2OE3A

Crystal structure of mitochondrial thioredoxin 3 from saccharomyces cerevisiae (oxidized form)
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
106
structure length
106
Chain Sequence
SSYTSITKLTNLTEFRNLIKQNDKLVIDFYATWCGPCKMMQPHLTKLIQAYPDVRFVKCDVDESPDIAKECEVTAMPTFVLGKDGQLIGKIIGANPTALEKGIKDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Thioredoxin-3
publication title Structural and mechanistic analyses of yeast mitochondrial thioredoxin Trx3 reveal putative function of its additional cysteine residues
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 33
structure length 106
sequence length 106
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2oe3A00
2DJJA 3L9UA 2NPBA 5LCZA 1TP9A 4H86A 5KN3A 2RM5A 3ZFBA 3A3TA 2GT6A 2H71A 3D6IA 4HU9A 5CO3A 2P5RA 5D9TA 3D4TA 1SKSB 3KP9A 5ECPB 6GSYA 2VD0A 2CAIA 4KGIA 1UC7A 2GQLA 3WGXA 3I43A 2YWOA 1ZGNA 2YJ7A 4ZXGA 2OBKA 4V2NA 2JSYA 4KAEA 5EL8A 1S3CA 3GRXA 2DBCA 4MJEA 4ZIJA 1R4WA 1FB0A 2OE3A 3F6DA 2GSRA 3GIXA 1J9BA 3RPPA 2IPAA 4TVEA 3Q6OA 2JL4A 4HU7A 1M99A 2YPMA 2JSZA 2LJKA 5COHA 5F0GA 1PA3A 4RUVA 3W8JA 3K8NA 4HOJA 5CP1A 2HXKA 1ILOA 4G9HA 1R5AA 3D22A 2VOCA 1WMJA 2IN3A 2YV7A 2N5BA 5G1KA 1ST9A 4L5LA 1B9YC 2B5YA 4HQSA 1GP1A 2FWFA 1OKTA 2K6VA 3BOAA 3HY2A 3TRQA 4PX1A 2C3NA 5IMDA 2CVDA 4TW5A 3UEMA 1WRYA 3KD0A 4AJ6A 1URMA 2CZ2A 1JZRA 2GDRA 1TXXA 3KH9A 2VCZA 2HSYA 4XIHA 3BD2A 3GKNA 3KJYA 3BBYA 5GAPD 3L78A 3LEFA 1TRVA 4O92A 3FRCA 4LMWA 4N11A 2HI7A 4NAXA 1YF1A 1M0UA 2LQOA 5G5EA 1U3AA 2WZ9A 3UL3A 3VI5A 2C3QA 4LL1B 4OO5A 4ML1A 4GRFA 1SK0A 2O85A 2VO4A 3J7Yb 1B8XA 3FKFA 1SENA 5FT3A 3UVTA 4K1FA 3PGTA 3LSZA 2EC4A 1DSBA 1U88A 2VL3A 3G7YA 2IMDA 3CYNA 3GNJA 3GX0A 5GAND 3I9V2 1T7PB 2IFQB 3ERWA 2PMTA 2XPDA 3R2QA 2H1BA 2YCDA 3ED3A 3G7IA 1YKCA 1K0CA 1Z6NA 5D9VA 4NV5A 1AC1A 4EXJA 2FCHA 5B8BA 2H0GA 1B48A 3TRPA 2KP2A 3ZYWA 2XBIA 4NV2A 1QGVA 1FB6A 1T8EB 2LKUA 1SK1A 2WS2A 2GZZA 1U3IA 1X5CA 1TK5B 2NBSA 3O3TA 1NW2A 2ON5A 1ZYEA 1M7TA 1YZXA 2LEGA 2ON7A 4N30A 3C1SA 1LJRA 1GNEA 2GSSA 3QPMA 1QXHA 3CSHA 4I2UA 1CQGA 4PURA 2PVQA 3CTGA 1G7OA 1OC9B 5J9CA 3I69A 5ECOB 2YWIA 4FH8A 3KMOA 3F63A 2C0FA 2LS5A 2VIMA 3CMIA 3QMXA 1AQXA 2DJ0A 2WDUA 4GWRA 1GSQA 1ACVA 1PRXA 1XWAA 2H74A 4KCAA 4I97A 3UARA 3ME8A 2PBJA 4NWYA 1O73A 3UBKA 3C7MA 2A2RA 4Q5NA 4PQIA 1G0TA 2IMFA 1OC8A 3FZ4A 3FZ5A 4YQMA 2MBSA 3TKPA 1ABAA 3TKSE 3EMPA 2RIIA 2WFCA 3IDVA 1PL1A 1Z3EA 8GSSA 2IL3A 5KN1A 3IR4A 4IBPA 3HKRA 4IHUA 3APOA 5KEJA 2BMXA 5JCGA 1B9XC 1U87A 2IIYA 5A4VA 3HJOA 1XCCA 5CNWA 6GSVA 1HD2A 5H5RA 2AUVA 4F03A 5ECIB 1O7UA 3DXBA 1TI1A 2F8AA 5AIVA 2HT9A 3BJ5A 5IO2A 2H1AA 2H1DA 5ENUA 5HFKA 5JCWA 4X1UA 5D96A 1V58A 2I1UA 3W8SA 5FWGA 2QC7A 3ZMLA 4WF5A 4HUAA 5A4UA 2E2MA 6GSUA 2WJUA 1GTAA 5DQYA 5IPGA 5JWQB 1GSDA 4OMVA 2YJHA 3ZMKA 1PD21 4FYUA 2IMIA 2VL9A 4IELA 3LYPA 2LQQA 5IMFA 4JBBA 3FY7A 4GTUA 2FA4A 2H01A 2PVOC 3HCZA 2H6YA 2MMZA 3M8NA 4PXOA 2N5FA 3N9JA 1N8JA 5F05A 4IGJA 4MH3A 4DSSB 5B8AA 3IPZA 1Z5YE 3O6TA 4KW6A 4HJ2A 3GTUB 1K0DA 2B7JA 1MD4A 1PKWA 5DBQA 1MDJA 2YANA 1MEKA 1GTUA 3QAVA 1X9MB 4IW9A 5AIXA 3RBTA 2E0QA 4MZBA 5IM9A 1PGTA 4YAVA 3D4MA 4IQ1A 4RQRA 2RUFA 3H93A 3KZQA 2LRCA 3F6FA 4NMUA 4MABA 4KH7A 2FD3A 2MZCA 3KM6A 3L9SA 3RPNA 1T1VA 3GURA 3QOUA 1OYJA 3UIWA 1WJKA 4J56E 4D73A 5GSTA 1W89A 2I9HA 1GH2A 1HNAA 1XFLA 3DVXA 5IMVA 4HZ2A 5AISA 5GZZB 1BAYA 1X5DA 2V6OA 3IBHA 1WP0A 4PNFA 2P0GA 4MK3A 1TK0B 1H75A 4KSOA 3ISOA 3WYWA 1GLQA 2AV4A 2CAQA 2Z9SA 3A2WA 1YQ1A 3FR3A 5DJMA 3HJPA 1TW9A 2O8VB 3LXTA 2LJAA 2O7KA 1NHYA 2RUEA 1SJZA 4K6XA 3I6AA 3IK7A 5ECNB 3L9VA 2L5OA 4TN8A 5CRGA 3E3EA 2CV4A 1GSYA 5EVOA 1C72A 3EU4A 2A2SA 3TDGA 1MTCA 12GSA 2N5AA 5J4UA 4PQHA 1NHOA 3NIVA 3EURA 2DIZA 4GF0A 4JEDA 4WF4A 4TXOA 2AB6A 4BWSA 2H66A 1WE0A 4F0BA 4GCIA 1AQVA 3M9JA 3FK8A 4MJCA 2ZUPA 2TRCP 1G6WA 2PU9C 2VCXA 3N5OA 4KNDA 3HZ8A 5D9XA 1BYEA 1O85A 4MP4A 3V1WA 3D21A 4V1Ap 2H8LA 4OFTA 7GSSA 4WR5A 4WXTA 3KXOA 1TKDB 4ECCA 4WBRD 3QFBC 4MA9A 4YQUA 3H79A 4NHZA 1T00A 1ZCPA 2VLTA 5J5NA 3EU3A 2L57A 4ZB6A 3CXGA 2H6ZA 3KP8A 4WR4A 5IPHA 1Y6EA 1ZYQB 1EP8A 1Z6MA 3GSSA 2FA8A 4K8MA 1OC3A 3RDWA 4V2LA 2NTOA 1GTBA 1TU8A 5HFIA 2HZFA 1F37A 3TKRA 4XTSA 4I2TA 3QAWA 4KCEA 4OFNA 1Q98A 4F0CA 1EEMA 1SD9A 3QAGA 3HDCA 3G9BA 4E8EA 2YZUA 19GSA 2PGTA 3W6GA 2EIOA 3A5WA 4TXOB 1X5EA 1Z9HA 1S3AA 3LJRA 5G31A 2DC5A 2H30A 3VLNA 1CQHA 1XOBA 1WOUA 4LL4B 1WPIA 3M0FA 4IN0A 18GSA 3ZZXA 1XOAA 5HR0A 5A4WA 3TKSA 1XVWA 1EV4A 3D5JA 2IFQA 4IJ3A 4Q5FA 2FWEA 2FHEA 3D0ZA 1THOA 2DMLA 3GH9A 4BL7A 5INYA 4HDEA 3IA1A 3C73A 10GSA 4WKWA 1R26A 1QFNA 4K0GA 1K0MA 4PQ1A 5ECSA 1VRSD 1A2LA 4V1Ag 3QFAC 3FYGA 1AUCA 2M72A 4YAPA 2GSTA 2V1MA 2L5LA 3AY8A 3TJJA 3TOUA 1V98A 1M2DA 2OA7A 1KBNA 2H19A 3ZVJA 4EUYA 5C00A 3GUSA 1OC9A 3APQA 4WETA 2L59A 3KTLA 3FHKA 3VI7A 2EIRA 1EOHA 4IP6A 5JCUA 2YP6A 4JE1A 1BX9A 2F9SA 2VLUA 2DMMA 2DSAA 1PKZA 3FZ9A 2VUPA 1Q4JA 1SL1B 4PUFC 5JWRB 5B7CA 2PERA 5ID2B 1M2BA 4HS1A 3TGZA 3Q18A 1XWBA 2WB9A 3U5RE 5ECRB 3QD9A 2YNXA 1LBKA 4K7IA 2VM1A 16GSA 3PINA 1GRXA 1PMTA 3A2VA 2GLRA 1JLWA 5DAKB 4Q5QA 3BCKA 4MCUA 1X9WB 2ZNMA 4ULXA 1AAZA 5HFGA 1UA5A 4TR1B 4GXZA 2VCVA 3KMNA 4DVCA 5A5KA 4FYCA 1THXA 5F06A 4X43A 1FAAA 1I5GA 4N10A 3KEBA 4POLA 1A8YA 1FOVA 1ERTA 3P7XA 5HR2A 5KN2A 4L0UA 3L4NA 2JU5A 3IAS2 2OE1A 2AJQB 3PH9A 4Z7XA 3APSA 4JZQA 1V40A 2C8UA 4I6XA 1VF3A 3P90A 3F3RA 3O76A 9GSSA 3ZVJD 4ZL8A 1OE8A 3NZNA 5E4WA 1A0RP 2CA8A 1KTEA 4MZWA 3EC3A 2VL2A 3GX8A 5IMAA 3IE3A 1T4ZA 4GSNA 4ZILA 1LU4A 4EDYA 1GSSA 3UJ1A 1E2YA 4HJMA 1ERUA 3M9KA 3BCIA 3LORA 2WRTA 2K9FA 3US3A 3H8QA 2HRFA 1XW6A 2V6KA 2XPEA 1M9BA 2ZCTA 4XRAA 4DSSA 5HQPA 2GTUA 1TRSA 4OCFA 3IC4A 1XW9A 3F9UA 3EYTA 2LNTA 3GTUA 3LYKA 2BTOT 2FWGA 2CX3A 5CYYA 4IKHA 5IOWA 1HYUA 1M9AA 4HI7A 3M3MA 5IMZA 1QQ2A 5CAXA 1G6YA 1B4QA 5DVBA 4EDZA 2YZHA 3FZAA 1IYIA 4DEJA 2R4VA 1YKAA 2H72A 4N0VA 5IMCA 1A0FA 1K3OA 4EVMA 4NXIA 1BQ7A 5E59A 2KP1A 3GSTA 1OVNA 2MBTA 3DRNA 2YV9A 5DQSA 4KX4A 4BA7A 2M80A 2GZPA 4EO3A 2DJKA 3TRXA 2X64A 4FIWA 3TJKA 4IP1A 3JCML 1VF4A 3P2AA 4YH2A 2FLSA 1M2AA 4ZBBA 11GSA 3DMLA 3EINA 2X8CA 2CT6A 1ERWA 2R6KA 3A2XA 2HSHA 5H5QA 1FHEA 2LV3A 2R37A 3UMAA 3F0IA 2YWNA 4QL7A 3TB2A 3DWVA 2C80A 4LMVA 2L6CA 2XHFA 2H76A 4ECBA 3E0UA 3GKMA 4J57E 3EE2A 1BJXA 4EC0A 1SKRB 2L4QA 4L0WA 4HEA2 1TRWA 5LD0A 3VWVA 3TCOA 3CBUA 4OD7A 4O32A 1TRUA 1J0FA 5F8BA 1X9SB 5D8IA 1A8LA 2V41A 1F3BA 1TU7A 4ILFA 3C71A 2DJ1A 4MDCA 1J08A 1EGRA 1QK8A 4I8BA 3CRUA 2MMAA 3F4TA 2FNOA 2H0IA 3G7JA 3KH7A 6GSSA 1GULA 3KCMA 4GQFA 4OCEA 5D73A 4DSRA 5ELGA 4G2EA 4KA0A 4E8HA 4MH2A 2TRXA 1BG5A 1GWCA 2B7KA 1K0OA 2GQKA 4POKA 2LUSA 2PUKC 2FWHA 2HYXA 4KSMA 4MF6A 1NSWA 3GV1A 2LRNA 2EIQA 5J9BA 1O6JA 1B4PA 1SU9A 3VFIA 2REMA 3GFKA 2LNSA 2RLIA 5GSSA 1R7HA 1ZMAA 2CX4A 2HZEB 4WEYA 1O8WA 2K18A 2H6XA 4K0NA 2FY6A 1RW1A 2YWMA 5D9WA 4XS6A 4MMMA 13GSA 3GKKA 3WGEA 2OJLA 4F9ZA 1XZOA 1SD8A 3HYPA 3ZL5A 4K2DA 4FO5A 1DUGA 4NPBA 3CTFA 3ZITA 2IJYA 1XPVA 2X8HA 5B6MA 2IWTA 4G10A 1HNBA 2H1GA 3ERGA 4X0XA 2H75A 1VF1A 1SL0B 5DALB 3MSZA 4HQZA 3WT1A 1K3YA 1SK2A 1N2AA 2MMOA 1EZKA 2DIYA 2LSTA 2B5XA 2B1KA 3GA4A 1R5PA 5HR3A 1SJIA 1AXDA 2LTKA 4MJAA 4AF2A 2I3YA 5ECHB 5FHIA 3GKXA 2CVKA 1O8XA 4EE0A 3F3QA 3PR8A 4PGTA 4ZB9A 2LJRA 5DCHA 5IOXA 2GT5A 1EOGA 3GL3A 2AHEA 4ZBDA 3MNGA 1O81A 3HA9A 4Q5RA 4F2IA 2P31A 1I9DA 2B5EA 4MF5A 4MPGA 2CQ9A 3LWAA 3DD3A 2B1LA 2IMKA 3TKQA 3IHQA 3TUEA 1G7EA 14GSA 5G1LA 3WGDA 4EL1A 2I4AA 1USBA 1FW1A 4GLTA 5JWOB 4JRRA 3QDNA 1XWKA 5DCGA 4K7OA 3GHAA 2HE3A 3Q74A 2G2QA 2H0HA 3VPTA 2MMNA 3FEUA 2F3MA 3RHBA 3TJGA 1QMVA 1JZOA 1FG4A 1TJDA 2AYTA 4MPFA 2JZRA 1K3LA 2XBQA 4JR4A 4GQCA 1PX6A 4BWQA 3U6VA 4OWYA 3S9FA 1UVZA 2VLVA 1KEBA 1JHBA 5DJLA 5ID2A 3WT2A 1GL8A 1TTZA 3FR6A 1RK4A 2DJ3A 1TK8B 4GSTA 1V9WA 3TJBA 6GSTA 2VCQA 3ZIVA 2OBIA 2O87A 4KDUA 5DAKA 3LXZA 2KUCA 2YOIA 2NDOA 4XS1A 5IIZA 1Z7RA 4TR1A 2BJXA 3DVWA 1HNCA 1YDKA 4JR6A 4J2FA 4KUNA 5J41A 3F4SA 3GMFA 1VGLA 5ABRA 1ML6A 1W4VA 2X99A 4ACSA 3GN3A 3IXRA 1Y25A 3ZRDA 3ZLPA 4DSQA 3IV4A 1ON4A 2D2ZA 22GSA 2QKEA 2ES7A 5HR1A 3EWLA 4TRXA 1GUMA 1T4YA 1JFUA 4ECJA 2M46A 1EGOA 1YJ6A 1YEPA 4XS4A 1K0AA 2WULA 3CSJA 3H1NA 3ZREA 20GSA 5ECLB 3HVXA 5F07A 1MDKA 1AQWA 4GSSA 1SYRA 2B6MA 5ELAA 1SJ6A 3QCPA 4CDOA 1OAZA 2A4VA 3DIEA 3CRTA 5H5SA 4QQ7A 4V2MA 1DE1A 3UOMA 2GVPA 4XRDA 4RI6A 1JZDA 2VCWA 4ML6A 3IAM2 3RHCA 5ECMB 1YY7A 4IJIA 1AIUA 6GSWA 3TOTA 3FR9A 3HD5A 1TOFA 1KNGA 4XCSA 1GSFA 4JU5A 3LG6A 5CRDA 1PQNA 5AGYA 2C1YA 4O5RA 3HZ4A 2JACA 4WBJA 1SL2B 1ZZYA 1BEDA 3P8WA 4EF0A 3H4KA 1AW9A 3E9JB 3KGKA 4POMA 1X0RA 2E2GA 4OO4A 2G0FA 3HXSA 4AJ8A 3CSIA 4LLRA 3UAPA 2L4CA 2JZTA 3VWUA 3ME7A 5G2ZA 2XC2A 1F3AA 4MF7A 1EP7A 1NM3A 4PNGA 3MWHA 4XS4B 2F51A 2TIRA 3M1GA 1U6TA 4ZL9A 1GNWA 4P3YB 2MYGA 3MDKA 2C4JA 1ZOFA 3L0HA 2NVLA 4OFMA 4K9ZA 2QSIA 5IO0A 4ISDA 5LNKe 3LQ7A 5ECKB 3NOFA 5EPFA 2RM6A 4POBA 3J7Yk 4KDXA 3HHVA 5CREA 3TJFA 3ZFLA 1S3DA 1SKWB 4O7HA 1PL2A 5L71A 4F82A 2VM2A 1HQOA 5D93A 1FO5A 3VWXA 2GSQA 3EMXA 3SBCA 4RI7A 1XBSA 4TKYA 2B3SA 4QL9A 1A23A 2QGVA 2R5GA 2VCTA 3IK9A 3OR5A 1A2JA 4MLYA 1GUKA 2K8VA 3UBLA 4N0ZA 4AJ7A 2FGXA 4NHWA 4L8EA 1H4OA 2KHPA 2GGTA 4G19A 1XXUA 2HFDA 3Q19A 1F9MA 3GH6A 2E7PA 1PN9A 4YQVA 3FW2A 1EEJA 2DLXA 2I81A 1MDIA 1DBYA 1FVJA 2C0DA 4ZL7A 2PPTA 1F2EA 2V2GA 1GSUA 5G5FA 5AN1A 3TKSC 2L6DA 4CW9A 2HZEA 1IYHA 2OACA 4TOPA 3DYRA 4MJBA 1A24A 1OKDA 5J3RA 17GSA 3HJMA 2O89A 4ECIA 4LA1A 3DKSA 1XWGA 2ALBA 5G30A 2FUG2 5B6NA 4IQAA 5C04A 2GZYA 4BVYA 3QR6A 5DDLA 2OADA 1DE2A 3KTBA 1FVKA 2YN1A 3GL5A 4BPYA 1V57A 2IMEA 1JZWA 3LFLA 2GQMA 1TI3A 5DALA 2P5QA 3F8UA 3DGQA 2HRNA 3C1RA 3ZIJA 4CHSA 2PWJA 2C0EA 2WGRA 4TR4A 1A2MA 4MZCA 1QUWA 4I5QA 2GS3A 3SWLA 1JLVA 1E6BA 5CRHA 2R2JA 4AGSA 3DEXA 2AAWA 2R3XA 1MD3A 1GSEA 1EV9A 2KOKA 1WIKA 3IOSA 1TDIA 2CVBA 2F8FA 3LGCA 4BVXA 4ZBAA 3VWWA 4KDYA 1WWJA 2J9HA 1ZL9A 2V32A 4IVFA 4TR3A 1OE7A 2VAFA 2H70A 3IRAA 4HZ4A 3VURA 1F6MC 3ZTLA 5ECQB 1GLPA 2LRTA 1PSQA 1EWXA 4XHMA 2VD1A 4PUAA 1UN2A 3VPQA 5CRWA 3ERFA 3MAKA 2HNLA 4ZB8A 4RQXA 1GTIA 2J23A 3F4RA 1GUHA 4TXVA 3UVHA 4IS0A 4KE3A 3WD6A 3RAZA 1VF2A 1YEXA 1T3BA 5EY6A 1Z7PA 3HVVA 2JADA 3VK9A 1XVQA 2WCIA 1RQMA 2PN8A 3HVSA 1SYXA 4ID0A 1V2AA 2CZ3A 2C3TA 5KN0A 2C0GA 2DJ2A 1ERVA 2K8SA 1YF0A 4K7NA 2KLXA 2OKAA 5IQYA 4L5OA 1XW5A 4KB3A 3C8EA 4TR0A 2OE0A 6GSXA 2H73A 3KIJA 1K0BA 2VL2C 1XIYA 3GYKA 4FYBA 4EKZA 2HLSA 4D73B 2X8GA 2JZSA 3EVIA 1PX7A 1K0NA 1XWCA
