3VWWA

Crystal structure of a0-domain of p5 from h. sapiens
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
116
structure length
115
Chain Sequence
DDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKAATALKDVVKVGAVDADKHHSLGGQYGVQGFPTIIFGSNKNRPEDYQGGRTGEAIVDAALSALRQLVKDRLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Protein disulfide-isomerase A6
publication title Synergistic cooperation of PDI family members in peroxiredoxin 4-driven oxidative protein folding
pubmed doi rcsb
source organism Homo sapiens
total genus 36
structure length 115
sequence length 116
chains with identical sequence B
ec nomenclature ec 5.3.4.1: Protein disulfide-isomerase.
pdb deposition date 2012-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3vwwA01
2JL4A 1M2AA 3GX0A 4QQ7A 4TOPA 1JZRA 5H5RA 2VCXA 4TN8A 1XWCA 4TR0A 2IN3A 4HZ2A 4GSNA 4QL9A 1SKWB 6GSXA 4TW5A 4IGJA 3CRTA 3TJFA 3EINA 1EP7A 1A2MA 3D6IA 2L6DA 2C0DA 3N9JA 3GYKA 9GSSA 1A24A 8GSSA 3FEUA 2OBKA 4EUYA 3F6DA 4NV5A 1CQHA 2C4JA 3MAKA 2BJXA 3TJBA 4TR1B 3J7Yk 2CZ2A 1YKAA 5JWOB 5JCUA 3F9UA 4WF4A 2FLSA 1BG5A 2AJQB 3A2VA 3G7YA 3WYWA 1EGOA 2OE0A 2YJHA 2LJRA 2JZSA 3IE3A 4KUNA 4L0UA 3W6GA 2P5QA 1AIUA 1YF0A 1WPIA 1XOBA 4EE0A 2GZZA 2X8CA 2O87A 3H1NA 2MMAA 5CREA 1SYRA 4NXIA 5L71A 3HZ4A 1FAAA 3IK7A 1O7UA 2YWNA 3QAGA 1TJDA 1GTAA 1Z3EA 2PGTA 1T4ZA 3ZMKA 2WCIA 1SJ6A 5F06A 2KLXA 5D9WA 4ZBAA 1A8LA 4AF2A 2CAQA 4HQZA 2PPTA 2DIZA 4N11A 5ID2A 3ZLPA 4GXZA 4K7NA 3APOA 3D5JA 2N5AA 4GTUA 4JRRA 1ERVA 3F4RA 2GGTA 2DJJA 2ON7A 3KM6A 1U3AA 1ON4A 4WBJA 3IAS2 5B7CA 1WP0A 1ERWA 1DBYA 2LNTA 1XOAA 3IC4A 2KOKA 5DJLA 2X8HA 1F2EA 2LRTA 2IMFA 4Q5RA 5A5KA 2ZNMA 4LLRA 5JWQB 1TI3A 4I97A 2L59A 3LXTA 5D9TA 4TVEA 4EDYA 5IMAA 3CYNA 4KDUA 2GZPA 5J5NA 2MBTA 1I5GA 4I8BA 4ZILA 2QKEA 2F3MA 3GKKA 3GV1A 3LJRA 3W8SA 1VF4A 2KUCA 2YZUA 5EY6A 1A2JA 3DWVA 3V1WA 4IHUA 1OC8A 1DE1A 3ZL5A 2HSYA 4HDEA 4JR6A 1X5EA 1AQVA 1Y25A 3F63A 1GSYA 2GSTA 4RI6A 1TU7A 1TTZA 4F03A 2H6XA 5AIVA 3UARA 1THXA 2NBSA 1TW9A 4NHZA 1BYEA 1IYIA 2OA7A 2LSTA 1UA5A 4DSRA 5IPHA 1KTEA 1QQ2A 3WGXA 3FR6A 1TRWA 4D73A 3UVHA 2L6CA 1MEKA 3ZZXA 3I9V2 3H79A 4TXOB 2CT6A 5GSSA 1TRVA 2YV7A 2OKAA 3KD0A 4JE1A 1HNAA 5E59A 4HI7A 4ECCA 5IMDA 3UMAA 5CNWA 1FB0A 2WRTA 2O7KA 3CMIA 4HU9A 2CQ9A 5CYYA 1B4QA 5G1LA 19GSA 2H0HA 1VF1A 5HFKA 5KN3A 5D73A 4FYUA 4XCSA 2FWEA 1KBNA 2M46A 5FWGA 4EKZA 1V2AA 4HEA2 1XBSA 2AV4A 2C0GA 2V6KA 3CTGA 3E9JB 5DJMA 2K8VA 4DEJA 1B9XC 3UIWA 1YDKA 3KGKA 4XS4A 3F3QA 3IK9A 3L0HA 4ZIJA 2D2ZA 5CRWA 1ZGNA 3I43A 3FHKA 1K0AA 2TRXA 4IQ1A 2LNSA 2LTKA 2VOCA 3QAWA 2GS3A 2H19A 1TI1A 5AISA 3ME8A 1G7EA 2DMMA 2F8FA 4V2MA 4OD7A 4OO5A 1OC9A 4K7IA 2H70A 3FR3A 2VL9A 2IMEA 5DQSA 1XWKA 3KTLA 3DVXA 4JZQA 2XHFA 2REMA 4HUAA 4EL1A 4F82A 2FUG2 2GT5A 2WFCA 3G7IA 1BEDA 4X1UA 1HD2A 14GSA 2ZUPA 2HYXA 4MP4A 4KE3A 4POBA 5G5FA 5HQPA 1SJZA 6GSVA 2FWHA 3P8WA 2IFQB 3GH6A 2VD0A 1M2BA 1C72A 5ECKB 1T8EB 1TXXA 1NHYA 3M9JA 1TK8B 3VWUA 4J57E 6GSWA 1M7TA 5HFIA 2C3NA 2J23A 1BX9A 5J4UA 5ECHB 4KNDA 5KN2A 3VWXA 2VIMA 2I4AA 5ECIB 5IPGA 2H73A 3IRAA 4MF7A 3DIEA 2MMOA 4EF0A 3GL5A 2QSIA 3A2XA 3DD3A 4DVCA 2F9SA 3RBTA 1AAZA 3GX8A 1BAYA 3DEXA 1Z5YE 3HY2A 2FWGA 2GQMA 1J08A 2GDRA 4J2FA 4XRDA 2PVQA 1U87A 2B1KA 4MJEA 2H1BA 2LRCA 1K3YA 4FYCA 5B8BA 4MJBA 1GSFA 4O32A 4OMVA 1GULA 2MZCA 5GAPD 3EVIA 3NOFA 17GSA 1AQXA 5ENUA 1W4VA 2AB6A 4KSMA 3G9BA 2JSZA 4IP6A 1YEPA 5JCGA 5ECOB 3M0FA 2K6VA 2VD1A 4ZL7A 2L5LA 2FA8A 4PX1A 3WGDA 1X5CA 3F4TA 1PGTA 3ZVJD 4BWSA 3CBUA 4HOJA 5IOXA 1PSQA 1JLWA 1XPVA 5HFGA 3IPZA 1XVWA 2M80A 1GP1A 4N10A 3S9FA 2H01A 4IS0A 4JBBA 3GA4A 2H0IA 1WWJA 4MDCA 3FY7A 1SK0A 2I3YA 1TU8A 4IQAA 4IJ3A 3TDGA 1M0UA 4TXOA 1GUMA 2PN8A 5G30A 3SWLA 4K8MA 3FKFA 1TRUA 4MK3A 1N2AA 3VPTA 5DVBA 3ZIJA 4ACSA 1EEMA 3Q18A 4YH2A 4NAXA 4E8HA 1PQNA 1PA3A 4V1Ap 3QMXA 2R6KA 4LA1A 4PQHA 7GSSA 4NV2A 1GRXA 1XVQA 1GNEA 2GLRA 2LS5A 2B6MA 1B8XA 3DVWA 2HI7A 5GSTA 4MPGA 3IR4A 4P3YB 1J9BA 1XW5A 2G2QA 2QGVA 3BOAA 3PINA 3KCMA 2K18A 2TIRA 1X9MB 5IM9A 4ZBBA 2X64A 1O8XA 3KXOA 1ERTA 1PD21 3D4TA 5D8IA 2H76A 4YQVA 1TOFA 1PN9A 4WR4A 1ABAA 2C1YA 3TKRA 4RQXA 1Y6EA 2DSAA 3EMXA 1ZYEA 4L5LA 3C1RA 3RPNA 1DE2A 1YZXA 3UVTA 3FZAA 2OBIA 5INYA 2LQOA 3C7MA 3M3MA 3KIJA 4WKWA 4CHSA 3BJ5A 2E0QA 1I9DA 5IO0A 2CZ3A 2V41A 1XFLA 1TK0B 3GHAA 3Q74A 2KHPA 3TKPA 2H66A 3EU4A 2HLSA 3QAVA 3GFKA 2N5FA 5IIZA 4O7HA 4EO3A 3AY8A 1NW2A 3O3TA 5CO3A 2XPEA 1JHBA 4BVXA 2B3SA 2I81A 1AXDA 3MWHA 2JU5A 3LGCA 1YEXA 1EV4A 1KEBA 4MJAA 5DALB 4XS1A 2JADA 5IO2A 4QL7A 5LD0A 2Z9SA 1DSBA 1XIYA 2IFQA 3L4NA 2WGRA 2E2MA 2HXKA 5EVOA 1YKCA 1GL8A 3TOUA 1V57A 4MZCA 4ULXA 1EGRA 3HJMA 5AN1A 4PNGA 2EIQA 3QFBC 4MZWA 4V1Ag 2LKUA 1FVJA 3EE2A 3U6VA 1X9WB 3F6FA 3H93A 1WIKA 5E4WA 1XWGA 3UBKA 1BQ7A 1NSWA 1Z7RA 2CVBA 2V32A 2CA8A 2FGXA 3H4KA 1SYXA 3A5WA 3RHBA 3ISOA 1LU4A 3TKSA 3HZ8A 4OFMA 2ALBA 2DLXA 2GTUA 5D96A 2CX3A 3UJ1A 6GSSA 1SENA 2R5GA 2V1MA 2PMTA 3LQ7A 3EURA 1MD4A 3O76A 4TKYA 2C3QA 3ZITA 4KCEA 1F3BA 3VURA 2AAWA 4NWYA 3LYKA 5H5SA 3FR9A 3VFIA 4AJ8A 5KN0A 1U88A 5IMVA 2HZEB 1ZMAA 1WJKA 1GTBA 1M2DA 1MDIA 2CVKA 3TB2A 3F4SA 3TJGA 3HVXA 1ST9A 2DIYA 5CAXA 1Q4JA 2YNXA 3KEBA 2DJ0A 1J0FA 5J3RA 4GCIA 3TKSC 4RQRA 4ZL9A 5D93A 3DYRA 5JCWA 4YQMA 4DSSA 2E2GA 2WULA 4TR3A 1MDJA 11GSA 5F07A 2GQLA 1HNBA 2GQKA 2ON5A 3F8UA 3TJKA 3GTUB 2VCTA 3TKSE 5ECMB 3FRCA 3APQA 2MYGA 3MDKA 2HRFA 3HCZA 1FVKA 1R26A 1PL2A 2J9HA 1ZCPA 3ZFLA 18GSA 1R5AA 2ES7A 4KX4A 3VWWA 2JSYA 3TGZA 3QOUA 5HR0A 2WDUA 2O89A 4BPYA 2PU9C 2YN1A 2VCVA 1EOGA 3DMLA 3LSZA 4LMVA 2H74A 2R2JA 2R37A 4PURA 2YP6A 2R3XA 1GLPA 4PNFA 4V2NA 4L8EA 3QPMA 4IJIA 1GSSA 1YQ1A 3CSHA 3A3TA 3BD2A 3C73A 3HKRA 3IXRA 1TDIA 5C04A 1T00A 2M72A 4XRAA 1GUHA 1OE7A 1SU9A 2C8UA 1SL2B 1SD8A 1WOUA 1OKTA 4PQ1A 2VL2C 1JLVA 4IP1A 3G7JA 3QR6A 4EDZA 4TR1A 1HQOA 2NPBA 5HR3A 1SL0B 2X8GA 3C8EA 3CXGA 1VRSD 3Q19A 1PRXA 2JACA 2IMDA 3Q6OA 2PBJA 1PX7A 2XBIA 4OO4A 2BMXA 3LFLA 4POLA 2AYTA 1Z9HA 1E2YA 5A4WA 3LYPA 5DALA 1FG4A 3D0ZA 2IIYA 3UAPA 2B7JA 2BTOT 2HE3A 1OE8A 1UVZA 1VF2A 2P5RA 4HJMA 3QCPA 3CSJA 2EC4A 4KSOA 3L9UA 3LWAA 4K1FA 4OCEA 4X0XA 2K9FA 1IYHA 2LV3A 5B6MA 1GLQA 1TRSA 3FZ9A 4POMA 4K9ZA 4JR4A 2XPDA 3IAM2 3PGTA 4F9ZA 4KA0A 1URMA 3C1SA 4OCFA 1EWXA 2O8VB 1R5PA 3D4MA 4K6XA 2VAFA 1SK1A 1GTIA 3GRXA 2A4VA 5H5QA 3RDWA 3HHVA 6GSUA 3GSTA 2ZCTA 2YZHA 5DCHA 4HZ4A 5AIXA 4E8EA 1QMVA 1PX6A 3BCIA 4XIHA 2NTOA 5F8BA 1OVNA 3ERWA 2A2SA 4ZB8A 2LEGA 1R4WA 3ZTLA 2VLVA 2H30A 1AUCA 4O5RA 1ZYQB 1JZDA 2HFDA 2P31A 6GSYA 2JZTA 1DUGA 1AQWA 4MJCA 4HU7A 2HZEA 1ZL9A 2LJKA 2VCZA 4WEYA 2OADA 2YWMA 5DBQA 2L4QA 2VL3A 2K8SA 1MTCA 3HYPA 2YOIA 2I9HA 2LRNA 4X43A 3QFAC 2C80A 5AGYA 5FHIA 3A2WA 3EWLA 1V9WA 4EVMA 2CVDA 2OE3A 13GSA 4YAVA 1PL1A 3GTUA 3W8JA 4ZXGA 2HT9A 2IPAA 3UEMA 1QXHA 2CX4A 5ECRB 5LCZA 4GQFA 1T4YA 5EL8A 1XCCA 3L78A 1YY7A 3GUSA 3ED3A 2H6ZA 4BL7A 3QDNA 1PMTA 2H1AA 2EIOA 1CQGA 3KTBA 1FW1A 4ZL8A 4IBPA 2F51A 4K0GA 2GSSA 3LORA 4XHMA 4MF5A 4FIWA 1QFNA 1RQMA 1EOHA 3BBYA 1GWCA 3KJYA 5F0GA 4IVFA 3M1GA 2P0GA 5ECSA 1SL1B 5IQYA 4GF0A 3OR5A 2VLUA 2MBSA 1GNWA 3DRNA 2R4VA 1FB6A 1UN2A 3RPPA 4F2IA 5B6NA 3ERFA 1XW6A 2H8LA 1F6MC 1NHOA 4ECBA 2NDOA 2IMKA 2PUKC 3APSA 4ECIA 4XS4B 4G19A 4J56E 4EC0A 5IMFA 1XZOA 3NIVA 2GVPA 4PUAA 5DCGA 5A4VA 2E7PA 4FH8A 4RI7A 1QK8A 4PUFC 3RHCA 1ACVA 1F3AA 3I6AA 4LL1B 2WS2A 2TRCP 4YAPA 1G0TA 2RLIA 4MPFA 2X99A 2A2RA 5CRDA 2AHEA 1OC9B 2OJLA 3F3RA 3R2QA 1EEJA 1E6BA 4YQUA 3MSZA 4LMWA 3TRXA 3HXSA 3KP8A 3N5OA 1R7HA 4CDOA 3GNJA 4FYBA 1KNGA 2AUVA 3GKMA 2H75A 4MH3A 1Z6NA 4JEDA 2L4CA 5ECLB 1TKDB 2IL3A 2MMNA 1GSDA 1SD9A 4K7OA 1OKDA 4KB3A 4AJ6A 4HS1A 2XBQA 3FK8A 4F0CA 22GSA 3KMOA 2H0GA 5J9CA 4WBRD 2VCWA 1BJXA 3F0IA 4MLYA 4IN0A 4TR4A 3HJOA 4MCUA 5ECPB 4AGSA 1EV9A 3D21A 4XTSA 1A2LA 3M9KA 4POKA 3ZVJA 4JU5A 1O85A 5D9VA 5GZZB 4XS6A 12GSA 5G5EA 5J9BA 3H8QA 3FZ4A 5J41A 2VM1A 2OE1A 2KP2A 2FD3A 1G6WA 2C0EA 2C0FA 4F0BA 3EMPA 3KP9A 4Z7XA 4KAEA 1V98A 1ILOA 3GIXA 3P7XA 5HR1A 20GSA 2C3TA 3DKSA 3QD9A 16GSA 1M9BA 3HDCA 4H86A 3TUEA 2FHEA 1ZOFA 4ML6A 1X0RA 4N30A 3ZMLA 3GMFA 1SJIA 4O92A 2GSRA 3EU3A 4FO5A 5G2ZA 1WRYA 1X5DA 3ME7A 3P90A 4GQCA 3TJJA 1JFUA 3ZYWA 5KEJA 5DQYA 2HNLA 1THOA 3L9VA 4G10A 2O85A 3WT2A 1M99A 4I5QA 1A23A 5FT3A 3CTFA 4WXTA 4ZBDA 1RK4A 4DSQA 5ABRA 1JZWA 5C00A 3IA1A 4HQSA 1OAZA 1O8WA 1W89A 5DAKB 4NMUA 1GSUA 5IOWA 2VM2A 1GSQA 1G7OA 4L5OA 1VGLA 3O6TA 3HJPA 4KDXA 4N0ZA 1K3OA 5CRHA 3VWVA 1LJRA 2RIIA 3LG6A 4I2TA 3K8NA 1K0NA 3FZ5A 2B7KA 1FO5A 3HD5A 2VL2A 2KP1A 1TP9A 2G0FA 4I6XA 1A0RP 3UBLA 2N5BA 3KMNA 4NPBA 3VLNA 3GL3A 5A4UA 3TCOA 1HNCA 4MA9A 4MF6A 3M8NA 2OACA 3LEFA 2PERA 1O73A 2FY6A 5LNKe 2FCHA 2DJKA 3IOSA 3UOMA 3CSIA 1SKRB 2H72A 2CAIA 1ZZYA 4LL4B 4GLTA 2GZYA 2I1UA 2V2GA 2EIRA 4IELA 3BCKA 2VO4A 1A0FA 3TOTA 4OWYA 1PKWA 4IW9A 2WJUA 4V2LA 3ZFBA 1QGVA 4GWRA 5ELGA 3FW2A 1B4PA 5B8AA 4TXVA 1EZKA 5HR2A 3PH9A 3C71A 1K0OA 3IBHA 3VPQA 1ERUA 1V58A 2YCDA 4ILFA 3IHQA 1HYUA 3D22A 2LJAA 4L0WA 4PXOA 1F37A 1S3CA 2DJ2A 3FYGA 1GUKA 4GSTA 2VLTA 3TRQA 1AC1A 2NVLA 1K0BA 2VCQA 2QC7A 3WGEA 4I2UA 3U5RE 3GH9A 5CP1A 1MDKA 3GKNA 1OYJA 2JZRA 4KDYA 2DJ1A 2DBCA 1X9SB 3EYTA 1YF1A 3LXZA 5JWRB 2LQQA 1TK5B 1SK2A 1K0DA 4ZB6A 5GAND 1QUWA 4GRFA 5COHA 3IV4A 4ISDA 4N0VA 3VI7A 2F8AA 3WD6A 1M9AA 3TKQA 1F9MA 3US3A 5G1KA 1XW9A 1Q98A 3E3EA 3GSSA 3P2AA 2H6YA 1XXUA 1USBA 2GT6A 4PQIA 4Q5NA 1XWAA 4ZB9A 10GSA 4ID0A 5KN1A 3ZREA 1EP8A 3MNGA 4PGTA 3ERGA 2HRNA 6GSTA 1LBKA 2RUEA 1XWBA 3VK9A 3DGQA 2RUFA 1FOVA 1U3IA 3J7Yb 5D9XA 2B5EA 4MABA 3HVVA 2WZ9A 4OFTA 1S3DA 3NZNA 5ID2B 1WE0A 1UC7A 4TRXA 4HJ2A 1GSEA 1K0MA 3ZRDA 2HSHA 3EC3A 1G6YA 5DDLA 2L57A 5G31A 5ECQB 1GH2A 4AJ7A 4OFNA 1U6TA 2GSQA 2YJ7A 1PKZA 4KW6A 1SKSB 2IJYA 2DMLA 4WF5A 1B48A 1K3LA 3GN3A 3DXBA 4BVYA 1WMJA 4IKHA 2MMZA 4K0NA 2RM5A 2PVOC 4BWQA 1AW9A 1T7PB 3E0UA 2LUSA 2HZFA 2VUPA 2YV9A 4MH2A 1NM3A 4NHWA 1T1VA 4K2DA 1JZOA 3L9SA 3HVSA 1OC3A 1MD3A 2IMIA 2FA4A 3ZIVA 1H75A 4KCAA 3KZQA 1FHEA 3CRUA 1Z7PA 1Z6MA 3KH7A 4G2EA 1K0CA 1S3AA 4GSSA 1ML6A 3TRPA 1GTUA 2V6OA 4RUVA 2YWIA 4KH7A 1A8YA 4WETA 5DAKA 2YWOA 4CW9A 2B5XA 1VF3A 2XC2A 2H1DA 3KH9A 1H4OA 3PR8A 2IWTA 4ML1A 4EXJA 2FNOA 5CRGA 4Q5QA 2WB9A 5IMZA 1N8JA 3GKXA 5EPFA 3JCML 2L5OA 2YANA 3GURA 2DJ3A 1V40A 4KGIA 4D73B 4MMMA 4DSSB 3I69A 3WT1A 3SBCA 2B1LA 4WR5A 1O6JA 2FWFA 3RAZA 1T3BA 4BA7A 3UL3A 5IMCA 1YJ6A 3VI5A 2CV4A 2DC5A 1RW1A 1O81A 2RM6A 4ECJA 3IDVA 5ELAA 5F05A 2PWJA 2YPMA 4Q5FA 5ECNB 4MZBA 2B5YA 3HA9A 4G9HA 1B9YC 2H1GA 2H71A
