2OE3A

Crystal structure of mitochondrial thioredoxin 3 from saccharomyces cerevisiae (oxidized form)
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
106
structure length
106
Chain Sequence
SSYTSITKLTNLTEFRNLIKQNDKLVIDFYATWCGPCKMMQPHLTKLIQAYPDVRFVKCDVDESPDIAKECEVTAMPTFVLGKDGQLIGKIIGANPTALEKGIKDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thioredoxin-3
publication title Structural and mechanistic analyses of yeast mitochondrial thioredoxin Trx3 reveal putative function of its additional cysteine residues
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Electron transport
total genus 33
structure length 106
sequence length 106
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2oe3A00
1UN2A 2RM6A 1G7OA 1YF1A 1WPIA 4BPYA 1WJKA 3I6AA 2O89A 1ZYQB 3IAS2 3GH6A 2HE3A 3G7IA 1GNEA 4XCSA 2B1LA 1R26A 2I1UA 2IL3A 3GKNA 1X0RA 3IHQA 2F9SA 3P7XA 3IBHA 4MK3A 5KN0A 4ACSA 2P5RA 4J57E 4KX4A 4MMMA 3QMXA 5H5SA 1FB0A 2GZZA 2TRXA 1XPVA 2LS5A 2N5AA 3F4RA 2V2GA 2H1AA 4EUYA 2P31A 4F0BA 5G1KA 1F6MC 2AB6A 1GSQA 5IO0A 4KSMA 4XTSA 3ZMKA 3GUSA 2C0EA 5CRDA 2GQLA 4IJ3A 3VK9A 5ID2B 3MDKA 4POMA 2GSRA 5CRHA 4GF0A 4WETA 2WZ9A 2PU9C 2C3NA 2FWGA 5DJLA 3LORA 4GSSA 2CVDA 1Z3EA 4YAVA 2GVPA 4XHMA 4YH2A 2QC7A 3GNJA 3RHCA 1XWBA 4MZCA 1J0FA 4JR4A 3PR8A 4ZIJA 1GUKA 2AUVA 3ZYWA 1A0RP 1DBYA 3ZIJA 1PKWA 4GWRA 2YZUA 4ZL7A 1TDIA 2E7PA 1PSQA 1XVWA 3EU4A 2FA8A 1CQGA 4P3YB 3ED3A 3ERWA 2E2MA 3L4NA 4X1UA 1FB6A 2DBCA 5GSTA 1B4QA 1C72A 3TJJA 4OWYA 2LKUA 3OR5A 6GSVA 4LMWA 3KTLA 3HVXA 1XIYA 3H4KA 2RIIA 4V2NA 4E8HA 3BOAA 3L0HA 5B6MA 12GSA 1SL0B 4EC0A 1RW1A 4CW9A 2L57A 3CBUA 3CXGA 5G2ZA 2PN8A 1F3AA 4Q5RA 2YZHA 1OE8A 2HFDA 5IPGA 5ECRB 5IMCA 5GZZB 1FO5A 1UA5A 4GQFA 1U3AA 4G10A 3EC3A 1A23A 4ZL8A 4IKHA 2B1KA 2NTOA 3D22A 1JFUA 4NPBA 1FVKA 2M72A 2MZCA 2VL3A 1G7EA 5JCGA 2VO4A 3HKRA 1O6JA 4L8EA 3IK7A 3GIXA 3UBLA 4WR4A 1Z9HA 2DMLA 2YWOA 5GAPD 4LL1B 1TI1A 3DVWA 3VWVA 2IFQA 3H79A 2IN3A 5DCHA 5CO3A 1U6TA 3GL5A 1TK5B 3H1NA 3Q19A 5F06A 4G2EA 4ZBBA 4XS1A 1PL1A 1USBA 4TR1B 2CX3A 1K0OA 1EV4A 1K0DA 2EIRA 2L59A 2HYXA 4BA7A 1KEBA 1V57A 1EP7A 3RBTA 4TXOB 3VI5A 4I2TA 3GFKA 5B8AA 4HDEA 1ERVA 1ABAA 2R2JA 3I69A 2IIYA 3K8NA 3IOSA 1XWKA 5J41A 1XW6A 3D5JA 3LSZA 4EKZA 2P0GA 4O7HA 13GSA 2VLUA 1GSSA 1K3OA 5IIZA 2WULA 3QFAC 1XXUA 5ECLB 1SU9A 4JZQA 1SJ6A 3F8UA 2LRNA 4WR5A 2GGTA 3ZVJA 2FA4A 2XBIA 2YV7A 1PQNA 1T1VA 2Z9SA 1TP9A 4TXVA 4FYUA 4HU7A 1MD3A 3D4MA 3QDNA 4PURA 2HZEB 3TOTA 1JZOA 2LEGA 5DALB 1THOA 4HI7A 4FYCA 1A8YA 4K7IA 1HQOA 2MMOA 3IXRA 3F4SA 3WT1A 2VOCA 4TR4A 2GQKA 3TJFA 3C1RA 2OJLA 5IMVA 1OAZA 3KP9A 3O6TA 3IDVA 3P8WA 1QFNA 1TW9A 1BEDA 4KSOA 1TU8A 3M9KA 3EMXA 1GTBA 3UL3A 1SYRA 2H74A 2H6XA 5JWRB 2JL4A 3UEMA 3L9SA 1BJXA 3TKSC 1A2JA 4Q5NA 4AF2A 3UMAA 2HT9A 5ABRA 5AIVA 1HNCA 2G0FA 2VCTA 3FK8A 3ZMLA 1X5EA 4YAPA 1XWAA 2YP6A 2CZ2A 1LBKA 3UIWA 3QAVA 1GLPA 4L5OA 2R37A 1XCCA 2BTOT 2OBKA 3GH9A 3HVSA 2PUKC 1TJDA 5IMDA 1GNWA 2LQOA 5A4WA 2HRFA 3VURA 4HZ4A 2DIYA 3G9BA 4MJAA 4YQUA 1SKWB 4IW9A 1GSFA 2YJ7A 2GTUA 4KH7A 6GSYA 4OO4A 1GWCA 1YY7A 2IMIA 2VLVA 3EVIA 6GSUA 3VI7A 1WE0A 2O8VB 5ENUA 3L9VA 4NHWA 3TRQA 20GSA 2VCZA 3EU3A 4FYBA 4POKA 3WD6A 3LYKA 4MCUA 3D4TA 4F9ZA 1NHYA 1F2EA 2FGXA 3KTBA 4PXOA 1KBNA 2MBTA 3E0UA 4TR0A 3ZRDA 2CVBA 2GT6A 17GSA 4MA9A 5D9TA 1N2AA 2L4QA 3HYPA 4BVXA 1AUCA 1XWGA 1WOUA 5AGYA 1PX6A 4OCFA 11GSA 2FWEA 3GSSA 3GTUA 3IPZA 1GULA 2A2SA 3C71A 5EPFA 3QPMA 1OC9A 4JR6A 1K3LA 1GSYA 2MMNA 1ACVA 1Y6EA 2CA8A 1Z5YE 1JLWA 1KNGA 2I4AA 3UBKA 1TOFA 2C4JA 3IRAA 4MF5A 5JCUA 1ZCPA 4QL7A 4HJMA 3DMLA 1O7UA 5DAKB 4K1FA 4WKWA 3GN3A 1XVQA 2C80A 3MNGA 4JU5A 3UARA 1V9WA 2YANA 5G1LA 4JEDA 4GTUA 2YCDA 1MDJA 4XIHA 1RK4A 1URMA 3A2VA 3NZNA 1AAZA 3W8JA 2VL2A 1GUHA 5C00A 4F82A 2TRCP 1JZDA 4ULXA 5LD0A 4I2UA 1WIKA 3I43A 1B8XA 3KZQA 1HNBA 1GTAA 1X9MB 1EEMA 4OFTA 2VCQA 5IO2A 4HUAA 4WBRD 3LQ7A 1BAYA 4XS4A 2WFCA 3LEFA 3FZ9A 2O85A 2I3YA 4MPGA 1DE2A 1J08A 5D9XA 2GS3A 3KMOA 1OC3A 3TUEA 5IMFA 4KCEA 1XZOA 3BD2A 3EWLA 1GRXA 2KP2A 5DDLA 2VM2A 4IN0A 1MD4A 1K0CA 1QUWA 1TXXA 2IMFA 2LNTA 3WGXA 3N9JA 2GT5A 1QMVA 4FIWA 3RPPA 1B48A 4ECCA 16GSA 3E3EA 3A2WA 2LQQA 2EIQA 2YOIA 3HA9A 3VWUA 2H0HA 3CMIA 1V40A 3KP8A 4EO3A 4OD7A 4O92A 2F8FA 3LXTA 5DCGA 2GSSA 2K18A 3N5OA 4FO5A 3RAZA 5G5EA 1ZYEA 3KCMA 2AHEA 2XBQA 4O32A 1I9DA 4PQIA 5L71A 1K0BA 5ELGA 3VWXA 2V6KA 3JCML 2ALBA 1M9AA 4KAEA 1TI3A 2JSZA 3F6DA 1PD21 5AN1A 5H5QA 6GSSA 2C8UA 3GX0A 1FG4A 2GSTA 1TK8B 4GCIA 2MBSA 1HNAA 5CREA 2LJKA 18GSA 4GSTA 3V1WA 1SKRB 2OA7A 1NSWA 3VPTA 3D21A 5ECNB 2MMAA 1X5DA 2L6DA 4I8BA 1XW5A 3GMFA 2JACA 2VCXA 1VRSD 3CSHA 1GSEA 2FWFA 2P5QA 1OYJA 1M99A 2RUEA 1O8XA 5CP1A 1SK0A 2B6MA 2H30A 3KXOA 4RUVA 2R4VA 1GSUA 2LRTA 4V1Ap 3DXBA 2LUSA 3L9UA 4K2DA 5KN2A 2IMEA 4H86A 3DVXA 1A0FA 5KEJA 2X8GA 4GQCA 2WGRA 4MZBA 2B7JA 4LMVA 3FHKA 4DVCA 3RPNA 4OFNA 1ERWA 4HOJA 4XRDA 3TRPA 2HZFA 4HQSA 2A2RA 1NM3A 5DJMA 2REMA 1KTEA 3ZREA 2D2ZA 2NDOA 1FOVA 2PBJA 2PVQA 1EWXA 3ZL5A 1O8WA 1U88A 2J23A 4TKYA 2VUPA 1SL1B 1TKDB 2FUG2 6GSTA 1ERUA 1OVNA 4EL1A 4KA0A 3FZAA 1MEKA 4JBBA 4LA1A 3DEXA 2MMZA 1THXA 2PVOC 2FWHA 1M7TA 3KIJA 4V2LA 2QSIA 5HR2A 1ERTA 1SKSB 4D73B 2VD1A 2AYTA 1W4VA 4MABA 5CRWA 4K7OA 3HY2A 2C0FA 5D9WA 4WXTA 2NPBA 2GZYA 2RLIA 1PN9A 1N8JA 5IMZA 2B3SA 1G6YA 8GSSA 1PA3A 2LTKA 5JWOB 2GLRA 1MTCA 4N0ZA 3S9FA 3MWHA 4DSSA 5HR3A 4IQAA 1FAAA 1R4WA 4YQVA 2PPTA 2FLSA 1XWCA 5CNWA 2IJYA 2XPEA 4IHUA 2LNSA 4I5QA 1X9SB 1XW9A 1GH2A 1K0AA 4POBA 2ZNMA 2OBIA 1ZOFA 2YNXA 5G31A 3QOUA 1LJRA 2H19A 4ECJA 4TR1A 5HQPA 1VGLA 3KEBA 2PWJA 3QCPA 5DVBA 2H1GA 1EOGA 4HQZA 2YWNA 4WF4A 1AC1A 1A8LA 2LSTA 4RI6A 4TRXA 2J9HA 3GRXA 5F0GA 1X9WB 2GZPA 4PX1A 3VWWA 2HNLA 1S3AA 2JZSA 3PGTA 4EDZA 2M46A 2GSQA 4N30A 4I6XA 1ST9A 1YQ1A 4O5RA 5C04A 1O85A 1DUGA 5ELAA 5JWQB 2X99A 5IMAA 2L5LA 1T00A 4MJBA 4ZL9A 3U5RE 4KNDA 2GDRA 2C1YA 3DIEA 4LL4B 2VCVA 1S3DA 1SJIA 2YV9A 3BCKA 2E2GA 4ZILA 2DIZA 5J3RA 6GSXA 3KJYA 5DALA 4L0UA 2WCIA 2NBSA 5HFIA 1ZL9A 1BX9A 4MZWA 7GSSA 1GL8A 3QD9A 5J5NA 3GHAA 1WMJA 1M0UA 4NXIA 3A2XA 1XOBA 1E2YA 1NHOA 1OKDA 2KP1A 1EOHA 4PNGA 2R6KA 3D6IA 3DGQA 5FWGA 6GSWA 3IA1A 1V98A 1A2LA 3FZ4A 3PINA 1AQXA 4DSQA 4NAXA 4XRAA 1QGVA 2V1MA 1PL2A 2WDUA 5B8BA 1T4YA 1EV9A 4OMVA 3EURA 4ML1A 1A24A 3NOFA 5A5KA 3W6GA 3UVHA 2JSYA 2DLXA 3DD3A 5ECHB 3US3A 5IM9A 1T7PB 2DJ1A 3O3TA 5D93A 5DQYA 3DYRA 2F3MA 3EYTA 2CT6A 2JU5A 2V32A 3DKSA 2B7KA 2O87A 3FR6A 5INYA 1IYHA 4X43A 1G6WA 5EL8A 2C0GA 3ERGA 3GTUB 1B9YC 5HFGA 2X8CA 4Q5FA 4NV5A 1OC9B 4V1Ag 4E8EA 2ZUPA 4IP6A 3EINA 2K8VA 1B4PA 1TRWA 4MPFA 1TRSA 2LRCA 1V58A 3RHBA 2R5GA 4KB3A 2B5XA 2BJXA 4OO5A 1JHBA 2WRTA 3CSIA 3IV4A 4K6XA 5F07A 5ECSA 1DE1A 5D8IA 2B5YA 2H73A 1F3BA 2XHFA 2DJJA 4IVFA 3TJGA 3EE2A 2FNOA 2OE1A 2CQ9A 2CV4A 9GSSA 2WS2A 3HHVA 2N5FA 4RI7A 2VM1A 2H66A 1YEXA 2RUFA 1SK2A 4N0VA 2H0IA 3QAWA 3F63A 1UVZA 3VFIA 1ILOA 4L5LA 4YQMA 1XBSA 1M2BA 5AIXA 3TCOA 1SD8A 2FCHA 1GLQA 3GKMA 1QQ2A 14GSA 4XS4B 4IBPA 4ZBAA 4CDOA 4N11A 3C8EA 1EEJA 3QFBC 1M9BA 1S3CA 5KN1A 3F9UA 1U3IA 2VL9A 3J7Yk 3ME8A 2H76A 3TKSA 4IP1A 1UC7A 4Z7XA 4KCAA 2JADA 3HDCA 5DAKA 4WF5A 2K8SA 1FHEA 3CRUA 1HD2A 2C3QA 3ISOA 1G0TA 3HVVA 3Q6OA 5CYYA 5IOWA 3KD0A 4N10A 3SWLA 1K0NA 4GXZA 5ECOB 4BWSA 2HXKA 3P90A 3H93A 2YJHA 1SK1A 2DJ2A 4NMUA 3BJ5A 5LCZA 3LXZA 1CQHA 1A2MA 3GKXA 5D96A 4PUFC 1TRVA 1QK8A 3DRNA 4XS6A 2IMKA 3H8QA 3TRXA 4F0CA 4K8MA 4KW6A 4RQRA 4TW5A 1AIUA 4WEYA 4KDXA 3CTGA 4EDYA 1XFLA 1YJ6A 5ECMB 3APQA 4EVMA 3ERFA 4ZXGA 3D0ZA 1TU7A 3M0FA 3WYWA 4MH2A 4G9HA 3FR9A 1PX7A 1NW2A 2IPAA 5IQYA 4DEJA 3APOA 2YWIA 3QAGA 3HJPA 4IGJA 5CRGA 10GSA 3LGCA 2R3XA 4JRRA 3C1SA 2ON5A 1EGOA 1SJZA 4TN8A 2DSAA 2OKAA 4QL9A 4CHSA 3EMPA 3GYKA 1K3YA 3F3RA 3A3TA 3BBYA 5GAND 3ZVJD 4K7NA 3F4TA 2EIOA 2YWMA 3TKRA 2IMDA 3U6VA 4V2MA 4TR3A 3MSZA 1T3BA 5ID2A 3ZZXA 2GQMA 2HRNA 3IR4A 5D73A 1BG5A 3VLNA 2H6YA 1U87A 1IYIA 3ZTLA 2DJ3A 1F37A 3R2QA 2FD3A 4PGTA 2ES7A 2X64A 2JZTA 3Q18A 4ML6A 5EVOA 3KM6A 2CX4A 4POLA 1BYEA 4EE0A 22GSA 1GSDA 4TVEA 3LFLA 1R5AA 3UOMA 3WT2A 3LYPA 2EC4A 1YKAA 1EP8A 1DSBA 4ISDA 1Z6MA 3LJRA 2TIRA 2DJ0A 4HJ2A 2QKEA 1GTIA 4AJ8A 5B7CA 1RQMA 1VF1A 1OC8A 2WJUA 2JZRA 3GURA 3C7MA 2HSHA 5HR1A 2IFQB 3FR3A 3CRTA 4MDCA 3KH9A 3GA4A 4EF0A 1AQWA 1VF4A 3A5WA 5J9BA 2RM5A 2F51A 5IOXA 3LG6A 4AJ7A 3FKFA 3IC4A 1FW1A 2OADA 1M2DA 3FY7A 3F3QA 4MP4A 2CZ3A 4L0WA 3TDGA 3ZIVA 4IJIA 5ECKB 3HD5A 4KDYA 4ZB6A 5F05A 1BQ7A 3ZITA 4DSSB 1OE7A 2K6VA 4GLTA 2HI7A 4JE1A 2VD0A 2YN1A 3QR6A 4ECIA 2F8AA 3HXSA 5ECPB 2QGVA 5DBQA 2DJKA 3FEUA 3UJ1A 5DQSA 4IELA 1PKZA 4KDUA 1H4OA 5G30A 3ZFBA 2E0QA 3TJKA 2L4CA 3WGDA 1PRXA 4X0XA 4F03A 4AGSA 4ECBA 1F9MA 2BMXA 4D73A 4WBJA 1TTZA 1YDKA 4KGIA 2M80A 1V2AA 5ECQB 3HJOA 1ZMAA 3GL3A 2V41A 2FY6A 1M2AA 4OFMA 2I9HA 4PUAA 4NV2A 4KE3A 3G7JA 1O73A 1R7HA 3MAKA 2IWTA 1TK0B 2H01A 4F2IA 4IS0A 3C73A 3F6FA 4TXOA 1WWJA 2H0GA 5IPHA 1X5CA 4IQ1A 1PMTA 2K9FA 2N5BA 2XC2A 2C3TA 5JCWA 2NVLA 4K0GA 3FW2A 1SENA 2L6CA 4NWYA 2LV3A 4FH8A 4HEA2 4BL7A 2B5EA 5B6NA 5J9CA 2PERA 1HYUA 4DSRA 1H75A 4AJ6A 1ZZYA 3HZ8A 2H6ZA 3DWVA 2X8HA 3E9JB 4NHZA 5HR0A 2H8LA 3Q74A 4MLYA 2HZEA 1O81A 2KLXA 3CSJA 3FRCA 3M9JA 5A4UA 3APSA 3LWAA 4MJCA 4PNFA 1EGRA 3GV1A 5EY6A 2AJQB 1T4ZA 2CAQA 5G5FA 4MH3A 5D9VA 2VL2C 3SBCA 2PMTA 1AXDA 1SYXA 1ML6A 1OKTA 3P2AA 4KUNA 4I97A 5GSSA 3IE3A 2VCWA 1Q4JA 3TGZA 2AAWA 2H72A 3TJBA 5FT3A 2MYGA 1GTUA 2V6OA 2C0DA 3CTFA 2DC5A 4QQ7A 3FZ5A 4ID0A 2OE0A 2HSYA 3BCIA 2HLSA 3PH9A 3TKQA 3FYGA 4GSNA 1W89A 2KOKA 2KUCA 3HJMA 2KHPA 1MDKA 1B9XC 1YKCA 3ME7A 4K0NA 5HFKA 3W8SA 1JLVA 4TOPA 2H1DA 2XPDA 5E4WA 4ZBDA 1YZXA 4OCEA 5AISA 3HZ4A 3WGEA 1I5GA 1Q98A 1GP1A 2H71A 5CAXA 4HZ2A 5H5RA 3ZLPA 4Q5QA 3KH7A 2LJAA 1Z7PA 1SD9A 2CVKA 2WB9A 2PGTA 3G7YA 3M8NA 1WRYA 3M3MA 1E6BA 2G2QA 3GSTA 1EZKA 1LU4A 5COHA 2ON7A 3KGKA 3J7Yb 4ILFA 4J56E 5A4VA 4HS1A 2OACA 4GRFA 3GX8A 1QXHA 4PQHA 1MDIA 3UAPA 4EXJA 4K9ZA 4ZB9A 1PGTA 4MF7A 1ON4A 4LLRA 4J2FA 3IAM2 2AV4A 5FHIA 1ZGNA 3UVTA 3TB2A 1VF2A 5E59A 1T8EB 2I81A 4MF6A 5F8BA 1WP0A 3L78A 3RDWA 2DMMA 1SL2B 4PQ1A 1GUMA 1FVJA 2YPMA 4BVYA 19GSA 2CAIA 1XOAA 1JZRA 2L5OA 2VIMA 4BWQA 1YF0A 3F0IA 3TKSE 5KN3A 2O7KA 1TRUA 1VF3A 2A4VA 2H70A 1Y25A 3HCZA 1AW9A 3VPQA 4ZB8A 5LNKe 1K0MA 2H1BA 3TOUA 1JZWA 4HU9A 4RQXA 3KMNA 3GKKA 3I9V2 3NIVA 2VLTA 2ZCTA 2VAFA 1J9BA 2LJRA 1Z6NA 5J4UA 3TKPA 2OE3A 1Z7RA 3IK9A 5ECIB 3CYNA 4MJEA 2FHEA 1AQVA 3AY8A 2H75A 1R5PA 3ZFLA 3M1GA 4G19A 3O76A 1YEPA
