1QFNA

Glutaredoxin-1-ribonucleotide reductase b1 mixed disulfide bond
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
85
structure length
85
Chain Sequence
MQTVIFGRSGCPYSVRAKDLAEKLSNERDDFQYQYVDIRAEGITKEDLQQKAGKPVETVPQIFVDQQHIGGYTDFAAWVKENLDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport/oxidoreductase
molecule keywords PROTEIN (GLUTAREDOXIN 1)
publication title Binding specificity and mechanistic insight into glutaredoxin-catalyzed protein disulfide reduction.
pubmed doi rcsb
source organism Escherichia coli
total genus 24
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 1999-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00462 Glutaredoxin Glutaredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1qfnA00
1YZXA 4TR4A 1AQXA 4V2NA 1TXXA 4KNDA 2H8LA 2VL3A 4HEA2 2FA4A 1WRYA 1EOGA 1R4WA 2IFQA 1BEDA 2H01A 3FRCA 1VGLA 1ZOFA 5J9BA 5G30A 2ZCTA 5A4WA 4HQZA 2HZEA 2AV4A 1UVZA 4BWQA 1SYRA 2L5LA 5B8BA 5IPHA 1TOFA 3AY8A 2ZUPA 1T4ZA 2NVLA 3IPZA 2P0GA 2GZPA 4MMMA 1OC8A 5HQPA 5IMZA 5KN1A 4MP4A 5D9XA 4TXOA 2YN1A 1AAZA 3P2AA 2WRTA 2J23A 4MPFA 1HD2A 4JE1A 2DMLA 2LNSA 4BWSA 1A23A 2FWHA 4IBPA 3TGZA 4IJ3A 2C0GA 3DEXA 1AUCA 2AHEA 2OACA 3L78A 2MBSA 3ZFBA 3CSJA 4KAEA 1WP0A 3ZVJA 2YP6A 1R26A 1XCCA 4J56E 3ZVJD 4L5LA 2VIMA 5F05A 2F8FA 4G19A 7GSSA 1WIKA 5ECRB 2GTUA 3GKNA 1XWCA 5J41A 3HVVA 1SKRB 1GWCA 3IHQA 2B6MA 1KTEA 3LEFA 5D96A 5HR3A 6GSTA 6GSVA 1PKZA 3GSSA 4K8MA 1X0RA 3FEUA 1YKCA 3KCMA 1ZYEA 2DJ1A 5CYYA 4GF0A 1U3IA 1XFLA 1HNCA 2OADA 2FHEA 4NHWA 1O8XA 3QMXA 1KBNA 4BVXA 2X64A 1XXUA 3GKMA 4NHZA 6GSYA 3CRTA 1TRVA 3D4TA 3GA4A 3GX8A 3TJBA 1K0MA 3HZ4A 4PQHA 3FHKA 1AC1A 3N9JA 4MABA 4YAVA 2B1LA 4NV2A 1HNAA 5DAKA 4ZBDA 1TK5B 4PNFA 4FO5A 3APSA 4G9HA 2E0QA 4EC0A 1XWAA 2CAIA 2HSYA 1Y25A 4OFTA 2LRCA 2H1GA 3VURA 3MAKA 2MZCA 2IWTA 2IMEA 3C73A 4ACSA 3VWVA 5CAXA 5DDLA 2EIQA 2IIYA 1QQ2A 2CA8A 4KB3A 4ID0A 3TJGA 2GGTA 3R2QA 3G7IA 2MMOA 4GSTA 4YQMA 1YY7A 4K6XA 2V41A 5AIVA 3HCZA 2FWGA 4YH2A 1Q4JA 1O7UA 2I81A 1TTZA 2LNTA 5IOWA 2C80A 3HJMA 4ZBAA 3G9BA 4KA0A 2BJXA 1OC3A 4IS0A 2DJKA 5JWOB 3MSZA 3DYRA 4F0BA 3SBCA 3U6VA 1O6JA 3CRUA 2PBJA 1DE1A 19GSA 2MBTA 1WWJA 3TKQA 2F8AA 4MK3A 4OWYA 1TI3A 5GSSA 1K3YA 1K0OA 3FZ5A 3GX0A 3H93A 4HI7A 2I4AA 5ECLB 2H6YA 3VWUA 2A2SA 3F8UA 4LLRA 5IM9A 2GLRA 4AJ8A 1X5EA 3L9VA 2CZ2A 1DE2A 6GSWA 5A4VA 2E2GA 2PGTA 4CHSA 3DKSA 3Q19A 4ZXGA 2HT9A 5HFKA 5DVBA 3ZTLA 3V1WA 5JWQB 2B3SA 2H66A 1Z7RA 2CX3A 3APQA 4ZBBA 1ABAA 4F82A 3IRAA 1OKDA 2L4CA 3BCKA 1HNBA 5IIZA 1G7EA 4GRFA 2YANA 3TJFA 2TRXA 4LL4B 1SJIA 1F37A 4DSQA 2O89A 3GKXA 5D9VA 3IXRA 4HU9A 1BQ7A 3RDWA 3KGKA 2X99A 2LUSA 1FVKA 4J57E 5IO2A 4PUFC 5COHA 2YZUA 4JRRA 1G0TA 2PU9C 1SKWB 2RM5A 1PX7A 2JZRA 2GZZA 4O7HA 5ECKB 4HZ4A 2DMMA 3VWXA 5AISA 1TKDB 4I5QA 1CQHA 2ON7A 1YF1A 3VFIA 1WJKA 2PERA 3ZMLA 3M8NA 5HR1A 5ELAA 4V1Ap 1EV4A 2L6DA 3WGDA 2ZNMA 3DD3A 3UBLA 2R4VA 2WS2A 3FZ9A 1GNEA 4V1Ag 3PH9A 2CX4A 1ZGNA 4IJIA 2H75A 3EC3A 3EWLA 2HRFA 4POMA 1A24A 2XPEA 3D0ZA 5IMVA 4KCAA 2VD1A 3KMNA 2F3MA 1SK2A 1GTAA 3GV1A 3HDCA 3A3TA 2DLXA 4MA9A 1A0FA 2NPBA 2WULA 4EF0A 1K0CA 3G7JA 4IP6A 2KP1A 2B7JA 4X0XA 3FR6A 4NXIA 2LJRA 2YWNA 2O85A 2DJ2A 2DBCA 4HS1A 1HYUA 1B4PA 3HVXA 2H6XA 4IVFA 2JADA 2E7PA 1PD21 3CBUA 1TRUA 3DRNA 20GSA 2VLTA 1AQWA 4GQCA 1EEMA 3BBYA 3QAWA 2FD3A 8GSSA 2PMTA 1PRXA 4TVEA 3UVTA 5KN3A 1F3BA 1J08A 1WOUA 1PA3A 2K9FA 2FLSA 3H4KA 4NPBA 2REMA 1F3AA 2VM2A 2WZ9A 4JR4A 2MMZA 2HFDA 2HNLA 4H86A 5IOXA 4HJ2A 3BD2A 1T3BA 1M9BA 4L0WA 4MH2A 4E8EA 1THOA 4HZ2A 4DSRA 5G2ZA 4KDYA 4PXOA 3DXBA 5DALA 1V40A 3MDKA 5E4WA 5LNKe 5C00A 4ECIA 5D93A 2YZHA 3GMFA 1JFUA 3DGQA 2OE0A 2R3XA 5LCZA 3NIVA 1BYEA 4IP1A 4OCFA 5CREA 3EYTA 1MD4A 4ECCA 3C1RA 2LTKA 3KH7A 2IN3A 2O8VB 4HOJA 5DBQA 12GSA 2OBIA 2IMFA 1A2MA 1TDIA 4XCSA 4I97A 2P31A 2MYGA 17GSA 1PMTA 2XPDA 3TKSE 3I6AA 4IQ1A 3C71A 4L8EA 1V98A 3APOA 4FH8A 4ZL9A 3JCML 2IMKA 2MMAA 3M9KA 1EWXA 1T8EB 1AXDA 2V32A 1BX9A 4XTSA 1VF1A 1N8JA 1MDJA 4O92A 3KIJA 2PN8A 4RI7A 5IMDA 4ML1A 2M46A 4JEDA 3EE2A 3WGEA 1U6TA 2A2RA 3IV4A 1M9AA 1YDKA 4GCIA 2OE3A 4K9ZA 1O85A 1SK0A 5H5SA 3WYWA 3D5JA 1AQVA 2N5FA 4QL9A 2TIRA 3FYGA 4MZBA 1S3CA 2H0IA 3IC4A 1Z9HA 2WDUA 3UARA 2VLVA 1SL0B 5DCGA 5F07A 3GHAA 3FR3A 2I1UA 2V2GA 2O7KA 4EVMA 4D73A 3M9JA 5GAPD 2C1YA 3ZITA 1GNWA 1YF0A 3VWWA 4TKYA 1ZCPA 1SU9A 1Z6NA 5G1LA 3LG6A 4WETA 4MF5A 2VOCA 1GSEA 2G0FA 3QAGA 1X5DA 5G5EA 3ZMKA 2WCIA 3HYPA 1HQOA 4BA7A 2OKAA 2C8UA 2VM1A 3KTLA 6GSXA 5ECHB 3KH9A 4F03A 2FUG2 3ZL5A 1ON4A 2X8GA 5JCGA 2L59A 1M99A 2H74A 2H0GA 3KP8A 3LYKA 2JZTA 2X8HA 1T7PB 2HI7A 3D22A 3GNJA 2LQQA 1SD8A 4OFMA 5H5RA 4K1FA 1GRXA 1XZOA 2CT6A 1A0RP 2H71A 2JSZA 5IQYA 4JZQA 4K7NA 1K0DA 1QK8A 2CQ9A 3KEBA 3VI5A 4WXTA 4POLA 2B5EA 1FB0A 2LS5A 1SL1B 3HA9A 2BTOT 2H73A 4POBA 4KUNA 2QC7A 3N5OA 4F2IA 5CRWA 3TKSC 2GQKA 2H70A 4JU5A 4NAXA 2HSHA 3ZRDA 1FB6A 4ZL8A 4DSSB 3VK9A 3IAS2 5KEJA 1S3AA 1O73A 2C3QA 1LU4A 4HDEA 1GSDA 2KP2A 3Q6OA 4G2EA 2LKUA 16GSA 1GUMA 3J7Yb 1C72A 2XBIA 2IMIA 4WKWA 1NHYA 2VCZA 1NW2A 3DVXA 5J3RA 3QR6A 3KZQA 4EDZA 3QAVA 3RHBA 2DIYA 2XBQA 2JACA 5ECOB 3WD6A 1AIUA 3MNGA 2QKEA 2P5QA 4K7OA 2EIOA 1R5AA 2ON5A 4EUYA 3EU3A 3L0HA 1OVNA 1TK8B 1VF4A 2OE1A 1ZYQB 2FY6A 3HKRA 4QQ7A 3UJ1A 1JHBA 2G2QA 2GSTA 4BL7A 3TUEA 1Z6MA 5EVOA 4TR1B 2XHFA 2GT6A 4IN0A 3EURA 1TRSA 3NOFA 1GSFA 1ST9A 2NBSA 4TN8A 1PL1A 4I8BA 4WBJA 3FZ4A 2GS3A 1V9WA 4LL1B 5ABRA 5E59A 2K8SA 5ECQB 1YEXA 1V2AA 3CTGA 2CVKA 4KH7A 1Z7PA 1MD3A 2YV7A 1G7OA 2R6KA 4YQUA 3GTUB 2VL9A 4EKZA 1TW9A 1U87A 3TKRA 4EE0A 4O32A 3DWVA 1E6BA 4CW9A 3EU4A 1T4YA 1XPVA 5IMAA 1GSYA 2KOKA 4NMUA 3A5WA 2EIRA 4TW5A 1ERTA 3LFLA 5ID2B 2DSAA 1JZOA 2L57A 1UN2A 4PX1A 4K2DA 3E3EA 4MPGA 4YAPA 3UL3A 1F6MC 4ML6A 4KW6A 5G31A 3TDGA 2FA8A 1K0BA 3DMLA 5DJMA 4WEYA 2HYXA 4KDUA 3M3MA 1FG4A 3I43A 4MF7A 2PWJA 1UA5A 3UOMA 3VLNA 2IPAA 3KD0A 2JL4A 2GSRA 3TKSA 3ME7A 2LV3A 4Q5FA 1ZMAA 2IL3A 1SJZA 4HU7A 3A2WA 1FAAA 4XS4B 4X1UA 4Z7XA 2RUFA 3ZREA 2JZSA 3ZYWA 4L0UA 1JZRA 3RPPA 1WE0A 4YQVA 3HXSA 5B6NA 3FK8A 5IMFA 1PKWA 1X9WB 3PINA 5AIXA 3DVWA 1PX6A 4GQFA 2CVDA 4PNGA 4K0NA 3ERFA 2K18A 3GRXA 2AYTA 4AJ6A 2RM6A 2YWOA 2GT5A 3F6DA 4ZL7A 5IPGA 4XS1A 1IYIA 3IBHA 3GSTA 3ERWA 3MWHA 4P3YB 3KM6A 3UVHA 3D21A 4NWYA 2DJJA 1OC9B 5L71A 4FYCA 4Q5RA 4MZWA 1A2JA 5F06A 3GTUA 1YKAA 2CV4A 3LYPA 4Q5QA 5ECSA 1YQ1A 1ZZYA 4KE3A 1VRSD 3GYKA 4WF4A 5LD0A 3GL5A 3EVIA 1EOHA 2C0EA 5FT3A 4KGIA 2AAWA 2H30A 4I6XA 2MMNA 1G6YA 4LMWA 1YEPA 2HZFA 1OE7A 3BOAA 1SENA 3GH9A 5DQYA 4KSOA 2YWIA 2C3NA 2IFQB 2VO4A 1GLQA 4I2UA 2HZEB 2RUEA 4GSNA 2AB6A 2NTOA 3IK7A 4O5RA 1B9YC 2DIZA 1M2DA 4ZILA 3ERGA 2OJLA 5IMCA 2KLXA 3IR4A 1GH2A 4EXJA 1K3LA 1H4OA 2V1MA 2L5OA 1RW1A 4CDOA 2R5GA 1GUHA 5EY6A 5H5QA 4IHUA 3M1GA 3WGXA 4TXOB 3S9FA 1GTBA 3ZFLA 1V57A 4N11A 5D8IA 2JSYA 4MZCA 2C0FA 3QFAC 4DEJA 1GULA 3VPTA 4WBRD 1EP8A 5CP1A 2V6KA 1SJ6A 1KEBA 1EEJA 2DC5A 1LJRA 4MJAA 2DJ3A 2IJYA 1V58A 4MLYA 4HJMA 5J9CA 2YJHA 4MCUA 5G1KA 3GL3A 3HHVA 2A4VA 2B7KA 4X43A 3LORA 4MJEA 5DJLA 1EV9A 1K0AA 4KX4A 3IA1A 3P90A 1QXHA 4GLTA 5JCUA 1J0FA 1GL8A 1JZWA 3OR5A 3F63A 1TI1A 3F9UA 5CRHA 5ECPB 2N5BA 3UBKA 1O8WA 3L9UA 4GXZA 5AN1A 3CTFA 3NZNA 3US3A 3FKFA 2ALBA 4PQIA 4OCEA 3KXOA 1KNGA 4Q5NA 3L4NA 1SYXA 3TOTA 1M0UA 1DBYA 4IELA 3O76A 5AGYA 5EPFA 1K0NA 1SKSB 1H75A 4IKHA 1IYHA 2J9HA 2FNOA 4FYUA 5DAKB 3WT1A 2WGRA 4QL7A 1GSSA 5J4UA 2R2JA 5B7CA 1M7TA 3Q74A 1MEKA 5HR2A 5HR0A 2GQLA 1DSBA 3F4RA 4KSMA 1XOBA 1BJXA 5ECIB 1XVWA 2R37A 4ZB9A 3ZZXA 3TJJA 1SD9A 2PUKC 2VAFA 4KCEA 4N30A 1B48A 1M2AA 1A8YA 2E2MA 1QMVA 3ZIVA 1OE8A 3GUSA 4OO4A 5KN0A 1PN9A 2Z9SA 3IE3A 4ECJA 2FGXA 3KTBA 4K7IA 3F4SA 2RIIA 1T00A 5IO0A 5CNWA 2JU5A 3TCOA 1J9BA 3TRXA 2KHPA 4FIWA 5GZZB 3EINA 3TJKA 3Q18A 3F4TA 1QGVA 4XRDA 2VL2C 1E2YA 2FWEA 1EGRA 3PGTA 4DVCA 1TU8A 4PUAA 3CSIA 3TRPA 2GZYA 9GSSA 4MDCA 2LRTA 2P5RA 5FHIA 1W89A 2B5XA 2WFCA 1B4QA 2YWMA 3VI7A 1ML6A 3W8JA 2C3TA 2PVOC 1FW1A 1A2LA 2YOIA 4N10A 4LA1A 1RK4A 3HZ8A 1XVQA 2OBKA 5C04A 5F8BA 1XWBA 3D4MA 3C7MA 1I9DA 4HQSA 4RI6A 2GDRA 2L4QA 3F6FA 1X5CA 4ILFA 2K8VA 4TOPA 3GH6A 1K3OA 2WB9A 4OD7A 1OKTA 4OMVA 1FOVA 5GSTA 3TB2A 3LXZA 1G6WA 3QPMA 4ZIJA 3IK9A 5JCWA 14GSA 2C4JA 3CYNA 4XS6A 3E0UA 1EGOA 1XW9A 1BAYA 5DQSA 2ES7A 1MDKA 3IOSA 2HLSA 1EZKA 1GSQA 2NDOA 2H76A 1GTUA 1B9XC 4NV5A 4L5OA 1FVJA 1S3DA 1GUKA 2B1KA 2VCTA 3GN3A 2L6CA 3C1SA 2H0HA 3FZAA 3M0FA 1GSUA 3CSHA 5A5KA 1PL2A 4MJBA 2WJUA 3W8SA 1ERVA 4K0GA 1M2BA 3CMIA 3O6TA 1XW5A 1FO5A 3EMXA 4MH3A 2D2ZA 2LQOA 3H8QA 3BCIA 4GWRA 1SL2B 4PURA 2VUPA 5D9TA 5CRGA 2VCQA 3H79A 3GURA 5INYA 4LMVA 2AUVA 1ILOA 4AF2A 3P7XA 3HJPA 2H72A 3HJOA 1CQGA 2VD0A 3K8NA 2C0DA 4PQ1A 2QGVA 1XWKA 2I3YA 4MJCA 3KMOA 1BG5A 4PGTA 3KP9A 1NM3A 2EC4A 1AW9A 4POKA 1TRWA 4AJ7A 1PSQA 5JWRB 3F3RA 4WR5A 5CO3A 1URMA 3TOUA 5GAND 3LWAA 2IMDA 5EL8A 4XHMA 2H1DA 2YPMA 4TRXA 4DSSA 2V6OA 3GFKA 5B6MA 3ME8A 4OFNA 2FWFA 3IAM2 3RPNA 3RAZA 3UAPA 18GSA 4BVYA 1TP9A 2VL2A 2YJ7A 1OYJA 4JBBA 1JZDA 2RLIA 1ERUA 3FW2A 2LJKA 2KUCA 5ENUA 4V2LA 3LJRA 3F0IA 1F2EA 3WT2A 4HUAA 2BMXA 2N5AA 4J2FA 2O87A 1Z3EA 1DUGA 1QFNA 2K6VA 3BJ5A 1R7HA 4ISDA 3D6IA 1T1VA 3GIXA 2M72A 1SK1A 4N0ZA 4V2MA 3RHCA 4TR3A 5DCHA 2VCWA 1ACVA 3LGCA 3L9SA 1MDIA 1U3AA 3C8EA 1OAZA 3LSZA 1XW6A 3A2XA 2VCXA 2CZ3A 3HD5A 1VF2A 4KDXA 3QD9A 2I9HA 2FCHA 1NHOA 4XRAA 2GSQA 2XC2A 1Q98A 5DALB 3TKPA 4AGSA 3PR8A 2H1BA 2VCVA 1I5GA 3P8WA 4WR4A 4F0CA 4TR1A 2LSTA 1VF3A 1W4VA 3UIWA 2GSSA 2LEGA 1PQNA 4EO3A 3SWLA 4JR6A 1GLPA 3FY7A 4WF5A 3RBTA 2PPTA 3GKKA 2PVQA 4TXVA 2H1AA 4EL1A 4RQXA 4I2TA 3A2VA 1O81A 4E8HA 1X9SB 2B5YA 3ISOA 1LBKA 3QCPA 1GTIA 4FYBA 5J5NA 2CAQA 1THXA 1GP1A 4RUVA 5D9WA 1B8XA 4F9ZA 5F0GA 5G5FA 3H1NA 1WMJA 3LXTA 4GTUA 5ID2A 3I69A 3CXGA 5B8AA 1WPIA 3ZIJA 2CVBA 1XBSA 5HFGA 2YV9A 6GSUA 2DJ0A 4MF6A 1RQMA 1JLVA 2HXKA 1ZL9A 4IGJA 5FWGA 1Z5YE 4GSSA 2HE3A 2VLUA 3QDNA 4RQRA 5ELGA 1U88A 3G7YA 1ERWA 6GSSA 1TJDA 3HY2A 4G10A 2YCDA 2M80A 3W6GA 1JLWA 3TRQA 1EP7A 1TU7A 3IDVA 2QSIA 2OA7A 10GSA 1PGTA 4XIHA 4EDYA 4IW9A 3LQ7A 4ULXA 4ECBA 3UMAA 2TRCP 1N2AA 11GSA 2F9SA 2H19A 5D73A 3EMPA 4XS4A 5ECNB 1XOAA 1F9MA 1TK0B 4D73B 4ZB8A 13GSA 22GSA 4OO5A 2HRNA 4N0VA 1MTCA 1XIYA 2F51A 3J7Yk 4ZB6A 1Y6EA 4TR0A 5CRDA 3VPQA 5A4UA 3I9V2 1YJ6A 5HFIA 3KJYA 3QOUA 3FR9A 3U5RE 3UEMA 2AJQB 1USBA 1QUWA 3F3QA 5ECMB 1OC9A 4BPYA 3HVSA 1UC7A 2GQMA 1R5PA 1FHEA 3QFBC 3ZLPA 5KN2A 1X9MB 1A8LA 2LRNA 3E9JB 3ED3A 3O3TA 1XWGA 2H6ZA 2GVPA 4IQAA 3DIEA 2X8CA 2LJAA 1NSWA 2YNXA