chains in the Genus database with same CATH superfamily
2DJJA 3L9UA 2X4AA 2NPBA 5LCZA 1TP9A 4H86A 5KN3A 2RM5A 3ZFBA 3A3TA 2GT6A 2H71A 3D6IA 4HU9A 5CO3A 2P5RA 5D9TA 3D4TA 1SKSB 3KP9A 5ECPB 6GSYA 2VD0A 2CAIA 4KGIA 1UC7A 2GQLA 3WGXA 3I43A 2YWOA 1ZGNA 4O5UA 2YJ7A 4ZXGA 2OBKA 4V2NA 2JSYA 4KAEA 5EL8A 1S3CA 3GRXA 2DBCA 4MJEA 4ZIJA 1R4WA 1FB0A 2OE3A 3F6DA 2GSRA 3GIXA 1J9BA 3RPPA 2IPAA 4TVEA 3Q6OA 2JL4A 4HU7A 1M99A 2YPMA 2JSZA 2LJKA 5COHA 5F0GA 1PA3A 4RUVA 3W8JA 3K8NA 4HOJA 5CP1A 2HXKA 1ILOA 4G9HA 1R5AA 3D22A 2VOCA 1WMJA 2IN3A 2YV7A 2N5BA 5G1KA 1ST9A 4L5LA 1B9YC 2B5YA 4HQSA 1GP1A 2FWFA 1OKTA 2K6VA 3BOAA 3HY2A 3TRQA 4PX1A 2C3NA 5IMDA 2CVDA 4TW5A 3UEMA 1WRYA 3KD0A 4O5QA 4AJ6A 1URMA 2CZ2A 1JZRA 2GDRA 1TXXA 3KH9A 2VCZA 2HSYA 4XIHA 3BD2A 3GKNA 3KJYA 3BBYA 5GAPD 3L78A 3LEFA 1TRVA 4O92A 3FRCA 4LMWA 4N11A 2HI7A 4NAXA 1YF1A 1M0UA 2LQOA 5G5EA 1U3AA 2WZ9A 3UL3A 3VI5A 2C3QA 4LL1B 4OO5A 4ML1A 1FOHA 4GRFA 1SK0A 2O85A 2VO4A 3J7Yb 1B8XA 3FKFA 1SENA 5FT3A 3UVTA 4K1FA 3PGTA 3LSZA 2EC4A 1DSBA 1U88A 2VL3A 3G7YA 2IMDA 3CYNA 3GNJA 3GX0A 5GAND 3I9V2 1T7PB 2IFQB 3ERWA 2PMTA 2XPDA 3R2QA 4BL7B 2H1BA 2YCDA 3ED3A 3G7IA 1YKCA 1K0CA 1Z6NA 5D9VA 4NV5A 1AC1A 4EXJA 2FCHA 4G0LA 4EIQA 5B8BA 2H0GA 1B48A 3TRPA 2KP2A 3ZYWA 2XBIA 4NV2A 1QGVA 1FB6A 1T8EB 2LKUA 1SK1A 2WS2A 2GZZA 1U3IA 1X5CA 1TK5B 2NBSA 3O3TA 1NW2A 2ON5A 1ZYEA 1M7TA 1YZXA 2LEGA 2ON7A 4N30A 3C1SA 1LJRA 1GNEA 2GSSA 3QPMA 1QXHA 3CSHA 4I2UA 1CQGA 4PURA 2PVQA 3CTGA 1G7OA 1OC9B 5J9CA 3I69A 5ECOB 2YWIA 4FH8A 3KMOA 3F63A 2C0FA 2LS5A 2VIMA 3CMIA 3QMXA 1AQXA 2DJ0A 2WDUA 4GWRA 1GSQA 1ACVA 1PRXA 1XWAA 2H74A 4KCAA 4I97A 3UARA 3ME8A 2PBJA 4NWYA 1O73A 3UBKA 3C7MA 2A2RA 4Q5NA 4PTSA 4PQIA 1G0TA 2IMFA 1OC8A 3FZ4A 3FZ5A 4YQMA 2MBSA 3TKPA 1ABAA 3TKSE 3EMPA 2RIIA 2WFCA 3IDVA 1PL1A 1Z3EA 8GSSA 2IL3A 5KN1A 3IR4A 4IBPA 3HKRA 4IHUA 3APOA 5KEJA 2BMXA 5JCGA 1B9XC 1U87A 2IIYA 5A4VA 3HJOA 1XCCA 5CNWA 6GSVA 1HD2A 5H5RA 2AUVA 4F03A 5ECIB 1O7UA 4FQUA 3DXBA 1TI1A 2F8AA 5AIVA 2HT9A 3BJ5A 5IO2A 2H1AA 2H1DA 5ENUA 5HFKA 5JCWA 4X1UA 5D96A 1V58A 2I1UA 3W8SA 5FWGA 2QC7A 3ZMLA 4WF5A 2DKHA 4HUAA 5A4UA 2E2MA 6GSUA 2WJUA 1GTAA 5BRTA 5DQYA 5IPGA 5JWQB 1GSDA 4OMVA 2YJHA 3ZMKA 1PD21 4FYUA 2IMIA 2VL9A 4IELA 3LYPA 2LQQA 3PPUA 5IMFA 4JBBA 3FY7A 4GTUA 2FA4A 2H01A 2PVOC 3HCZA 2H6YA 2MMZA 3M8NA 4PXOA 2N5FA 3N9JA 1N8JA 5F05A 4IGJA 4MH3A 4DSSB 5B8AA 3IPZA 1Z5YE 4G0IA 3O6TA 4KW6A 4HJ2A 3GTUB 1K0DA 2B7JA 1MD4A 1PKWA 5DBQA 1MDJA 2YANA 1MEKA 1GTUA 3QAVA 1X9MB 4IW9A 4CY6A 5AIXA 3RBTA 2E0QA 4MZBA 5IM9A 1PGTA 4YAVA 5KOWA 3D4MA 4IQ1A 4RQRA 2RUFA 3H93A 3KZQA 2LRCA 3F6FA 4NMUA 2R0CA 4HSCX 4MABA 4KH7A 2FD3A 2MZCA 3KM6A 3L9SA 3RPNA 1T1VA 3GURA 3QOUA 1OYJA 3UIWA 1WJKA 4J56E 4D73A 5GSTA 1W89A 2I9HA 1GH2A 1HNAA 1XFLA 4YKFA 3DVXA 5IMVA 4HZ2A 5AISA 5GZZB 1BAYA 1X5DA 2V6OA 3IBHA 1WP0A 4PNFA 2P0GA 4MK3A 1TK0B 1H75A 4KSOA 3ISOA 3WYWA 1GLQA 2AV4A 2CAQA 2Z9SA 4BIKA 3A2WA 1YQ1A 3FR3A 5DJMA 3HJPA 1TW9A 2O8VB 3LXTA 2LJAA 2O7KA 1NHYA 2RUEA 1SJZA 4K6XA 3I6AA 3IK7A 5ECNB 3L9VA 2L5OA 4TN8A 5CRGA 3E3EA 2CV4A 1GSYA 5EVOA 1C72A 3EU4A 2A2SA 3TDGA 1MTCA 12GSA 2N5AA 5J4UA 4PQHA 1NHOA 3NIVA 3EURA 2HSMA 2DIZA 1PFOA 4GF0A 4JEDA 4WF4A 4TXOA 2AB6A 4BWSA 2H66A 1WE0A 4F0BA 4GCIA 1AQVA 3M9JA 3FK8A 4MJCA 2ZUPA 2TRCP 1G6WA 2PU9C 2VCXA 3N5OA 4KNDA 3HZ8A 5D9XA 1BYEA 1O85A 4MP4A 3V1WA 3D21A 4V1Ap 2H8LA 4OFTA 7GSSA 4WR5A 4WXTA 3KXOA 1TKDB 4ECCA 4WBRD 3QFBC 4MA9A 4YQUA 3H79A 4NHZA 1T00A 1ZCPA 2VLTA 5J5NA 3EU3A 2L57A 4ZB6A 3CXGA 2H6ZA 3KP8A 4WR4A 5IPHA 1Y6EA 1ZYQB 1EP8A 1Z6MA 3GSSA 2FA8A 4K8MA 1OC3A 3RDWA 4V2LA 2NTOA 1GTBA 1TU8A 5HFIA 2HZFA 1F37A 3TKRA 4XTSA 4I2TA 3QAWA 4KCEA 4OFNA 1Q98A 4F0CA 1EEMA 1SD9A 3QAGA 3HDCA 3G9BA 4E8EA 2YZUA 19GSA 2PGTA 3W6GA 2EIOA 3A5WA 4TXOB 1X5EA 1Z9HA 1S3AA 3LJRA 5G31A 2DC5A 2H30A 3VLNA 1CQHA 1XOBA 1WOUA 4LL4B 1WPIA 3M0FA 4IN0A 18GSA 3ZZXA 1XOAA 5HR0A 5A4WA 3TKSA 1XVWA 1EV4A 3D5JA 2IFQA 4IJ3A 4Q5FA 2FWEA 4K5RA 2FHEA 3D0ZA 1THOA 2DMLA 3GH9A 4BL7A 5INYA 4HDEA 3IA1A 4MNNA 3C73A 10GSA 4WKWA 1R26A 1QFNA 3FMWA 4K0GA 1K0MA 4PQ1A 5ECSA 1VRSD 1A2LA 4K5SA 4V1Ag 3QFAC 3FYGA 1AUCA 2M72A 4YAPA 2GSTA 2V1MA 2L5LA 3AY8A 3TJJA 3TOUA 1V98A 1M2DA 2OA7A 1KBNA 2H19A 3ZVJA 4EUYA 5C00A 3GUSA 1OC9A 3APQA 4WETA 2L59A 3KTLA 3FHKA 3VI7A 2EIRA 1EOHA 4IP6A 5JCUA 2YP6A 4JE1A 1BX9A 2F9SA 2VLUA 2DMMA 2DSAA 1PKZA 3FZ9A 2VUPA 1Q4JA 1SL1B 4PUFC 5JWRB 5B7CA 2PERA 5ID2B 1M2BA 4HS1A 3TGZA 3Q18A 1XWBA 2WB9A 3U5RE 5ECRB 3QD9A 1M3IA 2YNXA 1LBKA 4K7IA 2VM1A 16GSA 3PINA 1GRXA 1PMTA 3A2VA 2GLRA 1JLWA 5DAKB 4Q5QA 3BCKA 4MCUA 1X9WB 2ZNMA 4ULXA 1AAZA 4Z2TA 5HFGA 1UA5A 4TR1B 4GXZA 2VCVA 3KMNA 4DVCA 5A5KA 4FYCA 1THXA 5F06A 4X43A 1FAAA 1I5GA 4N10A 3KEBA 4POLA 1A8YA 1FOVA 1ERTA 3P7XA 5HR2A 5KN2A 4L0UA 3L4NA 3LW9A 2JU5A 3IAS2 2OE1A 2AJQB 3PH9A 4Z7XA 3APSA 4JZQA 1V40A 2C8UA 4I6XA 1VF3A 3P90A 3F3RA 3O76A 9GSSA 3ZVJD 4ZL8A 1OE8A 4USSA 3NZNA 5E4WA 1A0RP 2CA8A 1KTEA 4MZWA 3EC3A 2VL2A 3GX8A 5IMAA 3IE3A 1T4ZA 4GSNA 4ZILA 4KF9A 1LU4A 4EDYA 1GSSA 3UJ1A 1E2YA 4HJMA 1ERUA 3M9KA 3BCIA 3LORA 2WRTA 2K9FA 3US3A 3H8QA 2HRFA 2QA1A 1XW6A 2V6KA 2XPEA 1ZYNA 1M9BA 2ZCTA 4XRAA 4DSSA 5HQPA 2GTUA 1TRSA 4OCFA 3IC4A 1XW9A 3F9UA 3EYTA 2LNTA 3GTUA 3LYKA 2BTOT 2FWGA 2CX3A 5CYYA 4IKHA 5IOWA 1HYUA 1M9AA 4HI7A 3M3MA 5IMZA 1QQ2A 5CAXA 1G6YA 1B4QA 5DVBA 4EDZA 2YZHA 3FZAA 1IYIA 4DEJA 2R4VA 1YKAA 5BMUA 2H72A 4N0VA 5IMCA 1A0FA 1M3JA 1K3OA 4EVMA 4NXIA 1BQ7A 5E59A 2KP1A 3GSTA 1OVNA 2MBTA 3DRNA 2YV9A 5DQSA 4KX4A 4BA7A 2M80A 2GZPA 4EO3A 2DJKA 3TRXA 2X64A 4FIWA 3TJKA 4IP1A 3JCML 1VF4A 3P2AA 4YH2A 2FLSA 2A4HA 1M2AA 4ZBBA 11GSA 3DMLA 3EINA 2X8CA 2CT6A 1ERWA 2R6KA 3A2XA 2HSHA 5H5QA 1FHEA 2LV3A 2R37A 3UMAA 3F0IA 2YWNA 4QL7A 3TB2A 3DWVA 2C80A 4LMVA 2L6CA 2XHFA 2H76A 4ECBA 3E0UA 1XG8A 3GKMA 4J57E 3EE2A 1BJXA 4EC0A 1SKRB 2L4QA 4L0WA 4HEA2 1TRWA 5LD0A 3VWVA 3TCOA 3CBUA 4OD7A 4O32A 1TRUA 1J0FA 5F8BA 3HVNA 1X9SB 5D8IA 1A8LA 2V41A 1F3BA 1TU7A 4ILFA 3C71A 2DJ1A 4MDCA 1J08A 1EGRA 1QK8A 4I8BA 3CRUA 2MMAA 3F4TA 2FNOA 2H0IA 3G7JA 3KH7A 6GSSA 1GULA 3KCMA 4GQFA 4OCEA 5D73A 4DSRA 5ELGA 4G2EA 4KA0A 4E8HA 4MH2A 2TRXA 1BG5A 1GWCA 2B7KA 1K0OA 2GQKA 4POKA 2LUSA 2PUKC 2FWHA 2HYXA 4KSMA 4MF6A 1NSWA 3GV1A 2LRNA 2EIQA 5J9BA 1O6JA 1B4PA 1SU9A 3VFIA 4G0KA 2R0PA 2REMA 2UZ8A 3GFKA 2LNSA 2RLIA 5GSSA 1R7HA 1ZMAA 2CX4A 2HZEB 4WEYA 1O8WA 2K18A 2H6XA 4K0NA 2FY6A 1RW1A 2YWMA 5D9WA 4XS6A 4MMMA 13GSA 3GKKA 3WGEA 2OJLA 4CY8A 4F9ZA 1XZOA 1SD8A 3HYPA 3ZL5A 4K2DA 4FO5A 1DUGA 4NPBA 3CTFA 3ZITA 2IJYA 1XPVA 2X8HA 4BVYB 5B6MA 2IWTA 4G10A 1HNBA 2H1GA 3ERGA 4X0XA 2H75A 1VF1A 1SL0B 5DALB 3MSZA 4HQZA 3WT1A 1K3YA 1SK2A 1N2AA 2MMOA 1EZKA 2DIYA 2LSTA 2B5XA 2B1KA 3GA4A 1R5PA 5HR3A 1SJIA 1AXDA 2LTKA 4MJAA 4AF2A 2I3YA 5ECHB 5FHIA 3GKXA 2X49A 2CVKA 1O8XA 3EPTA 4EE0A 3F3QA 3PR8A 4BVXB 4PGTA 4ZB9A 2LJRA 5DCHA 5IOXA 2GT5A 1EOGA 3GL3A 2AHEA 4ZBDA 3MNGA 2HRKA 1O81A 3HA9A 4Q5RA 4F2IA 2P31A 1I9DA 2B5EA 4MF5A 4MPGA 3A5IA 2CQ9A 3LWAA 3DD3A 2B1LA 2IMKA 3TKQA 3IHQA 3TUEA 1G7EA 14GSA 5G1LA 2QA2A 3WGDA 4EL1A 2I4AA 1USBA 1FW1A 4GLTA 5JWOB 4JRRA 3QDNA 1XWKA 4K7OA 5DCGA 3GHAA 2HE3A 3Q74A 2G2QA 2H0HA 3VPTA 2MMNA 3FEUA 2F3MA 3RHBA 3TJGA 1QMVA 1JZOA 1FG4A 1TJDA 2AYTA 4MPFA 2JZRA 1K3LA 2XBQA 4JR4A 4GQCA 1PX6A 4BWQA 3U6VA 4OWYA 3S9FA 1UVZA 2VLVA 1KEBA 1JHBA 5DJLA 5ID2A 3WT2A 1GL8A 1TTZA 3FR6A 1RK4A 2DJ3A 1TK8B 4GSTA 1V9WA 3TJBA 6GSTA 2VCQA 4Z2RA 3ZIVA 2OBIA 2O87A 4KDUA 5DAKA 3LXZA 2KUCA 2YOIA 2NDOA 4XS1A 5IIZA 1Z7RA 4TR1A 2BJXA 3DVWA 1HNCA 1YDKA 4JR6A 4J2FA 4KUNA 5J41A 3F4SA 3GMFA 1VGLA 5ABRA 1ML6A 2DKIA 1W4VA 2X99A 4ACSA 3GN3A 3IXRA 1Y25A 3ZRDA 3ZLPA 4DSQA 2HRAA 3IV4A 1ON4A 2D2ZA 22GSA 2QKEA 2ES7A 5HR1A 3EWLA 4TRXA 1GUMA 1T4YA 1JFUA 4A5PA 4ECJA 2M46A 1EGOA 1YJ6A 1YEPA 4XS4A 1K0AA 2WULA 3CSJA 3H1NA 3ZREA 4K2XA 20GSA 5ECLB 3HVXA 5F07A 1MDKA 2R0GA 1AQWA 4GSSA 1SYRA 2B6MA 4YKGA 5ELAA 1SJ6A 3QCPA 4CDOA 1OAZA 2A4VA 3DIEA 3CRTA 5H5SA 4QQ7A 4V2MA 1DE1A 3UOMA 2GVPA 4XRDA 4RI6A 1JZDA 2VCWA 4ML6A 3IAM2 3RHCA 5ECMB 1YY7A 4IJIA 1AIUA 6GSWA 3TOTA 3FR9A 3HD5A 1TOFA 1KNGA 4XCSA 1GSFA 4JU5A 3LG6A 4Z2UA 5CRDA 1PQNA 5AGYA 2C1YA 4O5RA 3HZ4A 2JACA 4WBJA 1SL2B 1ZZYA 1BEDA 3P8WA 4EF0A 3H4KA 1AW9A 3E9JB 3KGKA 4POMA 1X0RA 2E2GA 4OO4A 2G0FA 3HXSA 4AJ8A 3CSIA 4LLRA 3UAPA 2L4CA 2JZTA 3VWUA 3ME7A 5G2ZA 2XC2A 1F3AA 3MYDA 4MF7A 1EP7A 1S3RA 1NM3A 4PNGA 3MWHA 4XS4B 2F51A 2TIRA 3M1GA 1U6TA 4ZL9A 1GNWA 4P3YB 2MYGA 3MDKA 1PN0A 4X4JA 2C4JA 1ZOFA 3L0HA 2NVLA 4OFMA 4K9ZA 2QSIA 5IO0A 4ISDA 