RDWA 1IYHA 2AJQB 4MMMA 3ISOA 5DBQA 2KP2A 2AYTA 2LEGA 2GZPA 2M46A 4MZWA 2QA2A 2GQMA 4PURA 3F63A 4MDCA 3LYKA 1GUHA 2L5LA 1MDIA 1JLWA 3P7XA 2YP6A 3PR8A 1XWBA 3Q6OA 4IBPA 2C0DA 3D5JA 5F0GA 3DVXA 3FKFA 1B9XC 4TKYA 3M9JA 3D4MA 1HYUA 2DJKA 4MPGA 2MBTA 1XBSA 2H1AA 3PH9A 3HVSA 3MYDA 4H86A 4ICYA 2CAIA 2F3MA 5H5SA 1AQXA 1TOFA 2CT6A 20GSA 2B6MA 1TRSA 2OKAA 3D21A 3CMIA 3ZVJD 3GH9A 1NHOA 4K6XA 13GSA 12GSA 1SKRB 4RQXA 2J23A 2X8CA 2V1MA 1U88A 1FAAA 1V98A 1DE1A 1SK1A 4L0UA 1JFUA 5ECKB 1LU4A 3JCML 2C3TA 1BAYA 4ML1A 4ECBA 2VCQA 2P0GA 1QK8A 5IQYA 2B5YA 4MZBA 5IPHA 4TRXA 1PX6A 4EKZA 5HR1A 4TOPA 1DE2A 5EL8A 1OKDA 4V2MA 4N10A 1SJZA 4RI6A 1F9MA 1ERWA 4X43A 1PKZA 3APQA 2LJRA 4KX4A 4XS4A 3ZIJA 2TIRA 2VLUA 2IIYA 5FHIA 2C8UA 2C80A 4POBA 3V1WA 4LLRA 3HJOA 2LQQA 1PMTA 2HFDA 4L8EA 4KB3A 2PU9C 4XTSA 3KIJA 2LNSA 2ES7A 3HDCA 1YEXA 4IGJA 4MH3A 3CRUA 3TKQA 3UBKA 2JACA 1ST9A 3HCZA 1G0TA 1X5DA 4F0BA 1GSQA 2DSAA 5E59A 2HZFA 2GQKA 5GSTA 4JZQA 2R6KA 2F8AA 1F37A 5IM9A 1ML6A 3TKSC 3I9V2 2LQOA 4D73B 2UZ8A 2HZEA 5IMDA 2E2MA 1GSEA 2JL4A 5ECIB 3F4SA 2LUSA 1T8EB 5CRGA 4MA9A 1FVJA 2NVLA 1T4YA 2FWGA 1EWXA 3M8NA 2FWFA 3FZAA 4JRRA 4ECJA 2XHFA 1GSFA 5DCHA 2O85A 2H70A 3GX8A 1TTZA 1N8JA 2LTKA 3U6VA 3D4TA 1AXDA 4MZCA 1G7OA 5HQPA 1TDIA 1PKWA 1GULA 1GNWA 4BL7A 1K3LA 2WS2A 1C72A 3GMFA 4LMVA 1GTBA 3IV4A 3IA1A
chains in the Genus database with same CATH topology
3MDKA 4PTSA 5EPFA 3KD0A 2L4QA 3I69A 4BA7A 3N9JA 1X9SB 4HEA2 2YJ7A 4KGIA 2MMZA 1A23A 1TU8A 2A4HA 3MIXA 2VCTA 4ZL8A 1SL2B 2R0GA 3MWHA 4DEJA 3KM6A 4K1FA 2B1LA 3OR5A 2AUVA 3VWWA 5IMCA 1SD8A 2JU5A 3EWLA 4G19A 3KZQA 2E7PA 4CDOA 4O7HA 2HLSA 2LNTA 1LJRA 1TP9A 3G9BA 3RBTA 4RUVA 1PGTA 4IJ3A 1TRVA 2AAWA 4YAPA 1H4OA 1V2AA 1PA3A 2H6XA 2RLIA 1F6MC 3A5IA 1Q98A 3LYPA 4O5UA 4K5SA 4YKGA 2H30A 4KSMA 4IN0A 6GSWA 3ZMLA 1S3AA 4DSSA 4EF0A 5J4UA 1V40A 4TN8A 3GV1A 4POMA 4EUYA 1RQMA 4F82A 2F9SA 3FR9A 4ULXA 1XWKA 2D2ZA 1U3IA 4NV2A 2XC2A 1O85A 2OE1A 3GUSA 1JZRA 3ERGA 2OACA 3TKSA 4WR5A 3TJJA 1A2JA 2EIOA 2I9HA 1ABAA 1BG5A 3F4RA 3M1GA 4HS1A 3KP8A 1Z5YE 2DLXA 5D9TA 5J9CA 3SBCA 2OE0A 1RK4A 4EDZA 3D6IA 3GYKA 3VURA 2BTOT 2VL9A 4O32A 4GLTA 5G5FA 4DSRA 3WT2A 4WEYA 4IP1A 3P90A 3IR4A 4BVXA 4MP4A 2J9HA 4MF6A 1PL2A 1OC3A 2PN8A 1EGRA 4OFMA 1M2AA 2YV9A 4I2UA 2B3SA 2DC5A 2YZHA 4PQIA 2FGXA 3KP9A 2XBQA 1PL1A 4F0CA 1ERTA 2NDOA 1R5PA 2DKHA 4HQSA 1AQVA 1M0UA 4AJ6A 5D96A 2RIIA 1UVZA 1K0NA 3HD5A 4BVYA 5IMZA 1HNBA 4OCFA 5F07A 1B4QA 4XS4B 3F8UA 1GLQA 3GX0A 4YQUA 4TR3A 2FD3A 2YWNA 1OAZA 1ON4A 3EE2A 3TOTA 3KJYA 2VCWA 5GAPD 2KUCA 3GKKA 3HA9A 3VI5A 4KDUA 4MLYA 1HNCA 4MJCA 5ECRB 1SD9A 2ZUPA 3BJ5A 3DRNA 1B8XA 2IN3A 3KCMA 2R3XA 2CVDA 1J0FA 3UBLA 3E9JB 2R2JA 4NPBA 1XXUA 2R37A 2WRTA 2HZEB 2WDUA 3A5WA 5IMVA 4ZIJA 2IPAA 2CAQA 2P5RA 4BPYA 4ZL9A 3UAPA 6GSYA 5DCGA 4BWSA 2XPDA 4F03A 1J08A 1YF0A 4WBJA 4GF0A 3GSTA 1TKDB 4KCAA 17GSA 3TGZA 2EIQA 3J7Yb 3DD3A 1OC9A 3P2AA 3QR6A 5AIXA 1GSSA 2LJAA 2GSTA 3DGQA 5CRWA 1G6YA 2H6ZA 4HZ4A 5ECOB 4HU9A 5AISA 4G0KA 4XRDA 4GXZA 2N5FA 2N5BA 1M7TA 2WB9A 1E2YA 2C0EA 2L5OA 1GSDA 2X8HA 2OA7A 1OVNA 4N0ZA 4KF9A 3DEXA 2ALBA 5EVOA 1MTCA 2IJYA 2IMEA 4BL7B 3UJ1A 1OE8A 2REMA 4F2IA 5KOWA 2JZTA 2IFQA 1VRSD 1U3AA 3L9VA 2VD0A 5H5RA 1U87A 3MSZA 3G7JA 4EDYA 1GUKA 1SK0A 2OJLA 3FR6A 3GRXA 1A2LA 5HFGA 5ECHB 3FHKA 4ECIA 1X5EA 2V2GA 4LL1B 3RAZA 3BD2A 4Q5FA 1SL0B 1U6TA 3GURA 2X64A 5G30A 3IC4A 2MMAA 4G9HA 2L6DA 1TRWA 1MEKA 2H0IA 4KUNA 1R7HA 4AJ7A 1S3DA 1TI1A 2DMMA 3EPTA 4XCSA 1BYEA 3CTGA 3LFLA 4I5QA 4ZXGA 3A2WA 1OYJA 3APOA 1URMA 4HJMA 2A4VA 3ZZXA 2H1GA 3E3EA 2JSYA 4XHMA 1TXXA 4PNGA 5FWGA 3RHCA 5G5EA 1K0OA 4MF7A 2YPMA 4P3YB 1FOVA 1TJDA 1THXA 3VWXA 3H8QA 6GSTA 22GSA 4DSSB 2ZCTA 4PXOA 1R5AA 5F06A 2GZYA 8GSSA 4FQUA 5LNKe 4AJ8A 1WOUA 3IRAA 4X1UA 5AN1A 3PINA 5DQSA 4EE0A 3TJKA 2FA4A 1EOGA 2YV7A 3KGKA 4IKHA 3MAKA 5D8IA 3VFIA 1I9DA 1SYXA 4NAXA 4TR0A 1F3AA 2H74A 2O8VB 1M9AA 5JWRB 4XS6A 3FZ4A 5AIVA 5LD0A 4WR4A 5G31A 2GZZA 3ME7A 3C7MA 4YAVA 1WP0A 1O8WA 4K7NA 3DWVA 4HDEA 2GGTA 2IMFA 4BVXB 4G0LA 2LV3A 5G1KA 2NPBA 1PD21 1AQWA 2R5GA 5D93A 1THOA 3EVIA 3UARA 1M2DA 2FA8A 2ON7A 4I6XA 1XCCA 4CW9A 1UA5A 3LQ7A 3S9FA 4QL9A 1A24A 3L9UA 5J5NA 4ID0A 2GT5A 2H71A 2VD1A 5ECNB 2VCZA 2AB6A 3Q74A 4WF5A 3F3QA 2C0FA 2V6OA 2C0GA 5L71A 1UN2A 3TB2A 3VPQA 4IP6A 3VWVA 3KTBA 3EU4A 5G2ZA 3WT1A 1TK0B 2H6YA 5IO0A 4Z2RA 3W8SA 1Z6NA 4V2LA 5DQYA 3H4KA 4HOJA 2XPEA 4IJIA 4L5LA 3HJPA 3FZ5A 1DSBA 4EO3A 4HQZA 3L78A 1SU9A 2K6VA 3W6GA 4KW6A 2HRAA 3GKXA 2O7KA 4Z7XA 2X8GA 4CHSA 5JWOB 1TI3A 3UL3A 1EV9A 2L6CA 1TRUA 3VWUA 2CX3A 1EV4A 2H66A 2OE3A 4GSNA 1RW1A 3TOUA 4YH2A 2WFCA 4PQ1A 1ZYQB 4EIQA 3ZLPA 2QKEA 1A8YA 3IAM2 3TKRA 4NHZA 2Z9SA 4EL1A 2B5XA 3C73A 1EGOA 5HFIA 2ZNMA 4NMUA 2WCIA 4I97A 3UOMA 1OC9B 4OMVA 4IVFA 2MMNA 3F6FA 1ERVA 2HSYA 3FMWA 5DALA 5HFKA 4E8HA 1XFLA 1XOAA 3IK7A 3ZFBA 2WGRA 1QQ2A 2K8VA 3O6TA 4PUFC 3US3A 3G7YA 3H79A 1VF1A 1EEJA 1K0DA 4Q5QA 4TXOA 4MJBA 1BEDA 1JZWA 4PX1A 3IOSA 4NWYA 2AV4A 3APSA 3LJRA 5D9VA 2IFQB 1HNAA 5HR2A 2FNOA 1YY7A 3QAVA 5G1LA 3BBYA 4GSSA 4PNFA 4TR4A 4WXTA 4FO5A 1ZOFA 1FW1A 4V1Ag 2XBIA 2G2QA 1N2AA 3TJGA 3VI7A 2CQ9A 1AC1A 1IYIA 2VL3A 1WJKA 1ZMAA 4J57E 1SKWB 2HSHA 2YCDA 1T1VA 4XRAA 1KEBA 1HD2A 4WBRD 2A2SA 5A4VA 4CY8A 3BOAA 3RHBA 4MNNA 2LSTA 2GSSA 2PUKC 3EU3A 3QFAC 2KLXA 1X9WB 2PERA 5C04A 2V41A 2VL2C 3LWAA 4K0NA 4DVCA 2JADA 3RPPA 1A8LA 3LXZA 1O6JA 1GSYA 5JCWA 3IXRA 5CO3A 1SENA 5ECQB 6GSSA 4IELA 1SJIA 1XOBA 3CSJA 1XVWA 3FYGA 3R2QA 2H72A 2FY6A 3I6AA 4K2DA 2N5AA 1GTUA 4ZBAA 1JLVA 2HRNA 2MYGA 2OBKA 2I81A 4JBBA 10GSA 1K0MA 4L0WA 3DXBA 4FYBA 5EY6A 3QDNA 5KN1A 2FWHA 2H01A 2GSRA 3NZNA 3UIWA 5DAKA 1VGLA 5B8AA 3FY7A 1EZKA 1BQ7A 4HUAA 4QQ7A 1Z7RA 2V32A 1J9BA 1ZZYA 3C1RA 3F4TA 4JEDA 2CVKA 5IIZA 3A2XA 4L5OA 3L9SA 3H93A 1WE0A 19GSA 2E2GA 4GQCA 3IAS2 1H75A 1YF1A 4AF2A 2EC4A 1YKAA 3DKSA 3QD9A 2VUPA 2CV4A 3GIXA 3ME8A 4ZB9A 4IQ1A 1GP1A 2YNXA 1JHBA 5B7CA 1MD4A 2HRKA 1LBKA 5COHA 5IO2A 4I8BA 2VM1A 3GSSA 1B48A 3LORA 3TRQA 2PMTA 5B6NA 1AIUA 3ZMKA 1T4ZA 2C3NA 3P8WA 4J56E 1MD3A 2C1YA 4TR1A 4V1Ap 4X0XA 5IOWA 3RPNA 4J2FA 5DDLA 2H1DA 3ZREA 2OBIA 1AUCA 1GL8A 4HZ2A 11GSA 1G7EA 2FUG2 1K3OA 3C8EA 3FEUA 4X4JA 2GQLA 4ZB8A 5F05A 2M80A 1YDKA 2R4VA 5HR0A 4EC0A 5BMUA 4ZB6A 3LW9A 1FG4A 4MABA 3M3MA 1WRYA 1ZYPA 2VL2A 4ISDA 2B7JA 3KH7A 1UC7A 2DKIA 2GT6A 3TKSE 2JSZA 4PGTA 3ZIVA 2TRCP 2CZ2A 5GZZB 1NM3A 2P5QA 3VK9A 2BJXA 2H73A 4EXJA 4ZBBA 3KXOA 1V9WA 2B5EA 1GNEA 1HQOA 5DALB 4K5RA 2LKUA 1BJXA 2VLTA 1O81A 2KHPA 1CQGA 1Y25A 2CZ3A 4K9ZA 3U5RE 2H8LA 3F0IA 5LCZA 2WJUA 1WMJA 5BRTA 3F3RA 5CP1A 4TXOB 4JU5A 2PGTA 2DIZA 5CNWA 3Q18A 3F9UA 18GSA 3CYNA 3I43A 4KSOA 5KEJA 4E8EA 5KN0A 2MBSA 4G10A 2MMOA 3IHQA 1XW6A 1YKCA 2GLRA 2B7KA 3KTLA 1ZYNA 3ZFLA 3IBHA 4TW5A 3HY2A 4OD7A 3H1NA 2DJJA 4O5QA 2DBCA 2VOCA 1X9MB 4RQRA 3GKNA 3UVHA 1OKTA 14GSA 4KDYA 3GN3A 2HE3A 3EC3A 4OWYA 4ML6A 3WD6A 3UEMA 1GLPA 2RM6A 5J9BA 4NV5A 3ZRDA 2L57A 5CRHA 2PWJA 2EIRA 1QGVA 4K2XA 1XWCA 3DMLA 2VCVA 4PQHA 3WGXA 1USBA 1EP7A 3SWLA 1XPVA 1M9BA 5CRDA 4KNDA 3K8NA 3CSIA 