chains in the Genus database with same CATH superfamily
1YZXA 4TR4A 1AQXA 4V2NA 1TXXA 4KNDA 2H8LA 2VL3A 4HEA2 2FA4A 1WRYA 1EOGA 1R4WA 2IFQA 1BEDA 2H01A 3FRCA 1VGLA 1ZOFA 5J9BA 5G30A 2ZCTA 5A4WA 4HQZA 2A4HA 2HZEA 2AV4A 1UVZA 4BWQA 1SYRA 2L5LA 5B8BA 5IPHA 1TOFA 3AY8A 2ZUPA 1T4ZA 2NVLA 3IPZA 2P0GA 2GZPA 4MMMA 1OC8A 5HQPA 5IMZA 5KN1A 4MP4A 5D9XA 4TXOA 2YN1A 1AAZA 3P2AA 2WRTA 2J23A 4MPFA 1HD2A 4JE1A 2DMLA 2LNSA 4BWSA 1A23A 2FWHA 4IBPA 3TGZA 4IJ3A 2C0GA 3DEXA 1AUCA 2AHEA 2OACA 3L78A 2MBSA 3ZFBA 5BMUA 3CSJA 4KAEA 1WP0A 3ZVJA 2YP6A 4CY6A 1R26A 1XCCA 4J56E 3ZVJD 4L5LA 2VIMA 5F05A 2F8FA 4G19A 7GSSA 4CY8A 1WIKA 5ECRB 2GTUA 3GKNA 1XWCA 5J41A 3HVVA 1SKRB 1GWCA 3IHQA 2B6MA 1KTEA 3LEFA 5D96A 5HR3A 6GSTA 6GSVA 1PKZA 3GSSA 4K8MA 1X0RA 3FEUA 1YKCA 4G0KA 3KCMA 1ZYEA 2DJ1A 5CYYA 4GF0A 1U3IA 1XFLA 1HNCA 2OADA 2FHEA 4NHWA 1O8XA 3QMXA 1KBNA 4BVXA 2X64A 1XXUA 3GKMA 4NHZA 4K5RA 6GSYA 4BL7B 3CRTA 1TRVA 3D4TA 3GA4A 3GX8A 3TJBA 1K0MA 3HZ4A 4PQHA 3FHKA 1AC1A 3N9JA 4MABA 1ZYPA 4YAVA 2B1LA 4NV2A 1HNAA 5DAKA 4ZBDA 1TK5B 4PNFA 4FO5A 3APSA 4G9HA 2E0QA 4EC0A 1XWAA 2CAIA 2HSYA 1Y25A 4OFTA 2LRCA 2H1GA 3VURA 3MAKA 4BIKA 2MZCA 2IWTA 1PFOA 2IMEA 3C73A 4ACSA 3VWVA 5CAXA 5DDLA 2EIQA 2IIYA 1QQ2A 2CA8A 4KB3A 4ID0A 3TJGA 2GGTA 3R2QA 3G7IA 2MMOA 4GSTA 4YQMA 1YY7A 4K6XA 2V41A 4X4JA 5AIVA 3HCZA 2FWGA 4YH2A 1Q4JA 1O7UA 2I81A 1TTZA 2LNTA 5IOWA 2C80A 3HJMA 4ZBAA 3G9BA 4KA0A 2BJXA 1OC3A 4IS0A 2DJKA 5JWOB 3MSZA 3DYRA 4F0BA 3SBCA 3U6VA 1O6JA 3CRUA 2PBJA 1DE1A 19GSA 2MBTA 1WWJA 3TKQA 2F8AA 4MK3A 4OWYA 1TI3A 5GSSA 1K3YA 1K0OA 3FZ5A 3GX0A 3H93A 4HI7A 2I4AA 5ECLB 2H6YA 3VWUA 2A2SA 3F8UA 4LLRA 5IM9A 2GLRA 4AJ8A 1X5EA 2QA2A 3L9VA 2CZ2A 1DE2A 6GSWA 5A4VA 2E2GA 2PGTA 4CHSA 3DKSA 3Q19A 4ZXGA 2HT9A 5HFKA 5DVBA 3ZTLA 3V1WA 3R3EA 5JWQB 2B3SA 2H66A 1Z7RA 2CX3A 2DKIA 3APQA 4ZBBA 1ABAA 4F82A 3IRAA 1OKDA 2L4CA 3BCKA 1HNBA 5IIZA 1G7EA 4GRFA 2YANA 5KOXA 3TJFA 2TRXA 4LL4B 1SJIA 1F37A 4DSQA 2O89A 4EIPA 3GKXA 5D9VA 3IXRA 4HU9A 1BQ7A 3RDWA 3KGKA 2X99A 2LUSA 1FVKA 4J57E 5IO2A 4PUFC 5COHA 2YZUA 4JRRA 1G0TA 2PU9C 1SKWB 4YKGA 2RM5A 1PX7A 2JZRA 2GZZA 2DKHA 4O7HA 5ECKB 4HZ4A 2DMMA 3VWXA 5AISA 1TKDB 4I5QA 1CQHA 2ON7A 1YF1A 3VFIA 1WJKA 2PERA 3ZMLA 3M8NA 5HR1A 5ELAA 4V1Ap 4G0IA 1EV4A 2L6DA 3WGDA 2ZNMA 3DD3A 3UBLA 2R4VA 2WS2A 3FZ9A 1GNEA 4V1Ag 3PH9A 3MIXA 2CX4A 1ZGNA 4IJIA 2H75A 3EC3A 3EWLA 2HRFA 4POMA 1A24A 2XPEA 3D0ZA 5IMVA 4KCAA 2VD1A 3KMNA 2F3MA 1SK2A 1GTAA 3GV1A 3HDCA 3A3TA 2DLXA 4MA9A 1A0FA 2NPBA 2WULA 4EF0A 1K0CA 3G7JA 4IP6A 2KP1A 2B7JA 4X0XA 3FR6A 4NXIA 2LJRA 2YWNA 2O85A 3IHGA 2DJ2A 2DBCA 4HS1A 1HYUA 1B4PA 3HVXA 2H6XA 4EIQA 4IVFA 2JADA 2E7PA 1PD21 3CBUA 1TRUA 3DRNA 20GSA 2VLTA 1AQWA 4GQCA 1EEMA 3BBYA 3QAWA 2FD3A 8GSSA 2PMTA 1PRXA 4TVEA 3UVTA 5KN3A 1F3BA 1J08A 1WOUA 1PA3A 2K9FA 2FLSA 3H4KA 4NPBA 2REMA 1F3AA 2VM2A 2WZ9A 4JR4A 2MMZA 2HFDA 2HNLA 4H86A 5IOXA 4HJ2A 3BD2A 1T3BA 1M9BA 4L0WA 4MH2A 4E8EA 4MNNA 1THOA 4HZ2A 4DSRA 5G2ZA 4KDYA 4PXOA 3DXBA 5DALA 1V40A 3MDKA 5E4WA 5LNKe 5C00A 4ECIA 5D93A 2YZHA 3GMFA 1JFUA 3DGQA 2OE0A 2R3XA 5LCZA 3NIVA 1BYEA 4IP1A 4OCFA 5CREA 3EYTA 1MD4A 4ECCA 3C1RA 2LTKA 3KH7A 2IN3A 2O8VB 4HOJA 5DBQA 12GSA 2OBIA 2IMFA 1A2MA 1TDIA 4XCSA 4I97A 2P31A 2MYGA 17GSA 1PMTA 2XPDA 3TKSE 3I6AA 4IQ1A 3C71A 4L8EA 1V98A 3APOA 4FH8A 4ZL9A 3JCML 2IMKA 2MMAA 1FOHA 3M9KA 1EWXA 1T8EB 1AXDA 2V32A 1BX9A 4XTSA 1VF1A 1N8JA 1MDJA 4O92A 3KIJA 2PN8A 3MYDA 4RI7A 5IMDA 4ML1A 2M46A 4JEDA 3EE2A 3WGEA 1U6TA 2A2RA 3IV4A 1M9AA 1YDKA 4GCIA 2OE3A 4K9ZA 1O85A 1SK0A 5H5SA 3WYWA 3D5JA 1AQVA 2N5FA 4QL9A 2TIRA 3FYGA 4MZBA 1S3CA 2H0IA 3IC4A 1Z9HA 2WDUA 3UARA 2VLVA 1SL0B 5DCGA 5F07A 3GHAA 3FR3A 2I1UA 2V2GA 2O7KA 4EVMA 4D73A 3M9JA 5GAPD 2C1YA 3ZITA 1GNWA 1YF0A 3VWWA 4TKYA 1ZCPA 1SU9A 1Z6NA 5G1LA 3LG6A 4WETA 4MF5A 2VOCA 1GSEA 2G0FA 3QAGA 1X5DA 5G5EA 3ZMKA 2WCIA 3HYPA 1HQOA 4BA7A 2OKAA 4K2XA 2C8UA 2VM1A 3KTLA 6GSXA 5ECHB 3KH9A 4F03A 2FUG2 3ZL5A 2R0GA 1ON4A 2X8GA 5JCGA 2L59A 1M99A 2H74A 2H0GA 3KP8A 3LYKA 2JZTA 2X8HA 1T7PB 2HI7A 3D22A 3GNJA 2LQQA 1SD8A 4OFMA 5H5RA 4K1FA 1GRXA 1XZOA 2CT6A 1A0RP 2H71A 2JSZA 5IQYA 4JZQA 4K7NA 1K0DA 1QK8A 2CQ9A 3KEBA 4O5UA 3VI5A 4WXTA 4POLA 2B5EA 1FB0A 2LS5A 1SL1B 3HA9A 2BTOT 2H73A 4POBA 4KUNA 4USSA 2QC7A 3N5OA 4F2IA 5CRWA 3TKSC 2GQKA 2H70A 4JU5A 4NAXA 2HSHA 3ZRDA 1FB6A 4ZL8A 4DSSB 3VK9A 3IAS2 5KEJA 1S3AA 1O73A 2C3QA 1LU4A 4BVYB 4HDEA 1GSDA 2KP2A 3Q6OA 4G2EA 2LKUA 16GSA 1GUMA 3J7Yb 1C72A 2XBIA 2IMIA 4WKWA 1NHYA 2VCZA 1NW2A 3DVXA 5J3RA 3QR6A 3KZQA 2HRAA 4EDZA 3QAVA 3RHBA 2DIYA 2XBQA 2JACA 5ECOB 3WD6A 1AIUA 3MNGA 2QKEA 2P5QA 4K7OA 2EIOA 1R5AA 2ON5A 3A5IA 4EUYA 3EU3A 3L0HA 1OVNA 1TK8B 1VF4A 2OE1A 1ZYQB 2FY6A 3HKRA 4QQ7A 3UJ1A 1JHBA 2G2QA 2GSTA 4BL7A 3TUEA 1Z6MA 5EVOA 4TR1B 2XHFA 2GT6A 4IN0A 3EURA 1TRSA 3NOFA 1GSFA 1ST9A 2NBSA 4TN8A 4HSCX 1PL1A 4I8BA 4WBJA 3FZ4A 2GS3A 1V9WA 4LL1B 5ABRA 5E59A 2K8SA 5ECQB 4FQUA 1YEXA 1V2AA 3CTGA 2CVKA 4KH7A 1Z7PA 1MD3A 2X49A 2YV7A 1G7OA 1M3IA 2R6KA 4YQUA 3GTUB 2VL9A 4EKZA 1TW9A 3IC8A 1U87A 3TKRA 4EE0A 4O32A 3DWVA 1E6BA 4CW9A 3EU4A 1T4YA 1XPVA 5IMAA 1GSYA 2KOKA 4NMUA 3A5WA 2EIRA 4TW5A 1ERTA 3LFLA 5ID2B 2DSAA 1JZOA 2L57A 1UN2A 4PX1A 4K2DA 3E3EA 4MPGA 4YAPA 3UL3A 1F6MC 4ML6A 4KW6A 5G31A 3TDGA 2FA8A 1K0BA 3DMLA 5DJMA 4WEYA 2HYXA 4KDUA 4PTSA 3M3MA 1FG4A 3I43A 4MF7A 2PWJA 4A5PA 1UA5A 3UOMA 3VLNA 2IPAA 3KD0A 2JL4A 2GSRA 3TKSA 3ME7A 2LV3A 4Q5FA 1ZMAA 2IL3A 1SJZA 4HU7A 3A2WA 1FAAA 4XS4B 4X1UA 4Z7XA 2RUFA 3ZREA 2JZSA 3ZYWA 4L0UA 1JZRA 3RPPA 1WE0A 4YQVA 3HXSA 5B6NA 3FK8A 5IMFA 1PKWA 1X9WB 3PINA 5AIXA 3PPUA 3DVWA 1PX6A 4GQFA 2CVDA 4PNGA 4K0NA 3ERFA 2K18A 3GRXA 2AYTA 4AJ6A 2RM6A 2YWOA 2GT5A 3EPTA 3F6DA 4ZL7A 5IPGA 4XS1A 1IYIA 3IBHA 3GSTA 3ERWA 3MWHA 4P3YB 3KM6A 3UVHA 3D21A 4NWYA 2DJJA 1OC9B 5L71A 4FYCA 4Q5RA 4Z2TA 4MZWA 1A2JA 5F06A 3GTUA 1YKAA 2A2PA 2CV4A 4Z2UA 3LYPA 4Q5QA 5ECSA 1YQ1A 1ZZYA 4KE3A 1VRSD 3GYKA 4WF4A 5LD0A 3GL5A 3EVIA 1EOHA 2C0EA 5FT3A 4KGIA 2AAWA 2H30A 4I6XA 2MMNA 1G6YA 4LMWA 1YEPA 2HZFA 1OE7A 2UZ8A 3BOAA 1SENA 3GH9A 5DQYA 4KSOA 2YWIA 2C3NA 2IFQB 2VO4A 1GLQA 4I2UA 2HZEB 2RUEA 4GSNA 2AB6A 2NTOA 3IK7A 4O5RA 1B9YC 2DIZA 1M2DA 4ZILA 3ERGA 2OJLA 5IMCA 2KLXA 3IR4A 1GH2A 4EXJA 1K3LA 1H4OA 2V1MA 2L5OA 1RW1A 4CDOA 2R5GA 1GUHA 5EY6A 5H5QA 4IHUA 3M1GA 3WGXA 4TXOB 3S9FA 1GTBA 3ZFLA 1V57A 4N11A 5D8IA 2JSYA 4MZCA 2C0FA 3QFAC 4DEJA 1GULA 3VPTA 4WBRD 1EP8A 5CP1A 2V6KA 1SJ6A 1KEBA 1EEJA 2DC5A 4O5QA 1LJRA 4MJAA 2DJ3A 2IJYA 1V58A 4MLYA 4HJMA 5J9CA 2YJHA 4MCUA 5G1KA 3GL3A 3HHVA 2A4VA 2B7KA 4X43A 3LORA 4MJEA 5DJLA 1EV9A 1K0AA 4KX4A 3IA1A 3P90A 1QXHA 4GLTA 5JCUA 1J0FA 1GL8A 1JZWA 3OR5A 3F63A 1TI1A 3F9UA 5CRHA 5ECPB 2N5BA 3UBKA 4BVXB 1O8WA 3L9UA 4GXZA 5AN1A 3CTFA 3NZNA 3US3A 3FKFA 2ALBA 4PQIA 4OCEA 3KXOA 1KNGA 4Q5NA 3L4NA 1SYXA 3TOTA 1M0UA 1DBYA 4IELA 3O76A 5AGYA 5EPFA 1K0NA 1SKSB 1H75A 4IKHA 1IYHA 2J9HA 2FNOA 4FYUA 5DAKB 3WT1A 2WGRA 4QL7A 1GSSA 5J4UA 2R2JA 5B7CA 1M7TA 3Q74A 1MEKA 5HR2A 5HR0A 2GQLA 1DSBA 4Z2RA 3F4RA 4KSMA 1XOBA 3CQFA 5ECIB 1BJXA 1XVWA 2R37A 4ZB9A 3ZZXA 3TJJA 1SD9A 2PUKC 2VAFA 4KCEA 4N30A 1B48A 1M2AA 1A8YA 2E2MA 1QMVA 3ZIVA 1OE8A 3GUSA 4OO4A 5KN0A 1PN9A 2Z9SA 3IE3A 4ECJA 3HVNA 2FGXA 3KTBA 4K7IA 3F4SA 2RIIA 1T00A 5IO0A 5CNWA 2JU5A 4KF9A 3TCOA 1J9BA 3TRXA 2KHPA 4FIWA 5GZZB 3EINA 3TJKA 3Q18A 3F4TA 1QGVA 4XRDA 2VL2C 2X4AA 1E2YA 2FWEA 1EGRA 3PGTA 4DVCA 1TU8A 4PUAA 3CSIA 3TRPA 2GZYA 9GSSA 4MDCA 2LRTA 2HSMA 2P5RA 5FHIA 1W89A 2B5XA 2WFCA 1B4QA 2YWMA 3VI7A 1ML6A 3W8JA 2C3TA 2PVOC 1FW1A 1A2LA 2YOIA 4N10A 4LA1A 1RK4A 3HZ8A 1XVQA 2OBKA 5C04A 5F8BA 1XWBA 3D4MA 3C7MA 1I9DA 4HQSA 4RI6A 2GDRA 2L4QA 3F6FA 1X5CA 2R0CA 4ILFA 4K5SA 2K8VA 4TOPA 3GH6A 1K3OA 2WB9A 4OD7A 1OKTA 4OMVA 1FOVA 5GSTA 3TB2A 3LXZA 1G6WA 3QPMA 4ZIJA 3IK9A 5JCWA 2R0PA 14GSA 2C4JA 3CYNA 4XS6A 3E0UA 1EGOA 1XW9A 1BAYA 5DQSA 2ES7A 1MDKA 3IOSA 2HLSA 1EZKA 1GSQA 2NDOA 2H76A 1GTUA 1B9XC 4NV5A 4L5OA 1FVJA 1S3DA 1GUKA 2B1KA 2VCTA 3GN3A 2L6CA 3C1SA 2H0HA 3FZAA 3M0FA 1GSUA 3CSHA 5A5KA 1XG8A 1PL2A 4MJBA 2WJUA 3W8SA 1ERVA 4K0GA 1M2BA 3CMIA 3O6TA 1XW5A 1FO5A 3EMXA 4MH3A 2D2ZA 2LQOA 1S3RA 3H8QA 3BCIA 4GWRA 1SL2B 4PURA 2VUPA 5D9TA 5CRGA 2VCQA 3H79A 3GURA 5INYA 4LMVA 2AUVA 1ILOA 4AF2A 3P7XA 3HJPA 2H72A 3HJOA 1CQGA 2VD0A 3K8NA 2C0DA 4PQ1A 2QGVA 1XWKA 2I3YA 4MJCA 3KMOA 1BG5A 4PGTA 3KP9A 1NM3A 2EC4A 1AW9A 4POKA 1TRWA 4AJ7A 1PSQA 5JWRB 5KOWA 3F3RA 4WR5A 5CO3A 1URMA 3TOUA 5GAND 3LWAA 2IMDA 5EL8A 4XHMA 