4BWSA

Crystal structure of the heterotrimer of pqbp1, u5-15kd and u5-52kd.
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
133
structure length
133
Chain Sequence
LPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWAMEDKQEMVDIIETVYRGARKGRGLVVSPKDYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords THIOREDOXIN-LIKE PROTEIN 4A
publication title Mutations in the Pqbp1 Gene Prevent its Interaction with the Spliceosomal Protein U5-15Kd.
pubmed doi rcsb
source organism Homo sapiens
total genus 42
structure length 133
sequence length 133
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02966 DIM1 Mitosis protein DIM1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4bwsA00
3D5JA 2H6YA 3TKSA 3KH9A 2YZHA 2GZPA 4NV2A 5H5QA 4HI7A 2JACA 5ENUA 2FWHA 5D8IA 4AJ7A 1G0TA 4BWSA 1E6BA 5D96A 2IN3A 2DMMA 1FW1A 4EC0A 3U5RE 4LL1B 4P3YB 3F63A 4LA1A 1JZOA 2DJJA 3FKFA 1OAZA 2AHEA 1ST9A 2ES7A 2B3SA 4WETA 1URMA 1TRUA 1M2AA 5IOWA 3LG6A 2IL3A 3MAKA 1PKZA 2JSYA 4ZBDA 5J9BA 4I6XA 4HOJA 5IIZA 3CSJA 1X9SB 2B1KA 4MABA 2G2QA 1XW6A 3TRXA 1VF4A 1AW9A 4POBA 2PUKC 2LJAA 3APOA 4TR1A 1R4WA 5DALA 1MEKA 4PUFC 4ZL9A 2CVBA 3QDNA 2X8CA 1A0RP 5IO0A 2WGRA 1KBNA 5C04A 5ECMB 1GSUA 3G9BA 1GNEA 2NVLA 4MF5A 1ZYEA 2MMAA 4TR1B 2FNOA 3RHCA 2XHFA 1EP7A 4G10A 5DALB 3ZVJD 3LXTA 5G5EA 1DBYA 1DE2A 3SWLA 4IELA 4WEYA 2H01A 4K6XA 1E2YA 5ABRA 3KD0A 1Z6NA 3IV4A 3F4RA 3WD6A 3F6DA 1TKDB 4TW5A 3IRAA 2JZSA 2HLSA 2JZRA 3BOAA 4K1FA 2N5BA 4K7OA 3ERGA 1ABAA 1EV9A 4Q5FA 1Z7PA 5J3RA 5HFGA 4TXVA 1AQWA 1XXUA 2H8LA 4CW9A 3MDKA 3NZNA 1XWCA 2YJHA 1B4PA 3C1RA 3VI7A 3G7YA 3GL3A 4RUVA 2I3YA 1IYIA 2GGTA 2NDOA 3EURA 2H70A 2GZZA 1B9YC 5DAKA 2RIIA 1THOA 1ZZYA 3QFAC 1M9AA 5F8BA 3E0UA 1SJ6A 2LUSA 1M9BA 2IFQA 5LCZA 1MDKA 1NHOA 1B9XC 3BCIA 2NTOA 5DAKB 4GF0A 4MPFA 4AJ8A 1ERUA 4PUAA 2YN1A 1TDIA 2CAQA 2IFQB 1SD8A 2H19A 3FR9A 3GURA 3TCOA 5GSTA 5KN3A 3EC3A 1YKAA 2B5XA 2RM6A 2D2ZA 2YPMA 2F9SA 2KHPA 1S3CA 2LS5A 4KAEA 1K0AA 2MYGA 2LRCA 4MZBA 2CAIA 2R3XA 2CX3A 1FB6A 3UARA 2H1BA 2XPEA 4HQZA 5IM9A 2R4VA 2B7JA 3EU4A 4X1UA 5ECKB 1BJXA 3CRUA 2JADA 3IA1A 3M8NA 1XW5A 4DSQA 3IXRA 3A5WA 2OACA 4LMWA 1A24A 2LQQA 2ON5A 4FYUA 2K8VA 3KH7A 2HZFA 4ML6A 2CZ2A 5ECIB 1Y6EA 4LMVA 3WT2A 3TUEA 1BEDA 2IMIA 2TIRA 4V2MA 2YP6A 1WJKA 1YF0A 2RUEA 1SJIA 1HNBA 2VL9A 4IQ1A 3Q6OA 3GSTA 1GLPA 3HD5A 2VAFA 1QQ2A 1EEMA 3GN3A 5INYA 1GP1A 4GTUA 2H0HA 1K3OA 3LSZA 4NWYA 3ZZXA 1R5AA 4TVEA 4WKWA 3HHVA 3WGXA 4EL1A 1JZDA 4GQCA 5COHA 1QK8A 2L6DA 5A4VA 4E8HA 1R26A 1TXXA 2DBCA 5ECLB 4IKHA 5IQYA 3PR8A 2B5EA 4QL9A 1OE8A 13GSA 4I2UA 2YWIA 1ILOA 4OMVA 3FEUA 1TJDA 2V6OA 3GRXA 3LYPA 2GQLA 1XOAA 3ISOA 2HRNA 2LKUA 4KW6A 5IMDA 3HDCA 3TJBA 5CO3A 5JWRB 3D22A 2VD0A 2WJUA 3BJ5A 5GAPD 1EEJA 1PN9A 1CQGA 5ECRB 1WMJA 3IBHA 1DE1A 1HNAA 2VM1A 1KEBA 3TOTA 1FB0A 1V2AA 3N5OA 3KP8A 4TR4A 5JCGA 4IS0A 2OE1A 3EMPA 1QFNA 8GSSA 3IAM2 3I9V2 2L6CA 2AAWA 3VWXA 2IIYA 3MNGA 2L5LA 4PURA 3TKRA 5DQYA 1K0NA 1VF3A 4XS1A 1EGOA 5L71A 4G9HA 2EIRA 2MMOA 4MDCA 2OKAA 4MCUA 3IDVA 3ZRDA 1S3DA 4WF5A 1GTIA 4HU7A 4ZBBA 5DBQA 5B6NA 3MWHA 2KOKA 2H6ZA 3O3TA 1AXDA 4GWRA 4QQ7A 3QPMA 5KN0A 3U6VA 4K7NA 4KDUA 4EXJA 3IPZA 5CNWA 5D73A 1GSDA 1QUWA 3HVXA 5DCGA 3TKSE 3FY7A 1SD9A 4PQIA 2IMFA 4ECCA 1YJ6A 1UVZA 1X5CA 2DJ2A 1USBA 4X0XA 4ZXGA 3L0HA 2CZ3A 2IWTA 5GAND 3US3A 1SU9A 4FH8A 1GUMA 4N0ZA 1ZOFA 3O76A 4GRFA 2LQOA 5D9VA 5ECPB 1KTEA 2CX4A 3ME8A 4NXIA 3M1GA 1ERWA 5HR0A 1ERVA 4GXZA 1S3AA 3RPNA 1O8WA 2DMLA 1HYUA 3KZQA 4J56E 4F03A 1ZCPA 4PQHA 6GSUA 1ZMAA 4F2IA 1VRSD 3QAVA 1IYHA 4L0UA 1JZRA 1OC8A 3ZFBA 3FZ9A 1PGTA 1B4QA 3UOMA 2OE3A 1RQMA 2VL2C 2H30A 5E59A 1RK4A 4MLYA 2G0FA 3HCZA 3LEFA 1GUHA 1BYEA 5G2ZA 2FA8A 4WF4A 1X9WB 4V1Ap 2P31A 5EVOA 3ERFA 3H1NA 2OE0A 2K6VA 1K3YA 3BCKA 5CREA 3I6AA 2VCVA 1T1VA 2H75A 3AY8A 2JZTA 5C00A 1BAYA 4IJ3A 1G7OA 4EO3A 2GSRA 5F05A 6GSYA 2GDRA 4BVYA 3CYNA 3DVWA 7GSSA 3VPTA 2H76A 3TDGA 2H72A 3IE3A 2L57A 3BBYA 1VF2A 2VLVA 1GULA 3H93A 3KTLA 1N8JA 2V41A 3H8QA 2V1MA 1OKTA 1PA3A 2GSSA 3GSSA 5A4WA 4HZ4A 5J9CA 4N0VA 3J7Yk 1DUGA 2M72A 2OBIA 3UMAA 2E2GA 3DYRA 2LSTA 1TK8B 2HE3A 4OFTA 1FOVA 4TXOA 2RUFA 2H1DA 3EWLA 1YF1A 3A3TA 3DWVA 3KMOA 2LEGA 2ZCTA 2R5GA 4YAVA 4PQ1A 1I5GA 2J23A 4NAXA 1TK5B 3JCML 3LGCA 3GX8A 4GSSA 4TXOB 2IMEA 4HS1A 1TTZA 1VF1A 3O6TA 1XOBA 1NM3A 4Q5RA 2VM2A 1M2DA 3I43A 2X8HA 5HFIA 3CTFA 1M2BA 2V2GA 1UA5A 2F8AA 11GSA 2MMNA 4XHMA 4IBPA 4NPBA 5ID2A 1GRXA 5DVBA 2H73A 1QMVA 2TRCP 1Z3EA 3C7MA 4K2DA 1TRVA 4BVXA 3I69A 5AGYA 2KP1A 1MDJA 3EYTA 3M3MA 1O85A 4IVFA 5ID2B 3GA4A 4RI7A 1V9WA 4L5LA 5FT3A 3GX0A 3L78A 4H86A 4Z7XA 1EGRA 2GZYA 4KDYA 1NW2A 4OO5A 5G5FA 2VLUA 2LJKA 2A4VA 1W89A 5F0GA 1U88A 4I8BA 1R7HA 1U87A 5FWGA 3W8SA 2CVDA 1JZWA 3DVXA 4K0GA 1T4ZA 5JWQB 3Q18A 1FG4A 1W4VA 2GT5A 4N10A 4ZIJA 5ECNB 1OYJA 1MDIA 2HFDA 3VURA 4ZILA 4MJCA 2X8GA 1GNWA 3F6FA 2VCZA 2PPTA 2IPAA 1TK0B 1PD21 3UEMA 4KGIA 1X5DA 3F3QA 2HYXA 1T00A 4IN0A 5ECOB 2HRFA 2QSIA 2NPBA 1AQXA 2E7PA 1T3BA 1U3AA 4K7IA 4MZWA 5B8BA 5F06A 2MBSA 3APSA 2FUG2 4XS6A 2DLXA 4GQFA 1K0CA 2V32A 3VWWA 3GH6A 2DC5A 1AAZA 2I1UA 2C8UA 4O32A 3HY2A 1ZYQB 2REMA 3P7XA 2B7KA 2F51A 3QAWA 1K0MA 3VPQA 4ECIA 1GH2A 2IJYA 2B1LA 1YKCA 4EE0A 3L4NA 5G31A 4OCFA 1F37A 1JHBA 5IMVA 2CQ9A 2NBSA 4OFMA 1B8XA 4L8EA 3IC4A 2H1AA 3FYGA 4PGTA 1ON4A 2C1YA 2H0IA 2WFCA 3QOUA 1FHEA 4F0BA 1SL1B 4KCAA 1SK1A 1T7PB 3LWAA 5DQSA 4KUNA 2P5QA 2QGVA 3M0FA 3GHAA 2E2MA 1TU8A 1J9BA 4KSMA 5ELGA 5ECQB 1SJZA 4J2FA 3CSIA 3C73A 3GUSA 2PBJA 3GKXA 19GSA 1OC9A 4XRAA 5HR1A 5AIVA 1PRXA 1XWAA 4QL7A 3F0IA 5G30A 4O92A 4GCIA 3UBLA 2LNTA 5HQPA 2VLTA 4IP1A 1OC9B 3GTUA 5AISA 1GSEA 5IMZA 12GSA 3LJRA 1O81A 2F3MA 4MZCA 2VCXA 2XBIA 1F9MA 5EPFA 2CT6A 2FWEA 2VCWA 3CBUA 1EOHA 3GTUB 