chains in the Genus database with same CATH superfamily
1UN2A 2RM6A 1G7OA 4A5PA 1YF1A 1WPIA 4BPYA 1WJKA 3I6AA 2O89A 1ZYQB 3IAS2 3GH6A 2HE3A 3G7IA 1GNEA 4XCSA 2B1LA 1R26A 2I1UA 2IL3A 3GKNA 1X0RA 3IHQA 2F9SA 3P7XA 3IBHA 4MK3A 5KN0A 4ACSA 2P5RA 4J57E 4KX4A 4MMMA 3QMXA 5H5SA 1FB0A 2GZZA 2TRXA 1XPVA 2LS5A 2N5AA 3F4RA 2V2GA 2H1AA 4EUYA 2P31A 4F0BA 5G1KA 1F6MC 2AB6A 1GSQA 4Z2TA 5IO0A 4KSMA 4XTSA 3ZMKA 3GUSA 2C0EA 5CRDA 2GQLA 4IJ3A 3VK9A 5ID2B 3MDKA 4POMA 2GSRA 5CRHA 4GF0A 4WETA 2WZ9A 2PU9C 2C3NA 2FWGA 5DJLA 3LORA 4GSSA 2CVDA 1Z3EA 4YAVA 2GVPA 4XHMA 4YH2A 2QC7A 3GNJA 3RHCA 1XWBA 4MZCA 1J0FA 4JR4A 3PR8A 4ZIJA 1GUKA 2AUVA 3ZYWA 1A0RP 1DBYA 3ZIJA 1PKWA 4GWRA 1M3IA 2YZUA 2UZ8A 4ZL7A 1TDIA 2E7PA 3IC8A 1PSQA 1XVWA 3EU4A 2FA8A 1CQGA 4P3YB 3ED3A 3ERWA 2E2MA 3L4NA 1XG8A 4X1UA 1FB6A 2DBCA 5GSTA 1B4QA 1C72A 3TJJA 4OWYA 2LKUA 3OR5A 6GSVA 4LMWA 3KTLA 3HVXA 1XIYA 3H4KA 2RIIA 4V2NA 4E8HA 3BOAA 3L0HA 5B6MA 12GSA 1SL0B 4EC0A 1RW1A 4CW9A 2L57A 3CBUA 3CXGA 5G2ZA 2PN8A 1F3AA 4Q5RA 2YZHA 1OE8A 2HFDA 5IPGA 5ECRB 5IMCA 5GZZB 1FO5A 1UA5A 4GQFA 1U3AA 4G10A 3EC3A 1A23A 4ZL8A 4IKHA 2B1KA 2NTOA 3D22A 1JFUA 4NPBA 1FVKA 2M72A 2MZCA 2VL3A 1G7EA 5JCGA 2VO4A 3HKRA 1O6JA 4L8EA 3IK7A 3GIXA 3UBLA 4WR4A 1Z9HA 2DMLA 2YWOA 5GAPD 4LL1B 1TI1A 3DVWA 3VWVA 2IFQA 2X4AA 3H79A 2IN3A 5DCHA 5CO3A 1U6TA 3GL5A 1TK5B 3H1NA 3Q19A 5F06A 4G2EA 4ZBBA 2R0PA 4XS1A 1PL1A 1USBA 4TR1B 2CX3A 1K0OA 1EV4A 1K0DA 2EIRA 2L59A 2HYXA 4BA7A 1KEBA 1V57A 1EP7A 3RBTA 4TXOB 3VI5A 4I2TA 3GFKA 5B8AA 4HDEA 1ERVA 1ABAA 2R2JA 3I69A 2IIYA 3K8NA 3IOSA 1XWKA 5J41A 1XW6A 3D5JA 3LSZA 4EKZA 2P0GA 4O7HA 13GSA 2VLUA 1GSSA 1K3OA 5IIZA 4HSCX 2WULA 3QFAC 1XXUA 5ECLB 1SU9A 4JZQA 1SJ6A 3F8UA 4BL7B 2LRNA 4WR5A 2GGTA 3ZVJA 2FA4A 2XBIA 2YV7A 1PQNA 1T1VA 2Z9SA 1TP9A 4CY6A 4TXVA 4FYUA 4HU7A 1MD3A 3D4MA 3QDNA 4PURA 4K5SA 2HZEB 3TOTA 1JZOA 2LEGA 3MYDA 5DALB 1THOA 4HI7A 4FYCA 1A8YA 4K7IA 1HQOA 2MMOA 3IXRA 3F4SA 3WT1A 2VOCA 4TR4A 2GQKA 3TJFA 3C1RA 2OJLA 5IMVA 1OAZA 3KP9A 3O6TA 3IDVA 3P8WA 1QFNA 1TW9A 1BEDA 4KSOA 1TU8A 3M9KA 3EMXA 1GTBA 3UL3A 1SYRA 2H74A 2H6XA 5JWRB 2JL4A 3UEMA 3L9SA 1BJXA 3TKSC 1A2JA 4Q5NA 4AF2A 3UMAA 2HT9A 5ABRA 5AIVA 1HNCA 2G0FA 2VCTA 3FK8A 3ZMLA 1X5EA 4YAPA 1XWAA 2YP6A 2CZ2A 1LBKA 3UIWA 3QAVA 1GLPA 4L5OA 4K2XA 2R37A 1XCCA 2BTOT 2OBKA 3GH9A 3HVSA 2PUKC 1TJDA 5IMDA 1GNWA 2LQOA 5A4WA 2HRFA 3VURA 4HZ4A 2DIYA 3G9BA 4MJAA 4YQUA 1SKWB 4IW9A 1GSFA 2YJ7A 2GTUA 4KH7A 3R3EA 6GSYA 4OO4A 1GWCA 1YY7A 2IMIA 2VLVA 3EVIA 6GSUA 3VI7A 1WE0A 2O8VB 5ENUA 3L9VA 4NHWA 3TRQA 4EIPA 20GSA 2VCZA 3EU3A 4FYBA 4POKA 3WD6A 3LYKA 4MCUA 3D4TA 4USSA 4F9ZA 1NHYA 1F2EA 2FGXA 3KTBA 4PXOA 1KBNA 2MBTA 3E0UA 4TR0A 3ZRDA 2CVBA 2GT6A 17GSA 4MA9A 5D9TA 1N2AA 2L4QA 3HYPA 4BVXA 1AUCA 1XWGA 1WOUA 5AGYA 1PX6A 4OCFA 11GSA 2FWEA 3GSSA 3GTUA 3IPZA 1GULA 2A2SA 3C71A 5EPFA 3QPMA 1OC9A 4JR6A 1K3LA 1GSYA 2MMNA 4K5RA 1ACVA 1Y6EA 2CA8A 1Z5YE 1JLWA 1KNGA 2I4AA 3UBKA 1TOFA 2C4JA 3IRAA 4MF5A 5JCUA 1ZCPA 4QL7A 4BVYB 4HJMA 3DMLA 1O7UA 5DAKB 4K1FA 4WKWA 3GN3A 1XVQA 2C80A 3MNGA 4JU5A 3UARA 1V9WA 2YANA 5G1LA 4JEDA 4GTUA 2YCDA 1MDJA 4XIHA 1RK4A 2R0CA 1URMA 3A2VA 3NZNA 1AAZA 3W8JA 2VL2A 1GUHA 5C00A 4F82A 2TRCP 1JZDA 4ULXA 5LD0A 1M3JA 1WIKA 3I43A 4I2UA 1B8XA 3KZQA 1HNBA 1GTAA 1X9MB 1EEMA 4OFTA 2VCQA 5IO2A 4HUAA 4WBRD 5BMUA 3LQ7A 1BAYA 4XS4A 2WFCA 3LEFA 3FZ9A 2O85A 2I3YA 4MPGA 1DE2A 1J08A 5D9XA 2GS3A 3KMOA 1OC3A 4X4JA 5IMFA 3TUEA 4KCEA 1XZOA 3BD2A 3EWLA 1GRXA 2KP2A 5DDLA 2VM2A 4IN0A 1MD4A 1K0CA 1QUWA 1TXXA 2IMFA 2LNTA 3WGXA 3N9JA 2GT5A 1QMVA 4FIWA 3RPPA 1B48A 4ECCA 16GSA 3E3EA 3A2WA 2LQQA 2EIQA 2YOIA 3HA9A 3VWUA 2H0HA 3CMIA 1V40A 3KP8A 4EO3A 4OD7A 4O92A 2F8FA 3LXTA 5DCGA 2GSSA 2K18A 3N5OA 4FO5A 3RAZA 5G5EA 1ZYEA 3KCMA 2AHEA 2XBQA 4O32A 2QA1A 1I9DA 4PQIA 5L71A 1K0BA 5ELGA 3VWXA 2V6KA 3JCML 2ALBA 1M9AA 4KAEA 1TI3A 2JSZA 3F6DA 1PD21 5AN1A 5H5QA 6GSSA 2C8UA 3GX0A 1FG4A 2GSTA 1TK8B 4GCIA 2MBSA 1HNAA 5CREA 2LJKA 18GSA 4GSTA 3V1WA 1SKRB 2OA7A 1NSWA 3VPTA 3D21A 1S3RA 5ECNB 2MMAA 1X5DA 2L6DA 4I8BA 4YKFA 1XW5A 3GMFA 2JACA 2VCXA 1VRSD 3CSHA 1GSEA 2FWFA 2A4HA 2P5QA 1OYJA 1M99A 2RUEA 1O8XA 5CP1A 1SK0A 2B6MA 2H30A 3KXOA 4RUVA 2R4VA 1GSUA 2LRTA 4V1Ap 3DXBA 2LUSA 3L9UA 4K2DA 5KN2A 2IMEA 4H86A 3DVXA 1A0FA 5KEJA 2X8GA 4GQCA 2WGRA 4MZBA 2B7JA 4LMVA 3FHKA 4DVCA 3RPNA 4OFNA 1ERWA 4HOJA 4XRDA 3TRPA 2HZFA 4HQSA 2A2RA 1NM3A 5DJMA 2REMA 1KTEA 3ZREA 2D2ZA 2NDOA 1FOVA 2PBJA 2PVQA 1EWXA 3ZL5A 1O8WA 1U88A 2J23A 4TKYA 2VUPA 1SL1B 1TKDB 3HVNA 2FUG2 6GSTA 1ERUA 1OVNA 3A5IA 4EL1A 4KA0A 3FZAA 1MEKA 4JBBA 4LA1A 3DEXA 2MMZA 1THXA 2PVOC 2FWHA 1M7TA 3KIJA 4V2LA 2QSIA 4ICYA 5HR2A 1ERTA 1SKSB 4D73B 2VD1A 2AYTA 1W4VA 4MABA 5CRWA 4K7OA 3HY2A 2C0FA 5D9WA 4WXTA 2NPBA 2GZYA 2RLIA 1PN9A 1N8JA 5IMZA 2B3SA 1G6YA 8GSSA 1PA3A 2LTKA 5JWOB 2GLRA 4EIQA 1MTCA 4N0ZA 3S9FA 3MWHA 4DSSA 5HR3A 4IQAA 1FAAA 1R4WA 4YQVA 2PPTA 2FLSA 1XWCA 5CNWA 2IJYA 2XPEA 4IHUA 2LNSA 4I5QA 1X9SB 1XW9A 1GH2A 1K0AA 3LW9A 2ZNMA 4POBA 2OBIA 1ZOFA 2YNXA 5G31A 3QOUA 1LJRA 3PPUA 2H19A 4ECJA 2A2PA 4TR1A 5HQPA 1VGLA 3KEBA 2PWJA 3QCPA 5DVBA 2H1GA 1EOGA 4HQZA 2YWNA 4WF4A 1AC1A 1A8LA 2LSTA 4RI6A 4TRXA 2J9HA 3GRXA 3CQFA 5F0GA 1X9WB 2GZPA 4PX1A 3VWWA 2HNLA 1S3AA 2JZSA 3PGTA 4EDZA 2M46A 2GSQA 4N30A 4I6XA 1ST9A 1YQ1A 4O5RA 5C04A 1O85A 1DUGA 5ELAA 5JWQB 2X99A 5IMAA 2L5LA 1T00A 4MJBA 4ZL9A 3U5RE 1PN0A 4KNDA 2GDRA 2C1YA 3DIEA 4LL4B 2VCVA 1S3DA 1SJIA 2YV9A 3BCKA 2E2GA 4ZILA 2DIZA 5J3RA 6GSXA 3KJYA 5DALA 4L0UA 2WCIA 4YKGA 2NBSA 5HFIA 1ZL9A 1BX9A 4MZWA 7GSSA 1GL8A 3QD9A 5J5NA 3GHAA 1WMJA 1M0UA 4NXIA 3A2XA 1XOBA 1E2YA 1NHOA 1OKDA 2KP1A 1EOHA 4PNGA 2R6KA 3D6IA 3DGQA 5FWGA 6GSWA 3IA1A 1V98A 1A2LA 3FZ4A 3PINA 1AQXA 4DSQA 2HRKA 4NAXA 4XRAA 1QGVA 4PTSA 2V1MA 1PL2A 2WDUA 5B8BA 1T4YA 1EV9A 4OMVA 3EURA 4ML1A 1A24A 3NOFA 5A5KA 3W6GA 3UVHA 2JSYA 2DLXA 3DD3A 5ECHB 3US3A 5IM9A 1T7PB 2DJ1A 3O3TA 5D93A 5DQYA 3DYRA 2QA2A 2F3MA 3EYTA 2CT6A 2JU5A 2V32A 3DKSA 2B7KA 2O87A 3FR6A 5INYA 1IYHA 4X43A 4BVXB 1G6WA 5EL8A 2C0GA 2HSMA 3ERGA 3GTUB 1B9YC 5HFGA 2X8CA 4Q5FA 4NV5A 1OC9B 4V1Ag 4E8EA 2ZUPA 4IP6A 3EINA 2K8VA 1B4PA 1TRWA 4MPFA 1TRSA 2LRCA 1V58A 3RHBA 2R5GA 4KB3A 2B5XA 2BJXA 4OO5A 1JHBA 2WRTA 3CSIA 3IV4A 4K6XA 5F07A 5ECSA 4KF9A 1DE1A 4G0LA 5D8IA 2B5YA 2H73A 1F3BA 2XHFA 2DJJA 4IVFA 3TJGA 3EE2A 2FNOA 2OE1A 2CQ9A 2CV4A 9GSSA 2WS2A 3HHVA 3IHGA 2N5FA 4RI7A 2VM1A 2H66A 1YEXA 2RUFA 1SK2A 4N0VA 2H0IA 3QAWA 3F63A 1UVZA 3VFIA 4G0KA 1ILOA 4L5LA 4YQMA 1XBSA 1M2BA 5AIXA 3TCOA 1SD8A 2FCHA 1GLQA 3GKMA 1QQ2A 4O5QA 14GSA 4XS4B 4IBPA 4ZBAA 4CDOA 4N11A 3C8EA 1EEJA 3QFBC 1M9BA 1S3CA 5KN1A 3F9UA 1U3IA 2VL9A 3J7Yk 3ME8A 2H76A 3TKSA 4IP1A 1UC7A 2DKIA 4Z7XA 4KCAA 2JADA 3HDCA 5DAKA 4WF5A 2K8SA 1FHEA 3CRUA 1PFOA 1HD2A 2C3QA 3ISOA 1G0TA 3HVVA 3Q6OA 5CYYA 5IOWA 3KD0A 4N10A 3SWLA 1K0NA 4GXZA 5ECOB 4BWSA 2HXKA 3P90A 3H93A 2YJHA 1SK1A 2DJ2A 4NMUA 3BJ5A 5LCZA 3LXZA 1CQHA 1A2MA 3GKXA 5D96A 4PUFC 1TRVA 1QK8A 3DRNA 4XS6A 2IMKA 3H8QA 4O5UA 3TRXA 4F0CA 4K8MA 4KW6A 4RQRA 4TW5A 1AIUA 4G0IA 4WEYA 4KDXA 3CTGA 4EDYA 1XFLA 1YJ6A 5ECMB 3APQA 4EVMA 3ERFA 4ZXGA 3D0ZA 1TU7A 3M0FA 3WYWA 3FMWA 4MH2A 4G9HA 3FR9A 1PX7A 1NW2A 2IPAA 5IQYA 4DEJA 3APOA 2YWIA 3QAGA 3HJPA 4IGJA 5CRGA 10GSA 3LGCA 2R3XA 4JRRA 3C1SA 2ON5A 1EGOA 1SJZA 4TN8A 2DSAA 2OKAA 4QL9A 4CHSA 3EMPA 3GYKA 1K3YA 3F3RA 3A3TA 3BBYA 5GAND 3ZVJD 4K7NA 3F4TA 2EIOA 2YWMA 3TKRA 2IMDA 3U6VA 4V2MA 4TR3A 3MSZA 1T3BA 5ID2A 3ZZXA 2GQMA 2HRNA 3IR4A 5D73A 1BG5A 3VLNA 5KOWA 2H6YA 1U87A 1IYIA 3ZTLA 2DJ3A 1F37A 3R2QA 2FD3A 4PGTA 2ES7A 2X64A 2JZTA 3Q18A 4ML6A 5EVOA 1ZYNA 3KM6A 2CX4A 4POLA 1BYEA 4EE0A 22GSA 1GSDA 4TVEA 3LFLA 1R5AA 3UOMA 3WT2A 3LYPA 2EC4A 1YKAA 1EP8A 1DSBA 4ISDA 1Z6MA 3LJRA 2TIRA 2DJ0A 4HJ2A 2QKEA 1GTIA 4AJ8A 5B7CA 1RQMA 1VF1A 1OC8A 2WJUA 2JZRA 3GURA 3C7MA 2HSHA 5HR1A 2IFQB 3FR3A 3CRTA 4MDCA 3KH9A 3GA4A 4EF0A 1AQWA 1VF4A 3A5WA 5J9BA 2RM5A 2F51A 5IOXA 3LG6A 4AJ7A 3FKFA 3IC4A 1FW1A 2OADA 1M2DA 3FY7A 3F3QA 4MP4A 2CZ3A 4L0WA 3TDGA 3ZIVA 4IJIA 5ECKB 3HD5A 4Z2RA 4KDYA 4ZB6A 5F05A 1BQ7A 3ZITA 4DSSB 1OE7A 2K6VA 4GLTA 2HI7A 4JE1A 2VD0A 2YN1A 3QR6A 4ECIA 2F8AA 3HXSA 5ECPB 2QGVA 5DBQA 2DJKA 3FEUA 3UJ1A 5DQSA 4IELA 1PKZA 4KDUA 1H4OA 5G30A 3ZFBA 2E0QA 3TJKA 2HRAA 4Z2UA 2L4CA 3WGDA 1PRXA 4X0XA 4F03A 4AGSA 4ECBA 1F9MA 2BMXA 4D73A 4WBJA 1TTZA 1YDKA 4KGIA 2M80A 1V2AA 2R0GA 5ECQB 3HJOA 1ZMAA 3GL3A 2V41A 2FY6A 1M2AA 4OFMA 2I9HA 4PUAA 4NV2A 4KE3A 3G7JA 1O73A 1R7HA 3MAKA 3MIXA 2IWTA 1TK0B 