4EIPA 5LNKe 3LQ7A 5ECKB 3NOFA 5EPFA 2RM6A 4POBA 3J7Yk 4KDXA 3HHVA 5CREA 3TJFA 3ZFLA 1S3DA 1SKWB 4O7HA 4ICYA 1PL2A 3CQFA 5L71A 4F82A 2VM2A 1HQOA 5D93A 1FO5A 3VWXA 2GSQA 3EMXA 3SBCA 4RI7A 1XBSA 4TKYA 2B3SA 4QL9A 1A23A 2QGVA 2R5GA 2VCTA 3IK9A 3OR5A 1A2JA 4MLYA 1GUKA 2K8VA 2A2PA 3UBLA 3IHGA 4N0ZA 4AJ7A 2FGXA 4NHWA 4L8EA 1H4OA 2KHPA 2GGTA 4G19A 1XXUA 2HFDA 3Q19A 1ZYPA 1F9MA 3GH6A 2E7PA 1PN9A 4YQVA 3FW2A 1EEJA 2DLXA 2I81A 1MDIA 1DBYA 1FVJA 2C0DA 4ZL7A 2PPTA 1F2EA 2V2GA 1GSUA 5G5FA 5AN1A 3TKSC 2L6DA 4CW9A 2HZEA 1IYHA 2OACA 4TOPA 3DYRA 4MJBA 5KOXA 1A24A 1OKDA 5J3RA 17GSA 3HJMA 2O89A 4ECIA 4LA1A 3DKSA 1XWGA 2ALBA 5G30A 2FUG2 5B6NA 4IQAA 5C04A 2GZYA 4BVYA 3QR6A 5DDLA 2OADA 1DE2A 3KTBA 1FVKA 2YN1A 3GL5A 4BPYA 1V57A 2IMEA 1JZWA 3LFLA 2GQMA 1TI3A 5DALA 2P5QA 3F8UA 3DGQA 2HRNA 3C1RA 3ZIJA 4CHSA 2PWJA 2C0EA 2WGRA 4TR4A 1A2MA 4MZCA 1QUWA 4I5QA 2GS3A 3SWLA 1JLVA 1E6BA 5CRHA 2R2JA 4AGSA 3DEXA 2AAWA 2R3XA 1MD3A 1GSEA 1EV9A 2KOKA 1WIKA 3IOSA 1TDIA 2CVBA 2F8FA 3LGCA 4BVXA 4ZBAA 3VWWA 4KDYA 1WWJA 2J9HA 1ZL9A 2V32A 4IVFA 4TR3A 1OE7A 2VAFA 2H70A 3IRAA 4HZ4A 3VURA 1F6MC 3ZTLA 5ECQB 1GLPA 2LRTA 1PSQA 1EWXA 4XHMA 2VD1A 4PUAA 1UN2A 3VPQA 5CRWA 3ERFA 3MAKA 2HNLA 3IC8A 4ZB8A 4RQXA 1GTIA 2J23A 3F4RA 1GUHA 4TXVA 3UVHA 3MIXA 4IS0A 4KE3A 3WD6A 3RAZA 1VF2A 1YEXA 1T3BA 5EY6A 1Z7PA 3HVVA 3R3EA 2JADA 3VK9A 1XVQA 2WCIA 1RQMA 2PN8A 3HVSA 1SYXA 4ID0A 1V2AA 2CZ3A 2C3TA 5KN0A 2C0GA 2DJ2A 1ERVA 2K8SA 1YF0A 4K7NA 2KLXA 2OKAA 5IQYA 4L5OA 1XW5A 4KB3A 3C8EA 4TR0A 2OE0A 6GSXA 2H73A 3KIJA 1K0BA 2VL2C 1XIYA 3GYKA 4FYBA 4EKZA 2HLSA 4D73B 2X8GA 2JZSA 3EVIA 1PX7A 1K0NA 1XWCA
chains in the Genus database with same CATH topology
2DJJA 3L9UA 2X4AA 2NPBA 5LCZA 1TP9A 4H86A 5KN3A 2RM5A 3ZFBA 3A3TA 2GT6A 2H71A 3D6IA 4HU9A 5CO3A 2P5RA 5D9TA 3D4TA 1SKSB 3KP9A 5ECPB 6GSYA 2VD0A 2CAIA 4KGIA 1UC7A 2GQLA 3WGXA 3I43A 2YWOA 1ZGNA 4O5UA 2YJ7A 4ZXGA 2OBKA 4V2NA 2JSYA 4KAEA 5EL8A 1S3CA 3GRXA 2DBCA 4MJEA 4ZIJA 1R4WA 1FB0A 2OE3A 3F6DA 2GSRA 3GIXA 1J9BA 3RPPA 2IPAA 4TVEA 3Q6OA 2JL4A 4HU7A 1M99A 2YPMA 2JSZA 2LJKA 5COHA 5F0GA 1PA3A 4RUVA 3W8JA 3K8NA 4HOJA 5CP1A 2HXKA 1ILOA 4G9HA 1R5AA 3D22A 2VOCA 1WMJA 2IN3A 2YV7A 2N5BA 5G1KA 1ST9A 4L5LA 1B9YC 2B5YA 4HQSA 1GP1A 2FWFA 1OKTA 2K6VA 3BOAA 3HY2A 3TRQA 4PX1A 2C3NA 5IMDA 2CVDA 4TW5A 3UEMA 1WRYA 3KD0A 4O5QA 4AJ6A 1URMA 2CZ2A 1JZRA 2GDRA 1TXXA 3KH9A 2VCZA 2HSYA 4XIHA 3BD2A 3GKNA 3KJYA 3BBYA 5GAPD 3L78A 3LEFA 1TRVA 4O92A 3FRCA 4LMWA 4N11A 2HI7A 4NAXA 1YF1A 1M0UA 2LQOA 5G5EA 1U3AA 2WZ9A 3UL3A 3VI5A 2C3QA 4LL1B 4OO5A 4ML1A 1FOHA 4GRFA 1SK0A 2O85A 2VO4A 3J7Yb 1B8XA 3FKFA 1SENA 5FT3A 3UVTA 4K1FA 3PGTA 3LSZA 2EC4A 1DSBA 1U88A 2VL3A 3G7YA 2IMDA 3CYNA 3GNJA 3GX0A 5GAND 3I9V2 1T7PB 2IFQB 3ERWA 2PMTA 2XPDA 3R2QA 4BL7B 2H1BA 2YCDA 3ED3A 3G7IA 1YKCA 1K0CA 1Z6NA 5D9VA 4NV5A 1AC1A 4EXJA 2FCHA 4G0LA 4EIQA 5B8BA 2H0GA 1B48A 3TRPA 2KP2A 3ZYWA 2XBIA 4NV2A 1QGVA 1FB6A 1T8EB 2LKUA 1SK1A 2WS2A 2GZZA 1U3IA 1X5CA 1TK5B 2NBSA 3O3TA 1NW2A 2ON5A 1ZYEA 1M7TA 1YZXA 2LEGA 2ON7A 4N30A 3C1SA 1LJRA 1GNEA 2GSSA 3QPMA 1QXHA 3CSHA 4I2UA 1CQGA 4PURA 2PVQA 3CTGA 1G7OA 1OC9B 5J9CA 3I69A 5ECOB 2YWIA 4FH8A 3KMOA 3F63A 2C0FA 2LS5A 2VIMA 3CMIA 3QMXA 1AQXA 2DJ0A 2WDUA 4GWRA 1GSQA 1ACVA 1PRXA 1XWAA 2H74A 4KCAA 4I97A 3UARA 3ME8A 2PBJA 4NWYA 1O73A 3UBKA 3C7MA 2A2RA 4Q5NA 4PTSA 4PQIA 1G0TA 2IMFA 1OC8A 3FZ4A 3FZ5A 4YQMA 2MBSA 3TKPA 1ABAA 3TKSE 3EMPA 2RIIA 2WFCA 3IDVA 1PL1A 1Z3EA 8GSSA 2IL3A 5KN1A 3IR4A 4IBPA 3HKRA 4IHUA 3APOA 5KEJA 2BMXA 5JCGA 1B9XC 1U87A 2IIYA 5A4VA 3HJOA 1XCCA 5CNWA 6GSVA 1HD2A 5H5RA 2AUVA 4F03A 5ECIB 1O7UA 4FQUA 3DXBA 1TI1A 2F8AA 5AIVA 2HT9A 3BJ5A 5IO2A 2H1AA 2H1DA 5ENUA 5HFKA 5JCWA 4X1UA 5D96A 1V58A 2I1UA 3W8SA 5FWGA 2QC7A 3ZMLA 4WF5A 2DKHA 4HUAA 5A4UA 2E2MA 6GSUA 2WJUA 1GTAA 5BRTA 5DQYA 5IPGA 5JWQB 1GSDA 4OMVA 2YJHA 3ZMKA 1PD21 4FYUA 2IMIA 2VL9A 4IELA 3LYPA 2LQQA 3PPUA 5IMFA 4JBBA 3FY7A 4GTUA 2FA4A 2H01A 2PVOC 3HCZA 2H6YA 2MMZA 3M8NA 4PXOA 2N5FA 3N9JA 1N8JA 5F05A 4IGJA 4MH3A 4DSSB 5B8AA 3IPZA 1Z5YE 4G0IA 3O6TA 4KW6A 4HJ2A 3GTUB 1K0DA 2B7JA 1MD4A 1PKWA 5DBQA 1MDJA 2YANA 1MEKA 1GTUA 3QAVA 1X9MB 4IW9A 4CY6A 5AIXA 3RBTA 2E0QA 4MZBA 5IM9A 1PGTA 4YAVA 5KOWA 3D4MA 4IQ1A 4RQRA 2RUFA 3H93A 3KZQA 2LRCA 3F6FA 4NMUA 2R0CA 4MABA 4KH7A 2FD3A 2MZCA 3KM6A 3L9SA 3RPNA 1T1VA 3GURA 3QOUA 1OYJA 3UIWA 1WJKA 4J56E 4D73A 5GSTA 1W89A 2I9HA 1GH2A 1HNAA 1XFLA 4YKFA 3DVXA 5IMVA 4HZ2A 5AISA 5GZZB 1BAYA 1X5DA 2V6OA 3IBHA 1WP0A 4PNFA 2P0GA 4MK3A 1TK0B 1H75A 4KSOA 3ISOA 3WYWA 1GLQA 2AV4A 2CAQA 2Z9SA 3A2WA 1YQ1A 3FR3A 5DJMA 3HJPA 1TW9A 2O8VB 3LXTA 2LJAA 2O7KA 1NHYA 2RUEA 1SJZA 4K6XA 3I6AA 3IK7A 5ECNB 3L9VA 2L5OA 4TN8A 5CRGA 3E3EA 2CV4A 1GSYA 5EVOA 1C72A 3EU4A 2A2SA 3TDGA 1MTCA 12GSA 2N5AA 5J4UA 4PQHA 1NHOA 3NIVA 3EURA 2HSMA 2DIZA 4GF0A 4JEDA 4WF4A 4TXOA 2AB6A 4BWSA 2H66A 1WE0A 4F0BA 4GCIA 1AQVA 3M9JA 3FK8A 4MJCA 2ZUPA 2TRCP 1G6WA 2PU9C 2VCXA 3N5OA 4KNDA 3HZ8A 5D9XA 1BYEA 1O85A 4MP4A 3V1WA 3D21A 4V1Ap 2H8LA 4OFTA 7GSSA 4WR5A 4WXTA 3KXOA 1TKDB 4ECCA 4WBRD 3QFBC 4MA9A 4YQUA 3H79A 4NHZA 1T00A 1ZCPA 2VLTA 5J5NA 3EU3A 2L57A 4ZB6A 3CXGA 2H6ZA 3KP8A 4WR4A 5IPHA 1Y6EA 1ZYQB 1EP8A 1Z6MA 3GSSA 2FA8A 4K8MA 1OC3A 3RDWA 4V2LA 2NTOA 1GTBA 1TU8A 5HFIA 2HZFA 1F37A 3TKRA 4XTSA 4I2TA 3QAWA 4KCEA 4OFNA 1Q98A 4F0CA 1EEMA 1SD9A 3QAGA 3HDCA 3G9BA 4E8EA 2YZUA 19GSA 2PGTA 3W6GA 2EIOA 3A5WA 4TXOB 1X5EA 1Z9HA 1S3AA 3LJRA 5G31A 2DC5A 2H30A 3VLNA 1CQHA 1XOBA 1WOUA 4LL4B 1WPIA 3M0FA 4IN0A 18GSA 3ZZXA 1XOAA 5HR0A 5A4WA 3TKSA 1XVWA 1EV4A 3D5JA 2IFQA 4IJ3A 4Q5FA 2FWEA 4K5RA 2FHEA 3D0ZA 1THOA 2DMLA 3GH9A 4BL7A 5INYA 4HDEA 3IA1A 4MNNA 3C73A 10GSA 4WKWA 1R26A 1QFNA 3FMWA 4K0GA 1K0MA 4PQ1A 5ECSA 1VRSD 1A2LA 4K5SA 4V1Ag 3QFAC 3FYGA 1AUCA 2M72A 4YAPA 2GSTA 2V1MA 2L5LA 3AY8A 3TJJA 3TOUA 1V98A 1M2DA 2OA7A 1KBNA 2H19A 3ZVJA 4EUYA 5C00A 3GUSA 1OC9A 3APQA 4WETA 2L59A 3KTLA 3FHKA 3VI7A 2EIRA 1EOHA 4IP6A 5JCUA 2YP6A 4JE1A 1BX9A 2F9SA 2VLUA 2DMMA 2DSAA 1PKZA 3FZ9A 2VUPA 1Q4JA 1SL1B 4PUFC 5JWRB 5B7CA 2PERA 5ID2B 1M2BA 4HS1A 3TGZA 3Q18A 1XWBA 2WB9A 3U5RE 5ECRB 3QD9A 2YNXA 1LBKA 4K7IA 2VM1A 16GSA 3PINA 1GRXA 1PMTA 3A2VA 2GLRA 1JLWA 5DAKB 4Q5QA 3BCKA 4MCUA 1X9WB 2ZNMA 4ULXA 1AAZA 4Z2TA 5HFGA 1UA5A 4TR1B 4GXZA 2VCVA 3KMNA 4DVCA 5A5KA 4FYCA 1THXA 5F06A 4X43A 1FAAA 1I5GA 4N10A 3KEBA 4POLA 1A8YA 1FOVA 1ERTA 3P7XA 5HR2A 5KN2A 4L0UA 3L4NA 3LW9A 2JU5A 3IAS2 2OE1A 2AJQB 3PH9A 4Z7XA 3APSA 4JZQA 1V40A 2C8UA 4I6XA 1VF3A 3P90A 3F3RA 3O76A 9GSSA 3ZVJD 4ZL8A 1OE8A 4USSA 3NZNA 5E4WA 1A0RP 2CA8A 1KTEA 4MZWA 3EC3A 2VL2A 3GX8A 5IMAA 3IE3A 1T4ZA 4GSNA 4ZILA 4KF9A 1LU4A 4EDYA 1GSSA 3UJ1A 1E2YA 4HJMA 1ERUA 3M9KA 3BCIA 3LORA 2WRTA 2K9FA 3US3A 3H8QA 2HRFA 2QA1A 1XW6A 2V6KA 2XPEA 1ZYNA 1M9BA 2ZCTA 4XRAA 4DSSA 5HQPA 2GTUA 1TRSA 4OCFA 3IC4A 1XW9A 3F9UA 3EYTA 2LNTA 3GTUA 3LYKA 2BTOT 2FWGA 2CX3A 5CYYA 4IKHA 5IOWA 1HYUA 1M9AA 4HI7A 3M3MA 5IMZA 1QQ2A 5CAXA 1G6YA 1B4QA 5DVBA 4EDZA 2YZHA 3FZAA 1IYIA 4DEJA 2R4VA 1YKAA 5BMUA 2H72A 4N0VA 5IMCA 1A0FA 1K3OA 4EVMA 4NXIA 1BQ7A 5E59A 2KP1A 3GSTA 1OVNA 2MBTA 3DRNA 2YV9A 5DQSA 4KX4A 4BA7A 2M80A 2GZPA 4EO3A 2DJKA 3TRXA 2X64A 4FIWA 3TJKA 4IP1A 3JCML 1VF4A 3P2AA 4YH2A 2FLSA 2A4HA 1M2AA 4ZBBA 11GSA 3DMLA 3EINA 2X8CA 2CT6A 1ERWA 2R6KA 3A2XA 2HSHA 5H5QA 1FHEA 2LV3A 2R37A 3UMAA 3F0IA 2YWNA 4QL7A 3TB2A 3DWVA 2C80A 4LMVA 2L6CA 2XHFA 2H76A 4ECBA 3E0UA 3GKMA 4J57E 3EE2A 1BJXA 4EC0A 1SKRB 2L4QA 4L0WA 4HEA2 1TRWA 5LD0A 3VWVA 3TCOA 3CBUA 4OD7A 4O32A 1TRUA 1J0FA 5F8BA 1X9SB 5D8IA 1A8LA 2V41A 1F3BA 1TU7A 4ILFA 3C71A 2DJ1A 4MDCA 1J08A 1EGRA 1QK8A 4I8BA 3CRUA 2MMAA 3F4TA 2FNOA 2H0IA 3G7JA 3KH7A 6GSSA 1GULA 3KCMA 4GQFA 4OCEA 5D73A 4DSRA 5ELGA 4G2EA 4KA0A 4E8HA 4MH2A 2TRXA 1BG5A 1GWCA 2B7KA 1K0OA 2GQKA 4POKA 2LUSA 2PUKC 2FWHA 2HYXA 4KSMA 4MF6A 1NSWA 3GV1A 2LRNA 2EIQA 5J9BA 1O6JA 1B4PA 1SU9A 3VFIA 4G0KA 2R0PA 2REMA 2UZ8A 3GFKA 2LNSA 2RLIA 5GSSA 1R7HA 1ZMAA 2CX4A 2HZEB 4WEYA 1O8WA 2K18A 2H6XA 4K0NA 2FY6A 1RW1A 2YWMA 5D9WA 4XS6A 4MMMA 13GSA 3GKKA 3WGEA 2OJLA 4CY8A 4F9ZA 1XZOA 1SD8A 3HYPA 3ZL5A 4K2DA 4FO5A 1DUGA 4NPBA 3CTFA 3ZITA 2IJYA 1XPVA 2X8HA 4BVYB 5B6MA 2IWTA 4G10A 1HNBA 2H1GA 3ERGA 4X0XA 2H75A 1VF1A 1SL0B 5DALB 3MSZA 4HQZA 3WT1A 1K3YA 1SK2A 1N2AA 2MMOA 1EZKA 2DIYA 2LSTA 2B5XA 2B1KA 3GA4A 1R5PA 5HR3A 1SJIA 1AXDA 2LTKA 4MJAA 4AF2A 2I3YA 5ECHB 5FHIA 3GKXA 2X49A 2CVKA 1O8XA 3EPTA 4EE0A 3F3QA 3PR8A 4BVXB 4PGTA 4ZB9A 2LJRA 5DCHA 5IOXA 2GT5A 1EOGA 3GL3A 2AHEA 4ZBDA 3MNGA 2HRKA 1O81A 3HA9A 4Q5RA 4F2IA 2P31A 1I9DA 2B5EA 4MF5A 4MPGA 3A5IA 2CQ9A 3LWAA 3DD3A 2B1LA 2IMKA 3TKQA 3IHQA 3TUEA 1G7EA 14GSA 5G1LA 2QA2A 3WGDA 4EL1A 2I4AA 1USBA 1FW1A 4GLTA 5JWOB 4JRRA 3QDNA 1XWKA 4K7OA 5DCGA 3GHAA 2HE3A 3Q74A 2G2QA 2H0HA 3VPTA 2MMNA 3FEUA 2F3MA 3RHBA 3TJGA 1QMVA 1JZOA 1FG4A 1TJDA 2AYTA 4MPFA 2JZRA 1K3LA 2XBQA 4JR4A 4GQCA 1PX6A 4BWQA 3U6VA 4OWYA 3S9FA 1UVZA 2VLVA 1KEBA 1JHBA 5DJLA 5ID2A 3WT2A 1GL8A 1TTZA 3FR6A 1RK4A 2DJ3A 1TK8B 4GSTA 1V9WA 3TJBA 6GSTA 2VCQA 4Z2RA 3ZIVA 2OBIA 2O87A 4KDUA 5DAKA 3LXZA 2KUCA 2YOIA 2NDOA 4XS1A 5IIZA 1Z7RA 4TR1A 2BJXA 3DVWA 1HNCA 1YDKA 4JR6A 4J2FA 4KUNA 5J41A 3F4SA 3GMFA 1VGLA 5ABRA 1ML6A 2DKIA 1W4VA 2X99A 4ACSA 3GN3A 3IXRA 1Y25A 3ZRDA 3ZLPA 4DSQA 2HRAA 3IV4A 1ON4A 2D2ZA 22GSA 2QKEA 2ES7A 5HR1A 3EWLA 4TRXA 1GUMA 1T4YA 1JFUA 4A5PA 4ECJA 2M46A 1EGOA 1YJ6A 1YEPA 4XS4A 1K0AA 2WULA 3CSJA 3H1NA 3ZREA 4K2XA 20GSA 5ECLB 3HVXA 5F07A 1MDKA 