4MMMA 1AC1A 2YV7A 2A2SA 4MA9A 4ZB8A 5IPHA 1Z5YE 2AV4A 3GNJA 1Z7RA 1O6JA 5E4WA 3H79A 2PU9C 4XS4A 5HFKA 2WDUA 1UC7A 1Q98A 2C0DA 1V98A 3OR5A 5KN1A 4KE3A 3KXOA 5A5KA 1FVJA 4YQMA 3TJGA 3LXZA 4XS4B 3LFLA 2PVOC 1SL2B 2MZCA 1X9MB 3H4KA 4OCEA 4CDOA 4RQXA 4WR5A 3ZLPA 4POMA 5HR3A 2PERA 2GTUA 2ZUPA 1BG5A 1GTUA 2FCHA 2H0GA 2C3NA 3HZ8A 1WRYA 1GSSA 4TOPA 4X43A 3IK9A 2N5AA 2WS2A 3QR6A 4JEDA 1ZGNA 4ML1A 1WWJA 2L5OA 2DJ3A 4MK3A 1OE7A 4TRXA 3W8JA 3P90A 3RPPA 1TP9A 2PN8A 4KNDA 5JCWA 1A2MA 4HJ2A 2LRNA 4BL7A 3GH9A 3FHKA 4JE1A 4V2LA 5EY6A 1PL1A 2VOCA 4YH2A 4O7HA 1GWCA 1F3AA 1XIYA 3HA9A 4Q5NA 5IMFA 6GSWA 3VK9A 2WRTA 2VD1A 2O87A 4EF0A 2CVKA 4JBBA 4AF2A 10GSA 1AQVA 4XCSA 3R2QA 3APQA 1OVNA 2KLXA 4GSNA 1PMTA 4N30A 2P5RA 3HVVA 4KB3A 4EKZA 2JL4A 9GSSA 3UVTA 1TI3A 4OD7A 2I9HA 1G6YA 2QC7A 2EIQA 1SK2A 4ZL8A 4MJBA 1GUKA 1WOUA 1NHYA 5D9TA 1K0OA 5KN2A 3A2VA 3HJPA 1SKWB 2L4QA 1GSQA 5J4UA 3EU3A 3BD2A 4PNGA 3DD3A 3D4TA 1XWBA 3TRQA 5AN1A 2YANA 6GSVA 2LNSA 1GSYA 3TJKA 2QKEA 2HI7A 4JZQA 1HD2A 4I2TA 3FR6A 2P0GA 4F0CA 3ZIVA 2DIZA 2XBQA 3GIXA 1M99A 3IHQA 3E9JB 3TGZA 1O8XA 1Z6MA 3ERWA 3LQ7A 2VUPA 3L9SA 3VFIA 4F9ZA 4HUAA 2H6XA 5J5NA 3UVHA 2C3QA 3D21A 4JU5A 4CHSA 1SENA 1PQNA 3L9VA 5IOXA 3N9JA 3DMLA 3G7JA 4NV5A 2M46A 1JFUA 2WB9A 2LTKA 2KUCA 3HKRA 2BTOT 2VL2A 4EDZA 5H5RA 1WP0A 1YDKA 4ZBAA 4TR0A 1B48A 2WZ9A 1X0RA 2Z9SA 2K18A 2OADA 5CRDA 2FWFA 3TKSC 1BX9A 1MD4A 1XPVA 3C71A 4JRRA 3ZREA 2YWNA 3CXGA 5LD0A 5GSSA 1C72A 3IAS2 4EVMA 3FK8A 3UAPA 1K3LA 4EDYA 3TJFA 2K9FA 4WR4A 1HNCA 3S9FA 3KM6A 1T8EB 1MD3A 2O85A 3UBKA 17GSA 1A8LA 1AUCA 2FGXA 2H71A 3RDWA 1XW9A 6GSXA 1TI1A 1NSWA 4MP4A 3EVIA 4XTSA 3F9UA 1JLVA 3E3EA 1SL0B 5IMCA 2DSAA 1H75A 4GSTA 4MF7A 2C0FA 3CRTA 2AYTA 3F3RA 2YCDA 2IMKA 3TKPA 4ZL7A 2YWMA 4ISDA 4KH7A 5B8AA 2L4CA 4TN8A 2LRTA 4DEJA 4IGJA 3VWVA 3KJYA 2YJ7A 1PSQA 1A2LA 3K8NA 2VIMA 4NHWA 3L9UA 4MJAA 3HJMA 1XWKA 4HZ2A 4NMUA 2N5FA 2O7KA 4YQUA 1R5PA 3DGQA 2HXKA 1DSBA 3MSZA 4K9ZA 4RQRA 1RW1A 2MMZA 2I4AA 3UJ1A 1SKSB 2PMTA 1SYRA 1A0FA 1MTCA 4I97A 4IW9A 5CRGA 5D9XA 2EIOA 3ZFLA 3GKMA 1PX6A 3HZ4A 3TB2A 5HR2A 1EV4A 2BJXA 2M80A 1FVKA 1BQ7A 4HU9A 4E8EA 3RAZA 5IMAA 1O7UA 3ZMLA 1G7EA 1LJRA 3P8WA 2YV9A 5ECSA 4PX1A 3D6IA 1HQOA 3FW2A 2O89A 1O73A 2VL3A 3CSHA 4IJIA 2HSHA 3V1WA 3FZAA 1I9DA 3GFKA 1OKDA 3RBTA 1QXHA 1N2AA 2BMXA 4IHUA 1WPIA 3FZ4A 3KGKA 1Z9HA 4HEA2 3IOSA 4L5OA 5G1KA 2L59A 3PINA 2DJKA 3DEXA 3ZVJA 1XVQA 4NHZA 2KP2A 5B6MA 1U3IA 2LJRA 4MPGA 1PL2A 1QGVA 3Q74A 3FRCA 2YZUA 1F3BA 2V6KA 3F4SA 5IO2A 2HSYA 3ZMKA 2FD3A 4J57E 2X64A 1VGLA 1XWGA 1GTAA 2OJLA 2E0QA 4ECJA 4HDEA 2PGTA 4V1Ag 5KEJA 1SK0A 14GSA 3G7IA 4ACSA 5FHIA 2X99A 3M9KA 4K8MA 4ECBA 1WIKA 3KMNA 3VI5A 5J41A 2JU5A 5A4UA 6GSSA 3TKQA 4DSRA 2OBKA 2HNLA 4FIWA 3QD9A 1XZOA 4XIHA 16GSA 5ELAA 4DVCA 4O5RA 1TRWA 2TRXA 3KTBA 1EWXA 3DRNA 1LU4A 2ON7A 3PH9A 3GL5A 4F82A 4YAPA 3UIWA 1F2EA 2XC2A 3GKNA 3WGDA 4TKYA 3F4TA 1UN2A 3FR3A 4IQAA 5DJMA 3IK7A 2YOIA 1YEPA 3DKSA 1EZKA 3F8UA 4WBJA 1XBSA 3NIVA 5H5SA 3HJOA 2FHEA 1WE0A 4EUYA 2ALBA 4DSSA 5CP1A 6GSTA 1XVWA 3HVSA 3KEBA 1J0FA 1H4OA 2FLSA 2WCIA 4Q5QA 3LYKA 3WYWA 1ACVA 2DJ0A 5LNKe 4KA0A 4ZB9A 3CTGA 2FWGA 4DSSB 2GS3A 4L0WA 1ML6A 3KP9A 1TU7A 4K0NA 2HZEA 2GQMA 1SKRB 3EMXA 5CAXA 18GSA 1Q4JA 4IP6A 4BA7A 3HYPA 2AUVA 3GMFA 1A2JA 2C0EA 2AJQB 5JCUA 2HZEB 4ULXA 2C0GA 5DJLA 3C1SA 20GSA 3ZYWA 2WULA 1GSFA 5G1LA 2IMDA 3QMXA 4OO4A 2C3TA 3DIEA 3VWUA 2YWOA 3GYKA 5CYYA 2LV3A 3A2WA 1PX7A 4N11A 2GSTA 2DJ1A 5CRHA 3TOUA 3GKKA 4LLRA 4XRDA 1JLWA 1TW9A 2EC4A 3UL3A 2GQKA 3Q19A 22GSA 1YEXA 2PVQA 2HT9A 3SBCA 5F07A 5ECHB 2I81A 4ID0A 4JR4A 2GT6A 4GLTA 4FO5A 4AJ6A 3KIJA 2ZNMA 1XCCA 3EE2A 4OFNA 1TOFA 2F8FA 2AB6A 4G2EA 2VCTA 4G19A 4KSOA 3TJJA 3WT1A 4KDXA 1G6WA 1X5EA 4MH3A 2B6MA 1A23A 3RHBA 1V57A 3ED3A 3IR4A 3QAGA 1J08A 3EINA 4OWYA 2C80A 2R6KA 3ZIJA 2MBTA 1AIUA 5DDLA 4AGSA 2H74A 3QFBC 1SYXA 4V2NA 4MH2A 1GTBA 1U6TA 2B5YA 3ZL5A 1KNGA 2A2RA 5AIXA 1OC3A 3QCPA 3HXSA 4RI6A 2PWJA 3DXBA 4JR6A 1M0UA 2R2JA 4FYCA 2GSQA 4MF6A 1FO5A 1GL8A 2R37A 5DCHA 1LBKA 3D4MA 1PKWA 3A2XA 4WBRD 2CV4A 2C4JA 4HJMA 3NOFA 1THXA 2K8SA 2RLIA 2H1GA 3ZTLA 1XFLA 3M9JA 4BWQA 5B7CA 1EOGA 3WGEA 1V58A 3LORA 4YQVA 1EP8A 4D73A 1ERTA 3FZ5A 3ME7A 4ZB6A 3CMIA 5D9WA 2DIYA 4KCEA 2FA4A 2VO4A 5EL8A 4KX4A 5JWOB 3VLNA 2JSZA 4D73B 1ZL9A 4POLA 1V40A 2H66A 3J7Yb 5CRWA 1CQHA 2RM5A 2J9HA 4PXOA 1T4YA 5D93A 4LL4B 2YNXA 3D0ZA 1Y25A 2O8VB 3PGTA 1A8YA 4WXTA 2CA8A 1K0BA 1M7TA 3C8EA 3TRPA 2FY6A 1K0DA 4I5QA 4POKA 5IPGA 1YZXA 1GLQA 5GZZB 2XPDA 3ZITA 4FYBA 4BPYA 4ILFA 2OA7A 4PNFA 1F6MC 3KCMA 2GVPA 1YQ1A 3GV1A 4TR3A 2VCQA 3P2AA 4HQSA 3W6GA 4MJEA 1FAAA 2GLRA 1TRSA 1YY7A
chains in the Genus database with same CATH superfamily
3D5JA 2H6YA 3TKSA 3KH9A 2YZHA 2GZPA 4NV2A 5H5QA 4HI7A 1PFOA 2JACA 5ENUA 2FWHA 5D8IA 4AJ7A 1G0TA 4BWSA 1E6BA 5D96A 2IN3A 2DMMA 1FW1A 4EC0A 3U5RE 4LL1B 4P3YB 3F63A 4LA1A 1JZOA 2DJJA 3FKFA 1OAZA 2AHEA 1ST9A 2ES7A 2B3SA 4WETA 1URMA 1TRUA 1M2AA 5IOWA 3LG6A 2IL3A 3MAKA 1PKZA 2JSYA 4ZBDA 5J9BA 1PN0A 1FOHA 4I6XA 4HOJA 5IIZA 4G0LA 3CSJA 1X9SB 2B1KA 4MABA 2G2QA 1XW6A 3TRXA 1VF4A 1AW9A 4POBA 2PUKC 2LJAA 3APOA 4TR1A 1R4WA 5DALA 1MEKA 4PUFC 4ZL9A 2CVBA 3QDNA 2X8CA 1A0RP 5IO0A 2WGRA 1KBNA 5C04A 4G0IA 5ECMB 1GSUA 3G9BA 1GNEA 2NVLA 4MF5A 1ZYEA 2MMAA 4TR1B 2FNOA 3RHCA 2XHFA 1EP7A 4G10A 5DALB 3ZVJD 3LXTA 5G5EA 1DBYA 1DE2A 3SWLA 4IELA 4WEYA 2H01A 4K6XA 1E2YA 5ABRA 3KD0A 1Z6NA 3IV4A 3F4RA 3WD6A 3F6DA 1TKDB 4TW5A 3IRAA 2JZSA 2HLSA 2JZRA 3BOAA 4K1FA 2N5BA 4K7OA 3ERGA 1ABAA 1EV9A 4Q5FA 1Z7PA 5J3RA 5HFGA 4TXVA 1AQWA 1XXUA 2H8LA 4CW9A 3MDKA 3MIXA 3NZNA 1XWCA 5KOXA 2YJHA 1B4PA 3C1RA 3VI7A 3G7YA 3GL3A 4RUVA 1M3JA 2I3YA 1IYIA 2GGTA 2NDOA 3EURA 2H70A 2GZZA 1B9YC 5DAKA 2RIIA 1THOA 