3W8JA 1NHYA 1WPIA 2OADA 3PPUA 2YZUA 2DJ2A 1XW9A 4LMWA 9GSSA 2HI7A 2IWTA 3QPMA 1A0FA 4EIPA 3MNGA 4JE1A 3NIVA 3TUEA 1PSQA 4N11A 3WYWA 2H75A 2I4AA 2YWOA 4YQMA 3QFBC 4TVEA 4LL4B 4JR4A 3IE3A 3ED3A 2FLSA 4MH2A 4PUAA 5DAKB 5FT3A 5H5QA 5E4WA 2YOIA 3KMNA 1K0BA 2KOKA 4BWQA 1JZDA 3O3TA 1W89A 3FZ9A 4FYUA 4ZBDA 4USSA 1R26A 3C71A 2RUFA 2CX4A 3N5OA 2VO4A 4TXVA 4BVYB 1FO5A 4KCEA 3PGTA 4NXIA 3QMXA 1ACVA 5ELAA 3AY8A 2F8FA 3GL3A 1V57A 2DIYA 4IS0A 1W4VA 1ZCPA 3C1SA 2QC7A 1Y6EA 1QUWA 1GSUA 2O87A 1T00A 4MJAA 3QCPA 1K0AA 5ID2A 4JR6A 1XZOA 3M0FA 4I2TA 1GWCA 2YANA 3EURA 3TRXA 1A0RP 3WGDA 1GTIA 1X0RA 1T3BA 3HHVA 3LGCA 3ZYWA 3KMOA 5IOXA 4V2NA 4N30A 4DSQA 3TJFA 4TR1B 4OCEA 2GS3A 3ERFA 4MPFA 3GTUA 5DJMA 2NTOA 4RI7A 1QMVA 2FHEA 5C00A 5KOXA 1ZGNA 1PX7A 3HYPA 4HU7A 3E0UA 1TU7A 5B6MA 3HJMA 1ILOA 3GFKA 1QXHA 1WIKA 1F2EA 2QGVA 1K3YA 1B9YC 5AGYA 1CQHA 1M2BA 2PBJA 4Q5NA 4MCUA 4QL7A 4KA0A 1XVQA 5IPGA 4MK3A 1DUGA 3J7Yk 4K0GA 3LEFA 1YEPA 3F6DA 3IDVA 3IHGA 4LA1A 2LRTA 4K7IA 4ACSA 1ZYEA 5ENUA 2IMIA 2R0CA 5INYA 1MDJA 2H76A 2CVBA 1VF3A 2VIMA 2DJ0A 2IMDA 3NOFA 2TRXA 1B4PA 2H0GA 2L59A 5KN2A 1S3CA 1KBNA 1G6WA 1GUMA 3TCOA 4FH8A 4GSTA 2WZ9A 4Q5RA 3EYTA 4ZL7A 16GSA 6GSUA 1BX9A 2QSIA 1MDKA 2DJ3A 4CY6A 3L4NA 3EMPA 3VLNA 2M72A 1XWAA 4FIWA 4A5PA 5CAXA 2GVPA 4IHUA 3CBUA 3LXTA 3FRCA 3QAGA 4O92A 3CSHA 3LSZA 4Z2UA 2HRFA 1TW9A 4K8MA 2JZSA 1FVKA 5ELGA 2VM2A 1ERUA 4IW9A 2FCHA 5IMFA 4Z2TA 4KH7A 3BCIA 1ZL9A 1XW5A 5B8BA 1GRXA 1NW2A 2A2RA 4G2EA 5JWQB 5IMAA 2LS5A 2A2PA 1GH2A 3IPZA 2KP1A 1VF4A 3A2VA 1Q4JA 2DJ1A 5J3RA 5F8BA 1SK2A 2IL3A 1YZXA 4KDXA 1I5GA 2YWMA 1WWJA 4WETA 5HR3A 4F9ZA 2K9FA 2ON5A 5JCGA 5D9XA 3HKRA 2K8SA 3FK8A 2LRCA 3HVXA 2JZRA 2CA8A 1Z7PA 3A3TA 4EVMA 1EOHA 2V6KA 2H19A 3HXSA 4MJEA 5J41A 1AW9A 1KTEA 1FOHA 2VCXA 3DYRA 1SYRA 2DMLA 1K0CA 4KAEA 5CYYA 1DBYA 3QAWA 3LG6A 2L4CA 2H0HA 2GSQA 3GNJA 1JZOA 3HZ8A 2HT9A 5D73A 1O73A 2P31A 2LJKA 4ILFA 1X5CA 2C3QA 3UMAA 4OFTA 2G0FA 2X49A 1V58A 1NSWA 2H1BA 1PN0A 4FYCA 3GH6A 1R4WA 4GCIA 5ID2B 1TK8B 3IK9A 1O7UA 4GWRA 3FW2A 4G0IA 1YQ1A 3DIEA 4D73A 3D22A 3GHAA 3GKMA 5ECSA 2F51A 3HVVA 2PVOC 4MF5A 3G7IA 3EMXA 2FWEA 2PVQA 4POLA 1Z3EA 1XIYA 1SL1B 3ZITA 5JCUA 2YN1A 2HSMA 5ECLB 4WKWA 2YJHA 6GSVA 2LRNA 3GA4A 3HZ4A 3UVTA 5DVBA 4GRFA 1GTAA 5ECPB 2B1KA 5A5KA 4HJ2A 3GTUB 4OO5A 3KH9A 4K7OA 1YJ6A 1VF2A 5ABRA 2O89A 3TKPA 2GDRA 1O8XA 4HI7A 2AHEA 4OO4A 2C4JA 3L0HA 2VAFA 7GSSA 1FHEA 2RM5A 3CTFA 3CXGA 1AAZA 1SKSB 4ZILA 1Z6MA 5D9WA 2RUEA 4POKA 4IQAA 1T7PB 4OFNA 3O76A 2GTUA 3QOUA 2X99A 5CREA 5DJLA 2HYXA 2MZCA 2HXKA 3TDGA 2E0QA 1SJ6A 6GSXA 1EEMA 5ECMB 2IMKA 1FB6A 2X4AA 1KNGA 3CRTA 1PN9A 2YWIA 2PPTA 3WGEA 3VPTA 3FR3A 1FB0A 3TJBA 2HNLA 1TK5B 4YQVA 2K18A 1OC8A 2VLVA 4AGSA 2R0PA 1E6BA 2WULA 4ECCA 4XS1A 3D0ZA 3BCKA 4N0VA 3EINA 3M9KA 3GL5A 2I1UA 5KN3A 1PRXA 2BMXA 1XWGA 3DVWA 5A4WA 3Q19A 4O5RA 1OE7A 4GQFA 1M99A 3ZL5A 3ERWA 4NHWA 3IC8A 3TRPA 1F3BA 4KE3A 3R3EA 1EP8A 4YKFA 3KEBA 3ZTLA 1PQNA 2QA1A 3ZVJA 1QFNA 4XIHA 5GSSA 1Z9HA 2NBSA 4WF4A 1A2MA 4GTUA 5A4UA 2I3YA 5GAND 3RDWA 1IYHA 2AJQB 4MMMA 3ISOA 5DBQA 2KP2A 2AYTA 2LEGA 2GZPA 2M46A 4MZWA 2QA2A 2GQMA 4PURA 3F63A 4MDCA 3LYKA 1GUHA 2L5LA 1MDIA 1JLWA 3P7XA 2YP6A 3PR8A 1XWBA 3Q6OA 4IBPA 2C0DA 3D5JA 5F0GA 3DVXA 3FKFA 1B9XC 4TKYA 3M9JA 3D4MA 1HYUA 2DJKA 4MPGA 2MBTA 1XBSA 2H1AA 3PH9A 3HVSA 3MYDA 4H86A 4ICYA 2CAIA 2F3MA 5H5SA 1AQXA 1TOFA 2CT6A 20GSA 2B6MA 1TRSA 2OKAA 3D21A 3CMIA 3ZVJD 3GH9A 1NHOA 4K6XA 13GSA 12GSA 1SKRB 4RQXA 2J23A 2X8CA 2V1MA 1U88A 1FAAA 1V98A 1DE1A 1SK1A 4L0UA 1JFUA 5ECKB 1LU4A 3JCML 2C3TA 1BAYA 4ML1A 4ECBA 2VCQA 2P0GA 1QK8A 5IQYA 2B5YA 4MZBA 5IPHA 4TRXA 1PX6A 4EKZA 5HR1A 4TOPA 1DE2A 5EL8A 1OKDA 4V2MA 4N10A 1SJZA 4RI6A 1F9MA 1ERWA 4X43A 1PKZA 3APQA 2LJRA 4KX4A 4XS4A 3ZIJA 2TIRA 2VLUA 2IIYA 5FHIA 2C8UA 2C80A 4POBA 3V1WA 4LLRA 3HJOA 2LQQA 1PMTA 2HFDA 4L8EA 4KB3A 2PU9C 4XTSA 3KIJA 2LNSA 2ES7A 3HDCA 1YEXA 4IGJA 4MH3A 3CRUA 3TKQA 3UBKA 2JACA 1ST9A 3HCZA 1G0TA 1X5DA 4F0BA 1GSQA 2DSAA 5E59A 2HZFA 2GQKA 5GSTA 4JZQA 2R6KA 2F8AA 1F37A 5IM9A 1ML6A 3TKSC 3I9V2 2LQOA 4D73B 2UZ8A 2HZEA 5IMDA 2E2MA 1GSEA 2JL4A 5ECIB 3F4SA 2LUSA 1T8EB 5CRGA 4MA9A 1FVJA 2NVLA 1T4YA 2FWGA 1EWXA 3M8NA 2FWFA 3FZAA 4JRRA 4ECJA 2XHFA 1GSFA 5DCHA 2O85A 2H70A 3GX8A 1TTZA 1N8JA 2LTKA 3U6VA 3D4TA 1AXDA 4MZCA 1G7OA 5HQPA 1TDIA 1PKWA 1GULA 1GNWA 4BL7A 1K3LA 2WS2A 1C72A 3GMFA 4LMVA 1GTBA 3IV4A 3IA1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MDK A;  5EPF A;  3KD0 A;  2L4Q A;  3I69 A;  4BA7 A;  3N9J A;  1X9S B;  4HEA 2;  2YJ7 A;  4KGI A;  2MMZ A;  1A23 A;  1TU8 A;  2VCT A;  4ZL8 A;  1SL2 B;  3MWH A;  4DEJ A;  3KM6 A;  4K1F A;  2B1L A;  3OR5 A;  2AUV A;  3VWW A;  5IMC A;  1SD8 A;  2JU5 A;  3EWL A;  4G19 A;  3KZQ A;  2E7P A;  4CDO A;  4O7H A;  2HLS A;  2LNT A;  1LJR A;  1TP9 A;  3G9B A;  3RBT A;  4RUV A;  1PGT A;  4IJ3 A;  1TRV A;  2AAW A;  4YAP A;  1H4O A;  1V2A A;  1PA3 A;  2H6X A;  2RLI A;  1F6M C;  1Q98 A;  3LYP A;  2H30 A;  4KSM A;  4IN0 A;  6GSW A;  3ZML A;  1S3A A;  4DSS A;  4EF0 A;  5J4U A;  1V40 A;  4TN8 A;  3GV1 A;  4POM A;  4EUY A;  1RQM A;  4F82 A;  2F9S A;  3FR9 A;  4ULX A;  1XWK A;  2D2Z A;  1U3I A;  4NV2 A;  2XC2 A;  1O85 A;  2OE1 A;  3GUS A;  1JZR A;  3ERG A;  2OAC A;  3TKS A;  4WR5 A;  3TJJ A;  1A2J A;  2EIO A;  2I9H A;  1ABA A;  1BG5 A;  3F4R A;  3M1G A;  4HS1 A;  3KP8 A;  1Z5Y E;  2DLX A;  5D9T A;  5J9C A;  3SBC A;  2OE0 A;  1RK4 A;  4EDZ A;  3D6I A;  3GYK A;  3VUR A;  2BTO T;  2VL9 A;  4O32 A;  4GLT A;  5G5F A;  4DSR A;  3WT2 A;  4WEY A;  4IP1 A;  3P90 A;  3IR4 A;  4BVX A;  4MP4 A;  2J9H A;  4MF6 A;  1PL2 A;  1OC3 A;  2PN8 A;  1EGR A;  4OFM A;  1M2A A;  2YV9 A;  4I2U A;  2B3S A;  2DC5 A;  2YZH A;  4PQI A;  2FGX A;  3KP9 A;  2XBQ A;  1PL1 A;  4F0C A;  1ERT A;  2NDO A;  1R5P A;  4HQS A;  1AQV A;  1M0U A;  4AJ6 A;  5D96 A;  2RII A;  1UVZ A;  1K0N A;  3HD5 A;  4BVY A;  5IMZ A;  1HNB A;  4OCF A;  5F07 A;  1B4Q A;  4XS4 B;  3F8U A;  1GLQ A;  3GX0 A;  4YQU A;  4TR3 A;  2FD3 A;  2YWN A;  1OAZ A;  1ON4 A;  3EE2 A;  3TOT A;  3KJY A;  2VCW A;  5GAP D;  2KUC A;  3GKK A;  3HA9 A;  3VI5 A;  4KDU A;  4MLY A;  1HNC A;  4MJC A;  5ECR B;  1SD9 A;  2ZUP A;  3BJ5 A;  3DRN A;  1B8X A;  2IN3 A;  3KCM A;  2R3X A;  2CVD A;  1J0F A;  3UBL A;  3E9J B;  2R2J A;  4NPB A;  1XXU A;  2R37 A;  2WRT A;  2HZE B;  2WDU A;  3A5W A;  5IMV A;  4ZIJ A;  2IPA A;  2CAQ A;  2P5R A;  4BPY A;  4ZL9 A;  3UAP A;  6GSY A;  5DCG A;  4BWS A;  2XPD A;  4F03 A;  1J08 A;  1YF0 A;  4WBJ A;  4GF0 A;  3GST A;  1TKD B;  4KCA A;  17GS A;  3TGZ A;  2EIQ A;  3J7Y b;  3DD3 A;  1OC9 A;  3P2A A;  3QR6 A;  5AIX A;  1GSS A;  2LJA A;  2GST A;  3DGQ A;  5CRW A;  1G6Y A;  2H6Z A;  4HZ4 A;  5ECO B;  4HU9 A;  5AIS A;  4XRD A;  4GXZ A;  2N5F A;  2N5B A;  1M7T A;  2WB9 A;  1E2Y A;  2C0E A;  2L5O A;  1GSD A;  2X8H A;  2OA7 A;  1OVN A;  4N0Z A;  3DEX A;  2ALB A;  5EVO A;  1MTC A;  2IJY A;  2IME A;  3UJ1 A;  1OE8 A;  2REM A;  4F2I A;  2JZT A;  2IFQ A;  1VRS D;  1U3A A;  