chains in the Genus database with same CATH superfamily
2JL4A 1M2AA 3GX0A 4QQ7A 4TOPA 1JZRA 5H5RA 2VCXA 4TN8A 1XWCA 4TR0A 3IHGA 2IN3A 4HZ2A 4GSNA 4QL9A 1SKWB 6GSXA 4TW5A 4IGJA 3CRTA 3TJFA 3EINA 1EP7A 1A2MA 3D6IA 2L6DA 4K5RA 2C0DA 3N9JA 3GYKA 9GSSA 1A24A 8GSSA 3FEUA 2OBKA 4EUYA 3F6DA 4NV5A 1CQHA 2C4JA 3MAKA 2BJXA 3MYDA 3TJBA 4TR1B 3J7Yk 2CZ2A 1YKAA 5JWOB 5JCUA 3F9UA 4WF4A 2FLSA 1BG5A 2AJQB 3A2VA 3G7YA 3WYWA 1EGOA 2OE0A 2YJHA 2LJRA 2JZSA 3IE3A 4O5QA 4KUNA 4L0UA 3W6GA 2P5QA 1AIUA 1YF0A 1WPIA 1XOBA 4EE0A 2GZZA 2X8CA 2O87A 3H1NA 2MMAA 5CREA 1SYRA 4NXIA 5L71A 3HZ4A 1FAAA 3IK7A 1O7UA 2YWNA 3QAGA 1TJDA 1GTAA 1Z3EA 2PGTA 1T4ZA 3ZMKA 2WCIA 1SJ6A 4HSCX 5F06A 2KLXA 5D9WA 4ZBAA 1A8LA 4AF2A 2CAQA 4HQZA 2PPTA 2DIZA 4N11A 5ID2A 3ZLPA 4GXZA 4K7NA 4Z2RA 3APOA 3D5JA 2N5AA 4GTUA 4JRRA 1ERVA 3F4RA 2GGTA 2DJJA 2ON7A 3KM6A 1U3AA 1ON4A 4WBJA 3IAS2 5B7CA 1WP0A 1ERWA 1DBYA 2LNTA 1XOAA 3IC4A 2KOKA 5DJLA 2X8HA 1F2EA 2LRTA 2IMFA 4Q5RA 5A5KA 2ZNMA 4LLRA 5JWQB 1TI3A 4I97A 2L59A 2R0CA 3LXTA 5D9TA 4TVEA 4EDYA 5IMAA 3CYNA 4KDUA 2GZPA 5J5NA 2MBTA 1I5GA 4I8BA 4ZILA 2QKEA 2F3MA 4EIQA 3GKKA 2HRAA 3GV1A 3LJRA 3W8SA 1VF4A 2KUCA 2YZUA 5EY6A 1A2JA 3DWVA 3V1WA 4IHUA 1OC8A 1DE1A 3ZL5A 2HSYA 4HDEA 4JR6A 1X5EA 1AQVA 1Y25A 3F63A 1GSYA 2GSTA 4RI6A 1TU7A 1TTZA 4F03A 2H6XA 5AIVA 3UARA 1THXA 2NBSA 1TW9A 4NHZA 1BYEA 2X4AA 1IYIA 2OA7A 2LSTA 1UA5A 4DSRA 5IPHA 1KTEA 1QQ2A 3WGXA 3FR6A 1TRWA 4D73A 3UVHA 1XG8A 2L6CA 1MEKA 3ZZXA 3I9V2 3H79A 4TXOB 2CT6A 5GSSA 1TRVA 2YV7A 2OKAA 3KD0A 4JE1A 1HNAA 5E59A 4HI7A 4ECCA 5IMDA 3UMAA 5CNWA 1FB0A 2WRTA 2O7KA 3CMIA 4BL7B 4HU9A 2CQ9A 5CYYA 1B4QA 5G1LA 19GSA 2H0HA 1VF1A 5HFKA 5KN3A 5D73A 4O5UA 4FYUA 4XCSA 2FWEA 1KBNA 2M46A 5FWGA 4EKZA 1V2AA 4HEA2 1XBSA 2AV4A 2C0GA 2V6KA 3CTGA 3E9JB 5DJMA 2K8VA 4DEJA 1B9XC 3UIWA 1YDKA 3KGKA 4XS4A 3F3QA 3IK9A 3L0HA 4ZIJA 2D2ZA 5CRWA 1ZGNA 4Z2TA 3I43A 3FHKA 1K0AA 2TRXA 3HVNA 4IQ1A 2LNSA 2LTKA 2VOCA 3QAWA 2GS3A 2H19A 1TI1A 5AISA 3ME8A 1G7EA 2DMMA 2F8FA 4V2MA 4OD7A 4OO5A 1OC9A 4K7IA 2H70A 3FR3A 2VL9A 2IMEA 5DQSA 1XWKA 3KTLA 3DVXA 4JZQA 2XHFA 2REMA 4HUAA 4EL1A 4F82A 2FUG2 2GT5A 2WFCA 4BVXB 3G7IA 1BEDA 4X1UA 1HD2A 14GSA 2ZUPA 2HYXA 4MP4A 4KE3A 4POBA 5G5FA 5HQPA 1SJZA 6GSVA 2FWHA 3P8WA 4ICYA 2IFQB 3GH6A 2VD0A 1M2BA 1C72A 5ECKB 1T8EB 1TXXA 1NHYA 3M9JA 4EIPA 1TK8B 3VWUA 4J57E 6GSWA 1M7TA 5HFIA 2C3NA 2J23A 1BX9A 5J4UA 4USSA 5ECHB 4KNDA 5KN2A 3VWXA 2VIMA 2I4AA 5ECIB 5IPGA 2H73A 3IRAA 4MF7A 3DIEA 2MMOA 4EF0A 3GL5A 2QSIA 3A2XA 3DD3A 4DVCA 2F9SA 3RBTA 1AAZA 3GX8A 1BAYA 3DEXA 1Z5YE 3HY2A 2FWGA 2GQMA 2DKHA 1J08A 2GDRA 4J2FA 4XRDA 2PVQA 1U87A 2B1KA 4MJEA 2H1BA 2LRCA 1K3YA 4FYCA 5B8BA 4MJBA 1GSFA 4O32A 4OMVA 1GULA 2MZCA 5GAPD 3EVIA 3NOFA 17GSA 1AQXA 5ENUA 1W4VA 2AB6A 4KSMA 3G9BA 2JSZA 4IP6A 1YEPA 5JCGA 5ECOB 3M0FA 2K6VA 2VD1A 4ZL7A 2L5LA 2FA8A 4PX1A 3WGDA 1X5CA 3F4TA 1PGTA 3ZVJD 4BWSA 3CBUA 4HOJA 5IOXA 1PSQA 1JLWA 1XPVA 5HFGA 3IPZA 1XVWA 2M80A 1GP1A 4N10A 3S9FA 2H01A 4IS0A 4JBBA 3GA4A 2H0IA 1WWJA 4MDCA 3FY7A 1SK0A 2I3YA 1TU8A 4IQAA 4IJ3A 3TDGA 1M0UA 4TXOA 1GUMA 2PN8A 5G30A 3SWLA 4K8MA 3FKFA 1TRUA 4MK3A 1N2AA 3VPTA 5DVBA 3ZIJA 4ACSA 1EEMA 3Q18A 4YH2A 4NAXA 3PPUA 4E8HA 1PQNA 1PA3A 4V1Ap 3QMXA 2R6KA 4LA1A 4PQHA 7GSSA 4NV2A 1GRXA 1XVQA 1GNEA 2GLRA 2LS5A 2B6MA 1B8XA 3DVWA 2HI7A 5GSTA 4MPGA 3IR4A 4P3YB 1J9BA 1ZYNA 1XW5A 2G2QA 2QGVA 3BOAA 3PINA 4K5SA 3KCMA 2K18A 2HRKA 2TIRA 1X9MB 5IM9A 4ZBBA 2X64A 1O8XA 3KXOA 1ERTA 1PD21 3D4TA 5D8IA 2H76A 4YQVA 1TOFA 1PN9A 4WR4A 1ABAA 2C1YA 3TKRA 4RQXA 1Y6EA 2DSAA 3EMXA 1ZYEA 4L5LA 3C1RA 3RPNA 2X49A 1DE2A 1YZXA 3UVTA 3FZAA 2OBIA 5INYA 2LQOA 3C7MA 3M3MA 3KIJA 4WKWA 4CHSA 3BJ5A 2E0QA 1I9DA 5IO0A 2CZ3A 2V41A 1XFLA 1TK0B 3GHAA 3Q74A 2KHPA 3TKPA 2H66A 3EU4A 2HLSA 3QAVA 3GFKA 2N5FA 5IIZA 4O7HA 4EO3A 3AY8A 1NW2A 3O3TA 5CO3A 2XPEA 1JHBA 4BVXA 2B3SA 2I81A 1AXDA 3MWHA 4G0IA 2JU5A 3LGCA 1YEXA 1EV4A 1KEBA 4MJAA 5DALB 4XS1A 2JADA 5IO2A 4QL7A 5LD0A 2Z9SA 1DSBA 1XIYA 2IFQA 3L4NA 2WGRA 2E2MA 2HXKA 5EVOA 1YKCA 1GL8A 3TOUA 1V57A 4MZCA 4ULXA 1EGRA 3HJMA 5AN1A 4PNGA 2EIQA 3QFBC 4Z2UA 4MZWA 4V1Ag 2LKUA 1FVJA 3EE2A 3U6VA 1X9WB 3F6FA 3H93A 1WIKA 5E4WA 1XWGA 3UBKA 1BQ7A 1NSWA 1Z7RA 2CVBA 4BIKA 2V32A 2CA8A 2FGXA 3H4KA 1SYXA 3A5WA 3RHBA 3ISOA 1LU4A 3TKSA 3HZ8A 4OFMA 2ALBA 2DLXA 2GTUA 5D96A 2CX3A 3UJ1A 6GSSA 1SENA 2R5GA 2V1MA 2PMTA 3LQ7A 3EURA 1MD4A 3O76A 4TKYA 2C3QA 3ZITA 4KCEA 1F3BA 3VURA 2AAWA 4NWYA 3LYKA 4MNNA 5H5SA 3FR9A 3VFIA 4AJ8A 5KN0A 1U88A 5IMVA 2HZEB 1ZMAA 1WJKA 1GTBA 1M2DA 1MDIA 2CVKA 3TB2A 3F4SA 3TJGA 3HVXA 1ST9A 2DIYA 5CAXA 1Q4JA 2YNXA 3KEBA 2DJ0A 1J0FA 5J3RA 4GCIA 3TKSC 4RQRA 4ZL9A 5D93A 3DYRA 5JCWA 4YQMA 4DSSA 2E2GA 2WULA 4TR3A 1MDJA 11GSA 5F07A 2GQLA 1HNBA 2GQKA 2ON5A 3F8UA 3TJKA 3GTUB 2VCTA 3TKSE 5ECMB 3FRCA 3APQA 2MYGA 3MDKA 2HRFA 3HCZA 1FVKA 1R26A 1PL2A 2J9HA 1ZCPA 3ZFLA 18GSA 1R5AA 2ES7A 4KX4A 3VWWA 2JSYA 3TGZA 3QOUA 5HR0A 2WDUA 2O89A 4BPYA 2R0GA 2PU9C 2YN1A 2VCVA 1EOGA 3DMLA 3LSZA 4LMVA 3R3EA 2H74A 2R2JA 2R37A 4PURA 2YP6A 2R3XA 1GLPA 4PNFA 4V2NA 4L8EA 3QPMA 4IJIA 1GSSA 1YQ1A 3CSHA 3A3TA 3BD2A 3C73A 3HKRA 3IXRA 1TDIA 5C04A 1T00A 2M72A 4XRAA 1GUHA 1OE7A 1SU9A 2C8UA 1SL2B 1SD8A 1WOUA 1OKTA 2A2PA 4PQ1A 2VL2C 1JLVA 4IP1A 3G7JA 3QR6A 4EDZA 4TR1A 1HQOA 2NPBA 1S3RA 5HR3A 1SL0B 2X8GA 3C8EA 3CXGA 1VRSD 3Q19A 1PRXA 2JACA 2IMDA 3Q6OA 2PBJA 1PX7A 2XBIA 4OO4A 2BMXA 3LFLA 4POLA 2AYTA 1Z9HA 1E2YA 5A4WA 3LYPA 5DALA 1FG4A 3D0ZA 2IIYA 3UAPA 2B7JA 2BTOT 2HE3A 1OE8A 1UVZA 1VF2A 2P5RA 4HJMA 3QCPA 3CSJA 5KOXA 2EC4A 4KSOA 3L9UA 3LWAA 4K1FA 4OCEA 4X0XA 2K9FA 1IYHA 1ZYPA 2LV3A 5B6MA 1GLQA 1TRSA 3FZ9A 4POMA 4K9ZA 4JR4A 2XPDA 3IAM2 3PGTA 4F9ZA 4KA0A 1URMA 3C1SA 3A5IA 4OCFA 1EWXA 2O8VB 1R5PA 3D4MA 4K6XA 4G0KA 2VAFA 1SK1A 1GTIA 3GRXA 2A4VA 5H5QA 3RDWA 3HHVA 6GSUA 3GSTA 2ZCTA 2YZHA 5DCHA 4HZ4A 5AIXA 4E8EA 1QMVA 1PX6A 3BCIA 4XIHA 2NTOA 5F8BA 1OVNA 3ERWA 2A2SA 4ZB8A 2LEGA 1R4WA 3ZTLA 2VLVA 2H30A 1AUCA 4O5RA 1ZYQB 1JZDA 2HFDA 2P31A 6GSYA 2JZTA 2A4HA 1DUGA 1AQWA 4MJCA 4HU7A 2HZEA 1ZL9A 2LJKA 2VCZA 4WEYA 2OADA 2YWMA 5DBQA 2L4QA 2VL3A 2K8SA 3IC8A 1MTCA 3HYPA 2YOIA 2I9HA 2LRNA 4X43A 3CQFA 3QFAC 2C80A 5AGYA 5FHIA 3A2WA 3EWLA 1V9WA 4EVMA 2CVDA 2OE3A 13GSA 4YAVA 1PL1A 3GTUA 3W8JA 4ZXGA 2HT9A 2IPAA 4YKGA 3UEMA 1QXHA 2CX4A 5ECRB 5LCZA 4GQFA 1T4YA 5EL8A 1XCCA 3L78A 1YY7A 3GUSA 3ED3A 2H6ZA 4BL7A 3QDNA 1PMTA 2H1AA 2EIOA 1CQGA 3KTBA 1FW1A 4ZL8A 4IBPA 2F51A 4K0GA 2GSSA 3LORA 4XHMA 4MF5A 4FIWA 1QFNA 1RQMA 1EOHA 3BBYA 1GWCA 3KJYA 5F0GA 4IVFA 3M1GA 2P0GA 5ECSA 1SL1B 4CY8A 5IQYA 4GF0A 3OR5A 2VLUA 2MBSA 1FOHA 1GNWA 3DRNA 2R4VA 1FB6A 1UN2A 3RPPA 4F2IA 5B6NA 3ERFA 1XW6A 2H8LA 1F6MC 1NHOA 4ECBA 2NDOA 2IMKA 2PUKC 3APSA 4ECIA 4XS4B 4G19A 3LW9A 4J56E 4EC0A 5IMFA 1XZOA 3NIVA 2GVPA 4PUAA 1M3IA 5DCGA 5A4VA 2E7PA 4FH8A 4RI7A 1QK8A 4PUFC 4A5PA 3RHCA 1ACVA 1F3AA 3I6AA 4LL1B 2WS2A 2TRCP 4YAPA 5BRTA 1G0TA 2RLIA 4MPFA 2X99A 2A2RA 5CRDA 2AHEA 1OC9B 1PFOA 2OJLA 3F3RA 3R2QA 1EEJA 1E6BA 4YQUA 3MSZA 4LMWA 3TRXA 3HXSA 3KP8A 3N5OA 1R7HA 4CDOA 3GNJA 4FYBA 1KNGA 2AUVA 3GKMA 2H75A 4MH3A 1Z6NA 4JEDA 2L4CA 5ECLB 1TKDB 2IL3A 2MMNA 1GSDA 1SD9A 4K7OA 1OKDA 4KB3A 4AJ6A 4HS1A 2XBQA 3FK8A 4F0CA 22GSA 3KMOA 2H0GA 5J9CA 4WBRD 2VCWA 1BJXA 3F0IA 4MLYA 4IN0A 4TR4A 3HJOA 4MCUA 5ECPB 4AGSA 1EV9A 3D21A 4XTSA 1A2LA 3M9KA 4POKA 3ZVJA 4JU5A 1O85A 5D9VA 5GZZB 4XS6A 12GSA 5G5EA 5J9BA 3H8QA 3FZ4A 5J41A 2VM1A 2OE1A 2KP2A 2FD3A 1G6WA 2C0EA 2C0FA 4F0BA 3EMPA 3KP9A 4Z7XA 4KAEA 1V98A 1ILOA 3GIXA 3P7XA 5HR1A 1PN0A 20GSA 2C3TA 3DKSA 3QD9A 16GSA 1M9BA 3HDCA 4H86A 3TUEA 2FHEA 1ZOFA 4BVYB 4ML6A 1X0RA 4N30A 3ZMLA 3GMFA 1SJIA 4O92A 2GSRA 3EU3A 4FO5A 5G2ZA 1WRYA 1X5DA 3ME7A 3P90A 4GQCA 3TJJA 1JFUA 3ZYWA 5KEJA 5DQYA 2HNLA 1THOA 3L9VA 4G10A 2O85A 3WT2A 1M99A 4I5QA 1A23A 5FT3A 3CTFA 4WXTA 4ZBDA 1RK4A 4DSQA 5ABRA 1JZWA 5C00A 2DKIA 4CY6A 3IA1A 4HQSA 1OAZA 1O8WA 1W89A 5DAKB 4NMUA 1GSUA 5IOWA 2VM2A 4K2XA 1GSQA 1G7OA 4L5OA 1VGLA 3O6TA 3HJPA 4KDXA 4N0ZA 1K3OA 5CRHA 4X4JA 3VWVA 1LJRA 2RIIA 3LG6A 4I2TA 3K8NA 1K0NA 3FZ5A 2B7KA 1FO5A 3HD5A 2VL2A 2KP1A 1TP9A 4FQUA 2G0FA 4I6XA 1A0RP 3UBLA 2N5BA 3KMNA 4NPBA 3VLNA 3GL3A 5A4UA 3TCOA 1HNCA 4MA9A 4MF6A 3M8NA 2OACA 3LEFA 2PERA 1O73A 4KF9A 2FY6A 2QA2A 5LNKe 2FCHA 2DJKA 3IOSA 3UOMA 3CSIA 1SKRB 2H72A 2CAIA 1ZZYA 4LL4B 4GLTA 2GZYA 2I1UA 2V2GA 2EIRA 4IELA 3BCKA 2VO4A 1A0FA 3TOTA 4OWYA 1PKWA 4IW9A 2WJUA 4V2LA 3ZFBA 1QGVA 4GWRA 5ELGA 3FW2A 5KOWA 