2R0GA 1AQWA 4GSSA 1SYRA 2B6MA 4YKGA 5ELAA 1SJ6A 3QCPA 4CDOA 1OAZA 2A4VA 3DIEA 3CRTA 5H5SA 4QQ7A 4V2MA 1DE1A 3UOMA 2GVPA 4XRDA 4RI6A 1JZDA 2VCWA 4ML6A 3IAM2 3RHCA 5ECMB 1YY7A 4IJIA 1AIUA 6GSWA 3TOTA 3FR9A 3HD5A 1TOFA 1KNGA 4XCSA 1GSFA 4JU5A 3LG6A 4Z2UA 5CRDA 1PQNA 5AGYA 2C1YA 4O5RA 3HZ4A 2JACA 4WBJA 1SL2B 1ZZYA 1BEDA 3P8WA 4EF0A 3H4KA 1AW9A 3E9JB 3KGKA 4POMA 1X0RA 2E2GA 4OO4A 2G0FA 3HXSA 4AJ8A 3CSIA 4LLRA 3UAPA 2L4CA 2JZTA 3VWUA 3ME7A 5G2ZA 2XC2A 1F3AA 3MYDA 4MF7A 1EP7A 1NM3A 4PNGA 3MWHA 4XS4B 2F51A 2TIRA 3M1GA 1U6TA 4ZL9A 1GNWA 4P3YB 2MYGA 3MDKA 1PN0A 4X4JA 2C4JA 1ZOFA 3L0HA 2NVLA 4OFMA 4K9ZA 2QSIA 5IO0A 4ISDA 4EIPA 5LNKe 3LQ7A 5ECKB 3NOFA 5EPFA 2RM6A 4POBA 3J7Yk 4KDXA 3HHVA 5CREA 3TJFA 3ZFLA 1S3DA 1SKWB 4O7HA 4ICYA 1PL2A 5L71A 4F82A 2VM2A 1HQOA 5D93A 1FO5A 3VWXA 2GSQA 3EMXA 3SBCA 4RI7A 1XBSA 4TKYA 2B3SA 4QL9A 1A23A 2QGVA 2R5GA 2VCTA 3IK9A 3OR5A 1A2JA 4MLYA 1GUKA 2K8VA 2A2PA 3UBLA 3IHGA 4N0ZA 4AJ7A 2FGXA 4NHWA 4L8EA 1H4OA 2KHPA 2GGTA 4G19A 1XXUA 2HFDA 3Q19A 1ZYPA 1F9MA 3GH6A 2E7PA 1PN9A 4YQVA 3FW2A 1EEJA 2DLXA 2I81A 1MDIA 1DBYA 1FVJA 2C0DA 4ZL7A 2PPTA 1F2EA 2V2GA 1GSUA 5G5FA 5AN1A 3TKSC 2L6DA 4CW9A 2HZEA 1IYHA 2OACA 4TOPA 3DYRA 4MJBA 5KOXA 1A24A 1OKDA 5J3RA 17GSA 3HJMA 2O89A 4ECIA 4LA1A 3DKSA 1XWGA 2ALBA 5G30A 2FUG2 5B6NA 4IQAA 5C04A 2GZYA 4BVYA 3QR6A 5DDLA 2OADA 1DE2A 3KTBA 1FVKA 2YN1A 3GL5A 4BPYA 1V57A 2IMEA 1JZWA 3LFLA 2GQMA 1TI3A 5DALA 2P5QA 3F8UA 3DGQA 2HRNA 3C1RA 3ZIJA 4CHSA 2PWJA 2C0EA 2WGRA 4TR4A 1A2MA 4MZCA 1QUWA 4I5QA 2GS3A 3SWLA 1JLVA 1E6BA 5CRHA 2R2JA 4AGSA 3DEXA 2AAWA 2R3XA 1MD3A 1GSEA 1EV9A 2KOKA 1WIKA 3IOSA 1TDIA 2CVBA 2F8FA 3LGCA 4BVXA 4ZBAA 3VWWA 4KDYA 1WWJA 2J9HA 1ZL9A 2V32A 4IVFA 4TR3A 1OE7A 2VAFA 2H70A 3IRAA 4HZ4A 3VURA 1F6MC 3ZTLA 5ECQB 1GLPA 2LRTA 1PSQA 1EWXA 4XHMA 2VD1A 4PUAA 1UN2A 3VPQA 5CRWA 3ERFA 3MAKA 2HNLA 3IC8A 4ZB8A 4RQXA 1GTIA 2J23A 3F4RA 1GUHA 4TXVA 3UVHA 3MIXA 4IS0A 4KE3A 3WD6A 3RAZA 1VF2A 1YEXA 1T3BA 5EY6A 1Z7PA 3HVVA 3R3EA 2JADA 3VK9A 1XVQA 2WCIA 1RQMA 2PN8A 3HVSA 1SYXA 4ID0A 1V2AA 2CZ3A 2C3TA 5KN0A 2C0GA 2DJ2A 1ERVA 2K8SA 1YF0A 4K7NA 2KLXA 2OKAA 5IQYA 4L5OA 1XW5A 4KB3A 3C8EA 4TR0A 2OE0A 6GSXA 2H73A 3KIJA 1K0BA 2VL2C 1XIYA 3GYKA 4FYBA 4EKZA 2HLSA 4D73B 2X8GA 2JZSA 3EVIA 1PX7A 1K0NA 1XWCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DJJ A;  3L9U A;  2NPB A;  5LCZ A;  1TP9 A;  4H86 A;  5KN3 A;  2RM5 A;  3ZFB A;  3A3T A;  2GT6 A;  2H71 A;  3D6I A;  4HU9 A;  5CO3 A;  2P5R A;  5D9T A;  3D4T A;  1SKS B;  3KP9 A;  5ECP B;  6GSY A;  2VD0 A;  2CAI A;  4KGI A;  1UC7 A;  2GQL A;  3WGX A;  3I43 A;  2YWO A;  1ZGN A;  2YJ7 A;  4ZXG A;  2OBK A;  4V2N A;  2JSY A;  4KAE A;  5EL8 A;  1S3C A;  3GRX A;  2DBC A;  4MJE A;  4ZIJ A;  1R4W A;  1FB0 A;  2OE3 A;  3F6D A;  2GSR A;  3GIX A;  1J9B A;  3RPP A;  2IPA A;  4TVE A;  3Q6O A;  2JL4 A;  4HU7 A;  1M99 A;  2YPM A;  2JSZ A;  2LJK A;  5COH A;  5F0G A;  1PA3 A;  4RUV A;  3W8J A;  3K8N A;  4HOJ A;  5CP1 A;  2HXK A;  1ILO A;  4G9H A;  1R5A A;  3D22 A;  2VOC A;  1WMJ A;  2IN3 A;  2YV7 A;  2N5B A;  5G1K A;  1ST9 A;  4L5L A;  1B9Y C;  2B5Y A;  4HQS A;  1GP1 A;  2FWF A;  1OKT A;  2K6V A;  3BOA A;  3HY2 A;  3TRQ A;  4PX1 A;  2C3N A;  5IMD A;  2CVD A;  4TW5 A;  3UEM A;  1WRY A;  3KD0 A;  4AJ6 A;  1URM A;  2CZ2 A;  1JZR A;  2GDR A;  1TXX A;  3KH9 A;  2VCZ A;  2HSY A;  4XIH A;  3BD2 A;  3GKN A;  3KJY A;  3BBY A;  5GAP D;  3L78 A;  3LEF A;  1TRV A;  4O92 A;  3FRC A;  4LMW A;  4N11 A;  2HI7 A;  4NAX A;  1YF1 A;  1M0U A;  2LQO A;  5G5E A;  1U3A A;  2WZ9 A;  3UL3 A;  3VI5 A;  2C3Q A;  4LL1 B;  4OO5 A;  4ML1 A;  4GRF A;  1SK0 A;  2O85 A;  2VO4 A;  3J7Y b;  1B8X A;  3FKF A;  1SEN A;  5FT3 A;  3UVT A;  4K1F A;  3PGT A;  3LSZ A;  2EC4 A;  1DSB A;  1U88 A;  2VL3 A;  3G7Y A;  2IMD A;  3CYN A;  3GNJ A;  3GX0 A;  5GAN D;  3I9V 2;  1T7P B;  2IFQ B;  3ERW A;  2PMT A;  2XPD A;  3R2Q A;  2H1B A;  2YCD A;  3ED3 A;  3G7I A;  1YKC A;  1K0C A;  1Z6N A;  5D9V A;  4NV5 A;  1AC1 A;  4EXJ A;  2FCH A;  5B8B A;  2H0G A;  1B48 A;  3TRP A;  2KP2 A;  3ZYW A;  2XBI A;  4NV2 A;  1QGV A;  1FB6 A;  1T8E B;  2LKU A;  1SK1 A;  2WS2 A;  2GZZ A;  1U3I A;  1X5C A;  1TK5 B;  2NBS A;  3O3T A;  1NW2 A;  2ON5 A;  1ZYE A;  1M7T A;  1YZX A;  2LEG A;  2ON7 A;  4N30 A;  3C1S A;  1LJR A;  1GNE A;  2GSS A;  3QPM A;  1QXH A;  3CSH A;  4I2U A;  1CQG A;  4PUR A;  2PVQ A;  3CTG A;  1G7O A;  1OC9 B;  5J9C A;  3I69 A;  5ECO B;  2YWI A;  4FH8 A;  3KMO A;  3F63 A;  2C0F A;  2LS5 A;  2VIM A;  3CMI A;  3QMX A;  1AQX A;  2DJ0 A;  2WDU A;  4GWR A;  1GSQ A;  1ACV A;  1PRX A;  1XWA A;  2H74 A;  4KCA A;  4I97 A;  3UAR A;  3ME8 A;  2PBJ A;  4NWY A;  1O73 A;  3UBK A;  3C7M A;  2A2R A;  4Q5N A;  4PQI A;  1G0T A;  2IMF A;  1OC8 A;  3FZ4 A;  3FZ5 A;  4YQM A;  2MBS A;  3TKP A;  1ABA A;  3TKS E;  3EMP A;  2RII A;  2WFC A;  3IDV A;  1PL1 A;  1Z3E A;  8GSS A;  2IL3 A;  5KN1 A;  3IR4 A;  4IBP A;  3HKR A;  4IHU A;  3APO A;  5KEJ A;  2BMX A;  5JCG A;  1B9X C;  1U87 A;  2IIY A;  5A4V A;  3HJO A;  1XCC A;  5CNW A;  6GSV A;  1HD2 A;  5H5R A;  2AUV A;  4F03 A;  5ECI B;  1O7U A;  3DXB A;  1TI1 A;  2F8A A;  5AIV A;  2HT9 A;  3BJ5 A;  5IO2 A;  2H1A A;  2H1D A;  5ENU A;  5HFK A;  5JCW A;  4X1U A;  5D96 A;  1V58 A;  2I1U A;  3W8S A;  5FWG A;  2QC7 A;  3ZML A;  4WF5 A;  4HUA A;  5A4U A;  2E2M A;  6GSU A;  2WJU A;  1GTA A;  5DQY A;  5IPG A;  5JWQ B;  1GSD A;  4OMV A;  2YJH A;  3ZMK A;  1PD2 1;  4FYU A;  2IMI A;  2VL9 A;  4IEL A;  3LYP A;  2LQQ A;  5IMF A;  4JBB A;  3FY7 A;  4GTU A;  2FA4 A;  2H01 A;  2PVO C;  3HCZ A;  2H6Y A;  2MMZ A;  3M8N A;  4PXO A;  2N5F A;  3N9J A;  1N8J A;  5F05 A;  4IGJ A;  4MH3 A;  4DSS B;  5B8A A;  3IPZ A;  1Z5Y E;  3O6T A;  4KW6 A;  4HJ2 A;  3GTU B;  1K0D A;  2B7J A;  1MD4 A;  1PKW A;  5DBQ A;  1MDJ A;  2YAN A;  1MEK A;  1GTU A;  3QAV A;  1X9M B;  4IW9 A;  5AIX A;  3RBT A;  2E0Q A;  4MZB A;  5IM9 A;  1PGT A;  4YAV A;  3D4M A;  4IQ1 A;  4RQR A;  2RUF A;  3H93 A;  3KZQ A;  2LRC A;  3F6F A;  4NMU A;  4MAB A;  4KH7 A;  2FD3 A;  2MZC A;  3KM6 A;  3L9S A;  3RPN A;  1T1V A;  3GUR A;  3QOU A;  1OYJ A;  3UIW A;  1WJK A;  4J56 E;  4D73 A;  5GST A;  1W89 A;  2I9H A;  1GH2 A;  1HNA A;  1XFL A;  3DVX A;  5IMV A;  4HZ2 A;  5AIS A;  5GZZ B;  1BAY A;  1X5D A;  2V6O A;  3IBH A;  1WP0 A;  4PNF A;  2P0G A;  4MK3 A;  1TK0 B;  1H75 A;  4KSO A;  3ISO A;  3WYW A;  1GLQ A;  2AV4 A;  2CAQ A;  2Z9S A;  3A2W A;  1YQ1 A;  3FR3 A;  5DJM A;  3HJP A;  1TW9 A;  2O8V B;  3LXT A;  2LJA A;  2O7K A;  1NHY A;  2RUE A;  1SJZ A;  4K6X A;  3I6A A;  3IK7 A;  5ECN B;  3L9V A;  2L5O A;  4TN8 A;  5CRG A;  3E3E A;  2CV4 A;  1GSY A;  5EVO A;  1C72 A;  3EU4 A;  2A2S A;  3TDG A;  1MTC A;  12GS A;  2N5A A;  5J4U A;  4PQH A;  1NHO A;  3NIV A;  3EUR A;  2DIZ A;  4GF0 A;  4JED A;  4WF4 A;  4TXO A;  2AB6 A;  4BWS A;  2H66 A;  1WE0 A;  4F0B A;  4GCI A;  1AQV A;  3M9J A;  3FK8 A;  4MJC A;  2ZUP A;  2TRC P;  1G6W A;  2PU9 C;  2VCX A;  3N5O A;  4KND A;  3HZ8 A;  5D9X A;  1BYE A;  1O85 A;  4MP4 A;  3V1W A;  3D21 A;  4V1A p;  2H8L A;  4OFT A;  7GSS A;  4WR5 A;  4WXT A;  3KXO A;  1TKD B;  4ECC A;  4WBR D;  3QFB C;  4MA9 A;  4YQU A;  3H79 A;  4NHZ A;  1T00 A;  1ZCP A;  2VLT A;  5J5N A;  3EU3 A;  2L57 A;  4ZB6 A;  3CXG A;  2H6Z A;  3KP8 A;  4WR4 A;  5IPH A;  1Y6E A;  1ZYQ B;  1EP8 A;  1Z6M A;  3GSS A;  2FA8 A;  4K8M A;  1OC3 A;  3RDW A;  4V2L A;  2NTO A;  1GTB A;  1TU8 A;  5HFI A;  2HZF A;  1F37 A;  3TKR A;  4XTS A;  4I2T A;  3QAW A;  4KCE A;  4OFN A;  1Q98 A;  4F0C A;  1EEM A;  1SD9 A;  3QAG A;  3HDC A;  3G9B A;  4E8E A;  2YZU A;  19GS A;  2PGT A;  3W6G A;  2EIO A;  3A5W A;  4TXO B;  1X5E A;  1Z9H A;  1S3A A;  3LJR A;  5G31 A;  2DC5 A;  2H30 A;  3VLN A;  1CQH A;  1XOB A;  1WOU A;  4LL4 B;  1WPI A;  3M0F A;  4IN0 A;  18GS A;  3ZZX A;  1XOA A;  5HR0 A;  5A4W A;  3TKS A;  1XVW A;  1EV4 A;  3D5J A;  2IFQ A;  4IJ3 A;  4Q5F A;  2FWE A;  2FHE A;  3D0Z A;  1THO A;  2DML A;  3GH9 A;  4BL7 A;  5INY A;  4HDE A;  3IA1 A;  3C73 A;  10GS A;  4WKW A;  1R26 A;  1QFN A;  4K0G A;  1K0M A;  4PQ1 A;  5ECS A;  1VRS D;  1A2L A;  4V1A g;  3QFA C;  3FYG A;  1AUC A;  2M72 A;  4YAP A;  2GST A;  2V1M A;  2L5L A;  3AY8 A;  3TJJ A;  3TOU A;  1V98 A;  1M2D A;  2OA7 A;  1KBN A;  2H19 A;  3ZVJ A;  4EUY A;  5C00 A;  3GUS A;  1OC9 A;  3APQ A;  4WET A;  2L59 A;  3KTL A;  3FHK A;  3VI7 A;  2EIR A;  1EOH A;  4IP6 A;  5JCU A;  2YP6 A;  4JE1 A;  1BX9 A;  2F9S A;  2VLU A;  2DMM A;  2DSA A;  1PKZ A;  3FZ9 A;  2VUP A;  1Q4J A;  1SL1 B;  4PUF C;  5JWR B;  5B7C A;  2PER A;  5ID2 B;  1M2B A;  4HS1 A;  3TGZ A;  3Q18 A;  1XWB A;  2WB9 A;  3U5R E;  5ECR B;  3QD9 A;  2YNX A;  1LBK A;  4K7I A;  2VM1 A;  16GS A;  3PIN A;  1GRX A;  1PMT A;  3A2V A;  2GLR A;  1JLW A;  5DAK B;  4Q5Q A;  3BCK A;  4MCU A;  1X9W B;  2ZNM A;  4ULX A;  1AAZ A;  5HFG A;  1UA5 A;  4TR1 B;  4GXZ A;  2VCV A;  3KMN A;  4DVC A;  5A5K A;  4FYC A;  1THX A;  5F06 A;  4X43 A;  1FAA A;  1I5G A;  4N10 A;  3KEB A;  4POL A;  1A8Y A;  1FOV A;  1ERT A;  3P7X A;  5HR2 A;  5KN2 A;  4L0U A;  3L4N A;  2JU5 A;  3IAS 2;  2OE1 A;  2AJQ B;  3PH9 A;  4Z7X A;  3APS A;  4JZQ A;  1V40 A;  2C8U A;  4I6X A;  1VF3 A;  3P90 A;  3F3R A;  3O76 A;  9GSS A;  3ZVJ D;  4ZL8 A;  1OE8 A;  3NZN A;  5E4W A;  1A0R P;  2CA8 A;  1KTE A;  4MZW A;  3EC3 A;  2VL2 A;  