1ZZYA 3QFAC 1M9AA 5F8BA 3E0UA 1SJ6A 2LUSA 1M9BA 2IFQA 5LCZA 1MDKA 1NHOA 1B9XC 3BCIA 2NTOA 5DAKB 4GF0A 4MPFA 4AJ8A 1ERUA 4PUAA 2YN1A 1TDIA 2CAQA 2IFQB 1SD8A 2H19A 3FR9A 3GURA 3TCOA 5GSTA 5KN3A 3EC3A 1YKAA 2B5XA 2RM6A 2D2ZA 2YPMA 2F9SA 2KHPA 1S3CA 2LS5A 4KAEA 4HSCX 1K0AA 2MYGA 2LRCA 4MZBA 2CAIA 2R3XA 2CX3A 1FB6A 3UARA 2H1BA 2XPEA 4HQZA 5IM9A 2R4VA 4EIPA 2B7JA 3EU4A 4X1UA 5ECKB 1BJXA 3CRUA 2JADA 3IA1A 3M8NA 1XW5A 4DSQA 3IXRA 3A5WA 2OACA 4LMWA 1A24A 2LQQA 2ON5A 4FYUA 2K8VA 3KH7A 2HZFA 4ML6A 2CZ2A 5ECIB 1Y6EA 4LMVA 3WT2A 3TUEA 1BEDA 2IMIA 2TIRA 4V2MA 2YP6A 1WJKA 1YF0A 2RUEA 4Z2RA 1SJIA 1HNBA 2VL9A 4IQ1A 3Q6OA 3GSTA 1GLPA 3HD5A 2VAFA 1QQ2A 1EEMA 3GN3A 5INYA 1GP1A 4GTUA 2H0HA 1K3OA 3LSZA 4NWYA 3ZZXA 1R5AA 4TVEA 4WKWA 3HHVA 3WGXA 4EL1A 1S3RA 1JZDA 3CQFA 4GQCA 5COHA 1QK8A 2L6DA 5A4VA 4E8HA 1R26A 1TXXA 2DBCA 5ECLB 4IKHA 5IQYA 4YKGA 3PR8A 2B5EA 4QL9A 1OE8A 13GSA 4I2UA 2YWIA 1ILOA 4OMVA 3FEUA 1TJDA 2V6OA 2HSMA 3GRXA 3LYPA 2GQLA 1XOAA 3ISOA 1ZYNA 2HRNA 2LKUA 4KW6A 5IMDA 3HDCA 3TJBA 5CO3A 5JWRB 3D22A 2VD0A 2WJUA 3BJ5A 5GAPD 1EEJA 1PN9A 1CQGA 5ECRB 1WMJA 3IBHA 1DE1A 1HNAA 2VM1A 1KEBA 3TOTA 1FB0A 1V2AA 3N5OA 3KP8A 4TR4A 5JCGA 4IS0A 2OE1A 3EMPA 1QFNA 8GSSA 3IAM2 3I9V2 2L6CA 2AAWA 3VWXA 2IIYA 4Z2UA 3MNGA 2L5LA 4PURA 3TKRA 5DQYA 1K0NA 1VF3A 4XS1A 1EGOA 5L71A 4G9HA 2EIRA 2MMOA 4MDCA 2OKAA 4MCUA 3IDVA 4YKFA 1S3DA 3ZRDA 4WF5A 1GTIA 4HU7A 4ZBBA 5DBQA 5B6NA 3MWHA 2KOKA 2H6ZA 3O3TA 1AXDA 4GWRA 4QQ7A 3QPMA 5KN0A 3U6VA 4K7NA 4KDUA 2HRAA 4EXJA 3IPZA 5CNWA 5D73A 1GSDA 1QUWA 3HVXA 5DCGA 3TKSE 3FY7A 1SD9A 4PQIA 2IMFA 4ECCA 1YJ6A 1UVZA 1X5CA 2DJ2A 1USBA 4X0XA 4ZXGA 3L0HA 2CZ3A 2IWTA 4USSA 5GAND 3US3A 1SU9A 4FH8A 1GUMA 4N0ZA 1ZOFA 3O76A 4GRFA 2LQOA 5D9VA 5ECPB 1KTEA 2CX4A 3ME8A 4NXIA 3M1GA 1ERWA 4A5PA 5HR0A 1ERVA 4GXZA 1S3AA 3RPNA 1O8WA 2DMLA 1HYUA 3KZQA 4J56E 4F03A 1ZCPA 4PQHA 6GSUA 1ZMAA 4F2IA 1VRSD 3QAVA 1IYHA 4L0UA 1JZRA 1OC8A 3ZFBA 3FZ9A 1PGTA 1B4QA 3UOMA 2OE3A 1RQMA 2VL2C 2H30A 5E59A 1RK4A 4MLYA 2G0FA 3HCZA 3LEFA 1GUHA 1BYEA 5G2ZA 2FA8A 4WF4A 1X9WB 4V1Ap 2P31A 5EVOA 3ERFA 3H1NA 2OE0A 2K6VA 1K3YA 3BCKA 5CREA 3I6AA 2VCVA 1T1VA 2H75A 3AY8A 2JZTA 5C00A 1BAYA 4IJ3A 1G7OA 4EO3A 2GSRA 5F05A 6GSYA 2GDRA 4BVYA 3CYNA 3DVWA 7GSSA 4G0KA 3VPTA 2H76A 3TDGA 2H72A 3IE3A 2L57A 3BBYA 1VF2A 2VLVA 1GULA 3H93A 3KTLA 1N8JA 2V41A 3H8QA 2V1MA 4BVYB 1OKTA 1PA3A 2GSSA 3GSSA 5A4WA 4HZ4A 5J9CA 4N0VA 3J7Yk 1DUGA 2M72A 2OBIA 3UMAA 2E2GA 3DYRA 2LSTA 1TK8B 2HE3A 4OFTA 1FOVA 4TXOA 2RUFA 2H1DA 3EWLA 1YF1A 3A3TA 3DWVA 3KMOA 2LEGA 2ZCTA 2R5GA 4YAVA 2DKIA 4PQ1A 1I5GA 2J23A 4NAXA 1TK5B 3JCML 3LGCA 3GX8A 4GSSA 4TXOB 2IMEA 4HS1A 1TTZA 1VF1A 3O6TA 1XOBA 1NM3A 4Q5RA 2VM2A 1M2DA 3I43A 2X8HA 5HFIA 3CTFA 1M2BA 2V2GA 1UA5A 2F8AA 11GSA 2MMNA 4XHMA 4IBPA 4NPBA 5ID2A 1GRXA 5DVBA 2H73A 1QMVA 2TRCP 1Z3EA 3C7MA 2UZ8A 4K2DA 4BIKA 1TRVA 4BVXA 3I69A 5AGYA 2KP1A 1MDJA 3EYTA 3M3MA 1O85A 4IVFA 5ID2B 3GA4A 4RI7A 1V9WA 4L5LA 5FT3A 3GX0A 3L78A 4BVXB 4H86A 4Z7XA 1EGRA 2GZYA 4KDYA 1NW2A 4OO5A 5G5FA 2VLUA 2LJKA 2A4VA 1W89A 5F0GA 1U88A 4I8BA 1R7HA 1U87A 5FWGA 3W8SA 2CVDA 1JZWA 3DVXA 4K0GA 1T4ZA 5JWQB 3Q18A 1FG4A 1W4VA 2GT5A 4N10A 4ZIJA 5ECNB 1OYJA 1MDIA 2HFDA 3VURA 4ZILA 4MJCA 2X8GA 1GNWA 3F6FA 2VCZA 2PPTA 2IPAA 1TK0B 1PD21 3UEMA 4KGIA 1X5DA 3F3QA 2HYXA 1T00A 4IN0A 5ECOB 2HRFA 2QSIA 2NPBA 1AQXA 2E7PA 1T3BA 1U3AA 4K7IA 4MZWA 5B8BA 2R0GA 5F06A 2MBSA 3APSA 2FUG2 4XS6A 2DLXA 4GQFA 1K0CA 2V32A 3VWWA 3GH6A 4K5SA 2DC5A 1AAZA 2I1UA 2C8UA 4O32A 3HY2A 1ZYQB 2REMA 3P7XA 2B7KA 2F51A 3QAWA 1K0MA 3VPQA 4ECIA 1GH2A 2IJYA 2B1LA 1YKCA 4EE0A 3L4NA 4O5QA 5G31A 4OCFA 1F37A 1JHBA 5IMVA 2CQ9A 2NBSA 4OFMA 1B8XA 4L8EA 3IC4A 2H1AA 3FYGA 4PGTA 1ON4A 2C1YA 2H0IA 2WFCA 3QOUA 1FHEA 4F0BA 1SL1B 4KCAA 1SK1A 1T7PB 3LWAA 5DQSA 4KUNA 2P5QA 2QGVA 3M0FA 3GHAA 2E2MA 1TU8A 1J9BA 4KSMA 5ELGA 5ECQB 1SJZA 4J2FA 3CSIA 3C73A 3GUSA 2PBJA 3GKXA 19GSA 1OC9A 4XRAA 5HR1A 5AIVA 1PRXA 1XWAA 4QL7A 3F0IA 5G30A 4O92A 4GCIA 3UBLA 2LNTA 5HQPA 2VLTA 4IP1A 1OC9B 3GTUA 5AISA 1GSEA 5IMZA 12GSA 3LJRA 1O81A 2F3MA 4MZCA 2VCXA 2XBIA 1F9MA 5EPFA 2CT6A 2FWEA 2VCWA 3CBUA 1EOHA 3GTUB 1ZYPA 4MMMA 1AC1A 2YV7A 2A2SA 4MA9A 4ZB8A 5IPHA 1Z5YE 2AV4A 3GNJA 1Z7RA 1O6JA 5E4WA 3H79A 2PU9C 4XS4A 5HFKA 2WDUA 1UC7A 1Q98A 2C0DA 1V98A 3OR5A 5KN1A 4KE3A 3KXOA 5A5KA 1FVJA 4YQMA 3TJGA 3LXZA 4XS4B 3LFLA 2PVOC 1SL2B 2MZCA 1X9MB 3H4KA 4OCEA 4CDOA 4RQXA 4WR5A 3ZLPA 2DKHA 4POMA 5HR3A 2PERA 2GTUA 2ZUPA 1BG5A 1GTUA 2FCHA 2H0GA 2C3NA 3HZ8A 1WRYA 1GSSA 4TOPA 4X43A 3IK9A 2N5AA 2WS2A 3QR6A 4JEDA 1ZGNA 4ML1A 1WWJA 2L5OA 2DJ3A 4MK3A 1OE7A 4TRXA 3W8JA 3P90A 3RPPA 1TP9A 2PN8A 4KNDA 5JCWA 1A2MA 4HJ2A 2LRNA 4BL7A 3GH9A 3FHKA 4JE1A 4V2LA 5EY6A 1PL1A 2VOCA 4YH2A 4O7HA 1GWCA 1F3AA 1XIYA 3HA9A 4Q5NA 5IMFA 6GSWA 3VK9A 2WRTA 2VD1A 2O87A 4BL7B 4EF0A 2CVKA 4JBBA 4AF2A 10GSA 1AQVA 4XCSA 3R2QA 3APQA 1OVNA 2KLXA 4GSNA 1PMTA 2X49A 4N30A 2P5RA 3HVVA 4KB3A 4EKZA 2JL4A 9GSSA 3UVTA 1TI3A 4OD7A 2I9HA 5BMUA 1G6YA 2QC7A 2EIQA 1SK2A 4ZL8A 4MJBA 1GUKA 1WOUA 2QA2A 1NHYA 5D9TA 1K0OA 5KN2A 3A2VA 3HJPA 1SKWB 2L4QA 1GSQA 5J4UA 3EU3A 3BD2A 4PNGA 3DD3A 3D4TA 1XWBA 3TRQA 5AN1A 2YANA 6GSVA 2LNSA 1GSYA 3TJKA 2QKEA 2HI7A 4JZQA 1HD2A 4I2TA 3FR6A 2P0GA 4F0CA 3ZIVA 2DIZA 2XBQA 3GIXA 1M99A 3IHQA 1XG8A 3E9JB 3TGZA 1O8XA 1Z6MA 3ERWA 3LQ7A 2VUPA 3L9SA 3VFIA 4F9ZA 4HUAA 2H6XA 5J5NA 3UVHA 2C3QA 3D21A 4JU5A 4CHSA 1SENA 1PQNA 3L9VA 5IOXA 2A2PA 3N9JA 3DMLA 3G7JA 4NV5A 2M46A 1JFUA 2WB9A 2LTKA 4KF9A 2KUCA 3HKRA 2BTOT 2VL2A 4EDZA 5H5RA 1WP0A 4ICYA 1YDKA 4ZBAA 4TR0A 1B48A 2WZ9A 1X0RA 2Z9SA 2K18A 2OADA 5CRDA 2FWFA 3TKSC 1BX9A 1MD4A 1XPVA 3C71A 4JRRA 3ZREA 2YWNA 3CXGA 5LD0A 5GSSA 1C72A 2R0CA 3IAS2 4EVMA 3FK8A 3UAPA 1K3LA 4EDYA 