1B4PA 5B8AA 4TXVA 1EZKA 5HR2A 3PH9A 3C71A 1K0OA 3IBHA 3VPQA 1ERUA 1V58A 2YCDA 4ILFA 3IHQA 1HYUA 3D22A 2LJAA 4L0WA 4PXOA 1F37A 1S3CA 2DJ2A 3FYGA 1GUKA 4GSTA 2VLTA 3TRQA 1AC1A 2NVLA 1K0BA 2VCQA 2QC7A 3WGEA 4I2UA 3U5RE 3GH9A 5CP1A 1MDKA 3GKNA 1OYJA 2JZRA 4KDYA 2DJ1A 2DBCA 1X9SB 4YKFA 3EYTA 1YF1A 3LXZA 5JWRB 2LQQA 1TK5B 1SK2A 1K0DA 4ZB6A 3EPTA 5GAND 1QUWA 4GRFA 5COHA 3IV4A 4ISDA 4N0VA 3VI7A 2F8AA 3WD6A 1M9AA 3TKQA 1F9MA 3US3A 5G1KA 1XW9A 1Q98A 3E3EA 3FMWA 3GSSA 3P2AA 2H6YA 1XXUA 1M3JA 1USBA 2GT6A 4PQIA 4Q5NA 1XWAA 3MIXA 4ZB9A 10GSA 4ID0A 2R0PA 5KN1A 3ZREA 1EP8A 3MNGA 4PGTA 3ERGA 2HRNA 6GSTA 1LBKA 2RUEA 1XWBA 3VK9A 3DGQA 2RUFA 1FOVA 1U3IA 3J7Yb 5D9XA 2B5EA 4MABA 3HVVA 2WZ9A 4OFTA 1S3DA 3NZNA 5ID2B 1WE0A 1UC7A 4TRXA 4HJ2A 1GSEA 1K0MA 3ZRDA 2HSHA 3EC3A 1G6YA 5DDLA 2L57A 5G31A 5ECQB 1GH2A 4AJ7A 4OFNA 1U6TA 2GSQA 2YJ7A 1PKZA 4KW6A 1SKSB 2IJYA 2DMLA 4WF5A 1B48A 1K3LA 3GN3A 3DXBA 4BVYA 1WMJA 4IKHA 2MMZA 4K0NA 2RM5A 2PVOC 4BWQA 1AW9A 1T7PB 3E0UA 2LUSA 2HZFA 2VUPA 2YV9A 4MH2A 1NM3A 4NHWA 1T1VA 4K2DA 1JZOA 3L9SA 3HVSA 2QA1A 1OC3A 1MD3A 2IMIA 2FA4A 3ZIVA 4PTSA 1H75A 4KCAA 3KZQA 1FHEA 3CRUA 1Z7PA 1Z6MA 3KH7A 4G2EA 1K0CA 1S3AA 4GSSA 1ML6A 3TRPA 1GTUA 2V6OA 4RUVA 2YWIA 4KH7A 1A8YA 4WETA 5DAKA 2YWOA 4CW9A 2B5XA 1VF3A 2XC2A 2H1DA 3KH9A 1H4OA 3PR8A 2IWTA 4ML1A 4EXJA 2FNOA 5CRGA 4Q5QA 2WB9A 5IMZA 1N8JA 2HSMA 3GKXA 5EPFA 3JCML 2L5OA 2YANA 3GURA 2DJ3A 1V40A 4KGIA 4D73B 5BMUA 4MMMA 4DSSB 3I69A 3WT1A 3SBCA 2B1LA 4WR5A 1O6JA 2FWFA 3RAZA 1T3BA 4BA7A 3UL3A 4G0LA 5IMCA 1YJ6A 3VI5A 2CV4A 2DC5A 1RW1A 1O81A 2RM6A 4ECJA 3IDVA 5ELAA 5F05A 2PWJA 2YPMA 4Q5FA 2UZ8A 5ECNB 4MZBA 2B5YA 3HA9A 4G9HA 1B9YC 2H1GA 2H71A
chains in the Genus database with same CATH topology
2JL4A 1M2AA 3GX0A 4QQ7A 4TOPA 1JZRA 5H5RA 2VCXA 4TN8A 1XWCA 4TR0A 3IHGA 2IN3A 4HZ2A 4GSNA 4QL9A 1SKWB 6GSXA 4TW5A 4IGJA 3CRTA 3TJFA 3EINA 1EP7A 1A2MA 3D6IA 2L6DA 4K5RA 2C0DA 3N9JA 3GYKA 9GSSA 1A24A 8GSSA 3FEUA 2OBKA 4EUYA 3F6DA 4NV5A 1CQHA 2C4JA 3MAKA 2BJXA 3MYDA 3TJBA 4TR1B 3J7Yk 2CZ2A 1YKAA 5JWOB 5JCUA 3F9UA 4WF4A 2FLSA 1BG5A 2AJQB 3A2VA 3G7YA 3WYWA 1EGOA 2OE0A 2YJHA 2LJRA 2JZSA 3IE3A 4O5QA 4KUNA 4L0UA 3W6GA 2P5QA 1AIUA 1YF0A 1WPIA 1XOBA 4EE0A 2GZZA 2X8CA 2O87A 3H1NA 2MMAA 5CREA 1SYRA 4NXIA 5L71A 3HZ4A 1FAAA 3IK7A 1O7UA 2YWNA 3QAGA 1TJDA 1GTAA 1Z3EA 2PGTA 1T4ZA 3ZMKA 2WCIA 1SJ6A 5F06A 2KLXA 5D9WA 4ZBAA 1A8LA 4AF2A 2CAQA 4HQZA 2PPTA 2DIZA 4N11A 5ID2A 3ZLPA 4GXZA 4K7NA 4Z2RA 3APOA 3D5JA 2N5AA 4GTUA 4JRRA 1ERVA 3F4RA 2GGTA 2DJJA 2ON7A 3KM6A 1U3AA 1ON4A 4WBJA 3IAS2 5B7CA 1WP0A 1ERWA 1DBYA 2LNTA 1XOAA 3IC4A 2KOKA 5DJLA 2X8HA 1F2EA 2LRTA 2IMFA 4Q5RA 5A5KA 2ZNMA 4LLRA 5JWQB 1TI3A 4I97A 2L59A 2R0CA 3LXTA 5D9TA 4TVEA 4EDYA 5IMAA 3CYNA 4KDUA 2GZPA 5J5NA 2MBTA 1I5GA 4I8BA 4ZILA 2QKEA 2F3MA 4EIQA 3GKKA 2HRAA 3GV1A 3LJRA 3W8SA 1VF4A 2KUCA 2YZUA 5EY6A 1A2JA 3DWVA 3V1WA 4IHUA 1OC8A 1DE1A 3ZL5A 2HSYA 4HDEA 4JR6A 1X5EA 1AQVA 1Y25A 3F63A 1GSYA 2GSTA 4RI6A 1TU7A 1TTZA 4F03A 2H6XA 5AIVA 3UARA 1THXA 2NBSA 1TW9A 4NHZA 1BYEA 2X4AA 1IYIA 2OA7A 2LSTA 1UA5A 4DSRA 5IPHA 1KTEA 1QQ2A 3WGXA 3FR6A 1TRWA 4D73A 3UVHA 2L6CA 1MEKA 3ZZXA 3I9V2 3H79A 4TXOB 2CT6A 5GSSA 1TRVA 2YV7A 2OKAA 3KD0A 4JE1A 1HNAA 5E59A 4HI7A 4ECCA 5IMDA 3UMAA 5CNWA 1FB0A 2WRTA 2O7KA 3CMIA 4BL7B 4HU9A 2CQ9A 5CYYA 1B4QA 5G1LA 19GSA 2H0HA 1VF1A 5HFKA 5KN3A 5D73A 4O5UA 4FYUA 4XCSA 2FWEA 1KBNA 2M46A 5FWGA 4EKZA 1V2AA 4HEA2 1XBSA 2AV4A 2C0GA 2V6KA 3CTGA 3E9JB 5DJMA 2K8VA 4DEJA 1B9XC 3UIWA 1YDKA 3KGKA 4XS4A 3F3QA 3IK9A 3L0HA 4ZIJA 2D2ZA 5CRWA 1ZGNA 4Z2TA 3I43A 3FHKA 1K0AA 2TRXA 4IQ1A 2LNSA 2LTKA 2VOCA 3QAWA 2GS3A 2H19A 1TI1A 5AISA 3ME8A 1G7EA 2DMMA 2F8FA 4V2MA 4OD7A 4OO5A 1OC9A 4K7IA 2H70A 3FR3A 2VL9A 2IMEA 5DQSA 1XWKA 3KTLA 3DVXA 4JZQA 2XHFA 2REMA 4HUAA 4EL1A 4F82A 2FUG2 2GT5A 2WFCA 4BVXB 3G7IA 1BEDA 4X1UA 1HD2A 14GSA 2ZUPA 2HYXA 4MP4A 4KE3A 4POBA 5G5FA 5HQPA 1SJZA 6GSVA 2FWHA 3P8WA 4ICYA 2IFQB 3GH6A 2VD0A 1M2BA 1C72A 5ECKB 1T8EB 1TXXA 1NHYA 3M9JA 4EIPA 1TK8B 3VWUA 4J57E 6GSWA 1M7TA 5HFIA 2C3NA 2J23A 1BX9A 5J4UA 4USSA 5ECHB 4KNDA 5KN2A 3VWXA 2VIMA 2I4AA 5ECIB 5IPGA 2H73A 3IRAA 4MF7A 3DIEA 2MMOA 4EF0A 3GL5A 2QSIA 3A2XA 3DD3A 4DVCA 2F9SA 3RBTA 1AAZA 3GX8A 1BAYA 3DEXA 1Z5YE 3HY2A 2FWGA 2GQMA 2DKHA 1J08A 2GDRA 4J2FA 4XRDA 2PVQA 1U87A 2B1KA 4MJEA 2H1BA 2LRCA 1K3YA 4FYCA 5B8BA 4MJBA 1GSFA 4O32A 4OMVA 1GULA 2MZCA 5GAPD 3EVIA 3NOFA 17GSA 1AQXA 5ENUA 1W4VA 2AB6A 4KSMA 3G9BA 2JSZA 4IP6A 1YEPA 5JCGA 5ECOB 3M0FA 2K6VA 2VD1A 4ZL7A 2L5LA 2FA8A 4PX1A 3WGDA 1X5CA 3F4TA 1PGTA 3ZVJD 4BWSA 3CBUA 4HOJA 5IOXA 1PSQA 1JLWA 1XPVA 5HFGA 3IPZA 1XVWA 2M80A 1GP1A 4N10A 3S9FA 2H01A 4IS0A 4JBBA 3GA4A 2H0IA 1WWJA 4MDCA 3FY7A 1SK0A 2I3YA 1TU8A 4IQAA 4IJ3A 3TDGA 1M0UA 4TXOA 1GUMA 2PN8A 5G30A 3SWLA 4K8MA 3FKFA 1TRUA 4MK3A 1N2AA 3VPTA 5DVBA 3ZIJA 4ACSA 1EEMA 3Q18A 4YH2A 4NAXA 3PPUA 4E8HA 1PQNA 1PA3A 4V1Ap 3QMXA 2R6KA 4LA1A 4PQHA 7GSSA 4NV2A 1GRXA 1XVQA 1GNEA 2GLRA 2LS5A 2B6MA 1B8XA 3DVWA 2HI7A 5GSTA 4MPGA 3IR4A 4P3YB 1J9BA 1ZYNA 1XW5A 2G2QA 2QGVA 3BOAA 3PINA 4K5SA 3KCMA 2K18A 2HRKA 2TIRA 1X9MB 5IM9A 4ZBBA 2X64A 1O8XA 3KXOA 1ERTA 1PD21 3D4TA 5D8IA 2H76A 4YQVA 1TOFA 1PN9A 4WR4A 1ABAA 2C1YA 3TKRA 4RQXA 1Y6EA 2DSAA 3EMXA 1ZYEA 4L5LA 3C1RA 3RPNA 2X49A 1DE2A 1YZXA 3UVTA 3FZAA 2OBIA 5INYA 2LQOA 3C7MA 3M3MA 3KIJA 4WKWA 4CHSA 3BJ5A 2E0QA 1I9DA 5IO0A 2CZ3A 2V41A 1XFLA 1TK0B 3GHAA 3Q74A 2KHPA 3TKPA 2H66A 3EU4A 2HLSA 3QAVA 3GFKA 2N5FA 5IIZA 4O7HA 4EO3A 3AY8A 1NW2A 3O3TA 5CO3A 2XPEA 1JHBA 4BVXA 2B3SA 2I81A 1AXDA 3MWHA 4G0IA 2JU5A 3LGCA 1YEXA 1EV4A 1KEBA 4MJAA 5DALB 4XS1A 2JADA 5IO2A 4QL7A 5LD0A 2Z9SA 1DSBA 1XIYA 2IFQA 3L4NA 2WGRA 2E2MA 2HXKA 5EVOA 1YKCA 1GL8A 3TOUA 1V57A 4MZCA 4ULXA 1EGRA 3HJMA 5AN1A 4PNGA 2EIQA 3QFBC 4Z2UA 4MZWA 4V1Ag 2LKUA 1FVJA 3EE2A 3U6VA 1X9WB 3F6FA 3H93A 1WIKA 5E4WA 1XWGA 3UBKA 1BQ7A 1NSWA 1Z7RA 2CVBA 2V32A 2CA8A 2FGXA 3H4KA 1SYXA 3A5WA 3RHBA 3ISOA 1LU4A 3TKSA 3HZ8A 4OFMA 2ALBA 2DLXA 2GTUA 5D96A 2CX3A 3UJ1A 6GSSA 1SENA 2R5GA 2V1MA 2PMTA 3LQ7A 3EURA 1MD4A 3O76A 4TKYA 2C3QA 3ZITA 4KCEA 1F3BA 3VURA 2AAWA 4NWYA 3LYKA 4MNNA 5H5SA 3FR9A 3VFIA 4AJ8A 5KN0A 1U88A 5IMVA 2HZEB 1ZMAA 1WJKA 1GTBA 1M2DA 1MDIA 2CVKA 3TB2A 3F4SA 3TJGA 3HVXA 1ST9A 2DIYA 5CAXA 1Q4JA 2YNXA 3KEBA 2DJ0A 1J0FA 5J3RA 4GCIA 3TKSC 4RQRA 4ZL9A 5D93A 3DYRA 5JCWA 4YQMA 4DSSA 2E2GA 2WULA 4TR3A 1MDJA 11GSA 5F07A 2GQLA 1HNBA 2GQKA 2ON5A 3F8UA 3TJKA 3GTUB 2VCTA 3TKSE 5ECMB 3FRCA 3APQA 2MYGA 3MDKA 2HRFA 3HCZA 1FVKA 1R26A 1PL2A 2J9HA 1ZCPA 3ZFLA 18GSA 1R5AA 2ES7A 4KX4A 3VWWA 2JSYA 3TGZA 3QOUA 5HR0A 2WDUA 2O89A 4BPYA 2R0GA 2PU9C 2YN1A 2VCVA 1EOGA 3DMLA 3LSZA 4LMVA 3R3EA 2H74A 2R2JA 2R37A 4PURA 2YP6A 2R3XA 1GLPA 4PNFA 4V2NA 4L8EA 3QPMA 4IJIA 1GSSA 1YQ1A 3CSHA 3A3TA 3BD2A 3C73A 3HKRA 3IXRA 1TDIA 5C04A 1T00A 2M72A 4XRAA 1GUHA 1OE7A 1SU9A 2C8UA 1SL2B 1SD8A 1WOUA 1OKTA 2A2PA 4PQ1A 2VL2C 1JLVA 4IP1A 3G7JA 3QR6A 4EDZA 4TR1A 1HQOA 2NPBA 5HR3A 1SL0B 2X8GA 3C8EA 3CXGA 1VRSD 3Q19A 1PRXA 2JACA 2IMDA 3Q6OA 2PBJA 1PX7A 2XBIA 4OO4A 2BMXA 3LFLA 4POLA 2AYTA 1Z9HA 1E2YA 5A4WA 3LYPA 5DALA 1FG4A 3D0ZA 2IIYA 3UAPA 2B7JA 2BTOT 2HE3A 1OE8A 1UVZA 1VF2A 2P5RA 4HJMA 3QCPA 3CSJA 5KOXA 2EC4A 4KSOA 3L9UA 3LWAA 4K1FA 4OCEA 4X0XA 2K9FA 1IYHA 1ZYPA 2LV3A 5B6MA 1GLQA 1TRSA 3FZ9A 4POMA 4K9ZA 4JR4A 2XPDA 3IAM2 3PGTA 4F9ZA 4KA0A 1URMA 3C1SA 3A5IA 4OCFA 1EWXA 2O8VB 1R5PA 3D4MA 4K6XA 4G0KA 2VAFA 1SK1A 1GTIA 3GRXA 2A4VA 5H5QA 3RDWA 3HHVA 6GSUA 3GSTA 2ZCTA 2YZHA 5DCHA 4HZ4A 5AIXA 4E8EA 1QMVA 1PX6A 3BCIA 4XIHA 2NTOA 5F8BA 1OVNA 3ERWA 2A2SA 4ZB8A 2LEGA 1R4WA 3ZTLA 2VLVA 2H30A 1AUCA 4O5RA 1ZYQB 1JZDA 2HFDA 2P31A 6GSYA 2JZTA 2A4HA 1DUGA 1AQWA 4MJCA 4HU7A 2HZEA 1ZL9A 2LJKA 2VCZA 4WEYA 2OADA 2YWMA 5DBQA 2L4QA 2VL3A 2K8SA 3IC8A 1MTCA 3HYPA 2YOIA 2I9HA 2LRNA 4X43A 3QFAC 2C80A 5AGYA 5FHIA 3A2WA 3EWLA 1V9WA 4EVMA 2CVDA 2OE3A 13GSA 4YAVA 1PL1A 3GTUA 3W8JA 4ZXGA 2HT9A 2IPAA 4YKGA 3UEMA 1QXHA 2CX4A 5ECRB 5LCZA 4GQFA 1T4YA 5EL8A 1XCCA 3L78A 1YY7A 3GUSA 3ED3A 2H6ZA 4BL7A 3QDNA 1PMTA 2H1AA 2EIOA 1CQGA 3KTBA 1FW1A 4ZL8A 4IBPA 2F51A 4K0GA 2GSSA 3LORA 4XHMA 4MF5A 4FIWA 1QFNA 1RQMA 1EOHA 3BBYA 1GWCA 3KJYA 5F0GA 4IVFA 3M1GA 2P0GA 5ECSA 1SL1B 4CY8A 5IQYA 4GF0A 3OR5A 2VLUA 2MBSA 1FOHA 1GNWA 3DRNA 2R4VA 1FB6A 1UN2A 3RPPA 4F2IA 5B6NA 3ERFA 1XW6A 2H8LA 1F6MC 1NHOA 4ECBA 2NDOA 2IMKA 2PUKC 3APSA 4ECIA 4XS4B 4G19A 3LW9A 4J56E 4EC0A 5IMFA 1XZOA 3NIVA 2GVPA 4PUAA 5DCGA 5A4VA 2E7PA 4FH8A 4RI7A 1QK8A 4PUFC 4A5PA 3RHCA 1ACVA 1F3AA 3I6AA 4LL1B 2WS2A 2TRCP 4YAPA 5BRTA 1G0TA 2RLIA 4MPFA 2X99A 2A2RA 5CRDA 2AHEA 1OC9B 2OJLA 3F3RA 3R2QA 1EEJA 1E6BA 4YQUA 3MSZA 4LMWA 3TRXA 3HXSA 3KP8A 3N5OA 1R7HA 4CDOA 3GNJA 4FYBA 1KNGA 2AUVA 3GKMA 2H75A 4MH3A 1Z6NA 4JEDA 2L4CA 5ECLB 1TKDB 2IL3A 2MMNA 1GSDA 1SD9A 4K7OA 1OKDA 4KB3A 4AJ6A 4HS1A 2XBQA 3FK8A 4F0CA 22GSA 3KMOA 2H0GA 5J9CA 4WBRD 2VCWA 1BJXA 3F0IA 4MLYA 4IN0A 4TR4A 3HJOA 4MCUA 5ECPB 4AGSA 1EV9A 3D21A 4XTSA 1A2LA 3M9KA 4POKA 3ZVJA 4JU5A 1O85A 5D9VA 5GZZB 4XS6A 12GSA 5G5EA 5J9BA 3H8QA 3FZ4A 5J41A 2VM1A 2OE1A 2KP2A 2FD3A 1G6WA 2C0EA 2C0FA 4F0BA 3EMPA 3KP9A 4Z7XA 4KAEA 1V98A 1ILOA 3GIXA 3P7XA 5HR1A 1PN0A 20GSA 2C3TA 3DKSA 3QD9A 16GSA 1M9BA 3HDCA 4H86A 3TUEA 2FHEA 1ZOFA 4BVYB 4ML6A 1X0RA 4N30A 3ZMLA 3GMFA 1SJIA 4O92A 2GSRA 3EU3A 4FO5A 5G2ZA 1WRYA 1X5DA 3ME7A 3P90A 4GQCA 3TJJA 1JFUA 3ZYWA 5KEJA 5DQYA 2HNLA 1THOA 3L9VA 4G10A 2O85A 3WT2A 1M99A 4I5QA 1A23A 