3GX8 A;  5IMA A;  3IE3 A;  1T4Z A;  4GSN A;  4ZIL A;  1LU4 A;  4EDY A;  1GSS A;  3UJ1 A;  1E2Y A;  4HJM A;  1ERU A;  3M9K A;  3BCI A;  3LOR A;  2WRT A;  2K9F A;  3US3 A;  3H8Q A;  2HRF A;  1XW6 A;  2V6K A;  2XPE A;  1M9B A;  2ZCT A;  4XRA A;  4DSS A;  5HQP A;  2GTU A;  1TRS A;  4OCF A;  3IC4 A;  1XW9 A;  3F9U A;  3EYT A;  2LNT A;  3GTU A;  3LYK A;  2BTO T;  2FWG A;  2CX3 A;  5CYY A;  4IKH A;  5IOW A;  1HYU A;  1M9A A;  4HI7 A;  3M3M A;  5IMZ A;  1QQ2 A;  5CAX A;  1G6Y A;  1B4Q A;  5DVB A;  4EDZ A;  2YZH A;  3FZA A;  1IYI A;  4DEJ A;  2R4V A;  1YKA A;  2H72 A;  4N0V A;  5IMC A;  1A0F A;  1K3O A;  4EVM A;  4NXI A;  1BQ7 A;  5E59 A;  2KP1 A;  3GST A;  1OVN A;  2MBT A;  3DRN A;  2YV9 A;  5DQS A;  4KX4 A;  4BA7 A;  2M80 A;  2GZP A;  4EO3 A;  2DJK A;  3TRX A;  2X64 A;  4FIW A;  3TJK A;  4IP1 A;  3JCM L;  1VF4 A;  3P2A A;  4YH2 A;  2FLS A;  1M2A A;  4ZBB A;  11GS A;  3DML A;  3EIN A;  2X8C A;  2CT6 A;  1ERW A;  2R6K A;  3A2X A;  2HSH A;  5H5Q A;  1FHE A;  2LV3 A;  2R37 A;  3UMA A;  3F0I A;  2YWN A;  4QL7 A;  3TB2 A;  3DWV A;  2C80 A;  4LMV A;  2L6C A;  2XHF A;  2H76 A;  4ECB A;  3E0U A;  3GKM A;  4J57 E;  3EE2 A;  1BJX A;  4EC0 A;  1SKR B;  2L4Q A;  4L0W A;  4HEA 2;  1TRW A;  5LD0 A;  3VWV A;  3TCO A;  3CBU A;  4OD7 A;  4O32 A;  1TRU A;  1J0F A;  5F8B A;  1X9S B;  5D8I A;  1A8L A;  2V41 A;  1F3B A;  1TU7 A;  4ILF A;  3C71 A;  2DJ1 A;  4MDC A;  1J08 A;  1EGR A;  1QK8 A;  4I8B A;  3CRU A;  2MMA A;  3F4T A;  2FNO A;  2H0I A;  3G7J A;  3KH7 A;  6GSS A;  1GUL A;  3KCM A;  4GQF A;  4OCE A;  5D73 A;  4DSR A;  5ELG A;  4G2E A;  4KA0 A;  4E8H A;  4MH2 A;  2TRX A;  1BG5 A;  1GWC A;  2B7K A;  1K0O A;  2GQK A;  4POK A;  2LUS A;  2PUK C;  2FWH A;  2HYX A;  4KSM A;  4MF6 A;  1NSW A;  3GV1 A;  2LRN A;  2EIQ A;  5J9B A;  1O6J A;  1B4P A;  1SU9 A;  3VFI A;  2REM A;  3GFK A;  2LNS A;  2RLI A;  5GSS A;  1R7H A;  1ZMA A;  2CX4 A;  2HZE B;  4WEY A;  1O8W A;  2K18 A;  2H6X A;  4K0N A;  2FY6 A;  1RW1 A;  2YWM A;  5D9W A;  4XS6 A;  4MMM A;  13GS A;  3GKK A;  3WGE A;  2OJL A;  4F9Z A;  1XZO A;  1SD8 A;  3HYP A;  3ZL5 A;  4K2D A;  4FO5 A;  1DUG A;  4NPB A;  3CTF A;  3ZIT A;  2IJY A;  1XPV A;  2X8H A;  5B6M A;  2IWT A;  4G10 A;  1HNB A;  2H1G A;  3ERG A;  4X0X A;  2H75 A;  1VF1 A;  1SL0 B;  5DAL B;  3MSZ A;  4HQZ A;  3WT1 A;  1K3Y A;  1SK2 A;  1N2A A;  2MMO A;  1EZK A;  2DIY A;  2LST A;  2B5X A;  2B1K A;  3GA4 A;  1R5P A;  5HR3 A;  1SJI A;  1AXD A;  2LTK A;  4MJA A;  4AF2 A;  2I3Y A;  5ECH B;  5FHI A;  3GKX A;  2CVK A;  1O8X A;  4EE0 A;  3F3Q A;  3PR8 A;  4PGT A;  4ZB9 A;  2LJR A;  5DCH A;  5IOX A;  2GT5 A;  1EOG A;  3GL3 A;  2AHE A;  4ZBD A;  3MNG A;  1O81 A;  3HA9 A;  4Q5R A;  4F2I A;  2P31 A;  1I9D A;  2B5E A;  4MF5 A;  4MPG A;  2CQ9 A;  3LWA A;  3DD3 A;  2B1L A;  2IMK A;  3TKQ A;  3IHQ A;  3TUE A;  1G7E A;  14GS A;  5G1L A;  3WGD A;  4EL1 A;  2I4A A;  1USB A;  1FW1 A;  4GLT A;  5JWO B;  4JRR A;  3QDN A;  1XWK A;  5DCG A;  4K7O A;  3GHA A;  2HE3 A;  3Q74 A;  2G2Q A;  2H0H A;  3VPT A;  2MMN A;  3FEU A;  2F3M A;  3RHB A;  3TJG A;  1QMV A;  1JZO A;  1FG4 A;  1TJD A;  2AYT A;  4MPF A;  2JZR A;  1K3L A;  2XBQ A;  4JR4 A;  4GQC A;  1PX6 A;  4BWQ A;  3U6V A;  4OWY A;  3S9F A;  1UVZ A;  2VLV A;  1KEB A;  1JHB A;  5DJL A;  5ID2 A;  3WT2 A;  1GL8 A;  1TTZ A;  3FR6 A;  1RK4 A;  2DJ3 A;  1TK8 B;  4GST A;  1V9W A;  3TJB A;  6GST A;  2VCQ A;  3ZIV A;  2OBI A;  2O87 A;  4KDU A;  5DAK A;  3LXZ A;  2KUC A;  2YOI A;  2NDO A;  4XS1 A;  5IIZ A;  1Z7R A;  4TR1 A;  2BJX A;  3DVW A;  1HNC A;  1YDK A;  4JR6 A;  4J2F A;  4KUN A;  5J41 A;  3F4S A;  3GMF A;  1VGL A;  5ABR A;  1ML6 A;  1W4V A;  2X99 A;  4ACS A;  3GN3 A;  3IXR A;  1Y25 A;  3ZRD A;  3ZLP A;  4DSQ A;  3IV4 A;  1ON4 A;  2D2Z A;  22GS A;  2QKE A;  2ES7 A;  5HR1 A;  3EWL A;  4TRX A;  1GUM A;  1T4Y A;  1JFU A;  4ECJ A;  2M46 A;  1EGO A;  1YJ6 A;  1YEP A;  4XS4 A;  1K0A A;  2WUL A;  3CSJ A;  3H1N A;  3ZRE A;  20GS A;  5ECL B;  3HVX A;  5F07 A;  1MDK A;  1AQW A;  4GSS A;  1SYR A;  2B6M A;  5ELA A;  1SJ6 A;  3QCP A;  4CDO A;  1OAZ A;  2A4V A;  3DIE A;  3CRT A;  5H5S A;  4QQ7 A;  4V2M A;  1DE1 A;  3UOM A;  2GVP A;  4XRD A;  4RI6 A;  1JZD A;  2VCW A;  4ML6 A;  3IAM 2;  3RHC A;  5ECM B;  1YY7 A;  4IJI A;  1AIU A;  6GSW A;  3TOT A;  3FR9 A;  3HD5 A;  1TOF A;  1KNG A;  4XCS A;  1GSF A;  4JU5 A;  3LG6 A;  5CRD A;  1PQN A;  5AGY A;  2C1Y A;  4O5R A;  3HZ4 A;  2JAC A;  4WBJ A;  1SL2 B;  1ZZY A;  1BED A;  3P8W A;  4EF0 A;  3H4K A;  1AW9 A;  3E9J B;  3KGK A;  4POM A;  1X0R A;  2E2G A;  4OO4 A;  2G0F A;  3HXS A;  4AJ8 A;  3CSI A;  4LLR A;  3UAP A;  2L4C A;  2JZT A;  3VWU A;  3ME7 A;  5G2Z A;  2XC2 A;  1F3A A;  4MF7 A;  1EP7 A;  1NM3 A;  4PNG A;  3MWH A;  4XS4 B;  2F51 A;  2TIR A;  3M1G A;  1U6T A;  4ZL9 A;  1GNW A;  4P3Y B;  2MYG A;  3MDK A;  2C4J A;  1ZOF A;  3L0H A;  2NVL A;  4OFM A;  4K9Z A;  2QSI A;  5IO0 A;  4ISD A;  5LNK e;  3LQ7 A;  5ECK B;  3NOF A;  5EPF A;  2RM6 A;  4POB A;  3J7Y k;  4KDX A;  3HHV A;  5CRE A;  3TJF A;  3ZFL A;  1S3D A;  1SKW B;  4O7H A;  1PL2 A;  5L71 A;  4F82 A;  2VM2 A;  1HQO A;  5D93 A;  1FO5 A;  3VWX A;  2GSQ A;  3EMX A;  3SBC A;  4RI7 A;  1XBS A;  4TKY A;  2B3S A;  4QL9 A;  1A23 A;  2QGV A;  2R5G A;  2VCT A;  3IK9 A;  3OR5 A;  1A2J A;  4MLY A;  1GUK A;  2K8V A;  3UBL A;  4N0Z A;  4AJ7 A;  2FGX A;  4NHW A;  4L8E A;  1H4O A;  2KHP A;  2GGT A;  4G19 A;  1XXU A;  2HFD A;  3Q19 A;  1F9M A;  3GH6 A;  2E7P A;  1PN9 A;  4YQV A;  3FW2 A;  1EEJ A;  2DLX A;  2I81 A;  1MDI A;  1DBY A;  1FVJ A;  2C0D A;  4ZL7 A;  2PPT A;  1F2E A;  2V2G A;  1GSU A;  5G5F A;  5AN1 A;  3TKS C;  2L6D A;  4CW9 A;  2HZE A;  1IYH A;  2OAC A;  4TOP A;  3DYR A;  4MJB A;  1A24 A;  1OKD A;  5J3R A;  17GS A;  3HJM A;  2O89 A;  4ECI A;  4LA1 A;  3DKS A;  1XWG A;  2ALB A;  5G30 A;  2FUG 2;  5B6N A;  4IQA A;  5C04 A;  2GZY A;  4BVY A;  3QR6 A;  5DDL A;  2OAD A;  1DE2 A;  3KTB A;  1FVK A;  2YN1 A;  3GL5 A;  4BPY A;  1V57 A;  2IME A;  1JZW A;  3LFL A;  2GQM A;  1TI3 A;  5DAL A;  2P5Q A;  3F8U A;  3DGQ A;  2HRN A;  3C1R A;  3ZIJ A;  4CHS A;  2PWJ A;  2C0E A;  2WGR A;  4TR4 A;  1A2M A;  4MZC A;  1QUW A;  4I5Q A;  2GS3 A;  3SWL A;  1JLV A;  1E6B A;  5CRH A;  2R2J A;  4AGS A;  3DEX A;  2AAW A;  2R3X A;  1MD3 A;  1GSE A;  1EV9 A;  2KOK A;  1WIK A;  3IOS A;  1TDI A;  2CVB A;  2F8F A;  3LGC A;  4BVX A;  4ZBA A;  3VWW A;  4KDY A;  1WWJ A;  2J9H A;  1ZL9 A;  2V32 A;  4IVF A;  4TR3 A;  1OE7 A;  2VAF A;  2H70 A;  3IRA A;  4HZ4 A;  3VUR A;  1F6M C;  3ZTL A;  5ECQ B;  1GLP A;  2LRT A;  1PSQ A;  1EWX A;  4XHM A;  2VD1 A;  4PUA A;  1UN2 A;  3VPQ A;  5CRW A;  3ERF A;  3MAK A;  2HNL A;  4ZB8 A;  4RQX A;  1GTI A;  2J23 A;  3F4R A;  1GUH A;  4TXV A;  3UVH A;  4IS0 A;  4KE3 A;  3WD6 A;  3RAZ A;  1VF2 A;  1YEX A;  1T3B A;  5EY6 A;  1Z7P A;  3HVV A;  2JAD A;  3VK9 A;  1XVQ A;  2WCI A;  1RQM A;  2PN8 A;  3HVS A;  1SYX A;  4ID0 A;  1V2A A;  2CZ3 A;  2C3T A;  5KN0 A;  2C0G A;  2DJ2 A;  1ERV A;  2K8S A;  1YF0 A;  4K7N A;  2KLX A;  2OKA A;  5IQY A;  4L5O A;  1XW5 A;  4KB3 A;  3C8E A;  4TR0 A;  2OE0 A;  6GSX A;  2H73 A;  3KIJ A;  1K0B A;  2VL2 C;  1XIY A;  3GYK A;  4FYB A;  4EKZ A;  2HLS A;  4D73 B;  2X8G A;  2JZS A;  3EVI A;  1PX7 A;  1K0N A;  1XWC A; 
#chains in the Genus database with same CATH topology
 2DJJ A;  3L9U A;  2X4A A;  2NPB A;  5LCZ A;  1TP9 A;  4H86 A;  5KN3 A;  2RM5 A;  3ZFB A;  3A3T A;  2GT6 A;  2H71 A;  3D6I A;  4HU9 A;  5CO3 A;  2P5R A;  5D9T A;  3D4T A;  1SKS B;  3KP9 A;  5ECP B;  6GSY A;  2VD0 A;  2CAI A;  4KGI A;  1UC7 A;  2GQL A;  3WGX A;  3I43 A;  2YWO A;  1ZGN A;  4O5U A;  2YJ7 A;  4ZXG A;  2OBK A;  4V2N A;  2JSY A;  4KAE A;  5EL8 A;  1S3C A;  3GRX A;  2DBC A;  4MJE A;  4ZIJ A;  1R4W A;  1FB0 A;  2OE3 A;  3F6D A;  2GSR A;  3GIX A;  1J9B A;  3RPP A;  2IPA A;  4TVE A;  3Q6O A;  2JL4 A;  4HU7 A;  1M99 A;  2YPM A;  2JSZ A;  2LJK A;  5COH A;  5F0G A;  1PA3 A;  4RUV A;  3W8J A;  3K8N A;  4HOJ A;  5CP1 A;  2HXK A;  1ILO A;  4G9H A;  1R5A A;  3D22 A;  2VOC A;  1WMJ A;  2IN3 A;  2YV7 A;  2N5B A;  5G1K A;  1ST9 A;  4L5L A;  1B9Y C;  2B5Y A;  4HQS A;  1GP1 A;  2FWF A;  1OKT A;  2K6V A;  3BOA A;  3HY2 A;  3TRQ A;  4PX1 A;  2C3N A;  5IMD A;  2CVD A;  4TW5 A;  3UEM A;  1WRY A;  3KD0 A;  4O5Q A;  4AJ6 A;  1URM A;  2CZ2 A;  1JZR A;  2GDR A;  1TXX A;  3KH9 A;  2VCZ A;  2HSY A;  4XIH A;  3BD2 A;  3GKN A;  3KJY A;  3BBY A;  5GAP D;  3L78 A;  3LEF A;  1TRV A;  4O92 A;  3FRC A;  4LMW A;  4N11 A;  2HI7 A;  4NAX A;  1YF1 A;  1M0U A;  2LQO A;  5G5E A;  1U3A A;  2WZ9 A;  3UL3 A;  3VI5 A;  2C3Q A;  4LL1 B;  4OO5 A;  4ML1 A;  1FOH A;  4GRF A;  1SK0 A;  2O85 A;  2VO4 A;  3J7Y b;  1B8X A;  3FKF A;  1SEN A;  5FT3 A;  3UVT A;  4K1F A;  3PGT A;  3LSZ A;  2EC4 A;  1DSB A;  1U88 A;  2VL3 A;  3G7Y A;  2IMD A;  3CYN A;  3GNJ A;  3GX0 A;  5GAN D;  3I9V 2;  1T7P B;  2IFQ B;  3ERW A;  2PMT A;  2XPD A;  3R2Q A;  4BL7 B;  2H1B A;  2YCD A;  3ED3 A;  3G7I A;  1YKC A;  1K0C A;  1Z6N A;  5D9V A;  4NV5 A;  1AC1 A;  4EXJ A;  2FCH A;  4G0L A;  4EIQ A;  5B8B A;  2H0G A;  1B48 A;  3TRP A;  2KP2 A;  3ZYW A;  2XBI A;  4NV2 A;  1QGV A;  1FB6 A;  1T8E B;  2LKU A;  1SK1 A;  2WS2 A;  2GZZ A;  1U3I A;  1X5C A;  1TK5 B;  2NBS A;  3O3T A;  1NW2 A;  2ON5 A;  1ZYE A;  1M7T