2H01A 4F2IA 4IS0A 3C73A 3F6FA 4TXOA 1WWJA 2H0GA 5IPHA 1X5CA 4IQ1A 1PMTA 2K9FA 5KOXA 2N5BA 2XC2A 2C3TA 5JCWA 2NVLA 4K0GA 3FW2A 1SENA 5BRTA 2L6CA 4NWYA 2LV3A 4FH8A 4HEA2 4BL7A 2B5EA 5B6NA 5J9CA 4FQUA 2PERA 2DKHA 1HYUA 4DSRA 1H75A 4AJ6A 1ZZYA 3HZ8A 2H6ZA 3DWVA 2X8HA 3E9JB 4NHZA 5HR0A 2H8LA 3Q74A 4MLYA 2HZEA 1O81A 2KLXA 3CSJA 3FRCA 3M9JA 5A4UA 3APSA 3LWAA 4MJCA 4PNFA 4BIKA 1EGRA 3GV1A 5EY6A 2AJQB 1T4ZA 1FOHA 2CAQA 5G5FA 4MH3A 5D9VA 2VL2C 3SBCA 2PMTA 4CY8A 1AXDA 1SYXA 1ML6A 1OKTA 3P2AA 4KUNA 4I97A 5GSSA 2X49A 3IE3A 2VCWA 1ZYPA 1Q4JA 3TGZA 2AAWA 2H72A 3TJBA 5FT3A 2MYGA 1GTUA 2V6OA 2C0DA 3CTFA 2DC5A 4QQ7A 3FZ5A 4ID0A 2OE0A 2HSYA 3BCIA 2HLSA 3PH9A 3TKQA 3FYGA 4GSNA 1W89A 2KOKA 2KUCA 3HJMA 2KHPA 1MDKA 1B9XC 1YKCA 3ME7A 4K0NA 5HFKA 3W8SA 1JLVA 4TOPA 2H1DA 2XPDA 5E4WA 4ZBDA 1YZXA 4OCEA 5AISA 3HZ4A 3WGEA 1I5GA 1Q98A 1GP1A 2H71A 5CAXA 4HZ2A 5H5RA 3ZLPA 4Q5QA 3KH7A 2LJAA 1Z7PA 1SD9A 2CVKA 2WB9A 2PGTA 3G7YA 3M8NA 1WRYA 3M3MA 1E6BA 2G2QA 3GSTA 1EZKA 1LU4A 5COHA 2ON7A 3KGKA 3J7Yb 4ILFA 4J56E 5A4VA 4HS1A 2OACA 4GRFA 3GX8A 1QXHA 4PQHA 1MDIA 3UAPA 4EXJA 4K9ZA 4ZB9A 1PGTA 4MF7A 1ON4A 4LLRA 4J2FA 3IAM2 2AV4A 5FHIA 1ZGNA 3UVTA 3TB2A 1VF2A 5E59A 1T8EB 2I81A 4MF6A 5F8BA 3EPTA 1WP0A 3L78A 3RDWA 2DMMA 1SL2B 4PQ1A 1GUMA 1FVJA 2YPMA 4BVYA 19GSA 2CAIA 1XOAA 1JZRA 2L5OA 2VIMA 4BWQA 1YF0A 3F0IA 3TKSE 5KN3A 2O7KA 1TRUA 1VF3A 2A4VA 2H70A 1Y25A 3HCZA 1AW9A 3VPQA 4ZB8A 5LNKe 1K0MA 4MNNA 2H1BA 3TOUA 1JZWA 4HU9A 4RQXA 3KMNA 3GKKA 3I9V2 3NIVA 2VLTA 2ZCTA 2VAFA 1J9BA 2LJRA 1Z6NA 5J4UA 3TKPA 2OE3A 1Z7RA 3IK9A 5ECIB 3CYNA 4MJEA 2FHEA 1AQVA 3AY8A 2H75A 1R5PA 3ZFLA 3M1GA 4G19A 3O76A 1YEPA
chains in the Genus database with same CATH topology
1UN2A 2RM6A 1G7OA 4A5PA 1YF1A 1WPIA 4BPYA 1WJKA 3I6AA 2O89A 1ZYQB 3IAS2 3GH6A 2HE3A 3G7IA 1GNEA 4XCSA 2B1LA 1R26A 2I1UA 2IL3A 3GKNA 1X0RA 3IHQA 2F9SA 3P7XA 3IBHA 4MK3A 5KN0A 4ACSA 2P5RA 4J57E 4KX4A 4MMMA 3QMXA 5H5SA 1FB0A 2GZZA 2TRXA 1XPVA 2LS5A 2N5AA 3F4RA 2V2GA 2H1AA 4EUYA 2P31A 4F0BA 5G1KA 1F6MC 2AB6A 1GSQA 4Z2TA 5IO0A 4KSMA 4XTSA 3ZMKA 3GUSA 2C0EA 5CRDA 2GQLA 4IJ3A 3VK9A 5ID2B 3MDKA 4POMA 2GSRA 5CRHA 4GF0A 4WETA 2WZ9A 2PU9C 2C3NA 2FWGA 5DJLA 3LORA 4GSSA 2CVDA 1Z3EA 4YAVA 2GVPA 4XHMA 4YH2A 2QC7A 3GNJA 3RHCA 1XWBA 4MZCA 1J0FA 4JR4A 3PR8A 4ZIJA 1GUKA 2AUVA 3ZYWA 1A0RP 1DBYA 3ZIJA 1PKWA 4GWRA 2YZUA 2UZ8A 4ZL7A 1TDIA 2E7PA 3IC8A 1PSQA 1XVWA 3EU4A 2FA8A 1CQGA 4P3YB 3ED3A 3ERWA 2E2MA 3L4NA 4X1UA 1FB6A 2DBCA 5GSTA 1B4QA 1C72A 3TJJA 4OWYA 2LKUA 3OR5A 6GSVA 4LMWA 3KTLA 3HVXA 1XIYA 3H4KA 2RIIA 4V2NA 4E8HA 3BOAA 3L0HA 5B6MA 12GSA 1SL0B 4EC0A 1RW1A 4CW9A 2L57A 3CBUA 3CXGA 5G2ZA 2PN8A 1F3AA 4Q5RA 2YZHA 1OE8A 2HFDA 5IPGA 5ECRB 5IMCA 5GZZB 1FO5A 1UA5A 4GQFA 1U3AA 4G10A 3EC3A 1A23A 4ZL8A 4IKHA 2B1KA 2NTOA 3D22A 1JFUA 4NPBA 1FVKA 2M72A 2MZCA 2VL3A 1G7EA 5JCGA 2VO4A 3HKRA 1O6JA 4L8EA 3IK7A 3GIXA 3UBLA 4WR4A 1Z9HA 2DMLA 2YWOA 5GAPD 4LL1B 1TI1A 3DVWA 3VWVA 2IFQA 2X4AA 3H79A 2IN3A 5DCHA 5CO3A 1U6TA 3GL5A 1TK5B 3H1NA 3Q19A 5F06A 4G2EA 4ZBBA 2R0PA 4XS1A 1PL1A 1USBA 4TR1B 2CX3A 1K0OA 1EV4A 1K0DA 2EIRA 2L59A 2HYXA 4BA7A 1KEBA 1V57A 1EP7A 3RBTA 4TXOB 3VI5A 4I2TA 3GFKA 5B8AA 4HDEA 1ERVA 1ABAA 2R2JA 3I69A 2IIYA 3K8NA 3IOSA 1XWKA 5J41A 1XW6A 3D5JA 3LSZA 4EKZA 2P0GA 4O7HA 13GSA 2VLUA 1GSSA 1K3OA 5IIZA 2WULA 3QFAC 1XXUA 5ECLB 1SU9A 4JZQA 1SJ6A 3F8UA 4BL7B 2LRNA 4WR5A 2GGTA 3ZVJA 2FA4A 2XBIA 2YV7A 1PQNA 1T1VA 2Z9SA 1TP9A 4CY6A 4TXVA 4FYUA 4HU7A 1MD3A 3D4MA 3QDNA 4PURA 4K5SA 2HZEB 3TOTA 1JZOA 2LEGA 3MYDA 5DALB 1THOA 4HI7A 4FYCA 1A8YA 4K7IA 1HQOA 2MMOA 3IXRA 3F4SA 3WT1A 2VOCA 4TR4A 2GQKA 3TJFA 3C1RA 2OJLA 5IMVA 1OAZA 3KP9A 3O6TA 3IDVA 3P8WA 1QFNA 1TW9A 1BEDA 4KSOA 1TU8A 3M9KA 3EMXA 1GTBA 3UL3A 1SYRA 2H74A 2H6XA 5JWRB 2JL4A 3UEMA 3L9SA 1BJXA 3TKSC 1A2JA 4Q5NA 4AF2A 3UMAA 2HT9A 5ABRA 5AIVA 1HNCA 2G0FA 2VCTA 3FK8A 3ZMLA 1X5EA 4YAPA 1XWAA 2YP6A 2CZ2A 1LBKA 3UIWA 3QAVA 1GLPA 4L5OA 4K2XA 2R37A 1XCCA 2BTOT 2OBKA 3GH9A 3HVSA 2PUKC 1TJDA 5IMDA 1GNWA 2LQOA 5A4WA 2HRFA 3VURA 4HZ4A 2DIYA 3G9BA 4MJAA 4YQUA 1SKWB 4IW9A 1GSFA 2YJ7A 2GTUA 4KH7A 3R3EA 6GSYA 4OO4A 1GWCA 1YY7A 2IMIA 2VLVA 3EVIA 6GSUA 3VI7A 1WE0A 2O8VB 5ENUA 3L9VA 4NHWA 3TRQA 4EIPA 20GSA 2VCZA 3EU3A 4FYBA 4POKA 3WD6A 3LYKA 4MCUA 3D4TA 4USSA 4F9ZA 1NHYA 1F2EA 2FGXA 3KTBA 4PXOA 1KBNA 2MBTA 3E0UA 4TR0A 3ZRDA 2CVBA 2GT6A 17GSA 4MA9A 5D9TA 1N2AA 2L4QA 3HYPA 4BVXA 1AUCA 1XWGA 1WOUA 5AGYA 1PX6A 4OCFA 11GSA 2FWEA 3GSSA 3GTUA 3IPZA 1GULA 2A2SA 3C71A 5EPFA 3QPMA 1OC9A 4JR6A 1K3LA 1GSYA 2MMNA 4K5RA 1ACVA 1Y6EA 2CA8A 1Z5YE 1JLWA 1KNGA 2I4AA 3UBKA 1TOFA 2C4JA 3IRAA 4MF5A 5JCUA 1ZCPA 4QL7A 4BVYB 4HJMA 3DMLA 1O7UA 5DAKB 4K1FA 4WKWA 3GN3A 1XVQA 2C80A 3MNGA 4JU5A 3UARA 1V9WA 2YANA 5G1LA 4JEDA 4GTUA 2YCDA 1MDJA 4XIHA 1RK4A 2R0CA 1URMA 3A2VA 3NZNA 1AAZA 3W8JA 2VL2A 1GUHA 5C00A 4F82A 2TRCP 1JZDA 4ULXA 5LD0A 4I2UA 1WIKA 3I43A 1B8XA 3KZQA 1HNBA 1GTAA 1X9MB 1EEMA 4OFTA 2VCQA 5IO2A 4HUAA 4WBRD 5BMUA 3LQ7A 1BAYA 4XS4A 2WFCA 3LEFA 3FZ9A 2O85A 2I3YA 4MPGA 1DE2A 1J08A 5D9XA 2GS3A 3KMOA 1OC3A 4X4JA 5IMFA 3TUEA 4KCEA 1XZOA 3BD2A 3EWLA 1GRXA 2KP2A 5DDLA 2VM2A 4IN0A 1MD4A 1K0CA 1QUWA 1TXXA 2IMFA 2LNTA 3WGXA 3N9JA 2GT5A 1QMVA 4FIWA 3RPPA 1B48A 4ECCA 16GSA 3E3EA 3A2WA 2LQQA 2EIQA 2YOIA 3HA9A 3VWUA 2H0HA 3CMIA 1V40A 3KP8A 4EO3A 4OD7A 4O92A 2F8FA 3LXTA 5DCGA 2GSSA 2K18A 3N5OA 4FO5A 3RAZA 5G5EA 1ZYEA 3KCMA 2AHEA 2XBQA 4O32A 2QA1A 1I9DA 4PQIA 5L71A 1K0BA 5ELGA 3VWXA 2V6KA 3JCML 2ALBA 1M9AA 4KAEA 1TI3A 2JSZA 3F6DA 1PD21 5AN1A 5H5QA 6GSSA 2C8UA 3GX0A 1FG4A 2GSTA 1TK8B 4GCIA 2MBSA 1HNAA 5CREA 2LJKA 18GSA 4GSTA 3V1WA 1SKRB 2OA7A 1NSWA 3VPTA 3D21A 5ECNB 2MMAA 1X5DA 2L6DA 4I8BA 4YKFA 1XW5A 3GMFA 2JACA 2VCXA 1VRSD 3CSHA 1GSEA 2FWFA 2A4HA 2P5QA 1OYJA 1M99A 2RUEA 1O8XA 5CP1A 1SK0A 2B6MA 2H30A 3KXOA 4RUVA 2R4VA 1GSUA 2LRTA 4V1Ap 3DXBA 2LUSA 3L9UA 4K2DA 5KN2A 2IMEA 4H86A 3DVXA 1A0FA 5KEJA 2X8GA 4GQCA 2WGRA 4MZBA 2B7JA 4LMVA 3FHKA 4DVCA 3RPNA 4OFNA 1ERWA 4HOJA 4XRDA 3TRPA 2HZFA 4HQSA 2A2RA 1NM3A 5DJMA 2REMA 1KTEA 3ZREA 2D2ZA 2NDOA 1FOVA 2PBJA 2PVQA 1EWXA 3ZL5A 1O8WA 1U88A 2J23A 4TKYA 2VUPA 1SL1B 1TKDB 2FUG2 6GSTA 1ERUA 1OVNA 3A5IA 4EL1A 4KA0A 3FZAA 1MEKA 4JBBA 4LA1A 3DEXA 2MMZA 1THXA 2PVOC 2FWHA 1M7TA 3KIJA 4V2LA 2QSIA 4ICYA 5HR2A 1ERTA 1SKSB 4D73B 2VD1A 2AYTA 1W4VA 4MABA 5CRWA 4K7OA 3HY2A 2C0FA 5D9WA 4WXTA 2NPBA 2GZYA 2RLIA 1PN9A 1N8JA 5IMZA 2B3SA 1G6YA 8GSSA 1PA3A 2LTKA 5JWOB 2GLRA 4EIQA 1MTCA 4N0ZA 3S9FA 3MWHA 4DSSA 5HR3A 4IQAA 1FAAA 1R4WA 4YQVA 2PPTA 2FLSA 1XWCA 5CNWA 2IJYA 2XPEA 4IHUA 2LNSA 4I5QA 1X9SB 1XW9A 1GH2A 1K0AA 3LW9A 2ZNMA 4POBA 2OBIA 1ZOFA 2YNXA 5G31A 3QOUA 1LJRA 3PPUA 2H19A 4ECJA 2A2PA 4TR1A 5HQPA 1VGLA 3KEBA 2PWJA 3QCPA 5DVBA 2H1GA 1EOGA 4HQZA 2YWNA 4WF4A 1AC1A 1A8LA 2LSTA 4RI6A 4TRXA 2J9HA 3GRXA 5F0GA 1X9WB 2GZPA 4PX1A 3VWWA 2HNLA 1S3AA 2JZSA 3PGTA 4EDZA 2M46A 2GSQA 4N30A 4I6XA 1ST9A 1YQ1A 4O5RA 5C04A 1O85A 1DUGA 5ELAA 5JWQB 2X99A 5IMAA 2L5LA 1T00A 4MJBA 4ZL9A 3U5RE 1PN0A 4KNDA 2GDRA 2C1YA 3DIEA 4LL4B 2VCVA 1S3DA 1SJIA 2YV9A 3BCKA 2E2GA 4ZILA 2DIZA 5J3RA 6GSXA 3KJYA 5DALA 4L0UA 2WCIA 4YKGA 2NBSA 5HFIA 1ZL9A 1BX9A 4MZWA 7GSSA 1GL8A 3QD9A 5J5NA 3GHAA 1WMJA 1M0UA 4NXIA 3A2XA 1XOBA 1E2YA 1NHOA 1OKDA 2KP1A 1EOHA 4PNGA 2R6KA 3D6IA 3DGQA 5FWGA 6GSWA 3IA1A 1V98A 1A2LA 3FZ4A 3PINA 1AQXA 4DSQA 2HRKA 4NAXA 4XRAA 1QGVA 4PTSA 2V1MA 1PL2A 2WDUA 5B8BA 1T4YA 1EV9A 4OMVA 3EURA 4ML1A 1A24A 3NOFA 5A5KA 3W6GA 3UVHA 2JSYA 2DLXA 3DD3A 5ECHB 3US3A 5IM9A 1T7PB 2DJ1A 3O3TA 5D93A 5DQYA 3DYRA 2QA2A 2F3MA 3EYTA 2CT6A 2JU5A 2V32A 3DKSA 2B7KA 2O87A 3FR6A 5INYA 1IYHA 4X43A 4BVXB 1G6WA 5EL8A 2C0GA 2HSMA 3ERGA 3GTUB 1B9YC 5HFGA 2X8CA 4Q5FA 4NV5A 1OC9B 4V1Ag 4E8EA 2ZUPA 4IP6A 3EINA 2K8VA 1B4PA 1TRWA 4MPFA 1TRSA 2LRCA 1V58A 3RHBA 2R5GA 4KB3A 2B5XA 2BJXA 4OO5A 1JHBA 2WRTA 3CSIA 3IV4A 4K6XA 5F07A 5ECSA 4KF9A 1DE1A 4G0LA 5D8IA 2B5YA 2H73A 1F3BA 2XHFA 2DJJA 4IVFA 3TJGA 3EE2A 2FNOA 2OE1A 2CQ9A 2CV4A 9GSSA 2WS2A 3HHVA 3IHGA 2N5FA 4RI7A 2VM1A 2H66A 1YEXA 2RUFA 1SK2A 4N0VA 2H0IA 3QAWA 3F63A 1UVZA 3VFIA 4G0KA 1ILOA 4L5LA 4YQMA 1XBSA 1M2BA 5AIXA 3TCOA 1SD8A 2FCHA 1GLQA 3GKMA 1QQ2A 4O5QA 14GSA 4XS4B 4IBPA 4ZBAA 4CDOA 4N11A 3C8EA 1EEJA 3QFBC 1M9BA 1S3CA 5KN1A 3F9UA 1U3IA 2VL9A 3J7Yk 3ME8A 2H76A 3TKSA 4IP1A 1UC7A 2DKIA 4Z7XA 4KCAA 2JADA 3HDCA 5DAKA 4WF5A 2K8SA 1FHEA 3CRUA 1HD2A 2C3QA 3ISOA 1G0TA 3HVVA 3Q6OA 5CYYA 5IOWA 3KD0A 4N10A 3SWLA 1K0NA 4GXZA 5ECOB 4BWSA 2HXKA 3P90A 3H93A 2YJHA 1SK1A 2DJ2A 4NMUA 3BJ5A 5LCZA 3LXZA 1CQHA 1A2MA 3GKXA 5D96A 4PUFC 1TRVA 1QK8A 3DRNA 4XS6A 2IMKA 3H8QA 4O5UA 3TRXA 4F0CA 4K8MA 4KW6A 4RQRA 4TW5A 1AIUA 4G0IA 4WEYA 4KDXA 3CTGA 4EDYA 1XFLA 1YJ6A 5ECMB 3APQA 4EVMA 3ERFA 4ZXGA 3D0ZA 1TU7A 3M0FA 3WYWA 3FMWA 4MH2A 4G9HA 3FR9A 1PX7A 1NW2A 2IPAA 5IQYA 4DEJA 3APOA 2YWIA 3QAGA 3HJPA 4IGJA 5CRGA 10GSA 3LGCA 2R3XA 4JRRA 3C1SA 2ON5A 1EGOA 1SJZA 4TN8A 2DSAA 2OKAA 4QL9A 4CHSA 3EMPA 3GYKA 1K3YA 3F3RA 3A3TA 3BBYA 5GAND 3ZVJD 4K7NA 3F4TA 2EIOA 2YWMA 3TKRA 2IMDA 3U6VA 4V2MA 4TR3A 3MSZA 1T3BA 5ID2A 3ZZXA 2GQMA 2HRNA 3IR4A 5D73A 1BG5A 3VLNA 5KOWA 2H6YA 1U87A 1IYIA 3ZTLA 2DJ3A 1F37A 3R2QA 2FD3A 4PGTA 2ES7A 2X64A 2JZTA 3Q18A 4ML6A 5EVOA 1ZYNA 3KM6A 2CX4A 4POLA 1BYEA 4EE0A 22GSA 1GSDA 4TVEA 3LFLA 1R5AA 3UOMA 3WT2A 3LYPA 2EC4A 1YKAA 1EP8A 1DSBA 4ISDA 1Z6MA 3LJRA 2TIRA 2DJ0A 4HJ2A 2QKEA 1GTIA 4AJ8A 5B7CA 1RQMA 1VF1A 1OC8A 2WJUA 2JZRA 3GURA 3C7MA 2HSHA 5HR1A 