3TJFA 2K9FA 3MYDA 4WR4A 1HNCA 3S9FA 3KM6A 1T8EB 1MD3A 2O85A 3UBKA 17GSA 1A8LA 1AUCA 2FGXA 2H71A 3RDWA 1XW9A 6GSXA 1TI1A 1NSWA 4MP4A 3EVIA 4XTSA 3F9UA 1JLVA 3E3EA 1SL0B 5IMCA 2DSAA 1H75A 4GSTA 4MF7A 2C0FA 3CRTA 2AYTA 3F3RA 2YCDA 2IMKA 3TKPA 4ZL7A 2YWMA 4ISDA 4KH7A 5B8AA 2L4CA 4TN8A 2LRTA 4DEJA 4IGJA 3VWVA 3KJYA 2YJ7A 1PSQA 1A2LA 3K8NA 2VIMA 4NHWA 3L9UA 4MJAA 3HJMA 4K5RA 1XWKA 4HZ2A 4NMUA 2N5FA 2O7KA 4YQUA 1R5PA 3DGQA 2HXKA 1DSBA 3MSZA 4K9ZA 4RQRA 1RW1A 2MMZA 2I4AA 3UJ1A 1SKSB 2PMTA 1SYRA 1A0FA 1MTCA 4PTSA 4I97A 4IW9A 5CRGA 5D9XA 4Z2TA 4K2XA 2EIOA 3ZFLA 3GKMA 1PX6A 3HZ4A 3TB2A 5HR2A 1EV4A 2BJXA 2M80A 1FVKA 1BQ7A 4HU9A 4E8EA 3RAZA 5IMAA 1O7UA 3ZMLA 1G7EA 1LJRA 3P8WA 2YV9A 5ECSA 4PX1A 3D6IA 1HQOA 3FW2A 2O89A 1O73A 2VL3A 3CSHA 4IJIA 2HSHA 3EPTA 3V1WA 3FZAA 1I9DA 3GFKA 1OKDA 3RBTA 1QXHA 1N2AA 2BMXA 4IHUA 2R0PA 1WPIA 3FZ4A 3KGKA 1Z9HA 4HEA2 3IOSA 4L5OA 5G1KA 2L59A 3PINA 2DJKA 3DEXA 3ZVJA 1XVQA 4NHZA 2KP2A 3FMWA 5B6MA 1U3IA 2LJRA 4MPGA 1PL2A 1QGVA 3Q74A 4CY8A 3FRCA 2YZUA 1F3BA 2V6KA 3F4SA 5IO2A 2HSYA 5KOWA 3ZMKA 2FD3A 4J57E 2X64A 1VGLA 1XWGA 1GTAA 2OJLA 2E0QA 4ECJA 4HDEA 2PGTA 4V1Ag 2X4AA 5KEJA 1SK0A 14GSA 3G7IA 4ACSA 5FHIA 2X99A 3M9KA 4K8MA 4ECBA 1WIKA 3KMNA 3VI5A 5J41A 2JU5A 5A4UA 6GSSA 3TKQA 4DSRA 2OBKA 2HNLA 4FIWA 3LW9A 3QD9A 1XZOA 4XIHA 2HRKA 16GSA 5ELAA 4DVCA 4O5RA 1TRWA 2TRXA 3KTBA 1EWXA 3DRNA 1LU4A 2ON7A 3PH9A 3GL5A 4F82A 4YAPA 3UIWA 1F2EA 2XC2A 3GKNA 3WGDA 4TKYA 4EIQA 3F4TA 1UN2A 3FR3A 4IQAA 5DJMA 3IK7A 2YOIA 1YEPA 3DKSA 1EZKA 3F8UA 4WBJA 1XBSA 3NIVA 5H5SA 3HJOA 2FHEA 1WE0A 4EUYA 2ALBA 4DSSA 5CP1A 6GSTA 1XVWA 3HVSA 4FQUA 3KEBA 1J0FA 1H4OA 3R3EA 2FLSA 2WCIA 4Q5QA 3LYKA 3WYWA 1ACVA 2DJ0A 5LNKe 4KA0A 4ZB9A 3CTGA 2FWGA 4DSSB 2GS3A 4L0WA 1ML6A 3KP9A 1TU7A 4K0NA 2HZEA 2GQMA 1SKRB 3EMXA 5CAXA 18GSA 1Q4JA 4IP6A 4BA7A 3HYPA 2AUVA 3GMFA 1A2JA 2C0EA 2AJQB 5JCUA 2HZEB 4X4JA 4ULXA 2C0GA 5DJLA 3C1SA 20GSA 3ZYWA 2WULA 1GSFA 5G1LA 2IMDA 3QMXA 4OO4A 2C3TA 3DIEA 3VWUA 2YWOA 3GYKA 5CYYA 2LV3A 3A2WA 1PX7A 4N11A 2GSTA 2DJ1A 5CRHA 3TOUA 3GKKA 4LLRA 4XRDA 1JLWA 1TW9A 2EC4A 3UL3A 2GQKA 3Q19A 22GSA 1YEXA 2PVQA 2HT9A 3SBCA 5F07A 5ECHB 2I81A 4ID0A 4JR4A 2GT6A 4GLTA 4FO5A 4AJ6A 3KIJA 2ZNMA 1XCCA 3EE2A 4OFNA 1TOFA 2F8FA 2A4HA 2AB6A 4G2EA 2VCTA 4G19A 4KSOA 3TJJA 3WT1A 4KDXA 1G6WA 1X5EA 4MH3A 2B6MA 1A23A 3RHBA 1V57A 3ED3A 3IR4A 3QAGA 1J08A 3EINA 4MNNA 4OWYA 2C80A 2R6KA 3ZIJA 2MBTA 1AIUA 5DDLA 4AGSA 2H74A 3QFBC 1SYXA 4V2NA 4MH2A 1GTBA 1U6TA 2B5YA 3ZL5A 1KNGA 2A2RA 3IC8A 5AIXA 1OC3A 3QCPA 3HXSA 4RI6A 2PWJA 5BRTA 3DXBA 4JR6A 1M0UA 2R2JA 4FYCA 2GSQA 4MF6A 1FO5A 1GL8A 2R37A 5DCHA 1LBKA 3D4MA 1PKWA 3A2XA 4WBRD 2CV4A 2C4JA 4HJMA 3NOFA 1THXA 2K8SA 2RLIA 2H1GA 3HVNA 3A5IA 3ZTLA 1XFLA 3M9JA 4BWQA 5B7CA 4CY6A 1EOGA 3WGEA 1V58A 3LORA 4YQVA 1EP8A 4D73A 1ERTA 3FZ5A 3ME7A 4ZB6A 3CMIA 5D9WA 2DIYA 4KCEA 2FA4A 2VO4A 5EL8A 4KX4A 5JWOB 3VLNA 2JSZA 4D73B 1ZL9A 3IHGA 4POLA 1V40A 2H66A 3J7Yb 5CRWA 1CQHA 2RM5A 2J9HA 4PXOA 1T4YA 5D93A 4LL4B 2YNXA 3D0ZA 1Y25A 2O8VB 3PGTA 1A8YA 4WXTA 2CA8A 1K0BA 1M7TA 3C8EA 3TRPA 2FY6A 1K0DA 4I5QA 4POKA 5IPGA 1YZXA 2QA1A 1GLQA 5GZZB 2XPDA 3ZITA 4FYBA 4BPYA 4ILFA 2OA7A 4PNFA 1F6MC 4O5UA 3KCMA 1M3IA 2GVPA 3PPUA 1YQ1A 3GV1A 4TR3A 2VCQA 3P2AA 4HQSA 3W6GA 4MJEA 1FAAA 2GLRA 1TRSA 1YY7A
chains in the Genus database with same CATH topology
3D5JA 2H6YA 3TKSA 3KH9A 2YZHA 2GZPA 4NV2A 5H5QA 4HI7A 2JACA 5ENUA 2FWHA 5D8IA 4AJ7A 1G0TA 4BWSA 1E6BA 5D96A 2IN3A 2DMMA 1FW1A 4EC0A 3U5RE 4LL1B 4P3YB 3F63A 4LA1A 1JZOA 2DJJA 3FKFA 1OAZA 2AHEA 1ST9A 2ES7A 2B3SA 4WETA 1URMA 1TRUA 1M2AA 5IOWA 3LG6A 2IL3A 3MAKA 1PKZA 2JSYA 4ZBDA 5J9BA 1PN0A 1FOHA 4I6XA 4HOJA 5IIZA 4G0LA 3CSJA 1X9SB 2B1KA 4MABA 2G2QA 1XW6A 3TRXA 1VF4A 1AW9A 4POBA 2PUKC 2LJAA 3APOA 4TR1A 1R4WA 5DALA 1MEKA 4PUFC 4ZL9A 2CVBA 3QDNA 2X8CA 1A0RP 5IO0A 2WGRA 1KBNA 5C04A 4G0IA 5ECMB 1GSUA 3G9BA 1GNEA 2NVLA 4MF5A 1ZYEA 2MMAA 4TR1B 2FNOA 3RHCA 2XHFA 1EP7A 4G10A 5DALB 3ZVJD 3LXTA 5G5EA 1DBYA 1DE2A 3SWLA 4IELA 4WEYA 2H01A 4K6XA 1E2YA 5ABRA 3KD0A 1Z6NA 3IV4A 3F4RA 3WD6A 3F6DA 1TKDB 4TW5A 3IRAA 2JZSA 2HLSA 2JZRA 3BOAA 4K1FA 2N5BA 4K7OA 3ERGA 1ABAA 1EV9A 4Q5FA 1Z7PA 5J3RA 5HFGA 4TXVA 1AQWA 1XXUA 2H8LA 4CW9A 3MDKA 3MIXA 3NZNA 1XWCA 5KOXA 2YJHA 1B4PA 3C1RA 3VI7A 3G7YA 3GL3A 4RUVA 2I3YA 1IYIA 2GGTA 2NDOA 3EURA 2H70A 2GZZA 1B9YC 5DAKA 2RIIA 1THOA 1ZZYA 3QFAC 1M9AA 5F8BA 3E0UA 1SJ6A 2LUSA 1M9BA 2IFQA 5LCZA 1MDKA 1NHOA 1B9XC 3BCIA 2NTOA 5DAKB 4GF0A 4MPFA 4AJ8A 1ERUA 4PUAA 2YN1A 1TDIA 2CAQA 2IFQB 1SD8A 2H19A 3FR9A 3GURA 3TCOA 5GSTA 5KN3A 3EC3A 1YKAA 2B5XA 2RM6A 2D2ZA 2YPMA 2F9SA 2KHPA 1S3CA 2LS5A 4KAEA 1K0AA 2MYGA 2LRCA 4MZBA 2CAIA 2R3XA 2CX3A 1FB6A 3UARA 2H1BA 2XPEA 4HQZA 5IM9A 2R4VA 4EIPA 2B7JA 3EU4A 4X1UA 5ECKB 1BJXA 3CRUA 2JADA 3IA1A 3M8NA 1XW5A 4DSQA 3IXRA 3A5WA 2OACA 4LMWA 1A24A 2LQQA 2ON5A 4FYUA 2K8VA 3KH7A 2HZFA 4ML6A 2CZ2A 5ECIB 1Y6EA 4LMVA 3WT2A 3TUEA 1BEDA 2IMIA 2TIRA 4V2MA 2YP6A 1WJKA 1YF0A 2RUEA 4Z2RA 1SJIA 1HNBA 2VL9A 4IQ1A 3Q6OA 3GSTA 1GLPA 3HD5A 2VAFA 1QQ2A 1EEMA 3GN3A 5INYA 1GP1A 4GTUA 2H0HA 1K3OA 3LSZA 4NWYA 3ZZXA 1R5AA 4TVEA 4WKWA 3HHVA 3WGXA 4EL1A 1JZDA 4GQCA 5COHA 1QK8A 2L6DA 5A4VA 4E8HA 1R26A 1TXXA 2DBCA 5ECLB 4IKHA 5IQYA 4YKGA 3PR8A 2B5EA 4QL9A 1OE8A 13GSA 4I2UA 2YWIA 1ILOA 4OMVA 3FEUA 1TJDA 2V6OA 2HSMA 3GRXA 3LYPA 2GQLA 1XOAA 3ISOA 1ZYNA 2HRNA 2LKUA 4KW6A 5IMDA 3HDCA 3TJBA 5CO3A 5JWRB 3D22A 2VD0A 2WJUA 3BJ5A 5GAPD 1EEJA 1PN9A 1CQGA 5ECRB 1WMJA 3IBHA 1DE1A 1HNAA 2VM1A 1KEBA 3TOTA 1FB0A 1V2AA 3N5OA 3KP8A 4TR4A 5JCGA 4IS0A 2OE1A 3EMPA 1QFNA 8GSSA 3IAM2 3I9V2 2L6CA 2AAWA 3VWXA 2IIYA 4Z2UA 3MNGA 2L5LA 4PURA 3TKRA 5DQYA 1K0NA 1VF3A 4XS1A 1EGOA 5L71A 4G9HA 2EIRA 2MMOA 4MDCA 