A;  1YZX A;  2LEG A;  2ON7 A;  4N30 A;  3C1S A;  1LJR A;  1GNE A;  2GSS A;  3QPM A;  1QXH A;  3CSH A;  4I2U A;  1CQG A;  4PUR A;  2PVQ A;  3CTG A;  1G7O A;  1OC9 B;  5J9C A;  3I69 A;  5ECO B;  2YWI A;  4FH8 A;  3KMO A;  3F63 A;  2C0F A;  2LS5 A;  2VIM A;  3CMI A;  3QMX A;  1AQX A;  2DJ0 A;  2WDU A;  4GWR A;  1GSQ A;  1ACV A;  1PRX A;  1XWA A;  2H74 A;  4KCA A;  4I97 A;  3UAR A;  3ME8 A;  2PBJ A;  4NWY A;  1O73 A;  3UBK A;  3C7M A;  2A2R A;  4Q5N A;  4PTS A;  4PQI A;  1G0T A;  2IMF A;  1OC8 A;  3FZ4 A;  3FZ5 A;  4YQM A;  2MBS A;  3TKP A;  1ABA A;  3TKS E;  3EMP A;  2RII A;  2WFC A;  3IDV A;  1PL1 A;  1Z3E A;  8GSS A;  2IL3 A;  5KN1 A;  3IR4 A;  4IBP A;  3HKR A;  4IHU A;  3APO A;  5KEJ A;  2BMX A;  5JCG A;  1B9X C;  1U87 A;  2IIY A;  5A4V A;  3HJO A;  1XCC A;  5CNW A;  6GSV A;  1HD2 A;  5H5R A;  2AUV A;  4F03 A;  5ECI B;  1O7U A;  4FQU A;  3DXB A;  1TI1 A;  2F8A A;  5AIV A;  2HT9 A;  3BJ5 A;  5IO2 A;  2H1A A;  2H1D A;  5ENU A;  5HFK A;  5JCW A;  4X1U A;  5D96 A;  1V58 A;  2I1U A;  3W8S A;  5FWG A;  2QC7 A;  3ZML A;  4WF5 A;  2DKH A;  4HUA A;  5A4U A;  2E2M A;  6GSU A;  2WJU A;  1GTA A;  5BRT A;  5DQY A;  5IPG A;  5JWQ B;  1GSD A;  4OMV A;  2YJH A;  3ZMK A;  1PD2 1;  4FYU A;  2IMI A;  2VL9 A;  4IEL A;  3LYP A;  2LQQ A;  3PPU A;  5IMF A;  4JBB A;  3FY7 A;  4GTU A;  2FA4 A;  2H01 A;  2PVO C;  3HCZ A;  2H6Y A;  2MMZ A;  3M8N A;  4PXO A;  2N5F A;  3N9J A;  1N8J A;  5F05 A;  4IGJ A;  4MH3 A;  4DSS B;  5B8A A;  3IPZ A;  1Z5Y E;  4G0I A;  3O6T A;  4KW6 A;  4HJ2 A;  3GTU B;  1K0D A;  2B7J A;  1MD4 A;  1PKW A;  5DBQ A;  1MDJ A;  2YAN A;  1MEK A;  1GTU A;  3QAV A;  1X9M B;  4IW9 A;  4CY6 A;  5AIX A;  3RBT A;  2E0Q A;  4MZB A;  5IM9 A;  1PGT A;  4YAV A;  5KOW A;  3D4M A;  4IQ1 A;  4RQR A;  2RUF A;  3H93 A;  3KZQ A;  2LRC A;  3F6F A;  4NMU A;  2R0C A;  4HSC X;  4MAB A;  4KH7 A;  2FD3 A;  2MZC A;  3KM6 A;  3L9S A;  3RPN A;  1T1V A;  3GUR A;  3QOU A;  1OYJ A;  3UIW A;  1WJK A;  4J56 E;  4D73 A;  5GST A;  1W89 A;  2I9H A;  1GH2 A;  1HNA A;  1XFL A;  4YKF A;  3DVX A;  5IMV A;  4HZ2 A;  5AIS A;  5GZZ B;  1BAY A;  1X5D A;  2V6O A;  3IBH A;  1WP0 A;  4PNF A;  2P0G A;  4MK3 A;  1TK0 B;  1H75 A;  4KSO A;  3ISO A;  3WYW A;  1GLQ A;  2AV4 A;  2CAQ A;  2Z9S A;  4BIK A;  3A2W A;  1YQ1 A;  3FR3 A;  5DJM A;  3HJP A;  1TW9 A;  2O8V B;  3LXT A;  2LJA A;  2O7K A;  1NHY A;  2RUE A;  1SJZ A;  4K6X A;  3I6A A;  3IK7 A;  5ECN B;  3L9V A;  2L5O A;  4TN8 A;  5CRG A;  3E3E A;  2CV4 A;  1GSY A;  5EVO A;  1C72 A;  3EU4 A;  2A2S A;  3TDG A;  1MTC A;  12GS A;  2N5A A;  5J4U A;  4PQH A;  1NHO A;  3NIV A;  3EUR A;  2HSM A;  2DIZ A;  1PFO A;  4GF0 A;  4JED A;  4WF4 A;  4TXO A;  2AB6 A;  4BWS A;  2H66 A;  1WE0 A;  4F0B A;  4GCI A;  1AQV A;  3M9J A;  3FK8 A;  4MJC A;  2ZUP A;  2TRC P;  1G6W A;  2PU9 C;  2VCX A;  3N5O A;  4KND A;  3HZ8 A;  5D9X A;  1BYE A;  1O85 A;  4MP4 A;  3V1W A;  3D21 A;  4V1A p;  2H8L A;  4OFT A;  7GSS A;  4WR5 A;  4WXT A;  3KXO A;  1TKD B;  4ECC A;  4WBR D;  3QFB C;  4MA9 A;  4YQU A;  3H79 A;  4NHZ A;  1T00 A;  1ZCP A;  2VLT A;  5J5N A;  3EU3 A;  2L57 A;  4ZB6 A;  3CXG A;  2H6Z A;  3KP8 A;  4WR4 A;  5IPH A;  1Y6E A;  1ZYQ B;  1EP8 A;  1Z6M A;  3GSS A;  2FA8 A;  4K8M A;  1OC3 A;  3RDW A;  4V2L A;  2NTO A;  1GTB A;  1TU8 A;  5HFI A;  2HZF A;  1F37 A;  3TKR A;  4XTS A;  4I2T A;  3QAW A;  4KCE A;  4OFN A;  1Q98 A;  4F0C A;  1EEM A;  1SD9 A;  3QAG A;  3HDC A;  3G9B A;  4E8E A;  2YZU A;  19GS A;  2PGT A;  3W6G A;  2EIO A;  3A5W A;  4TXO B;  1X5E A;  1Z9H A;  1S3A A;  3LJR A;  5G31 A;  2DC5 A;  2H30 A;  3VLN A;  1CQH A;  1XOB A;  1WOU A;  4LL4 B;  1WPI A;  3M0F A;  4IN0 A;  18GS A;  3ZZX A;  1XOA A;  5HR0 A;  5A4W A;  3TKS A;  1XVW A;  1EV4 A;  3D5J A;  2IFQ A;  4IJ3 A;  4Q5F A;  2FWE A;  4K5R A;  2FHE A;  3D0Z A;  1THO A;  2DML A;  3GH9 A;  4BL7 A;  5INY A;  4HDE A;  3IA1 A;  4MNN A;  3C73 A;  10GS A;  4WKW A;  1R26 A;  1QFN A;  3FMW A;  4K0G A;  1K0M A;  4PQ1 A;  5ECS A;  1VRS D;  1A2L A;  4K5S A;  4V1A g;  3QFA C;  3FYG A;  1AUC A;  2M72 A;  4YAP A;  2GST A;  2V1M A;  2L5L A;  3AY8 A;  3TJJ A;  3TOU A;  1V98 A;  1M2D A;  2OA7 A;  1KBN A;  2H19 A;  3ZVJ A;  4EUY A;  5C00 A;  3GUS A;  1OC9 A;  3APQ A;  4WET A;  2L59 A;  3KTL A;  3FHK A;  3VI7 A;  2EIR A;  1EOH A;  4IP6 A;  5JCU A;  2YP6 A;  4JE1 A;  1BX9 A;  2F9S A;  2VLU A;  2DMM A;  2DSA A;  1PKZ A;  3FZ9 A;  2VUP A;  1Q4J A;  1SL1 B;  4PUF C;  5JWR B;  5B7C A;  2PER A;  5ID2 B;  1M2B A;  4HS1 A;  3TGZ A;  3Q18 A;  1XWB A;  2WB9 A;  3U5R E;  5ECR B;  3QD9 A;  1M3I A;  2YNX A;  1LBK A;  4K7I A;  2VM1 A;  16GS A;  3PIN A;  1GRX A;  1PMT A;  3A2V A;  2GLR A;  1JLW A;  5DAK B;  4Q5Q A;  3BCK A;  4MCU A;  1X9W B;  2ZNM A;  4ULX A;  1AAZ A;  4Z2T A;  5HFG A;  1UA5 A;  4TR1 B;  4GXZ A;  2VCV A;  3KMN A;  4DVC A;  5A5K A;  4FYC A;  1THX A;  5F06 A;  4X43 A;  1FAA A;  1I5G A;  4N10 A;  3KEB A;  4POL A;  1A8Y A;  1FOV A;  1ERT A;  3P7X A;  5HR2 A;  5KN2 A;  4L0U A;  3L4N A;  3LW9 A;  2JU5 A;  3IAS 2;  2OE1 A;  2AJQ B;  3PH9 A;  4Z7X A;  3APS A;  4JZQ A;  1V40 A;  2C8U A;  4I6X A;  1VF3 A;  3P90 A;  3F3R A;  3O76 A;  9GSS A;  3ZVJ D;  4ZL8 A;  1OE8 A;  4USS A;  3NZN A;  5E4W A;  1A0R P;  2CA8 A;  1KTE A;  4MZW A;  3EC3 A;  2VL2 A;  3GX8 A;  5IMA A;  3IE3 A;  1T4Z A;  4GSN A;  4ZIL A;  4KF9 A;  1LU4 A;  4EDY A;  1GSS A;  3UJ1 A;  1E2Y A;  4HJM A;  1ERU A;  3M9K A;  3BCI A;  3LOR A;  2WRT A;  2K9F A;  3US3 A;  3H8Q A;  2HRF A;  2QA1 A;  1XW6 A;  2V6K A;  2XPE A;  1ZYN A;  1M9B A;  2ZCT A;  4XRA A;  4DSS A;  5HQP A;  2GTU A;  1TRS A;  4OCF A;  3IC4 A;  1XW9 A;  3F9U A;  3EYT A;  2LNT A;  3GTU A;  3LYK A;  2BTO T;  2FWG A;  2CX3 A;  5CYY A;  4IKH A;  5IOW A;  1HYU A;  1M9A A;  4HI7 A;  3M3M A;  5IMZ A;  1QQ2 A;  5CAX A;  1G6Y A;  1B4Q A;  5DVB A;  4EDZ A;  2YZH A;  3FZA A;  1IYI A;  4DEJ A;  2R4V A;  1YKA A;  5BMU A;  2H72 A;  4N0V A;  5IMC A;  1A0F A;  1M3J A;  1K3O A;  4EVM A;  4NXI A;  1BQ7 A;  5E59 A;  2KP1 A;  3GST A;  1OVN A;  2MBT A;  3DRN A;  2YV9 A;  5DQS A;  4KX4 A;  4BA7 A;  2M80 A;  2GZP A;  4EO3 A;  2DJK A;  3TRX A;  2X64 A;  4FIW A;  3TJK A;  4IP1 A;  3JCM L;  1VF4 A;  3P2A A;  4YH2 A;  2FLS A;  2A4H A;  1M2A A;  4ZBB A;  11GS A;  3DML A;  3EIN A;  2X8C A;  2CT6 A;  1ERW A;  2R6K A;  3A2X A;  2HSH A;  5H5Q A;  1FHE A;  2LV3 A;  2R37 A;  3UMA A;  3F0I A;  2YWN A;  4QL7 A;  3TB2 A;  3DWV A;  2C80 A;  4LMV A;  2L6C A;  2XHF A;  2H76 A;  4ECB A;  3E0U A;  1XG8 A;  3GKM A;  4J57 E;  3EE2 A;  1BJX A;  4EC0 A;  1SKR B;  2L4Q A;  4L0W A;  4HEA 2;  1TRW A;  5LD0 A;  3VWV A;  3TCO A;  3CBU A;  4OD7 A;  4O32 A;  1TRU A;  1J0F A;  5F8B A;  3HVN A;  1X9S B;  5D8I A;  1A8L A;  2V41 A;  1F3B A;  1TU7 A;  4ILF A;  3C71 A;  2DJ1 A;  4MDC A;  1J08 A;  1EGR A;  1QK8 A;  4I8B A;  3CRU A;  2MMA A;  3F4T A;  2FNO A;  2H0I A;  3G7J A;  3KH7 A;  6GSS A;  1GUL A;  3KCM A;  4GQF A;  4OCE A;  5D73 A;  4DSR A;  5ELG A;  4G2E A;  4KA0 A;  4E8H A;  4MH2 A;  2TRX A;  1BG5 A;  1GWC A;  2B7K A;  1K0O A;  2GQK A;  4POK A;  2LUS A;  2PUK C;  2FWH A;  2HYX A;  4KSM A;  4MF6 A;  1NSW A;  3GV1 A;  2LRN A;  2EIQ A;  5J9B A;  1O6J A;  1B4P A;  1SU9 A;  3VFI A;  4G0K A;  2R0P A;  2REM A;  2UZ8 A;  3GFK A;  2LNS A;  2RLI A;  5GSS A;  1R7H A;  1ZMA A;  2CX4 A;  2HZE B;  4WEY A;  1O8W A;  2K18 A;  2H6X A;  4K0N A;  2FY6 A;  1RW1 A;  2YWM A;  5D9W A;  4XS6 A;  4MMM A;  13GS A;  3GKK A;  3WGE A;  2OJL A;  4CY8 A;  4F9Z A;  1XZO A;  1SD8 A;  3HYP A;  3ZL5 A;  4K2D A;  4FO5 A;  1DUG A;  4NPB A;  3CTF A;  3ZIT A;  2IJY A;  1XPV A;  2X8H A;  4BVY B;  5B6M A;  2IWT A;  4G10 A;  1HNB A;  2H1G A;  3ERG A;  4X0X A;  2H75 A;  1VF1 A;  1SL0 B;  5DAL B;  3MSZ A;  4HQZ A;  3WT1 A;  1K3Y A;  1SK2 A;  1N2A A;  2MMO A;  1EZK A;  2DIY A;  2LST A;  2B5X A;  2B1K A;  3GA4 A;  1R5P A;  5HR3 A;  1SJI A;  1AXD A;  2LTK A;  4MJA A;  4AF2 A;  2I3Y A;  5ECH B;  5FHI A;  3GKX A;  2X49 A;  2CVK A;  1O8X A;  3EPT A;  4EE0 A;  3F3Q A;  3PR8 A;  4BVX B;  4PGT A;  4ZB9 A;  2LJR A;  5DCH A;  5IOX A;  2GT5 A;  1EOG A;  3GL3 A;  2AHE A;  4ZBD A;  3MNG A;  2HRK A;  1O81 A;  3HA9 A;  4Q5R A;  4F2I A;  2P31 A;  1I9D A;  2B5E A;  4MF5 A;  4MPG A;  3A5I A;  2CQ9 A;  3LWA A;  3DD3 A;  2B1L A;  2IMK A;  3TKQ A;  3IHQ A;  3TUE A;  1G7E A;  14GS A;  5G1L A;  2QA2 A;  3WGD A;  4EL1 A;  2I4A A;  1USB A;  1FW1 A;  4GLT A;  5JWO B;  4JRR A;  3QDN A;  1XWK A;  4K7O A;  5DCG A;  3GHA A;  2HE3 A;  3Q74 A;  2G2Q A;  2H0H A;  3VPT A;  2MMN A;  3FEU A;  2F3M A;  3RHB A;  3TJG A;  1QMV A;  1JZO A;  1FG4 A;  1TJD A;  2AYT A;  4MPF A;  2JZR A;  1K3L A;  2XBQ A;  4JR4 A;  4GQC A;  1PX6 A;  4BWQ A;  3U6V A;  4OWY A;  3S9F A;  1UVZ A;  2VLV A;  1KEB A;  1JHB A;  5DJL A;  5ID2 A;  3WT2 A;  1GL8 A;  1TTZ A;  3FR6 A;  1RK4 A;  2DJ3 A;  1TK8 B;  4GST A;  1V9W A;  3TJB A;  6GST A;  2VCQ A;  4Z2R A;  3ZIV A;  2OBI A;  2O87 A;  4KDU A;  5DAK A;  3LXZ A;  2KUC A;  2YOI A;  2NDO A;  4XS1 A;  5IIZ A;  1Z7R A;  4TR1 A;  2BJX A;  3DVW A;  1HNC A;  1YDK A;  4JR6 A;  4J2F A;  4KUN A;  5J41 A;  3F4S A;  3GMF A;  1VGL A;  5ABR A;  1ML6 A;  2DKI A;  1W4V A;  2X99 A;  4ACS A;  3GN3 A;  3IXR A;  1Y25 A;  3ZRD A;  3ZLP A;  4DSQ A;  2HRA A;  3IV4 A;  1ON4 A;  2D2Z A;  22GS A;  2QKE A;  2ES7 