2IFQB 3FR3A 3CRTA 4MDCA 3KH9A 3GA4A 4EF0A 1AQWA 1VF4A 3A5WA 5J9BA 2RM5A 2F51A 5IOXA 3LG6A 4AJ7A 3FKFA 3IC4A 1FW1A 2OADA 1M2DA 3FY7A 3F3QA 4MP4A 2CZ3A 4L0WA 3TDGA 3ZIVA 4IJIA 5ECKB 3HD5A 4Z2RA 4KDYA 4ZB6A 5F05A 1BQ7A 3ZITA 4DSSB 1OE7A 2K6VA 4GLTA 2HI7A 4JE1A 2VD0A 2YN1A 3QR6A 4ECIA 2F8AA 3HXSA 5ECPB 2QGVA 5DBQA 2DJKA 3FEUA 3UJ1A 5DQSA 4IELA 1PKZA 4KDUA 1H4OA 5G30A 3ZFBA 2E0QA 3TJKA 2HRAA 4Z2UA 2L4CA 3WGDA 1PRXA 4X0XA 4F03A 4AGSA 4ECBA 1F9MA 2BMXA 4D73A 4WBJA 1TTZA 1YDKA 4KGIA 2M80A 1V2AA 2R0GA 5ECQB 3HJOA 1ZMAA 3GL3A 2V41A 2FY6A 1M2AA 4OFMA 2I9HA 4PUAA 4NV2A 4KE3A 3G7JA 1O73A 1R7HA 3MAKA 3MIXA 2IWTA 1TK0B 2H01A 4F2IA 4IS0A 3C73A 3F6FA 4TXOA 1WWJA 2H0GA 5IPHA 1X5CA 4IQ1A 1PMTA 2K9FA 5KOXA 2N5BA 2XC2A 2C3TA 5JCWA 2NVLA 4K0GA 3FW2A 1SENA 5BRTA 2L6CA 4NWYA 2LV3A 4FH8A 4HEA2 4BL7A 2B5EA 5B6NA 5J9CA 4FQUA 2PERA 2DKHA 1HYUA 4DSRA 1H75A 4AJ6A 1ZZYA 3HZ8A 2H6ZA 3DWVA 2X8HA 3E9JB 4NHZA 5HR0A 2H8LA 3Q74A 4MLYA 2HZEA 1O81A 2KLXA 3CSJA 3FRCA 3M9JA 5A4UA 3APSA 3LWAA 4MJCA 4PNFA 1EGRA 3GV1A 5EY6A 2AJQB 1T4ZA 1FOHA 2CAQA 5G5FA 4MH3A 5D9VA 2VL2C 3SBCA 2PMTA 4CY8A 1AXDA 1SYXA 1ML6A 1OKTA 3P2AA 4KUNA 4I97A 5GSSA 2X49A 3IE3A 2VCWA 1ZYPA 1Q4JA 3TGZA 2AAWA 2H72A 3TJBA 5FT3A 2MYGA 1GTUA 2V6OA 2C0DA 3CTFA 2DC5A 4QQ7A 3FZ5A 4ID0A 2OE0A 2HSYA 3BCIA 2HLSA 3PH9A 3TKQA 3FYGA 4GSNA 1W89A 2KOKA 2KUCA 3HJMA 2KHPA 1MDKA 1B9XC 1YKCA 3ME7A 4K0NA 5HFKA 3W8SA 1JLVA 4TOPA 2H1DA 2XPDA 5E4WA 4ZBDA 1YZXA 4OCEA 5AISA 3HZ4A 3WGEA 1I5GA 1Q98A 1GP1A 2H71A 5CAXA 4HZ2A 5H5RA 3ZLPA 4Q5QA 3KH7A 2LJAA 1Z7PA 1SD9A 2CVKA 2WB9A 2PGTA 3G7YA 3M8NA 1WRYA 3M3MA 1E6BA 2G2QA 3GSTA 1EZKA 1LU4A 5COHA 2ON7A 3KGKA 3J7Yb 4ILFA 4J56E 5A4VA 4HS1A 2OACA 4GRFA 3GX8A 1QXHA 4PQHA 1MDIA 3UAPA 4EXJA 4K9ZA 4ZB9A 1PGTA 4MF7A 1ON4A 4LLRA 4J2FA 3IAM2 2AV4A 5FHIA 1ZGNA 3UVTA 3TB2A 1VF2A 5E59A 1T8EB 2I81A 4MF6A 5F8BA 3EPTA 1WP0A 3L78A 3RDWA 2DMMA 1SL2B 4PQ1A 1GUMA 1FVJA 2YPMA 4BVYA 19GSA 2CAIA 1XOAA 1JZRA 2L5OA 2VIMA 4BWQA 1YF0A 3F0IA 3TKSE 5KN3A 2O7KA 1TRUA 1VF3A 2A4VA 2H70A 1Y25A 3HCZA 1AW9A 3VPQA 4ZB8A 5LNKe 1K0MA 4MNNA 2H1BA 3TOUA 1JZWA 4HU9A 4RQXA 3KMNA 3GKKA 3I9V2 3NIVA 2VLTA 2ZCTA 2VAFA 1J9BA 2LJRA 1Z6NA 5J4UA 3TKPA 2OE3A 1Z7RA 3IK9A 5ECIB 3CYNA 4MJEA 2FHEA 1AQVA 3AY8A 2H75A 1R5PA 3ZFLA 3M1GA 4G19A 3O76A 1YEPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UN2 A;  2RM6 A;  1G7O A;  1YF1 A;  1WPI A;  4BPY A;  1WJK A;  3I6A A;  2O89 A;  1ZYQ B;  3IAS 2;  3GH6 A;  2HE3 A;  3G7I A;  1GNE A;  4XCS A;  2B1L A;  1R26 A;  2I1U A;  2IL3 A;  3GKN A;  1X0R A;  3IHQ A;  2F9S A;  3P7X A;  3IBH A;  4MK3 A;  5KN0 A;  4ACS A;  2P5R A;  4J57 E;  4KX4 A;  4MMM A;  3QMX A;  5H5S A;  1FB0 A;  2GZZ A;  2TRX A;  1XPV A;  2LS5 A;  2N5A A;  3F4R A;  2V2G A;  2H1A A;  4EUY A;  2P31 A;  4F0B A;  5G1K A;  1F6M C;  2AB6 A;  1GSQ A;  5IO0 A;  4KSM A;  4XTS A;  3ZMK A;  3GUS A;  2C0E A;  5CRD A;  2GQL A;  4IJ3 A;  3VK9 A;  5ID2 B;  3MDK A;  4POM A;  2GSR A;  5CRH A;  4GF0 A;  4WET A;  2WZ9 A;  2PU9 C;  2C3N A;  2FWG A;  5DJL A;  3LOR A;  4GSS A;  2CVD A;  1Z3E A;  4YAV A;  2GVP A;  4XHM A;  4YH2 A;  2QC7 A;  3GNJ A;  3RHC A;  1XWB A;  4MZC A;  1J0F A;  4JR4 A;  3PR8 A;  4ZIJ A;  1GUK A;  2AUV A;  3ZYW A;  1A0R P;  1DBY A;  3ZIJ A;  1PKW A;  4GWR A;  2YZU A;  4ZL7 A;  1TDI A;  2E7P A;  1PSQ A;  1XVW A;  3EU4 A;  2FA8 A;  1CQG A;  4P3Y B;  3ED3 A;  3ERW A;  2E2M A;  3L4N A;  4X1U A;  1FB6 A;  2DBC A;  5GST A;  1B4Q A;  1C72 A;  3TJJ A;  4OWY A;  2LKU A;  3OR5 A;  6GSV A;  4LMW A;  3KTL A;  3HVX A;  1XIY A;  3H4K A;  2RII A;  4V2N A;  4E8H A;  3BOA A;  3L0H A;  5B6M A;  12GS A;  1SL0 B;  4EC0 A;  1RW1 A;  4CW9 A;  2L57 A;  3CBU A;  3CXG A;  5G2Z A;  2PN8 A;  1F3A A;  4Q5R A;  2YZH A;  1OE8 A;  2HFD A;  5IPG A;  5ECR B;  5IMC A;  5GZZ B;  1FO5 A;  1UA5 A;  4GQF A;  1U3A A;  4G10 A;  3EC3 A;  1A23 A;  4ZL8 A;  4IKH A;  2B1K A;  2NTO A;  3D22 A;  1JFU A;  4NPB A;  1FVK A;  2M72 A;  2MZC A;  2VL3 A;  1G7E A;  5JCG A;  2VO4 A;  3HKR A;  1O6J A;  4L8E A;  3IK7 A;  3GIX A;  3UBL A;  4WR4 A;  1Z9H A;  2DML A;  2YWO A;  5GAP D;  4LL1 B;  1TI1 A;  3DVW A;  3VWV A;  2IFQ A;  3H79 A;  2IN3 A;  5DCH A;  5CO3 A;  1U6T A;  3GL5 A;  1TK5 B;  3H1N A;  3Q19 A;  5F06 A;  4G2E A;  4ZBB A;  4XS1 A;  1PL1 A;  1USB A;  4TR1 B;  2CX3 A;  1K0O A;  1EV4 A;  1K0D A;  2EIR A;  2L59 A;  2HYX A;  4BA7 A;  1KEB A;  1V57 A;  1EP7 A;  3RBT A;  4TXO B;  3VI5 A;  4I2T A;  3GFK A;  5B8A A;  4HDE A;  1ERV A;  1ABA A;  2R2J A;  3I69 A;  2IIY A;  3K8N A;  3IOS A;  1XWK A;  5J41 A;  1XW6 A;  3D5J A;  3LSZ A;  4EKZ A;  2P0G A;  4O7H A;  13GS A;  2VLU A;  1GSS A;  1K3O A;  5IIZ A;  2WUL A;  3QFA C;  1XXU A;  5ECL B;  1SU9 A;  4JZQ A;  1SJ6 A;  3F8U A;  2LRN A;  4WR5 A;  2GGT A;  3ZVJ A;  2FA4 A;  2XBI A;  2YV7 A;  1PQN A;  1T1V A;  2Z9S A;  1TP9 A;  4TXV A;  4FYU A;  4HU7 A;  1MD3 A;  3D4M A;  3QDN A;  4PUR A;  2HZE B;  3TOT A;  1JZO A;  2LEG A;  5DAL B;  1THO A;  4HI7 A;  4FYC A;  1A8Y A;  4K7I A;  1HQO A;  2MMO A;  3IXR A;  3F4S A;  3WT1 A;  2VOC A;  4TR4 A;  2GQK A;  3TJF A;  3C1R A;  2OJL A;  5IMV A;  1OAZ A;  3KP9 A;  3O6T A;  3IDV A;  3P8W A;  1QFN A;  1TW9 A;  1BED A;  4KSO A;  1TU8 A;  3M9K A;  3EMX A;  1GTB A;  3UL3 A;  1SYR A;  2H74 A;  2H6X A;  5JWR B;  2JL4 A;  3UEM A;  3L9S A;  1BJX A;  3TKS C;  1A2J A;  4Q5N A;  4AF2 A;  3UMA A;  2HT9 A;  5ABR A;  5AIV A;  1HNC A;  2G0F A;  2VCT A;  3FK8 A;  3ZML A;  1X5E A;  4YAP A;  1XWA A;  2YP6 A;  2CZ2 A;  1LBK A;  3UIW A;  3QAV A;  1GLP A;  4L5O A;  2R37 A;  1XCC A;  2BTO T;  2OBK A;  3GH9 A;  3HVS A;  2PUK C;  1TJD A;  5IMD A;  1GNW A;  2LQO A;  5A4W A;  2HRF A;  3VUR A;  4HZ4 A;  2DIY A;  3G9B A;  4MJA A;  4YQU A;  1SKW B;  4IW9 A;  1GSF A;  2YJ7 A;  2GTU A;  4KH7 A;  6GSY A;  4OO4 A;  1GWC A;  1YY7 A;  2IMI A;  2VLV A;  3EVI A;  6GSU A;  3VI7 A;  1WE0 A;  2O8V B;  5ENU A;  3L9V A;  4NHW A;  3TRQ A;  20GS A;  2VCZ A;  3EU3 A;  4FYB A;  4POK A;  3WD6 A;  3LYK A;  4MCU A;  3D4T A;  4F9Z A;  1NHY A;  1F2E A;  2FGX A;  3KTB A;  4PXO A;  1KBN A;  2MBT A;  3E0U A;  4TR0 A;  3ZRD A;  2CVB A;  2GT6 A;  17GS A;  4MA9 A;  5D9T A;  1N2A A;  2L4Q A;  3HYP A;  4BVX A;  1AUC A;  1XWG A;  1WOU A;  5AGY A;  1PX6 A;  4OCF A;  11GS A;  2FWE A;  3GSS A;  3GTU A;  3IPZ A;  1GUL A;  2A2S A;  3C71 A;  5EPF A;  3QPM A;  1OC9 A;  4JR6 A;  1K3L A;  1GSY A;  2MMN A;  1ACV A;  1Y6E A;  2CA8 A;  1Z5Y E;  1JLW A;  1KNG A;  2I4A A;  3UBK A;  1TOF A;  2C4J A;  3IRA A;  4MF5 A;  5JCU A;  1ZCP A;  4QL7 A;  4HJM A;  3DML A;  1O7U A;  5DAK B;  4K1F A;  4WKW A;  3GN3 A;  1XVQ A;  2C80 A;  3MNG A;  4JU5 A;  3UAR A;  1V9W A;  2YAN A;  5G1L A;  4JED A;  4GTU A;  2YCD A;  1MDJ A;  4XIH A;  1RK4 A;  1URM A;  3A2V A;  3NZN A;  1AAZ A;  3W8J A;  2VL2 A;  1GUH A;  5C00 A;  4F82 A;  2TRC P;  1JZD A;  4ULX A;  5LD0 A;  4I2U A;  1WIK A;  3I43 A;  1B8X A;  3KZQ A;  1HNB A;  1GTA A;  1X9M B;  1EEM A;  4OFT A;  2VCQ A;  5IO2 A;  4HUA A;  4WBR D;  3LQ7 A;  1BAY A;  4XS4 A;  2WFC A;  3LEF A;  3FZ9 A;  2O85 A;  2I3Y A;  4MPG A;  1DE2 A;  1J08 A;  5D9X A;  2GS3 A;  3KMO A;  1OC3 A;  3TUE A;  5IMF A;  4KCE A;  1XZO A;  3BD2 A;  3EWL A;  1GRX A;  2KP2 A;  5DDL A;  2VM2 A;  4IN0 A;  1MD4 A;  1K0C A;  1QUW A;  1TXX A;  2IMF A;  2LNT A;  3WGX A;  3N9J A;  2GT5 A;  1QMV A;  4FIW A;  3RPP A;  1B48 A;  4ECC A;  16GS A;  3E3E A;  3A2W A;  2LQQ A;  2EIQ A;  2YOI A;  3HA9 A;  3VWU A;  2H0H A;  3CMI A;  1V40 A;  3KP8 A;  4EO3 A;  4OD7 A;  4O92 A;  2F8F A;  3LXT A;  5DCG A;  2GSS A;  2K18 A;  3N5O A;  4FO5 A;  3RAZ A;  5G5E A;  1ZYE A;  3KCM A;  2AHE A;  2XBQ A;  4O32 A;  1I9D A;  4PQI A;  5L71 A;  1K0B A;  5ELG A;  3VWX A;  2V6K A;  3JCM L;  2ALB A;  1M9A A;  4KAE A;  1TI3 A;  2JSZ A;  3F6D A;  1PD2 1;  5AN1 A;  5H5Q A;  6GSS A;  2C8U A;  3GX0 A;  1FG4 A;  2GST A;  1TK8 B;  4GCI A;  2MBS A;  1HNA A;  5CRE A;  2LJK A;  18GS A;  4GST A;  3V1W A;  1SKR B;  2OA7 A;  1NSW A;  3VPT A;  3D21 A;  5ECN B;  2MMA A;  1X5D A;  2L6D A;  4I8B A;  1XW5 A;  3GMF A;  2JAC A;  2VCX A;  1VRS D;  3CSH A;  1GSE A;  2FWF A;  2P5Q A;  1OYJ A;  1M99 A;  2RUE A;  1O8X A;  5CP1 A;  1SK0 A;  2B6M A;  2H30 A;  3KXO A;  4RUV A;  2R4V A;  1GSU A;  2LRT A;  4V1A p;  3DXB A;  2LUS A;  3L9U A;  4K2D A;  5KN2 A;  2IME A;  4H86 A;  3DVX A;  1A0F A;  5KEJ A;  2X8G A;  4GQC A;  2WGR A;  4MZB A;  2B7J A;  4LMV A;  3FHK A;  4DVC A;  3RPN A;  4OFN A;  1ERW A;  4HOJ A;  4XRD A;  3TRP A;  2HZF A;  4HQS A;  2A2R A;  1NM3 A;  5DJM A;  2REM A;  1KTE A;  3ZRE A;  2D2Z A;  2NDO A;  1FOV A;  2PBJ A;  2PVQ A;  1EWX A;  3ZL5 A;  1O8W A;  1U88 A;  2J23 A;  4TKY A;  2VUP A;  1SL1 B;  1TKD B;  2FUG 2;  6GST A;  1ERU A;  1OVN A;  4EL1 A;  4KA0 A;  3FZA A;  1MEK A;  4JBB A;  4LA1 A;  3DEX A;  2MMZ A;  1THX A;  2PVO C;  2FWH A;  1M7T A;  3KIJ A;  4V2L A;  2QSI A;  5HR2 A;  1ERT A;  1SKS B;  4D73 B;  2VD1 A;  2AYT A;  1W4V A;  4MAB A;  5CRW A;  4K7O A;  3HY2 A;  2C0F A;  5D9W A;  4WXT A;  2NPB A;  2GZY A;  2RLI A;  1PN9 A;  1N8J A;  5IMZ A;  2B3S A;  1G6Y A;  8GSS A;  1PA3 A;  2LTK A;  5JWO B;  2GLR A;  1MTC A;  4N0Z A;  3S9F A;  3MWH A;  4DSS A;  5HR3 A;  4IQA A;  1FAA A;  1R4W A;  4YQV A;  2PPT A;  2FLS A;  1XWC A;  5CNW A;  2IJY A;  2XPE A;  4IHU A;  2LNS A;  4I5Q A;  1X9S B;  1XW9 A;  1GH2 