2OKAA 4MCUA 3IDVA 4YKFA 1S3DA 3ZRDA 4WF5A 1GTIA 4HU7A 4ZBBA 5DBQA 5B6NA 3MWHA 2KOKA 2H6ZA 3O3TA 1AXDA 4GWRA 4QQ7A 3QPMA 5KN0A 3U6VA 4K7NA 4KDUA 2HRAA 4EXJA 3IPZA 5CNWA 5D73A 1GSDA 1QUWA 3HVXA 5DCGA 3TKSE 3FY7A 1SD9A 4PQIA 2IMFA 4ECCA 1YJ6A 1UVZA 1X5CA 2DJ2A 1USBA 4X0XA 4ZXGA 3L0HA 2CZ3A 2IWTA 4USSA 5GAND 3US3A 1SU9A 4FH8A 1GUMA 4N0ZA 1ZOFA 3O76A 4GRFA 2LQOA 5D9VA 5ECPB 1KTEA 2CX4A 3ME8A 4NXIA 3M1GA 1ERWA 4A5PA 5HR0A 1ERVA 4GXZA 1S3AA 3RPNA 1O8WA 2DMLA 1HYUA 3KZQA 4J56E 4F03A 1ZCPA 4PQHA 6GSUA 1ZMAA 4F2IA 1VRSD 3QAVA 1IYHA 4L0UA 1JZRA 1OC8A 3ZFBA 3FZ9A 1PGTA 1B4QA 3UOMA 2OE3A 1RQMA 2VL2C 2H30A 5E59A 1RK4A 4MLYA 2G0FA 3HCZA 3LEFA 1GUHA 1BYEA 5G2ZA 2FA8A 4WF4A 1X9WB 4V1Ap 2P31A 5EVOA 3ERFA 3H1NA 2OE0A 2K6VA 1K3YA 3BCKA 5CREA 3I6AA 2VCVA 1T1VA 2H75A 3AY8A 2JZTA 5C00A 1BAYA 4IJ3A 1G7OA 4EO3A 2GSRA 5F05A 6GSYA 2GDRA 4BVYA 3CYNA 3DVWA 7GSSA 4G0KA 3VPTA 2H76A 3TDGA 2H72A 3IE3A 2L57A 3BBYA 1VF2A 2VLVA 1GULA 3H93A 3KTLA 1N8JA 2V41A 3H8QA 2V1MA 4BVYB 1OKTA 1PA3A 2GSSA 3GSSA 5A4WA 4HZ4A 5J9CA 4N0VA 3J7Yk 1DUGA 2M72A 2OBIA 3UMAA 2E2GA 3DYRA 2LSTA 1TK8B 2HE3A 4OFTA 1FOVA 4TXOA 2RUFA 2H1DA 3EWLA 1YF1A 3A3TA 3DWVA 3KMOA 2LEGA 2ZCTA 2R5GA 4YAVA 2DKIA 4PQ1A 1I5GA 2J23A 4NAXA 1TK5B 3JCML 3LGCA 3GX8A 4GSSA 4TXOB 2IMEA 4HS1A 1TTZA 1VF1A 3O6TA 1XOBA 1NM3A 4Q5RA 2VM2A 1M2DA 3I43A 2X8HA 5HFIA 3CTFA 1M2BA 2V2GA 1UA5A 2F8AA 11GSA 2MMNA 4XHMA 4IBPA 4NPBA 5ID2A 1GRXA 5DVBA 2H73A 1QMVA 2TRCP 1Z3EA 3C7MA 2UZ8A 4K2DA 1TRVA 4BVXA 3I69A 5AGYA 2KP1A 1MDJA 3EYTA 3M3MA 1O85A 4IVFA 5ID2B 3GA4A 4RI7A 1V9WA 4L5LA 5FT3A 3GX0A 3L78A 4BVXB 4H86A 4Z7XA 1EGRA 2GZYA 4KDYA 1NW2A 4OO5A 5G5FA 2VLUA 2LJKA 2A4VA 1W89A 5F0GA 1U88A 4I8BA 1R7HA 1U87A 5FWGA 3W8SA 2CVDA 1JZWA 3DVXA 4K0GA 1T4ZA 5JWQB 3Q18A 1FG4A 1W4VA 2GT5A 4N10A 4ZIJA 5ECNB 1OYJA 1MDIA 2HFDA 3VURA 4ZILA 4MJCA 2X8GA 1GNWA 3F6FA 2VCZA 2PPTA 2IPAA 1TK0B 1PD21 3UEMA 4KGIA 1X5DA 3F3QA 2HYXA 1T00A 4IN0A 5ECOB 2HRFA 2QSIA 2NPBA 1AQXA 2E7PA 1T3BA 1U3AA 4K7IA 4MZWA 5B8BA 2R0GA 5F06A 2MBSA 3APSA 2FUG2 4XS6A 2DLXA 4GQFA 1K0CA 2V32A 3VWWA 3GH6A 4K5SA 2DC5A 1AAZA 2I1UA 2C8UA 4O32A 3HY2A 1ZYQB 2REMA 3P7XA 2B7KA 2F51A 3QAWA 1K0MA 3VPQA 4ECIA 1GH2A 2IJYA 2B1LA 1YKCA 4EE0A 3L4NA 4O5QA 5G31A 4OCFA 1F37A 1JHBA 5IMVA 2CQ9A 2NBSA 4OFMA 1B8XA 4L8EA 3IC4A 2H1AA 3FYGA 4PGTA 1ON4A 2C1YA 2H0IA 2WFCA 3QOUA 1FHEA 4F0BA 1SL1B 4KCAA 1SK1A 1T7PB 3LWAA 5DQSA 4KUNA 2P5QA 2QGVA 3M0FA 3GHAA 2E2MA 1TU8A 1J9BA 4KSMA 5ELGA 5ECQB 1SJZA 4J2FA 3CSIA 3C73A 3GUSA 2PBJA 3GKXA 19GSA 1OC9A 4XRAA 5HR1A 5AIVA 1PRXA 1XWAA 4QL7A 3F0IA 5G30A 4O92A 4GCIA 3UBLA 2LNTA 5HQPA 2VLTA 4IP1A 1OC9B 3GTUA 5AISA 1GSEA 5IMZA 12GSA 3LJRA 1O81A 2F3MA 4MZCA 2VCXA 2XBIA 1F9MA 5EPFA 2CT6A 2FWEA 2VCWA 3CBUA 1EOHA 3GTUB 1ZYPA 4MMMA 1AC1A 2YV7A 2A2SA 4MA9A 4ZB8A 5IPHA 1Z5YE 2AV4A 3GNJA 1Z7RA 1O6JA 5E4WA 3H79A 2PU9C 4XS4A 5HFKA 2WDUA 1UC7A 1Q98A 2C0DA 1V98A 3OR5A 5KN1A 4KE3A 3KXOA 5A5KA 1FVJA 4YQMA 3TJGA 3LXZA 4XS4B 3LFLA 2PVOC 1SL2B 2MZCA 1X9MB 3H4KA 4OCEA 4CDOA 4RQXA 4WR5A 3ZLPA 2DKHA 4POMA 5HR3A 2PERA 2GTUA 2ZUPA 1BG5A 1GTUA 2FCHA 2H0GA 2C3NA 3HZ8A 1WRYA 1GSSA 4TOPA 4X43A 3IK9A 2N5AA 2WS2A 3QR6A 4JEDA 1ZGNA 4ML1A 1WWJA 2L5OA 2DJ3A 4MK3A 1OE7A 4TRXA 3W8JA 3P90A 3RPPA 1TP9A 2PN8A 4KNDA 5JCWA 1A2MA 4HJ2A 2LRNA 4BL7A 3GH9A 3FHKA 4JE1A 4V2LA 5EY6A 1PL1A 2VOCA 4YH2A 4O7HA 1GWCA 1F3AA 1XIYA 3HA9A 4Q5NA 5IMFA 6GSWA 3VK9A 2WRTA 2VD1A 2O87A 4BL7B 4EF0A 2CVKA 4JBBA 4AF2A 10GSA 1AQVA 4XCSA 3R2QA 3APQA 1OVNA 2KLXA 4GSNA 1PMTA 2X49A 4N30A 2P5RA 3HVVA 4KB3A 4EKZA 2JL4A 9GSSA 3UVTA 1TI3A 4OD7A 2I9HA 5BMUA 1G6YA 2QC7A 2EIQA 1SK2A 4ZL8A 4MJBA 1GUKA 1WOUA 2QA2A 1NHYA 5D9TA 1K0OA 5KN2A 3A2VA 3HJPA 1SKWB 2L4QA 1GSQA 5J4UA 3EU3A 3BD2A 4PNGA 3DD3A 3D4TA 1XWBA 3TRQA 5AN1A 2YANA 6GSVA 2LNSA 1GSYA 3TJKA 2QKEA 2HI7A 4JZQA 1HD2A 4I2TA 3FR6A 2P0GA 4F0CA 3ZIVA 2DIZA 2XBQA 3GIXA 1M99A 3IHQA 3E9JB 3TGZA 1O8XA 1Z6MA 3ERWA 3LQ7A 2VUPA 3L9SA 3VFIA 4F9ZA 4HUAA 2H6XA 5J5NA 3UVHA 2C3QA 3D21A 4JU5A 4CHSA 1SENA 1PQNA 3L9VA 5IOXA 2A2PA 3N9JA 3DMLA 3G7JA 4NV5A 2M46A 1JFUA 2WB9A 2LTKA 4KF9A 2KUCA 3HKRA 2BTOT 2VL2A 4EDZA 5H5RA 1WP0A 4ICYA 1YDKA 4ZBAA 4TR0A 1B48A 2WZ9A 1X0RA 2Z9SA 2K18A 2OADA 5CRDA 2FWFA 3TKSC 1BX9A 1MD4A 1XPVA 3C71A 4JRRA 3ZREA 2YWNA 3CXGA 5LD0A 5GSSA 1C72A 2R0CA 3IAS2 4EVMA 3FK8A 3UAPA 1K3LA 4EDYA 3TJFA 2K9FA 3MYDA 4WR4A 1HNCA 3S9FA 3KM6A 1T8EB 1MD3A 2O85A 3UBKA 17GSA 1A8LA 1AUCA 2FGXA 2H71A 3RDWA 1XW9A 6GSXA 1TI1A 1NSWA 4MP4A 3EVIA 4XTSA 3F9UA 1JLVA 3E3EA 1SL0B 5IMCA 2DSAA 1H75A 4GSTA 4MF7A 2C0FA 3CRTA 2AYTA 3F3RA 2YCDA 2IMKA 3TKPA 4ZL7A 2YWMA 4ISDA 4KH7A 5B8AA 2L4CA 4TN8A 2LRTA 4DEJA 4IGJA 3VWVA 3KJYA 2YJ7A 1PSQA 1A2LA 3K8NA 2VIMA 4NHWA 3L9UA 4MJAA 3HJMA 4K5RA 1XWKA 4HZ2A 4NMUA 2N5FA 2O7KA 4YQUA 1R5PA 3DGQA 2HXKA 1DSBA 3MSZA 4K9ZA 4RQRA 1RW1A 2MMZA 2I4AA 3UJ1A 1SKSB 2PMTA 1SYRA 1A0FA 1MTCA 4PTSA 4I97A 4IW9A 5CRGA 5D9XA 4Z2TA 4K2XA 2EIOA 3ZFLA 3GKMA 1PX6A 3HZ4A 3TB2A 5HR2A 1EV4A 2BJXA 2M80A 1FVKA 1BQ7A 4HU9A 4E8EA 3RAZA 5IMAA 1O7UA 3ZMLA 1G7EA 1LJRA 3P8WA 2YV9A 5ECSA 4PX1A 3D6IA 1HQOA 3FW2A 2O89A 1O73A 2VL3A 3CSHA 4IJIA 2HSHA 3EPTA 3V1WA 3FZAA 1I9DA 3GFKA 1OKDA 3RBTA 1QXHA 1N2AA 2BMXA 4IHUA 2R0PA 1WPIA 3FZ4A 3KGKA 1Z9HA 4HEA2 3IOSA 4L5OA 5G1KA 2L59A 3PINA 2DJKA 3DEXA 3ZVJA 1XVQA 4NHZA 2KP2A 3FMWA 5B6MA 1U3IA 2LJRA 4MPGA 1PL2A 1QGVA 3Q74A 4CY8A 3FRCA 2YZUA 1F3BA 2V6KA 3F4SA 5IO2A 2HSYA 5KOWA 3ZMKA 2FD3A 4J57E 2X64A 1VGLA 1XWGA 1GTAA 2OJLA 2E0QA 4ECJA 4HDEA 2PGTA 4V1Ag 2X4AA 5KEJA 1SK0A 14GSA 3G7IA 4ACSA 5FHIA 2X99A 3M9KA 4K8MA 4ECBA 1WIKA 3KMNA 3VI5A 5J41A 2JU5A 5A4UA 6GSSA 3TKQA 4DSRA 2OBKA 2HNLA 4FIWA 3LW9A 3QD9A 1XZOA 4XIHA 2HRKA 16GSA 5ELAA 4DVCA 4O5RA 1TRWA 