3L9V A;  2VD0 A;  5H5R A;  1U87 A;  3MSZ A;  3G7J A;  4EDY A;  1GUK A;  1SK0 A;  2OJL A;  3FR6 A;  3GRX A;  1A2L A;  5HFG A;  5ECH B;  3FHK A;  4ECI A;  1X5E A;  2V2G A;  4LL1 B;  3RAZ A;  3BD2 A;  4Q5F A;  1SL0 B;  1U6T A;  3GUR A;  2X64 A;  5G30 A;  3IC4 A;  2MMA A;  4G9H A;  2L6D A;  1TRW A;  1MEK A;  2H0I A;  4KUN A;  1R7H A;  4AJ7 A;  1S3D A;  1TI1 A;  2DMM A;  4XCS A;  1BYE A;  3CTG A;  3LFL A;  4I5Q A;  4ZXG A;  3A2W A;  1OYJ A;  3APO A;  1URM A;  4HJM A;  2A4V A;  3ZZX A;  2H1G A;  3E3E A;  2JSY A;  4XHM A;  1TXX A;  4PNG A;  5FWG A;  3RHC A;  5G5E A;  1K0O A;  4MF7 A;  2YPM A;  4P3Y B;  1FOV A;  1TJD A;  1THX A;  3VWX A;  3H8Q A;  6GST A;  22GS A;  4DSS B;  2ZCT A;  4PXO A;  1R5A A;  5F06 A;  2GZY A;  8GSS A;  5LNK e;  4AJ8 A;  1WOU A;  3IRA A;  4X1U A;  5AN1 A;  3PIN A;  5DQS A;  4EE0 A;  3TJK A;  2FA4 A;  1EOG A;  2YV7 A;  3KGK A;  4IKH A;  3MAK A;  5D8I A;  3VFI A;  1I9D A;  1SYX A;  4NAX A;  4TR0 A;  1F3A A;  2H74 A;  2O8V B;  1M9A A;  5JWR B;  4XS6 A;  3FZ4 A;  5AIV A;  5LD0 A;  4WR4 A;  5G31 A;  2GZZ A;  3ME7 A;  3C7M A;  4YAV A;  1WP0 A;  1O8W A;  4K7N A;  3DWV A;  4HDE A;  2GGT A;  2IMF A;  2LV3 A;  5G1K A;  2NPB A;  1PD2 1;  1AQW A;  2R5G A;  5D93 A;  1THO A;  3EVI A;  3UAR A;  1M2D A;  2FA8 A;  2ON7 A;  4I6X A;  1XCC A;  4CW9 A;  1UA5 A;  3LQ7 A;  3S9F A;  4QL9 A;  1A24 A;  3L9U A;  5J5N A;  4ID0 A;  2GT5 A;  2H71 A;  2VD1 A;  5ECN B;  2VCZ A;  2AB6 A;  3Q74 A;  4WF5 A;  3F3Q A;  2C0F A;  2V6O A;  2C0G A;  5L71 A;  1UN2 A;  3TB2 A;  3VPQ A;  4IP6 A;  3VWV A;  3KTB A;  3EU4 A;  5G2Z A;  3WT1 A;  1TK0 B;  2H6Y A;  5IO0 A;  3W8S A;  1Z6N A;  4V2L A;  5DQY A;  3H4K A;  4HOJ A;  2XPE A;  4IJI A;  4L5L A;  3HJP A;  3FZ5 A;  1DSB A;  4EO3 A;  4HQZ A;  3L78 A;  1SU9 A;  2K6V A;  3W6G A;  4KW6 A;  3GKX A;  2O7K A;  4Z7X A;  2X8G A;  4CHS A;  5JWO B;  1TI3 A;  3UL3 A;  1EV9 A;  2L6C A;  1TRU A;  3VWU A;  2CX3 A;  1EV4 A;  2H66 A;  2OE3 A;  4GSN A;  1RW1 A;  3TOU A;  4YH2 A;  2WFC A;  4PQ1 A;  1ZYQ B;  3ZLP A;  2QKE A;  1A8Y A;  3IAM 2;  3TKR A;  4NHZ A;  2Z9S A;  4EL1 A;  2B5X A;  3C73 A;  1EGO A;  5HFI A;  2ZNM A;  4NMU A;  2WCI A;  4I97 A;  3UOM A;  1OC9 B;  4OMV A;  4IVF A;  2MMN A;  3F6F A;  1ERV A;  2HSY A;  5DAL A;  5HFK A;  4E8H A;  1XFL A;  1XOA A;  3IK7 A;  3ZFB A;  2WGR A;  1QQ2 A;  2K8V A;  3O6T A;  4PUF C;  3US3 A;  3G7Y A;  3H79 A;  1VF1 A;  1EEJ A;  1K0D A;  4Q5Q A;  4TXO A;  4MJB A;  1BED A;  1JZW A;  4PX1 A;  3IOS A;  4NWY A;  2AV4 A;  3APS A;  3LJR A;  5D9V A;  2IFQ B;  1HNA A;  5HR2 A;  2FNO A;  1YY7 A;  3QAV A;  5G1L A;  3BBY A;  4GSS A;  4PNF A;  4TR4 A;  4WXT A;  4FO5 A;  1ZOF A;  1FW1 A;  4V1A g;  2XBI A;  2G2Q A;  1N2A A;  3TJG A;  3VI7 A;  2CQ9 A;  1AC1 A;  1IYI A;  2VL3 A;  1WJK A;  1ZMA A;  4J57 E;  1SKW B;  2HSH A;  2YCD A;  1T1V A;  4XRA A;  1KEB A;  1HD2 A;  4WBR D;  2A2S A;  5A4V A;  3BOA A;  3RHB A;  2LST A;  2GSS A;  2PUK C;  3EU3 A;  3QFA C;  2KLX A;  1X9W B;  2PER A;  5C04 A;  2V41 A;  2VL2 C;  3LWA A;  4K0N A;  4DVC A;  2JAD A;  3RPP A;  1A8L A;  3LXZ A;  1O6J A;  1GSY A;  5JCW A;  3IXR A;  5CO3 A;  1SEN A;  5ECQ B;  6GSS A;  4IEL A;  1SJI A;  1XOB A;  3CSJ A;  1XVW A;  3FYG A;  3R2Q A;  2H72 A;  2FY6 A;  3I6A A;  4K2D A;  2N5A A;  1GTU A;  4ZBA A;  1JLV A;  2HRN A;  2MYG A;  2OBK A;  2I81 A;  4JBB A;  10GS A;  1K0M A;  4L0W A;  3DXB A;  4FYB A;  5EY6 A;  3QDN A;  5KN1 A;  2FWH A;  2H01 A;  2GSR A;  3NZN A;  3UIW A;  5DAK A;  1VGL A;  5B8A A;  3FY7 A;  1EZK A;  1BQ7 A;  4HUA A;  4QQ7 A;  1Z7R A;  2V32 A;  1J9B A;  1ZZY A;  3C1R A;  3F4T A;  4JED A;  2CVK A;  5IIZ A;  3A2X A;  4L5O A;  3L9S A;  3H93 A;  1WE0 A;  19GS A;  2E2G A;  4GQC A;  3IAS 2;  1H75 A;  1YF1 A;  4AF2 A;  2EC4 A;  1YKA A;  3DKS A;  3QD9 A;  2VUP A;  2CV4 A;  3GIX A;  3ME8 A;  4ZB9 A;  4IQ1 A;  1GP1 A;  2YNX A;  1JHB A;  5B7C A;  1MD4 A;  1LBK A;  5COH A;  5IO2 A;  4I8B A;  2VM1 A;  3GSS A;  1B48 A;  3LOR A;  3TRQ A;  2PMT A;  5B6N A;  1AIU A;  3ZMK A;  1T4Z A;  2C3N A;  3P8W A;  4J56 E;  1MD3 A;  2C1Y A;  4TR1 A;  4V1A p;  4X0X A;  5IOW A;  3RPN A;  4J2F A;  5DDL A;  2H1D A;  3ZRE A;  2OBI A;  1AUC A;  1GL8 A;  4HZ2 A;  11GS A;  1G7E A;  2FUG 2;  1K3O A;  3C8E A;  3FEU A;  2GQL A;  4ZB8 A;  5F05 A;  2M80 A;  1YDK A;  2R4V A;  5HR0 A;  4EC0 A;  4ZB6 A;  1FG4 A;  4MAB A;  3M3M A;  1WRY A;  2VL2 A;  4ISD A;  2B7J A;  3KH7 A;  1UC7 A;  3TKS E;  2GT6 A;  2JSZ A;  4PGT A;  3ZIV A;  2TRC P;  2CZ2 A;  5GZZ B;  1NM3 A;  2P5Q A;  3VK9 A;  2BJX A;  2H73 A;  4EXJ A;  4ZBB A;  3KXO A;  1V9W A;  2B5E A;  1GNE A;  1HQO A;  5DAL B;  2LKU A;  1BJX A;  2VLT A;  1O81 A;  2KHP A;  1CQG A;  1Y25 A;  2CZ3 A;  4K9Z A;  3U5R E;  2H8L A;  3F0I A;  5LCZ A;  2WJU A;  1WMJ A;  3F3R A;  5CP1 A;  4TXO B;  4JU5 A;  2PGT A;  2DIZ A;  5CNW A;  3Q18 A;  3F9U A;  18GS A;  3CYN A;  3I43 A;  4KSO A;  5KEJ A;  4E8E A;  5KN0 A;  2MBS A;  4G10 A;  2MMO A;  3IHQ A;  1XW6 A;  1YKC A;  2GLR A;  2B7K A;  3KTL A;  3ZFL A;  3IBH A;  4TW5 A;  3HY2 A;  4OD7 A;  3H1N A;  2DJJ A;  2DBC A;  2VOC A;  1X9M B;  4RQR A;  3GKN A;  3UVH A;  1OKT A;  14GS A;  4KDY A;  3GN3 A;  2HE3 A;  3EC3 A;  4OWY A;  4ML6 A;  3WD6 A;  3UEM A;  1GLP A;  2RM6 A;  5J9B A;  4NV5 A;  3ZRD A;  2L57 A;  5CRH A;  2PWJ A;  2EIR A;  1QGV A;  1XWC A;  3DML A;  2VCV A;  4PQH A;  3WGX A;  1USB A;  1EP7 A;  3SWL A;  1XPV A;  1M9B A;  5CRD A;  4KND A;  3K8N A;  3CSI A;  3W8J A;  1NHY A;  1WPI A;  2OAD A;  2YZU A;  2DJ2 A;  1XW9 A;  4LMW A;  9GSS A;  2HI7 A;  2IWT A;  3QPM A;  1A0F A;  3MNG A;  4JE1 A;  3NIV A;  3TUE A;  1PSQ A;  4N11 A;  3WYW A;  2H75 A;  2I4A A;  2YWO A;  4YQM A;  3QFB C;  4TVE A;  4LL4 B;  4JR4 A;  3IE3 A;  3ED3 A;  2FLS A;  4MH2 A;  4PUA A;  5DAK B;  5FT3 A;  5H5Q A;  5E4W A;  2YOI A;  3KMN A;  1K0B A;  2KOK A;  4BWQ A;  1JZD A;  3O3T A;  1W89 A;  3FZ9 A;  4FYU A;  4ZBD A;  1R26 A;  3C71 A;  2RUF A;  2CX4 A;  3N5O A;  2VO4 A;  4TXV A;  1FO5 A;  4KCE A;  3PGT A;  4NXI A;  3QMX A;  1ACV A;  5ELA A;  3AY8 A;  2F8F A;  3GL3 A;  1V57 A;  2DIY A;  4IS0 A;  1W4V A;  1ZCP A;  3C1S A;  2QC7 A;  1Y6E A;  1QUW A;  1GSU A;  2O87 A;  1T00 A;  4MJA A;  3QCP A;  1K0A A;  5ID2 A;  4JR6 A;  1XZO A;  3M0F A;  4I2T A;  1GWC A;  2YAN A;  3EUR A;  3TRX A;  1A0R P;  3WGD A;  1GTI A;  1X0R A;  1T3B A;  3HHV A;  3LGC A;  3ZYW A;  3KMO A;  5IOX A;  4V2N A;  4N30 A;  4DSQ A;  3TJF A;  4TR1 B;  4OCE A;  2GS3 A;  3ERF A;  4MPF A;  3GTU A;  5DJM A;  2NTO A;  4RI7 A;  1QMV A;  2FHE A;  5C00 A;  1ZGN A;  1PX7 A;  3HYP A;  4HU7 A;  3E0U A;  1TU7 A;  5B6M A;  3HJM A;  1ILO A;  3GFK A;  1QXH A;  1WIK A;  1F2E A;  2QGV A;  1K3Y A;  1B9Y C;  5AGY A;  1CQH A;  1M2B A;  2PBJ A;  4Q5N A;  4MCU A;  4QL7 A;  4KA0 A;  1XVQ A;  5IPG A;  4MK3 A;  1DUG A;  3J7Y k;  4K0G A;  3LEF A;  1YEP A;  3F6D A;  3IDV A;  4LA1 A;  2LRT A;  4K7I A;  4ACS A;  1ZYE A;  5ENU A;  2IMI A;  5INY A;  