A;  1K0A A;  4POB A;  2ZNM A;  2OBI A;  1ZOF A;  2YNX A;  5G31 A;  3QOU A;  1LJR A;  2H19 A;  4ECJ A;  4TR1 A;  5HQP A;  1VGL A;  3KEB A;  2PWJ A;  3QCP A;  5DVB A;  2H1G A;  1EOG A;  4HQZ A;  2YWN A;  4WF4 A;  1AC1 A;  1A8L A;  2LST A;  4RI6 A;  4TRX A;  2J9H A;  3GRX A;  5F0G A;  1X9W B;  2GZP A;  4PX1 A;  3VWW A;  2HNL A;  1S3A A;  2JZS A;  3PGT A;  4EDZ A;  2M46 A;  2GSQ A;  4N30 A;  4I6X A;  1ST9 A;  1YQ1 A;  4O5R A;  5C04 A;  1O85 A;  1DUG A;  5ELA A;  5JWQ B;  2X99 A;  5IMA A;  2L5L A;  1T00 A;  4MJB A;  4ZL9 A;  3U5R E;  4KND A;  2GDR A;  2C1Y A;  3DIE A;  4LL4 B;  2VCV A;  1S3D A;  1SJI A;  2YV9 A;  3BCK A;  2E2G A;  4ZIL A;  2DIZ A;  5J3R A;  6GSX A;  3KJY A;  5DAL A;  4L0U A;  2WCI A;  2NBS A;  5HFI A;  1ZL9 A;  1BX9 A;  4MZW A;  7GSS A;  1GL8 A;  3QD9 A;  5J5N A;  3GHA A;  1WMJ A;  1M0U A;  4NXI A;  3A2X A;  1XOB A;  1E2Y A;  1NHO A;  1OKD A;  2KP1 A;  1EOH A;  4PNG A;  2R6K A;  3D6I A;  3DGQ A;  5FWG A;  6GSW A;  3IA1 A;  1V98 A;  1A2L A;  3FZ4 A;  3PIN A;  1AQX A;  4DSQ A;  4NAX A;  4XRA A;  1QGV A;  2V1M A;  1PL2 A;  2WDU A;  5B8B A;  1T4Y A;  1EV9 A;  4OMV A;  3EUR A;  4ML1 A;  1A24 A;  3NOF A;  5A5K A;  3W6G A;  3UVH A;  2JSY A;  2DLX A;  3DD3 A;  5ECH B;  3US3 A;  5IM9 A;  1T7P B;  2DJ1 A;  3O3T A;  5D93 A;  5DQY A;  3DYR A;  2F3M A;  3EYT A;  2CT6 A;  2JU5 A;  2V32 A;  3DKS A;  2B7K A;  2O87 A;  3FR6 A;  5INY A;  1IYH A;  4X43 A;  1G6W A;  5EL8 A;  2C0G A;  3ERG A;  3GTU B;  1B9Y C;  5HFG A;  2X8C A;  4Q5F A;  4NV5 A;  1OC9 B;  4V1A g;  4E8E A;  2ZUP A;  4IP6 A;  3EIN A;  2K8V A;  1B4P A;  1TRW A;  4MPF A;  1TRS A;  2LRC A;  1V58 A;  3RHB A;  2R5G A;  4KB3 A;  2B5X A;  2BJX A;  4OO5 A;  1JHB A;  2WRT A;  3CSI A;  3IV4 A;  4K6X A;  5F07 A;  5ECS A;  1DE1 A;  5D8I A;  2B5Y A;  2H73 A;  1F3B A;  2XHF A;  2DJJ A;  4IVF A;  3TJG A;  3EE2 A;  2FNO A;  2OE1 A;  2CQ9 A;  2CV4 A;  9GSS A;  2WS2 A;  3HHV A;  2N5F A;  4RI7 A;  2VM1 A;  2H66 A;  1YEX A;  2RUF A;  1SK2 A;  4N0V A;  2H0I A;  3QAW A;  3F63 A;  1UVZ A;  3VFI A;  1ILO A;  4L5L A;  4YQM A;  1XBS A;  1M2B A;  5AIX A;  3TCO A;  1SD8 A;  2FCH A;  1GLQ A;  3GKM A;  1QQ2 A;  14GS A;  4XS4 B;  4IBP A;  4ZBA A;  4CDO A;  4N11 A;  3C8E A;  1EEJ A;  3QFB C;  1M9B A;  1S3C A;  5KN1 A;  3F9U A;  1U3I A;  2VL9 A;  3J7Y k;  3ME8 A;  2H76 A;  3TKS A;  4IP1 A;  1UC7 A;  4Z7X A;  4KCA A;  2JAD A;  3HDC A;  5DAK A;  4WF5 A;  2K8S A;  1FHE A;  3CRU A;  1HD2 A;  2C3Q A;  3ISO A;  1G0T A;  3HVV A;  3Q6O A;  5CYY A;  5IOW A;  3KD0 A;  4N10 A;  3SWL A;  1K0N A;  4GXZ A;  5ECO B;  4BWS A;  2HXK A;  3P90 A;  3H93 A;  2YJH A;  1SK1 A;  2DJ2 A;  4NMU A;  3BJ5 A;  5LCZ A;  3LXZ A;  1CQH A;  1A2M A;  3GKX A;  5D96 A;  4PUF C;  1TRV A;  1QK8 A;  3DRN A;  4XS6 A;  2IMK A;  3H8Q A;  3TRX A;  4F0C A;  4K8M A;  4KW6 A;  4RQR A;  4TW5 A;  1AIU A;  4WEY A;  4KDX A;  3CTG A;  4EDY A;  1XFL A;  1YJ6 A;  5ECM B;  3APQ A;  4EVM A;  3ERF A;  4ZXG A;  3D0Z A;  1TU7 A;  3M0F A;  3WYW A;  4MH2 A;  4G9H A;  3FR9 A;  1PX7 A;  1NW2 A;  2IPA A;  5IQY A;  4DEJ A;  3APO A;  2YWI A;  3QAG A;  3HJP A;  4IGJ A;  5CRG A;  10GS A;  3LGC A;  2R3X A;  4JRR A;  3C1S A;  2ON5 A;  1EGO A;  1SJZ A;  4TN8 A;  2DSA A;  2OKA A;  4QL9 A;  4CHS A;  3EMP A;  3GYK A;  1K3Y A;  3F3R A;  3A3T A;  3BBY A;  5GAN D;  3ZVJ D;  4K7N A;  3F4T A;  2EIO A;  2YWM A;  3TKR A;  2IMD A;  3U6V A;  4V2M A;  4TR3 A;  3MSZ A;  1T3B A;  5ID2 A;  3ZZX A;  2GQM A;  2HRN A;  3IR4 A;  5D73 A;  1BG5 A;  3VLN A;  2H6Y A;  1U87 A;  1IYI A;  3ZTL A;  2DJ3 A;  1F37 A;  3R2Q A;  2FD3 A;  4PGT A;  2ES7 A;  2X64 A;  2JZT A;  3Q18 A;  4ML6 A;  5EVO A;  3KM6 A;  2CX4 A;  4POL A;  1BYE A;  4EE0 A;  22GS A;  1GSD A;  4TVE A;  3LFL A;  1R5A A;  3UOM A;  3WT2 A;  3LYP A;  2EC4 A;  1YKA A;  1EP8 A;  1DSB A;  4ISD A;  1Z6M A;  3LJR A;  2TIR A;  2DJ0 A;  4HJ2 A;  2QKE A;  1GTI A;  4AJ8 A;  5B7C A;  1RQM A;  1VF1 A;  1OC8 A;  2WJU A;  2JZR A;  3GUR A;  3C7M A;  2HSH A;  5HR1 A;  2IFQ B;  3FR3 A;  3CRT A;  4MDC A;  3KH9 A;  3GA4 A;  4EF0 A;  1AQW A;  1VF4 A;  3A5W A;  5J9B A;  2RM5 A;  2F51 A;  5IOX A;  3LG6 A;  4AJ7 A;  3FKF A;  3IC4 A;  1FW1 A;  2OAD A;  1M2D A;  3FY7 A;  3F3Q A;  4MP4 A;  2CZ3 A;  4L0W A;  3TDG A;  3ZIV A;  4IJI A;  5ECK B;  3HD5 A;  4KDY A;  4ZB6 A;  5F05 A;  1BQ7 A;  3ZIT A;  4DSS B;  1OE7 A;  2K6V A;  4GLT A;  2HI7 A;  4JE1 A;  2VD0 A;  2YN1 A;  3QR6 A;  4ECI A;  2F8A A;  3HXS A;  5ECP B;  2QGV A;  5DBQ A;  2DJK A;  3FEU A;  3UJ1 A;  5DQS A;  4IEL A;  1PKZ A;  4KDU A;  1H4O A;  5G30 A;  3ZFB A;  2E0Q A;  3TJK A;  2L4C A;  3WGD A;  1PRX A;  4X0X A;  4F03 A;  4AGS A;  4ECB A;  1F9M A;  2BMX A;  4D73 A;  4WBJ A;  1TTZ A;  1YDK A;  4KGI A;  2M80 A;  1V2A A;  5ECQ B;  3HJO A;  1ZMA A;  3GL3 A;  2V41 A;  2FY6 A;  1M2A A;  4OFM A;  2I9H A;  4PUA A;  4NV2 A;  4KE3 A;  3G7J A;  1O73 A;  1R7H A;  3MAK A;  2IWT A;  1TK0 B;  2H01 A;  4F2I A;  4IS0 A;  3C73 A;  3F6F A;  4TXO A;  1WWJ A;  2H0G A;  5IPH A;  1X5C A;  4IQ1 A;  1PMT A;  2K9F A;  2N5B A;  2XC2 A;  2C3T A;  5JCW A;  2NVL A;  4K0G A;  3FW2 A;  1SEN A;  2L6C A;  4NWY A;  2LV3 A;  4FH8 A;  4HEA 2;  4BL7 A;  2B5E A;  5B6N A;  5J9C A;  2PER A;  1HYU A;  4DSR A;  1H75 A;  4AJ6 A;  1ZZY A;  3HZ8 A;  2H6Z A;  3DWV A;  2X8H A;  3E9J B;  4NHZ A;  5HR0 A;  2H8L A;  3Q74 A;  4MLY A;  2HZE A;  1O81 A;  2KLX A;  3CSJ A;  3FRC A;  3M9J A;  5A4U A;  3APS A;  3LWA A;  4MJC A;  4PNF A;  1EGR A;  3GV1 A;  5EY6 A;  2AJQ B;  1T4Z A;  2CAQ A;  5G5F A;  4MH3 A;  5D9V A;  2VL2 C;  3SBC A;  2PMT A;  1AXD A;  1SYX A;  1ML6 A;  1OKT A;  3P2A A;  4KUN A;  4I97 A;  5GSS A;  3IE3 A;  2VCW A;  1Q4J A;  3TGZ A;  2AAW A;  2H72 A;  3TJB A;  5FT3 A;  2MYG A;  1GTU A;  2V6O A;  2C0D A;  3CTF A;  2DC5 A;  4QQ7 A;  3FZ5 A;  4ID0 A;  2OE0 A;  2HSY A;  3BCI A;  2HLS A;  3PH9 A;  3TKQ A;  3FYG A;  4GSN A;  1W89 A;  2KOK A;  2KUC A;  3HJM A;  2KHP A;  1MDK A;  1B9X C;  1YKC A;  3ME7 A;  4K0N A;  5HFK A;  3W8S A;  1JLV A;  4TOP A;  2H1D A;  2XPD A;  5E4W A;  4ZBD A;  1YZX A;  4OCE A;  5AIS A;  3HZ4 A;  3WGE A;  1I5G A;  1Q98 A;  1GP1 A;  2H71 A;  5CAX A;  4HZ2 A;  5H5R A;  3ZLP A;  4Q5Q A;  3KH7 A;  2LJA A;  1Z7P A;  1SD9 A;  2CVK A;  2WB9 A;  2PGT A;  3G7Y A;  3M8N A;  1WRY A;  3M3M A;  1E6B A;  2G2Q A;  3GST A;  1EZK A;  1LU4 A;  5COH A;  2ON7 A;  3KGK A;  3J7Y b;  4ILF A;  4J56 E;  5A4V A;  4HS1 A;  2OAC A;  4GRF A;  3GX8 A;  1QXH A;  4PQH A;  1MDI A;  3UAP A;  4EXJ A;  4K9Z A;  4ZB9 A;  1PGT A;  4MF7 A;  1ON4 A;  4LLR A;  4J2F A;  3IAM 2;  2AV4 A;  5FHI A;  1ZGN A;  3UVT A;  3TB2 A;  1VF2 A;  5E59 A;  1T8E B;  2I81 A;  4MF6 A;  5F8B A;  1WP0 A;  3L78 A;  3RDW A;  2DMM A;  1SL2 B;  4PQ1 A;  1GUM A;  1FVJ A;  2YPM A;  4BVY A;  19GS A;  2CAI A;  1XOA A;  1JZR A;  2L5O A;  2VIM A;  4BWQ A;  1YF0 A;  3F0I A;  3TKS E;  5KN3 A;  2O7K A;  1TRU A;  1VF3 A;  2A4V A;  2H70 A;  1Y25 A;  3HCZ A;  1AW9 A;  3VPQ A;  4ZB8 A;  5LNK e;  1K0M A;  2H1B A;  3TOU A;  1JZW A;  4HU9 A;  4RQX A;  3KMN A;  3GKK A;  3I9V 2;  3NIV A;  2VLT A;  2ZCT A;  2VAF A;  1J9B A;  2LJR A;  1Z6N A;  5J4U A;  3TKP A;  2OE3 A;  1Z7R A;  3IK9 A;  5ECI B;  3CYN A;  4MJE A;  2FHE A;  1AQV A;  3AY8 A;  2H75 A;  1R5P A;  3ZFL A;  3M1G A;  4G19 A;  3O76 A;  1YEP A; 
#chains in the Genus database with same CATH topology
 1UN2 A;  2RM6 A;  1G7O A;  4A5P A;  1YF1 A;  1WPI A;  4BPY A;  1WJK A;  3I6A A;  2O89 A;  1ZYQ B;  3IAS 2;  3GH6 A;  2HE3 A;  3G7I A;  1GNE A;  4XCS A;  2B1L A;  1R26 A;  2I1U A;  2IL3 A;  3GKN A;  1X0R A;  3IHQ A;  2F9S A;  3P7X A;  3IBH A;  4MK3 A;  5KN0 A;  4ACS A;  2P5R A;  4J57 E;  4KX4 A;  4MMM A;  3QMX A;  5H5S A;  1FB0 A;  2GZZ A;  2TRX A;  1XPV A;  2LS5 A;  2N5A A;  3F4R A;  2V2G A;  2H1A A;  4EUY A;  2P31 A;  4F0B A;  5G1K A;  1F6M C;  2AB6 A;  1GSQ A;  4Z2T A;  5IO0 A;  4KSM A;  4XTS A;  3ZMK A;  3GUS A;  2C0E A;  5CRD A;  2GQL A;  4IJ3 A;  3VK9 A;  5ID2 B;  3MDK A;  4POM A;  2GSR A;  5CRH A;  4GF0 A;  4WET A;  2WZ9 A;  2PU9 C;  2C3N A;  2FWG A;  5DJL A;  3LOR A;  4GSS A;  2CVD A;  1Z3E A;  4YAV A;  2GVP A;  4XHM A;  4YH2 A;  2QC7 A;  3GNJ A;  3RHC A;  1XWB A;  4MZC A;  1J0F A;  4JR4 A;  3PR8 A;  4ZIJ A;  1GUK A;  2AUV A;  3ZYW A;  1A0R P;  1DBY A;  3ZIJ A;  1PKW A;  4GWR A;  1M3I A;  2YZU A;  2UZ8 A;  4ZL7 A;  1TDI A;  2E7P A;  3IC8 A;  1PSQ A;  1XVW A;  3EU4 A;  2FA8 A;  1CQG A;  4P3Y B;  3ED3 A;  3ERW A;  2E2M A;  3L4N A;  1XG8 A;  4X1U A;  1FB6 A;  2DBC A;  5GST A;  1B4Q A;  1C72 A;  3TJJ A;  4OWY A;  2LKU A;  3OR5 A;  6GSV A;  4LMW A;  3KTL A;  3HVX A;  1XIY A;  3H4K A;  2RII A;  4V2N A;  4E8H A;  3BOA A;  3L0H A;  5B6M A;  12GS A;  1SL0 B;  4EC0 A;  1RW1 A;  4CW9 A;  2L57 A;  3CBU A;  3CXG A;  5G2Z A;  2PN8 A;  1F3A A;  4Q5R A;  2YZH A;  1OE8 A;  2HFD A;  5IPG A;  5ECR B;  5IMC A;  5GZZ B;  1FO5 A;  1UA5 A;  4GQF A;  1U3A A;  4G10 A;  3EC3 A;  1A23 A;  4ZL8 A;  4IKH A;  2B1K A;  2NTO A;  3D22 A;  1JFU A;  4NPB A;  1FVK A;  2M72 A;  2MZC A;  2VL3 A;  1G7E A;  5JCG A;  2VO4 A;  3HKR A;  1O6J A;  4L8E A;  3IK7 A;  3GIX A;  3UBL A;  4WR4 A;  1Z9H A;  2DML A;  2YWO A;  5GAP D;  4LL1 B;  1TI1 A;  3DVW A;  3VWV A;  2IFQ A;  2X4A A;  3H79 A;  2IN3 A;  5DCH A;  5CO3 A;  1U6T A;  3GL5 A;  1TK5 B;  3H1N A;  3Q19 A;  5F06 