5FT3A 3CTFA 4WXTA 4ZBDA 1RK4A 4DSQA 5ABRA 1JZWA 5C00A 2DKIA 4CY6A 3IA1A 4HQSA 1OAZA 1O8WA 1W89A 5DAKB 4NMUA 1GSUA 5IOWA 2VM2A 4K2XA 1GSQA 1G7OA 4L5OA 1VGLA 3O6TA 3HJPA 4KDXA 4N0ZA 1K3OA 5CRHA 4X4JA 3VWVA 1LJRA 2RIIA 3LG6A 4I2TA 3K8NA 1K0NA 3FZ5A 2B7KA 1FO5A 3HD5A 2VL2A 2KP1A 1TP9A 4FQUA 2G0FA 4I6XA 1A0RP 3UBLA 2N5BA 3KMNA 4NPBA 3VLNA 3GL3A 5A4UA 3TCOA 1HNCA 4MA9A 4MF6A 3M8NA 2OACA 3LEFA 2PERA 1O73A 4KF9A 2FY6A 2QA2A 5LNKe 2FCHA 2DJKA 3IOSA 3UOMA 3CSIA 1SKRB 2H72A 2CAIA 1ZZYA 4LL4B 4GLTA 2GZYA 2I1UA 2V2GA 2EIRA 4IELA 3BCKA 2VO4A 1A0FA 3TOTA 4OWYA 1PKWA 4IW9A 2WJUA 4V2LA 3ZFBA 1QGVA 4GWRA 5ELGA 3FW2A 5KOWA 1B4PA 5B8AA 4TXVA 1EZKA 5HR2A 3PH9A 3C71A 1K0OA 3IBHA 3VPQA 1ERUA 1V58A 2YCDA 4ILFA 3IHQA 1HYUA 3D22A 2LJAA 4L0WA 4PXOA 1F37A 1S3CA 2DJ2A 3FYGA 1GUKA 4GSTA 2VLTA 3TRQA 1AC1A 2NVLA 1K0BA 2VCQA 2QC7A 3WGEA 4I2UA 3U5RE 3GH9A 5CP1A 1MDKA 3GKNA 1OYJA 2JZRA 4KDYA 2DJ1A 2DBCA 1X9SB 4YKFA 3EYTA 1YF1A 3LXZA 5JWRB 2LQQA 1TK5B 1SK2A 1K0DA 4ZB6A 3EPTA 5GAND 1QUWA 4GRFA 5COHA 3IV4A 4ISDA 4N0VA 3VI7A 2F8AA 3WD6A 1M9AA 3TKQA 1F9MA 3US3A 5G1KA 1XW9A 1Q98A 3E3EA 3FMWA 3GSSA 3P2AA 2H6YA 1XXUA 1USBA 2GT6A 4PQIA 4Q5NA 1XWAA 3MIXA 4ZB9A 10GSA 4ID0A 2R0PA 5KN1A 3ZREA 1EP8A 3MNGA 4PGTA 3ERGA 2HRNA 6GSTA 1LBKA 2RUEA 1XWBA 3VK9A 3DGQA 2RUFA 1FOVA 1U3IA 3J7Yb 5D9XA 2B5EA 4MABA 3HVVA 2WZ9A 4OFTA 1S3DA 3NZNA 5ID2B 1WE0A 1UC7A 4TRXA 4HJ2A 1GSEA 1K0MA 3ZRDA 2HSHA 3EC3A 1G6YA 5DDLA 2L57A 5G31A 5ECQB 1GH2A 4AJ7A 4OFNA 1U6TA 2GSQA 2YJ7A 1PKZA 4KW6A 1SKSB 2IJYA 2DMLA 4WF5A 1B48A 1K3LA 3GN3A 3DXBA 4BVYA 1WMJA 4IKHA 2MMZA 4K0NA 2RM5A 2PVOC 4BWQA 1AW9A 1T7PB 3E0UA 2LUSA 2HZFA 2VUPA 2YV9A 4MH2A 1NM3A 4NHWA 1T1VA 4K2DA 1JZOA 3L9SA 3HVSA 2QA1A 1OC3A 1MD3A 2IMIA 2FA4A 3ZIVA 4PTSA 1H75A 4KCAA 3KZQA 1FHEA 3CRUA 1Z7PA 1Z6MA 3KH7A 4G2EA 1K0CA 1S3AA 4GSSA 1ML6A 3TRPA 1GTUA 2V6OA 4RUVA 2YWIA 4KH7A 1A8YA 4WETA 5DAKA 2YWOA 4CW9A 2B5XA 1VF3A 2XC2A 2H1DA 3KH9A 1H4OA 3PR8A 2IWTA 4ML1A 4EXJA 2FNOA 5CRGA 4Q5QA 2WB9A 5IMZA 1N8JA 2HSMA 3GKXA 5EPFA 3JCML 2L5OA 2YANA 3GURA 2DJ3A 1V40A 4KGIA 4D73B 5BMUA 4MMMA 4DSSB 3I69A 3WT1A 3SBCA 2B1LA 4WR5A 1O6JA 2FWFA 3RAZA 1T3BA 4BA7A 3UL3A 4G0LA 5IMCA 1YJ6A 3VI5A 2CV4A 2DC5A 1RW1A 1O81A 2RM6A 4ECJA 3IDVA 5ELAA 5F05A 2PWJA 2YPMA 4Q5FA 2UZ8A 5ECNB 4MZBA 2B5YA 3HA9A 4G9HA 1B9YC 2H1GA 2H71A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JL4 A;  1M2A A;  3GX0 A;  4QQ7 A;  4TOP A;  1JZR A;  5H5R A;  2VCX A;  4TN8 A;  1XWC A;  4TR0 A;  2IN3 A;  4HZ2 A;  4GSN A;  4QL9 A;  1SKW B;  6GSX A;  4TW5 A;  4IGJ A;  3CRT A;  3TJF A;  3EIN A;  1EP7 A;  1A2M A;  3D6I A;  2L6D A;  2C0D A;  3N9J A;  3GYK A;  9GSS A;  1A24 A;  8GSS A;  3FEU A;  2OBK A;  4EUY A;  3F6D A;  4NV5 A;  1CQH A;  2C4J A;  3MAK A;  2BJX A;  3TJB A;  4TR1 B;  3J7Y k;  2CZ2 A;  1YKA A;  5JWO B;  5JCU A;  3F9U A;  4WF4 A;  2FLS A;  1BG5 A;  2AJQ B;  3A2V A;  3G7Y A;  3WYW A;  1EGO A;  2OE0 A;  2YJH A;  2LJR A;  2JZS A;  3IE3 A;  4KUN A;  4L0U A;  3W6G A;  2P5Q A;  1AIU A;  1YF0 A;  1WPI A;  1XOB A;  4EE0 A;  2GZZ A;  2X8C A;  2O87 A;  3H1N A;  2MMA A;  5CRE A;  1SYR A;  4NXI A;  5L71 A;  3HZ4 A;  1FAA A;  3IK7 A;  1O7U A;  2YWN A;  3QAG A;  1TJD A;  1GTA A;  1Z3E A;  2PGT A;  1T4Z A;  3ZMK A;  2WCI A;  1SJ6 A;  5F06 A;  2KLX A;  5D9W A;  4ZBA A;  1A8L A;  4AF2 A;  2CAQ A;  4HQZ A;  2PPT A;  2DIZ A;  4N11 A;  5ID2 A;  3ZLP A;  4GXZ A;  4K7N A;  3APO A;  3D5J A;  2N5A A;  4GTU A;  4JRR A;  1ERV A;  3F4R A;  2GGT A;  2DJJ A;  2ON7 A;  3KM6 A;  1U3A A;  1ON4 A;  4WBJ A;  3IAS 2;  5B7C A;  1WP0 A;  1ERW A;  1DBY A;  2LNT A;  1XOA A;  3IC4 A;  2KOK A;  5DJL A;  2X8H A;  1F2E A;  2LRT A;  2IMF A;  4Q5R A;  5A5K A;  2ZNM A;  4LLR A;  5JWQ B;  1TI3 A;  4I97 A;  2L59 A;  3LXT A;  5D9T A;  4TVE A;  4EDY A;  5IMA A;  3CYN A;  4KDU A;  2GZP A;  5J5N A;  2MBT A;  1I5G A;  4I8B A;  4ZIL A;  2QKE A;  2F3M A;  3GKK A;  3GV1 A;  3LJR A;  3W8S A;  1VF4 A;  2KUC A;  2YZU A;  5EY6 A;  1A2J A;  3DWV A;  3V1W A;  4IHU A;  1OC8 A;  1DE1 A;  3ZL5 A;  2HSY A;  4HDE A;  4JR6 A;  1X5E A;  1AQV A;  1Y25 A;  3F63 A;  1GSY A;  2GST A;  4RI6 A;  1TU7 A;  1TTZ A;  4F03 A;  2H6X A;  5AIV A;  3UAR A;  1THX A;  2NBS A;  1TW9 A;  4NHZ A;  1BYE A;  1IYI A;  2OA7 A;  2LST A;  1UA5 A;  4DSR A;  5IPH A;  1KTE A;  1QQ2 A;  3WGX A;  3FR6 A;  1TRW A;  4D73 A;  3UVH A;  2L6C A;  1MEK A;  3ZZX A;  3I9V 2;  3H79 A;  4TXO B;  2CT6 A;  5GSS A;  1TRV A;  2YV7 A;  2OKA A;  3KD0 A;  4JE1 A;  1HNA A;  5E59 A;  4HI7 A;  4ECC A;  5IMD A;  3UMA A;  5CNW A;  1FB0 A;  2WRT A;  2O7K A;  3CMI A;  4HU9 A;  2CQ9 A;  5CYY A;  1B4Q A;  5G1L A;  19GS A;  2H0H A;  1VF1 A;  5HFK A;  5KN3 A;  5D73 A;  4FYU A;  4XCS A;  2FWE A;  1KBN A;  2M46 A;  5FWG A;  4EKZ A;  1V2A A;  4HEA 2;  1XBS A;  2AV4 A;  2C0G A;  2V6K A;  3CTG A;  3E9J B;  5DJM A;  2K8V A;  4DEJ A;  1B9X C;  3UIW A;  1YDK A;  3KGK A;  4XS4 A;  3F3Q A;  3IK9 A;  3L0H A;  4ZIJ A;  2D2Z A;  5CRW A;  1ZGN A;  3I43 A;  3FHK A;  1K0A A;  2TRX A;  4IQ1 A;  2LNS A;  2LTK A;  2VOC A;  3QAW A;  2GS3 A;  2H19 A;  1TI1 A;  5AIS A;  3ME8 A;  1G7E A;  2DMM A;  2F8F A;  4V2M A;  4OD7 A;  4OO5 A;  1OC9 A;  4K7I A;  2H70 A;  3FR3 A;  2VL9 A;  2IME A;  5DQS A;  1XWK A;  3KTL A;  3DVX A;  4JZQ A;  2XHF A;  2REM A;  4HUA A;  4EL1 A;  4F82 A;  2FUG 2;  2GT5 A;  2WFC A;  3G7I A;  1BED A;  4X1U A;  1HD2 A;  14GS A;  2ZUP A;  2HYX A;  4MP4 A;  4KE3 A;  4POB A;  5G5F A;  5HQP A;  1SJZ A;  6GSV A;  2FWH A;  3P8W A;  2IFQ B;  3GH6 A;  2VD0 A;  1M2B A;  1C72 A;  5ECK B;  1T8E B;  1TXX A;  1NHY A;  3M9J A;  1TK8 B;  3VWU A;  4J57 E;  6GSW A;  1M7T A;  5HFI A;  2C3N A;  2J23 A;  1BX9 A;  5J4U A;  5ECH B;  4KND A;  5KN2 A;  3VWX A;  2VIM A;  2I4A A;  5ECI B;  5IPG A;  2H73 A;  3IRA A;  4MF7 A;  3DIE A;  2MMO A;  4EF0 A;  3GL5 A;  2QSI A;  3A2X A;  3DD3 A;  4DVC A;  2F9S A;  3RBT A;  1AAZ A;  3GX8 A;  1BAY A;  3DEX A;  1Z5Y E;  3HY2 A;  2FWG A;  2GQM A;  1J08 A;  2GDR A;  4J2F A;  4XRD A;  2PVQ A;  1U87 A;  2B1K A;  4MJE A;  2H1B A;  2LRC A;  1K3Y A;  4FYC A;  5B8B A;  4MJB A;  1GSF A;  4O32 A;  4OMV A;  1GUL A;  2MZC A;  5GAP D;  3EVI A;  3NOF A;  17GS A;  1AQX A;  5ENU A;  1W4V A;  2AB6 A;  4KSM A;  3G9B A;  2JSZ A;  4IP6 A;  1YEP A;  5JCG A;  5ECO B;  3M0F A;  2K6V A;  2VD1 A;  4ZL7 A;  2L5L A;  2FA8 A;  4PX1 A;  3WGD A;  1X5C A;  3F4T A;  1PGT A;  3ZVJ D;  4BWS A;  3CBU A;  4HOJ A;  5IOX A;  1PSQ A;  1JLW A;  1XPV A;  5HFG A;  3IPZ A;  1XVW A;  2M80 A;  1GP1 A;  4N10 A;  3S9F A;  2H01 A;  4IS0 A;  4JBB A;  3GA4 A;  2H0I A;  1WWJ A;  4MDC A;  3FY7 A;  1SK0 A;  2I3Y A;  1TU8 A;  4IQA A;  4IJ3 A;  3TDG A;  1M0U A;  4TXO A;  1GUM A;  2PN8 A;  5G30 A;  3SWL A;  4K8M A;  3FKF A;  1TRU A;  4MK3 A;  1N2A A;  3VPT A;  5DVB A;  3ZIJ A;  4ACS A;  1EEM A;  3Q18 A;  4YH2 A;  4NAX A;  4E8H A;  1PQN A;  1PA3 A;  4V1A p;  3QMX A;  2R6K A;  4LA1 A;  4PQH A;  7GSS A;  4NV2 A;  1GRX A;  1XVQ A;  1GNE A;  2GLR A;  2LS5 A;  2B6M A;  1B8X A;  3DVW A;  2HI7 A;  5GST A;  4MPG A;  3IR4 A;  4P3Y B;  1J9B A;  1XW5 A;  2G2Q A;  2QGV A;  3BOA A;  3PIN A;  3KCM A;  2K18 A;  2TIR A;  1X9M B;  5IM9 A;  4ZBB A;  2X64 A;  1O8X A;  3KXO A;  1ERT A;  1PD2 1;  3D4T A;  5D8I A;  2H76 A;  4YQV A;  1TOF A;  1PN9 A;  4WR4 A;  1ABA A;  2C1Y A;  3TKR A;  4RQX A;  1Y6E A;  2DSA A;  3EMX A;  1ZYE A;  4L5L A;  3C1R A;  3RPN A;  1DE2 A;  1YZX A;  3UVT A;  3FZA A;  2OBI A;  5INY A;  2LQO A;  3C7M A;  3M3M A;  3KIJ A;  4WKW A;  4CHS A;  3BJ5 A;  2E0Q A;  1I9D A;  5IO0 A;  2CZ3 A;  2V41 A;  1XFL A;  1TK0 B;  3GHA A;  3Q74 A;  2KHP A;  3TKP A;  2H66 A;  3EU4 A;  2HLS A;  3QAV A;  3GFK A;  2N5F A;  5IIZ A;  4O7H A;  4EO3 A;  3AY8 A;  1NW2 A;  3O3T A;  5CO3 A;  2XPE A;  1JHB A;  4BVX A;  2B3S A;  2I81 A;  1AXD A;  3MWH A;  2JU5 A;  3LGC A;  1YEX A;  1EV4 A;  1KEB A;  4MJA A;  5DAL B;  4XS1 A;  2JAD A;  5IO2 A;  4QL7 A;  5LD0 A;  2Z9S A;  1DSB A;  1XIY A;  2IFQ A;  3L4N A;  2WGR A;  2E2M A;  2HXK A;  5EVO A;  1YKC A;  1GL8 A;  3TOU A;  1V57 A;  4MZC A;  4ULX A;  1EGR A;  3HJM A;  5AN1 A;  4PNG A;  2EIQ A;  3QFB C;  4MZW A;  4V1A g;  2LKU A;  1FVJ A;  3EE2 A;  3U6V A;  1X9W B;  3F6F A;  3H93 A;  1WIK A;  5E4W A;  1XWG A;  3UBK A;  1BQ7 A;  1NSW A;  1Z7R A;  2CVB A;  2V32 A;  2CA8 A;  2FGX A;  3H4K A;  1SYX A;  3A5W A;  3RHB A;  3ISO A;  1LU4 A;  3TKS A;  3HZ8 A;  4OFM A;  2ALB A;  2DLX A;  2GTU A;  5D96 A;  2CX3 A;  3UJ1 A;  6GSS A;  1SEN A;  2R5G A;  2V1M A;  2PMT A;  3LQ7 A;  3EUR A;  1MD4 A;  3O76 A;  4TKY A;  2C3Q A;  3ZIT A;  4KCE A;  1F3B A;  3VUR A;  2AAW A;  4NWY A;  3LYK A;  5H5S A;  3FR9 A;  3VFI A;  4AJ8 A;  5KN0 A;  1U88 A;  5IMV A;  2HZE B;  1ZMA A;  1WJK A;  1GTB A;  1M2D A;  1MDI A;  2CVK A;  3TB2 A;  3F4S A;  3TJG A;  3HVX A;  1ST9 A;  2DIY A;  5CAX A;  1Q4J A;  2YNX A;  3KEB A;  2DJ0 A;  1J0F A;  5J3R A;  4GCI A;  3TKS C;  4RQR A;  4ZL9 A;  5D93 A;  3DYR A;  5JCW A;  4YQM A;  4DSS A;  2E2G A;  2WUL A;  4TR3 A;  1MDJ A;  11GS A;  5F07 A;  2GQL A;  1HNB A;  2GQK A;  2ON5 A;  3F8U A;  3TJK A;  3GTU B;  2VCT A;  3TKS E;  5ECM B;  3FRC A;  3APQ A;  2MYG A;  3MDK A;  2HRF A;  3HCZ A;  1FVK A;  1R26 A;  1PL2 A;  2J9H A;  1ZCP A;  3ZFL A;  18GS A;  1R5A A;  2ES7 A;  4KX4 A;  3VWW A;  2JSY A;  3TGZ A;  3QOU A;  5HR0 A;  2WDU A;  2O89 A;  