2H1DA 2YPMA 4TRXA 4DSSA 2V6OA 3GFKA 5B6MA 3LW9A 3ME8A 4OFNA 2FWFA 3IAM2 3RPNA 3RAZA 3UAPA 18GSA 4BVYA 1TP9A 2VL2A 2YJ7A 1OYJA 4JBBA 1JZDA 2RLIA 1ERUA 3FW2A 2LJKA 2KUCA 5ENUA 4V2LA 3LJRA 3F0IA 1F2EA 3WT2A 4HUAA 2BMXA 1ZYNA 2N5AA 4J2FA 2O87A 1Z3EA 1DUGA 1QFNA 2HRKA 2K6VA 3BJ5A 1R7HA 4ISDA 3D6IA 1T1VA 3GIXA 2M72A 1SK1A 4N0ZA 4V2MA 3RHCA 4TR3A 5DCHA 2VCWA 1ACVA 3LGCA 3L9SA 1MDIA 1U3AA 3C8EA 4YKFA 1OAZA 3LSZA 1XW6A 3A2XA 2VCXA 2CZ3A 3HD5A 1VF2A 4KDXA 3QD9A 2I9HA 2FCHA 1NHOA 4XRAA 2GSQA 2XC2A 1Q98A 5DALB 3TKPA 4AGSA 3PR8A 2H1BA 2VCVA 1I5GA 3P8WA 4ICYA 4WR4A 4F0CA 4TR1A 2LSTA 1VF3A 1W4VA 3UIWA 2GSSA 2LEGA 1PQNA 4EO3A 3SWLA 4JR6A 1GLPA 5BRTA 3FY7A 4WF5A 3RBTA 2PPTA 3GKKA 2PVQA 4TXVA 2H1AA 4EL1A 4RQXA 4I2TA 3A2VA 1O81A 4E8HA 1X9SB 2B5YA 3ISOA 1LBKA 3QCPA 1GTIA 4FYBA 5J5NA 2QA1A 3FMWA 2CAQA 1THXA 1GP1A 4RUVA 5D9WA 1B8XA 4F9ZA 5F0GA 5G5FA 3H1NA 1WMJA 3LXTA 4GTUA 5ID2A 3I69A 3CXGA 5B8AA 1WPIA 3ZIJA 2CVBA 1XBSA 5HFGA 2YV9A 6GSUA 2DJ0A 4MF6A 1RQMA 1JLVA 2HXKA 1ZL9A 4IGJA 5FWGA 1Z5YE 4GSSA 2HE3A 2VLUA 3QDNA 4RQRA 5ELGA 1PN0A 1U88A 3G7YA 1ERWA 6GSSA 3HY2A 1TJDA 4G10A 2YCDA 2M80A 3W6GA 1JLWA 3TRQA 1EP7A 1TU7A 3IDVA 2QSIA 2OA7A 10GSA 1PGTA 4XIHA 4EDYA 4IW9A 3LQ7A 4ULXA 4ECBA 3UMAA 2TRCP 1N2AA 11GSA 2F9SA 2H19A 5D73A 3EMPA 4XS4A 5ECNB 1XOAA 1F9MA 1TK0B 4D73B 4ZB8A 13GSA 22GSA 4OO5A 2HRNA 4N0VA 1MTCA 1XIYA 2F51A 3J7Yk 4ZB6A 1Y6EA 4TR0A 5CRDA 3VPQA 5A4UA 3I9V2 1YJ6A 5HFIA 3KJYA 3QOUA 3FR9A 3U5RE 3UEMA 2AJQB 1USBA 1QUWA 4G0LA 3F3QA 5ECMB 1OC9A 4BPYA 3HVSA 1UC7A 2GQMA 1R5PA 1FHEA 3QFBC 3ZLPA 5KN2A 1X9MB 1A8LA 2LRNA 3E9JB 3ED3A 3O3TA 1XWGA 2H6ZA 2GVPA 4IQAA 3DIEA 2X8CA 1M3JA 2LJAA 1NSWA 2YNXA
chains in the Genus database with same CATH topology
1YZXA 4TR4A 1AQXA 4V2NA 1TXXA 4KNDA 2H8LA 2VL3A 4HEA2 2FA4A 1WRYA 1EOGA 1R4WA 2IFQA 1BEDA 2H01A 3FRCA 1VGLA 1ZOFA 5J9BA 5G30A 2ZCTA 5A4WA 4HQZA 2A4HA 2HZEA 2AV4A 1UVZA 4BWQA 1SYRA 2L5LA 5B8BA 5IPHA 1TOFA 3AY8A 2ZUPA 1T4ZA 2NVLA 3IPZA 2P0GA 2GZPA 4MMMA 1OC8A 5HQPA 5IMZA 5KN1A 4MP4A 5D9XA 4TXOA 2YN1A 1AAZA 3P2AA 2WRTA 2J23A 4MPFA 1HD2A 4JE1A 2DMLA 2LNSA 4BWSA 1A23A 2FWHA 4IBPA 3TGZA 4IJ3A 2C0GA 3DEXA 1AUCA 2AHEA 2OACA 3L78A 2MBSA 3ZFBA 5BMUA 3CSJA 4KAEA 1WP0A 3ZVJA 2YP6A 4CY6A 1R26A 1XCCA 4J56E 3ZVJD 4L5LA 2VIMA 5F05A 2F8FA 4G19A 7GSSA 4CY8A 1WIKA 5ECRB 2GTUA 3GKNA 1XWCA 5J41A 3HVVA 1SKRB 1GWCA 3IHQA 2B6MA 1KTEA 3LEFA 5D96A 5HR3A 6GSTA 6GSVA 1PKZA 3GSSA 4K8MA 1X0RA 3FEUA 1YKCA 4G0KA 3KCMA 1ZYEA 2DJ1A 5CYYA 4GF0A 1U3IA 1XFLA 1HNCA 2OADA 2FHEA 4NHWA 1O8XA 3QMXA 1KBNA 4BVXA 2X64A 1XXUA 3GKMA 4NHZA 4K5RA 6GSYA 4BL7B 3CRTA 1TRVA 3D4TA 3GA4A 3GX8A 3TJBA 1K0MA 3HZ4A 4PQHA 3FHKA 1AC1A 3N9JA 4MABA 1ZYPA 4YAVA 2B1LA 4NV2A 1HNAA 5DAKA 4ZBDA 1TK5B 4PNFA 4FO5A 3APSA 4G9HA 2E0QA 4EC0A 1XWAA 2CAIA 2HSYA 1Y25A 4OFTA 2LRCA 2H1GA 3VURA 3MAKA 2MZCA 2IWTA 2IMEA 3C73A 4ACSA 3VWVA 5CAXA 5DDLA 2EIQA 2IIYA 1QQ2A 2CA8A 4KB3A 4ID0A 3TJGA 2GGTA 3R2QA 3G7IA 2MMOA 4GSTA 4YQMA 1YY7A 4K6XA 2V41A 4X4JA 5AIVA 3HCZA 2FWGA 4YH2A 1Q4JA 1O7UA 2I81A 1TTZA 2LNTA 5IOWA 2C80A 3HJMA 4ZBAA 3G9BA 4KA0A 2BJXA 1OC3A 4IS0A 2DJKA 5JWOB 3MSZA 3DYRA 4F0BA 3SBCA 3U6VA 1O6JA 3CRUA 2PBJA 1DE1A 19GSA 2MBTA 1WWJA 3TKQA 2F8AA 4MK3A 4OWYA 1TI3A 5GSSA 1K3YA 1K0OA 3FZ5A 3GX0A 3H93A 4HI7A 2I4AA 5ECLB 2H6YA 3VWUA 2A2SA 3F8UA 4LLRA 5IM9A 2GLRA 4AJ8A 1X5EA 2QA2A 3L9VA 2CZ2A 1DE2A 6GSWA 5A4VA 2E2GA 2PGTA 4CHSA 3DKSA 3Q19A 4ZXGA 2HT9A 5HFKA 5DVBA 3ZTLA 3V1WA 3R3EA 5JWQB 2B3SA 2H66A 1Z7RA 2CX3A 2DKIA 3APQA 4ZBBA 1ABAA 4F82A 3IRAA 1OKDA 2L4CA 3BCKA 1HNBA 5IIZA 1G7EA 4GRFA 2YANA 5KOXA 3TJFA 2TRXA 4LL4B 1SJIA 1F37A 4DSQA 2O89A 4EIPA 3GKXA 5D9VA 3IXRA 4HU9A 1BQ7A 3RDWA 3KGKA 2X99A 2LUSA 1FVKA 4J57E 5IO2A 4PUFC 5COHA 2YZUA 4JRRA 1G0TA 2PU9C 1SKWB 4YKGA 2RM5A 1PX7A 2JZRA 2GZZA 2DKHA 4O7HA 5ECKB 4HZ4A 2DMMA 3VWXA 5AISA 1TKDB 4I5QA 1CQHA 2ON7A 1YF1A 3VFIA 1WJKA 2PERA 3ZMLA 3M8NA 5HR1A 5ELAA 4V1Ap 4G0IA 1EV4A 2L6DA 3WGDA 2ZNMA 3DD3A 3UBLA 2R4VA 2WS2A 3FZ9A 1GNEA 4V1Ag 3PH9A 3MIXA 2CX4A 1ZGNA 4IJIA 2H75A 3EC3A 3EWLA 2HRFA 4POMA 1A24A 2XPEA 3D0ZA 5IMVA 4KCAA 2VD1A 3KMNA 2F3MA 1SK2A 1GTAA 3GV1A 3HDCA 3A3TA 2DLXA 4MA9A 1A0FA 2NPBA 2WULA 4EF0A 1K0CA 3G7JA 4IP6A 2KP1A 2B7JA 4X0XA 3FR6A 4NXIA 2LJRA 2YWNA 2O85A 3IHGA 2DJ2A 2DBCA 4HS1A 1HYUA 1B4PA 3HVXA 2H6XA 4EIQA 4IVFA 2JADA 2E7PA 1PD21 3CBUA 1TRUA 3DRNA 20GSA 2VLTA 1AQWA 4GQCA 1EEMA 3BBYA 3QAWA 2FD3A 8GSSA 2PMTA 1PRXA 4TVEA 3UVTA 5KN3A 1F3BA 1J08A 1WOUA 1PA3A 2K9FA 2FLSA 3H4KA 4NPBA 2REMA 1F3AA 2VM2A 2WZ9A 4JR4A 2MMZA 2HFDA 2HNLA 4H86A 5IOXA 4HJ2A 3BD2A 1T3BA 1M9BA 4L0WA 4MH2A 4E8EA 4MNNA 1THOA 4HZ2A 4DSRA 5G2ZA 4KDYA 4PXOA 3DXBA 5DALA 1V40A 3MDKA 5E4WA 5LNKe 5C00A 4ECIA 5D93A 2YZHA 3GMFA 1JFUA 3DGQA 2OE0A 2R3XA 5LCZA 3NIVA 1BYEA 4IP1A 4OCFA 5CREA 3EYTA 1MD4A 4ECCA 3C1RA 2LTKA 3KH7A 2IN3A 2O8VB 4HOJA 5DBQA 12GSA 2OBIA 2IMFA 1A2MA 1TDIA 4XCSA 4I97A 2P31A 2MYGA 17GSA 1PMTA 2XPDA 3TKSE 3I6AA 4IQ1A 3C71A 4L8EA 1V98A 3APOA 4FH8A 4ZL9A 3JCML 2IMKA 2MMAA 1FOHA 3M9KA 1EWXA 1T8EB 1AXDA 2V32A 1BX9A 4XTSA 1VF1A 1N8JA 1MDJA 4O92A 3KIJA 2PN8A 3MYDA 4RI7A 5IMDA 4ML1A 2M46A 4JEDA 3EE2A 3WGEA 1U6TA 2A2RA 3IV4A 1M9AA 1YDKA 4GCIA 2OE3A 4K9ZA 1O85A 1SK0A 5H5SA 3WYWA 3D5JA 1AQVA 2N5FA 4QL9A 2TIRA 3FYGA 4MZBA 1S3CA 2H0IA 3IC4A 1Z9HA 2WDUA 3UARA 2VLVA 1SL0B 5DCGA 5F07A 3GHAA 3FR3A 2I1UA 2V2GA 2O7KA 4EVMA 4D73A 3M9JA 5GAPD 2C1YA 3ZITA 1GNWA 1YF0A 3VWWA 4TKYA 1ZCPA 1SU9A 1Z6NA 5G1LA 3LG6A 4WETA 4MF5A 2VOCA 1GSEA 2G0FA 3QAGA 1X5DA 5G5EA 3ZMKA 2WCIA 3HYPA 1HQOA 4BA7A 2OKAA 4K2XA 2C8UA 2VM1A 3KTLA 6GSXA 5ECHB 3KH9A 4F03A 2FUG2 3ZL5A 2R0GA 1ON4A 2X8GA 5JCGA 2L59A 1M99A 2H74A 2H0GA 3KP8A 3LYKA 2JZTA 2X8HA 1T7PB 2HI7A 3D22A 3GNJA 2LQQA 1SD8A 4OFMA 5H5RA 4K1FA 1GRXA 1XZOA 2CT6A 1A0RP 2H71A 2JSZA 5IQYA 4JZQA 4K7NA 1K0DA 1QK8A 2CQ9A 3KEBA 4O5UA 3VI5A 4WXTA 4POLA 2B5EA 1FB0A 2LS5A 1SL1B 3HA9A 2BTOT 2H73A 4POBA 4KUNA 4USSA 2QC7A 3N5OA 4F2IA 5CRWA 3TKSC 2GQKA 2H70A 4JU5A 4NAXA 2HSHA 3ZRDA 1FB6A 4ZL8A 4DSSB 3VK9A 3IAS2 5KEJA 1S3AA 1O73A 2C3QA 1LU4A 4BVYB 4HDEA 1GSDA 2KP2A 3Q6OA 4G2EA 2LKUA 16GSA 1GUMA 3J7Yb 1C72A 2XBIA 2IMIA 4WKWA 1NHYA 2VCZA 1NW2A 3DVXA 5J3RA 3QR6A 3KZQA 2HRAA 4EDZA 3QAVA 3RHBA 2DIYA 2XBQA 2JACA 5ECOB 3WD6A 1AIUA 3MNGA 2QKEA 2P5QA 4K7OA 2EIOA 1R5AA 2ON5A 3A5IA 4EUYA 3EU3A 3L0HA 1OVNA 1TK8B 1VF4A 2OE1A 1ZYQB 2FY6A 3HKRA 4QQ7A 3UJ1A 1JHBA 2G2QA 2GSTA 4BL7A 3TUEA 1Z6MA 5EVOA 4TR1B 2XHFA 2GT6A 4IN0A 3EURA 1TRSA 3NOFA 1GSFA 1ST9A 2NBSA 4TN8A 1PL1A 4I8BA 4WBJA 3FZ4A 2GS3A 1V9WA 4LL1B 5ABRA 5E59A 2K8SA 5ECQB 4FQUA 1YEXA 1V2AA 3CTGA 2CVKA 4KH7A 1Z7PA 1MD3A 2X49A 2YV7A 1G7OA 2R6KA 4YQUA 3GTUB 2VL9A 4EKZA 1TW9A 3IC8A 1U87A 3TKRA 4EE0A 4O32A 3DWVA 1E6BA 4CW9A 3EU4A 1T4YA 1XPVA 5IMAA 1GSYA 2KOKA 4NMUA 3A5WA 2EIRA 4TW5A 1ERTA 3LFLA 5ID2B 2DSAA 1JZOA 2L57A 1UN2A 4PX1A 4K2DA 3E3EA 4MPGA 4YAPA 3UL3A 1F6MC 4ML6A 4KW6A 5G31A 3TDGA 2FA8A 1K0BA 3DMLA 5DJMA 4WEYA 2HYXA 4KDUA 4PTSA 3M3MA 1FG4A 3I43A 4MF7A 2PWJA 4A5PA 1UA5A 3UOMA 3VLNA 2IPAA 3KD0A 2JL4A 2GSRA 3TKSA 3ME7A 2LV3A 4Q5FA 1ZMAA 2IL3A 1SJZA 4HU7A 3A2WA 1FAAA 4XS4B 4X1UA 4Z7XA 2RUFA 3ZREA 2JZSA 3ZYWA 4L0UA 1JZRA 3RPPA 1WE0A 4YQVA 3HXSA 5B6NA 3FK8A 5IMFA 1PKWA 1X9WB 3PINA 5AIXA 3PPUA 3DVWA 1PX6A 4GQFA 2CVDA 4PNGA 4K0NA 3ERFA 2K18A 3GRXA 2AYTA 4AJ6A 2RM6A 2YWOA 2GT5A 3EPTA 3F6DA 4ZL7A 5IPGA 4XS1A 1IYIA 3IBHA 3GSTA 3ERWA 3MWHA 4P3YB 3KM6A 3UVHA 3D21A 4NWYA 2DJJA 1OC9B 5L71A 4FYCA 4Q5RA 4Z2TA 4MZWA 1A2JA 5F06A 3GTUA 1YKAA 2A2PA 2CV4A 4Z2UA 3LYPA 4Q5QA 5ECSA 1YQ1A 1ZZYA 4KE3A 1VRSD 3GYKA 4WF4A 5LD0A 3GL5A 3EVIA 1EOHA 2C0EA 5FT3A 4KGIA 2AAWA 2H30A 4I6XA 2MMNA 1G6YA 4LMWA 1YEPA 2HZFA 1OE7A 2UZ8A 3BOAA 1SENA 3GH9A 5DQYA 4KSOA 2YWIA 2C3NA 2IFQB 2VO4A 1GLQA 4I2UA 2HZEB 2RUEA 4GSNA 2AB6A 2NTOA 3IK7A 4O5RA 1B9YC 2DIZA 1M2DA 4ZILA 3ERGA 2OJLA 5IMCA 2KLXA 3IR4A 1GH2A 4EXJA 1K3LA 1H4OA 2V1MA 2L5OA 1RW1A 4CDOA 2R5GA 1GUHA 5EY6A 5H5QA 4IHUA 3M1GA 3WGXA 4TXOB 3S9FA 1GTBA 3ZFLA 1V57A 4N11A 5D8IA 2JSYA 4MZCA 2C0FA 3QFAC 4DEJA 1GULA 3VPTA 4WBRD 1EP8A 5CP1A 2V6KA 1SJ6A 1KEBA 1EEJA 2DC5A 4O5QA 1LJRA 4MJAA 2DJ3A 2IJYA 1V58A 4MLYA 4HJMA 5J9CA 2YJHA 4MCUA 5G1KA 3GL3A 3HHVA 2A4VA 2B7KA 4X43A 3LORA 4MJEA 5DJLA 1EV9A 1K0AA 4KX4A 3IA1A 3P90A 1QXHA 4GLTA 5JCUA 1J0FA 1GL8A 1JZWA 3OR5A 3F63A 1TI1A 3F9UA 5CRHA 5ECPB 2N5BA 3UBKA 4BVXB 1O8WA 3L9UA 4GXZA 5AN1A 3CTFA 3NZNA 3US3A 3FKFA 2ALBA 4PQIA 4OCEA 3KXOA 1KNGA 4Q5NA 3L4NA 1SYXA 3TOTA 1M0UA 1DBYA 4IELA 3O76A 5AGYA 5EPFA 1K0NA 1SKSB 1H75A 4IKHA 1IYHA 2J9HA 2FNOA 4FYUA 5DAKB 3WT1A 2WGRA 4QL7A 1GSSA 5J4UA 2R2JA 5B7CA 1M7TA 3Q74A 1MEKA 5HR2A 5HR0A 2GQLA 1DSBA 4Z2RA 3F4RA 4KSMA 1XOBA 1BJXA 5ECIB 1XVWA 2R37A 4ZB9A 3ZZXA 3TJJA 1SD9A 2PUKC 2VAFA 4KCEA 4N30A 1B48A 1M2AA 1A8YA 2E2MA 1QMVA 3ZIVA 1OE8A 3GUSA 4OO4A 5KN0A 1PN9A 2Z9SA 3IE3A 4ECJA 2FGXA 3KTBA 4K7IA 3F4SA 2RIIA 1T00A 5IO0A 5CNWA 2JU5A 4KF9A 3TCOA 1J9BA 3TRXA 2KHPA 4FIWA 5GZZB 3EINA 3TJKA 3Q18A 3F4TA 1QGVA 4XRDA 2VL2C 2X4AA 1E2YA 2FWEA 1EGRA 3PGTA 4DVCA 1TU8A 4PUAA 3CSIA 3TRPA 2GZYA 9GSSA 4MDCA 2LRTA 2HSMA 2P5RA 5FHIA 1W89A 2B5XA 2WFCA 1B4QA 2YWMA 3VI7A 1ML6A 3W8JA 2C3TA 2PVOC 1FW1A 1A2LA 2YOIA 4N10A 4LA1A 1RK4A 3HZ8A 1XVQA 2OBKA 5C04A 5F8BA 1XWBA 3D4MA 3C7MA 1I9DA 4HQSA 4RI6A 2GDRA 2L4QA 3F6FA 1X5CA 2R0CA 4ILFA 4K5SA 2K8VA 4TOPA 3GH6A 1K3OA 2WB9A 4OD7A 1OKTA 4OMVA 1FOVA 5GSTA 3TB2A 3LXZA 1G6WA 3QPMA 4ZIJA 3IK9A 5JCWA 2R0PA 