1MDJ A;  2H76 A;  2CVB A;  1VF3 A;  2VIM A;  2DJ0 A;  2IMD A;  3NOF A;  2TRX A;  1B4P A;  2H0G A;  2L59 A;  5KN2 A;  1S3C A;  1KBN A;  1G6W A;  1GUM A;  3TCO A;  4FH8 A;  4GST A;  2WZ9 A;  4Q5R A;  3EYT A;  4ZL7 A;  16GS A;  6GSU A;  1BX9 A;  2QSI A;  1MDK A;  2DJ3 A;  3L4N A;  3EMP A;  3VLN A;  2M72 A;  1XWA A;  4FIW A;  5CAX A;  2GVP A;  4IHU A;  3CBU A;  3LXT A;  3FRC A;  3QAG A;  4O92 A;  3CSH A;  3LSZ A;  2HRF A;  1TW9 A;  4K8M A;  2JZS A;  1FVK A;  5ELG A;  2VM2 A;  1ERU A;  4IW9 A;  2FCH A;  5IMF A;  4KH7 A;  3BCI A;  1ZL9 A;  1XW5 A;  5B8B A;  1GRX A;  1NW2 A;  2A2R A;  4G2E A;  5JWQ B;  5IMA A;  2LS5 A;  1GH2 A;  3IPZ A;  2KP1 A;  1VF4 A;  3A2V A;  1Q4J A;  2DJ1 A;  5J3R A;  5F8B A;  1SK2 A;  2IL3 A;  1YZX A;  4KDX A;  1I5G A;  2YWM A;  1WWJ A;  4WET A;  5HR3 A;  4F9Z A;  2K9F A;  2ON5 A;  5JCG A;  5D9X A;  3HKR A;  2K8S A;  3FK8 A;  2LRC A;  3HVX A;  2JZR A;  2CA8 A;  1Z7P A;  3A3T A;  4EVM A;  1EOH A;  2V6K A;  2H19 A;  3HXS A;  4MJE A;  5J41 A;  1AW9 A;  1KTE A;  2VCX A;  3DYR A;  1SYR A;  2DML A;  1K0C A;  4KAE A;  5CYY A;  1DBY A;  3QAW A;  3LG6 A;  2L4C A;  2H0H A;  2GSQ A;  3GNJ A;  1JZO A;  3HZ8 A;  2HT9 A;  5D73 A;  1O73 A;  2P31 A;  2LJK A;  4ILF A;  1X5C A;  2C3Q A;  3UMA A;  4OFT A;  2G0F A;  1V58 A;  1NSW A;  2H1B A;  4FYC A;  3GH6 A;  1R4W A;  4GCI A;  5ID2 B;  1TK8 B;  3IK9 A;  1O7U A;  4GWR A;  3FW2 A;  1YQ1 A;  3DIE A;  4D73 A;  3D22 A;  3GHA A;  3GKM A;  5ECS A;  2F51 A;  3HVV A;  2PVO C;  4MF5 A;  3G7I A;  3EMX A;  2FWE A;  2PVQ A;  4POL A;  1Z3E A;  1XIY A;  1SL1 B;  3ZIT A;  5JCU A;  2YN1 A;  5ECL B;  4WKW A;  2YJH A;  6GSV A;  2LRN A;  3GA4 A;  3HZ4 A;  3UVT A;  5DVB A;  5ECP B;  4GRF A;  1GTA A;  2B1K A;  5A5K A;  4HJ2 A;  3GTU B;  4OO5 A;  3KH9 A;  4K7O A;  1YJ6 A;  1VF2 A;  5ABR A;  2O89 A;  3TKP A;  2GDR A;  1O8X A;  4HI7 A;  2AHE A;  4OO4 A;  2C4J A;  3L0H A;  2VAF A;  7GSS A;  1FHE A;  2RM5 A;  3CTF A;  3CXG A;  1AAZ A;  1SKS B;  4ZIL A;  1Z6M A;  5D9W A;  2RUE A;  4POK A;  4IQA A;  1T7P B;  4OFN A;  3O76 A;  2GTU A;  3QOU A;  2X99 A;  5CRE A;  5DJL A;  2HYX A;  2MZC A;  2HXK A;  3TDG A;  2E0Q A;  1SJ6 A;  6GSX A;  1EEM A;  5ECM B;  2IMK A;  1FB6 A;  1KNG A;  3CRT A;  1PN9 A;  2YWI A;  2PPT A;  3WGE A;  3VPT A;  3FR3 A;  1FB0 A;  3TJB A;  2HNL A;  1TK5 B;  4YQV A;  2K18 A;  1OC8 A;  2VLV A;  4AGS A;  1E6B A;  2WUL A;  4ECC A;  4XS1 A;  3D0Z A;  3BCK A;  4N0V A;  3EIN A;  3M9K A;  3GL5 A;  2I1U A;  5KN3 A;  1PRX A;  2BMX A;  1XWG A;  3DVW A;  5A4W A;  3Q19 A;  4O5R A;  1OE7 A;  4GQF A;  1M99 A;  3ZL5 A;  3ERW A;  4NHW A;  3TRP A;  1F3B A;  4KE3 A;  1EP8 A;  3KEB A;  3ZTL A;  1PQN A;  3ZVJ A;  1QFN A;  4XIH A;  5GSS A;  1Z9H A;  2NBS A;  4WF4 A;  1A2M A;  4GTU A;  5A4U A;  2I3Y A;  5GAN D;  3RDW A;  1IYH A;  2AJQ B;  4MMM A;  3ISO A;  5DBQ A;  2KP2 A;  2AYT A;  2LEG A;  2GZP A;  2M46 A;  4MZW A;  2GQM A;  4PUR A;  3F63 A;  4MDC A;  3LYK A;  1GUH A;  2L5L A;  1MDI A;  1JLW A;  3P7X A;  2YP6 A;  3PR8 A;  1XWB A;  3Q6O A;  4IBP A;  2C0D A;  3D5J A;  5F0G A;  3DVX A;  3FKF A;  1B9X C;  4TKY A;  3M9J A;  3D4M A;  1HYU A;  2DJK A;  4MPG A;  2MBT A;  1XBS A;  2H1A A;  3PH9 A;  3HVS A;  4H86 A;  2CAI A;  2F3M A;  5H5S A;  1AQX A;  1TOF A;  2CT6 A;  20GS A;  2B6M A;  1TRS A;  2OKA A;  3D21 A;  3CMI A;  3ZVJ D;  3GH9 A;  1NHO A;  4K6X A;  13GS A;  12GS A;  1SKR B;  4RQX A;  2J23 A;  2X8C A;  2V1M A;  1U88 A;  1FAA A;  1V98 A;  1DE1 A;  1SK1 A;  4L0U A;  1JFU A;  5ECK B;  1LU4 A;  3JCM L;  2C3T A;  1BAY A;  4ML1 A;  4ECB A;  2VCQ A;  2P0G A;  1QK8 A;  5IQY A;  2B5Y A;  4MZB A;  5IPH A;  4TRX A;  1PX6 A;  4EKZ A;  5HR1 A;  4TOP A;  1DE2 A;  5EL8 A;  1OKD A;  4V2M A;  4N10 A;  1SJZ A;  4RI6 A;  1F9M A;  1ERW A;  4X43 A;  1PKZ A;  3APQ A;  2LJR A;  4KX4 A;  4XS4 A;  3ZIJ A;  2TIR A;  2VLU A;  2IIY A;  5FHI A;  2C8U A;  2C80 A;  4POB A;  3V1W A;  4LLR A;  3HJO A;  2LQQ A;  1PMT A;  2HFD A;  4L8E A;  4KB3 A;  2PU9 C;  4XTS A;  3KIJ A;  2LNS A;  2ES7 A;  3HDC A;  1YEX A;  4IGJ A;  4MH3 A;  3CRU A;  3TKQ A;  3UBK A;  2JAC A;  1ST9 A;  3HCZ A;  1G0T A;  1X5D A;  4F0B A;  1GSQ A;  2DSA A;  5E59 A;  2HZF A;  2GQK A;  5GST A;  4JZQ A;  2R6K A;  2F8A A;  1F37 A;  5IM9 A;  1ML6 A;  3TKS C;  3I9V 2;  2LQO A;  4D73 B;  2HZE A;  5IMD A;  2E2M A;  1GSE A;  2JL4 A;  5ECI B;  3F4S A;  2LUS A;  1T8E B;  5CRG A;  4MA9 A;  1FVJ A;  2NVL A;  1T4Y A;  2FWG A;  1EWX A;  3M8N A;  2FWF A;  3FZA A;  4JRR A;  4ECJ A;  2XHF A;  1GSF A;  5DCH A;  2O85 A;  2H70 A;  3GX8 A;  1TTZ A;  1N8J A;  2LTK A;  3U6V A;  3D4T A;  1AXD A;  4MZC A;  1G7O A;  5HQP A;  1TDI A;  1PKW A;  1GUL A;  1GNW A;  4BL7 A;  1K3L A;  2WS2 A;  1C72 A;  3GMF A;  4LMV A;  1GTB A;  3IV4 A;  3IA1 A; 
#chains in the Genus database with same CATH topology
 3MDK A;  4PTS A;  5EPF A;  3KD0 A;  2L4Q A;  3I69 A;  4BA7 A;  3N9J A;  1X9S B;  4HEA 2;  2YJ7 A;  4KGI A;  2MMZ A;  1A23 A;  1TU8 A;  2A4H A;  3MIX A;  2VCT A;  4ZL8 A;  1SL2 B;  2R0G A;  3MWH A;  4DEJ A;  3KM6 A;  4K1F A;  2B1L A;  3OR5 A;  2AUV A;  3VWW A;  5IMC A;  1SD8 A;  2JU5 A;  3EWL A;  4G19 A;  3KZQ A;  2E7P A;  4CDO A;  4O7H A;  2HLS A;  2LNT A;  1LJR A;  1TP9 A;  3G9B A;  3RBT A;  4RUV A;  1PGT A;  4IJ3 A;  1TRV A;  2AAW A;  4YAP A;  1H4O A;  1V2A A;  1PA3 A;  2H6X A;  2RLI A;  1F6M C;  3A5I A;  1Q98 A;  3LYP A;  4O5U A;  4K5S A;  4YKG A;  2H30 A;  4KSM A;  4IN0 A;  6GSW A;  3ZML A;  1S3A A;  4DSS A;  4EF0 A;  5J4U A;  1V40 A;  4TN8 A;  3GV1 A;  4POM A;  4EUY A;  1RQM A;  4F82 A;  2F9S A;  3FR9 A;  4ULX A;  1XWK A;  2D2Z A;  1U3I A;  4NV2 A;  2XC2 A;  1O85 A;  2OE1 A;  3GUS A;  1JZR A;  3ERG A;  2OAC A;  3TKS A;  4WR5 A;  3TJJ A;  1A2J A;  2EIO A;  2I9H A;  1ABA A;  1BG5 A;  3F4R A;  3M1G A;  4HS1 A;  3KP8 A;  1Z5Y E;  2DLX A;  5D9T A;  5J9C A;  3SBC A;  2OE0 A;  1RK4 A;  4EDZ A;  3D6I A;  3GYK A;  3VUR A;  2BTO T;  2VL9 A;  4O32 A;  4GLT A;  5G5F A;  4DSR A;  3WT2 A;  4WEY A;  4IP1 A;  3P90 A;  3IR4 A;  4BVX A;  4MP4 A;  2J9H A;  4MF6 A;  1PL2 A;  1OC3 A;  2PN8 A;  1EGR A;  4OFM A;  1M2A A;  2YV9 A;  4I2U A;  2B3S A;  2DC5 A;  2YZH A;  4PQI A;  2FGX A;  3KP9 A;  2XBQ A;  1PL1 A;  4F0C A;  1ERT A;  2NDO A;  1R5P A;  2DKH A;  4HQS A;  1AQV A;  1M0U A;  4AJ6 A;  5D96 A;  2RII A;  1UVZ A;  1K0N A;  3HD5 A;  4BVY A;  5IMZ A;  1HNB A;  4OCF A;  5F07 A;  1B4Q A;  4XS4 B;  3F8U A;  1GLQ A;  3GX0 A;  4YQU A;  4TR3 A;  2FD3 A;  2YWN A;  1OAZ A;  1ON4 A;  3EE2 A;  3TOT A;  3KJY A;  2VCW A;  5GAP D;  2KUC A;  3GKK A;  3HA9 A;  3VI5 A;  4KDU A;  4MLY A;  1HNC A;  4MJC A;  5ECR B;  1SD9 A;  2ZUP A;  3BJ5 A;  3DRN A;  1B8X A;  2IN3 A;  3KCM A;  2R3X A;  2CVD A;  1J0F A;  3UBL A;  3E9J B;  2R2J A;  4NPB A;  1XXU A;  2R37 A;  2WRT A;  2HZE B;  2WDU A;  3A5W A;  5IMV A;  4ZIJ A;  2IPA A;  2CAQ A;  2P5R A;  4BPY A;  4ZL9 A;  3UAP A;  6GSY A;  5DCG A;  4BWS A;  1S3R A;  2XPD A;  