4BPY A;  2PU9 C;  2YN1 A;  2VCV A;  1EOG A;  3DML A;  3LSZ A;  4LMV A;  2H74 A;  2R2J A;  2R37 A;  4PUR A;  2YP6 A;  2R3X A;  1GLP A;  4PNF A;  4V2N A;  4L8E A;  3QPM A;  4IJI A;  1GSS A;  1YQ1 A;  3CSH A;  3A3T A;  3BD2 A;  3C73 A;  3HKR A;  3IXR A;  1TDI A;  5C04 A;  1T00 A;  2M72 A;  4XRA A;  1GUH A;  1OE7 A;  1SU9 A;  2C8U A;  1SL2 B;  1SD8 A;  1WOU A;  1OKT A;  4PQ1 A;  2VL2 C;  1JLV A;  4IP1 A;  3G7J A;  3QR6 A;  4EDZ A;  4TR1 A;  1HQO A;  2NPB A;  5HR3 A;  1SL0 B;  2X8G A;  3C8E A;  3CXG A;  1VRS D;  3Q19 A;  1PRX A;  2JAC A;  2IMD A;  3Q6O A;  2PBJ A;  1PX7 A;  2XBI A;  4OO4 A;  2BMX A;  3LFL A;  4POL A;  2AYT A;  1Z9H A;  1E2Y A;  5A4W A;  3LYP A;  5DAL A;  1FG4 A;  3D0Z A;  2IIY A;  3UAP A;  2B7J A;  2BTO T;  2HE3 A;  1OE8 A;  1UVZ A;  1VF2 A;  2P5R A;  4HJM A;  3QCP A;  3CSJ A;  2EC4 A;  4KSO A;  3L9U A;  3LWA A;  4K1F A;  4OCE A;  4X0X A;  2K9F A;  1IYH A;  2LV3 A;  5B6M A;  1GLQ A;  1TRS A;  3FZ9 A;  4POM A;  4K9Z A;  4JR4 A;  2XPD A;  3IAM 2;  3PGT A;  4F9Z A;  4KA0 A;  1URM A;  3C1S A;  4OCF A;  1EWX A;  2O8V B;  1R5P A;  3D4M A;  4K6X A;  2VAF A;  1SK1 A;  1GTI A;  3GRX A;  2A4V A;  5H5Q A;  3RDW A;  3HHV A;  6GSU A;  3GST A;  2ZCT A;  2YZH A;  5DCH A;  4HZ4 A;  5AIX A;  4E8E A;  1QMV A;  1PX6 A;  3BCI A;  4XIH A;  2NTO A;  5F8B A;  1OVN A;  3ERW A;  2A2S A;  4ZB8 A;  2LEG A;  1R4W A;  3ZTL A;  2VLV A;  2H30 A;  1AUC A;  4O5R A;  1ZYQ B;  1JZD A;  2HFD A;  2P31 A;  6GSY A;  2JZT A;  1DUG A;  1AQW A;  4MJC A;  4HU7 A;  2HZE A;  1ZL9 A;  2LJK A;  2VCZ A;  4WEY A;  2OAD A;  2YWM A;  5DBQ A;  2L4Q A;  2VL3 A;  2K8S A;  1MTC A;  3HYP A;  2YOI A;  2I9H A;  2LRN A;  4X43 A;  3QFA C;  2C80 A;  5AGY A;  5FHI A;  3A2W A;  3EWL A;  1V9W A;  4EVM A;  2CVD A;  2OE3 A;  13GS A;  4YAV A;  1PL1 A;  3GTU A;  3W8J A;  4ZXG A;  2HT9 A;  2IPA A;  3UEM A;  1QXH A;  2CX4 A;  5ECR B;  5LCZ A;  4GQF A;  1T4Y A;  5EL8 A;  1XCC A;  3L78 A;  1YY7 A;  3GUS A;  3ED3 A;  2H6Z A;  4BL7 A;  3QDN A;  1PMT A;  2H1A A;  2EIO A;  1CQG A;  3KTB A;  1FW1 A;  4ZL8 A;  4IBP A;  2F51 A;  4K0G A;  2GSS A;  3LOR A;  4XHM A;  4MF5 A;  4FIW A;  1QFN A;  1RQM A;  1EOH A;  3BBY A;  1GWC A;  3KJY A;  5F0G A;  4IVF A;  3M1G A;  2P0G A;  5ECS A;  1SL1 B;  5IQY A;  4GF0 A;  3OR5 A;  2VLU A;  2MBS A;  1GNW A;  3DRN A;  2R4V A;  1FB6 A;  1UN2 A;  3RPP A;  4F2I A;  5B6N A;  3ERF A;  1XW6 A;  2H8L A;  1F6M C;  1NHO A;  4ECB A;  2NDO A;  2IMK A;  2PUK C;  3APS A;  4ECI A;  4XS4 B;  4G19 A;  4J56 E;  4EC0 A;  5IMF A;  1XZO A;  3NIV A;  2GVP A;  4PUA A;  5DCG A;  5A4V A;  2E7P A;  4FH8 A;  4RI7 A;  1QK8 A;  4PUF C;  3RHC A;  1ACV A;  1F3A A;  3I6A A;  4LL1 B;  2WS2 A;  2TRC P;  4YAP A;  1G0T A;  2RLI A;  4MPF A;  2X99 A;  2A2R A;  5CRD A;  2AHE A;  1OC9 B;  2OJL A;  3F3R A;  3R2Q A;  1EEJ A;  1E6B A;  4YQU A;  3MSZ A;  4LMW A;  3TRX A;  3HXS A;  3KP8 A;  3N5O A;  1R7H A;  4CDO A;  3GNJ A;  4FYB A;  1KNG A;  2AUV A;  3GKM A;  2H75 A;  4MH3 A;  1Z6N A;  4JED A;  2L4C A;  5ECL B;  1TKD B;  2IL3 A;  2MMN A;  1GSD A;  1SD9 A;  4K7O A;  1OKD A;  4KB3 A;  4AJ6 A;  4HS1 A;  2XBQ A;  3FK8 A;  4F0C A;  22GS A;  3KMO A;  2H0G A;  5J9C A;  4WBR D;  2VCW A;  1BJX A;  3F0I A;  4MLY A;  4IN0 A;  4TR4 A;  3HJO A;  4MCU A;  5ECP B;  4AGS A;  1EV9 A;  3D21 A;  4XTS A;  1A2L A;  3M9K A;  4POK A;  3ZVJ A;  4JU5 A;  1O85 A;  5D9V A;  5GZZ B;  4XS6 A;  12GS A;  5G5E A;  5J9B A;  3H8Q A;  3FZ4 A;  5J41 A;  2VM1 A;  2OE1 A;  2KP2 A;  2FD3 A;  1G6W A;  2C0E A;  2C0F A;  4F0B A;  3EMP A;  3KP9 A;  4Z7X A;  4KAE A;  1V98 A;  1ILO A;  3GIX A;  3P7X A;  5HR1 A;  20GS A;  2C3T A;  3DKS A;  3QD9 A;  16GS A;  1M9B A;  3HDC A;  4H86 A;  3TUE A;  2FHE A;  1ZOF A;  4ML6 A;  1X0R A;  4N30 A;  3ZML A;  3GMF A;  1SJI A;  4O92 A;  2GSR A;  3EU3 A;  4FO5 A;  5G2Z A;  1WRY A;  1X5D A;  3ME7 A;  3P90 A;  4GQC A;  3TJJ A;  1JFU A;  3ZYW A;  5KEJ A;  5DQY A;  2HNL A;  1THO A;  3L9V A;  4G10 A;  2O85 A;  3WT2 A;  1M99 A;  4I5Q A;  1A23 A;  5FT3 A;  3CTF A;  4WXT A;  4ZBD A;  1RK4 A;  4DSQ A;  5ABR A;  1JZW A;  5C00 A;  3IA1 A;  4HQS A;  1OAZ A;  1O8W A;  1W89 A;  5DAK B;  4NMU A;  1GSU A;  5IOW A;  2VM2 A;  1GSQ A;  1G7O A;  4L5O A;  1VGL A;  3O6T A;  3HJP A;  4KDX A;  4N0Z A;  1K3O A;  5CRH A;  3VWV A;  1LJR A;  2RII A;  3LG6 A;  4I2T A;  3K8N A;  1K0N A;  3FZ5 A;  2B7K A;  1FO5 A;  3HD5 A;  2VL2 A;  2KP1 A;  1TP9 A;  2G0F A;  4I6X A;  1A0R P;  3UBL A;  2N5B A;  3KMN A;  4NPB A;  3VLN A;  3GL3 A;  5A4U A;  3TCO A;  1HNC A;  4MA9 A;  4MF6 A;  3M8N A;  2OAC A;  3LEF A;  2PER A;  1O73 A;  2FY6 A;  5LNK e;  2FCH A;  2DJK A;  3IOS A;  3UOM A;  3CSI A;  1SKR B;  2H72 A;  2CAI A;  1ZZY A;  4LL4 B;  4GLT A;  2GZY A;  2I1U A;  2V2G A;  2EIR A;  4IEL A;  3BCK A;  2VO4 A;  1A0F A;  3TOT A;  4OWY A;  1PKW A;  4IW9 A;  2WJU A;  4V2L A;  3ZFB A;  1QGV A;  4GWR A;  5ELG A;  3FW2 A;  1B4P A;  5B8A A;  4TXV A;  1EZK A;  5HR2 A;  3PH9 A;  3C71 A;  1K0O A;  3IBH A;  3VPQ A;  1ERU A;  1V58 A;  2YCD A;  4ILF A;  3IHQ A;  1HYU A;  3D22 A;  2LJA A;  4L0W A;  4PXO A;  1F37 A;  1S3C A;  2DJ2 A;  3FYG A;  1GUK A;  4GST A;  2VLT A;  3TRQ A;  1AC1 A;  2NVL A;  1K0B A;  2VCQ A;  2QC7 A;  3WGE A;  4I2U A;  3U5R E;  3GH9 A;  5CP1 A;  1MDK A;  3GKN A;  1OYJ A;  2JZR A;  4KDY A;  2DJ1 A;  2DBC A;  1X9S B;  3EYT A;  1YF1 A;  3LXZ A;  5JWR B;  2LQQ A;  1TK5 B;  1SK2 A;  1K0D A;  4ZB6 A;  5GAN D;  1QUW A;  4GRF A;  5COH A;  3IV4 A;  4ISD A;  4N0V A;  3VI7 A;  2F8A A;  3WD6 A;  1M9A A;  3TKQ A;  1F9M A;  3US3 A;  5G1K A;  1XW9 A;  1Q98 A;  3E3E A;  3GSS A;  3P2A A;  2H6Y A;  1XXU A;  1USB A;  2GT6 A;  4PQI A;  4Q5N A;  1XWA A;  4ZB9 A;  10GS A;  4ID0 A;  5KN1 A;  3ZRE A;  1EP8 A;  3MNG A;  4PGT A;  3ERG A;  2HRN A;  6GST A;  1LBK A;  2RUE A;  1XWB A;  3VK9 A;  3DGQ A;  2RUF A;  1FOV A;  1U3I A;  3J7Y b;  5D9X A;  2B5E A;  4MAB A;  3HVV A;  2WZ9 A;  4OFT A;  1S3D A;  3NZN A;  5ID2 B;  1WE0 A;  1UC7 A;  4TRX A;  4HJ2 A;  1GSE A;  1K0M A;  3ZRD A;  2HSH A;  3EC3 A;  1G6Y A;  5DDL A;  2L57 A;  5G31 A;  5ECQ B;  1GH2 A;  4AJ7 A;  4OFN A;  1U6T A;  2GSQ A;  2YJ7 A;  1PKZ A;  4KW6 A;  1SKS B;  2IJY A;  2DML A;  4WF5 A;  1B48 A;  1K3L A;  3GN3 A;  3DXB A;  4BVY A;  1WMJ A;  4IKH A;  2MMZ A;  4K0N A;  2RM5 A;  2PVO C;  4BWQ A;  1AW9 A;  1T7P B;  3E0U A;  2LUS A;  2HZF A;  2VUP A;  2YV9 A;  4MH2 A;  1NM3 A;  4NHW A;  1T1V A;  4K2D A;  1JZO A;  3L9S A;  3HVS A;  1OC3 A;  1MD3 A;  2IMI A;  2FA4 A;  3ZIV A;  1H75 A;  4KCA A;  3KZQ A;  1FHE A;  3CRU A;  1Z7P A;  1Z6M A;  3KH7 A;  4G2E A;  1K0C A;  1S3A A;  4GSS A;  1ML6 A;  3TRP A;  1GTU A;  2V6O A;  4RUV A;  2YWI A;  4KH7 A;  1A8Y A;  4WET A;  5DAK A;  2YWO A;  4CW9 A;  2B5X A;  1VF3 A;  2XC2 A;  2H1D A;  3KH9 A;  1H4O A;  3PR8 A;  2IWT A;  4ML1 A;  4EXJ A;  2FNO A;  5CRG A;  4Q5Q A;  2WB9 A;  5IMZ A;  1N8J A;  3GKX A;  5EPF A;  3JCM L;  2L5O A;  2YAN A;  3GUR A;  2DJ3 A;  1V40 A;  4KGI A;  4D73 B;  4MMM A;  4DSS B;  3I69 A;  3WT1 A;  3SBC A;  2B1L A;  4WR5 A;  1O6J A;  2FWF A;  3RAZ A;  1T3B A;  4BA7 A;  3UL3 A;  5IMC A;  1YJ6 A;  3VI5 A;  2CV4 A;  2DC5 A;  1RW1 A;  1O81 A;  2RM6 A;  4ECJ A;  3IDV A;  5ELA A;  5F05 A;  2PWJ A;  2YPM A;  4Q5F A;  5ECN B;  4MZB A;  2B5Y A;  3HA9 A;  4G9H A;  1B9Y C;  2H1G A;  2H71 A; 
#chains in the Genus database with same CATH topology
 2JL4 A;  1M2A A;  3GX0 A;  4QQ7 A;  4TOP A;  1JZR A;  5H5R A;  2VCX A;  4TN8 A;  1XWC A;  4TR0 A;  3IHG A;  2IN3 A;  4HZ2 A;  4GSN A;  4QL9 A;  1SKW B;  6GSX A;  4TW5 A;  4IGJ A;  3CRT A;  3TJF A;  3EIN A;  1EP7 A;  1A2M A;  3D6I A;  2L6D A;  4K5R A;  2C0D A;  3N9J A;  3GYK A;  9GSS A;  1A24 A;  8GSS A;  3FEU A;  2OBK A;  4EUY A;  3F6D A;  4NV5 A;  1CQH A;  2C4J A;  3MAK A;  2BJX A;  3MYD A;  3TJB A;  4TR1 B;  3J7Y k;  2CZ2 A;  1YKA A;  5JWO B;  5JCU A;  3F9U A;  4WF4 A;  2FLS A;  1BG5 A;  2AJQ B;  3A2V A;  3G7Y A;  3WYW A;  1EGO A;  2OE0 A;  2YJH A;  2LJR A;  2JZS A;  3IE3 A;  4O5Q A;  4KUN A;  4L0U A;  3W6G A;  2P5Q A;  1AIU A;  1YF0 A;  1WPI A;  1XOB A;  4EE0 A;  2GZZ A;  2X8C A;  2O87 A;  3H1N A;  2MMA A;  5CRE A;  1SYR A;  4NXI A;  5L71 A;  3HZ4 A;  1FAA A;  3IK7 A;  1O7U A;  2YWN A;  3QAG A;  1TJD A;  1GTA A;  1Z3E A;  2PGT A;  1T4Z A;  3ZMK A;  2WCI A;  1SJ6 A;  4HSC X;  5F06 A;  2KLX A;  5D9W A;  4ZBA A;  1A8L A;  4AF2 A;  2CAQ A;  4HQZ A;  2PPT A;  2DIZ A;  4N11 A;  5ID2 A;  3ZLP A;  4GXZ A;  4K7N A;  4Z2R A;  3APO A;  3D5J A;  2N5A A;  4GTU A;  4JRR A;  1ERV A;  3F4R A;  2GGT A;  2DJJ A;  2ON7 A;  3KM6 A;  1U3A A;  1ON4 A;  4WBJ A;  3IAS 2;  5B7C A;  1WP0 A;  1ERW A;  1DBY A;  2LNT A;  1XOA A;  3IC4 A;  2KOK A;  5DJL A;  2X8H A;  1F2E A;  2LRT A;  2IMF A;  4Q5R A;  5A5K A;  2ZNM A;  4LLR A;  5JWQ B;  1TI3 A;  4I97 A;  2L59 A;  2R0C A;  3LXT A;  5D9T A;  4TVE A;  4EDY A;  5IMA A;  3CYN A;  4KDU A;  2GZP A;  5J5N A;  2MBT A;  1I5G A;  4I8B A;  4ZIL A;  2QKE A;  2F3M A;  4EIQ A;  3GKK A;  2HRA A;  3GV1 A;  3LJR A;  3W8S A;  1VF4 A;  2KUC A;  2YZU A;  5EY6 A;  1A2J A;  3DWV A;  3V1W A;  4IHU A;  1OC8 A;  1DE1 A;  3ZL5 A;  2HSY A;  4HDE A;  4JR6 A;  1X5E A;  1AQV A;  1Y25 A;  3F63 A;  1GSY A;  2GST A;  4RI6 A;  1TU7 A;  1TTZ A;  4F03 A;  2H6X A;  5AIV A;  3UAR A;  1THX A;  2NBS A;  1TW9 A;  4NHZ A;  1BYE