14GSA 2C4JA 3CYNA 4XS6A 3E0UA 1EGOA 1XW9A 1BAYA 5DQSA 2ES7A 1MDKA 3IOSA 2HLSA 1EZKA 1GSQA 2NDOA 2H76A 1GTUA 1B9XC 4NV5A 4L5OA 1FVJA 1S3DA 1GUKA 2B1KA 2VCTA 3GN3A 2L6CA 3C1SA 2H0HA 3FZAA 3M0FA 1GSUA 3CSHA 5A5KA 1PL2A 4MJBA 2WJUA 3W8SA 1ERVA 4K0GA 1M2BA 3CMIA 3O6TA 1XW5A 1FO5A 3EMXA 4MH3A 2D2ZA 2LQOA 3H8QA 3BCIA 4GWRA 1SL2B 4PURA 2VUPA 5D9TA 5CRGA 2VCQA 3H79A 3GURA 5INYA 4LMVA 2AUVA 1ILOA 4AF2A 3P7XA 3HJPA 2H72A 3HJOA 1CQGA 2VD0A 3K8NA 2C0DA 4PQ1A 2QGVA 1XWKA 2I3YA 4MJCA 3KMOA 1BG5A 4PGTA 3KP9A 1NM3A 2EC4A 1AW9A 4POKA 1TRWA 4AJ7A 1PSQA 5JWRB 5KOWA 3F3RA 4WR5A 5CO3A 1URMA 3TOUA 5GAND 3LWAA 2IMDA 5EL8A 4XHMA 2H1DA 2YPMA 4TRXA 4DSSA 2V6OA 3GFKA 5B6MA 3LW9A 3ME8A 4OFNA 2FWFA 3IAM2 3RPNA 3RAZA 3UAPA 18GSA 4BVYA 1TP9A 2VL2A 2YJ7A 1OYJA 4JBBA 1JZDA 2RLIA 1ERUA 3FW2A 2LJKA 2KUCA 5ENUA 4V2LA 3LJRA 3F0IA 1F2EA 3WT2A 4HUAA 2BMXA 1ZYNA 2N5AA 4J2FA 2O87A 1Z3EA 1DUGA 1QFNA 2HRKA 2K6VA 3BJ5A 1R7HA 4ISDA 3D6IA 1T1VA 3GIXA 2M72A 1SK1A 4N0ZA 4V2MA 3RHCA 4TR3A 5DCHA 2VCWA 1ACVA 3LGCA 3L9SA 1MDIA 1U3AA 3C8EA 4YKFA 1OAZA 3LSZA 1XW6A 3A2XA 2VCXA 2CZ3A 3HD5A 1VF2A 4KDXA 3QD9A 2I9HA 2FCHA 1NHOA 4XRAA 2GSQA 2XC2A 1Q98A 5DALB 3TKPA 4AGSA 3PR8A 2H1BA 2VCVA 1I5GA 3P8WA 4ICYA 4WR4A 4F0CA 4TR1A 2LSTA 1VF3A 1W4VA 3UIWA 2GSSA 2LEGA 1PQNA 4EO3A 3SWLA 4JR6A 1GLPA 5BRTA 3FY7A 4WF5A 3RBTA 2PPTA 3GKKA 2PVQA 4TXVA 2H1AA 4EL1A 4RQXA 4I2TA 3A2VA 1O81A 4E8HA 1X9SB 2B5YA 3ISOA 1LBKA 3QCPA 1GTIA 4FYBA 5J5NA 2QA1A 3FMWA 2CAQA 1THXA 1GP1A 4RUVA 5D9WA 1B8XA 4F9ZA 5F0GA 5G5FA 3H1NA 1WMJA 3LXTA 4GTUA 5ID2A 3I69A 3CXGA 5B8AA 1WPIA 3ZIJA 2CVBA 1XBSA 5HFGA 2YV9A 6GSUA 2DJ0A 4MF6A 1RQMA 1JLVA 2HXKA 1ZL9A 4IGJA 5FWGA 1Z5YE 4GSSA 2HE3A 2VLUA 3QDNA 4RQRA 5ELGA 1PN0A 1U88A 3G7YA 1ERWA 6GSSA 3HY2A 1TJDA 4G10A 2YCDA 2M80A 3W6GA 1JLWA 3TRQA 1EP7A 1TU7A 3IDVA 2QSIA 2OA7A 10GSA 1PGTA 4XIHA 4EDYA 4IW9A 3LQ7A 4ULXA 4ECBA 3UMAA 2TRCP 1N2AA 11GSA 2F9SA 2H19A 5D73A 3EMPA 4XS4A 5ECNB 1XOAA 1F9MA 1TK0B 4D73B 4ZB8A 13GSA 22GSA 4OO5A 2HRNA 4N0VA 1MTCA 1XIYA 2F51A 3J7Yk 4ZB6A 1Y6EA 4TR0A 5CRDA 3VPQA 5A4UA 3I9V2 1YJ6A 5HFIA 3KJYA 3QOUA 3FR9A 3U5RE 3UEMA 2AJQB 1USBA 1QUWA 4G0LA 3F3QA 5ECMB 1OC9A 4BPYA 3HVSA 1UC7A 2GQMA 1R5PA 1FHEA 3QFBC 3ZLPA 5KN2A 1X9MB 1A8LA 2LRNA 3E9JB 3ED3A 3O3TA 1XWGA 2H6ZA 2GVPA 4IQAA 3DIEA 2X8CA 2LJAA 1NSWA 2YNXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YZX A;  4TR4 A;  1AQX A;  4V2N A;  1TXX A;  4KND A;  2H8L A;  2VL3 A;  4HEA 2;  2FA4 A;  1WRY A;  1EOG A;  1R4W A;  2IFQ A;  1BED A;  2H01 A;  3FRC A;  1VGL A;  1ZOF A;  5J9B A;  5G30 A;  2ZCT A;  5A4W A;  4HQZ A;  2HZE A;  2AV4 A;  1UVZ A;  4BWQ A;  1SYR A;  2L5L A;  5B8B A;  5IPH A;  1TOF A;  3AY8 A;  2ZUP A;  1T4Z A;  2NVL A;  3IPZ A;  2P0G A;  2GZP A;  4MMM A;  1OC8 A;  5HQP A;  5IMZ A;  5KN1 A;  4MP4 A;  5D9X A;  4TXO A;  2YN1 A;  1AAZ A;  3P2A A;  2WRT A;  2J23 A;  4MPF A;  1HD2 A;  4JE1 A;  2DML A;  2LNS A;  4BWS A;  1A23 A;  2FWH A;  4IBP A;  3TGZ A;  4IJ3 A;  2C0G A;  3DEX A;  1AUC A;  2AHE A;  2OAC A;  3L78 A;  2MBS A;  3ZFB A;  3CSJ A;  4KAE A;  1WP0 A;  3ZVJ A;  2YP6 A;  1R26 A;  1XCC A;  4J56 E;  3ZVJ D;  4L5L A;  2VIM A;  5F05 A;  2F8F A;  4G19 A;  7GSS A;  1WIK A;  5ECR B;  2GTU A;  3GKN A;  1XWC A;  5J41 A;  3HVV A;  1SKR B;  1GWC A;  3IHQ A;  2B6M A;  1KTE A;  3LEF A;  5D96 A;  5HR3 A;  6GST A;  6GSV A;  1PKZ A;  3GSS A;  4K8M A;  1X0R A;  3FEU A;  1YKC A;  3KCM A;  1ZYE A;  2DJ1 A;  5CYY A;  4GF0 A;  1U3I A;  1XFL A;  1HNC A;  2OAD A;  2FHE A;  4NHW A;  1O8X A;  3QMX A;  1KBN A;  4BVX A;  2X64 A;  1XXU A;  3GKM A;  4NHZ A;  6GSY A;  3CRT A;  1TRV A;  3D4T A;  3GA4 A;  3GX8 A;  3TJB A;  1K0M A;  3HZ4 A;  4PQH A;  3FHK A;  1AC1 A;  3N9J A;  4MAB A;  4YAV A;  2B1L A;  4NV2 A;  1HNA A;  5DAK A;  4ZBD A;  1TK5 B;  4PNF A;  4FO5 A;  3APS A;  4G9H A;  2E0Q A;  4EC0 A;  1XWA A;  2CAI A;  2HSY A;  1Y25 A;  4OFT A;  2LRC A;  2H1G A;  3VUR A;  3MAK A;  2MZC A;  2IWT A;  2IME A;  3C73 A;  4ACS A;  3VWV A;  5CAX A;  5DDL A;  2EIQ A;  2IIY A;  1QQ2 A;  2CA8 A;  4KB3 A;  4ID0 A;  3TJG A;  2GGT A;  3R2Q A;  3G7I A;  2MMO A;  4GST A;  4YQM A;  1YY7 A;  4K6X A;  2V41 A;  5AIV A;  3HCZ A;  2FWG A;  4YH2 A;  1Q4J A;  1O7U A;  2I81 A;  1TTZ A;  2LNT A;  5IOW A;  2C80 A;  3HJM A;  4ZBA A;  3G9B A;  4KA0 A;  2BJX A;  1OC3 A;  4IS0 A;  2DJK A;  5JWO B;  3MSZ A;  3DYR A;  4F0B A;  3SBC A;  3U6V A;  1O6J A;  3CRU A;  2PBJ A;  1DE1 A;  19GS A;  2MBT A;  1WWJ A;  3TKQ A;  2F8A A;  4MK3 A;  4OWY A;  1TI3 A;  5GSS A;  1K3Y A;  1K0O A;  3FZ5 A;  3GX0 A;  3H93 A;  4HI7 A;  2I4A A;  5ECL B;  2H6Y A;  3VWU A;  2A2S A;  3F8U A;  4LLR A;  5IM9 A;  2GLR A;  4AJ8 A;  1X5E A;  3L9V A;  2CZ2 A;  1DE2 A;  6GSW A;  5A4V A;  2E2G A;  2PGT A;  4CHS A;  3DKS A;  3Q19 A;  4ZXG A;  2HT9 A;  5HFK A;  5DVB A;  3ZTL A;  3V1W A;  5JWQ B;  2B3S A;  2H66 A;  1Z7R A;  2CX3 A;  3APQ A;  4ZBB A;  1ABA A;  4F82 A;  3IRA A;  1OKD A;  2L4C A;  3BCK A;  1HNB A;  5IIZ A;  1G7E A;  4GRF A;  2YAN A;  3TJF A;  2TRX A;  4LL4 B;  1SJI A;  1F37 A;  4DSQ A;  2O89 A;  3GKX A;  5D9V A;  3IXR A;  4HU9 A;  1BQ7 A;  3RDW A;  3KGK A;  2X99 A;  2LUS A;  1FVK A;  4J57 E;  5IO2 A;  4PUF C;  5COH A;  2YZU A;  4JRR A;  1G0T A;  2PU9 C;  1SKW B;  2RM5 A;  1PX7 A;  2JZR A;  2GZZ A;  4O7H A;  5ECK B;  4HZ4 A;  2DMM A;  3VWX A;  5AIS A;  1TKD B;  4I5Q A;  1CQH A;  2ON7 A;  1YF1 A;  3VFI A;  1WJK A;  2PER A;  3ZML A;  3M8N A;  5HR1 A;  5ELA A;  4V1A p;  1EV4 A;  2L6D A;  3WGD A;  2ZNM A;  3DD3 A;  3UBL A;  2R4V A;  2WS2 A;  3FZ9 A;  1GNE A;  4V1A g;  3PH9 A;  2CX4 A;  1ZGN A;  4IJI A;  2H75 A;  3EC3 A;  3EWL A;  2HRF A;  4POM A;  1A24 A;  2XPE A;  3D0Z A;  5IMV A;  4KCA A;  2VD1 A;  3KMN A;  2F3M A;  1SK2 A;  1GTA A;  3GV1 A;  3HDC A;  3A3T A;  2DLX A;  4MA9 A;  1A0F A;  2NPB A;  2WUL A;  4EF0 A;  1K0C A;  3G7J A;  4IP6 A;  2KP1 A;  2B7J A;  4X0X A;  3FR6 A;  4NXI A;  2LJR A;  2YWN A;  2O85 A;  2DJ2 A;  2DBC A;  4HS1 A;  1HYU A;  1B4P A;  3HVX A;  2H6X A;  4IVF A;  2JAD A;  2E7P A;  1PD2 1;  3CBU A;  1TRU A;  3DRN A;  20GS A;  2VLT A;  1AQW A;  4GQC A;  1EEM A;  3BBY A;  3QAW A;  2FD3 A;  8GSS A;  2PMT A;  1PRX A;  4TVE A;  3UVT A;  5KN3 A;  1F3B A;  1J08 A;  1WOU A;  1PA3 A;  2K9F A;  2FLS A;  3H4K A;  4NPB A;  2REM A;  1F3A A;  2VM2 A;  2WZ9 A;  4JR4 A;  2MMZ A;  2HFD A;  2HNL A;  4H86 A;  5IOX A;  4HJ2 A;  3BD2 A;  1T3B A;  1M9B A;  4L0W A;  4MH2 A;  4E8E A;  1THO A;  4HZ2 A;  4DSR A;  5G2Z A;  4KDY A;  4PXO A;  3DXB A;  5DAL A;  1V40 A;  3MDK A;  5E4W A;  5LNK e;  5C00 A;  4ECI A;  5D93 A;  2YZH A;  3GMF A;  1JFU A;  3DGQ A;  2OE0 A;  2R3X A;  5LCZ A;  3NIV A;  1BYE A;  4IP1 A;  4OCF A;  5CRE A;  3EYT A;  1MD4 A;  4ECC A;  3C1R A;  2LTK A;  3KH7 A;  2IN3 A;  2O8V B;  4HOJ A;  5DBQ A;  12GS A;  2OBI A;  2IMF A;  1A2M A;  1TDI A;  4XCS A;  4I97 A;  2P31 A;  2MYG A;  17GS A;  1PMT A;  2XPD A;  3TKS E;  3I6A A;  4IQ1 A;  3C71 A;  4L8E A;  1V98 A;  3APO A;  4FH8 A;  4ZL9 A;  3JCM L;  2IMK A;  2MMA A;  3M9K A;  1EWX A;  1T8E B;  1AXD A;  2V32 A;  1BX9 A;  4XTS A;  1VF1 A;  1N8J A;  1MDJ A;  4O92 A;  3KIJ A;  2PN8 A;  4RI7 A;  5IMD A;  4ML1 A;  2M46 A;  4JED A;  3EE2 A;  3WGE A;  1U6T A;  2A2R A;  3IV4 A;  1M9A A;  1YDK A;  4GCI A;  2OE3 A;  4K9Z A;  1O85 A;  1SK0 A;  5H5S A;  3WYW A;  3D5J A;  1AQV A;  2N5F A;  4QL9 A;  2TIR A;  3FYG A;  4MZB A;  1S3C A;  2H0I A;  3IC4 A;  1Z9H A;  2WDU A;  3UAR A;  2VLV A;  1SL0 B;  5DCG A;  5F07 A;  3GHA A;  3FR3 A;  2I1U A;  2V2G A;  2O7K A;  4EVM A;  4D73 A;  3M9J A;  5GAP D;  2C1Y A;  3ZIT A;  1GNW A;  1YF0 A;  3VWW A;  4TKY A;  1ZCP A;  1SU9 A;  1Z6N A;  5G1L A;  3LG6 A;  4WET A;  4MF5 A;  2VOC A;  1GSE A;  2G0F A;  3QAG A;  1X5D A;  5G5E A;  3ZMK A;  2WCI A;  3HYP A;  1HQO A;  4BA7 A;  2OKA A;  2C8U A;  2VM1 A;  3KTL A;  6GSX A;  5ECH B;  3KH9 A;  4F03 A;  2FUG 2;  3ZL5 A;  1ON4 A;  2X8G A;  5JCG A;  2L59 A;  1M99 A;  2H74 A;  2H0G A;  3KP8 A;  3LYK A;  2JZT A;  2X8H A;  1T7P B;  2HI7 A;  3D22 A;  3GNJ A;  2LQQ A;  1SD8 A;  4OFM A;  5H5R A;  4K1F A;  1GRX A;  1XZO A;  2CT6 A;  1A0R P;  2H71 A;  2JSZ A;  5IQY A;  4JZQ A;  4K7N A;  1K0D A;  1QK8 A;  2CQ9 A;  3KEB A;  3VI5 A;  4WXT A;  4POL A;  2B5E A;  1FB0 A;  2LS5 A;  1SL1 B;  3HA9 A;  2BTO T;  2H73 A;  4POB A;  4KUN A;  2QC7 A;  3N5O A;  4F2I A;  5CRW A;  3TKS C;  2GQK A;  2H70 A;  4JU5 A;  4NAX A;  2HSH A;  3ZRD A;  1FB6 A;  4ZL8 A;  4DSS B;  3VK9 A;  3IAS 2;  5KEJ A;  1S3A A;  1O73 A;  2C3Q A;  1LU4 A;  4HDE A;  1GSD A;  2KP2 A;  3Q6O A;  4G2E A;  2LKU A;  16GS A;  1GUM A;  3J7Y b;  1C72 A;  2XBI A;  2IMI A;  4WKW A;  1NHY A;  2VCZ A;  1NW2 A;  3DVX A;  5J3R A;  3QR6 A;  3KZQ A;  4EDZ A;  3QAV A;  3RHB A;  2DIY A;  2XBQ A;  2JAC A;  5ECO B;  3WD6 A;  1AIU A;  3MNG A;  2QKE A;  2P5Q A;  4K7O A;  2EIO A;  1R5A A;  2ON5 A;  4EUY A;  3EU3 A;  3L0H A;  1OVN A;  1TK8 B;  1VF4 A;  2OE1 A;  1ZYQ B;  2FY6 A;  3HKR A;  4QQ7 A;  3UJ1 A;  1JHB A;  2G2Q A;  2GST A;  4BL7 A;  3TUE A;  1Z6M A;  5EVO A;  4TR1 B;  2XHF A;  2GT6 A;  4IN0 A;  3EUR A;  1TRS A;  3NOF A;  1GSF A;  1ST9 A;  2NBS A;  4TN8 A;  1PL1 A;  4I8B A;  4WBJ A;  3FZ4 A;  2GS3 A;  1V9W A;  4LL1 B;  5ABR A;  5E59 A;  2K8S A;  5ECQ B;  1YEX A;  1V2A A;  3CTG A;  2CVK A;  4KH7 A;  1Z7P A;  1MD3 A;  2YV7 A;  1G7O