A;  4G2E A;  4ZBB A;  2R0P A;  4XS1 A;  1PL1 A;  1USB A;  4TR1 B;  2CX3 A;  1K0O A;  1EV4 A;  1K0D A;  2EIR A;  2L59 A;  2HYX A;  4BA7 A;  1KEB A;  1V57 A;  1EP7 A;  3RBT A;  4TXO B;  3VI5 A;  4I2T A;  3GFK A;  5B8A A;  4HDE A;  1ERV A;  1ABA A;  2R2J A;  3I69 A;  2IIY A;  3K8N A;  3IOS A;  1XWK A;  5J41 A;  1XW6 A;  3D5J A;  3LSZ A;  4EKZ A;  2P0G A;  4O7H A;  13GS A;  2VLU A;  1GSS A;  1K3O A;  5IIZ A;  4HSC X;  2WUL A;  3QFA C;  1XXU A;  5ECL B;  1SU9 A;  4JZQ A;  1SJ6 A;  3F8U A;  4BL7 B;  2LRN A;  4WR5 A;  2GGT A;  3ZVJ A;  2FA4 A;  2XBI A;  2YV7 A;  1PQN A;  1T1V A;  2Z9S A;  1TP9 A;  4CY6 A;  4TXV A;  4FYU A;  4HU7 A;  1MD3 A;  3D4M A;  3QDN A;  4PUR A;  4K5S A;  2HZE B;  3TOT A;  1JZO A;  2LEG A;  3MYD A;  5DAL B;  1THO A;  4HI7 A;  4FYC A;  1A8Y A;  4K7I A;  1HQO A;  2MMO A;  3IXR A;  3F4S A;  3WT1 A;  2VOC A;  4TR4 A;  2GQK A;  3TJF A;  3C1R A;  2OJL A;  5IMV A;  1OAZ A;  3KP9 A;  3O6T A;  3IDV A;  3P8W A;  1QFN A;  1TW9 A;  1BED A;  4KSO A;  1TU8 A;  3M9K A;  3EMX A;  1GTB A;  3UL3 A;  1SYR A;  2H74 A;  2H6X A;  5JWR B;  2JL4 A;  3UEM A;  3L9S A;  1BJX A;  3TKS C;  1A2J A;  4Q5N A;  4AF2 A;  3UMA A;  2HT9 A;  5ABR A;  5AIV A;  1HNC A;  2G0F A;  2VCT A;  3FK8 A;  3ZML A;  1X5E A;  4YAP A;  1XWA A;  2YP6 A;  2CZ2 A;  1LBK A;  3UIW A;  3QAV A;  1GLP A;  4L5O A;  4K2X A;  2R37 A;  1XCC A;  2BTO T;  2OBK A;  3GH9 A;  3HVS A;  2PUK C;  1TJD A;  5IMD A;  1GNW A;  2LQO A;  5A4W A;  2HRF A;  3VUR A;  4HZ4 A;  2DIY A;  3G9B A;  4MJA A;  4YQU A;  1SKW B;  4IW9 A;  1GSF A;  2YJ7 A;  2GTU A;  4KH7 A;  3R3E A;  6GSY A;  4OO4 A;  1GWC A;  1YY7 A;  2IMI A;  2VLV A;  3EVI A;  6GSU A;  3VI7 A;  1WE0 A;  2O8V B;  5ENU A;  3L9V A;  4NHW A;  3TRQ A;  4EIP A;  20GS A;  2VCZ A;  3EU3 A;  4FYB A;  4POK A;  3WD6 A;  3LYK A;  4MCU A;  3D4T A;  4USS A;  4F9Z A;  1NHY A;  1F2E A;  2FGX A;  3KTB A;  4PXO A;  1KBN A;  2MBT A;  3E0U A;  4TR0 A;  3ZRD A;  2CVB A;  2GT6 A;  17GS A;  4MA9 A;  5D9T A;  1N2A A;  2L4Q A;  3HYP A;  4BVX A;  1AUC A;  1XWG A;  1WOU A;  5AGY A;  1PX6 A;  4OCF A;  11GS A;  2FWE A;  3GSS A;  3GTU A;  3IPZ A;  1GUL A;  2A2S A;  3C71 A;  5EPF A;  3QPM A;  1OC9 A;  4JR6 A;  1K3L A;  1GSY A;  2MMN A;  4K5R A;  1ACV A;  1Y6E A;  2CA8 A;  1Z5Y E;  1JLW A;  1KNG A;  2I4A A;  3UBK A;  1TOF A;  2C4J A;  3IRA A;  4MF5 A;  5JCU A;  1ZCP A;  4QL7 A;  4BVY B;  4HJM A;  3DML A;  1O7U A;  5DAK B;  4K1F A;  4WKW A;  3GN3 A;  1XVQ A;  2C80 A;  3MNG A;  4JU5 A;  3UAR A;  1V9W A;  2YAN A;  5G1L A;  4JED A;  4GTU A;  2YCD A;  1MDJ A;  4XIH A;  1RK4 A;  2R0C A;  1URM A;  3A2V A;  3NZN A;  1AAZ A;  3W8J A;  2VL2 A;  1GUH A;  5C00 A;  4F82 A;  2TRC P;  1JZD A;  4ULX A;  5LD0 A;  1M3J A;  1WIK A;  3I43 A;  4I2U A;  1B8X A;  3KZQ A;  1HNB A;  1GTA A;  1X9M B;  1EEM A;  4OFT A;  2VCQ A;  5IO2 A;  4HUA A;  4WBR D;  5BMU A;  3LQ7 A;  1BAY A;  4XS4 A;  2WFC A;  3LEF A;  3FZ9 A;  2O85 A;  2I3Y A;  4MPG A;  1DE2 A;  1J08 A;  5D9X A;  2GS3 A;  3KMO A;  1OC3 A;  4X4J A;  5IMF A;  3TUE A;  4KCE A;  1XZO A;  3BD2 A;  3EWL A;  1GRX A;  2KP2 A;  5DDL A;  2VM2 A;  4IN0 A;  1MD4 A;  1K0C A;  1QUW A;  1TXX A;  2IMF A;  2LNT A;  3WGX A;  3N9J A;  2GT5 A;  1QMV A;  4FIW A;  3RPP A;  1B48 A;  4ECC A;  16GS A;  3E3E A;  3A2W A;  2LQQ A;  2EIQ A;  2YOI A;  3HA9 A;  3VWU A;  2H0H A;  3CMI A;  1V40 A;  3KP8 A;  4EO3 A;  4OD7 A;  4O92 A;  2F8F A;  3LXT A;  5DCG A;  2GSS A;  2K18 A;  3N5O A;  4FO5 A;  3RAZ A;  5G5E A;  1ZYE A;  3KCM A;  2AHE A;  2XBQ A;  4O32 A;  2QA1 A;  1I9D A;  4PQI A;  5L71 A;  1K0B A;  5ELG A;  3VWX A;  2V6K A;  3JCM L;  2ALB A;  1M9A A;  4KAE A;  1TI3 A;  2JSZ A;  3F6D A;  1PD2 1;  5AN1 A;  5H5Q A;  6GSS A;  2C8U A;  3GX0 A;  1FG4 A;  2GST A;  1TK8 B;  4GCI A;  2MBS A;  1HNA A;  5CRE A;  2LJK A;  18GS A;  4GST A;  3V1W A;  1SKR B;  2OA7 A;  1NSW A;  3VPT A;  3D21 A;  1S3R A;  5ECN B;  2MMA A;  1X5D A;  2L6D A;  4I8B A;  4YKF A;  1XW5 A;  3GMF A;  2JAC A;  2VCX A;  1VRS D;  3CSH A;  1GSE A;  2FWF A;  2A4H A;  2P5Q A;  1OYJ A;  1M99 A;  2RUE A;  1O8X A;  5CP1 A;  1SK0 A;  2B6M A;  2H30 A;  3KXO A;  4RUV A;  2R4V A;  1GSU A;  2LRT A;  4V1A p;  3DXB A;  2LUS A;  3L9U A;  4K2D A;  5KN2 A;  2IME A;  4H86 A;  3DVX A;  1A0F A;  5KEJ A;  2X8G A;  4GQC A;  2WGR A;  4MZB A;  2B7J A;  4LMV A;  3FHK A;  4DVC A;  3RPN A;  4OFN A;  1ERW A;  4HOJ A;  4XRD A;  3TRP A;  2HZF A;  4HQS A;  2A2R A;  1NM3 A;  5DJM A;  2REM A;  1KTE A;  3ZRE A;  2D2Z A;  2NDO A;  1FOV A;  2PBJ A;  2PVQ A;  1EWX A;  3ZL5 A;  1O8W A;  1U88 A;  2J23 A;  4TKY A;  2VUP A;  1SL1 B;  1TKD B;  3HVN A;  2FUG 2;  6GST A;  1ERU A;  1OVN A;  3A5I A;  4EL1 A;  4KA0 A;  3FZA A;  1MEK A;  4JBB A;  4LA1 A;  3DEX A;  2MMZ A;  1THX A;  2PVO C;  2FWH A;  1M7T A;  3KIJ A;  4V2L A;  2QSI A;  4ICY A;  5HR2 A;  1ERT A;  1SKS B;  4D73 B;  2VD1 A;  2AYT A;  1W4V A;  4MAB A;  5CRW A;  4K7O A;  3HY2 A;  2C0F A;  5D9W A;  4WXT A;  2NPB A;  2GZY A;  2RLI A;  1PN9 A;  1N8J A;  5IMZ A;  2B3S A;  1G6Y A;  8GSS A;  1PA3 A;  2LTK A;  5JWO B;  2GLR A;  4EIQ A;  1MTC A;  4N0Z A;  3S9F A;  3MWH A;  4DSS A;  5HR3 A;  4IQA A;  1FAA A;  1R4W A;  4YQV A;  2PPT A;  2FLS A;  1XWC A;  5CNW A;  2IJY A;  2XPE A;  4IHU A;  2LNS A;  4I5Q A;  1X9S B;  1XW9 A;  1GH2 A;  1K0A A;  3LW9 A;  2ZNM A;  4POB A;  2OBI A;  1ZOF A;  2YNX A;  5G31 A;  3QOU A;  1LJR A;  3PPU A;  2H19 A;  4ECJ A;  2A2P A;  4TR1 A;  5HQP A;  1VGL A;  3KEB A;  2PWJ A;  3QCP A;  5DVB A;  2H1G A;  1EOG A;  4HQZ A;  2YWN A;  4WF4 A;  1AC1 A;  1A8L A;  2LST A;  4RI6 A;  4TRX A;  2J9H A;  3GRX A;  3CQF A;  5F0G A;  1X9W B;  2GZP A;  4PX1 A;  3VWW A;  2HNL A;  1S3A A;  2JZS A;  3PGT A;  4EDZ A;  2M46 A;  2GSQ A;  4N30 A;  4I6X A;  1ST9 A;  1YQ1 A;  4O5R A;  5C04 A;  1O85 A;  1DUG A;  5ELA A;  5JWQ B;  2X99 A;  5IMA A;  2L5L A;  1T00 A;  4MJB A;  4ZL9 A;  3U5R E;  1PN0 A;  4KND A;  2GDR A;  2C1Y A;  3DIE A;  4LL4 B;  2VCV A;  1S3D A;  1SJI A;  2YV9 A;  3BCK A;  2E2G A;  4ZIL A;  2DIZ A;  5J3R A;  6GSX A;  3KJY A;  5DAL A;  4L0U A;  2WCI A;  4YKG A;  2NBS A;  5HFI A;  1ZL9 A;  1BX9 A;  4MZW A;  7GSS A;  1GL8 A;  3QD9 A;  5J5N A;  3GHA A;  1WMJ A;  1M0U A;  4NXI A;  3A2X A;  1XOB A;  1E2Y A;  1NHO A;  1OKD A;  2KP1 A;  1EOH A;  4PNG A;  2R6K A;  3D6I A;  3DGQ A;  5FWG A;  6GSW A;  3IA1 A;  1V98 A;  1A2L A;  3FZ4 A;  3PIN A;  1AQX A;  4DSQ A;  2HRK A;  4NAX A;  4XRA A;  1QGV A;  4PTS A;  2V1M A;  1PL2 A;  2WDU A;  5B8B A;  1T4Y A;  1EV9 A;  4OMV A;  3EUR A;  4ML1 A;  1A24 A;  3NOF A;  5A5K A;  3W6G A;  3UVH A;  2JSY A;  2DLX A;  3DD3 A;  5ECH B;  3US3 A;  5IM9 A;  1T7P B;  2DJ1 A;  3O3T A;  5D93 A;  5DQY A;  3DYR A;  2QA2 A;  2F3M A;  3EYT A;  2CT6 A;  2JU5 A;  2V32 A;  3DKS A;  2B7K A;  2O87 A;  3FR6 A;  5INY A;  1IYH A;  4X43 A;  4BVX B;  1G6W A;  5EL8 A;  2C0G A;  2HSM A;  3ERG A;  3GTU B;  1B9Y C;  5HFG A;  2X8C A;  4Q5F A;  4NV5 A;  1OC9 B;  4V1A g;  4E8E A;  2ZUP A;  4IP6 A;  3EIN A;  2K8V A;  1B4P A;  1TRW A;  4MPF A;  1TRS A;  2LRC A;  1V58 A;  3RHB A;  2R5G A;  4KB3 A;  2B5X A;  2BJX A;  4OO5 A;  1JHB A;  2WRT A;  3CSI A;  3IV4 A;  4K6X A;  5F07 A;  5ECS A;  4KF9 A;  1DE1 A;  4G0L A;  5D8I A;  2B5Y A;  2H73 A;  1F3B A;  2XHF A;  2DJJ A;  4IVF A;  3TJG A;  3EE2 A;  2FNO A;  2OE1 A;  2CQ9 A;  2CV4 A;  9GSS A;  2WS2 A;  3HHV A;  3IHG A;  2N5F A;  4RI7 A;  2VM1 A;  2H66 A;  1YEX A;  2RUF A;  1SK2 A;  4N0V A;  2H0I A;  3QAW A;  3F63 A;  1UVZ A;  3VFI A;  4G0K A;  1ILO A;  4L5L A;  4YQM A;  1XBS A;  1M2B A;  5AIX A;  3TCO A;  1SD8 A;  2FCH A;  1GLQ A;  3GKM A;  1QQ2 A;  4O5Q A;  14GS A;  4XS4 B;  4IBP A;  4ZBA A;  4CDO A;  4N11 A;  3C8E A;  1EEJ A;  3QFB C;  1M9B A;  1S3C A;  5KN1 A;  3F9U A;  1U3I A;  2VL9 A;  3J7Y k;  3ME8 A;  2H76 A;  3TKS A;  4IP1 A;  1UC7 A;  2DKI A;  4Z7X A;  4KCA A;  2JAD A;  3HDC A;  5DAK A;  4WF5 A;  2K8S A;  1FHE A;  3CRU A;  1PFO A;  1HD2 A;  2C3Q A;  3ISO A;  1G0T A;  3HVV A;  3Q6O A;  5CYY A;  5IOW A;  3KD0 A;  4N10 A;  3SWL A;  1K0N A;  4GXZ A;  5ECO B;  4BWS A;  2HXK A;  3P90 A;  3H93 A;  2YJH A;  1SK1 A;  2DJ2 A;  4NMU A;  3BJ5 A;  5LCZ A;  3LXZ A;  1CQH A;  1A2M A;  3GKX A;  5D96 A;  4PUF C;  1TRV A;  1QK8 A;  3DRN A;  4XS6 A;  2IMK A;  3H8Q A;  4O5U A;  3TRX A;  4F0C A;  4K8M A;  4KW6 A;  4RQR A;  4TW5 A;  1AIU A;  4G0I A;  4WEY A;  4KDX A;  3CTG A;  4EDY A;  1XFL A;  1YJ6 A;  5ECM B;  3APQ A;  4EVM A;  3ERF A;  4ZXG A;  3D0Z A;  1TU7 A;  3M0F A;  3WYW A;  3FMW A;  4MH2 A;  4G9H A;  3FR9 A;  1PX7 A;  1NW2 A;  2IPA A;  5IQY A;  4DEJ A;  3APO A;  2YWI A;  3QAG A;  3HJP A;  4IGJ A;  5CRG A;  10GS A;  3LGC A;  2R3X A;  4JRR A;  3C1S A;  2ON5 A;  1EGO A;  1SJZ A;  4TN8 A;  2DSA A;  2OKA A;  4QL9 A;  4CHS A;  3EMP A;  3GYK A;  1K3Y A;  3F3R A;  3A3T A;  3BBY A;  5GAN D;  3ZVJ D;  4K7N A;  3F4T A;  2EIO A;  2YWM A;  3TKR A;  2IMD A;  3U6V A;  4V2M A;  4TR3 A;  3MSZ A;  1T3B A;  5ID2 A;  3ZZX A;  2GQM A;  2HRN A;  3IR4 A;  5D73 A;  1BG5 A;  3VLN A;  5KOW A;  2H6Y A;  1U87 A;  1IYI A;  3ZTL A;  2DJ3 A;  1F37 A;  3R2Q A;  2FD3 A;  4PGT A;  2ES7 A;  2X64 A;  2JZT A;  3Q18 A;  4ML6 A;  5EVO A;  1ZYN A;  3KM6 A;  2CX4 A;  4POL A;  1BYE A;  4EE0 A;  22GS A;  1GSD A;  4TVE A;  3LFL A;  1R5A A;  3UOM A;  3WT2 A;  3LYP