4F03 A;  1J08 A;  1YF0 A;  4WBJ A;  4GF0 A;  3GST A;  1TKD B;  4KCA A;  17GS A;  3TGZ A;  2EIQ A;  3J7Y b;  3DD3 A;  1OC9 A;  3P2A A;  3QR6 A;  5AIX A;  1GSS A;  2LJA A;  2GST A;  3DGQ A;  5CRW A;  1G6Y A;  2H6Z A;  4HZ4 A;  5ECO B;  4HU9 A;  5AIS A;  4G0K A;  4XRD A;  4GXZ A;  2N5F A;  2N5B A;  1M7T A;  2WB9 A;  1E2Y A;  2C0E A;  2L5O A;  1GSD A;  2X8H A;  2OA7 A;  1OVN A;  4N0Z A;  4KF9 A;  3DEX A;  2ALB A;  5EVO A;  1MTC A;  2IJY A;  2IME A;  4BL7 B;  3UJ1 A;  1OE8 A;  2REM A;  4F2I A;  5KOW A;  2JZT A;  2IFQ A;  1VRS D;  1U3A A;  3L9V A;  2VD0 A;  5H5R A;  1U87 A;  3MSZ A;  3G7J A;  4EDY A;  1GUK A;  1SK0 A;  2OJL A;  3FR6 A;  3GRX A;  1A2L A;  5HFG A;  5ECH B;  3FHK A;  4ECI A;  1X5E A;  2V2G A;  4LL1 B;  3RAZ A;  3BD2 A;  4Q5F A;  1SL0 B;  1U6T A;  3GUR A;  2X64 A;  5G30 A;  3IC4 A;  2MMA A;  4G9H A;  2L6D A;  1TRW A;  1MEK A;  2H0I A;  4KUN A;  1R7H A;  4AJ7 A;  1S3D A;  1TI1 A;  2DMM A;  3EPT A;  4XCS A;  1BYE A;  3CTG A;  3LFL A;  4I5Q A;  4ZXG A;  3A2W A;  1OYJ A;  3APO A;  1URM A;  4HJM A;  2A4V A;  3ZZX A;  2H1G A;  3E3E A;  2JSY A;  4XHM A;  1TXX A;  4PNG A;  5FWG A;  3RHC A;  5G5E A;  1K0O A;  4MF7 A;  2YPM A;  4P3Y B;  1FOV A;  1TJD A;  1THX A;  3VWX A;  3H8Q A;  6GST A;  22GS A;  4DSS B;  2ZCT A;  4PXO A;  1R5A A;  5F06 A;  2GZY A;  8GSS A;  4FQU A;  5LNK e;  4AJ8 A;  1WOU A;  3IRA A;  4X1U A;  5AN1 A;  4HSC X;  3PIN A;  5DQS A;  4EE0 A;  3TJK A;  2FA4 A;  3HVN A;  1EOG A;  2YV7 A;  3KGK A;  4IKH A;  3MAK A;  5D8I A;  3VFI A;  1I9D A;  1SYX A;  4NAX A;  4TR0 A;  1F3A A;  2H74 A;  2O8V B;  1M9A A;  5JWR B;  4XS6 A;  3FZ4 A;  5AIV A;  5LD0 A;  4WR4 A;  5G31 A;  2GZZ A;  3ME7 A;  3C7M A;  4YAV A;  1WP0 A;  1O8W A;  4K7N A;  3DWV A;  4HDE A;  2GGT A;  2IMF A;  4BVX B;  4G0L A;  2LV3 A;  5G1K A;  2NPB A;  1PD2 1;  1AQW A;  2R5G A;  5D93 A;  1THO A;  3EVI A;  3UAR A;  1M2D A;  2FA8 A;  2ON7 A;  4I6X A;  1XCC A;  4CW9 A;  1UA5 A;  3LQ7 A;  3S9F A;  4QL9 A;  1A24 A;  3L9U A;  5J5N A;  4ID0 A;  2GT5 A;  2H71 A;  2VD1 A;  5ECN B;  2VCZ A;  2AB6 A;  3Q74 A;  4WF5 A;  3F3Q A;  2C0F A;  2V6O A;  2C0G A;  5L71 A;  1UN2 A;  3TB2 A;  3VPQ A;  4IP6 A;  3VWV A;  3KTB A;  3EU4 A;  5G2Z A;  3WT1 A;  1TK0 B;  2H6Y A;  5IO0 A;  4Z2R A;  3W8S A;  1Z6N A;  4V2L A;  5DQY A;  3H4K A;  4HOJ A;  2XPE A;  4IJI A;  4L5L A;  3HJP A;  3FZ5 A;  1DSB A;  4EO3 A;  4HQZ A;  3L78 A;  1SU9 A;  2K6V A;  3W6G A;  4KW6 A;  2HRA A;  3GKX A;  2O7K A;  4Z7X A;  2X8G A;  4CHS A;  5JWO B;  1TI3 A;  3UL3 A;  1EV9 A;  2L6C A;  1TRU A;  3VWU A;  2CX3 A;  1EV4 A;  2H66 A;  2OE3 A;  4GSN A;  1RW1 A;  3TOU A;  4YH2 A;  2WFC A;  4PQ1 A;  1ZYQ B;  4EIQ A;  3ZLP A;  2QKE A;  1A8Y A;  3IAM 2;  3TKR A;  4NHZ A;  2Z9S A;  4EL1 A;  2B5X A;  3C73 A;  1EGO A;  5HFI A;  2ZNM A;  4NMU A;  2WCI A;  4I97 A;  3UOM A;  1OC9 B;  4OMV A;  4IVF A;  2MMN A;  3F6F A;  1ERV A;  2HSY A;  3FMW A;  5DAL A;  5HFK A;  4E8H A;  1XFL A;  1XOA A;  3IK7 A;  3ZFB A;  2WGR A;  1QQ2 A;  2K8V A;  3O6T A;  4PUF C;  3US3 A;  3G7Y A;  3H79 A;  1VF1 A;  1EEJ A;  1K0D A;  4Q5Q A;  4TXO A;  4MJB A;  1BED A;  1JZW A;  4PX1 A;  3IOS A;  4NWY A;  2AV4 A;  3APS A;  3LJR A;  5D9V A;  2IFQ B;  1HNA A;  5HR2 A;  2FNO A;  1YY7 A;  3QAV A;  5G1L A;  3BBY A;  4GSS A;  4PNF A;  4TR4 A;  4WXT A;  4FO5 A;  1ZOF A;  1FW1 A;  4V1A g;  2XBI A;  2G2Q A;  1N2A A;  3TJG A;  3VI7 A;  2CQ9 A;  1AC1 A;  1IYI A;  2VL3 A;  1WJK A;  1ZMA A;  4J57 E;  1SKW B;  2HSH A;  2YCD A;  1T1V A;  4XRA A;  1KEB A;  1HD2 A;  4WBR D;  2A2S A;  5A4V A;  4CY8 A;  1M3I A;  3BOA A;  3RHB A;  1PFO A;  4MNN A;  2LST A;  2GSS A;  2PUK C;  3EU3 A;  3QFA C;  2KLX A;  1X9W B;  2PER A;  5C04 A;  2V41 A;  2VL2 C;  3LWA A;  4K0N A;  4DVC A;  2JAD A;  3RPP A;  1A8L A;  3LXZ A;  1O6J A;  1GSY A;  5JCW A;  3IXR A;  5CO3 A;  1SEN A;  5ECQ B;  6GSS A;  4IEL A;  1SJI A;  1XOB A;  3CSJ A;  1XVW A;  3FYG A;  3R2Q A;  2H72 A;  2FY6 A;  3I6A A;  4K2D A;  2N5A A;  1GTU A;  4ZBA A;  1JLV A;  2HRN A;  2MYG A;  2OBK A;  2I81 A;  4JBB A;  10GS A;  1K0M A;  4L0W A;  3DXB A;  4FYB A;  5EY6 A;  3QDN A;  5KN1 A;  2FWH A;  2H01 A;  2GSR A;  3NZN A;  3UIW A;  5DAK A;  1VGL A;  5B8A A;  3FY7 A;  1EZK A;  1BQ7 A;  4HUA A;  4QQ7 A;  1Z7R A;  2V32 A;  1J9B A;  1ZZY A;  3C1R A;  3F4T A;  4JED A;  2CVK A;  5IIZ A;  3A2X A;  4L5O A;  3L9S A;  3H93 A;  1WE0 A;  19GS A;  2E2G A;  4GQC A;  3IAS 2;  1H75 A;  1YF1 A;  4AF2 A;  1XG8 A;  2EC4 A;  1YKA A;  3DKS A;  3QD9 A;  2VUP A;  2CV4 A;  3GIX A;  3ME8 A;  4ZB9 A;  4IQ1 A;  1GP1 A;  2YNX A;  1JHB A;  5B7C A;  1MD4 A;  2HRK A;  1LBK A;  5COH A;  5IO2 A;  4I8B A;  2VM1 A;  3GSS A;  1B48 A;  3LOR A;  3TRQ A;  2PMT A;  5B6N A;  1AIU A;  3ZMK A;  1T4Z A;  2C3N A;  3P8W A;  4J56 E;  1MD3 A;  2C1Y A;  4TR1 A;  4V1A p;  4X0X A;  5IOW A;  3RPN A;  4J2F A;  5DDL A;  2H1D A;  3ZRE A;  2OBI A;  1AUC A;  1GL8 A;  4HZ2 A;  11GS A;  1G7E A;  2FUG 2;  1K3O A;  3C8E A;  3FEU A;  4X4J A;  2GQL A;  4ZB8 A;  5F05 A;  2M80 A;  1YDK A;  2R4V A;  5HR0 A;  4EC0 A;  5BMU A;  4ZB6 A;  3LW9 A;  1FG4 A;  4MAB A;  3M3M A;  1WRY A;  1ZYP A;  2VL2 A;  4ISD A;  2B7J A;  3KH7 A;  1UC7 A;  2DKI A;  2GT6 A;  3TKS E;  2JSZ A;  4PGT A;  3ZIV A;  2TRC P;  2CZ2 A;  5GZZ B;  1NM3 A;  2P5Q A;  3VK9 A;  2BJX A;  2H73 A;  4EXJ A;  4ZBB A;  3KXO A;  1V9W A;  2B5E A;  1GNE A;  1HQO A;  5DAL B;  4K5R A;  2LKU A;  1BJX A;  2VLT A;  1O81 A;  2KHP A;  1CQG A;  1Y25 A;  2CZ3 A;  4K9Z A;  3U5R E;  2H8L A;  3F0I A;  5LCZ A;  2WJU A;  1WMJ A;  5BRT A;  3F3R A;  5CP1 A;  4TXO B;  4JU5 A;  2PGT A;  2DIZ A;  5CNW A;  3Q18 A;  3F9U A;  18GS A;  3CYN A;  3I43 A;  4KSO A;  5KEJ A;  4E8E A;  5KN0 A;  2MBS A;  4G10 A;  2MMO A;  3IHQ A;  1XW6 A;  1YKC A;  2GLR A;  2B7K A;  3KTL A;  1ZYN A;  3ZFL A;  3IBH A;  4TW5 A;  3HY2 A;  4OD7 A;  3H1N A;  2DJJ A;  4O5Q A;  2DBC A;  2VOC A;  1X9M B;  4RQR A;  3GKN A;  3UVH A;  1OKT A;  14GS A;  4KDY A;  3GN3 A;  2HE3 A;  3EC3 A;  4OWY A;  4ML6 A;  3WD6 A;  3UEM A;  1GLP A;  2RM6 A;  5J9B A;  4NV5 A;  3ZRD A;  2L57 A;  5CRH A;  2PWJ A;  2EIR A;  1QGV A;  4K2X A;  1XWC A;  3DML A;  2VCV A;  4PQH A;  3WGX A;  1USB A;  1EP7 A;  3SWL A;  1XPV A;  1M9B A;  5CRD A;  4KND A;  3K8N A;  3CSI A;  3W8J A;  1NHY A;  1WPI A;  2OAD A;  3PPU A;  2YZU A;  2DJ2 A;  1XW9 A;  4LMW A;  9GSS A;  2HI7 A;  2IWT A;  3QPM A;  1A0F A;  4EIP A;  3MNG A;  4JE1 A;  3NIV A;  3TUE A;  1PSQ A;  4N11 A;  3WYW A;  2H75 A;  2I4A A;  2YWO A;  4YQM A;  3QFB C;  4TVE A;  4LL4 B;  4JR4 A;  3IE3 A;  3ED3 A;  2FLS A;  4MH2 A;  4PUA A;  5DAK B;  5FT3 A;  5H5Q A;  5E4W A;  2YOI A;  3KMN A;  1K0B A;  2KOK A;  4BWQ A;  1JZD A;  3O3T A;  1W89 A;  3FZ9 A;  4FYU A;  4ZBD A;  4USS A;  1R26 A;  3C71 A;  2RUF A;  2CX4 A;  3N5O A;  2VO4 A;  4TXV A;  4BVY B;  1FO5 A;  4KCE A;  3PGT A;  4NXI A;  3QMX A;  1ACV A;  5ELA A;  3AY8 A;  2F8F A;  3GL3 A;  1V57 A;  2DIY A;  