A;  5HR1 A;  3EWL A;  4TRX A;  1GUM A;  1T4Y A;  1JFU A;  4A5P A;  4ECJ A;  2M46 A;  1EGO A;  1YJ6 A;  1YEP A;  4XS4 A;  1K0A A;  2WUL A;  3CSJ A;  3H1N A;  3ZRE A;  4K2X A;  20GS A;  5ECL B;  3HVX A;  5F07 A;  1MDK A;  2R0G A;  1AQW A;  4GSS A;  1SYR A;  2B6M A;  4YKG A;  5ELA A;  1SJ6 A;  3QCP A;  4CDO A;  1OAZ A;  2A4V A;  3DIE A;  3CRT A;  5H5S A;  4QQ7 A;  4V2M A;  1DE1 A;  3UOM A;  2GVP A;  4XRD A;  4RI6 A;  1JZD A;  2VCW A;  4ML6 A;  3IAM 2;  3RHC A;  5ECM B;  1YY7 A;  4IJI A;  1AIU A;  6GSW A;  3TOT A;  3FR9 A;  3HD5 A;  1TOF A;  1KNG A;  4XCS A;  1GSF A;  4JU5 A;  3LG6 A;  4Z2U A;  5CRD A;  1PQN A;  5AGY A;  2C1Y A;  4O5R A;  3HZ4 A;  2JAC A;  4WBJ A;  1SL2 B;  1ZZY A;  1BED A;  3P8W A;  4EF0 A;  3H4K A;  1AW9 A;  3E9J B;  3KGK A;  4POM A;  1X0R A;  2E2G A;  4OO4 A;  2G0F A;  3HXS A;  4AJ8 A;  3CSI A;  4LLR A;  3UAP A;  2L4C A;  2JZT A;  3VWU A;  3ME7 A;  5G2Z A;  2XC2 A;  1F3A A;  3MYD A;  4MF7 A;  1EP7 A;  1S3R A;  1NM3 A;  4PNG A;  3MWH A;  4XS4 B;  2F51 A;  2TIR A;  3M1G A;  1U6T A;  4ZL9 A;  1GNW A;  4P3Y B;  2MYG A;  3MDK A;  1PN0 A;  4X4J A;  2C4J A;  1ZOF A;  3L0H A;  2NVL A;  4OFM A;  4K9Z A;  2QSI A;  5IO0 A;  4ISD A;  4EIP A;  5LNK e;  3LQ7 A;  5ECK B;  3NOF A;  5EPF A;  2RM6 A;  4POB A;  3J7Y k;  4KDX A;  3HHV A;  5CRE A;  3TJF A;  3ZFL A;  1S3D A;  1SKW B;  4O7H A;  4ICY A;  1PL2 A;  3CQF A;  5L71 A;  4F82 A;  2VM2 A;  1HQO A;  5D93 A;  1FO5 A;  3VWX A;  2GSQ A;  3EMX A;  3SBC A;  4RI7 A;  1XBS A;  4TKY A;  2B3S A;  4QL9 A;  1A23 A;  2QGV A;  2R5G A;  2VCT A;  3IK9 A;  3OR5 A;  1A2J A;  4MLY A;  1GUK A;  2K8V A;  2A2P A;  3UBL A;  3IHG A;  4N0Z A;  4AJ7 A;  2FGX A;  4NHW A;  4L8E A;  1H4O A;  2KHP A;  2GGT A;  4G19 A;  1XXU A;  2HFD A;  3Q19 A;  1ZYP A;  1F9M A;  3GH6 A;  2E7P A;  1PN9 A;  4YQV A;  3FW2 A;  1EEJ A;  2DLX A;  2I81 A;  1MDI A;  1DBY A;  1FVJ A;  2C0D A;  4ZL7 A;  2PPT A;  1F2E A;  2V2G A;  1GSU A;  5G5F A;  5AN1 A;  3TKS C;  2L6D A;  4CW9 A;  2HZE A;  1IYH A;  2OAC A;  4TOP A;  3DYR A;  4MJB A;  5KOX A;  1A24 A;  1OKD A;  5J3R A;  17GS A;  3HJM A;  2O89 A;  4ECI A;  4LA1 A;  3DKS A;  1XWG A;  2ALB A;  5G30 A;  2FUG 2;  5B6N A;  4IQA A;  5C04 A;  2GZY A;  4BVY A;  3QR6 A;  5DDL A;  2OAD A;  1DE2 A;  3KTB A;  1FVK A;  2YN1 A;  3GL5 A;  4BPY A;  1V57 A;  2IME A;  1JZW A;  3LFL A;  2GQM A;  1TI3 A;  5DAL A;  2P5Q A;  3F8U A;  3DGQ A;  2HRN A;  3C1R A;  3ZIJ A;  4CHS A;  2PWJ A;  2C0E A;  2WGR A;  4TR4 A;  1A2M A;  4MZC A;  1QUW A;  4I5Q A;  2GS3 A;  3SWL A;  1JLV A;  1E6B A;  5CRH A;  2R2J A;  4AGS A;  3DEX A;  2AAW A;  2R3X A;  1MD3 A;  1GSE A;  1EV9 A;  2KOK A;  1WIK A;  3IOS A;  1TDI A;  2CVB A;  2F8F A;  3LGC A;  4BVX A;  4ZBA A;  3VWW A;  4KDY A;  1WWJ A;  2J9H A;  1ZL9 A;  2V32 A;  4IVF A;  4TR3 A;  1OE7 A;  2VAF A;  2H70 A;  3IRA A;  4HZ4 A;  3VUR A;  1F6M C;  3ZTL A;  5ECQ B;  1GLP A;  2LRT A;  1PSQ A;  1EWX A;  4XHM A;  2VD1 A;  4PUA A;  1UN2 A;  3VPQ A;  5CRW A;  3ERF A;  3MAK A;  2HNL A;  3IC8 A;  4ZB8 A;  4RQX A;  1GTI A;  2J23 A;  3F4R A;  1GUH A;  4TXV A;  3UVH A;  3MIX A;  4IS0 A;  4KE3 A;  3WD6 A;  3RAZ A;  1VF2 A;  1YEX A;  1T3B A;  5EY6 A;  1Z7P A;  3HVV A;  3R3E A;  2JAD A;  3VK9 A;  1XVQ A;  2WCI A;  1RQM A;  2PN8 A;  3HVS A;  1SYX A;  4ID0 A;  1V2A A;  2CZ3 A;  2C3T A;  5KN0 A;  2C0G A;  2DJ2 A;  1ERV A;  2K8S A;  1YF0 A;  4K7N A;  2KLX A;  2OKA A;  5IQY A;  4L5O A;  1XW5 A;  4KB3 A;  3C8E A;  4TR0 A;  2OE0 A;  6GSX A;  2H73 A;  3KIJ A;  1K0B A;  2VL2 C;  1XIY A;  3GYK A;  4FYB A;  4EKZ A;  2HLS A;  4D73 B;  2X8G A;  2JZS A;  3EVI A;  1PX7 A;  1K0N A;  1XWC A; 
#chains in the Genus database with same CATH homology
 2DJJ A;  3L9U A;  2X4A A;  2NPB A;  5LCZ A;  1TP9 A;  4H86 A;  5KN3 A;  2RM5 A;  3ZFB A;  3A3T A;  2GT6 A;  2H71 A;  3D6I A;  4HU9 A;  5CO3 A;  2P5R A;  5D9T A;  3D4T A;  1SKS B;  3KP9 A;  5ECP B;  6GSY A;  2VD0 A;  2CAI A;  4KGI A;  1UC7 A;  2GQL A;  3WGX A;  3I43 A;  2YWO A;  1ZGN A;  4O5U A;  2YJ7 A;  4ZXG A;  2OBK A;  4V2N A;  2JSY A;  4KAE A;  5EL8 A;  1S3C A;  3GRX A;  2DBC A;  4MJE A;  4ZIJ A;  1R4W A;  1FB0 A;  2OE3 A;  3F6D A;  2GSR A;  3GIX A;  1J9B A;  3RPP A;  2IPA A;  4TVE A;  3Q6O A;  2JL4 A;  4HU7 A;  1M99 A;  2YPM A;  2JSZ A;  2LJK A;  5COH A;  5F0G A;  1PA3 A;  4RUV A;  3W8J A;  3K8N A;  4HOJ A;  5CP1 A;  2HXK A;  1ILO A;  4G9H A;  1R5A A;  3D22 A;  2VOC A;  1WMJ A;  2IN3 A;  2YV7 A;  2N5B A;  5G1K A;  1ST9 A;  4L5L A;  1B9Y C;  2B5Y A;  4HQS A;  1GP1 A;  2FWF A;  1OKT A;  2K6V A;  3BOA A;  3HY2 A;  3TRQ A;  4PX1 A;  2C3N A;  5IMD A;  2CVD A;  4TW5 A;  3UEM A;  1WRY A;  3KD0 A;  4O5Q A;  4AJ6 A;  1URM A;  2CZ2 A;  1JZR A;  2GDR A;  1TXX A;  3KH9 A;  2VCZ A;  2HSY A;  4XIH A;  3BD2 A;  3GKN A;  3KJY A;  3BBY A;  5GAP D;  3L78 A;  3LEF A;  1TRV A;  4O92 A;  3FRC A;  4LMW A;  4N11 A;  2HI7 A;  4NAX A;  1YF1 A;  1M0U A;  2LQO A;  5G5E A;  1U3A A;  2WZ9 A;  3UL3 A;  3VI5 A;  2C3Q A;  4LL1 B;  4OO5 A;  4ML1 A;  1FOH A;  4GRF A;  1SK0 A;  2O85 A;  2VO4 A;  3J7Y b;  1B8X A;  3FKF A;  1SEN A;  5FT3 A;  3UVT A;  4K1F A;  3PGT A;  3LSZ A;  2EC4 A;  1DSB A;  1U88 A;  2VL3 A;  3G7Y A;  2IMD A;  3CYN A;  3GNJ A;  3GX0 A;  5GAN D;  3I9V 2;  1T7P B;  2IFQ B;  3ERW A;  2PMT A;  2XPD A;  3R2Q A;  4BL7 B;  2H1B A;  2YCD A;  3ED3 A;  3G7I A;  1YKC A;  1K0C A;  1Z6N A;  5D9V A;  4NV5 A;  1AC1 A;  4EXJ A;  2FCH A;  4G0L A;  4EIQ A;  5B8B A;  2H0G A;  1B48 A;  3TRP A;  2KP2 A;  3ZYW A;  2XBI A;  4NV2 A;  1QGV A;  1FB6 A;  1T8E B;  2LKU A;  1SK1 A;  2WS2 A;  2GZZ A;  1U3I A;  1X5C A;  1TK5 B;  2NBS A;  3O3T A;  1NW2 A;  2ON5 A;  1ZYE A;  1M7T A;  1YZX A;  2LEG A;  2ON7 A;  4N30 A;  3C1S A;  1LJR A;  1GNE A;  2GSS A;  3QPM A;  1QXH A;  3CSH A;  4I2U A;  1CQG A;  4PUR A;  2PVQ A;  3CTG A;  1G7O A;  1OC9 B;  5J9C A;  3I69 A;  5ECO B;  2YWI A;  4FH8 A;  3KMO A;  3F63 A;  2C0F A;  2LS5 A;  2VIM A;  3CMI A;  3QMX A;  1AQX A;  2DJ0 A;  2WDU A;  4GWR A;  1GSQ A;  1ACV A;  1PRX A;  1XWA A;  2H74 A;  4KCA A;  4I97 A;  3UAR A;  3ME8 A;  2PBJ A;  4NWY A;  1O73 A;  3UBK A;  3C7M A;  2A2R A;  4Q5N A;  4PTS A;  4PQI A;  1G0T A;  2IMF A;  1OC8 A;  3FZ4 A;  3FZ5 A;  4YQM A;  2MBS A;  3TKP A;  1ABA A;  3TKS E;  3EMP A;  2RII A;  2WFC A;  3IDV A;  1PL1 A;  1Z3E A;  8GSS A;  2IL3 A;  5KN1 A;  3IR4 A;  4IBP A;  3HKR A;  4IHU A;  3APO A;  5KEJ A;  2BMX A;  5JCG A;  1B9X C;  1U87 A;  2IIY A;  5A4V A;  3HJO A;  1XCC A;  5CNW A;  6GSV A;  1HD2 A;  5H5R A;  2AUV A;  4F03 A;  5ECI B;  1O7U A;  4FQU A;  3DXB A;  1TI1 A;  2F8A A;  5AIV A;  2HT9 A;  3BJ5 A;  5IO2 A;  2H1A A;  2H1D A;  5ENU A;  5HFK A;  5JCW A;  4X1U A;  5D96 A;  1V58 A;  2I1U A;  3W8S A;  5FWG A;  2QC7 A;  3ZML A;  4WF5 A;  2DKH A;  4HUA A;  5A4U A;  2E2M A;  6GSU A;  2WJU A;  1GTA A;  5BRT A;  5DQY A;  5IPG A;  5JWQ B;  1GSD A;  4OMV A;  2YJH A;  3ZMK A;  1PD2 1;  4FYU A;  2IMI A;  2VL9 A;  4IEL A;  3LYP A;  2LQQ A;  3PPU A;  5IMF A;  4JBB A;  3FY7 A;  4GTU A;  2FA4 A;  2H01 A;  2PVO C;  3HCZ A;  2H6Y A;  2MMZ A;  3M8N A;  4PXO A;  2N5F A;  3N9J A;  1N8J A;  5F05 A;  4IGJ A;  4MH3 A;  4DSS B;  5B8A A;  3IPZ A;  1Z5Y E;  4G0I A;  3O6T A;  4KW6 A;  4HJ2 A;  3GTU B;  1K0D A;  2B7J A;  1MD4 A;  1PKW A;  5DBQ A;  1MDJ A;  2YAN A;  1MEK A;  1GTU A;  3QAV A;  1X9M B;  4IW9 A;  4CY6 A;  5AIX A;  3RBT A;  2E0Q A;  4MZB A;  5IM9 A;  1PGT A;  4YAV A;  5KOW A;  3D4M A;  4IQ1 A;  4RQR A;  2RUF A;  3H93 A;  3KZQ A;  2LRC A;  3F6F A;  4NMU A;  2R0C A;  4MAB A;  4KH7 A;  2FD3 A;  2MZC A;  3KM6 A;  3L9S A;  3RPN A;  1T1V A;  3GUR A;  3QOU A;  1OYJ A;  3UIW A;  1WJK A;  4J56 E;  4D73 A;  5GST A;  1W89 A;  2I9H A;  1GH2 A;  1HNA A;  1XFL A;  4YKF A;  3DVX A;  5IMV A;  4HZ2 A;  5AIS A;  5GZZ B;  1BAY A;  1X5D A;  2V6O A;  3IBH A;  1WP0 A;  4PNF A;  2P0G A;  4MK3 A;  1TK0 B;  1H75 A;  4KSO A;  3ISO A;  3WYW A;  1GLQ A;  2AV4 A;  2CAQ A;  2Z9S A;  3A2W A;  1YQ1 A;  3FR3 A;  5DJM A;  3HJP A;  1TW9 A;  2O8V B;  3LXT A;  2LJA A;  2O7K A;  1NHY A;  2RUE A;  1SJZ A;  4K6X A;  3I6A A;  3IK7 A;  5ECN B;  3L9V A;  2L5O A;  4TN8 A;  5CRG A;  3E3E A;  2CV4 A;  1GSY A;  5EVO A;  1C72 A;  3EU4 A;  2A2S A;  3TDG A;  1MTC A;  12GS A;  2N5A A;  5J4U A;  4PQH A;  1NHO A;  3NIV A;  3EUR A;  2HSM A;  2DIZ A;  4GF0 A;  4JED A;  4WF4 A;  4TXO A;  2AB6 A;  4BWS A;  2H66 A;  1WE0 A;  4F0B A;  4GCI A;  1AQV A;  3M9J A;  3FK8 A;  4MJC A;  2ZUP A;  2TRC P;  1G6W A;  2PU9 C;  2VCX A;  3N5O A;  4KND A;  3HZ8 A;  5D9X A;  1BYE A;  1O85 A;  4MP4 A;  3V1W A;  3D21 A;  4V1A p;  2H8L A;  4OFT A;  7GSS A;  4WR5 A;  4WXT A;  3KXO A;  1TKD B;  4ECC A;  4WBR D;  3QFB C;  4MA9 A;  4YQU A;  3H79 A;  4NHZ A;  1T00 A;  1ZCP A;  2VLT A;  5J5N A;  3EU3 A;  2L57 A;  4ZB6 A;  3CXG A;  2H6Z A;  3KP8 A;  4WR4 A;  5IPH A;  1Y6E A;  1ZYQ B;  1EP8 A;  1Z6M A;  3GSS A;  2FA8 A;  4K8M A;  1OC3 A;  3RDW A;  4V2L A;  2NTO A;  1GTB A;  1TU8 A;  5HFI A;  2HZF A;  1F37 A;  3TKR A;  4XTS A;  4I2T A;  3QAW A;  4KCE A;  4OFN A;  1Q98 A;  4F0C A;  1EEM A;  1SD9 A;  3QAG A;  3HDC A;  3G9B A;  4E8E A;  2YZU A;  19GS A;  2PGT A;  3W6G A;  2EIO A;  3A5W A;  4TXO B;  1X5E A;  1Z9H A;  1S3A A;  3LJR A;  5G31 A;  2DC5 A;  2H30 A;  3VLN A;  1CQH A;  1XOB A;  1WOU A;  4LL4 B;  