A;  2EC4 A;  1YKA A;  1EP8 A;  1DSB A;  4ISD A;  1Z6M A;  3LJR A;  2TIR A;  2DJ0 A;  4HJ2 A;  2QKE A;  1GTI A;  4AJ8 A;  5B7C A;  1RQM A;  1VF1 A;  1OC8 A;  2WJU A;  2JZR A;  3GUR A;  3C7M A;  2HSH A;  5HR1 A;  2IFQ B;  3FR3 A;  3CRT A;  4MDC A;  3KH9 A;  3GA4 A;  4EF0 A;  1AQW A;  1VF4 A;  3A5W A;  5J9B A;  2RM5 A;  2F51 A;  5IOX A;  3LG6 A;  4AJ7 A;  3FKF A;  3IC4 A;  1FW1 A;  2OAD A;  1M2D A;  3FY7 A;  3F3Q A;  4MP4 A;  2CZ3 A;  4L0W A;  3TDG A;  3ZIV A;  4IJI A;  5ECK B;  3HD5 A;  4Z2R A;  4KDY A;  4ZB6 A;  5F05 A;  1BQ7 A;  3ZIT A;  4DSS B;  1OE7 A;  2K6V A;  4GLT A;  2HI7 A;  4JE1 A;  2VD0 A;  2YN1 A;  3QR6 A;  4ECI A;  2F8A A;  3HXS A;  5ECP B;  2QGV A;  5DBQ A;  2DJK A;  3FEU A;  3UJ1 A;  5DQS A;  4IEL A;  1PKZ A;  4KDU A;  1H4O A;  5G30 A;  3ZFB A;  2E0Q A;  3TJK A;  2HRA A;  4Z2U A;  2L4C A;  3WGD A;  1PRX A;  4X0X A;  4F03 A;  4AGS A;  4ECB A;  1F9M A;  2BMX A;  4D73 A;  4WBJ A;  1TTZ A;  1YDK A;  4KGI A;  2M80 A;  1V2A A;  2R0G A;  5ECQ B;  3HJO A;  1ZMA A;  3GL3 A;  2V41 A;  2FY6 A;  1M2A A;  4OFM A;  2I9H A;  4PUA A;  4NV2 A;  4KE3 A;  3G7J A;  1O73 A;  1R7H A;  3MAK A;  3MIX A;  2IWT A;  1TK0 B;  2H01 A;  4F2I A;  4IS0 A;  3C73 A;  3F6F A;  4TXO A;  1WWJ A;  2H0G A;  5IPH A;  1X5C A;  4IQ1 A;  1PMT A;  2K9F A;  5KOX A;  2N5B A;  2XC2 A;  2C3T A;  5JCW A;  2NVL A;  4K0G A;  3FW2 A;  1SEN A;  5BRT A;  2L6C A;  4NWY A;  2LV3 A;  4FH8 A;  4HEA 2;  4BL7 A;  2B5E A;  5B6N A;  5J9C A;  4FQU A;  2PER A;  2DKH A;  1HYU A;  4DSR A;  1H75 A;  4AJ6 A;  1ZZY A;  3HZ8 A;  2H6Z A;  3DWV A;  2X8H A;  3E9J B;  4NHZ A;  5HR0 A;  2H8L A;  3Q74 A;  4MLY A;  2HZE A;  1O81 A;  2KLX A;  3CSJ A;  3FRC A;  3M9J A;  5A4U A;  3APS A;  3LWA A;  4MJC A;  4PNF A;  4BIK A;  1EGR A;  3GV1 A;  5EY6 A;  2AJQ B;  1T4Z A;  1FOH A;  2CAQ A;  5G5F A;  4MH3 A;  5D9V A;  2VL2 C;  3SBC A;  2PMT A;  4CY8 A;  1AXD A;  1SYX A;  1ML6 A;  1OKT A;  3P2A A;  4KUN A;  4I97 A;  5GSS A;  2X49 A;  3IE3 A;  2VCW A;  1ZYP A;  1Q4J A;  3TGZ A;  2AAW A;  2H72 A;  3TJB A;  5FT3 A;  2MYG A;  1GTU A;  2V6O A;  2C0D A;  3CTF A;  2DC5 A;  4QQ7 A;  3FZ5 A;  4ID0 A;  2OE0 A;  2HSY A;  3BCI A;  2HLS A;  3PH9 A;  3TKQ A;  3FYG A;  4GSN A;  1W89 A;  2KOK A;  2KUC A;  3HJM A;  2KHP A;  1MDK A;  1B9X C;  1YKC A;  3ME7 A;  4K0N A;  5HFK A;  3W8S A;  1JLV A;  4TOP A;  2H1D A;  2XPD A;  5E4W A;  4ZBD A;  1YZX A;  4OCE A;  5AIS A;  3HZ4 A;  3WGE A;  1I5G A;  1Q98 A;  1GP1 A;  2H71 A;  5CAX A;  4HZ2 A;  5H5R A;  3ZLP A;  4Q5Q A;  3KH7 A;  2LJA A;  1Z7P A;  1SD9 A;  2CVK A;  2WB9 A;  2PGT A;  3G7Y A;  3M8N A;  1WRY A;  3M3M A;  1E6B A;  2G2Q A;  3GST A;  1EZK A;  1LU4 A;  5COH A;  2ON7 A;  3KGK A;  3J7Y b;  4ILF A;  4J56 E;  5A4V A;  4HS1 A;  2OAC A;  4GRF A;  3GX8 A;  1QXH A;  4PQH A;  1MDI A;  3UAP A;  4EXJ A;  4K9Z A;  4ZB9 A;  1PGT A;  4MF7 A;  1ON4 A;  4LLR A;  4J2F A;  3IAM 2;  2AV4 A;  5FHI A;  1ZGN A;  3UVT A;  3TB2 A;  1VF2 A;  5E59 A;  1T8E B;  2I81 A;  4MF6 A;  5F8B A;  3EPT A;  1WP0 A;  3L78 A;  3RDW A;  2DMM A;  1SL2 B;  4PQ1 A;  1GUM A;  1FVJ A;  2YPM A;  4BVY A;  19GS A;  2CAI A;  1XOA A;  1JZR A;  2L5O A;  2VIM A;  4BWQ A;  1YF0 A;  3F0I A;  3TKS E;  5KN3 A;  2O7K A;  1TRU A;  1VF3 A;  2A4V A;  2H70 A;  1Y25 A;  3HCZ A;  1AW9 A;  3VPQ A;  4ZB8 A;  5LNK e;  1K0M A;  4MNN A;  2H1B A;  3TOU A;  1JZW A;  4HU9 A;  4RQX A;  3KMN A;  3GKK A;  3I9V 2;  3NIV A;  2VLT A;  2ZCT A;  2VAF A;  1J9B A;  2LJR A;  1Z6N A;  5J4U A;  3TKP A;  2OE3 A;  1Z7R A;  3IK9 A;  5ECI B;  3CYN A;  4MJE A;  2FHE A;  1AQV A;  3AY8 A;  2H75 A;  1R5P A;  3ZFL A;  3M1G A;  4G19 A;  3O76 A;  1YEP A; 
#chains in the Genus database with same CATH homology
 1UN2 A;  2RM6 A;  1G7O A;  4A5P A;  1YF1 A;  1WPI A;  4BPY A;  1WJK A;  3I6A A;  2O89 A;  1ZYQ B;  3IAS 2;  3GH6 A;  2HE3 A;  3G7I A;  1GNE A;  4XCS A;  2B1L A;  1R26 A;  2I1U A;  2IL3 A;  3GKN A;  1X0R A;  3IHQ A;  2F9S A;  3P7X A;  3IBH A;  4MK3 A;  5KN0 A;  4ACS A;  2P5R A;  4J57 E;  4KX4 A;  4MMM A;  3QMX A;  5H5S A;  1FB0 A;  2GZZ A;  2TRX A;  1XPV A;  2LS5 A;  2N5A A;  3F4R A;  2V2G A;  2H1A A;  4EUY A;  2P31 A;  4F0B A;  5G1K A;  1F6M C;  2AB6 A;  1GSQ A;  4Z2T A;  5IO0 A;  4KSM A;  4XTS A;  3ZMK A;  3GUS A;  2C0E A;  5CRD A;  2GQL A;  4IJ3 A;  3VK9 A;  5ID2 B;  3MDK A;  4POM A;  2GSR A;  5CRH A;  4GF0 A;  4WET A;  2WZ9 A;  2PU9 C;  2C3N A;  2FWG A;  5DJL A;  3LOR A;  4GSS A;  2CVD A;  1Z3E A;  4YAV A;  2GVP A;  4XHM A;  4YH2 A;  2QC7 A;  3GNJ A;  3RHC A;  1XWB A;  4MZC A;  1J0F A;  4JR4 A;  3PR8 A;  4ZIJ A;  1GUK A;  2AUV A;  3ZYW A;  1A0R P;  1DBY A;  3ZIJ A;  1PKW A;  4GWR A;  2YZU A;  2UZ8 A;  4ZL7 A;  1TDI A;  2E7P A;  3IC8 A;  1PSQ A;  1XVW A;  3EU4 A;  2FA8 A;  1CQG A;  4P3Y B;  3ED3 A;  3ERW A;  2E2M A;  3L4N A;  4X1U A;  1FB6 A;  2DBC A;  5GST A;  1B4Q A;  1C72 A;  3TJJ A;  4OWY A;  2LKU A;  3OR5 A;  6GSV A;  4LMW A;  3KTL A;  3HVX A;  1XIY A;  3H4K A;  2RII A;  4V2N A;  4E8H A;  3BOA A;  3L0H A;  5B6M A;  12GS A;  1SL0 B;  4EC0 A;  1RW1 A;  4CW9 A;  2L57 A;  3CBU A;  3CXG A;  5G2Z A;  2PN8 A;  1F3A A;  4Q5R A;  2YZH A;  1OE8 A;  2HFD A;  5IPG A;  5ECR B;  5IMC A;  5GZZ B;  1FO5 A;  1UA5 A;  4GQF A;  1U3A A;  4G10 A;  3EC3 A;  1A23 A;  4ZL8 A;  4IKH A;  2B1K A;  2NTO A;  3D22 A;  1JFU A;  4NPB A;  1FVK A;  2M72 A;  2MZC A;  2VL3 A;  1G7E A;  5JCG A;  2VO4 A;  3HKR A;  1O6J A;  4L8E A;  3IK7 A;  3GIX A;  3UBL A;  4WR4 A;  1Z9H A;  2DML A;  2YWO A;  5GAP D;  4LL1 B;  1TI1 A;  3DVW A;  3VWV A;  2IFQ A;  2X4A A;  3H79 A;  2IN3 A;  5DCH A;  5CO3 A;  1U6T A;  3GL5 A;  1TK5 B;  3H1N A;  3Q19 A;  5F06 A;  4G2E A;  4ZBB A;  2R0P A;  4XS1 A;  1PL1 A;  1USB A;  4TR1 B;  2CX3 A;  1K0O A;  1EV4 A;  1K0D A;  2EIR A;  2L59 A;  2HYX A;  4BA7 A;  1KEB A;  1V57 A;  1EP7 A;  3RBT A;  4TXO B;  3VI5 A;  4I2T A;  3GFK A;  5B8A A;  4HDE A;  1ERV A;  1ABA A;  2R2J A;  3I69 A;  2IIY A;  3K8N A;  3IOS A;  1XWK A;  5J41 A;  1XW6 A;  3D5J A;  3LSZ A;  4EKZ A;  2P0G A;  4O7H A;  13GS A;  2VLU A;  1GSS A;  1K3O A;  5IIZ A;  2WUL A;  3QFA C;  1XXU A;  5ECL B;  1SU9 A;  4JZQ A;  1SJ6 A;  3F8U A;  4BL7 B;  2LRN A;  4WR5 A;  2GGT A;  3ZVJ A;  2FA4 A;  2XBI A;  2YV7 A;  1PQN A;  1T1V A;  2Z9S A;  1TP9 A;  4CY6 A;  4TXV A;  4FYU A;  4HU7 A;  1MD3 A;  3D4M A;  3QDN A;  4PUR A;  4K5S A;  2HZE B;  3TOT A;  1JZO A;  2LEG A;  3MYD A;  5DAL B;  1THO A;  4HI7 A;  4FYC A;  1A8Y A;  4K7I A;  1HQO A;  2MMO A;  3IXR A;  3F4S A;  3WT1 A;  2VOC A;  4TR4 A;  2GQK A;  3TJF A;  3C1R A;  2OJL A;  5IMV A;  1OAZ A;  3KP9 A;  3O6T A;  3IDV A;  3P8W A;  1QFN A;  1TW9 A;  1BED A;  4KSO A;  1TU8 A;  3M9K A;  3EMX A;  1GTB A;  3UL3 A;  1SYR A;  2H74 A;  2H6X A;  5JWR B;  2JL4 A;  3UEM A;  3L9S A;  1BJX A;  3TKS C;  1A2J A;  4Q5N A;  4AF2 A;  3UMA A;  2HT9 A;  5ABR A;  5AIV A;  1HNC A;  2G0F A;  2VCT A;  3FK8 A;  3ZML A;  1X5E A;  4YAP A;  1XWA A;  2YP6 A;  2CZ2 A;  1LBK A;  3UIW A;  3QAV A;  1GLP A;  4L5O A;  4K2X A;  2R37 A;  1XCC A;  2BTO T;  2OBK A;  3GH9 A;  3HVS A;  2PUK C;  1TJD A;  5IMD A;  1GNW A;  2LQO A;  5A4W A;  2HRF A;  3VUR A;  4HZ4 A;  2DIY A;  3G9B A;  4MJA A;  4YQU A;  1SKW B;  4IW9 A;  1GSF A;  2YJ7 A;  2GTU A;  4KH7 A;  3R3E A;  6GSY A;  4OO4 A;  1GWC A;  1YY7 A;  2IMI A;  2VLV A;  3EVI A;  6GSU A;  3VI7 A;  1WE0 A;  2O8V B;  5ENU A;  3L9V A;  4NHW A;  3TRQ A;  4EIP A;  20GS A;  2VCZ A;  3EU3 A;  4FYB A;  4POK A;  3WD6 A;  3LYK A;  4MCU A;  3D4T A;  4USS A;  4F9Z A;  1NHY A;  1F2E A;  2FGX A;  3KTB A;  4PXO A;  1KBN A;  2MBT A;  3E0U A;  4TR0 A;  3ZRD A;  2CVB A;  2GT6 A;  17GS A;  4MA9 A;  5D9T A;  1N2A A;  2L4Q A;  3HYP A;  4BVX A;  1AUC A;  1XWG A;  1WOU A;  5AGY A;  1PX6 A;  4OCF A;  11GS A;  2FWE A;  3GSS A;  3GTU A;  3IPZ A;  1GUL A;  2A2S A;  3C71 A;  5EPF A;  3QPM A;  1OC9 A;  4JR6 A;  1K3L A;  1GSY A;  2MMN A;  4K5R A;  1ACV A;  1Y6E A;  2CA8 A;  1Z5Y E;  1JLW A;  1KNG A;  2I4A A;  3UBK A;  1TOF A;  2C4J A;  3IRA A;  4MF5 A;  5JCU A;  1ZCP A;  4QL7 A;  4BVY B;  4HJM A;  3DML A;  1O7U A;  5DAK B;  4K1F A;  4WKW A;  3GN3 A;  1XVQ A;  2C80 A;  3MNG A;  4JU5 A;  3UAR A;  1V9W A;  2YAN A;  5G1L A;  4JED A;  4GTU A;  2YCD A;  1MDJ A;  4XIH A;  1RK4 A;  2R0C A;  1URM A;  3A2V A;  3NZN A;  1AAZ A;  3W8J A;  2VL2 A;  1GUH A;  5C00 A;  4F82 A;  2TRC P;  1JZD A;  4ULX A;  5LD0 A;  4I2U A;  1WIK A;  3I43 A;  1B8X A;  3KZQ A;  1HNB A;  1GTA A;  1X9M B;  1EEM A;  4OFT A;  2VCQ A;  5IO2 A;  4HUA A;  4WBR D;  5BMU A;  3LQ7 A;  1BAY A;  4XS4 A;  2WFC A;  3LEF A;  3FZ9 A;  2O85 A;  2I3Y A;  4MPG A;  1DE2 A;  1J08 A;  5D9X A;  2GS3 A;  3KMO A;  1OC3 A;  4X4J A;  5IMF A;  3TUE A;  4KCE A;  1XZO A;  3BD2 A;  3EWL A;  1GRX A;  2KP2 A;  5DDL A;  2VM2 A;  4IN0 A;  1MD4 A;  1K0C A;  1QUW A;  1TXX A;  2IMF A;  2LNT A;  3WGX A;  3N9J A;  2GT5 A;  1QMV A;  4FIW A;  3RPP A;  1B48 A;  4ECC A;  16GS A;  3E3E A;  3A2W A;  2LQQ A;  2EIQ A;  2YOI A;  3HA9 A;  3VWU A;  2H0H A;  3CMI A;  1V40 A;  3KP8 A;  4EO3 A;  4OD7 A;  4O92 A;  2F8F A;  3LXT A;  5DCG A;  2GSS A;  2K18 A;  3N5O A;  4FO5 A;  3RAZ A;  5G5E A;  1ZYE A;  3KCM A;  2AHE A;  2XBQ A;  4O32 A;  2QA1 A;  1I9D A;  4PQI A;  5L71 A;  1K0B A;  5ELG A;  3VWX A;  2V6K A;  3JCM L;  2ALB A;  1M9A A;  4KAE A;  1TI3 