A;  2R6K A;  4YQU A;  3GTU B;  2VL9 A;  4EKZ A;  1TW9 A;  1U87 A;  3TKR A;  4EE0 A;  4O32 A;  3DWV A;  1E6B A;  4CW9 A;  3EU4 A;  1T4Y A;  1XPV A;  5IMA A;  1GSY A;  2KOK A;  4NMU A;  3A5W A;  2EIR A;  4TW5 A;  1ERT A;  3LFL A;  5ID2 B;  2DSA A;  1JZO A;  2L57 A;  1UN2 A;  4PX1 A;  4K2D A;  3E3E A;  4MPG A;  4YAP A;  3UL3 A;  1F6M C;  4ML6 A;  4KW6 A;  5G31 A;  3TDG A;  2FA8 A;  1K0B A;  3DML A;  5DJM A;  4WEY A;  2HYX A;  4KDU A;  3M3M A;  1FG4 A;  3I43 A;  4MF7 A;  2PWJ A;  1UA5 A;  3UOM A;  3VLN A;  2IPA A;  3KD0 A;  2JL4 A;  2GSR A;  3TKS A;  3ME7 A;  2LV3 A;  4Q5F A;  1ZMA A;  2IL3 A;  1SJZ A;  4HU7 A;  3A2W A;  1FAA A;  4XS4 B;  4X1U A;  4Z7X A;  2RUF A;  3ZRE A;  2JZS A;  3ZYW A;  4L0U A;  1JZR A;  3RPP A;  1WE0 A;  4YQV A;  3HXS A;  5B6N A;  3FK8 A;  5IMF A;  1PKW A;  1X9W B;  3PIN A;  5AIX A;  3DVW A;  1PX6 A;  4GQF A;  2CVD A;  4PNG A;  4K0N A;  3ERF A;  2K18 A;  3GRX A;  2AYT A;  4AJ6 A;  2RM6 A;  2YWO A;  2GT5 A;  3F6D A;  4ZL7 A;  5IPG A;  4XS1 A;  1IYI A;  3IBH A;  3GST A;  3ERW A;  3MWH A;  4P3Y B;  3KM6 A;  3UVH A;  3D21 A;  4NWY A;  2DJJ A;  1OC9 B;  5L71 A;  4FYC A;  4Q5R A;  4MZW A;  1A2J A;  5F06 A;  3GTU A;  1YKA A;  2CV4 A;  3LYP A;  4Q5Q A;  5ECS A;  1YQ1 A;  1ZZY A;  4KE3 A;  1VRS D;  3GYK A;  4WF4 A;  5LD0 A;  3GL5 A;  3EVI A;  1EOH A;  2C0E A;  5FT3 A;  4KGI A;  2AAW A;  2H30 A;  4I6X A;  2MMN A;  1G6Y A;  4LMW A;  1YEP A;  2HZF A;  1OE7 A;  3BOA A;  1SEN A;  3GH9 A;  5DQY A;  4KSO A;  2YWI A;  2C3N A;  2IFQ B;  2VO4 A;  1GLQ A;  4I2U A;  2HZE B;  2RUE A;  4GSN A;  2AB6 A;  2NTO A;  3IK7 A;  4O5R A;  1B9Y C;  2DIZ A;  1M2D A;  4ZIL A;  3ERG A;  2OJL A;  5IMC A;  2KLX A;  3IR4 A;  1GH2 A;  4EXJ A;  1K3L A;  1H4O A;  2V1M A;  2L5O A;  1RW1 A;  4CDO A;  2R5G A;  1GUH A;  5EY6 A;  5H5Q A;  4IHU A;  3M1G A;  3WGX A;  4TXO B;  3S9F A;  1GTB A;  3ZFL A;  1V57 A;  4N11 A;  5D8I A;  2JSY A;  4MZC A;  2C0F A;  3QFA C;  4DEJ A;  1GUL A;  3VPT A;  4WBR D;  1EP8 A;  5CP1 A;  2V6K A;  1SJ6 A;  1KEB A;  1EEJ A;  2DC5 A;  1LJR A;  4MJA A;  2DJ3 A;  2IJY A;  1V58 A;  4MLY A;  4HJM A;  5J9C A;  2YJH A;  4MCU A;  5G1K A;  3GL3 A;  3HHV A;  2A4V A;  2B7K A;  4X43 A;  3LOR A;  4MJE A;  5DJL A;  1EV9 A;  1K0A A;  4KX4 A;  3IA1 A;  3P90 A;  1QXH A;  4GLT A;  5JCU A;  1J0F A;  1GL8 A;  1JZW A;  3OR5 A;  3F63 A;  1TI1 A;  3F9U A;  5CRH A;  5ECP B;  2N5B A;  3UBK A;  1O8W A;  3L9U A;  4GXZ A;  5AN1 A;  3CTF A;  3NZN A;  3US3 A;  3FKF A;  2ALB A;  4PQI A;  4OCE A;  3KXO A;  1KNG A;  4Q5N A;  3L4N A;  1SYX A;  3TOT A;  1M0U A;  1DBY A;  4IEL A;  3O76 A;  5AGY A;  5EPF A;  1K0N A;  1SKS B;  1H75 A;  4IKH A;  1IYH A;  2J9H A;  2FNO A;  4FYU A;  5DAK B;  3WT1 A;  2WGR A;  4QL7 A;  1GSS A;  5J4U A;  2R2J A;  5B7C A;  1M7T A;  3Q74 A;  1MEK A;  5HR2 A;  5HR0 A;  2GQL A;  1DSB A;  3F4R A;  4KSM A;  1XOB A;  1BJX A;  5ECI B;  1XVW A;  2R37 A;  4ZB9 A;  3ZZX A;  3TJJ A;  1SD9 A;  2PUK C;  2VAF A;  4KCE A;  4N30 A;  1B48 A;  1M2A A;  1A8Y A;  2E2M A;  1QMV A;  3ZIV A;  1OE8 A;  3GUS A;  4OO4 A;  5KN0 A;  1PN9 A;  2Z9S A;  3IE3 A;  4ECJ A;  2FGX A;  3KTB A;  4K7I A;  3F4S A;  2RII A;  1T00 A;  5IO0 A;  5CNW A;  2JU5 A;  3TCO A;  1J9B A;  3TRX A;  2KHP A;  4FIW A;  5GZZ B;  3EIN A;  3TJK A;  3Q18 A;  3F4T A;  1QGV A;  4XRD A;  2VL2 C;  1E2Y A;  2FWE A;  1EGR A;  3PGT A;  4DVC A;  1TU8 A;  4PUA A;  3CSI A;  3TRP A;  2GZY A;  9GSS A;  4MDC A;  2LRT A;  2P5R A;  5FHI A;  1W89 A;  2B5X A;  2WFC A;  1B4Q A;  2YWM A;  3VI7 A;  1ML6 A;  3W8J A;  2C3T A;  2PVO C;  1FW1 A;  1A2L A;  2YOI A;  4N10 A;  4LA1 A;  1RK4 A;  3HZ8 A;  1XVQ A;  2OBK A;  5C04 A;  5F8B A;  1XWB A;  3D4M A;  3C7M A;  1I9D A;  4HQS A;  4RI6 A;  2GDR A;  2L4Q A;  3F6F A;  1X5C A;  4ILF A;  2K8V A;  4TOP A;  3GH6 A;  1K3O A;  2WB9 A;  4OD7 A;  1OKT A;  4OMV A;  1FOV A;  5GST A;  3TB2 A;  3LXZ A;  1G6W A;  3QPM A;  4ZIJ A;  3IK9 A;  5JCW A;  14GS A;  2C4J A;  3CYN A;  4XS6 A;  3E0U A;  1EGO A;  1XW9 A;  1BAY A;  5DQS A;  2ES7 A;  1MDK A;  3IOS A;  2HLS A;  1EZK A;  1GSQ A;  2NDO A;  2H76 A;  1GTU A;  1B9X C;  4NV5 A;  4L5O A;  1FVJ A;  1S3D A;  1GUK A;  2B1K A;  2VCT A;  3GN3 A;  2L6C A;  3C1S A;  2H0H A;  3FZA A;  3M0F A;  1GSU A;  3CSH A;  5A5K A;  1PL2 A;  4MJB A;  2WJU A;  3W8S A;  1ERV A;  4K0G A;  1M2B A;  3CMI A;  3O6T A;  1XW5 A;  1FO5 A;  3EMX A;  4MH3 A;  2D2Z A;  2LQO A;  3H8Q A;  3BCI A;  4GWR A;  1SL2 B;  4PUR A;  2VUP A;  5D9T A;  5CRG A;  2VCQ A;  3H79 A;  3GUR A;  5INY A;  4LMV A;  2AUV A;  1ILO A;  4AF2 A;  3P7X A;  3HJP A;  2H72 A;  3HJO A;  1CQG A;  2VD0 A;  3K8N A;  2C0D A;  4PQ1 A;  2QGV A;  1XWK A;  2I3Y A;  4MJC A;  3KMO A;  1BG5 A;  4PGT A;  3KP9 A;  1NM3 A;  2EC4 A;  1AW9 A;  4POK A;  1TRW A;  4AJ7 A;  1PSQ A;  5JWR B;  3F3R A;  4WR5 A;  5CO3 A;  1URM A;  3TOU A;  5GAN D;  3LWA A;  2IMD A;  5EL8 A;  4XHM A;  2H1D A;  2YPM A;  4TRX A;  4DSS A;  2V6O A;  3GFK A;  5B6M A;  3ME8 A;  4OFN A;  2FWF A;  3IAM 2;  3RPN A;  3RAZ A;  3UAP A;  18GS A;  4BVY A;  1TP9 A;  2VL2 A;  2YJ7 A;  1OYJ A;  4JBB A;  1JZD A;  2RLI A;  1ERU A;  3FW2 A;  2LJK A;  2KUC A;  5ENU A;  4V2L A;  3LJR A;  3F0I A;  1F2E A;  3WT2 A;  4HUA A;  2BMX A;  2N5A A;  4J2F A;  2O87 A;  1Z3E A;  1DUG A;  1QFN A;  2K6V A;  3BJ5 A;  1R7H A;  4ISD A;  3D6I A;  1T1V A;  3GIX A;  2M72 A;  1SK1 A;  4N0Z A;  4V2M A;  3RHC A;  4TR3 A;  5DCH A;  2VCW A;  1ACV A;  3LGC A;  3L9S A;  1MDI A;  1U3A A;  3C8E A;  1OAZ A;  3LSZ A;  1XW6 A;  3A2X A;  2VCX A;  2CZ3 A;  3HD5 A;  1VF2 A;  4KDX A;  3QD9 A;  2I9H A;  2FCH A;  1NHO A;  4XRA A;  2GSQ A;  2XC2 A;  1Q98 A;  5DAL B;  3TKP A;  4AGS A;  3PR8 A;  2H1B A;  2VCV A;  1I5G A;  3P8W A;  4WR4 A;  4F0C A;  4TR1 A;  2LST A;  1VF3 A;  1W4V A;  3UIW A;  2GSS A;  2LEG A;  1PQN A;  4EO3 A;  3SWL A;  4JR6 A;  1GLP A;  3FY7 A;  4WF5 A;  3RBT A;  2PPT A;  3GKK A;  2PVQ A;  4TXV A;  2H1A A;  4EL1 A;  4RQX A;  4I2T A;  3A2V A;  1O81 A;  4E8H A;  1X9S B;  2B5Y A;  3ISO A;  1LBK A;  3QCP A;  1GTI A;  4FYB A;  5J5N A;  2CAQ A;  1THX A;  1GP1 A;  4RUV A;  5D9W A;  1B8X A;  4F9Z A;  5F0G A;  5G5F A;  3H1N A;  1WMJ A;  3LXT A;  4GTU A;  5ID2 A;  3I69 A;  3CXG A;  5B8A A;  1WPI A;  3ZIJ A;  2CVB A;  1XBS A;  5HFG A;  2YV9 A;  6GSU A;  2DJ0 A;  4MF6 A;  1RQM A;  1JLV A;  2HXK A;  1ZL9 A;  4IGJ A;  5FWG A;  1Z5Y E;  4GSS A;  2HE3 A;  2VLU A;  3QDN A;  4RQR A;  5ELG A;  1U88 A;  3G7Y A;  1ERW A;  6GSS A;  1TJD A;  3HY2 A;  4G10 A;  2YCD A;  2M80 A;  3W6G A;  1JLW A;  3TRQ A;  1EP7 A;  1TU7 A;  3IDV A;  2QSI A;  2OA7 A;  10GS A;  1PGT A;  4XIH A;  4EDY A;  4IW9 A;  3LQ7 A;  4ULX A;  4ECB A;  3UMA A;  2TRC P;  1N2A A;  11GS A;  2F9S A;  2H19 A;  5D73 A;  3EMP A;  4XS4 A;  5ECN B;  1XOA A;  1F9M A;  1TK0 B;  4D73 B;  4ZB8 A;  13GS A;  22GS A;  4OO5 A;  2HRN A;  4N0V A;  1MTC A;  1XIY A;  2F51 A;  3J7Y k;  4ZB6 A;  1Y6E A;  4TR0 A;  5CRD A;  3VPQ A;  5A4U A;  3I9V 2;  1YJ6 A;  5HFI A;  3KJY A;  3QOU A;  3FR9 A;  3U5R E;  3UEM A;  2AJQ B;  1USB A;  1QUW A;  3F3Q A;  5ECM B;  1OC9 A;  4BPY A;  3HVS A;  1UC7 A;  2GQM A;  1R5P A;  1FHE A;  3QFB C;  3ZLP A;  5KN2 A;  1X9M B;  1A8L A;  2LRN A;  3E9J B;  3ED3 A;  3O3T A;  1XWG A;  2H6Z A;  2GVP A;  4IQA A;  3DIE A;  2X8C A;  2LJA A;  1NSW A;  2YNX A; 
#chains in the Genus database with same CATH topology
 1YZX A;  4TR4 A;  1AQX A;  4V2N A;  1TXX A;  4KND A;  2H8L A;  2VL3 A;  4HEA 2;  2FA4 A;  1WRY A;  1EOG A;  1R4W A;  2IFQ A;  1BED A;  2H01 A;  3FRC A;  1VGL A;  1ZOF A;  5J9B A;  5G30 A;  2ZCT A;  5A4W A;  4HQZ A;  2A4H A;  2HZE A;  2AV4 A;  1UVZ A;  4BWQ A;  1SYR A;  2L5L A;  5B8B A;  5IPH A;  1TOF A;  3AY8 A;  2ZUP A;  1T4Z A;  2NVL A;  3IPZ A;  2P0G A;  2GZP A;  4MMM A;  1OC8 A;  5HQP A;  5IMZ A;  5KN1 A;  4MP4 A;  5D9X A;  4TXO A;  2YN1 A;  1AAZ A;  3P2A A;  2WRT A;  2J23 A;  4MPF A;  1HD2 A;  4JE1 A;  2DML A;  2LNS A;  4BWS A;  1A23 A;  2FWH A;  4IBP A;  3TGZ A;  4IJ3 A;  2C0G A;  3DEX A;  1AUC A;  2AHE A;  2OAC A;  3L78 A;  2MBS A;  3ZFB A;  5BMU A;  3CSJ A;  4KAE A;  1WP0 A;  3ZVJ A;  2YP6 A;  4CY6 A;  1R26 A;  1XCC A;  4J56 E;  3ZVJ D;  4L5L A;  2VIM A;  5F05 A;  2F8F A;  4G19 A;  7GSS A;  4CY8 A;  1WIK A;  5ECR B;  2GTU A;  3GKN A;  1XWC A;  5J41 A;  3HVV A;  1SKR B;  1GWC A;  3IHQ A;  2B6M A;  1KTE A;  3LEF A;  5D96 A;  5HR3 A;  6GST A;  6GSV A;  1PKZ A;  3GSS A;  4K8M A;  1X0R A;  3FEU A;  1YKC A;  4G0K A;  3KCM A;  1ZYE A;  2DJ1 A;  5CYY A;  4GF0 A;  1U3I A;  1XFL A;  1HNC A;  2OAD A;  2FHE A;  4NHW A;  1O8X A;  3QMX A;  1KBN A;  4BVX A;  2X64 A;  1XXU A;  3GKM A;  4NHZ A;  4K5R A;  6GSY A;  4BL7 B;  3CRT A;  1TRV A;  3D4T A;  3GA4 A;  3GX8 A;  3TJB A;  1K0M A;  3HZ4 A;  4PQH A;  3FHK A;  1AC1 A;  3N9J A;  4MAB A;  1ZYP A;  4YAV A;  2B1L A;  4NV2 A;  1HNA A;  5DAK A;  4ZBD A;  1TK5 B;  4PNF A;  4FO5 A;  3APS A;  4G9H A;  2E0Q A;  4EC0 A;  1XWA A;  2CAI A;  2HSY A;  1Y25 A;  4OFT A;  2LRC A;  2H1G A;  3VUR A;  3MAK A;  4BIK A;  2MZC A;  2IWT A;  1PFO A;  2IME A;  3C73 A;  4ACS A;  3VWV A;  5CAX A;  5DDL A;  2EIQ A;  2IIY A;  1QQ2 A;  2CA8 A;  4KB3 A;  4ID0 A;  3TJG A;  2GGT A;  3R2Q A;  3G7I A;  2MMO A;  4GST A;  4YQM A;  1YY7 A;  4K6X A;  2V41 A;  4X4J A;  5AIV A;  3HCZ A;  2FWG A;  4YH2 A;  1Q4J A;  