2TRXA 3KTBA 1EWXA 3DRNA 1LU4A 2ON7A 3PH9A 3GL5A 4F82A 4YAPA 3UIWA 1F2EA 2XC2A 3GKNA 3WGDA 4TKYA 4EIQA 3F4TA 1UN2A 3FR3A 4IQAA 5DJMA 3IK7A 2YOIA 1YEPA 3DKSA 1EZKA 3F8UA 4WBJA 1XBSA 3NIVA 5H5SA 3HJOA 2FHEA 1WE0A 4EUYA 2ALBA 4DSSA 5CP1A 6GSTA 1XVWA 3HVSA 4FQUA 3KEBA 1J0FA 1H4OA 3R3EA 2FLSA 2WCIA 4Q5QA 3LYKA 3WYWA 1ACVA 2DJ0A 5LNKe 4KA0A 4ZB9A 3CTGA 2FWGA 4DSSB 2GS3A 4L0WA 1ML6A 3KP9A 1TU7A 4K0NA 2HZEA 2GQMA 1SKRB 3EMXA 5CAXA 18GSA 1Q4JA 4IP6A 4BA7A 3HYPA 2AUVA 3GMFA 1A2JA 2C0EA 2AJQB 5JCUA 2HZEB 4X4JA 4ULXA 2C0GA 5DJLA 3C1SA 20GSA 3ZYWA 2WULA 1GSFA 5G1LA 2IMDA 3QMXA 4OO4A 2C3TA 3DIEA 3VWUA 2YWOA 3GYKA 5CYYA 2LV3A 3A2WA 1PX7A 4N11A 2GSTA 2DJ1A 5CRHA 3TOUA 3GKKA 4LLRA 4XRDA 1JLWA 1TW9A 2EC4A 3UL3A 2GQKA 3Q19A 22GSA 1YEXA 2PVQA 2HT9A 3SBCA 5F07A 5ECHB 2I81A 4ID0A 4JR4A 2GT6A 4GLTA 4FO5A 4AJ6A 3KIJA 2ZNMA 1XCCA 3EE2A 4OFNA 1TOFA 2F8FA 2A4HA 2AB6A 4G2EA 2VCTA 4G19A 4KSOA 3TJJA 3WT1A 4KDXA 1G6WA 1X5EA 4MH3A 2B6MA 1A23A 3RHBA 1V57A 3ED3A 3IR4A 3QAGA 1J08A 3EINA 4MNNA 4OWYA 2C80A 2R6KA 3ZIJA 2MBTA 1AIUA 5DDLA 4AGSA 2H74A 3QFBC 1SYXA 4V2NA 4MH2A 1GTBA 1U6TA 2B5YA 3ZL5A 1KNGA 2A2RA 3IC8A 5AIXA 1OC3A 3QCPA 3HXSA 4RI6A 2PWJA 5BRTA 3DXBA 4JR6A 1M0UA 2R2JA 4FYCA 2GSQA 4MF6A 1FO5A 1GL8A 2R37A 5DCHA 1LBKA 3D4MA 1PKWA 3A2XA 4WBRD 2CV4A 2C4JA 4HJMA 3NOFA 1THXA 2K8SA 2RLIA 2H1GA 3A5IA 3ZTLA 1XFLA 3M9JA 4BWQA 5B7CA 4CY6A 1EOGA 3WGEA 1V58A 3LORA 4YQVA 1EP8A 4D73A 1ERTA 3FZ5A 3ME7A 4ZB6A 3CMIA 5D9WA 2DIYA 4KCEA 2FA4A 2VO4A 5EL8A 4KX4A 5JWOB 3VLNA 2JSZA 4D73B 1ZL9A 3IHGA 4POLA 1V40A 2H66A 3J7Yb 5CRWA 1CQHA 2RM5A 2J9HA 4PXOA 1T4YA 5D93A 4LL4B 2YNXA 3D0ZA 1Y25A 2O8VB 3PGTA 1A8YA 4WXTA 2CA8A 1K0BA 1M7TA 3C8EA 3TRPA 2FY6A 1K0DA 4I5QA 4POKA 5IPGA 1YZXA 2QA1A 1GLQA 5GZZB 2XPDA 3ZITA 4FYBA 4BPYA 4ILFA 2OA7A 4PNFA 1F6MC 4O5UA 3KCMA 2GVPA 3PPUA 1YQ1A 3GV1A 4TR3A 2VCQA 3P2AA 4HQSA 3W6GA 4MJEA 1FAAA 2GLRA 1TRSA 1YY7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D5J A;  2H6Y A;  3TKS A;  3KH9 A;  2YZH A;  2GZP A;  4NV2 A;  5H5Q A;  4HI7 A;  2JAC A;  5ENU A;  2FWH A;  5D8I A;  4AJ7 A;  1G0T A;  4BWS A;  1E6B A;  5D96 A;  2IN3 A;  2DMM A;  1FW1 A;  4EC0 A;  3U5R E;  4LL1 B;  4P3Y B;  3F63 A;  4LA1 A;  1JZO A;  2DJJ A;  3FKF A;  1OAZ A;  2AHE A;  1ST9 A;  2ES7 A;  2B3S A;  4WET A;  1URM A;  1TRU A;  1M2A A;  5IOW A;  3LG6 A;  2IL3 A;  3MAK A;  1PKZ A;  2JSY A;  4ZBD A;  5J9B A;  4I6X A;  4HOJ A;  5IIZ A;  3CSJ A;  1X9S B;  2B1K A;  4MAB A;  2G2Q A;  1XW6 A;  3TRX A;  1VF4 A;  1AW9 A;  4POB A;  2PUK C;  2LJA A;  3APO A;  4TR1 A;  1R4W A;  5DAL A;  1MEK A;  4PUF C;  4ZL9 A;  2CVB A;  3QDN A;  2X8C A;  1A0R P;  5IO0 A;  2WGR A;  1KBN A;  5C04 A;  5ECM B;  1GSU A;  3G9B A;  1GNE A;  2NVL A;  4MF5 A;  1ZYE A;  2MMA A;  4TR1 B;  2FNO A;  3RHC A;  2XHF A;  1EP7 A;  4G10 A;  5DAL B;  3ZVJ D;  3LXT A;  5G5E A;  1DBY A;  1DE2 A;  3SWL A;  4IEL A;  4WEY A;  2H01 A;  4K6X A;  1E2Y A;  5ABR A;  3KD0 A;  1Z6N A;  3IV4 A;  3F4R A;  3WD6 A;  3F6D A;  1TKD B;  4TW5 A;  3IRA A;  2JZS A;  2HLS A;  2JZR A;  3BOA A;  4K1F A;  2N5B A;  4K7O A;  3ERG A;  1ABA A;  1EV9 A;  4Q5F A;  1Z7P A;  5J3R A;  5HFG A;  4TXV A;  1AQW A;  1XXU A;  2H8L A;  4CW9 A;  3MDK A;  3NZN A;  1XWC A;  2YJH A;  1B4P A;  3C1R A;  3VI7 A;  3G7Y A;  3GL3 A;  4RUV A;  2I3Y A;  1IYI A;  2GGT A;  2NDO A;  3EUR A;  2H70 A;  2GZZ A;  1B9Y C;  5DAK A;  2RII A;  1THO A;  1ZZY A;  3QFA C;  1M9A A;  5F8B A;  3E0U A;  1SJ6 A;  2LUS A;  1M9B A;  2IFQ A;  5LCZ A;  1MDK A;  1NHO A;  1B9X C;  3BCI A;  2NTO A;  5DAK B;  4GF0 A;  4MPF A;  4AJ8 A;  1ERU A;  4PUA A;  2YN1 A;  1TDI A;  2CAQ A;  2IFQ B;  1SD8 A;  2H19 A;  3FR9 A;  3GUR A;  3TCO A;  5GST A;  5KN3 A;  3EC3 A;  1YKA A;  2B5X A;  2RM6 A;  2D2Z A;  2YPM A;  2F9S A;  2KHP A;  1S3C A;  2LS5 A;  4KAE A;  1K0A A;  2MYG A;  2LRC A;  4MZB A;  2CAI A;  2R3X A;  2CX3 A;  1FB6 A;  3UAR A;  2H1B A;  2XPE A;  4HQZ A;  5IM9 A;  2R4V A;  2B7J A;  3EU4 A;  4X1U A;  5ECK B;  1BJX A;  3CRU A;  2JAD A;  3IA1 A;  3M8N A;  1XW5 A;  4DSQ A;  3IXR A;  3A5W A;  2OAC A;  4LMW A;  1A24 A;  2LQQ A;  2ON5 A;  4FYU A;  2K8V A;  3KH7 A;  2HZF A;  4ML6 A;  2CZ2 A;  5ECI B;  1Y6E A;  4LMV A;  3WT2 A;  3TUE A;  1BED A;  2IMI A;  2TIR A;  4V2M A;  2YP6 A;  1WJK A;  1YF0 A;  2RUE A;  1SJI A;  1HNB A;  2VL9 A;  4IQ1 A;  3Q6O A;  3GST A;  1GLP A;  3HD5 A;  2VAF A;  1QQ2 A;  1EEM A;  3GN3 A;  5INY A;  1GP1 A;  4GTU A;  2H0H A;  1K3O A;  3LSZ A;  4NWY A;  3ZZX A;  1R5A A;  4TVE A;  4WKW A;  3HHV A;  3WGX A;  4EL1 A;  1JZD A;  4GQC A;  5COH A;  1QK8 A;  2L6D A;  5A4V A;  4E8H A;  1R26 A;  1TXX A;  2DBC A;  5ECL B;  4IKH A;  5IQY A;  3PR8 A;  2B5E A;  4QL9 A;  1OE8 A;  13GS A;  4I2U A;  2YWI A;  1ILO A;  4OMV A;  3FEU A;  1TJD A;  2V6O A;  3GRX A;  3LYP A;  2GQL A;  1XOA A;  3ISO A;  2HRN A;  2LKU A;  4KW6 A;  5IMD A;  3HDC A;  3TJB A;  5CO3 A;  5JWR B;  3D22 A;  2VD0 A;  2WJU A;  3BJ5 A;  5GAP D;  1EEJ A;  1PN9 A;  1CQG A;  5ECR B;  1WMJ A;  3IBH A;  1DE1 A;  1HNA A;  2VM1 A;  1KEB A;  3TOT A;  1FB0 A;  1V2A A;  3N5O A;  3KP8 A;  4TR4 A;  5JCG A;  4IS0 A;  2OE1 A;  3EMP A;  1QFN A;  8GSS A;  3IAM 2;  3I9V 2;  2L6C A;  2AAW A;  3VWX A;  2IIY A;  3MNG A;  2L5L A;  4PUR A;  3TKR A;  5DQY A;  1K0N A;  1VF3 A;  4XS1 A;  1EGO A;  5L71 A;  4G9H A;  2EIR A;  2MMO A;  4MDC A;  2OKA A;  4MCU A;  3IDV A;  3ZRD A;  1S3D A;  4WF5 A;  1GTI A;  4HU7 A;  4ZBB A;  5DBQ A;  5B6N A;  3MWH A;  2KOK A;  2H6Z A;  3O3T A;  1AXD A;  4GWR A;  4QQ7 A;  3QPM A;  5KN0 A;  3U6V A;  4K7N A;  4KDU A;  4EXJ A;  3IPZ A;  5CNW A;  5D73 A;  1GSD A;  1QUW A;  3HVX A;  5DCG A;  3TKS E;  3FY7 A;  1SD9 