1WPI A;  3M0F A;  4IN0 A;  18GS A;  3ZZX A;  1XOA A;  5HR0 A;  5A4W A;  3TKS A;  1XVW A;  1EV4 A;  3D5J A;  2IFQ A;  4IJ3 A;  4Q5F A;  2FWE A;  4K5R A;  2FHE A;  3D0Z A;  1THO A;  2DML A;  3GH9 A;  4BL7 A;  5INY A;  4HDE A;  3IA1 A;  4MNN A;  3C73 A;  10GS A;  4WKW A;  1R26 A;  1QFN A;  3FMW A;  4K0G A;  1K0M A;  4PQ1 A;  5ECS A;  1VRS D;  1A2L A;  4K5S A;  4V1A g;  3QFA C;  3FYG A;  1AUC A;  2M72 A;  4YAP A;  2GST A;  2V1M A;  2L5L A;  3AY8 A;  3TJJ A;  3TOU A;  1V98 A;  1M2D A;  2OA7 A;  1KBN A;  2H19 A;  3ZVJ A;  4EUY A;  5C00 A;  3GUS A;  1OC9 A;  3APQ A;  4WET A;  2L59 A;  3KTL A;  3FHK A;  3VI7 A;  2EIR A;  1EOH A;  4IP6 A;  5JCU A;  2YP6 A;  4JE1 A;  1BX9 A;  2F9S A;  2VLU A;  2DMM A;  2DSA A;  1PKZ A;  3FZ9 A;  2VUP A;  1Q4J A;  1SL1 B;  4PUF C;  5JWR B;  5B7C A;  2PER A;  5ID2 B;  1M2B A;  4HS1 A;  3TGZ A;  3Q18 A;  1XWB A;  2WB9 A;  3U5R E;  5ECR B;  3QD9 A;  2YNX A;  1LBK A;  4K7I A;  2VM1 A;  16GS A;  3PIN A;  1GRX A;  1PMT A;  3A2V A;  2GLR A;  1JLW A;  5DAK B;  4Q5Q A;  3BCK A;  4MCU A;  1X9W B;  2ZNM A;  4ULX A;  1AAZ A;  4Z2T A;  5HFG A;  1UA5 A;  4TR1 B;  4GXZ A;  2VCV A;  3KMN A;  4DVC A;  5A5K A;  4FYC A;  1THX A;  5F06 A;  4X43 A;  1FAA A;  1I5G A;  4N10 A;  3KEB A;  4POL A;  1A8Y A;  1FOV A;  1ERT A;  3P7X A;  5HR2 A;  5KN2 A;  4L0U A;  3L4N A;  3LW9 A;  2JU5 A;  3IAS 2;  2OE1 A;  2AJQ B;  3PH9 A;  4Z7X A;  3APS A;  4JZQ A;  1V40 A;  2C8U A;  4I6X A;  1VF3 A;  3P90 A;  3F3R A;  3O76 A;  9GSS A;  3ZVJ D;  4ZL8 A;  1OE8 A;  4USS A;  3NZN A;  5E4W A;  1A0R P;  2CA8 A;  1KTE A;  4MZW A;  3EC3 A;  2VL2 A;  3GX8 A;  5IMA A;  3IE3 A;  1T4Z A;  4GSN A;  4ZIL A;  4KF9 A;  1LU4 A;  4EDY A;  1GSS A;  3UJ1 A;  1E2Y A;  4HJM A;  1ERU A;  3M9K A;  3BCI A;  3LOR A;  2WRT A;  2K9F A;  3US3 A;  3H8Q A;  2HRF A;  2QA1 A;  1XW6 A;  2V6K A;  2XPE A;  1ZYN A;  1M9B A;  2ZCT A;  4XRA A;  4DSS A;  5HQP A;  2GTU A;  1TRS A;  4OCF A;  3IC4 A;  1XW9 A;  3F9U A;  3EYT A;  2LNT A;  3GTU A;  3LYK A;  2BTO T;  2FWG A;  2CX3 A;  5CYY A;  4IKH A;  5IOW A;  1HYU A;  1M9A A;  4HI7 A;  3M3M A;  5IMZ A;  1QQ2 A;  5CAX A;  1G6Y A;  1B4Q A;  5DVB A;  4EDZ A;  2YZH A;  3FZA A;  1IYI A;  4DEJ A;  2R4V A;  1YKA A;  5BMU A;  2H72 A;  4N0V A;  5IMC A;  1A0F A;  1K3O A;  4EVM A;  4NXI A;  1BQ7 A;  5E59 A;  2KP1 A;  3GST A;  1OVN A;  2MBT A;  3DRN A;  2YV9 A;  5DQS A;  4KX4 A;  4BA7 A;  2M80 A;  2GZP A;  4EO3 A;  2DJK A;  3TRX A;  2X64 A;  4FIW A;  3TJK A;  4IP1 A;  3JCM L;  1VF4 A;  3P2A A;  4YH2 A;  2FLS A;  2A4H A;  1M2A A;  4ZBB A;  11GS A;  3DML A;  3EIN A;  2X8C A;  2CT6 A;  1ERW A;  2R6K A;  3A2X A;  2HSH A;  5H5Q A;  1FHE A;  2LV3 A;  2R37 A;  3UMA A;  3F0I A;  2YWN A;  4QL7 A;  3TB2 A;  3DWV A;  2C80 A;  4LMV A;  2L6C A;  2XHF A;  2H76 A;  4ECB A;  3E0U A;  3GKM A;  4J57 E;  3EE2 A;  1BJX A;  4EC0 A;  1SKR B;  2L4Q A;  4L0W A;  4HEA 2;  1TRW A;  5LD0 A;  3VWV A;  3TCO A;  3CBU A;  4OD7 A;  4O32 A;  1TRU A;  1J0F A;  5F8B A;  1X9S B;  5D8I A;  1A8L A;  2V41 A;  1F3B A;  1TU7 A;  4ILF A;  3C71 A;  2DJ1 A;  4MDC A;  1J08 A;  1EGR A;  1QK8 A;  4I8B A;  3CRU A;  2MMA A;  3F4T A;  2FNO A;  2H0I A;  3G7J A;  3KH7 A;  6GSS A;  1GUL A;  3KCM A;  4GQF A;  4OCE A;  5D73 A;  4DSR A;  5ELG A;  4G2E A;  4KA0 A;  4E8H A;  4MH2 A;  2TRX A;  1BG5 A;  1GWC A;  2B7K A;  1K0O A;  2GQK A;  4POK A;  2LUS A;  2PUK C;  2FWH A;  2HYX A;  4KSM A;  4MF6 A;  1NSW A;  3GV1 A;  2LRN A;  2EIQ A;  5J9B A;  1O6J A;  1B4P A;  1SU9 A;  3VFI A;  4G0K A;  2R0P A;  2REM A;  2UZ8 A;  3GFK A;  2LNS A;  2RLI A;  5GSS A;  1R7H A;  1ZMA A;  2CX4 A;  2HZE B;  4WEY A;  1O8W A;  2K18 A;  2H6X A;  4K0N A;  2FY6 A;  1RW1 A;  2YWM A;  5D9W A;  4XS6 A;  4MMM A;  13GS A;  3GKK A;  3WGE A;  2OJL A;  4CY8 A;  4F9Z A;  1XZO A;  1SD8 A;  3HYP A;  3ZL5 A;  4K2D A;  4FO5 A;  1DUG A;  4NPB A;  3CTF A;  3ZIT A;  2IJY A;  1XPV A;  2X8H A;  4BVY B;  5B6M A;  2IWT A;  4G10 A;  1HNB A;  2H1G A;  3ERG A;  4X0X A;  2H75 A;  1VF1 A;  1SL0 B;  5DAL B;  3MSZ A;  4HQZ A;  3WT1 A;  1K3Y A;  1SK2 A;  1N2A A;  2MMO A;  1EZK A;  2DIY A;  2LST A;  2B5X A;  2B1K A;  3GA4 A;  1R5P A;  5HR3 A;  1SJI A;  1AXD A;  2LTK A;  4MJA A;  4AF2 A;  2I3Y A;  5ECH B;  5FHI A;  3GKX A;  2X49 A;  2CVK A;  1O8X A;  3EPT A;  4EE0 A;  3F3Q A;  3PR8 A;  4BVX B;  4PGT A;  4ZB9 A;  2LJR A;  5DCH A;  5IOX A;  2GT5 A;  1EOG A;  3GL3 A;  2AHE A;  4ZBD A;  3MNG A;  2HRK A;  1O81 A;  3HA9 A;  4Q5R A;  4F2I A;  2P31 A;  1I9D A;  2B5E A;  4MF5 A;  4MPG A;  3A5I A;  2CQ9 A;  3LWA A;  3DD3 A;  2B1L A;  2IMK A;  3TKQ A;  3IHQ A;  3TUE A;  1G7E A;  14GS A;  5G1L A;  2QA2 A;  3WGD A;  4EL1 A;  2I4A A;  1USB A;  1FW1 A;  4GLT A;  5JWO B;  4JRR A;  3QDN A;  1XWK A;  4K7O A;  5DCG A;  3GHA A;  2HE3 A;  3Q74 A;  2G2Q A;  2H0H A;  3VPT A;  2MMN A;  3FEU A;  2F3M A;  3RHB A;  3TJG A;  1QMV A;  1JZO A;  1FG4 A;  1TJD A;  2AYT A;  4MPF A;  2JZR A;  1K3L A;  2XBQ A;  4JR4 A;  4GQC A;  1PX6 A;  4BWQ A;  3U6V A;  4OWY A;  3S9F A;  1UVZ A;  2VLV A;  1KEB A;  1JHB A;  5DJL A;  5ID2 A;  3WT2 A;  1GL8 A;  1TTZ A;  3FR6 A;  1RK4 A;  2DJ3 A;  1TK8 B;  4GST A;  1V9W A;  3TJB A;  6GST A;  2VCQ A;  4Z2R A;  3ZIV A;  2OBI A;  2O87 A;  4KDU A;  5DAK A;  3LXZ A;  2KUC A;  2YOI A;  2NDO A;  4XS1 A;  5IIZ A;  1Z7R A;  4TR1 A;  2BJX A;  3DVW A;  1HNC A;  1YDK A;  4JR6 A;  4J2F A;  4KUN A;  5J41 A;  3F4S A;  3GMF A;  1VGL A;  5ABR A;  1ML6 A;  2DKI A;  1W4V A;  2X99 A;  4ACS A;  3GN3 A;  3IXR A;  1Y25 A;  3ZRD A;  3ZLP A;  4DSQ A;  2HRA A;  3IV4 A;  1ON4 A;  2D2Z A;  22GS A;  2QKE A;  2ES7 A;  5HR1 A;  3EWL A;  4TRX A;  1GUM A;  1T4Y A;  1JFU A;  4A5P A;  4ECJ A;  2M46 A;  1EGO A;  1YJ6 A;  1YEP A;  4XS4 A;  1K0A A;  2WUL A;  3CSJ A;  3H1N A;  3ZRE A;  4K2X A;  20GS A;  5ECL B;  3HVX A;  5F07 A;  1MDK A;  2R0G A;  1AQW A;  4GSS A;  1SYR A;  2B6M A;  4YKG A;  5ELA A;  1SJ6 A;  3QCP A;  4CDO A;  1OAZ A;  2A4V A;  3DIE A;  3CRT A;  5H5S A;  4QQ7 A;  4V2M A;  1DE1 A;  3UOM A;  2GVP A;  4XRD A;  4RI6 A;  1JZD A;  2VCW A;  4ML6 A;  3IAM 2;  3RHC A;  5ECM B;  1YY7 A;  4IJI A;  1AIU A;  6GSW A;  3TOT A;  3FR9 A;  3HD5 A;  1TOF A;  1KNG A;  4XCS A;  1GSF A;  4JU5 A;  3LG6 A;  4Z2U A;  5CRD A;  1PQN A;  5AGY A;  2C1Y A;  4O5R A;  3HZ4 A;  2JAC A;  4WBJ A;  1SL2 B;  1ZZY A;  1BED A;  3P8W A;  4EF0 A;  3H4K A;  1AW9 A;  3E9J B;  3KGK A;  4POM A;  1X0R A;  2E2G A;  4OO4 A;  2G0F A;  3HXS A;  4AJ8 A;  3CSI A;  4LLR A;  3UAP A;  2L4C A;  2JZT A;  3VWU A;  3ME7 A;  5G2Z A;  2XC2 A;  1F3A A;  3MYD A;  4MF7 A;  1EP7 A;  1NM3 A;  4PNG A;  3MWH A;  4XS4 B;  2F51 A;  2TIR A;  3M1G A;  1U6T A;  4ZL9 A;  1GNW A;  4P3Y B;  2MYG A;  3MDK A;  1PN0 A;  4X4J A;  2C4J A;  1ZOF A;  3L0H A;  2NVL A;  4OFM A;  4K9Z A;  2QSI A;  5IO0 A;  4ISD A;  4EIP A;  5LNK e;  3LQ7 A;  5ECK B;  3NOF A;  5EPF A;  2RM6 A;  4POB A;  3J7Y k;  4KDX A;  3HHV A;  5CRE A;  3TJF A;  3ZFL A;  1S3D A;  1SKW B;  4O7H A;  4ICY A;  1PL2 A;  5L71 A;  4F82 A;  2VM2 A;  1HQO A;  5D93 A;  1FO5 A;  3VWX A;  2GSQ A;  3EMX A;  3SBC A;  4RI7 A;  1XBS A;  4TKY A;  2B3S A;  4QL9 A;  1A23 A;  2QGV A;  2R5G A;  2VCT A;  3IK9 A;  3OR5 A;  1A2J A;  4MLY A;  1GUK A;  2K8V A;  2A2P A;  3UBL A;  3IHG A;  4N0Z A;  4AJ7 A;  2FGX A;  4NHW A;  4L8E A;  1H4O A;  2KHP A;  2GGT A;  4G19 A;  1XXU A;  2HFD A;  3Q19 A;  1ZYP A;  1F9M A;  3GH6 A;  2E7P A;  1PN9 A;  4YQV A;  3FW2 A;  1EEJ A;  2DLX A;  2I81 A;  1MDI A;  1DBY A;  1FVJ A;  2C0D A;  4ZL7 A;  2PPT A;  1F2E A;  2V2G A;  1GSU A;  5G5F A;  5AN1 A;  3TKS C;  2L6D A;  4CW9 A;  2HZE A;  1IYH A;  2OAC A;  4TOP A;  3DYR A;  4MJB A;  5KOX A;  1A24 A;  1OKD A;  5J3R A;  17GS A;  3HJM A;  2O89 A;  4ECI A;  4LA1 A;  3DKS A;  1XWG A;  2ALB A;  5G30 A;  2FUG 2;  5B6N A;  4IQA A;  5C04 A;  2GZY A;  4BVY A;  3QR6 A;  5DDL A;  2OAD A;  1DE2 A;  3KTB A;  1FVK A;  2YN1 A;  3GL5 A;  4BPY A;  1V57 A;  2IME A;  1JZW A;  3LFL A;  2GQM A;  1TI3 A;  5DAL A;  2P5Q A;  3F8U A;  3DGQ A;  2HRN A;  3C1R A;  3ZIJ A;  4CHS A;  2PWJ A;  2C0E A;  2WGR A;  4TR4 A;  1A2M A;  4MZC A;  1QUW A;  4I5Q A;  2GS3 A;  3SWL A;  1JLV A;  1E6B A;  5CRH A;  2R2J A;  4AGS A;  3DEX A;  2AAW A;  2R3X A;  1MD3 A;  1GSE A;  1EV9 A;  2KOK A;  1WIK A;  3IOS A;  1TDI A;  2CVB A;  2F8F A;  3LGC A;  4BVX A;  4ZBA A;  3VWW A;  4KDY A;  1WWJ A;  2J9H A;  1ZL9 A;  2V32 A;  4IVF A;  4TR3 A;  1OE7 A;  2VAF A;  2H70 A;  3IRA A;  4HZ4 A;  3VUR A;  1F6M C;  3ZTL A;  5ECQ B;  1GLP A;  2LRT A;  1PSQ A;  1EWX A;  4XHM A;  2VD1 A;  4PUA A;  1UN2 A;  3VPQ A;  5CRW A;  3ERF A;  3MAK A;  2HNL A;  3IC8 A;  4ZB8 A;  4RQX A;  1GTI A;  2J23 A;  3F4R A;  1GUH A;  4TXV A;  3UVH A;  3MIX A;  4IS0 A;  4KE3 A;  3WD6 A;  3RAZ A;  1VF2 A;  1YEX A;  1T3B A;  5EY6 A;  1Z7P A;  3HVV A;  3R3E A;  2JAD A;  3VK9 A;  1XVQ A;  2WCI A;  1RQM A;  2PN8 A;  3HVS A;  1SYX A;  4ID0 A;  1V2A A;  2CZ3 A;  2C3T A;  5KN0 A;  2C0G A;  2DJ2 A;  1ERV A;  2K8S A;  1YF0 A;  4K7N A;  2KLX A;  2OKA A;  5IQY A;  4L5O A;  1XW5 A;  4KB3 A;  3C8E A;  4TR0 A;  2OE0 A;  6GSX A;  2H73 A;  3KIJ A;  1K0B A;  2VL2 C;  1XIY A;  3GYK A;  4FYB A;  4EKZ A;  2HLS A;  4D73 B;  2X8G A;  2JZS A;  3EVI A;  1PX7 A;  1K0N A;  1XWC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...