1O7U A;  2I81 A;  1TTZ A;  2LNT A;  5IOW A;  2C80 A;  3HJM A;  4ZBA A;  3G9B A;  4KA0 A;  2BJX A;  1OC3 A;  4IS0 A;  2DJK A;  5JWO B;  3MSZ A;  3DYR A;  4F0B A;  3SBC A;  3U6V A;  1O6J A;  3CRU A;  2PBJ A;  1DE1 A;  19GS A;  2MBT A;  1WWJ A;  3TKQ A;  2F8A A;  4MK3 A;  4OWY A;  1TI3 A;  5GSS A;  1K3Y A;  1K0O A;  3FZ5 A;  3GX0 A;  3H93 A;  4HI7 A;  2I4A A;  5ECL B;  2H6Y A;  3VWU A;  2A2S A;  3F8U A;  4LLR A;  5IM9 A;  2GLR A;  4AJ8 A;  1X5E A;  2QA2 A;  3L9V A;  2CZ2 A;  1DE2 A;  6GSW A;  5A4V A;  2E2G A;  2PGT A;  4CHS A;  3DKS A;  3Q19 A;  4ZXG A;  2HT9 A;  5HFK A;  5DVB A;  3ZTL A;  3V1W A;  3R3E A;  5JWQ B;  2B3S A;  2H66 A;  1Z7R A;  2CX3 A;  2DKI A;  3APQ A;  4ZBB A;  1ABA A;  4F82 A;  3IRA A;  1OKD A;  2L4C A;  3BCK A;  1HNB A;  5IIZ A;  1G7E A;  4GRF A;  2YAN A;  5KOX A;  3TJF A;  2TRX A;  4LL4 B;  1SJI A;  1F37 A;  4DSQ A;  2O89 A;  4EIP A;  3GKX A;  5D9V A;  3IXR A;  4HU9 A;  1BQ7 A;  3RDW A;  3KGK A;  2X99 A;  2LUS A;  1FVK A;  4J57 E;  5IO2 A;  4PUF C;  5COH A;  2YZU A;  4JRR A;  1G0T A;  2PU9 C;  1SKW B;  4YKG A;  2RM5 A;  1PX7 A;  2JZR A;  2GZZ A;  2DKH A;  4O7H A;  5ECK B;  4HZ4 A;  2DMM A;  3VWX A;  5AIS A;  1TKD B;  4I5Q A;  1CQH A;  2ON7 A;  1YF1 A;  3VFI A;  1WJK A;  2PER A;  3ZML A;  3M8N A;  5HR1 A;  5ELA A;  4V1A p;  4G0I A;  1EV4 A;  2L6D A;  3WGD A;  2ZNM A;  3DD3 A;  3UBL A;  2R4V A;  2WS2 A;  3FZ9 A;  1GNE A;  4V1A g;  3PH9 A;  3MIX A;  2CX4 A;  1ZGN A;  4IJI A;  2H75 A;  3EC3 A;  3EWL A;  2HRF A;  4POM A;  1A24 A;  2XPE A;  3D0Z A;  5IMV A;  4KCA A;  2VD1 A;  3KMN A;  2F3M A;  1SK2 A;  1GTA A;  3GV1 A;  3HDC A;  3A3T A;  2DLX A;  4MA9 A;  1A0F A;  2NPB A;  2WUL A;  4EF0 A;  1K0C A;  3G7J A;  4IP6 A;  2KP1 A;  2B7J A;  4X0X A;  3FR6 A;  4NXI A;  2LJR A;  2YWN A;  2O85 A;  3IHG A;  2DJ2 A;  2DBC A;  4HS1 A;  1HYU A;  1B4P A;  3HVX A;  2H6X A;  4EIQ A;  4IVF A;  2JAD A;  2E7P A;  1PD2 1;  3CBU A;  1TRU A;  3DRN A;  20GS A;  2VLT A;  1AQW A;  4GQC A;  1EEM A;  3BBY A;  3QAW A;  2FD3 A;  8GSS A;  2PMT A;  1PRX A;  4TVE A;  3UVT A;  5KN3 A;  1F3B A;  1J08 A;  1WOU A;  1PA3 A;  2K9F A;  2FLS A;  3H4K A;  4NPB A;  2REM A;  1F3A A;  2VM2 A;  2WZ9 A;  4JR4 A;  2MMZ A;  2HFD A;  2HNL A;  4H86 A;  5IOX A;  4HJ2 A;  3BD2 A;  1T3B A;  1M9B A;  4L0W A;  4MH2 A;  4E8E A;  4MNN A;  1THO A;  4HZ2 A;  4DSR A;  5G2Z A;  4KDY A;  4PXO A;  3DXB A;  5DAL A;  1V40 A;  3MDK A;  5E4W A;  5LNK e;  5C00 A;  4ECI A;  5D93 A;  2YZH A;  3GMF A;  1JFU A;  3DGQ A;  2OE0 A;  2R3X A;  5LCZ A;  3NIV A;  1BYE A;  4IP1 A;  4OCF A;  5CRE A;  3EYT A;  1MD4 A;  4ECC A;  3C1R A;  2LTK A;  3KH7 A;  2IN3 A;  2O8V B;  4HOJ A;  5DBQ A;  12GS A;  2OBI A;  2IMF A;  1A2M A;  1TDI A;  4XCS A;  4I97 A;  2P31 A;  2MYG A;  17GS A;  1PMT A;  2XPD A;  3TKS E;  3I6A A;  4IQ1 A;  3C71 A;  4L8E A;  1V98 A;  3APO A;  4FH8 A;  4ZL9 A;  3JCM L;  2IMK A;  2MMA A;  1FOH A;  3M9K A;  1EWX A;  1T8E B;  1AXD A;  2V32 A;  1BX9 A;  4XTS A;  1VF1 A;  1N8J A;  1MDJ A;  4O92 A;  3KIJ A;  2PN8 A;  3MYD A;  4RI7 A;  5IMD A;  4ML1 A;  2M46 A;  4JED A;  3EE2 A;  3WGE A;  1U6T A;  2A2R A;  3IV4 A;  1M9A A;  1YDK A;  4GCI A;  2OE3 A;  4K9Z A;  1O85 A;  1SK0 A;  5H5S A;  3WYW A;  3D5J A;  1AQV A;  2N5F A;  4QL9 A;  2TIR A;  3FYG A;  4MZB A;  1S3C A;  2H0I A;  3IC4 A;  1Z9H A;  2WDU A;  3UAR A;  2VLV A;  1SL0 B;  5DCG A;  5F07 A;  3GHA A;  3FR3 A;  2I1U A;  2V2G A;  2O7K A;  4EVM A;  4D73 A;  3M9J A;  5GAP D;  2C1Y A;  3ZIT A;  1GNW A;  1YF0 A;  3VWW A;  4TKY A;  1ZCP A;  1SU9 A;  1Z6N A;  5G1L A;  3LG6 A;  4WET A;  4MF5 A;  2VOC A;  1GSE A;  2G0F A;  3QAG A;  1X5D A;  5G5E A;  3ZMK A;  2WCI A;  3HYP A;  1HQO A;  4BA7 A;  2OKA A;  4K2X A;  2C8U A;  2VM1 A;  3KTL A;  6GSX A;  5ECH B;  3KH9 A;  4F03 A;  2FUG 2;  3ZL5 A;  2R0G A;  1ON4 A;  2X8G A;  5JCG A;  2L59 A;  1M99 A;  2H74 A;  2H0G A;  3KP8 A;  3LYK A;  2JZT A;  2X8H A;  1T7P B;  2HI7 A;  3D22 A;  3GNJ A;  2LQQ A;  1SD8 A;  4OFM A;  5H5R A;  4K1F A;  1GRX A;  1XZO A;  2CT6 A;  1A0R P;  2H71 A;  2JSZ A;  5IQY A;  4JZQ A;  4K7N A;  1K0D A;  1QK8 A;  2CQ9 A;  3KEB A;  4O5U A;  3VI5 A;  4WXT A;  4POL A;  2B5E A;  1FB0 A;  2LS5 A;  1SL1 B;  3HA9 A;  2BTO T;  2H73 A;  4POB A;  4KUN A;  4USS A;  2QC7 A;  3N5O A;  4F2I A;  5CRW A;  3TKS C;  2GQK A;  2H70 A;  4JU5 A;  4NAX A;  2HSH A;  3ZRD A;  1FB6 A;  4ZL8 A;  4DSS B;  3VK9 A;  3IAS 2;  5KEJ A;  1S3A A;  1O73 A;  2C3Q A;  1LU4 A;  4BVY B;  4HDE A;  1GSD A;  2KP2 A;  3Q6O A;  4G2E A;  2LKU A;  16GS A;  1GUM A;  3J7Y b;  1C72 A;  2XBI A;  2IMI A;  4WKW A;  1NHY A;  2VCZ A;  1NW2 A;  3DVX A;  5J3R A;  3QR6 A;  3KZQ A;  2HRA A;  4EDZ A;  3QAV A;  3RHB A;  2DIY A;  2XBQ A;  2JAC A;  5ECO B;  3WD6 A;  1AIU A;  3MNG A;  2QKE A;  2P5Q A;  4K7O A;  2EIO A;  1R5A A;  2ON5 A;  3A5I A;  4EUY A;  3EU3 A;  3L0H A;  1OVN A;  1TK8 B;  1VF4 A;  2OE1 A;  1ZYQ B;  2FY6 A;  3HKR A;  4QQ7 A;  3UJ1 A;  1JHB A;  2G2Q A;  2GST A;  4BL7 A;  3TUE A;  1Z6M A;  5EVO A;  4TR1 B;  2XHF A;  2GT6 A;  4IN0 A;  3EUR A;  1TRS A;  3NOF A;  1GSF A;  1ST9 A;  2NBS A;  4TN8 A;  4HSC X;  1PL1 A;  4I8B A;  4WBJ A;  3FZ4 A;  2GS3 A;  1V9W A;  4LL1 B;  5ABR A;  5E59 A;  2K8S A;  5ECQ B;  4FQU A;  1YEX A;  1V2A A;  3CTG A;  2CVK A;  4KH7 A;  1Z7P A;  1MD3 A;  2X49 A;  2YV7 A;  1G7O A;  1M3I A;  2R6K A;  4YQU A;  3GTU B;  2VL9 A;  4EKZ A;  1TW9 A;  3IC8 A;  1U87 A;  3TKR A;  4EE0 A;  4O32 A;  3DWV A;  1E6B A;  4CW9 A;  3EU4 A;  1T4Y A;  1XPV A;  5IMA A;  1GSY A;  2KOK A;  4NMU A;  3A5W A;  2EIR A;  4TW5 A;  1ERT A;  3LFL A;  5ID2 B;  2DSA A;  1JZO A;  2L57 A;  1UN2 A;  4PX1 A;  4K2D A;  3E3E A;  4MPG A;  4YAP A;  3UL3 A;  1F6M C;  4ML6 A;  4KW6 A;  5G31 A;  3TDG A;  2FA8 A;  1K0B A;  3DML A;  5DJM A;  4WEY A;  2HYX A;  4KDU A;  4PTS A;  3M3M A;  1FG4 A;  3I43 A;  4MF7 A;  2PWJ A;  4A5P A;  1UA5 A;  3UOM A;  3VLN A;  2IPA A;  3KD0 A;  2JL4 A;  2GSR A;  3TKS A;  3ME7 A;  2LV3 A;  4Q5F A;  1ZMA A;  2IL3 A;  1SJZ A;  4HU7 A;  3A2W A;  1FAA A;  4XS4 B;  4X1U A;  4Z7X A;  2RUF A;  3ZRE A;  2JZS A;  3ZYW A;  4L0U A;  1JZR A;  3RPP A;  1WE0 A;  4YQV A;  3HXS A;  5B6N A;  3FK8 A;  5IMF A;  1PKW A;  1X9W B;  3PIN A;  5AIX A;  3PPU A;  3DVW A;  1PX6 A;  4GQF A;  2CVD A;  4PNG A;  4K0N A;  3ERF A;  2K18 A;  3GRX A;  2AYT A;  4AJ6 A;  2RM6 A;  2YWO A;  2GT5 A;  3EPT A;  3F6D A;  4ZL7 A;  5IPG A;  4XS1 A;  1IYI A;  3IBH A;  3GST A;  3ERW A;  3MWH A;  4P3Y B;  3KM6 A;  3UVH A;  3D21 A;  4NWY A;  2DJJ A;  1OC9 B;  5L71 A;  4FYC A;  4Q5R A;  4Z2T A;  4MZW A;  1A2J A;  5F06 A;  3GTU A;  1YKA A;  2A2P A;  2CV4 A;  4Z2U A;  3LYP A;  4Q5Q A;  5ECS A;  1YQ1 A;  1ZZY A;  4KE3 A;  1VRS D;  3GYK A;  4WF4 A;  5LD0 A;  3GL5 A;  3EVI A;  1EOH A;  2C0E A;  5FT3 A;  4KGI A;  2AAW A;  2H30 A;  4I6X A;  2MMN A;  1G6Y A;  4LMW A;  1YEP A;  2HZF A;  1OE7 A;  2UZ8 A;  3BOA A;  1SEN A;  3GH9 A;  5DQY A;  4KSO A;  2YWI A;  2C3N A;  2IFQ B;  2VO4 A;  1GLQ A;  4I2U A;  2HZE B;  2RUE A;  4GSN A;  2AB6 A;  2NTO A;  3IK7 A;  4O5R A;  1B9Y C;  2DIZ A;  1M2D A;  4ZIL A;  3ERG A;  2OJL A;  5IMC A;  2KLX A;  3IR4 A;  1GH2 A;  4EXJ A;  1K3L A;  1H4O A;  2V1M A;  2L5O A;  1RW1 A;  4CDO A;  2R5G A;  1GUH A;  5EY6 A;  5H5Q A;  4IHU A;  3M1G A;  3WGX A;  4TXO B;  3S9F A;  1GTB A;  3ZFL A;  1V57 A;  4N11 A;  5D8I A;  2JSY A;  4MZC A;  2C0F A;  3QFA C;  4DEJ A;  1GUL A;  3VPT A;  4WBR D;  1EP8 A;  5CP1 A;  2V6K A;  1SJ6 A;  1KEB A;  1EEJ A;  2DC5 A;  4O5Q A;  1LJR A;  4MJA A;  2DJ3 A;  2IJY A;  1V58 A;  4MLY A;  4HJM A;  5J9C A;  2YJH A;  4MCU A;  5G1K A;  3GL3 A;  3HHV A;  2A4V A;  2B7K A;  4X43 A;  3LOR A;  4MJE A;  5DJL A;  1EV9 A;  1K0A A;  4KX4 A;  3IA1 A;  3P90 A;  1QXH A;  4GLT A;  5JCU A;  1J0F A;  1GL8 A;  1JZW A;  3OR5 A;  3F63 A;  1TI1 A;  3F9U A;  5CRH A;  5ECP B;  2N5B A;  3UBK A;  4BVX B;  1O8W A;  3L9U A;  4GXZ A;  5AN1 A;  3CTF A;  3NZN A;  3US3 A;  3FKF A;  2ALB A;  4PQI A;  4OCE A;  3KXO A;  1KNG A;  4Q5N A;  3L4N A;  1SYX A;  3TOT A;  1M0U A;  1DBY A;  4IEL A;  3O76 A;  5AGY A;  5EPF A;  1K0N A;  1SKS B;  1H75 A;  4IKH A;  1IYH A;  2J9H A;  2FNO A;  4FYU A;  5DAK B;  3WT1 A;  2WGR A;  4QL7 A;  1GSS A;  5J4U A;  2R2J A;  5B7C A;  1M7T A;  3Q74 A;  1MEK A;  5HR2 A;  5HR0 A;  2GQL A;  1DSB A;  4Z2R A;  3F4R A;  4KSM A;  1XOB A;  3CQF A;  5ECI B;  1BJX A;  1XVW A;  2R37 A;  4ZB9 A;  3ZZX A;  3TJJ A;  1SD9 A;  2PUK C;  2VAF A;  4KCE A;  4N30 A;  1B48 A;  1M2A A;  1A8Y A;  2E2M A;  1QMV A;  3ZIV A;  1OE8 A;  3GUS A;  4OO4 A;  5KN0 A;  1PN9 A;  2Z9S A;  3IE3 A;  4ECJ A;  3HVN A;  2FGX A;  3KTB A;  4K7I A;  3F4S A;  2RII A;  1T00 A;  5IO0 A;  5CNW A;  2JU5 A;  4KF9 A;  3TCO A;  1J9B A;  3TRX A;  2KHP A;  4FIW A;  5GZZ B;  3EIN A;  3TJK A;  3Q18 A;  3F4T A;  1QGV A;  4XRD A;  2VL2 C;  2X4A A;  1E2Y A;  2FWE A;  1EGR A;  3PGT A;  4DVC A;  1TU8 A;  4PUA A;  3CSI A;  3TRP A;  2GZY A;  9GSS A;  4MDC A;  2LRT A;  2HSM A;  2P5R A;  5FHI A;  1W89 A;  2B5X A;  2WFC A;  1B4Q A;  2YWM A;  3VI7 A;  1ML6 A;  3W8J A;  2C3T A;  2PVO C;  1FW1 A;  1A2L A;  2YOI A;  4N10 A;  4LA1 A;  1RK4 A;  3HZ8 A;  1XVQ A;  2OBK A;  5C04 A;  5F8B A;  1XWB A;  3D4M A;  3C7M A;  1I9D A;  4HQS A;  4RI6 A;  2GDR A;  2L4Q A;  3F6F A;  1X5C A;  2R0C A;  4ILF A;  4K5S