A;  4PQI A;  2IMF A;  4ECC A;  1YJ6 A;  1UVZ A;  1X5C A;  2DJ2 A;  1USB A;  4X0X A;  4ZXG A;  3L0H A;  2CZ3 A;  2IWT A;  5GAN D;  3US3 A;  1SU9 A;  4FH8 A;  1GUM A;  4N0Z A;  1ZOF A;  3O76 A;  4GRF A;  2LQO A;  5D9V A;  5ECP B;  1KTE A;  2CX4 A;  3ME8 A;  4NXI A;  3M1G A;  1ERW A;  5HR0 A;  1ERV A;  4GXZ A;  1S3A A;  3RPN A;  1O8W A;  2DML A;  1HYU A;  3KZQ A;  4J56 E;  4F03 A;  1ZCP A;  4PQH A;  6GSU A;  1ZMA A;  4F2I A;  1VRS D;  3QAV A;  1IYH A;  4L0U A;  1JZR A;  1OC8 A;  3ZFB A;  3FZ9 A;  1PGT A;  1B4Q A;  3UOM A;  2OE3 A;  1RQM A;  2VL2 C;  2H30 A;  5E59 A;  1RK4 A;  4MLY A;  2G0F A;  3HCZ A;  3LEF A;  1GUH A;  1BYE A;  5G2Z A;  2FA8 A;  4WF4 A;  1X9W B;  4V1A p;  2P31 A;  5EVO A;  3ERF A;  3H1N A;  2OE0 A;  2K6V A;  1K3Y A;  3BCK A;  5CRE A;  3I6A A;  2VCV A;  1T1V A;  2H75 A;  3AY8 A;  2JZT A;  5C00 A;  1BAY A;  4IJ3 A;  1G7O A;  4EO3 A;  2GSR A;  5F05 A;  6GSY A;  2GDR A;  4BVY A;  3CYN A;  3DVW A;  7GSS A;  3VPT A;  2H76 A;  3TDG A;  2H72 A;  3IE3 A;  2L57 A;  3BBY A;  1VF2 A;  2VLV A;  1GUL A;  3H93 A;  3KTL A;  1N8J A;  2V41 A;  3H8Q A;  2V1M A;  1OKT A;  1PA3 A;  2GSS A;  3GSS A;  5A4W A;  4HZ4 A;  5J9C A;  4N0V A;  3J7Y k;  1DUG A;  2M72 A;  2OBI A;  3UMA A;  2E2G A;  3DYR A;  2LST A;  1TK8 B;  2HE3 A;  4OFT A;  1FOV A;  4TXO A;  2RUF A;  2H1D A;  3EWL A;  1YF1 A;  3A3T A;  3DWV A;  3KMO A;  2LEG A;  2ZCT A;  2R5G A;  4YAV A;  4PQ1 A;  1I5G A;  2J23 A;  4NAX A;  1TK5 B;  3JCM L;  3LGC A;  3GX8 A;  4GSS A;  4TXO B;  2IME A;  4HS1 A;  1TTZ A;  1VF1 A;  3O6T A;  1XOB A;  1NM3 A;  4Q5R A;  2VM2 A;  1M2D A;  3I43 A;  2X8H A;  5HFI A;  3CTF A;  1M2B A;  2V2G A;  1UA5 A;  2F8A A;  11GS A;  2MMN A;  4XHM A;  4IBP A;  4NPB A;  5ID2 A;  1GRX A;  5DVB A;  2H73 A;  1QMV A;  2TRC P;  1Z3E A;  3C7M A;  4K2D A;  1TRV A;  4BVX A;  3I69 A;  5AGY A;  2KP1 A;  1MDJ A;  3EYT A;  3M3M A;  1O85 A;  4IVF A;  5ID2 B;  3GA4 A;  4RI7 A;  1V9W A;  4L5L A;  5FT3 A;  3GX0 A;  3L78 A;  4H86 A;  4Z7X A;  1EGR A;  2GZY A;  4KDY A;  1NW2 A;  4OO5 A;  5G5F A;  2VLU A;  2LJK A;  2A4V A;  1W89 A;  5F0G A;  1U88 A;  4I8B A;  1R7H A;  1U87 A;  5FWG A;  3W8S A;  2CVD A;  1JZW A;  3DVX A;  4K0G A;  1T4Z A;  5JWQ B;  3Q18 A;  1FG4 A;  1W4V A;  2GT5 A;  4N10 A;  4ZIJ A;  5ECN B;  1OYJ A;  1MDI A;  2HFD A;  3VUR A;  4ZIL A;  4MJC A;  2X8G A;  1GNW A;  3F6F A;  2VCZ A;  2PPT A;  2IPA A;  1TK0 B;  1PD2 1;  3UEM A;  4KGI A;  1X5D A;  3F3Q A;  2HYX A;  1T00 A;  4IN0 A;  5ECO B;  2HRF A;  2QSI A;  2NPB A;  1AQX A;  2E7P A;  1T3B A;  1U3A A;  4K7I A;  4MZW A;  5B8B A;  5F06 A;  2MBS A;  3APS A;  2FUG 2;  4XS6 A;  2DLX A;  4GQF A;  1K0C A;  2V32 A;  3VWW A;  3GH6 A;  2DC5 A;  1AAZ A;  2I1U A;  2C8U A;  4O32 A;  3HY2 A;  1ZYQ B;  2REM A;  3P7X A;  2B7K A;  2F51 A;  3QAW A;  1K0M A;  3VPQ A;  4ECI A;  1GH2 A;  2IJY A;  2B1L A;  1YKC A;  4EE0 A;  3L4N A;  5G31 A;  4OCF A;  1F37 A;  1JHB A;  5IMV A;  2CQ9 A;  2NBS A;  4OFM A;  1B8X A;  4L8E A;  3IC4 A;  2H1A A;  3FYG A;  4PGT A;  1ON4 A;  2C1Y A;  2H0I A;  2WFC A;  3QOU A;  1FHE A;  4F0B A;  1SL1 B;  4KCA A;  1SK1 A;  1T7P B;  3LWA A;  5DQS A;  4KUN A;  2P5Q A;  2QGV A;  3M0F A;  3GHA A;  2E2M A;  1TU8 A;  1J9B A;  4KSM A;  5ELG A;  5ECQ B;  1SJZ A;  4J2F A;  3CSI A;  3C73 A;  3GUS A;  2PBJ A;  3GKX A;  19GS A;  1OC9 A;  4XRA A;  5HR1 A;  5AIV A;  1PRX A;  1XWA A;  4QL7 A;  3F0I A;  5G30 A;  4O92 A;  4GCI A;  3UBL A;  2LNT A;  5HQP A;  2VLT A;  4IP1 A;  1OC9 B;  3GTU A;  5AIS A;  1GSE A;  5IMZ A;  12GS A;  3LJR A;  1O81 A;  2F3M A;  4MZC A;  2VCX A;  2XBI A;  1F9M A;  5EPF A;  2CT6 A;  2FWE A;  2VCW A;  3CBU A;  1EOH A;  3GTU B;  4MMM A;  1AC1 A;  2YV7 A;  2A2S A;  4MA9 A;  4ZB8 A;  5IPH A;  1Z5Y E;  2AV4 A;  3GNJ A;  1Z7R A;  1O6J A;  5E4W A;  3H79 A;  2PU9 C;  4XS4 A;  5HFK A;  2WDU A;  1UC7 A;  1Q98 A;  2C0D A;  1V98 A;  3OR5 A;  5KN1 A;  4KE3 A;  3KXO A;  5A5K A;  1FVJ A;  4YQM A;  3TJG A;  3LXZ A;  4XS4 B;  3LFL A;  2PVO C;  1SL2 B;  2MZC A;  1X9M B;  3H4K A;  4OCE A;  4CDO A;  4RQX A;  4WR5 A;  3ZLP A;  4POM A;  5HR3 A;  2PER A;  2GTU A;  2ZUP A;  1BG5 A;  1GTU A;  2FCH A;  2H0G A;  2C3N A;  3HZ8 A;  1WRY A;  1GSS A;  4TOP A;  4X43 A;  3IK9 A;  2N5A A;  2WS2 A;  3QR6 A;  4JED A;  1ZGN A;  4ML1 A;  1WWJ A;  2L5O A;  2DJ3 A;  4MK3 A;  1OE7 A;  4TRX A;  3W8J A;  3P90 A;  3RPP A;  1TP9 A;  2PN8 A;  4KND A;  5JCW A;  1A2M A;  4HJ2 A;  2LRN A;  4BL7 A;  3GH9 A;  3FHK A;  4JE1 A;  4V2L A;  5EY6 A;  1PL1 A;  2VOC A;  4YH2 A;  4O7H A;  1GWC A;  1F3A A;  1XIY A;  3HA9 A;  4Q5N A;  5IMF A;  6GSW A;  3VK9 A;  2WRT A;  2VD1 A;  2O87 A;  4EF0 A;  2CVK A;  4JBB A;  4AF2 A;  10GS A;  1AQV A;  4XCS A;  3R2Q A;  3APQ A;  1OVN A;  2KLX A;  4GSN A;  1PMT A;  4N30 A;  2P5R A;  3HVV A;  4KB3 A;  4EKZ A;  2JL4 A;  9GSS A;  3UVT A;  1TI3 A;  4OD7 A;  2I9H A;  1G6Y A;  2QC7 A;  2EIQ A;  1SK2 A;  4ZL8 A;  4MJB A;  1GUK A;  1WOU A;  1NHY A;  5D9T A;  1K0O A;  5KN2 A;  3A2V A;  3HJP A;  1SKW B;  2L4Q A;  1GSQ A;  5J4U A;  3EU3 A;  3BD2 A;  4PNG A;  3DD3 A;  3D4T A;  1XWB A;  3TRQ A;  5AN1 A;  2YAN A;  6GSV A;  2LNS A;  1GSY A;  3TJK A;  2QKE A;  2HI7 A;  4JZQ A;  1HD2 A;  4I2T A;  3FR6 A;  2P0G A;  4F0C A;  3ZIV A;  2DIZ A;  2XBQ A;  3GIX A;  1M99 A;  3IHQ A;  3E9J B;  3TGZ A;  1O8X A;  1Z6M A;  3ERW A;  3LQ7 A;  2VUP A;  3L9S A;  3VFI A;  4F9Z A;  4HUA A;  2H6X A;  5J5N A;  3UVH A;  2C3Q A;  3D21 A;  4JU5 A;  4CHS A;  1SEN A;  1PQN A;  3L9V A;  5IOX A;  3N9J A;  3DML A;  3G7J A;  4NV5 A;  2M46 A;  1JFU A;  2WB9 A;  2LTK A;  2KUC A;  3HKR A;  2BTO T;  2VL2 A;  4EDZ A;  5H5R A;  1WP0 A;  1YDK A;  