A;  2JSZ A;  3F6D A;  1PD2 1;  5AN1 A;  5H5Q A;  6GSS A;  2C8U A;  3GX0 A;  1FG4 A;  2GST A;  1TK8 B;  4GCI A;  2MBS A;  1HNA A;  5CRE A;  2LJK A;  18GS A;  4GST A;  3V1W A;  1SKR B;  2OA7 A;  1NSW A;  3VPT A;  3D21 A;  5ECN B;  2MMA A;  1X5D A;  2L6D A;  4I8B A;  4YKF A;  1XW5 A;  3GMF A;  2JAC A;  2VCX A;  1VRS D;  3CSH A;  1GSE A;  2FWF A;  2A4H A;  2P5Q A;  1OYJ A;  1M99 A;  2RUE A;  1O8X A;  5CP1 A;  1SK0 A;  2B6M A;  2H30 A;  3KXO A;  4RUV A;  2R4V A;  1GSU A;  2LRT A;  4V1A p;  3DXB A;  2LUS A;  3L9U A;  4K2D A;  5KN2 A;  2IME A;  4H86 A;  3DVX A;  1A0F A;  5KEJ A;  2X8G A;  4GQC A;  2WGR A;  4MZB A;  2B7J A;  4LMV A;  3FHK A;  4DVC A;  3RPN A;  4OFN A;  1ERW A;  4HOJ A;  4XRD A;  3TRP A;  2HZF A;  4HQS A;  2A2R A;  1NM3 A;  5DJM A;  2REM A;  1KTE A;  3ZRE A;  2D2Z A;  2NDO A;  1FOV A;  2PBJ A;  2PVQ A;  1EWX A;  3ZL5 A;  1O8W A;  1U88 A;  2J23 A;  4TKY A;  2VUP A;  1SL1 B;  1TKD B;  2FUG 2;  6GST A;  1ERU A;  1OVN A;  3A5I A;  4EL1 A;  4KA0 A;  3FZA A;  1MEK A;  4JBB A;  4LA1 A;  3DEX A;  2MMZ A;  1THX A;  2PVO C;  2FWH A;  1M7T A;  3KIJ A;  4V2L A;  2QSI A;  4ICY A;  5HR2 A;  1ERT A;  1SKS B;  4D73 B;  2VD1 A;  2AYT A;  1W4V A;  4MAB A;  5CRW A;  4K7O A;  3HY2 A;  2C0F A;  5D9W A;  4WXT A;  2NPB A;  2GZY A;  2RLI A;  1PN9 A;  1N8J A;  5IMZ A;  2B3S A;  1G6Y A;  8GSS A;  1PA3 A;  2LTK A;  5JWO B;  2GLR A;  4EIQ A;  1MTC A;  4N0Z A;  3S9F A;  3MWH A;  4DSS A;  5HR3 A;  4IQA A;  1FAA A;  1R4W A;  4YQV A;  2PPT A;  2FLS A;  1XWC A;  5CNW A;  2IJY A;  2XPE A;  4IHU A;  2LNS A;  4I5Q A;  1X9S B;  1XW9 A;  1GH2 A;  1K0A A;  3LW9 A;  2ZNM A;  4POB A;  2OBI A;  1ZOF A;  2YNX A;  5G31 A;  3QOU A;  1LJR A;  3PPU A;  2H19 A;  4ECJ A;  2A2P A;  4TR1 A;  5HQP A;  1VGL A;  3KEB A;  2PWJ A;  3QCP A;  5DVB A;  2H1G A;  1EOG A;  4HQZ A;  2YWN A;  4WF4 A;  1AC1 A;  1A8L A;  2LST A;  4RI6 A;  4TRX A;  2J9H A;  3GRX A;  5F0G A;  1X9W B;  2GZP A;  4PX1 A;  3VWW A;  2HNL A;  1S3A A;  2JZS A;  3PGT A;  4EDZ A;  2M46 A;  2GSQ A;  4N30 A;  4I6X A;  1ST9 A;  1YQ1 A;  4O5R A;  5C04 A;  1O85 A;  1DUG A;  5ELA A;  5JWQ B;  2X99 A;  5IMA A;  2L5L A;  1T00 A;  4MJB A;  4ZL9 A;  3U5R E;  1PN0 A;  4KND A;  2GDR A;  2C1Y A;  3DIE A;  4LL4 B;  2VCV A;  1S3D A;  1SJI A;  2YV9 A;  3BCK A;  2E2G A;  4ZIL A;  2DIZ A;  5J3R A;  6GSX A;  3KJY A;  5DAL A;  4L0U A;  2WCI A;  4YKG A;  2NBS A;  5HFI A;  1ZL9 A;  1BX9 A;  4MZW A;  7GSS A;  1GL8 A;  3QD9 A;  5J5N A;  3GHA A;  1WMJ A;  1M0U A;  4NXI A;  3A2X A;  1XOB A;  1E2Y A;  1NHO A;  1OKD A;  2KP1 A;  1EOH A;  4PNG A;  2R6K A;  3D6I A;  3DGQ A;  5FWG A;  6GSW A;  3IA1 A;  1V98 A;  1A2L A;  3FZ4 A;  3PIN A;  1AQX A;  4DSQ A;  2HRK A;  4NAX A;  4XRA A;  1QGV A;  4PTS A;  2V1M A;  1PL2 A;  2WDU A;  5B8B A;  1T4Y A;  1EV9 A;  4OMV A;  3EUR A;  4ML1 A;  1A24 A;  3NOF A;  5A5K A;  3W6G A;  3UVH A;  2JSY A;  2DLX A;  3DD3 A;  5ECH B;  3US3 A;  5IM9 A;  1T7P B;  2DJ1 A;  3O3T A;  5D93 A;  5DQY A;  3DYR A;  2QA2 A;  2F3M A;  3EYT A;  2CT6 A;  2JU5 A;  2V32 A;  3DKS A;  2B7K A;  2O87 A;  3FR6 A;  5INY A;  1IYH A;  4X43 A;  4BVX B;  1G6W A;  5EL8 A;  2C0G A;  2HSM A;  3ERG A;  3GTU B;  1B9Y C;  5HFG A;  2X8C A;  4Q5F A;  4NV5 A;  1OC9 B;  4V1A g;  4E8E A;  2ZUP A;  4IP6 A;  3EIN A;  2K8V A;  1B4P A;  1TRW A;  4MPF A;  1TRS A;  2LRC A;  1V58 A;  3RHB A;  2R5G A;  4KB3 A;  2B5X A;  2BJX A;  4OO5 A;  1JHB A;  2WRT A;  3CSI A;  3IV4 A;  4K6X A;  5F07 A;  5ECS A;  4KF9 A;  1DE1 A;  4G0L A;  5D8I A;  2B5Y A;  2H73 A;  1F3B A;  2XHF A;  2DJJ A;  4IVF A;  3TJG A;  3EE2 A;  2FNO A;  2OE1 A;  2CQ9 A;  2CV4 A;  9GSS A;  2WS2 A;  3HHV A;  3IHG A;  2N5F A;  4RI7 A;  2VM1 A;  2H66 A;  1YEX A;  2RUF A;  1SK2 A;  4N0V A;  2H0I A;  3QAW A;  3F63 A;  1UVZ A;  3VFI A;  4G0K A;  1ILO A;  4L5L A;  4YQM A;  1XBS A;  1M2B A;  5AIX A;  3TCO A;  1SD8 A;  2FCH A;  1GLQ A;  3GKM A;  1QQ2 A;  4O5Q A;  14GS A;  4XS4 B;  4IBP A;  4ZBA A;  4CDO A;  4N11 A;  3C8E A;  1EEJ A;  3QFB C;  1M9B A;  1S3C A;  5KN1 A;  3F9U A;  1U3I A;  2VL9 A;  3J7Y k;  3ME8 A;  2H76 A;  3TKS A;  4IP1 A;  1UC7 A;  2DKI A;  4Z7X A;  4KCA A;  2JAD A;  3HDC A;  5DAK A;  4WF5 A;  2K8S A;  1FHE A;  3CRU A;  1HD2 A;  2C3Q A;  3ISO A;  1G0T A;  3HVV A;  3Q6O A;  5CYY A;  5IOW A;  3KD0 A;  4N10 A;  3SWL A;  1K0N A;  4GXZ A;  5ECO B;  4BWS A;  2HXK A;  3P90 A;  3H93 A;  2YJH A;  1SK1 A;  2DJ2 A;  4NMU A;  3BJ5 A;  5LCZ A;  3LXZ A;  1CQH A;  1A2M A;  3GKX A;  5D96 A;  4PUF C;  1TRV A;  1QK8 A;  3DRN A;  4XS6 A;  2IMK A;  3H8Q A;  4O5U A;  3TRX A;  4F0C A;  4K8M A;  4KW6 A;  4RQR A;  4TW5 A;  1AIU A;  4G0I A;  4WEY A;  4KDX A;  3CTG A;  4EDY A;  1XFL A;  1YJ6 A;  5ECM B;  3APQ A;  4EVM A;  3ERF A;  4ZXG A;  3D0Z A;  1TU7 A;  3M0F A;  3WYW A;  3FMW A;  4MH2 A;  4G9H A;  3FR9 A;  1PX7 A;  1NW2 A;  2IPA A;  5IQY A;  4DEJ A;  3APO A;  2YWI A;  3QAG A;  3HJP A;  4IGJ A;  5CRG A;  10GS A;  3LGC A;  2R3X A;  4JRR A;  3C1S A;  2ON5 A;  1EGO A;  1SJZ A;  4TN8 A;  2DSA A;  2OKA A;  4QL9 A;  4CHS A;  3EMP A;  3GYK A;  1K3Y A;  3F3R A;  3A3T A;  3BBY A;  5GAN D;  3ZVJ D;  4K7N A;  3F4T A;  2EIO A;  2YWM A;  3TKR A;  2IMD A;  3U6V A;  4V2M A;  4TR3 A;  3MSZ A;  1T3B A;  5ID2 A;  3ZZX A;  2GQM A;  2HRN A;  3IR4 A;  5D73 A;  1BG5 A;  3VLN A;  5KOW A;  2H6Y A;  1U87 A;  1IYI A;  3ZTL A;  2DJ3 A;  1F37 A;  3R2Q A;  2FD3 A;  4PGT A;  2ES7 A;  2X64 A;  2JZT A;  3Q18 A;  4ML6 A;  5EVO A;  1ZYN A;  3KM6 A;  2CX4 A;  4POL A;  1BYE A;  4EE0 A;  22GS A;  1GSD A;  4TVE A;  3LFL A;  1R5A A;  3UOM A;  3WT2 A;  3LYP A;  2EC4 A;  1YKA A;  1EP8 A;  1DSB A;  4ISD A;  1Z6M A;  3LJR A;  2TIR A;  2DJ0 A;  4HJ2 A;  2QKE A;  1GTI A;  4AJ8 A;  5B7C A;  1RQM A;  1VF1 A;  1OC8 A;  2WJU A;  2JZR A;  3GUR A;  3C7M A;  2HSH A;  5HR1 A;  2IFQ B;  3FR3 A;  3CRT A;  4MDC A;  3KH9 A;  3GA4 A;  4EF0 A;  1AQW A;  1VF4 A;  3A5W A;  5J9B A;  2RM5 A;  2F51 A;  5IOX A;  3LG6 A;  4AJ7 A;  3FKF A;  3IC4 A;  1FW1 A;  2OAD A;  1M2D A;  3FY7 A;  3F3Q A;  4MP4 A;  2CZ3 A;  4L0W A;  3TDG A;  3ZIV A;  4IJI A;  5ECK B;  3HD5 A;  4Z2R A;  4KDY A;  4ZB6 A;  5F05 A;  1BQ7 A;  3ZIT A;  4DSS B;  1OE7 A;  2K6V A;  4GLT A;  2HI7 A;  4JE1 A;  2VD0 A;  2YN1 A;  3QR6 A;  4ECI A;  2F8A A;  3HXS A;  5ECP B;  2QGV A;  5DBQ A;  2DJK A;  3FEU A;  3UJ1 A;  5DQS A;  4IEL A;  1PKZ A;  4KDU A;  1H4O A;  5G30 A;  3ZFB A;  2E0Q A;  3TJK A;  2HRA A;  4Z2U A;  2L4C A;  3WGD A;  1PRX A;  4X0X A;  4F03 A;  4AGS A;  4ECB A;  1F9M A;  2BMX A;  4D73 A;  4WBJ A;  1TTZ A;  1YDK A;  4KGI A;  2M80 A;  1V2A A;  2R0G A;  5ECQ B;  3HJO A;  1ZMA A;  3GL3 A;  2V41 A;  2FY6 A;  1M2A A;  4OFM A;  2I9H A;  4PUA A;  4NV2 A;  4KE3 A;  3G7J A;  1O73 A;  1R7H A;  3MAK A;  3MIX A;  2IWT A;  1TK0 B;  2H01 A;  4F2I A;  4IS0 A;  3C73 A;  3F6F A;  4TXO A;  1WWJ A;  2H0G A;  5IPH A;  1X5C A;  4IQ1 A;  1PMT A;  2K9F A;  5KOX A;  2N5B A;  2XC2 A;  2C3T A;  5JCW A;  2NVL A;  4K0G A;  3FW2 A;  1SEN A;  5BRT A;  2L6C A;  4NWY A;  2LV3 A;  4FH8 A;  4HEA 2;  4BL7 A;  2B5E A;  5B6N A;  5J9C A;  4FQU A;  2PER A;  2DKH A;  1HYU A;  4DSR A;  1H75 A;  4AJ6 A;  1ZZY A;  3HZ8 A;  2H6Z A;  3DWV A;  2X8H A;  3E9J B;  4NHZ A;  5HR0 A;  2H8L A;  3Q74 A;  4MLY A;  2HZE A;  1O81 A;  2KLX A;  3CSJ A;  3FRC A;  3M9J A;  5A4U A;  3APS A;  3LWA A;  4MJC A;  4PNF A;  1EGR A;  3GV1 A;  5EY6 A;  2AJQ B;  1T4Z A;  1FOH A;  2CAQ A;  5G5F A;  4MH3 A;  5D9V A;  2VL2 C;  3SBC A;  2PMT A;  4CY8 A;  1AXD A;  1SYX A;  1ML6 A;  1OKT A;  3P2A A;  4KUN A;  4I97 A;  5GSS A;  2X49 A;  3IE3 A;  2VCW A;  1ZYP A;  1Q4J A;  3TGZ A;  2AAW A;  2H72 A;  3TJB A;  5FT3 A;  2MYG A;  1GTU A;  2V6O A;  2C0D A;  3CTF A;  2DC5 A;  4QQ7 A;  3FZ5 A;  4ID0 A;  2OE0 A;  2HSY A;  3BCI A;  2HLS A;  3PH9 A;  3TKQ A;  3FYG A;  4GSN A;  1W89 A;  2KOK A;  2KUC A;  3HJM A;  2KHP A;  1MDK A;  1B9X C;  1YKC A;  3ME7 A;  4K0N A;  5HFK A;  3W8S A;  1JLV A;  4TOP A;  2H1D A;  2XPD A;  5E4W A;  4ZBD A;  1YZX A;  4OCE A;  5AIS A;  3HZ4 A;  3WGE A;  1I5G A;  1Q98 A;  1GP1 A;  2H71 A;  5CAX A;  4HZ2 A;  5H5R A;  3ZLP A;  4Q5Q A;  3KH7 A;  2LJA A;  1Z7P A;  1SD9 A;  2CVK A;  2WB9 A;  2PGT A;  3G7Y A;  3M8N A;  1WRY A;  3M3M A;  1E6B A;  2G2Q A;  3GST A;  1EZK A;  1LU4 A;  5COH A;  2ON7 A;  3KGK A;  3J7Y b;  4ILF A;  4J56 E;  5A4V A;  4HS1 A;  2OAC A;  4GRF A;  3GX8 A;  1QXH A;  4PQH A;  1MDI A;  3UAP A;  4EXJ A;  4K9Z A;  4ZB9 A;  1PGT A;  4MF7 A;  1ON4 A;  4LLR A;  4J2F A;  3IAM 2;  2AV4 A;  5FHI A;  1ZGN A;  3UVT A;  3TB2 A;  1VF2 A;  5E59 A;  1T8E B;  2I81 A;  4MF6 A;  5F8B A;  3EPT A;  1WP0 A;  3L78 A;  3RDW A;  2DMM A;  1SL2 B;  4PQ1 A;  1GUM A;  1FVJ A;  2YPM A;  4BVY A;  19GS A;  2CAI A;  1XOA A;  1JZR A;  2L5O A;  2VIM A;  4BWQ A;  1YF0 A;  3F0I A;  3TKS E;  5KN3 A;  2O7K A;  1TRU A;  1VF3 A;  2A4V A;  2H70 A;  1Y25 A;  3HCZ A;  1AW9 A;  3VPQ A;  4ZB8 A;  5LNK e;  1K0M A;  4MNN A;  2H1B A;  3TOU A;  1JZW A;  4HU9 A;  4RQX A;  3KMN A;  3GKK A;  3I9V 2;  3NIV A;  2VLT A;  2ZCT A;  2VAF A;  1J9B A;  2LJR A;  1Z6N A;  5J4U A;  3TKP A;  2OE3 A;  1Z7R A;  3IK9 A;  5ECI B;  3CYN A;  4MJE A;  2FHE A;  1AQV A;  3AY8 A;  2H75 A;  1R5P A;  3ZFL A;  3M1G A;  4G19 A;  3O76 A;  1YEP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...