A;  2K8V A;  4TOP A;  3GH6 A;  1K3O A;  2WB9 A;  4OD7 A;  1OKT A;  4OMV A;  1FOV A;  5GST A;  3TB2 A;  3LXZ A;  1G6W A;  3QPM A;  4ZIJ A;  3IK9 A;  5JCW A;  2R0P A;  14GS A;  2C4J A;  3CYN A;  4XS6 A;  3E0U A;  1EGO A;  1XW9 A;  1BAY A;  5DQS A;  2ES7 A;  1MDK A;  3IOS A;  2HLS A;  1EZK A;  1GSQ A;  2NDO A;  2H76 A;  1GTU A;  1B9X C;  4NV5 A;  4L5O A;  1FVJ A;  1S3D A;  1GUK A;  2B1K A;  2VCT A;  3GN3 A;  2L6C A;  3C1S A;  2H0H A;  3FZA A;  3M0F A;  1GSU A;  3CSH A;  5A5K A;  1XG8 A;  1PL2 A;  4MJB A;  2WJU A;  3W8S A;  1ERV A;  4K0G A;  1M2B A;  3CMI A;  3O6T A;  1XW5 A;  1FO5 A;  3EMX A;  4MH3 A;  2D2Z A;  2LQO A;  1S3R A;  3H8Q A;  3BCI A;  4GWR A;  1SL2 B;  4PUR A;  2VUP A;  5D9T A;  5CRG A;  2VCQ A;  3H79 A;  3GUR A;  5INY A;  4LMV A;  2AUV A;  1ILO A;  4AF2 A;  3P7X A;  3HJP A;  2H72 A;  3HJO A;  1CQG A;  2VD0 A;  3K8N A;  2C0D A;  4PQ1 A;  2QGV A;  1XWK A;  2I3Y A;  4MJC A;  3KMO A;  1BG5 A;  4PGT A;  3KP9 A;  1NM3 A;  2EC4 A;  1AW9 A;  4POK A;  1TRW A;  4AJ7 A;  1PSQ A;  5JWR B;  5KOW A;  3F3R A;  4WR5 A;  5CO3 A;  1URM A;  3TOU A;  5GAN D;  3LWA A;  2IMD A;  5EL8 A;  4XHM A;  2H1D A;  2YPM A;  4TRX A;  4DSS A;  2V6O A;  3GFK A;  5B6M A;  3LW9 A;  3ME8 A;  4OFN A;  2FWF A;  3IAM 2;  3RPN A;  3RAZ A;  3UAP A;  18GS A;  4BVY A;  1TP9 A;  2VL2 A;  2YJ7 A;  1OYJ A;  4JBB A;  1JZD A;  2RLI A;  1ERU A;  3FW2 A;  2LJK A;  2KUC A;  5ENU A;  4V2L A;  3LJR A;  3F0I A;  1F2E A;  3WT2 A;  4HUA A;  2BMX A;  1ZYN A;  2N5A A;  4J2F A;  2O87 A;  1Z3E A;  1DUG A;  1QFN A;  2HRK A;  2K6V A;  3BJ5 A;  1R7H A;  4ISD A;  3D6I A;  1T1V A;  3GIX A;  2M72 A;  1SK1 A;  4N0Z A;  4V2M A;  3RHC A;  4TR3 A;  5DCH A;  2VCW A;  1ACV A;  3LGC A;  3L9S A;  1MDI A;  1U3A A;  3C8E A;  4YKF A;  1OAZ A;  3LSZ A;  1XW6 A;  3A2X A;  2VCX A;  2CZ3 A;  3HD5 A;  1VF2 A;  4KDX A;  3QD9 A;  2I9H A;  2FCH A;  1NHO A;  4XRA A;  2GSQ A;  2XC2 A;  1Q98 A;  5DAL B;  3TKP A;  4AGS A;  3PR8 A;  2H1B A;  2VCV A;  1I5G A;  3P8W A;  4ICY A;  4WR4 A;  4F0C A;  4TR1 A;  2LST A;  1VF3 A;  1W4V A;  3UIW A;  2GSS A;  2LEG A;  1PQN A;  4EO3 A;  3SWL A;  4JR6 A;  1GLP A;  5BRT A;  3FY7 A;  4WF5 A;  3RBT A;  2PPT A;  3GKK A;  2PVQ A;  4TXV A;  2H1A A;  4EL1 A;  4RQX A;  4I2T A;  3A2V A;  1O81 A;  4E8H A;  1X9S B;  2B5Y A;  3ISO A;  1LBK A;  3QCP A;  1GTI A;  4FYB A;  5J5N A;  2QA1 A;  3FMW A;  2CAQ A;  1THX A;  1GP1 A;  4RUV A;  5D9W A;  1B8X A;  4F9Z A;  5F0G A;  5G5F A;  3H1N A;  1WMJ A;  3LXT A;  4GTU A;  5ID2 A;  3I69 A;  3CXG A;  5B8A A;  1WPI A;  3ZIJ A;  2CVB A;  1XBS A;  5HFG A;  2YV9 A;  6GSU A;  2DJ0 A;  4MF6 A;  1RQM A;  1JLV A;  2HXK A;  1ZL9 A;  4IGJ A;  5FWG A;  1Z5Y E;  4GSS A;  2HE3 A;  2VLU A;  3QDN A;  4RQR A;  5ELG A;  1PN0 A;  1U88 A;  3G7Y A;  1ERW A;  6GSS A;  3HY2 A;  1TJD A;  4G10 A;  2YCD A;  2M80 A;  3W6G A;  1JLW A;  3TRQ A;  1EP7 A;  1TU7 A;  3IDV A;  2QSI A;  2OA7 A;  10GS A;  1PGT A;  4XIH A;  4EDY A;  4IW9 A;  3LQ7 A;  4ULX A;  4ECB A;  3UMA A;  2TRC P;  1N2A A;  11GS A;  2F9S A;  2H19 A;  5D73 A;  3EMP A;  4XS4 A;  5ECN B;  1XOA A;  1F9M A;  1TK0 B;  4D73 B;  4ZB8 A;  13GS A;  22GS A;  4OO5 A;  2HRN A;  4N0V A;  1MTC A;  1XIY A;  2F51 A;  3J7Y k;  4ZB6 A;  1Y6E A;  4TR0 A;  5CRD A;  3VPQ A;  5A4U A;  3I9V 2;  1YJ6 A;  5HFI A;  3KJY A;  3QOU A;  3FR9 A;  3U5R E;  3UEM A;  2AJQ B;  1USB A;  1QUW A;  4G0L A;  3F3Q A;  5ECM B;  1OC9 A;  4BPY A;  3HVS A;  1UC7 A;  2GQM A;  1R5P A;  1FHE A;  3QFB C;  3ZLP A;  5KN2 A;  1X9M B;  1A8L A;  2LRN A;  3E9J B;  3ED3 A;  3O3T A;  1XWG A;  2H6Z A;  2GVP A;  4IQA A;  3DIE A;  2X8C A;  1M3J A;  2LJA A;  1NSW A;  2YNX A; 
#chains in the Genus database with same CATH homology
 1YZX A;  4TR4 A;  1AQX A;  4V2N A;  1TXX A;  4KND A;  2H8L A;  2VL3 A;  4HEA 2;  2FA4 A;  1WRY A;  1EOG A;  1R4W A;  2IFQ A;  1BED A;  2H01 A;  3FRC A;  1VGL A;  1ZOF A;  5J9B A;  5G30 A;  2ZCT A;  5A4W A;  4HQZ A;  2A4H A;  2HZE A;  2AV4 A;  1UVZ A;  4BWQ A;  1SYR A;  2L5L A;  5B8B A;  5IPH A;  1TOF A;  3AY8 A;  2ZUP A;  1T4Z A;  2NVL A;  3IPZ A;  2P0G A;  2GZP A;  4MMM A;  1OC8 A;  5HQP A;  5IMZ A;  5KN1 A;  4MP4 A;  5D9X A;  4TXO A;  2YN1 A;  1AAZ A;  3P2A A;  2WRT A;  2J23 A;  4MPF A;  1HD2 A;  4JE1 A;  2DML A;  2LNS A;  4BWS A;  1A23 A;  2FWH A;  4IBP A;  3TGZ A;  4IJ3 A;  2C0G A;  3DEX A;  1AUC A;  2AHE A;  2OAC A;  3L78 A;  2MBS A;  3ZFB A;  5BMU A;  3CSJ A;  4KAE A;  1WP0 A;  3ZVJ A;  2YP6 A;  4CY6 A;  1R26 A;  1XCC A;  4J56 E;  3ZVJ D;  4L5L A;  2VIM A;  5F05 A;  2F8F A;  4G19 A;  7GSS A;  4CY8 A;  1WIK A;  5ECR B;  2GTU A;  3GKN A;  1XWC A;  5J41 A;  3HVV A;  1SKR B;  1GWC A;  3IHQ A;  2B6M A;  1KTE A;  3LEF A;  5D96 A;  5HR3 A;  6GST A;  6GSV A;  1PKZ A;  3GSS A;  4K8M A;  1X0R A;  3FEU A;  1YKC A;  4G0K A;  3KCM A;  1ZYE A;  2DJ1 A;  5CYY A;  4GF0 A;  1U3I A;  1XFL A;  1HNC A;  2OAD A;  2FHE A;  4NHW A;  1O8X A;  3QMX A;  1KBN A;  4BVX A;  2X64 A;  1XXU A;  3GKM A;  4NHZ A;  4K5R A;  6GSY A;  4BL7 B;  3CRT A;  1TRV A;  3D4T A;  3GA4 A;  3GX8 A;  3TJB A;  1K0M A;  3HZ4 A;  4PQH A;  3FHK A;  1AC1 A;  3N9J A;  4MAB A;  1ZYP A;  4YAV A;  2B1L A;  4NV2 A;  1HNA A;  5DAK A;  4ZBD A;  1TK5 B;  4PNF A;  4FO5 A;  3APS A;  4G9H A;  2E0Q A;  4EC0 A;  1XWA A;  2CAI A;  2HSY A;  1Y25 A;  4OFT A;  2LRC A;  2H1G A;  3VUR A;  3MAK A;  2MZC A;  2IWT A;  2IME A;  3C73 A;  4ACS A;  3VWV A;  5CAX A;  5DDL A;  2EIQ A;  2IIY A;  1QQ2 A;  2CA8 A;  4KB3 A;  4ID0 A;  3TJG A;  2GGT A;  3R2Q A;  3G7I A;  2MMO A;  4GST A;  4YQM A;  1YY7 A;  4K6X A;  2V41 A;  4X4J A;  5AIV A;  3HCZ A;  2FWG A;  4YH2 A;  1Q4J A;  1O7U A;  2I81 A;  1TTZ A;  2LNT A;  5IOW A;  2C80 A;  3HJM A;  4ZBA A;  3G9B A;  4KA0 A;  2BJX A;  1OC3 A;  4IS0 A;  2DJK A;  5JWO B;  3MSZ A;  3DYR A;  4F0B A;  3SBC A;  3U6V A;  1O6J A;  3CRU A;  2PBJ A;  1DE1 A;  19GS A;  2MBT A;  1WWJ A;  3TKQ A;  2F8A A;  4MK3 A;  4OWY A;  1TI3 A;  5GSS A;  1K3Y A;  1K0O A;  3FZ5 A;  3GX0 A;  3H93 A;  4HI7 A;  2I4A A;  5ECL B;  2H6Y A;  3VWU A;  2A2S A;  3F8U A;  4LLR A;  5IM9 A;  2GLR A;  4AJ8 A;  1X5E A;  2QA2 A;  3L9V A;  2CZ2 A;  1DE2 A;  6GSW A;  5A4V A;  2E2G A;  2PGT A;  4CHS A;  3DKS A;  3Q19 A;  4ZXG A;  2HT9 A;  5HFK A;  5DVB A;  3ZTL A;  3V1W A;  3R3E A;  5JWQ B;  2B3S A;  2H66 A;  1Z7R A;  2CX3 A;  2DKI A;  3APQ A;  4ZBB A;  1ABA A;  4F82 A;  3IRA A;  1OKD A;  2L4C A;  3BCK A;  1HNB A;  5IIZ A;  1G7E A;  4GRF A;  2YAN A;  5KOX A;  3TJF A;  2TRX A;  4LL4 B;  1SJI A;  1F37 A;  4DSQ A;  2O89 A;  4EIP A;  3GKX A;  5D9V A;  3IXR A;  4HU9 A;  1BQ7 A;  3RDW A;  3KGK A;  2X99 A;  2LUS A;  1FVK A;  4J57 E;  5IO2 A;  4PUF C;  5COH A;  2YZU A;  4JRR A;  1G0T A;  2PU9 C;  1SKW B;  4YKG A;  2RM5 A;  1PX7 A;  2JZR A;  2GZZ A;  2DKH A;  4O7H A;  5ECK B;  4HZ4 A;  2DMM A;  3VWX A;  5AIS A;  1TKD B;  4I5Q A;  1CQH A;  2ON7 A;  1YF1 A;  3VFI A;  1WJK A;  2PER A;  3ZML A;  3M8N A;  5HR1 A;  5ELA A;  4V1A p;  4G0I A;  1EV4 A;  2L6D A;  3WGD A;  2ZNM A;  3DD3 A;  3UBL A;  2R4V A;  2WS2 A;  3FZ9 A;  1GNE A;  4V1A g;  3PH9 A;  3MIX A;  2CX4 A;  1ZGN A;  4IJI A;  2H75 A;  3EC3 A;  3EWL A;  2HRF A;  4POM A;  1A24 A;  2XPE A;  3D0Z A;  5IMV A;  4KCA A;  2VD1 A;  3KMN A;  2F3M A;  1SK2 A;  1GTA A;  3GV1 A;  3HDC A;  3A3T A;  2DLX A;  4MA9 A;  1A0F A;  2NPB A;  2WUL A;  4EF0 A;  1K0C A;  3G7J A;  4IP6 A;  2KP1 A;  2B7J A;  4X0X A;  3FR6 A;  4NXI A;  2LJR A;  2YWN A;  2O85 A;  3IHG A;  2DJ2 A;  2DBC A;  4HS1 A;  1HYU A;  1B4P A;  3HVX A;  2H6X A;  4EIQ A;  4IVF A;  2JAD A;  2E7P A;  1PD2 1;  3CBU A;  1TRU A;  3DRN A;  20GS A;  2VLT A;  1AQW A;  4GQC A;  1EEM A;  3BBY A;  3QAW A;  2FD3 A;  8GSS A;  2PMT A;  1PRX A;  4TVE A;  3UVT A;  5KN3 A;  1F3B A;  1J08 A;  1WOU A;  1PA3 A;  2K9F A;  2FLS A;  3H4K A;  4NPB A;  2REM A;  1F3A A;  2VM2 A;  2WZ9 A;  4JR4 A;  2MMZ A;  2HFD A;  2HNL A;  4H86 A;  5IOX A;  4HJ2 A;  3BD2 A;  1T3B A;  1M9B A;  4L0W A;  4MH2 A;  4E8E A;  4MNN A;  1THO A;  4HZ2 A;  4DSR A;  5G2Z A;  4KDY A;  4PXO A;  3DXB A;  5DAL A;  1V40 A;  3MDK A;  5E4W A;  5LNK e;  5C00 A;  4ECI A;  5D93 A;  2YZH A;  3GMF A;  1JFU A;  3DGQ A;  2OE0 A;  2R3X A;  5LCZ A;  3NIV A;  1BYE A;  4IP1 A;  4OCF A;  5CRE A;  3EYT A;  1MD4 A;  4ECC A;  3C1R A;  2LTK A;  3KH7 A;  2IN3 A;  2O8V B;  4HOJ A;  5DBQ A;  12GS A;  2OBI A;  2IMF A;  1A2M A;  1TDI A;  4XCS A;  4I97 A;  2P31 A;  2MYG A;  17GS A;  1PMT A;  2XPD A;  3TKS E;  3I6A A;  4IQ1 A;  3C71 A;  4L8E A;  1V98 A;  3APO A;  4FH8 A;  4ZL9 A;  3JCM L;  2IMK A;  2MMA A;  1FOH A;  3M9K A;  1EWX A;  1T8E B;  1AXD A;  2V32 A;  1BX9 A;  4XTS A;  1VF1 A;  1N8J A;  1MDJ A;  4O92 A;  3KIJ A;  2PN8 A;  3MYD A;  4RI7 A;  5IMD A;  4ML1 A;  2M46 A;  4JED A;  3EE2 A;  3WGE A;  1U6T A;  2A2R A;  3IV4 A;  1M9A A;  1YDK A;  4GCI A;  2OE3 A;  4K9Z A;  1O85 A;  1SK0 A;  5H5S A;  3WYW A;  3D5J A;  1AQV A;  2N5F A;  4QL9 A;  2TIR A;  3FYG A;  4MZB A;  1S3C A;  2H0I A;  3IC4 A;  1Z9H A;  2WDU A;  3UAR A;  2VLV A;  1SL0 B;  5DCG A;  5F07 A;  3GHA A;  3FR3 A;  2I1U A;  2V2G A;  2O7K A;  4EVM A;  4D73 A;  3M9J A;  5GAP D;  2C1Y A;  3ZIT A;  1GNW A;  1YF0 A;  3VWW A;  4TKY A;  1ZCP A;  1SU9 A;  1Z6N A;  5G1L A;  3LG6 A;  4WET A;  4MF5 A;  2VOC A;  1GSE A;  2G0F A;  3QAG A;  1X5D A;  