A;  2X4A A;  1IYI A;  2OA7 A;  2LST A;  1UA5 A;  4DSR A;  5IPH A;  1KTE A;  1QQ2 A;  3WGX A;  3FR6 A;  1TRW A;  4D73 A;  3UVH A;  1XG8 A;  2L6C A;  1MEK A;  3ZZX A;  3I9V 2;  3H79 A;  4TXO B;  2CT6 A;  5GSS A;  1TRV A;  2YV7 A;  2OKA A;  3KD0 A;  4JE1 A;  1HNA A;  5E59 A;  4HI7 A;  4ECC A;  5IMD A;  3UMA A;  5CNW A;  1FB0 A;  2WRT A;  2O7K A;  3CMI A;  4BL7 B;  4HU9 A;  2CQ9 A;  5CYY A;  1B4Q A;  5G1L A;  19GS A;  2H0H A;  1VF1 A;  5HFK A;  5KN3 A;  5D73 A;  4O5U A;  4FYU A;  4XCS A;  2FWE A;  1KBN A;  2M46 A;  5FWG A;  4EKZ A;  1V2A A;  4HEA 2;  1XBS A;  2AV4 A;  2C0G A;  2V6K A;  3CTG A;  3E9J B;  5DJM A;  2K8V A;  4DEJ A;  1B9X C;  3UIW A;  1YDK A;  3KGK A;  4XS4 A;  3F3Q A;  3IK9 A;  3L0H A;  4ZIJ A;  2D2Z A;  5CRW A;  1ZGN A;  4Z2T A;  3I43 A;  3FHK A;  1K0A A;  2TRX A;  3HVN A;  4IQ1 A;  2LNS A;  2LTK A;  2VOC A;  3QAW A;  2GS3 A;  2H19 A;  1TI1 A;  5AIS A;  3ME8 A;  1G7E A;  2DMM A;  2F8F A;  4V2M A;  4OD7 A;  4OO5 A;  1OC9 A;  4K7I A;  2H70 A;  3FR3 A;  2VL9 A;  2IME A;  5DQS A;  1XWK A;  3KTL A;  3DVX A;  4JZQ A;  2XHF A;  2REM A;  4HUA A;  4EL1 A;  4F82 A;  2FUG 2;  2GT5 A;  2WFC A;  4BVX B;  3G7I A;  1BED A;  4X1U A;  1HD2 A;  14GS A;  2ZUP A;  2HYX A;  4MP4 A;  4KE3 A;  4POB A;  5G5F A;  5HQP A;  1SJZ A;  6GSV A;  2FWH A;  3P8W A;  4ICY A;  2IFQ B;  3GH6 A;  2VD0 A;  1M2B A;  1C72 A;  5ECK B;  1T8E B;  1TXX A;  1NHY A;  3M9J A;  4EIP A;  1TK8 B;  3VWU A;  4J57 E;  6GSW A;  1M7T A;  5HFI A;  2C3N A;  2J23 A;  1BX9 A;  5J4U A;  4USS A;  5ECH B;  4KND A;  5KN2 A;  3VWX A;  2VIM A;  2I4A A;  5ECI B;  5IPG A;  2H73 A;  3IRA A;  4MF7 A;  3DIE A;  2MMO A;  4EF0 A;  3GL5 A;  2QSI A;  3A2X A;  3DD3 A;  4DVC A;  2F9S A;  3RBT A;  1AAZ A;  3GX8 A;  1BAY A;  3DEX A;  1Z5Y E;  3HY2 A;  2FWG A;  2GQM A;  2DKH A;  1J08 A;  2GDR A;  4J2F A;  4XRD A;  2PVQ A;  1U87 A;  2B1K A;  4MJE A;  2H1B A;  2LRC A;  1K3Y A;  4FYC A;  5B8B A;  4MJB A;  1GSF A;  4O32 A;  4OMV A;  1GUL A;  2MZC A;  5GAP D;  3EVI A;  3NOF A;  17GS A;  1AQX A;  5ENU A;  1W4V A;  2AB6 A;  4KSM A;  3G9B A;  2JSZ A;  4IP6 A;  1YEP A;  5JCG A;  5ECO B;  3M0F A;  2K6V A;  2VD1 A;  4ZL7 A;  2L5L A;  2FA8 A;  4PX1 A;  3WGD A;  1X5C A;  3F4T A;  1PGT A;  3ZVJ D;  4BWS A;  3CBU A;  4HOJ A;  5IOX A;  1PSQ A;  1JLW A;  1XPV A;  5HFG A;  3IPZ A;  1XVW A;  2M80 A;  1GP1 A;  4N10 A;  3S9F A;  2H01 A;  4IS0 A;  4JBB A;  3GA4 A;  2H0I A;  1WWJ A;  4MDC A;  3FY7 A;  1SK0 A;  2I3Y A;  1TU8 A;  4IQA A;  4IJ3 A;  3TDG A;  1M0U A;  4TXO A;  1GUM A;  2PN8 A;  5G30 A;  3SWL A;  4K8M A;  3FKF A;  1TRU A;  4MK3 A;  1N2A A;  3VPT A;  5DVB A;  3ZIJ A;  4ACS A;  1EEM A;  3Q18 A;  4YH2 A;  4NAX A;  3PPU A;  4E8H A;  1PQN A;  1PA3 A;  4V1A p;  3QMX A;  2R6K A;  4LA1 A;  4PQH A;  7GSS A;  4NV2 A;  1GRX A;  1XVQ A;  1GNE A;  2GLR A;  2LS5 A;  2B6M A;  1B8X A;  3DVW A;  2HI7 A;  5GST A;  4MPG A;  3IR4 A;  4P3Y B;  1J9B A;  1ZYN A;  1XW5 A;  2G2Q A;  2QGV A;  3BOA A;  3PIN A;  4K5S A;  3KCM A;  2K18 A;  2HRK A;  2TIR A;  1X9M B;  5IM9 A;  4ZBB A;  2X64 A;  1O8X A;  3KXO A;  1ERT A;  1PD2 1;  3D4T A;  5D8I A;  2H76 A;  4YQV A;  1TOF A;  1PN9 A;  4WR4 A;  1ABA A;  2C1Y A;  3TKR A;  4RQX A;  1Y6E A;  2DSA A;  3EMX A;  1ZYE A;  4L5L A;  3C1R A;  3RPN A;  2X49 A;  1DE2 A;  1YZX A;  3UVT A;  3FZA A;  2OBI A;  5INY A;  2LQO A;  3C7M A;  3M3M A;  3KIJ A;  4WKW A;  4CHS A;  3BJ5 A;  2E0Q A;  1I9D A;  5IO0 A;  2CZ3 A;  2V41 A;  1XFL A;  1TK0 B;  3GHA A;  3Q74 A;  2KHP A;  3TKP A;  2H66 A;  3EU4 A;  2HLS A;  3QAV A;  3GFK A;  2N5F A;  5IIZ A;  4O7H A;  4EO3 A;  3AY8 A;  1NW2 A;  3O3T A;  5CO3 A;  2XPE A;  1JHB A;  4BVX A;  2B3S A;  2I81 A;  1AXD A;  3MWH A;  4G0I A;  2JU5 A;  3LGC A;  1YEX A;  1EV4 A;  1KEB A;  4MJA A;  5DAL B;  4XS1 A;  2JAD A;  5IO2 A;  4QL7 A;  5LD0 A;  2Z9S A;  1DSB A;  1XIY A;  2IFQ A;  3L4N A;  2WGR A;  2E2M A;  2HXK A;  5EVO A;  1YKC A;  1GL8 A;  3TOU A;  1V57 A;  4MZC A;  4ULX A;  1EGR A;  3HJM A;  5AN1 A;  4PNG A;  2EIQ A;  3QFB C;  4Z2U A;  4MZW A;  4V1A g;  2LKU A;  1FVJ A;  3EE2 A;  3U6V A;  1X9W B;  3F6F A;  3H93 A;  1WIK A;  5E4W A;  1XWG A;  3UBK A;  1BQ7 A;  1NSW A;  1Z7R A;  2CVB A;  4BIK A;  2V32 A;  2CA8 A;  2FGX A;  3H4K A;  1SYX A;  3A5W A;  3RHB A;  3ISO A;  1LU4 A;  3TKS A;  3HZ8 A;  4OFM A;  2ALB A;  2DLX A;  2GTU A;  5D96 A;  2CX3 A;  3UJ1 A;  6GSS A;  1SEN A;  2R5G A;  2V1M A;  2PMT A;  3LQ7 A;  3EUR A;  1MD4 A;  3O76 A;  4TKY A;  2C3Q A;  3ZIT A;  4KCE A;  1F3B A;  3VUR A;  2AAW A;  4NWY A;  3LYK A;  4MNN A;  5H5S A;  3FR9 A;  3VFI A;  4AJ8 A;  5KN0 A;  1U88 A;  5IMV A;  2HZE B;  1ZMA A;  1WJK A;  1GTB A;  1M2D A;  1MDI A;  2CVK A;  3TB2 A;  3F4S A;  3TJG A;  3HVX A;  1ST9 A;  2DIY A;  5CAX A;  1Q4J A;  2YNX A;  3KEB A;  2DJ0 A;  1J0F A;  5J3R A;  4GCI A;  3TKS C;  4RQR A;  4ZL9 A;  5D93 A;  3DYR A;  5JCW A;  4YQM A;  4DSS A;  2E2G A;  2WUL A;  4TR3 A;  1MDJ A;  11GS A;  5F07 A;  2GQL A;  1HNB A;  2GQK A;  2ON5 A;  3F8U A;  3TJK A;  3GTU B;  2VCT A;  3TKS E;  5ECM B;  3FRC A;  3APQ A;  2MYG A;  3MDK A;  2HRF A;  3HCZ A;  1FVK A;  1R26 A;  1PL2 A;  2J9H A;  1ZCP A;  3ZFL A;  18GS A;  1R5A A;  2ES7 A;  4KX4 A;  3VWW A;  2JSY A;  3TGZ A;  3QOU A;  5HR0 A;  2WDU A;  2O89 A;  4BPY A;  2R0G A;  2PU9 C;  2YN1 A;  2VCV A;  1EOG A;  3DML A;  3LSZ A;  4LMV A;  3R3E A;  2H74 A;  2R2J A;  2R37 A;  4PUR A;  2YP6 A;  2R3X A;  1GLP A;  4PNF A;  4V2N A;  4L8E A;  3QPM A;  4IJI A;  1GSS A;  1YQ1 A;  3CSH A;  3A3T A;  3BD2 A;  3C73 A;  3HKR A;  3IXR A;  1TDI A;  5C04 A;  1T00 A;  2M72 A;  4XRA A;  1GUH A;  1OE7 A;  1SU9 A;  2C8U A;  1SL2 B;  1SD8 A;  1WOU A;  1OKT A;  2A2P A;  4PQ1 A;  2VL2 C;  1JLV A;  4IP1 A;  3G7J A;  3QR6 A;  4EDZ A;  4TR1 A;  1HQO A;  2NPB A;  1S3R A;  5HR3 A;  1SL0 B;  2X8G A;  3C8E A;  3CXG A;  1VRS D;  3Q19 A;  1PRX A;  2JAC A;  2IMD A;  3Q6O A;  2PBJ A;  1PX7 A;  2XBI A;  4OO4 A;  2BMX A;  3LFL A;  4POL A;  2AYT A;  1Z9H A;  1E2Y A;  5A4W A;  3LYP A;  5DAL A;  1FG4 A;  3D0Z A;  2IIY A;  3UAP A;  2B7J A;  2BTO T;  2HE3 A;  1OE8 A;  1UVZ A;  1VF2 A;  2P5R A;  4HJM A;  3QCP A;  3CSJ A;  5KOX A;  2EC4 A;  4KSO A;  3L9U A;  3LWA A;  4K1F A;  4OCE A;  4X0X A;  2K9F A;  1IYH A;  1ZYP A;  2LV3 A;  5B6M A;  1GLQ A;  1TRS A;  3FZ9 A;  4POM A;  4K9Z A;  4JR4 A;  2XPD A;  3IAM 2;  3PGT A;  4F9Z A;  4KA0 A;  1URM A;  3C1S A;  3A5I A;  4OCF A;  1EWX A;  2O8V B;  1R5P A;  3D4M A;  4K6X A;  4G0K A;  2VAF A;  1SK1 A;  1GTI A;  3GRX A;  2A4V A;  5H5Q A;  3RDW A;  3HHV A;  6GSU A;  3GST A;  2ZCT A;  2YZH A;  5DCH A;  4HZ4 A;  5AIX A;  4E8E A;  1QMV A;  1PX6 A;  3BCI A;  4XIH A;  2NTO A;  5F8B A;  1OVN A;  3ERW A;  2A2S A;  4ZB8 A;  2LEG A;  1R4W A;  3ZTL A;  2VLV A;  2H30 A;  1AUC A;  4O5R A;  1ZYQ B;  1JZD A;  2HFD A;  2P31 A;  6GSY A;  2JZT A;  2A4H A;  1DUG A;  1AQW A;  4MJC A;  4HU7 A;  2HZE A;  1ZL9 A;  2LJK A;  2VCZ A;  4WEY A;  2OAD A;  2YWM A;  5DBQ A;  2L4Q A;  2VL3 A;  2K8S A;  3IC8 A;  1MTC A;  3HYP A;  2YOI A;  2I9H A;  2LRN A;  4X43 A;  3CQF A;  3QFA C;  2C80 A;  5AGY A;  5FHI A;  3A2W A;  3EWL A;  1V9W A;  4EVM A;  2CVD A;  2OE3 A;  13GS A;  4YAV A;  1PL1 A;  3GTU A;  3W8J A;  4ZXG A;  2HT9 A;  2IPA A;  4YKG A;  3UEM A;  1QXH A;  2CX4 A;  5ECR B;  5LCZ A;  4GQF A;  1T4Y A;  5EL8 A;  1XCC A;  3L78 A;  1YY7 A;  3GUS A;  3ED3 A;  2H6Z A;  4BL7 A;  3QDN A;  1PMT A;  2H1A A;  2EIO A;  1CQG A;  3KTB A;  1FW1 A;  4ZL8 A;  4IBP A;  2F51 A;  4K0G A;  2GSS A;  3LOR A;  4XHM A;  4MF5 A;  4FIW A;  1QFN A;  1RQM A;  1EOH A;  3BBY A;  1GWC A;  3KJY A;  5F0G A;  4IVF A;  3M1G A;  2P0G A;  5ECS A;  1SL1 B;  4CY8 A;  5IQY A;  4GF0 A;  3OR5 A;  2VLU A;  2MBS A;  1FOH A;  1GNW A;  3DRN A;  2R4V A;  1FB6 A;  1UN2 A;  3RPP A;  4F2I A;  5B6N A;  3ERF A;  1XW6 A;  2H8L A;  1F6M C;  1NHO A;  4ECB A;  2NDO A;  2IMK A;  2PUK C;  3APS A;  4ECI A;  4XS4 B;  4G19 A;  3LW9 A;  4J56 E;  4EC0 A;  5IMF A;  1XZO A;  3NIV A;  2GVP A;  4PUA A;  1M3I A;  5DCG A;  5A4V A;  2E7P A;  4FH8 A;  4RI7 A;  1QK8 A;  4PUF C;  4A5P A;  3RHC A;  1ACV A;  1F3A A;  3I6A A;  4LL1 B;  2WS2 A;  2TRC P;  4YAP A;  5BRT A;  1G0T A;  2RLI A;  4MPF A;  2X99 A;  2A2R A;  5CRD A;  2AHE A;  1OC9 B;  1PFO A;  2OJL A;  3F3R A;  3R2Q A;  1EEJ A;  1E6B A;  4YQU A;  3MSZ A;  4LMW A;  3TRX A;  3HXS A;  3KP8 A;  3N5O A;  1R7H A;  4CDO A;  3GNJ A;  4FYB A;  1KNG A;  2AUV A;  3GKM A;  2H75 A;  4MH3 A;  1Z6N A;  4JED A;  2L4C A;  5ECL B;  1TKD B;  2IL3 A;  2MMN A;  1GSD A;  1SD9 A;  4K7O A;  1OKD A;  4KB3 A;  4AJ6 A;  4HS1 A;  2XBQ A;  3FK8 A;  4F0C A;  22GS A;  3KMO A;  2H0G A;  5J9C A;  4WBR D;  2VCW A;  1BJX A;  3F0I A;  4MLY A;  4IN0 A;  4TR4 A;  3HJO A;  4MCU A;  5ECP B;  4AGS A;  1EV9 A;  3D21 A;  4XTS A;  1A2L A;  3M9K A;  4POK A;  3ZVJ A;  4JU5 A;  1O85 A;  5D9V A;  5GZZ B;  4XS6 A;  12GS A;  5G5E A;  5J9B A;  3H8Q A;  3FZ4 A;  5J41 A;  2VM1 A;  2OE1 A;  2KP2 A;  2FD3 A;  1G6W A;  2C0E A;  2C0F A;  4F0B A;  3EMP A;  3KP9 A;  4Z7X A;  4KAE A;  1V98 A;  1ILO A;  3GIX A;  3P7X A;  5HR1 A;  1PN0 A;  20GS A;  2C3T A;  3DKS A;  3QD9 A;  16GS A;  1M9B A;  3HDC A;  4H86 A;  3TUE A;  2FHE A;  1ZOF A;  4BVY B;  4ML6 A;  1X0R A;  4N30 A;  3ZML A;  3GMF A;  1SJI A;  4O92 A;  2GSR A;  3EU3 A;  4FO5 A;  5G2Z