4IS0 A;  1W4V A;  1ZCP A;  3C1S A;  2QC7 A;  1Y6E A;  1QUW A;  1GSU A;  2O87 A;  1T00 A;  4MJA A;  3QCP A;  1K0A A;  5ID2 A;  4JR6 A;  1XZO A;  3M0F A;  4I2T A;  1GWC A;  2YAN A;  3EUR A;  3TRX A;  1A0R P;  3WGD A;  1GTI A;  1X0R A;  1T3B A;  3HHV A;  3LGC A;  3ZYW A;  3KMO A;  5IOX A;  4V2N A;  4N30 A;  4DSQ A;  3TJF A;  4TR1 B;  4OCE A;  2GS3 A;  3ERF A;  4MPF A;  3GTU A;  5DJM A;  2NTO A;  4RI7 A;  1QMV A;  2FHE A;  5C00 A;  5KOX A;  1ZGN A;  1PX7 A;  3HYP A;  4HU7 A;  3E0U A;  1TU7 A;  5B6M A;  4BIK A;  3HJM A;  1ILO A;  3GFK A;  1QXH A;  1WIK A;  1F2E A;  2QGV A;  1K3Y A;  1B9Y C;  5AGY A;  1CQH A;  1M2B A;  2PBJ A;  4Q5N A;  4MCU A;  4QL7 A;  4KA0 A;  1XVQ A;  5IPG A;  4MK3 A;  1DUG A;  3J7Y k;  4K0G A;  3LEF A;  1YEP A;  3F6D A;  3IDV A;  3IHG A;  4LA1 A;  2LRT A;  4K7I A;  4ACS A;  1ZYE A;  5ENU A;  2IMI A;  2R0C A;  5INY A;  1MDJ A;  2H76 A;  2CVB A;  1VF3 A;  2VIM A;  2DJ0 A;  2IMD A;  3NOF A;  2TRX A;  1B4P A;  2H0G A;  2L59 A;  5KN2 A;  1S3C A;  1KBN A;  1G6W A;  1GUM A;  3TCO A;  4FH8 A;  4GST A;  2WZ9 A;  4Q5R A;  3EYT A;  4ZL7 A;  16GS A;  6GSU A;  1BX9 A;  2QSI A;  1MDK A;  2DJ3 A;  4CY6 A;  3L4N A;  3EMP A;  3VLN A;  2M72 A;  1XWA A;  4FIW A;  4A5P A;  5CAX A;  2GVP A;  4IHU A;  3CBU A;  3LXT A;  3FRC A;  3QAG A;  4O92 A;  3CSH A;  3LSZ A;  4Z2U A;  2HRF A;  1TW9 A;  4K8M A;  2JZS A;  1FVK A;  5ELG A;  2VM2 A;  1ERU A;  4IW9 A;  2FCH A;  5IMF A;  4Z2T A;  4KH7 A;  3BCI A;  1ZL9 A;  1XW5 A;  5B8B A;  1GRX A;  1NW2 A;  2A2R A;  4G2E A;  5JWQ B;  5IMA A;  2LS5 A;  2A2P A;  1GH2 A;  3IPZ A;  2KP1 A;  1VF4 A;  3A2V A;  1Q4J A;  2DJ1 A;  5J3R A;  5F8B A;  1SK2 A;  2IL3 A;  1YZX A;  4KDX A;  1I5G A;  2YWM A;  1WWJ A;  4WET A;  5HR3 A;  4F9Z A;  2K9F A;  2ON5 A;  5JCG A;  5D9X A;  3HKR A;  2K8S A;  3FK8 A;  2LRC A;  3HVX A;  2JZR A;  2CA8 A;  1Z7P A;  3A3T A;  4EVM A;  3CQF A;  1EOH A;  2V6K A;  2H19 A;  3HXS A;  4MJE A;  5J41 A;  1AW9 A;  1KTE A;  1FOH A;  2VCX A;  3DYR A;  1SYR A;  2DML A;  1K0C A;  4KAE A;  5CYY A;  1DBY A;  3QAW A;  3LG6 A;  2L4C A;  2H0H A;  2GSQ A;  3GNJ A;  1JZO A;  3HZ8 A;  2HT9 A;  5D73 A;  1O73 A;  2P31 A;  2LJK A;  4ILF A;  1X5C A;  2C3Q A;  3UMA A;  4OFT A;  2G0F A;  2X49 A;  1V58 A;  1NSW A;  2H1B A;  1PN0 A;  4FYC A;  3GH6 A;  1R4W A;  4GCI A;  5ID2 B;  1TK8 B;  3IK9 A;  1O7U A;  4GWR A;  3FW2 A;  4G0I A;  1YQ1 A;  3DIE A;  4D73 A;  3D22 A;  1M3J A;  3GHA A;  3GKM A;  5ECS A;  2F51 A;  3HVV A;  2PVO C;  4MF5 A;  3G7I A;  3EMX A;  2FWE A;  2PVQ A;  4POL A;  1Z3E A;  1XIY A;  1SL1 B;  3ZIT A;  5JCU A;  2YN1 A;  2HSM A;  5ECL B;  4WKW A;  2YJH A;  6GSV A;  2LRN A;  3GA4 A;  3HZ4 A;  3UVT A;  5DVB A;  4GRF A;  1GTA A;  5ECP B;  2B1K A;  5A5K A;  4HJ2 A;  3GTU B;  4OO5 A;  3KH9 A;  4K7O A;  1YJ6 A;  1VF2 A;  5ABR A;  2O89 A;  3TKP A;  2GDR A;  1O8X A;  4HI7 A;  2AHE A;  4OO4 A;  2C4J A;  3L0H A;  2VAF A;  7GSS A;  1FHE A;  2RM5 A;  3CTF A;  3CXG A;  1AAZ A;  1SKS B;  4ZIL A;  1Z6M A;  5D9W A;  2RUE A;  4POK A;  4IQA A;  1T7P B;  4OFN A;  3O76 A;  2GTU A;  3QOU A;  2X99 A;  5CRE A;  5DJL A;  2HYX A;  2MZC A;  2HXK A;  3TDG A;  2E0Q A;  1SJ6 A;  6GSX A;  1EEM A;  5ECM B;  2IMK A;  1FB6 A;  2X4A A;  1KNG A;  3CRT A;  1PN9 A;  2YWI A;  2PPT A;  3WGE A;  3VPT A;  3FR3 A;  1FB0 A;  3TJB A;  2HNL A;  1TK5 B;  4YQV A;  2K18 A;  1OC8 A;  2VLV A;  4AGS A;  2R0P A;  1E6B A;  2WUL A;  4ECC A;  4XS1 A;  3D0Z A;  3BCK A;  4N0V A;  3EIN A;  3M9K A;  3GL5 A;  2I1U A;  5KN3 A;  1PRX A;  2BMX A;  1XWG A;  3DVW A;  5A4W A;  3Q19 A;  4O5R A;  1OE7 A;  4GQF A;  1M99 A;  3ZL5 A;  3ERW A;  4NHW A;  3IC8 A;  3TRP A;  1F3B A;  4KE3 A;  3R3E A;  1EP8 A;  4YKF A;  3KEB A;  3ZTL A;  1PQN A;  2QA1 A;  3ZVJ A;  1QFN A;  4XIH A;  5GSS A;  1Z9H A;  2NBS A;  4WF4 A;  1A2M A;  4GTU A;  5A4U A;  2I3Y A;  5GAN D;  3RDW A;  1IYH A;  2AJQ B;  4MMM A;  3ISO A;  5DBQ A;  2KP2 A;  2AYT A;  2LEG A;  2GZP A;  2M46 A;  4MZW A;  2QA2 A;  2GQM A;  4PUR A;  3F63 A;  4MDC A;  3LYK A;  1GUH A;  2L5L A;  1MDI A;  1JLW A;  3P7X A;  2YP6 A;  3PR8 A;  1XWB A;  3Q6O A;  4IBP A;  2C0D A;  3D5J A;  5F0G A;  3DVX A;  3FKF A;  1B9X C;  4TKY A;  3M9J A;  3D4M A;  1HYU A;  2DJK A;  4MPG A;  2MBT A;  1XBS A;  2H1A A;  3PH9 A;  3HVS A;  3MYD A;  4H86 A;  4ICY A;  2CAI A;  2F3M A;  5H5S A;  1AQX A;  1TOF A;  2CT6 A;  20GS A;  2B6M A;  1TRS A;  2OKA A;  3D21 A;  3CMI A;  3ZVJ D;  3GH9 A;  1NHO A;  4K6X A;  13GS A;  12GS A;  1SKR B;  4RQX A;  2J23 A;  2X8C A;  2V1M A;  1U88 A;  1FAA A;  1V98 A;  1DE1 A;  1SK1 A;  4L0U A;  1JFU A;  5ECK B;  1LU4 A;  3JCM L;  2C3T A;  1BAY A;  4ML1 A;  4ECB A;  2VCQ A;  2P0G A;  1QK8 A;  5IQY A;  2B5Y A;  4MZB A;  5IPH A;  4TRX A;  1PX6 A;  4EKZ A;  5HR1 A;  4TOP A;  1DE2 A;  5EL8 A;  1OKD A;  4V2M A;  4N10 A;  1SJZ A;  4RI6 A;  1F9M A;  1ERW A;  4X43 A;  1PKZ A;  3APQ A;  2LJR A;  4KX4 A;  4XS4 A;  3ZIJ A;  2TIR A;  2VLU A;  2IIY A;  5FHI A;  2C8U A;  2C80 A;  4POB A;  3V1W A;  4LLR A;  3HJO A;  2LQQ A;  1PMT A;  2HFD A;  4L8E A;  4KB3 A;  2PU9 C;  4XTS A;  3KIJ A;  2LNS A;  2ES7 A;  3HDC A;  1YEX A;  4IGJ A;  4MH3 A;  3CRU A;  3TKQ A;  3UBK A;  2JAC A;  1ST9 A;  3HCZ A;  1G0T A;  1X5D A;  4F0B A;  1GSQ A;  2DSA A;  5E59 A;  2HZF A;  2GQK A;  5GST A;  4JZQ A;  2R6K A;  2F8A A;  1F37 A;  5IM9 A;  1ML6 A;  3TKS C;  3I9V 2;  2LQO A;  4D73 B;  2UZ8 A;  2HZE A;  5IMD A;  2E2M A;  1GSE A;  2JL4 A;  5ECI B;  3F4S A;  2LUS A;  1T8E B;  5CRG A;  4MA9 A;  1FVJ A;  2NVL A;  1T4Y A;  2FWG A;  1EWX A;  3M8N A;  2FWF A;  3FZA A;  4JRR A;  4ECJ A;  2XHF A;  1GSF A;  5DCH A;  2O85 A;  2H70 A;  3GX8 A;  1TTZ A;  1N8J A;  2LTK A;  3U6V A;  3D4T A;  1AXD A;  4MZC A;  1G7O A;  5HQP A;  1TDI A;  1PKW A;  1GUL A;  1GNW A;  4BL7 A;  1K3L A;  2WS2 A;  1C72 A;  3GMF A;  4LMV A;  1GTB A;  3IV4 A;  3IA1 A; 
#chains in the Genus database with same CATH homology