5G5E A;  3ZMK A;  2WCI A;  3HYP A;  1HQO A;  4BA7 A;  2OKA A;  4K2X A;  2C8U A;  2VM1 A;  3KTL A;  6GSX A;  5ECH B;  3KH9 A;  4F03 A;  2FUG 2;  3ZL5 A;  2R0G A;  1ON4 A;  2X8G A;  5JCG A;  2L59 A;  1M99 A;  2H74 A;  2H0G A;  3KP8 A;  3LYK A;  2JZT A;  2X8H A;  1T7P B;  2HI7 A;  3D22 A;  3GNJ A;  2LQQ A;  1SD8 A;  4OFM A;  5H5R A;  4K1F A;  1GRX A;  1XZO A;  2CT6 A;  1A0R P;  2H71 A;  2JSZ A;  5IQY A;  4JZQ A;  4K7N A;  1K0D A;  1QK8 A;  2CQ9 A;  3KEB A;  4O5U A;  3VI5 A;  4WXT A;  4POL A;  2B5E A;  1FB0 A;  2LS5 A;  1SL1 B;  3HA9 A;  2BTO T;  2H73 A;  4POB A;  4KUN A;  4USS A;  2QC7 A;  3N5O A;  4F2I A;  5CRW A;  3TKS C;  2GQK A;  2H70 A;  4JU5 A;  4NAX A;  2HSH A;  3ZRD A;  1FB6 A;  4ZL8 A;  4DSS B;  3VK9 A;  3IAS 2;  5KEJ A;  1S3A A;  1O73 A;  2C3Q A;  1LU4 A;  4BVY B;  4HDE A;  1GSD A;  2KP2 A;  3Q6O A;  4G2E A;  2LKU A;  16GS A;  1GUM A;  3J7Y b;  1C72 A;  2XBI A;  2IMI A;  4WKW A;  1NHY A;  2VCZ A;  1NW2 A;  3DVX A;  5J3R A;  3QR6 A;  3KZQ A;  2HRA A;  4EDZ A;  3QAV A;  3RHB A;  2DIY A;  2XBQ A;  2JAC A;  5ECO B;  3WD6 A;  1AIU A;  3MNG A;  2QKE A;  2P5Q A;  4K7O A;  2EIO A;  1R5A A;  2ON5 A;  3A5I A;  4EUY A;  3EU3 A;  3L0H A;  1OVN A;  1TK8 B;  1VF4 A;  2OE1 A;  1ZYQ B;  2FY6 A;  3HKR A;  4QQ7 A;  3UJ1 A;  1JHB A;  2G2Q A;  2GST A;  4BL7 A;  3TUE A;  1Z6M A;  5EVO A;  4TR1 B;  2XHF A;  2GT6 A;  4IN0 A;  3EUR A;  1TRS A;  3NOF A;  1GSF A;  1ST9 A;  2NBS A;  4TN8 A;  1PL1 A;  4I8B A;  4WBJ A;  3FZ4 A;  2GS3 A;  1V9W A;  4LL1 B;  5ABR A;  5E59 A;  2K8S A;  5ECQ B;  4FQU A;  1YEX A;  1V2A A;  3CTG A;  2CVK A;  4KH7 A;  1Z7P A;  1MD3 A;  2X49 A;  2YV7 A;  1G7O A;  2R6K A;  4YQU A;  3GTU B;  2VL9 A;  4EKZ A;  1TW9 A;  3IC8 A;  1U87 A;  3TKR A;  4EE0 A;  4O32 A;  3DWV A;  1E6B A;  4CW9 A;  3EU4 A;  1T4Y A;  1XPV A;  5IMA A;  1GSY A;  2KOK A;  4NMU A;  3A5W A;  2EIR A;  4TW5 A;  1ERT A;  3LFL A;  5ID2 B;  2DSA A;  1JZO A;  2L57 A;  1UN2 A;  4PX1 A;  4K2D A;  3E3E A;  4MPG A;  4YAP A;  3UL3 A;  1F6M C;  4ML6 A;  4KW6 A;  5G31 A;  3TDG A;  2FA8 A;  1K0B A;  3DML A;  5DJM A;  4WEY A;  2HYX A;  4KDU A;  4PTS A;  3M3M A;  1FG4 A;  3I43 A;  4MF7 A;  2PWJ A;  4A5P A;  1UA5 A;  3UOM A;  3VLN A;  2IPA A;  3KD0 A;  2JL4 A;  2GSR A;  3TKS A;  3ME7 A;  2LV3 A;  4Q5F A;  1ZMA A;  2IL3 A;  1SJZ A;  4HU7 A;  3A2W A;  1FAA A;  4XS4 B;  4X1U A;  4Z7X A;  2RUF A;  3ZRE A;  2JZS A;  3ZYW A;  4L0U A;  1JZR A;  3RPP A;  1WE0 A;  4YQV A;  3HXS A;  5B6N A;  3FK8 A;  5IMF A;  1PKW A;  1X9W B;  3PIN A;  5AIX A;  3PPU A;  3DVW A;  1PX6 A;  4GQF A;  2CVD A;  4PNG A;  4K0N A;  3ERF A;  2K18 A;  3GRX A;  2AYT A;  4AJ6 A;  2RM6 A;  2YWO A;  2GT5 A;  3EPT A;  3F6D A;  4ZL7 A;  5IPG A;  4XS1 A;  1IYI A;  3IBH A;  3GST A;  3ERW A;  3MWH A;  4P3Y B;  3KM6 A;  3UVH A;  3D21 A;  4NWY A;  2DJJ A;  1OC9 B;  5L71 A;  4FYC A;  4Q5R A;  4Z2T A;  4MZW A;  1A2J A;  5F06 A;  3GTU A;  1YKA A;  2A2P A;  2CV4 A;  4Z2U A;  3LYP A;  4Q5Q A;  5ECS A;  1YQ1 A;  1ZZY A;  4KE3 A;  1VRS D;  3GYK A;  4WF4 A;  5LD0 A;  3GL5 A;  3EVI A;  1EOH A;  2C0E A;  5FT3 A;  4KGI A;  2AAW A;  2H30 A;  4I6X A;  2MMN A;  1G6Y A;  4LMW A;  1YEP A;  2HZF A;  1OE7 A;  2UZ8 A;  3BOA A;  1SEN A;  3GH9 A;  5DQY A;  4KSO A;  2YWI A;  2C3N A;  2IFQ B;  2VO4 A;  1GLQ A;  4I2U A;  2HZE B;  2RUE A;  4GSN A;  2AB6 A;  2NTO A;  3IK7 A;  4O5R A;  1B9Y C;  2DIZ A;  1M2D A;  4ZIL A;  3ERG A;  2OJL A;  5IMC A;  2KLX A;  3IR4 A;  1GH2 A;  4EXJ A;  1K3L A;  1H4O A;  2V1M A;  2L5O A;  1RW1 A;  4CDO A;  2R5G A;  1GUH A;  5EY6 A;  5H5Q A;  4IHU A;  3M1G A;  3WGX A;  4TXO B;  3S9F A;  1GTB A;  3ZFL A;  1V57 A;  4N11 A;  5D8I A;  2JSY A;  4MZC A;  2C0F A;  3QFA C;  4DEJ A;  1GUL A;  3VPT A;  4WBR D;  1EP8 A;  5CP1 A;  2V6K A;  1SJ6 A;  1KEB A;  1EEJ A;  2DC5 A;  4O5Q A;  1LJR A;  4MJA A;  2DJ3 A;  2IJY A;  1V58 A;  4MLY A;  4HJM A;  5J9C A;  2YJH A;  4MCU A;  5G1K A;  3GL3 A;  3HHV A;  2A4V A;  2B7K A;  4X43 A;  3LOR A;  4MJE A;  5DJL A;  1EV9 A;  1K0A A;  4KX4 A;  3IA1 A;  3P90 A;  1QXH A;  4GLT A;  5JCU A;  1J0F A;  1GL8 A;  1JZW A;  3OR5 A;  3F63 A;  1TI1 A;  3F9U A;  5CRH A;  5ECP B;  2N5B A;  3UBK A;  4BVX B;  1O8W A;  3L9U A;  4GXZ A;  5AN1 A;  3CTF A;  3NZN A;  3US3 A;  3FKF A;  2ALB A;  4PQI A;  4OCE A;  3KXO A;  1KNG A;  4Q5N A;  3L4N A;  1SYX A;  3TOT A;  1M0U A;  1DBY A;  4IEL A;  3O76 A;  5AGY A;  5EPF A;  1K0N A;  1SKS B;  1H75 A;  4IKH A;  1IYH A;  2J9H A;  2FNO A;  4FYU A;  5DAK B;  3WT1 A;  2WGR A;  4QL7 A;  1GSS A;  5J4U A;  2R2J A;  5B7C A;  1M7T A;  3Q74 A;  1MEK A;  5HR2 A;  5HR0 A;  2GQL A;  1DSB A;  4Z2R A;  3F4R A;  4KSM A;  1XOB A;  1BJX A;  5ECI B;  1XVW A;  2R37 A;  4ZB9 A;  3ZZX A;  3TJJ A;  1SD9 A;  2PUK C;  2VAF A;  4KCE A;  4N30 A;  1B48 A;  1M2A A;  1A8Y A;  2E2M A;  1QMV A;  3ZIV A;  1OE8 A;  3GUS A;  4OO4 A;  5KN0 A;  1PN9 A;  2Z9S A;  3IE3 A;  4ECJ A;  2FGX A;  3KTB A;  4K7I A;  3F4S A;  2RII A;  1T00 A;  5IO0 A;  5CNW A;  2JU5 A;  4KF9 A;  3TCO A;  1J9B A;  3TRX A;  2KHP A;  4FIW A;  5GZZ B;  3EIN A;  3TJK A;  3Q18 A;  3F4T A;  1QGV A;  4XRD A;  2VL2 C;  2X4A A;  1E2Y A;  2FWE A;  1EGR A;  3PGT A;  4DVC A;  1TU8 A;  4PUA A;  3CSI A;  3TRP A;  2GZY A;  9GSS A;  4MDC A;  2LRT A;  2HSM A;  2P5R A;  5FHI A;  1W89 A;  2B5X A;  2WFC A;  1B4Q A;  2YWM A;  3VI7 A;  1ML6 A;  3W8J A;  2C3T A;  2PVO C;  1FW1 A;  1A2L A;  2YOI A;  4N10 A;  4LA1 A;  1RK4 A;  3HZ8 A;  1XVQ A;  2OBK A;  5C04 A;  5F8B A;  1XWB A;  3D4M A;  3C7M A;  1I9D A;  4HQS A;  4RI6 A;  2GDR A;  2L4Q A;  3F6F A;  1X5C A;  2R0C A;  4ILF A;  4K5S A;  2K8V A;  4TOP A;  3GH6 A;  1K3O A;  2WB9 A;  4OD7 A;  1OKT A;  4OMV A;  1FOV A;  5GST A;  3TB2 A;  3LXZ A;  1G6W A;  3QPM A;  4ZIJ A;  3IK9 A;  5JCW A;  2R0P A;  14GS A;  2C4J A;  3CYN A;  4XS6 A;  3E0U A;  1EGO A;  1XW9 A;  1BAY A;  5DQS A;  2ES7 A;  1MDK A;  3IOS A;  2HLS A;  1EZK A;  1GSQ A;  2NDO A;  2H76 A;  1GTU A;  1B9X C;  4NV5 A;  4L5O A;  1FVJ A;  1S3D A;  1GUK A;  2B1K A;  2VCT A;  3GN3 A;  2L6C A;  3C1S A;  2H0H A;  3FZA A;  3M0F A;  1GSU A;  3CSH A;  5A5K A;  1PL2 A;  4MJB A;  2WJU A;  3W8S A;  1ERV A;  4K0G A;  1M2B A;  3CMI A;  3O6T A;  1XW5 A;  1FO5 A;  3EMX A;  4MH3 A;  2D2Z A;  2LQO A;  3H8Q A;  3BCI A;  4GWR A;  1SL2 B;  4PUR A;  2VUP A;  5D9T A;  5CRG A;  2VCQ A;  3H79 A;  3GUR A;  5INY A;  4LMV A;  2AUV A;  1ILO A;  4AF2 A;  3P7X A;  3HJP A;  2H72 A;  3HJO A;  1CQG A;  2VD0 A;  3K8N A;  2C0D A;  4PQ1 A;  2QGV A;  1XWK A;  2I3Y A;  4MJC A;  3KMO A;  1BG5 A;  4PGT A;  3KP9 A;  1NM3 A;  2EC4 A;  1AW9 A;  4POK A;  1TRW A;  4AJ7 A;  1PSQ A;  5JWR B;  5KOW A;  3F3R A;  4WR5 A;  5CO3 A;  1URM A;  3TOU A;  5GAN D;  3LWA A;  2IMD A;  5EL8 A;  4XHM A;  2H1D A;  2YPM A;  4TRX A;  4DSS A;  2V6O A;  3GFK A;  5B6M A;  3LW9 A;  3ME8 A;  4OFN A;  2FWF A;  3IAM 2;  3RPN A;  3RAZ A;  3UAP A;  18GS A;  4BVY A;  1TP9 A;  2VL2 A;  2YJ7 A;  1OYJ A;  4JBB A;  1JZD A;  2RLI A;  1ERU A;  3FW2 A;  2LJK A;  2KUC A;  5ENU A;  4V2L A;  3LJR A;  3F0I A;  1F2E A;  3WT2 A;  4HUA A;  2BMX A;  1ZYN A;  2N5A A;  4J2F A;  2O87 A;  1Z3E A;  1DUG A;  1QFN A;  2HRK A;  2K6V A;  3BJ5 A;  1R7H A;  4ISD A;  3D6I A;  1T1V A;  3GIX A;  2M72 A;  1SK1 A;  4N0Z A;  4V2M A;  3RHC A;  4TR3 A;  5DCH A;  2VCW A;  1ACV A;  3LGC A;  3L9S A;  1MDI A;  1U3A A;  3C8E A;  4YKF A;  1OAZ A;  3LSZ A;  1XW6 A;  3A2X A;  2VCX A;  2CZ3 A;  3HD5 A;  1VF2 A;  4KDX A;  3QD9 A;  2I9H A;  2FCH A;  1NHO A;  4XRA A;  2GSQ A;  2XC2 A;  1Q98 A;  5DAL B;  3TKP A;  4AGS A;  3PR8 A;  2H1B A;  2VCV A;  1I5G A;  3P8W A;  4ICY A;  4WR4 A;  4F0C A;  4TR1 A;  2LST A;  1VF3 A;  1W4V A;  3UIW A;  2GSS A;  2LEG A;  1PQN A;  4EO3 A;  3SWL A;  4JR6 A;  1GLP A;  5BRT A;  3FY7 A;  4WF5 A;  3RBT A;  2PPT A;  3GKK A;  2PVQ A;  4TXV A;  2H1A A;  4EL1 A;  4RQX A;  4I2T A;  3A2V A;  1O81 A;  4E8H A;  1X9S B;  2B5Y A;  3ISO A;  1LBK A;  3QCP A;  1GTI A;  4FYB A;  5J5N A;  2QA1 A;  3FMW A;  2CAQ A;  1THX A;  1GP1 A;  4RUV A;  5D9W A;  1B8X A;  4F9Z A;  5F0G A;  5G5F A;  3H1N A;  1WMJ A;  3LXT A;  4GTU A;  5ID2 A;  3I69 A;  3CXG A;  5B8A A;  1WPI A;  3ZIJ A;  2CVB A;  1XBS A;  5HFG A;  2YV9 A;  6GSU A;  2DJ0 A;  4MF6 A;  1RQM A;  1JLV A;  2HXK A;  1ZL9 A;  4IGJ A;  5FWG A;  1Z5Y E;  4GSS A;  2HE3 A;  2VLU A;  3QDN A;  4RQR A;  5ELG A;  1PN0 A;  1U88 A;  3G7Y A;  1ERW A;  6GSS A;  3HY2 A;  1TJD A;  4G10 A;  2YCD A;  2M80 A;  3W6G A;  1JLW A;  3TRQ A;  1EP7 A;  1TU7 A;  3IDV A;  2QSI A;  2OA7 A;  10GS A;  1PGT A;  4XIH A;  4EDY A;  4IW9 A;  3LQ7 A;  4ULX A;  4ECB A;  3UMA A;  2TRC P;  1N2A A;  11GS A;  2F9S A;  2H19 A;  5D73 A;  3EMP A;  4XS4 A;  5ECN B;  1XOA A;  1F9M A;  1TK0 B;  4D73 B;  4ZB8 A;  13GS A;  22GS A;  4OO5 A;  2HRN A;  4N0V A;  1MTC A;  1XIY A;  2F51 A;  3J7Y k;  4ZB6 A;  1Y6E A;  4TR0 A;  5CRD A;  3VPQ A;  5A4U A;  3I9V 2;  1YJ6 A;  5HFI A;  3KJY A;  3QOU A;  3FR9 A;  3U5R E;  3UEM A;  2AJQ B;  1USB A;  1QUW A;  4G0L A;  3F3Q A;  5ECM B;  1OC9 A;  4BPY A;  3HVS A;  1UC7 A;  2GQM A;  1R5P A;  1FHE A;  3QFB C;  3ZLP A;  5KN2 A;  1X9M B;  1A8L A;  2LRN A;  3E9J B;  3ED3 A;  3O3T A;  1XWG A;  2H6Z A;  2GVP A;  4IQA A;  3DIE A;  2X8C A;  2LJA A;  1NSW A;  2YNX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...