A;  1WRY A;  1X5D A;  3ME7 A;  3P90 A;  4GQC A;  3TJJ A;  1JFU A;  3ZYW A;  5KEJ A;  5DQY A;  2HNL A;  1THO A;  3L9V A;  4G10 A;  2O85 A;  3WT2 A;  1M99 A;  4I5Q A;  1A23 A;  5FT3 A;  3CTF A;  4WXT A;  4ZBD A;  1RK4 A;  4DSQ A;  5ABR A;  1JZW A;  5C00 A;  2DKI A;  4CY6 A;  3IA1 A;  4HQS A;  1OAZ A;  1O8W A;  1W89 A;  5DAK B;  4NMU A;  1GSU A;  5IOW A;  2VM2 A;  4K2X A;  1GSQ A;  1G7O A;  4L5O A;  1VGL A;  3O6T A;  3HJP A;  4KDX A;  4N0Z A;  1K3O A;  5CRH A;  4X4J A;  3VWV A;  1LJR A;  2RII A;  3LG6 A;  4I2T A;  3K8N A;  1K0N A;  3FZ5 A;  2B7K A;  1FO5 A;  3HD5 A;  2VL2 A;  2KP1 A;  1TP9 A;  4FQU A;  2G0F A;  4I6X A;  1A0R P;  3UBL A;  2N5B A;  3KMN A;  4NPB A;  3VLN A;  3GL3 A;  5A4U A;  3TCO A;  1HNC A;  4MA9 A;  4MF6 A;  3M8N A;  2OAC A;  3LEF A;  2PER A;  1O73 A;  4KF9 A;  2FY6 A;  2QA2 A;  5LNK e;  2FCH A;  2DJK A;  3IOS A;  3UOM A;  3CSI A;  1SKR B;  2H72 A;  2CAI A;  1ZZY A;  4LL4 B;  4GLT A;  2GZY A;  2I1U A;  2V2G A;  2EIR A;  4IEL A;  3BCK A;  2VO4 A;  1A0F A;  3TOT A;  4OWY A;  1PKW A;  4IW9 A;  2WJU A;  4V2L A;  3ZFB A;  1QGV A;  4GWR A;  5ELG A;  3FW2 A;  5KOW A;  1B4P A;  5B8A A;  4TXV A;  1EZK A;  5HR2 A;  3PH9 A;  3C71 A;  1K0O A;  3IBH A;  3VPQ A;  1ERU A;  1V58 A;  2YCD A;  4ILF A;  3IHQ A;  1HYU A;  3D22 A;  2LJA A;  4L0W A;  4PXO A;  1F37 A;  1S3C A;  2DJ2 A;  3FYG A;  1GUK A;  4GST A;  2VLT A;  3TRQ A;  1AC1 A;  2NVL A;  1K0B A;  2VCQ A;  2QC7 A;  3WGE A;  4I2U A;  3U5R E;  3GH9 A;  5CP1 A;  1MDK A;  3GKN A;  1OYJ A;  2JZR A;  4KDY A;  2DJ1 A;  2DBC A;  1X9S B;  4YKF A;  3EYT A;  1YF1 A;  3LXZ A;  5JWR B;  2LQQ A;  1TK5 B;  1SK2 A;  1K0D A;  4ZB6 A;  3EPT A;  5GAN D;  1QUW A;  4GRF A;  5COH A;  3IV4 A;  4ISD A;  4N0V A;  3VI7 A;  2F8A A;  3WD6 A;  1M9A A;  3TKQ A;  1F9M A;  3US3 A;  5G1K A;  1XW9 A;  1Q98 A;  3E3E A;  3FMW A;  3GSS A;  3P2A A;  2H6Y A;  1XXU A;  1M3J A;  1USB A;  2GT6 A;  4PQI A;  4Q5N A;  1XWA A;  3MIX A;  4ZB9 A;  10GS A;  4ID0 A;  2R0P A;  5KN1 A;  3ZRE A;  1EP8 A;  3MNG A;  4PGT A;  3ERG A;  2HRN A;  6GST A;  1LBK A;  2RUE A;  1XWB A;  3VK9 A;  3DGQ A;  2RUF A;  1FOV A;  1U3I A;  3J7Y b;  5D9X A;  2B5E A;  4MAB A;  3HVV A;  2WZ9 A;  4OFT A;  1S3D A;  3NZN A;  5ID2 B;  1WE0 A;  1UC7 A;  4TRX A;  4HJ2 A;  1GSE A;  1K0M A;  3ZRD A;  2HSH A;  3EC3 A;  1G6Y A;  5DDL A;  2L57 A;  5G31 A;  5ECQ B;  1GH2 A;  4AJ7 A;  4OFN A;  1U6T A;  2GSQ A;  2YJ7 A;  1PKZ A;  4KW6 A;  1SKS B;  2IJY A;  2DML A;  4WF5 A;  1B48 A;  1K3L A;  3GN3 A;  3DXB A;  4BVY A;  1WMJ A;  4IKH A;  2MMZ A;  4K0N A;  2RM5 A;  2PVO C;  4BWQ A;  1AW9 A;  1T7P B;  3E0U A;  2LUS A;  2HZF A;  2VUP A;  2YV9 A;  4MH2 A;  1NM3 A;  4NHW A;  1T1V A;  4K2D A;  1JZO A;  3L9S A;  3HVS A;  2QA1 A;  1OC3 A;  1MD3 A;  2IMI A;  2FA4 A;  3ZIV A;  4PTS A;  1H75 A;  4KCA A;  3KZQ A;  1FHE A;  3CRU A;  1Z7P A;  1Z6M A;  3KH7 A;  4G2E A;  1K0C A;  1S3A A;  4GSS A;  1ML6 A;  3TRP A;  1GTU A;  2V6O A;  4RUV A;  2YWI A;  4KH7 A;  1A8Y A;  4WET A;  5DAK A;  2YWO A;  4CW9 A;  2B5X A;  1VF3 A;  2XC2 A;  2H1D A;  3KH9 A;  1H4O A;  3PR8 A;  2IWT A;  4ML1 A;  4EXJ A;  2FNO A;  5CRG A;  4Q5Q A;  2WB9 A;  5IMZ A;  1N8J A;  2HSM A;  3GKX A;  5EPF A;  3JCM L;  2L5O A;  2YAN A;  3GUR A;  2DJ3 A;  1V40 A;  4KGI A;  4D73 B;  5BMU A;  4MMM A;  4DSS B;  3I69 A;  3WT1 A;  3SBC A;  2B1L A;  4WR5 A;  1O6J A;  2FWF A;  3RAZ A;  1T3B A;  4BA7 A;  3UL3 A;  4G0L A;  5IMC A;  1YJ6 A;  3VI5 A;  2CV4 A;  2DC5 A;  1RW1 A;  1O81 A;  2RM6 A;  4ECJ A;  3IDV A;  5ELA A;  5F05 A;  2PWJ A;  2YPM A;  4Q5F A;  2UZ8 A;  5ECN B;  4MZB A;  2B5Y A;  3HA9 A;  4G9H A;  1B9Y C;  2H1G A;  2H71 A; 
#chains in the Genus database with same CATH homology
 2JL4 A;  1M2A A;  3GX0 A;  4QQ7 A;  4TOP A;  1JZR A;  5H5R A;  2VCX A;  4TN8 A;  1XWC A;  4TR0 A;  3IHG A;  2IN3 A;  4HZ2 A;  4GSN A;  4QL9 A;  1SKW B;  6GSX A;  4TW5 A;  4IGJ A;  3CRT A;  3TJF A;  3EIN A;  1EP7 A;  1A2M A;  3D6I A;  2L6D A;  4K5R A;  2C0D A;  3N9J A;  3GYK A;  9GSS A;  1A24 A;  8GSS A;  3FEU A;  2OBK A;  4EUY A;  3F6D A;  4NV5 A;  1CQH A;  2C4J A;  3MAK A;  2BJX A;  3MYD A;  3TJB A;  4TR1 B;  3J7Y k;  2CZ2 A;  1YKA A;  5JWO B;  5JCU A;  3F9U A;  4WF4 A;  2FLS A;  1BG5 A;  2AJQ B;  3A2V A;  3G7Y A;  3WYW A;  1EGO A;  2OE0 A;  2YJH A;  2LJR A;  2JZS A;  3IE3 A;  4O5Q A;  4KUN A;  4L0U A;  3W6G A;  2P5Q A;  1AIU A;  1YF0 A;  1WPI A;  1XOB A;  4EE0 A;  2GZZ A;  2X8C A;  2O87 A;  3H1N A;  2MMA A;  5CRE A;  1SYR A;  4NXI A;  5L71 A;  3HZ4 A;  1FAA A;  3IK7 A;  1O7U A;  2YWN A;  3QAG A;  1TJD A;  1GTA A;  1Z3E A;  2PGT A;  1T4Z A;  3ZMK A;  2WCI A;  1SJ6 A;  5F06 A;  2KLX A;  5D9W A;  4ZBA A;  1A8L A;  4AF2 A;  2CAQ A;  4HQZ A;  2PPT A;  2DIZ A;  4N11 A;  5ID2 A;  3ZLP A;  4GXZ A;  4K7N A;  4Z2R A;  3APO A;  3D5J A;  2N5A A;  4GTU A;  4JRR A;  1ERV A;  3F4R A;  2GGT A;  2DJJ A;  2ON7 A;  3KM6 A;  1U3A A;  1ON4 A;  4WBJ A;  3IAS 2;  5B7C A;  1WP0 A;  1ERW A;  1DBY A;  2LNT A;  1XOA A;  3IC4 A;  2KOK A;  5DJL A;  2X8H A;  1F2E A;  2LRT A;  2IMF A;  4Q5R A;  5A5K A;  2ZNM A;  4LLR A;  5JWQ B;  1TI3 A;  4I97 A;  2L59 A;  2R0C A;  3LXT A;  5D9T A;  4TVE A;  4EDY A;  5IMA A;  3CYN A;  4KDU A;  2GZP A;  5J5N A;  2MBT A;  1I5G A;  4I8B A;  4ZIL A;  2QKE A;  2F3M A;  4EIQ A;  3GKK A;  2HRA A;  3GV1 A;  3LJR A;  3W8S A;  1VF4 A;  2KUC A;  2YZU A;  5EY6 A;  1A2J A;  3DWV A;  3V1W A;  4IHU A;  1OC8 A;  1DE1 A;  3ZL5 A;  2HSY A;  4HDE A;  4JR6 A;  1X5E A;  1AQV A;  1Y25 A;  3F63 A;  1GSY A;  2GST A;  4RI6 A;  1TU7 A;  1TTZ A;  4F03 A;  2H6X A;  5AIV A;  3UAR A;  1THX A;  2NBS A;  1TW9 A;  4NHZ A;  1BYE A;  2X4A A;  1IYI A;  2OA7 A;  2LST A;  1UA5 A;  4DSR A;  5IPH A;  1KTE A;  1QQ2 A;  3WGX A;  3FR6 A;  1TRW A;  4D73 A;  3UVH A;  2L6C A;  1MEK A;  3ZZX A;  3I9V 2;  3H79 A;  4TXO B;  2CT6 A;  5GSS A;  1TRV A;  2YV7 A;  2OKA A;  3KD0 A;  4JE1 A;  1HNA A;  5E59 A;  4HI7 A;  4ECC A;  5IMD A;  3UMA A;  5CNW A;  1FB0 A;  2WRT A;  2O7K A;  3CMI A;  4BL7 B;  4HU9 A;  2CQ9 A;  5CYY A;  1B4Q A;  5G1L A;  19GS A;  2H0H A;  1VF1 A;  5HFK A;  5KN3 A;  5D73 A;  4O5U A;  4FYU A;  4XCS A;  2FWE A;  1KBN A;  2M46 A;  5FWG A;  4EKZ A;  1V2A A;  4HEA 2;  1XBS A;  2AV4 A;  2C0G A;  2V6K A;  3CTG A;  3E9J B;  5DJM A;  2K8V A;  4DEJ A;  1B9X C;  3UIW A;  1YDK A;  3KGK A;  4XS4 A;  3F3Q A;  3IK9 A;  3L0H A;  4ZIJ A;  2D2Z A;  5CRW A;  1ZGN A;  4Z2T A;  3I43 A;  3FHK A;  1K0A A;  2TRX A;  4IQ1 A;  2LNS A;  2LTK A;  2VOC A;  3QAW A;  2GS3 A;  2H19 A;  1TI1 A;  5AIS A;  3ME8 A;  1G7E A;  2DMM A;  2F8F A;  4V2M A;  4OD7 A;  4OO5 A;  1OC9 A;  4K7I A;  2H70 A;  3FR3 A;  2VL9 A;  2IME A;  5DQS A;  1XWK A;  3KTL A;  3DVX A;  4JZQ A;  2XHF A;  2REM A;  4HUA A;  4EL1 A;  4F82 A;  2FUG 2;  2GT5 A;  2WFC A;  4BVX B;  3G7I A;  1BED A;  4X1U A;  1HD2 A;  14GS A;  2ZUP A;  2HYX A;  4MP4 A;  4KE3 A;  4POB A;  5G5F A;  5HQP A;  1SJZ A;  6GSV A;  2FWH A;  3P8W A;  4ICY A;  2IFQ B;  3GH6 A;  2VD0 A;  1M2B A;  1C72 A;  5ECK B;  1T8E B;  1TXX A;  1NHY A;  3M9J A;  4EIP A;  1TK8 B;  3VWU A;  4J57 E;  6GSW A;  1M7T A;  5HFI A;  2C3N A;  2J23 A;  1BX9 A;  5J4U A;  4USS A;  5ECH B;  4KND A;  5KN2 A;  3VWX A;  2VIM A;  2I4A A;  5ECI B;  5IPG A;  2H73 A;  3IRA A;  4MF7 A;  3DIE A;  2MMO A;  4EF0 A;  3GL5 A;  2QSI A;  3A2X A;  3DD3 A;  4DVC A;  2F9S A;  3RBT A;  1AAZ A;  3GX8 A;  1BAY A;  3DEX A;  1Z5Y E;  3HY2 A;  2FWG A;  2GQM A;  2DKH A;  1J08 A;  2GDR A;  4J2F A;  4XRD A;  2PVQ A;  1U87 A;  2B1K A;  4MJE A;  2H1B A;  2LRC A;  1K3Y A;  4FYC A;  5B8B A;  4MJB A;  1GSF A;  4O32 A;  4OMV A;  1GUL A;  2MZC A;  5GAP D;  3EVI A;  3NOF A;  17GS A;  1AQX A;  5ENU A;  1W4V A;  2AB6 A;  4KSM A;  3G9B A;  2JSZ A;  4IP6 A;  1YEP A;  5JCG A;  5ECO B;  3M0F A;  2K6V A;  2VD1 A;  4ZL7 A;  2L5L A;  2FA8 A;  4PX1 A;  3WGD A;  1X5C A;  3F4T A;  1PGT A;  3ZVJ D;  4BWS A;  3CBU A;  4HOJ A;  5IOX A;  1PSQ A;  1JLW A;  1XPV A;  5HFG A;  3IPZ A;  1XVW A;  2M80 A;  1GP1 A;  4N10 A;  3S9F A;  2H01 A;  4IS0 A;  4JBB A;  3GA4 A;  2H0I A;  1WWJ A;  4MDC A;  3FY7 A;  1SK0 A;  2I3Y A;  1TU8 A;  4IQA A;  4IJ3 A;  3TDG A;  1M0U A;  4TXO A;  1GUM A;  2PN8 A;  5G30 A;  3SWL A;  4K8M A;  3FKF A;  1TRU A;  4MK3 A;  1N2A A;  3VPT A;  5DVB A;  3ZIJ A;  4ACS A;  1EEM A;  3Q18 A;  4YH2 A;  4NAX A;  3PPU A;  4E8H A;  1PQN A;  1PA3 A;  4V1A p;  3QMX A;  2R6K A;  4LA1 A;  4PQH A;  7GSS A;  4NV2 A;  1GRX A;  1XVQ A;  1GNE A;  2GLR A;  2LS5 A;  2B6M A;  1B8X A;  3DVW A;  2HI7 A;  5GST A;  4MPG A;  3IR4 A;  4P3Y B;  1J9B A;  1ZYN A;  1XW5 A;  2G2Q A;  2QGV A;  3BOA A;  3PIN A;  4K5S A;  3KCM A;  2K18 A;  2HRK A;  2TIR A;  1X9M B;  5IM9 A;  4ZBB A;  2X64 A;  1O8X A;  3KXO A;  1ERT A;  1PD2 1;  3D4T A;  5D8I A;  2H76 A;  4YQV A;  1TOF A;  1PN9 A;  4WR4 A;  1ABA A;  2C1Y A;  3TKR A;  4RQX A;  1Y6E A;  2DSA A;  3EMX A;  1ZYE A;  4L5L A;  3C1R A;  3RPN A;  2X49 A;  1DE2 A;  1YZX A;  3UVT A;  3FZA A;  2OBI A;  5INY A;  2LQO A;  3C7M A;  3M3M A;  3KIJ A;  4WKW A;  4CHS A;  3BJ5 A;  2E0Q A;  1I9D A;  5IO0 A;  2CZ3 A;  2V41 A;  1XFL A;  1TK0 B;  3GHA A;  3Q74 A;  2KHP A;  3TKP A;  2H66 A;  3EU4 A;  2HLS A;  3QAV A;  3GFK A;  2N5F A;  5IIZ A;  4O7H A;  4EO3 A;  3AY8 A;  1NW2 A;  3O3T A;  5CO3 A;  2XPE A;  1JHB A;  