 3MDK A;  4PTS A;  5EPF A;  3KD0 A;  2L4Q A;  3I69 A;  4BA7 A;  3N9J A;  1X9S B;  4HEA 2;  2YJ7 A;  4KGI A;  2MMZ A;  1A23 A;  1TU8 A;  2A4H A;  3MIX A;  2VCT A;  4ZL8 A;  1SL2 B;  2R0G A;  3MWH A;  4DEJ A;  3KM6 A;  4K1F A;  2B1L A;  3OR5 A;  2AUV A;  3VWW A;  5IMC A;  1SD8 A;  2JU5 A;  3EWL A;  4G19 A;  3KZQ A;  2E7P A;  4CDO A;  4O7H A;  2HLS A;  2LNT A;  1LJR A;  1TP9 A;  3G9B A;  3RBT A;  4RUV A;  1PGT A;  4IJ3 A;  1TRV A;  2AAW A;  4YAP A;  1H4O A;  1V2A A;  1PA3 A;  2H6X A;  2RLI A;  1F6M C;  3A5I A;  1Q98 A;  3LYP A;  4O5U A;  4K5S A;  4YKG A;  2H30 A;  4KSM A;  4IN0 A;  6GSW A;  3ZML A;  1S3A A;  4DSS A;  4EF0 A;  5J4U A;  1V40 A;  4TN8 A;  3GV1 A;  4POM A;  4EUY A;  1RQM A;  4F82 A;  2F9S A;  3FR9 A;  4ULX A;  1XWK A;  2D2Z A;  1U3I A;  4NV2 A;  2XC2 A;  1O85 A;  2OE1 A;  3GUS A;  1JZR A;  3ERG A;  2OAC A;  3TKS A;  4WR5 A;  3TJJ A;  1A2J A;  2EIO A;  2I9H A;  1ABA A;  1BG5 A;  3F4R A;  3M1G A;  4HS1 A;  3KP8 A;  1Z5Y E;  2DLX A;  5D9T A;  5J9C A;  3SBC A;  2OE0 A;  1RK4 A;  4EDZ A;  3D6I A;  3GYK A;  3VUR A;  2BTO T;  2VL9 A;  4O32 A;  4GLT A;  5G5F A;  4DSR A;  3WT2 A;  4WEY A;  4IP1 A;  3P90 A;  3IR4 A;  4BVX A;  4MP4 A;  2J9H A;  4MF6 A;  1PL2 A;  1OC3 A;  2PN8 A;  1EGR A;  4OFM A;  1M2A A;  2YV9 A;  4I2U A;  2B3S A;  2DC5 A;  2YZH A;  4PQI A;  2FGX A;  3KP9 A;  2XBQ A;  1PL1 A;  4F0C A;  1ERT A;  2NDO A;  1R5P A;  2DKH A;  4HQS A;  1AQV A;  1M0U A;  4AJ6 A;  5D96 A;  2RII A;  1UVZ A;  1K0N A;  3HD5 A;  4BVY A;  5IMZ A;  1HNB A;  4OCF A;  5F07 A;  1B4Q A;  4XS4 B;  3F8U A;  1GLQ A;  3GX0 A;  4YQU A;  4TR3 A;  2FD3 A;  2YWN A;  1OAZ A;  1ON4 A;  3EE2 A;  3TOT A;  3KJY A;  2VCW A;  5GAP D;  2KUC A;  3GKK A;  3HA9 A;  3VI5 A;  4KDU A;  4MLY A;  1HNC A;  4MJC A;  5ECR B;  1SD9 A;  2ZUP A;  3BJ5 A;  3DRN A;  1B8X A;  2IN3 A;  3KCM A;  2R3X A;  2CVD A;  1J0F A;  3UBL A;  3E9J B;  2R2J A;  4NPB A;  1XXU A;  2R37 A;  2WRT A;  2HZE B;  2WDU A;  3A5W A;  5IMV A;  4ZIJ A;  2IPA A;  2CAQ A;  2P5R A;  4BPY A;  4ZL9 A;  3UAP A;  6GSY A;  5DCG A;  4BWS A;  2XPD A;  4F03 A;  1J08 A;  1YF0 A;  4WBJ A;  4GF0 A;  3GST A;  1TKD B;  4KCA A;  17GS A;  3TGZ A;  2EIQ A;  3J7Y b;  3DD3 A;  1OC9 A;  3P2A A;  3QR6 A;  5AIX A;  1GSS A;  2LJA A;  2GST A;  3DGQ A;  5CRW A;  1G6Y A;  2H6Z A;  4HZ4 A;  5ECO B;  4HU9 A;  5AIS A;  4G0K A;  4XRD A;  4GXZ A;  2N5F A;  2N5B A;  1M7T A;  2WB9 A;  1E2Y A;  2C0E A;  2L5O A;  1GSD A;  2X8H A;  2OA7 A;  1OVN A;  4N0Z A;  4KF9 A;  3DEX A;  2ALB A;  5EVO A;  1MTC A;  2IJY A;  2IME A;  4BL7 B;  3UJ1 A;  1OE8 A;  2REM A;  4F2I A;  5KOW A;  2JZT A;  2IFQ A;  1VRS D;  1U3A A;  3L9V A;  2VD0 A;  5H5R A;  1U87 A;  3MSZ A;  3G7J A;  4EDY A;  1GUK A;  1SK0 A;  2OJL A;  3FR6 A;  3GRX A;  1A2L A;  5HFG A;  5ECH B;  3FHK A;  4ECI A;  1X5E A;  2V2G A;  4LL1 B;  3RAZ A;  3BD2 A;  4Q5F A;  1SL0 B;  1U6T A;  3GUR A;  2X64 A;  5G30 A;  3IC4 A;  2MMA A;  4G9H A;  2L6D A;  1TRW A;  1MEK A;  2H0I A;  4KUN A;  1R7H A;  4AJ7 A;  1S3D A;  1TI1 A;  2DMM A;  3EPT A;  4XCS A;  1BYE A;  3CTG A;  3LFL A;  4I5Q A;  4ZXG A;  3A2W A;  1OYJ A;  3APO A;  1URM A;  4HJM A;  2A4V A;  3ZZX A;  2H1G A;  3E3E A;  2JSY A;  4XHM A;  1TXX A;  4PNG A;  5FWG A;  3RHC A;  5G5E A;  1K0O A;  4MF7 A;  2YPM A;  4P3Y B;  1FOV A;  1TJD A;  1THX A;  3VWX A;  3H8Q A;  6GST A;  22GS A;  4DSS B;  2ZCT A;  4PXO A;  1R5A A;  5F06 A;  2GZY A;  8GSS A;  4FQU A;  5LNK e;  4AJ8 A;  1WOU A;  3IRA A;  4X1U A;  5AN1 A;  3PIN A;  5DQS A;  4EE0 A;  3TJK A;  2FA4 A;  1EOG A;  2YV7 A;  3KGK A;  4IKH A;  3MAK A;  5D8I A;  3VFI A;  1I9D A;  1SYX A;  4NAX A;  4TR0 A;  1F3A A;  2H74 A;  2O8V B;  1M9A A;  5JWR B;  4XS6 A;  3FZ4 A;  5AIV A;  5LD0 A;  4WR4 A;  5G31 A;  2GZZ A;  3ME7 A;  3C7M A;  4YAV A;  1WP0 A;  1O8W A;  4K7N A;  3DWV A;  4HDE A;  2GGT A;  2IMF A;  4BVX B;  4G0L A;  2LV3 A;  5G1K A;  2NPB A;  1PD2 1;  1AQW A;  2R5G A;  5D93 A;  1THO A;  3EVI A;  3UAR A;  1M2D A;  2FA8 A;  2ON7 A;  4I6X A;  1XCC A;  4CW9 A;  1UA5 A;  3LQ7 A;  3S9F A;  4QL9 A;  1A24 A;  3L9U A;  5J5N A;  4ID0 A;  2GT5 A;  2H71 A;  2VD1 A;  5ECN B;  2VCZ A;  2AB6 A;  3Q74 A;  4WF5 A;  3F3Q A;  2C0F A;  2V6O A;  2C0G A;  5L71 A;  1UN2 A;  3TB2 A;  3VPQ A;  4IP6 A;  3VWV A;  3KTB A;  3EU4 A;  5G2Z A;  3WT1 A;  1TK0 B;  2H6Y A;  5IO0 A;  4Z2R A;  3W8S A;  1Z6N A;  4V2L A;  5DQY A;  3H4K A;  4HOJ A;  2XPE A;  4IJI A;  4L5L A;  3HJP A;  3FZ5 A;  1DSB A;  4EO3 A;  4HQZ A;  3L78 A;  1SU9 A;  2K6V A;  3W6G A;  4KW6 A;  2HRA A;  3GKX A;  2O7K A;  4Z7X A;  2X8G A;  4CHS A;  5JWO B;  1TI3 A;  3UL3 A;  1EV9 A;  2L6C A;  1TRU A;  3VWU A;  2CX3 A;  1EV4 A;  2H66 A;  2OE3 A;  4GSN A;  1RW1 A;  3TOU A;  4YH2 A;  2WFC A;  4PQ1 A;  1ZYQ B;  4EIQ A;  3ZLP A;  2QKE A;  1A8Y A;  3IAM 2;  3TKR A;  4NHZ A;  2Z9S A;  4EL1 A;  2B5X A;  3C73 A;  1EGO A;  5HFI A;  2ZNM A;  4NMU A;  2WCI A;  4I97 A;  3UOM A;  1OC9 B;  4OMV A;  4IVF A;  2MMN A;  3F6F A;  1ERV A;  2HSY A;  3FMW A;  5DAL A;  5HFK A;  4E8H A;  1XFL A;  1XOA A;  3IK7 A;  3ZFB A;  2WGR A;  1QQ2 A;  2K8V A;  3O6T A;  4PUF C;  3US3 A;  3G7Y A;  3H79 A;  1VF1 A;  1EEJ A;  1K0D A;  4Q5Q A;  4TXO A;  4MJB A;  1BED A;  1JZW A;  4PX1 A;  3IOS A;  4NWY A;  2AV4 A;  3APS A;  3LJR A;  5D9V A;  2IFQ B;  1HNA A;  5HR2 A;  2FNO A;  1YY7 A;  3QAV A;  5G1L A;  3BBY A;  4GSS A;  4PNF A;  4TR4 A;  4WXT A;  4FO5 A;  1ZOF A;  1FW1 A;  4V1A g;  2XBI A;  2G2Q A;  1N2A A;  3TJG A;  3VI7 A;  2CQ9 A;  1AC1 A;  1IYI A;  2VL3 A;  1WJK A;  1ZMA A;  4J57 E;  1SKW B;  2HSH A;  2YCD A;  1T1V A;  4XRA A;  1KEB A;  1HD2 A;  4WBR D;  2A2S A;  5A4V A;  4CY8 A;  3BOA A;  3RHB A;  4MNN A;  2LST A;  2GSS A;  2PUK C;  3EU3 A;  3QFA C;  2KLX A;  1X9W B;  2PER A;  5C04 A;  2V41 A;  2VL2 C;  3LWA A;  4K0N A;  4DVC A;  2JAD A;  3RPP A;  1A8L A;  3LXZ A;  1O6J A;  1GSY A;  5JCW A;  3IXR A;  5CO3 A;  1SEN A;  5ECQ B;  6GSS A;  4IEL A;  1SJI A;  1XOB A;  3CSJ A;  1XVW A;  3FYG A;  3R2Q A;  2H72 A;  2FY6 A;  3I6A A;  4K2D A;  2N5A A;  1GTU A;  4ZBA A;  1JLV A;  2HRN A;  2MYG A;  2OBK A;  2I81 A;  4JBB A;  10GS A;  1K0M A;  4L0W A;  3DXB A;  4FYB A;  5EY6 A;  3QDN A;  5KN1 A;  2FWH A;  2H01 A;  2GSR A;  3NZN A;  3UIW A;  5DAK A;  1VGL A;  5B8A A;  3FY7 A;  1EZK A;  1BQ7 A;  4HUA A;  4QQ7 A;  1Z7R A;  2V32 A;  1J9B A;  1ZZY A;  3C1R A;  3F4T A;  4JED A;  2CVK A;  5IIZ A;  3A2X A;  4L5O A;  3L9S A;  3H93 A;  1WE0 A;  19GS A;  2E2G A;  4GQC A;  3IAS 2;  1H75 A;  1YF1 A;  4AF2 A;  2EC4 A;  1YKA A;  3DKS A;  3QD9 A;  2VUP A;  2CV4 A;  3GIX A;  3ME8 A;  4ZB9 A;  4IQ1 A;  1GP1 A;  2YNX A;  1JHB A;  5B7C A;  1MD4 A;  2HRK A;  1LBK A;  5COH A;  5IO2 A;  4I8B A;  2VM1 A;  3GSS A;  1B48 A;  3LOR A;  3TRQ A;  2PMT A;  5B6N A;  1AIU A;  3ZMK A;  1T4Z A;  2C3N A;  3P8W A;  4J56 E;  1MD3 A;  2C1Y A;  4TR1 A;  4V1A p;  4X0X A;  5IOW A;  3RPN A;  4J2F A;  5DDL A;  2H1D A;  3ZRE A;  2OBI A;  1AUC A;  1GL8 A;  4HZ2 A;  11GS A;  1G7E A;  2FUG 2;  1K3O A;  3C8E A;  3FEU A;  4X4J A;  2GQL A;  4ZB8 A;  5F05 A;  2M80 A;  1YDK A;  2R4V A;  5HR0 A;  4EC0 A;  5BMU A;  4ZB6 A;  3LW9 A;  1FG4 A;  4MAB A;  3M3M A;  1WRY A;  1ZYP A;  2VL2 A;  4ISD A;  2B7J A;  3KH7 A;  1UC7 A;  2DKI A;  2GT6 A;  3TKS E;  2JSZ A;  4PGT A;  3ZIV A;  2TRC P;  2CZ2 A;  5GZZ B;  1NM3 A;  2P5Q A;  3VK9 A;  2BJX A;  2H73 A;  4EXJ A;  4ZBB A;  3KXO A;  1V9W A;  2B5E A;  1GNE A;  1HQO A;  5DAL B;  4K5R A;  2LKU A;  1BJX A;  2VLT A;  1O81 A;  2KHP A;  1CQG A;  1Y25 A;  2CZ3 A;  4K9Z A;  3U5R E;  2H8L A;  3F0I A;  5LCZ A;  2WJU A;  1WMJ A;  5BRT A;  3F3R A;  5CP1 A;  4TXO B;  4JU5 A;  2PGT A;  2DIZ A;  5CNW A;  3Q18 A;  3F9U A;  18GS A;  3CYN A;  3I43 A;  4KSO A;  5KEJ A;  4E8E A;  5KN0 A;  2MBS A;  4G10 A;  2MMO A;  3IHQ A;  1XW6 A;  1YKC A;  2GLR A;  2B7K A;  3KTL A;  1ZYN A;  3ZFL A;  3IBH A;  4TW5 A;  3HY2 A;  4OD7 A;  3H1N A;  2DJJ A;  4O5Q A;  2DBC A;  2VOC A;  1X9M B;  4RQR A;  3GKN A;  3UVH A;  1OKT A;  14GS A;  4KDY A;  3GN3 A;  2HE3 A;  3EC3 A;  4OWY A;  4ML6 A;  3WD6 A;  3UEM A;  1GLP A;  2RM6 A;  5J9B A;  4NV5 A;  3ZRD A;  2L57 A;  5CRH A;  2PWJ A;  2EIR A;  1QGV A;  4K2X A;  1XWC A;  3DML A;  2VCV A;  4PQH A;  3WGX A;  1USB A;  1EP7 A;  3SWL A;  1XPV A;  1M9B A;  5CRD A;  4KND A;  3K8N A;  3CSI A;  3W8J A;  1NHY A;  1WPI A;  2OAD A;  3PPU A;  2YZU A;  2DJ2 A;  1XW9 A;  4LMW A;  9GSS A;  2HI7 A;  2IWT A;  3QPM A;  1A0F A;  4EIP A;  3MNG A;  4JE1 A;  3NIV A;  3TUE A;  1PSQ A;  4N11 A;  3WYW A;  2H75 A;  2I4A A;  2YWO A;  4YQM A;  3QFB C;  4TVE A;  4LL4 B;  4JR4 A;  3IE3 A;  3ED3 A;  2FLS A;  4MH2 A;  4PUA A;  5DAK B;  5FT3 A;  5H5Q A;  5E4W A;  2YOI A;  3KMN A;  1K0B A;  2KOK A;  4BWQ A;  1JZD A;  3O3T A;  1W89 A;  3FZ9 A;  4FYU A;  4ZBD A;  4USS A;  1R26 A;  3C71 A;  2RUF A;  2CX4 A;  3N5O A;  2VO4 A;  4TXV A;  4BVY B;  1FO5 A;  4KCE A;  3PGT A;  4NXI A;  3QMX A;  1ACV A;  5ELA A;  3AY8 A;  2F8F A;  3GL3 A;  1V57 A;  2DIY A;  4IS0 A;  1W4V A;  1ZCP A;  3C1S A;  2QC7 A;  1Y6E A;  1QUW A;  1GSU A;  2O87 A;  1T00 A;  4MJA A;  3QCP A;  1K0A A;  5ID2 A;  4JR6 A;  1XZO A;  3M0F A;  4I2T A;  1GWC A;  2YAN A;  3EUR A;  3TRX A;  1A0R P;  3WGD A;  1GTI A;  1X0R A;  1T3B A;  3HHV A;  3LGC A;  3ZYW A;  3KMO A;  5IOX A;  4V2N A;  4N30 A;  4DSQ A;  3TJF A;  4TR1 B;  4OCE A;  2GS3 A;  3ERF A;  4MPF A;  3GTU A;  5DJM A;  2NTO A;  4RI7 A;  1QMV A;  2FHE A;  5C00 A;  5KOX A;  1ZGN A;  1PX7 A;  3HYP A;  4HU7 A;  3E0U A;  1TU7 A;  5B6M A;  3HJM A;  1ILO A;  3GFK A;  1QXH A;  1WIK A;  1F2E A;  2QGV A;  1K3Y A;  1B9Y C;  5AGY A;  1CQH A;  1M2B A;  2PBJ A;  4Q5N A;  4MCU A;  4QL7 A;  4KA0 A;  1XVQ A;  5IPG A;  4MK3 A;  1DUG A;  3J7Y k;  4K0G A;  3LEF A;  1YEP A;  3F6D A;  3IDV A;  3IHG A;  4LA1 A;  2LRT A;  4K7I A;  4ACS A;  1ZYE A;  5ENU A;  2IMI A;  2R0C A;  5INY A;  1MDJ A;  2H76 A;  2CVB A;  1VF3 A;  2VIM A;  2DJ0 A;  2IMD A;  3NOF A;  2TRX A;  1B4P A;  2H0G A;  2L59 A;  5KN2 A;  1S3C A;  1KBN A;  1G6W A;  1GUM A;  3TCO A;  4FH8 A;  4GST A;  2WZ9 A;  4Q5R A;  3EYT A;  4ZL7 A;  16GS A;  6GSU A;  1BX9 A;  2QSI A;  1MDK A;  2DJ3 A;  4CY6 A;  3L4N A;  3EMP A;  3VLN A;  2M72 A;  1XWA A;  4FIW A;  4A5P A;  5CAX A;  2GVP A;  4IHU A;  3CBU A;  3LXT A;  3FRC A;  3QAG A;  4O92 A;  3CSH A;  3LSZ A;  4Z2U A;  2HRF A;  1TW9 A;  4K8M A;  2JZS A;  1FVK A;  5ELG A;  2VM2 A;  1ERU A;  4IW9 A;  2FCH A;  5IMF A;  4Z2T A;  4KH7 A;  3BCI A;  1ZL9 A;  1XW5 A;  5B8B A;  1GRX A;  1NW2 A;  2A2R A;  4G2E A;  5JWQ B;  5IMA A;  2LS5 A;  2A2P A;  1GH2 A;  3IPZ A;  2KP1 A;  1VF4 A;  3A2V A;  1Q4J A;  2DJ1 A;  5J3R A;  5F8B A;  1SK2 A;  2IL3 A;  1YZX A;  4KDX A;  1I5G A;  2YWM A;  1WWJ A;  4WET A;  5HR3 A;  4F9Z A;  2K9F A;  2ON5 A;  5JCG A;  5D9X A;  3HKR A;  2K8S A;  3FK8 A;  2LRC A;  3HVX A;  2JZR A;  2CA8 A;  1Z7P A;  3A3T A;  4EVM A;  1EOH A;  2V6K A;  2H19 A;  3HXS A;  4MJE A;  5J41 A;  1AW9 A;  1KTE A;  1FOH A;  2VCX A;  3DYR A;  1SYR A;  2DML A;  1K0C A;  4KAE A;  5CYY A;  1DBY A;  3QAW A;  3LG6 A;  2L4C A;  2H0H A;  2GSQ A;  3GNJ A;  1JZO A;  3HZ8 A;  2HT9 A;  5D73 A;  1O73 A;  2P31 A;  2LJK A;  4ILF A;  1X5C A;  2C3Q A;  3UMA A;  4OFT A;  2G0F A;  2X49 A;  1V58 A;  1NSW A;  2H1B A;  1PN0 A;  4FYC A;  3GH6 A;  1R4W A;  4GCI A;  5ID2 B;  1TK8 B;  3IK9 A;  1O7U A;  4GWR A;  3FW2 A;  4G0I A;  1YQ1 A;  3DIE A;  4D73 A;  3D22 A;  3GHA A;  3GKM A;  5ECS A;  2F51 A;  3HVV A;  2PVO C;  4MF5 A;  3G7I A;  3EMX A;  2FWE A;  2PVQ A;  4POL A;  1Z3E A;  1XIY A;  1SL1 B;  3ZIT A;  5JCU A;  2YN1 A;  2HSM A;  5ECL B;  4WKW A;  2YJH A;  6GSV A;  2LRN A;  3GA4 A;  3HZ4 A;  3UVT A;  5DVB A;  4GRF A;  1GTA A;  5ECP B;  2B1K A;  5A5K A;  4HJ2 A;  3GTU B;  4OO5 A;  3KH9 A;  4K7O A;  1YJ6 A;  1VF2 A;  5ABR A;  2O89 A;  3TKP A;  2GDR A;  1O8X A;  4HI7 A;  2AHE A;  4OO4 A;  2C4J A;  3L0H A;  2VAF A;  7GSS A;  1FHE A;  2RM5 A;  3CTF A;  3CXG A;  1AAZ A;  1SKS B;  4ZIL A;  1Z6M A;  5D9W A;  2RUE A;  4POK A;  4IQA A;  1T7P B;  4OFN A;  3O76 A;  2GTU A;  3QOU A;  2X99 A;  5CRE A;  5DJL A;  2HYX A;  2MZC A;  2HXK A;  3TDG A;  2E0Q A;  1SJ6 A;  6GSX A;  1EEM A;  5ECM B;  2IMK A;  1FB6 A;  2X4A A;  1KNG A;  3CRT A;  1PN9 A;  2YWI A;  2PPT A;  3WGE A;  3VPT A;  3FR3 A;  1FB0 A;  3TJB A;  2HNL A;  1TK5 B;  4YQV A;  2K18 A;  1OC8 A;  2VLV A;  4AGS A;  2R0P A;  1E6B A;  2WUL A;  4ECC A;  4XS1 A;  3D0Z A;  3BCK A;  4N0V A;  3EIN A;  3M9K A;  3GL5 A;  2I1U A;  5KN3 A;  1PRX A;  2BMX A;  1XWG A;  3DVW A;  5A4W A;  3Q19 A;  4O5R A;  1OE7 A;  4GQF A;  1M99 A;  3ZL5 A;  3ERW A;  4NHW A;  3IC8 A;  3TRP A;  1F3B A;  4KE3 A;  3R3E A;  1EP8 A;  4YKF A;  3KEB A;  3ZTL A;  1PQN A;  2QA1 A;  3ZVJ A;  1QFN A;  4XIH A;  5GSS A;  1Z9H A;  2NBS A;  4WF4 A;  1A2M A;  4GTU A;  5A4U A;  2I3Y A;  5GAN D;  3RDW A;  1IYH A;  2AJQ B;  4MMM A;  3ISO A;  5DBQ A;  2KP2 A;  2AYT A;  2LEG A;  2GZP A;  2M46 A;  4MZW A;  2QA2 A;  2GQM A;  4PUR A;  3F63 A;  4MDC A;  3LYK A;  1GUH A;  2L5L A;  1MDI A;  1JLW A;  3P7X A;  2YP6 A;  3PR8 A;  1XWB A;  3Q6O A;  4IBP A;  2C0D A;  3D5J A;  5F0G A;  3DVX A;  3FKF A;  1B9X C;  4TKY A;  3M9J A;  3D4M A;  1HYU A;  2DJK A;  4MPG A;  2MBT A;  1XBS A;  2H1A A;  3PH9 A;  3HVS A;  3MYD A;  4H86 A;  4ICY A;  2CAI A;  2F3M A;  5H5S A;  1AQX A;  1TOF A;  2CT6 A;  20GS A;  2B6M A;  1TRS A;  2OKA A;  3D21 A;  3CMI A;  3ZVJ D;  3GH9 A;  1NHO A;  4K6X A;  13GS A;  12GS A;  1SKR B;  4RQX A;  2J23 A;  2X8C A;  2V1M A;  1U88 A;  1FAA A;  1V98 A;  1DE1 A;  1SK1 A;  4L0U A;  1JFU A;  5ECK B;  1LU4 A;  3JCM L;  2C3T A;  1BAY A;  4ML1 A;  4ECB A;  2VCQ A;  2P0G A;  1QK8 A;  5IQY A;  2B5Y A;  4MZB A;  5IPH A;  4TRX A;  1PX6 A;  4EKZ A;  5HR1 A;  4TOP A;  1DE2 A;  5EL8 A;  1OKD A;  4V2M A;  4N10 A;  1SJZ A;  4RI6 A;  1F9M A;  1ERW A;  4X43 A;  1PKZ A;  3APQ A;  2LJR A;  4KX4 A;  4XS4 A;  3ZIJ A;  2TIR A;  2VLU A;  2IIY A;  5FHI A;  2C8U A;  2C80 A;  4POB A;  3V1W A;  4LLR A;  3HJO A;  2LQQ A;  1PMT A;  2HFD A;  4L8E A;  4KB3 A;  2PU9 C;  4XTS A;  3KIJ A;  2LNS A;  2ES7 A;  3HDC A;  1YEX A;  4IGJ A;  4MH3 A;  3CRU A;  3TKQ A;  3UBK A;  2JAC A;  1ST9 A;  3HCZ A;  1G0T A;  1X5D A;  4F0B A;  1GSQ A;  2DSA A;  5E59 A;  2HZF A;  2GQK A;  5GST A;  4JZQ A;  2R6K A;  2F8A A;  1F37 A;  5IM9 A;  1ML6 A;  3TKS C;  3I9V 2;  2LQO A;  4D73 B;  2UZ8 A;  2HZE A;  5IMD A;  2E2M A;  1GSE A;  2JL4 A;  5ECI B;  3F4S A;  2LUS A;  1T8E B;  5CRG A;  4MA9 A;  1FVJ A;  2NVL A;  1T4Y A;  2FWG A;  1EWX A;  3M8N A;  2FWF A;  3FZA A;  4JRR A;  4ECJ A;  2XHF A;  1GSF A;  5DCH A;  2O85 A;  2H70 A;  3GX8 A;  1TTZ A;  1N8J A;  2LTK A;  3U6V A;  3D4T A;  1AXD A;  4MZC A;  1G7O A;  5HQP A;  1TDI A;  1PKW A;  1GUL A;  1GNW A;  4BL7 A;  1K3L A;  2WS2 A;  1C72 A;  3GMF A;  4LMV A;  1GTB A;  3IV4 A;  3IA1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...