4BVX A;  2B3S A;  2I81 A;  1AXD A;  3MWH A;  4G0I A;  2JU5 A;  3LGC A;  1YEX A;  1EV4 A;  1KEB A;  4MJA A;  5DAL B;  4XS1 A;  2JAD A;  5IO2 A;  4QL7 A;  5LD0 A;  2Z9S A;  1DSB A;  1XIY A;  2IFQ A;  3L4N A;  2WGR A;  2E2M A;  2HXK A;  5EVO A;  1YKC A;  1GL8 A;  3TOU A;  1V57 A;  4MZC A;  4ULX A;  1EGR A;  3HJM A;  5AN1 A;  4PNG A;  2EIQ A;  3QFB C;  4Z2U A;  4MZW A;  4V1A g;  2LKU A;  1FVJ A;  3EE2 A;  3U6V A;  1X9W B;  3F6F A;  3H93 A;  1WIK A;  5E4W A;  1XWG A;  3UBK A;  1BQ7 A;  1NSW A;  1Z7R A;  2CVB A;  2V32 A;  2CA8 A;  2FGX A;  3H4K A;  1SYX A;  3A5W A;  3RHB A;  3ISO A;  1LU4 A;  3TKS A;  3HZ8 A;  4OFM A;  2ALB A;  2DLX A;  2GTU A;  5D96 A;  2CX3 A;  3UJ1 A;  6GSS A;  1SEN A;  2R5G A;  2V1M A;  2PMT A;  3LQ7 A;  3EUR A;  1MD4 A;  3O76 A;  4TKY A;  2C3Q A;  3ZIT A;  4KCE A;  1F3B A;  3VUR A;  2AAW A;  4NWY A;  3LYK A;  4MNN A;  5H5S A;  3FR9 A;  3VFI A;  4AJ8 A;  5KN0 A;  1U88 A;  5IMV A;  2HZE B;  1ZMA A;  1WJK A;  1GTB A;  1M2D A;  1MDI A;  2CVK A;  3TB2 A;  3F4S A;  3TJG A;  3HVX A;  1ST9 A;  2DIY A;  5CAX A;  1Q4J A;  2YNX A;  3KEB A;  2DJ0 A;  1J0F A;  5J3R A;  4GCI A;  3TKS C;  4RQR A;  4ZL9 A;  5D93 A;  3DYR A;  5JCW A;  4YQM A;  4DSS A;  2E2G A;  2WUL A;  4TR3 A;  1MDJ A;  11GS A;  5F07 A;  2GQL A;  1HNB A;  2GQK A;  2ON5 A;  3F8U A;  3TJK A;  3GTU B;  2VCT A;  3TKS E;  5ECM B;  3FRC A;  3APQ A;  2MYG A;  3MDK A;  2HRF A;  3HCZ A;  1FVK A;  1R26 A;  1PL2 A;  2J9H A;  1ZCP A;  3ZFL A;  18GS A;  1R5A A;  2ES7 A;  4KX4 A;  3VWW A;  2JSY A;  3TGZ A;  3QOU A;  5HR0 A;  2WDU A;  2O89 A;  4BPY A;  2R0G A;  2PU9 C;  2YN1 A;  2VCV A;  1EOG A;  3DML A;  3LSZ A;  4LMV A;  3R3E A;  2H74 A;  2R2J A;  2R37 A;  4PUR A;  2YP6 A;  2R3X A;  1GLP A;  4PNF A;  4V2N A;  4L8E A;  3QPM A;  4IJI A;  1GSS A;  1YQ1 A;  3CSH A;  3A3T A;  3BD2 A;  3C73 A;  3HKR A;  3IXR A;  1TDI A;  5C04 A;  1T00 A;  2M72 A;  4XRA A;  1GUH A;  1OE7 A;  1SU9 A;  2C8U A;  1SL2 B;  1SD8 A;  1WOU A;  1OKT A;  2A2P A;  4PQ1 A;  2VL2 C;  1JLV A;  4IP1 A;  3G7J A;  3QR6 A;  4EDZ A;  4TR1 A;  1HQO A;  2NPB A;  5HR3 A;  1SL0 B;  2X8G A;  3C8E A;  3CXG A;  1VRS D;  3Q19 A;  1PRX A;  2JAC A;  2IMD A;  3Q6O A;  2PBJ A;  1PX7 A;  2XBI A;  4OO4 A;  2BMX A;  3LFL A;  4POL A;  2AYT A;  1Z9H A;  1E2Y A;  5A4W A;  3LYP A;  5DAL A;  1FG4 A;  3D0Z A;  2IIY A;  3UAP A;  2B7J A;  2BTO T;  2HE3 A;  1OE8 A;  1UVZ A;  1VF2 A;  2P5R A;  4HJM A;  3QCP A;  3CSJ A;  5KOX A;  2EC4 A;  4KSO A;  3L9U A;  3LWA A;  4K1F A;  4OCE A;  4X0X A;  2K9F A;  1IYH A;  1ZYP A;  2LV3 A;  5B6M A;  1GLQ A;  1TRS A;  3FZ9 A;  4POM A;  4K9Z A;  4JR4 A;  2XPD A;  3IAM 2;  3PGT A;  4F9Z A;  4KA0 A;  1URM A;  3C1S A;  3A5I A;  4OCF A;  1EWX A;  2O8V B;  1R5P A;  3D4M A;  4K6X A;  4G0K A;  2VAF A;  1SK1 A;  1GTI A;  3GRX A;  2A4V A;  5H5Q A;  3RDW A;  3HHV A;  6GSU A;  3GST A;  2ZCT A;  2YZH A;  5DCH A;  4HZ4 A;  5AIX A;  4E8E A;  1QMV A;  1PX6 A;  3BCI A;  4XIH A;  2NTO A;  5F8B A;  1OVN A;  3ERW A;  2A2S A;  4ZB8 A;  2LEG A;  1R4W A;  3ZTL A;  2VLV A;  2H30 A;  1AUC A;  4O5R A;  1ZYQ B;  1JZD A;  2HFD A;  2P31 A;  6GSY A;  2JZT A;  2A4H A;  1DUG A;  1AQW A;  4MJC A;  4HU7 A;  2HZE A;  1ZL9 A;  2LJK A;  2VCZ A;  4WEY A;  2OAD A;  2YWM A;  5DBQ A;  2L4Q A;  2VL3 A;  2K8S A;  3IC8 A;  1MTC A;  3HYP A;  2YOI A;  2I9H A;  2LRN A;  4X43 A;  3QFA C;  2C80 A;  5AGY A;  5FHI A;  3A2W A;  3EWL A;  1V9W A;  4EVM A;  2CVD A;  2OE3 A;  13GS A;  4YAV A;  1PL1 A;  3GTU A;  3W8J A;  4ZXG A;  2HT9 A;  2IPA A;  4YKG A;  3UEM A;  1QXH A;  2CX4 A;  5ECR B;  5LCZ A;  4GQF A;  1T4Y A;  5EL8 A;  1XCC A;  3L78 A;  1YY7 A;  3GUS A;  3ED3 A;  2H6Z A;  4BL7 A;  3QDN A;  1PMT A;  2H1A A;  2EIO A;  1CQG A;  3KTB A;  1FW1 A;  4ZL8 A;  4IBP A;  2F51 A;  4K0G A;  2GSS A;  3LOR A;  4XHM A;  4MF5 A;  4FIW A;  1QFN A;  1RQM A;  1EOH A;  3BBY A;  1GWC A;  3KJY A;  5F0G A;  4IVF A;  3M1G A;  2P0G A;  5ECS A;  1SL1 B;  4CY8 A;  5IQY A;  4GF0 A;  3OR5 A;  2VLU A;  2MBS A;  1FOH A;  1GNW A;  3DRN A;  2R4V A;  1FB6 A;  1UN2 A;  3RPP A;  4F2I A;  5B6N A;  3ERF A;  1XW6 A;  2H8L A;  1F6M C;  1NHO A;  4ECB A;  2NDO A;  2IMK A;  2PUK C;  3APS A;  4ECI A;  4XS4 B;  4G19 A;  3LW9 A;  4J56 E;  4EC0 A;  5IMF A;  1XZO A;  3NIV A;  2GVP A;  4PUA A;  5DCG A;  5A4V A;  2E7P A;  4FH8 A;  4RI7 A;  1QK8 A;  4PUF C;  4A5P A;  3RHC A;  1ACV A;  1F3A A;  3I6A A;  4LL1 B;  2WS2 A;  2TRC P;  4YAP A;  5BRT A;  1G0T A;  2RLI A;  4MPF A;  2X99 A;  2A2R A;  5CRD A;  2AHE A;  1OC9 B;  2OJL A;  3F3R A;  3R2Q A;  1EEJ A;  1E6B A;  4YQU A;  3MSZ A;  4LMW A;  3TRX A;  3HXS A;  3KP8 A;  3N5O A;  1R7H A;  4CDO A;  3GNJ A;  4FYB A;  1KNG A;  2AUV A;  3GKM A;  2H75 A;  4MH3 A;  1Z6N A;  4JED A;  2L4C A;  5ECL B;  1TKD B;  2IL3 A;  2MMN A;  1GSD A;  1SD9 A;  4K7O A;  1OKD A;  4KB3 A;  4AJ6 A;  4HS1 A;  2XBQ A;  3FK8 A;  4F0C A;  22GS A;  3KMO A;  2H0G A;  5J9C A;  4WBR D;  2VCW A;  1BJX A;  3F0I A;  4MLY A;  4IN0 A;  4TR4 A;  3HJO A;  4MCU A;  5ECP B;  4AGS A;  1EV9 A;  3D21 A;  4XTS A;  1A2L A;  3M9K A;  4POK A;  3ZVJ A;  4JU5 A;  1O85 A;  5D9V A;  5GZZ B;  4XS6 A;  12GS A;  5G5E A;  5J9B A;  3H8Q A;  3FZ4 A;  5J41 A;  2VM1 A;  2OE1 A;  2KP2 A;  2FD3 A;  1G6W A;  2C0E A;  2C0F A;  4F0B A;  3EMP A;  3KP9 A;  4Z7X A;  4KAE A;  1V98 A;  1ILO A;  3GIX A;  3P7X A;  5HR1 A;  1PN0 A;  20GS A;  2C3T A;  3DKS A;  3QD9 A;  16GS A;  1M9B A;  3HDC A;  4H86 A;  3TUE A;  2FHE A;  1ZOF A;  4BVY B;  4ML6 A;  1X0R A;  4N30 A;  3ZML A;  3GMF A;  1SJI A;  4O92 A;  2GSR A;  3EU3 A;  4FO5 A;  5G2Z A;  1WRY A;  1X5D A;  3ME7 A;  3P90 A;  4GQC A;  3TJJ A;  1JFU A;  3ZYW A;  5KEJ A;  5DQY A;  2HNL A;  1THO A;  3L9V A;  4G10 A;  2O85 A;  3WT2 A;  1M99 A;  4I5Q A;  1A23 A;  5FT3 A;  3CTF A;  4WXT A;  4ZBD A;  1RK4 A;  4DSQ A;  5ABR A;  1JZW A;  5C00 A;  2DKI A;  4CY6 A;  3IA1 A;  4HQS A;  1OAZ A;  1O8W A;  1W89 A;  5DAK B;  4NMU A;  1GSU A;  5IOW A;  2VM2 A;  4K2X A;  1GSQ A;  1G7O A;  4L5O A;  1VGL A;  3O6T A;  3HJP A;  4KDX A;  4N0Z A;  1K3O A;  5CRH A;  4X4J A;  3VWV A;  1LJR A;  2RII A;  3LG6 A;  4I2T A;  3K8N A;  1K0N A;  3FZ5 A;  2B7K A;  1FO5 A;  3HD5 A;  2VL2 A;  2KP1 A;  1TP9 A;  4FQU A;  2G0F A;  4I6X A;  1A0R P;  3UBL A;  2N5B A;  3KMN A;  4NPB A;  3VLN A;  3GL3 A;  5A4U A;  3TCO A;  1HNC A;  4MA9 A;  4MF6 A;  3M8N A;  2OAC A;  3LEF A;  2PER A;  1O73 A;  4KF9 A;  2FY6 A;  2QA2 A;  5LNK e;  2FCH A;  2DJK A;  3IOS A;  3UOM A;  3CSI A;  1SKR B;  2H72 A;  2CAI A;  1ZZY A;  4LL4 B;  4GLT A;  2GZY A;  2I1U A;  2V2G A;  2EIR A;  4IEL A;  3BCK A;  2VO4 A;  1A0F A;  3TOT A;  4OWY A;  1PKW A;  4IW9 A;  2WJU A;  4V2L A;  3ZFB A;  1QGV A;  4GWR A;  5ELG A;  3FW2 A;  5KOW A;  1B4P A;  5B8A A;  4TXV A;  1EZK A;  5HR2 A;  3PH9 A;  3C71 A;  1K0O A;  3IBH A;  3VPQ A;  1ERU A;  1V58 A;  2YCD A;  4ILF A;  3IHQ A;  1HYU A;  3D22 A;  2LJA A;  4L0W A;  4PXO A;  1F37 A;  1S3C A;  2DJ2 A;  3FYG A;  1GUK A;  4GST A;  2VLT A;  3TRQ A;  1AC1 A;  2NVL A;  1K0B A;  2VCQ A;  2QC7 A;  3WGE A;  4I2U A;  3U5R E;  3GH9 A;  5CP1 A;  1MDK A;  3GKN A;  1OYJ A;  2JZR A;  4KDY A;  2DJ1 A;  2DBC A;  1X9S B;  4YKF A;  3EYT A;  1YF1 A;  3LXZ A;  5JWR B;  2LQQ A;  1TK5 B;  1SK2 A;  1K0D A;  4ZB6 A;  3EPT A;  5GAN D;  1QUW A;  4GRF A;  5COH A;  3IV4 A;  4ISD A;  4N0V A;  3VI7 A;  2F8A A;  3WD6 A;  1M9A A;  3TKQ A;  1F9M A;  3US3 A;  5G1K A;  1XW9 A;  1Q98 A;  3E3E A;  3FMW A;  3GSS A;  3P2A A;  2H6Y A;  1XXU A;  1USB A;  2GT6 A;  4PQI A;  4Q5N A;  1XWA A;  3MIX A;  4ZB9 A;  10GS A;  4ID0 A;  2R0P A;  5KN1 A;  3ZRE A;  1EP8 A;  3MNG A;  4PGT A;  3ERG A;  2HRN A;  6GST A;  1LBK A;  2RUE A;  1XWB A;  3VK9 A;  3DGQ A;  2RUF A;  1FOV A;  1U3I A;  3J7Y b;  5D9X A;  2B5E A;  4MAB A;  3HVV A;  2WZ9 A;  4OFT A;  1S3D A;  3NZN A;  5ID2 B;  1WE0 A;  1UC7 A;  4TRX A;  4HJ2 A;  1GSE A;  1K0M A;  3ZRD A;  2HSH A;  3EC3 A;  1G6Y A;  5DDL A;  2L57 A;  5G31 A;  5ECQ B;  1GH2 A;  4AJ7 A;  4OFN A;  1U6T A;  2GSQ A;  2YJ7 A;  1PKZ A;  4KW6 A;  1SKS B;  2IJY A;  2DML A;  4WF5 A;  1B48 A;  1K3L A;  3GN3 A;  3DXB A;  4BVY A;  1WMJ A;  4IKH A;  2MMZ A;  4K0N A;  2RM5 A;  2PVO C;  4BWQ A;  1AW9 A;  1T7P B;  3E0U A;  2LUS A;  2HZF A;  2VUP A;  2YV9 A;  4MH2 A;  1NM3 A;  4NHW A;  1T1V A;  4K2D A;  1JZO A;  3L9S A;  3HVS A;  2QA1 A;  1OC3 A;  1MD3 A;  2IMI A;  2FA4 A;  3ZIV A;  4PTS A;  1H75 A;  4KCA A;  3KZQ A;  1FHE A;  3CRU A;  1Z7P A;  1Z6M A;  3KH7 A;  4G2E A;  1K0C A;  1S3A A;  4GSS A;  1ML6 A;  3TRP A;  1GTU A;  2V6O A;  4RUV A;  2YWI A;  4KH7 A;  1A8Y A;  4WET A;  5DAK A;  2YWO A;  4CW9 A;  2B5X A;  1VF3 A;  2XC2 A;  2H1D A;  3KH9 A;  1H4O A;  3PR8 A;  2IWT A;  4ML1 A;  4EXJ A;  2FNO A;  5CRG A;  4Q5Q A;  2WB9 A;  5IMZ A;  1N8J A;  2HSM A;  3GKX A;  5EPF A;  3JCM L;  2L5O A;  2YAN A;  3GUR A;  2DJ3 A;  1V40 A;  4KGI A;  4D73 B;  5BMU A;  4MMM A;  4DSS B;  3I69 A;  3WT1 A;  3SBC A;  2B1L A;  4WR5 A;  1O6J A;  2FWF A;  3RAZ A;  1T3B A;  4BA7 A;  3UL3 A;  4G0L A;  5IMC A;  1YJ6 A;  3VI5 A;  2CV4 A;  2DC5 A;  1RW1 A;  1O81 A;  2RM6 A;  4ECJ A;  3IDV A;  5ELA A;  5F05 A;  2PWJ A;  2YPM A;  4Q5F A;  2UZ8 A;  5ECN B;  4MZB A;  2B5Y A;  3HA9 A;  4G9H A;  1B9Y C;  2H1G A;  2H71 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...