4ZBA A;  4TR0 A;  1B48 A;  2WZ9 A;  1X0R A;  2Z9S A;  2K18 A;  2OAD A;  5CRD A;  2FWF A;  3TKS C;  1BX9 A;  1MD4 A;  1XPV A;  3C71 A;  4JRR A;  3ZRE A;  2YWN A;  3CXG A;  5LD0 A;  5GSS A;  1C72 A;  3IAS 2;  4EVM A;  3FK8 A;  3UAP A;  1K3L A;  4EDY A;  3TJF A;  2K9F A;  4WR4 A;  1HNC A;  3S9F A;  3KM6 A;  1T8E B;  1MD3 A;  2O85 A;  3UBK A;  17GS A;  1A8L A;  1AUC A;  2FGX A;  2H71 A;  3RDW A;  1XW9 A;  6GSX A;  1TI1 A;  1NSW A;  4MP4 A;  3EVI A;  4XTS A;  3F9U A;  1JLV A;  3E3E A;  1SL0 B;  5IMC A;  2DSA A;  1H75 A;  4GST A;  4MF7 A;  2C0F A;  3CRT A;  2AYT A;  3F3R A;  2YCD A;  2IMK A;  3TKP A;  4ZL7 A;  2YWM A;  4ISD A;  4KH7 A;  5B8A A;  2L4C A;  4TN8 A;  2LRT A;  4DEJ A;  4IGJ A;  3VWV A;  3KJY A;  2YJ7 A;  1PSQ A;  1A2L A;  3K8N A;  2VIM A;  4NHW A;  3L9U A;  4MJA A;  3HJM A;  1XWK A;  4HZ2 A;  4NMU A;  2N5F A;  2O7K A;  4YQU A;  1R5P A;  3DGQ A;  2HXK A;  1DSB A;  3MSZ A;  4K9Z A;  4RQR A;  1RW1 A;  2MMZ A;  2I4A A;  3UJ1 A;  1SKS B;  2PMT A;  1SYR A;  1A0F A;  1MTC A;  4I97 A;  4IW9 A;  5CRG A;  5D9X A;  2EIO A;  3ZFL A;  3GKM A;  1PX6 A;  3HZ4 A;  3TB2 A;  5HR2 A;  1EV4 A;  2BJX A;  2M80 A;  1FVK A;  1BQ7 A;  4HU9 A;  4E8E A;  3RAZ A;  5IMA A;  1O7U A;  3ZML A;  1G7E A;  1LJR A;  3P8W A;  2YV9 A;  5ECS A;  4PX1 A;  3D6I A;  1HQO A;  3FW2 A;  2O89 A;  1O73 A;  2VL3 A;  3CSH A;  4IJI A;  2HSH A;  3V1W A;  3FZA A;  1I9D A;  3GFK A;  1OKD A;  3RBT A;  1QXH A;  1N2A A;  2BMX A;  4IHU A;  1WPI A;  3FZ4 A;  3KGK A;  1Z9H A;  4HEA 2;  3IOS A;  4L5O A;  5G1K A;  2L59 A;  3PIN A;  2DJK A;  3DEX A;  3ZVJ A;  1XVQ A;  4NHZ A;  2KP2 A;  5B6M A;  1U3I A;  2LJR A;  4MPG A;  1PL2 A;  1QGV A;  3Q74 A;  3FRC A;  2YZU A;  1F3B A;  2V6K A;  3F4S A;  5IO2 A;  2HSY A;  3ZMK A;  2FD3 A;  4J57 E;  2X64 A;  1VGL A;  1XWG A;  1GTA A;  2OJL A;  2E0Q A;  4ECJ A;  4HDE A;  2PGT A;  4V1A g;  5KEJ A;  1SK0 A;  14GS A;  3G7I A;  4ACS A;  5FHI A;  2X99 A;  3M9K A;  4K8M A;  4ECB A;  1WIK A;  3KMN A;  3VI5 A;  5J41 A;  2JU5 A;  5A4U A;  6GSS A;  3TKQ A;  4DSR A;  2OBK A;  2HNL A;  4FIW A;  3QD9 A;  1XZO A;  4XIH A;  16GS A;  5ELA A;  4DVC A;  4O5R A;  1TRW A;  2TRX A;  3KTB A;  1EWX A;  3DRN A;  1LU4 A;  2ON7 A;  3PH9 A;  3GL5 A;  4F82 A;  4YAP A;  3UIW A;  1F2E A;  2XC2 A;  3GKN A;  3WGD A;  4TKY A;  3F4T A;  1UN2 A;  3FR3 A;  4IQA A;  5DJM A;  3IK7 A;  2YOI A;  1YEP A;  3DKS A;  1EZK A;  3F8U A;  4WBJ A;  1XBS A;  3NIV A;  5H5S A;  3HJO A;  2FHE A;  1WE0 A;  4EUY A;  2ALB A;  4DSS A;  5CP1 A;  6GST A;  1XVW A;  3HVS A;  3KEB A;  1J0F A;  1H4O A;  2FLS A;  2WCI A;  4Q5Q A;  3LYK A;  3WYW A;  1ACV A;  2DJ0 A;  5LNK e;  4KA0 A;  4ZB9 A;  3CTG A;  2FWG A;  4DSS B;  2GS3 A;  4L0W A;  1ML6 A;  3KP9 A;  1TU7 A;  4K0N A;  2HZE A;  2GQM A;  1SKR B;  3EMX A;  5CAX A;  18GS A;  1Q4J A;  4IP6 A;  4BA7 A;  3HYP A;  2AUV A;  3GMF A;  1A2J A;  2C0E A;  2AJQ B;  5JCU A;  2HZE B;  4ULX A;  2C0G A;  5DJL A;  3C1S A;  20GS A;  3ZYW A;  2WUL A;  1GSF A;  5G1L A;  2IMD A;  3QMX A;  4OO4 A;  2C3T A;  3DIE A;  3VWU A;  2YWO A;  3GYK A;  5CYY A;  2LV3 A;  3A2W A;  1PX7 A;  4N11 A;  2GST A;  2DJ1 A;  5CRH A;  3TOU A;  3GKK A;  4LLR A;  4XRD A;  1JLW A;  1TW9 A;  2EC4 A;  3UL3 A;  2GQK A;  3Q19 A;  22GS A;  1YEX A;  2PVQ A;  2HT9 A;  3SBC A;  5F07 A;  5ECH B;  2I81 A;  4ID0 A;  4JR4 A;  2GT6 A;  4GLT A;  4FO5 A;  4AJ6 A;  3KIJ A;  2ZNM A;  1XCC A;  3EE2 A;  4OFN A;  1TOF A;  2F8F A;  2AB6 A;  4G2E A;  2VCT A;  4G19 A;  4KSO A;  3TJJ A;  3WT1 A;  4KDX A;  1G6W A;  1X5E A;  4MH3 A;  2B6M A;  1A23 A;  3RHB A;  1V57 A;  3ED3 A;  3IR4 A;  3QAG A;  1J08 A;  3EIN A;  4OWY A;  2C80 A;  2R6K A;  3ZIJ A;  2MBT A;  1AIU A;  5DDL A;  4AGS A;  2H74 A;  3QFB C;  1SYX A;  4V2N A;  4MH2 A;  1GTB A;  1U6T A;  2B5Y A;  3ZL5 A;  1KNG A;  2A2R A;  5AIX A;  1OC3 A;  3QCP A;  3HXS A;  4RI6 A;  2PWJ A;  3DXB A;  4JR6 A;  1M0U A;  2R2J A;  4FYC A;  2GSQ A;  4MF6 A;  1FO5 A;  1GL8 A;  2R37 A;  5DCH A;  1LBK A;  3D4M A;  1PKW A;  3A2X A;  4WBR D;  2CV4 A;  2C4J A;  4HJM A;  3NOF A;  1THX A;  2K8S A;  2RLI A;  2H1G A;  3ZTL A;  1XFL A;  3M9J A;  4BWQ A;  5B7C A;  1EOG A;  3WGE A;  1V58 A;  3LOR A;  4YQV A;  1EP8 A;  4D73 A;  1ERT A;  3FZ5 A;  3ME7 A;  4ZB6 A;  3CMI A;  5D9W A;  2DIY A;  4KCE A;  2FA4 A;  2VO4 A;  5EL8 A;  4KX4 A;  5JWO B;  3VLN A;  2JSZ A;  4D73 B;  1ZL9 A;  4POL A;  1V40 A;  2H66 A;  3J7Y b;  5CRW A;  1CQH A;  2RM5 A;  2J9H A;  4PXO A;  1T4Y A;  5D93 A;  4LL4 B;  2YNX A;  3D0Z A;  1Y25 A;  2O8V B;  3PGT A;  1A8Y A;  4WXT A;  2CA8 A;  1K0B A;  1M7T A;  3C8E A;  3TRP A;  2FY6 A;  1K0D A;  4I5Q A;  4POK A;  5IPG A;  1YZX A;  1GLQ A;  5GZZ B;  2XPD A;  3ZIT A;  4FYB A;  4BPY A;  4ILF A;  2OA7 A;  4PNF A;  1F6M C;  3KCM A;  2GVP A;  1YQ1 A;  3GV1 A;  4TR3 A;  2VCQ A;  3P2A A;  4HQS A;  3W6G A;  4MJE A;  1FAA A;  2GLR A;  1TRS A;  1YY7 A; 
#chains in the Genus database with same CATH topology
 3D5J A;  2H6Y A;  3TKS A;  3KH9 A;  2YZH A;  2GZP A;  4NV2 A;  5H5Q A;  4HI7 A;  1PFO A;  2JAC A;  5ENU A;  2FWH A;  5D8I A;  4AJ7 A;  1G0T A;  4BWS A;  1E6B A;  5D96 A;  2IN3 A;  2DMM A;  1FW1 A;  4EC0 A;  3U5R E;  4LL1 B;  4P3Y B;  3F63 A;  4LA1 A;  1JZO A;  2DJJ A;  3FKF A;  1OAZ A;  2AHE A;  1ST9 A;  2ES7 A;  2B3S A;  4WET A;  1URM A;  1TRU A;  1M2A A;  5IOW A;  3LG6 A;  2IL3 A;  3MAK A;  1PKZ A;  2JSY A;  4ZBD A;  5J9B A;  1PN0 A;  1FOH A;  4I6X A;  4HOJ A;  5IIZ A;  4G0L A;  3CSJ A;  1X9S B;  2B1K A;  4MAB A;  2G2Q A;  1XW6 A;  3TRX A;  1VF4 A;  1AW9 A;  4POB A;  2PUK C;  2LJA A;  3APO A;  4TR1 A;  1R4W A;  5DAL A;  1MEK A;  4PUF C;  4ZL9 A;  2CVB A;  3QDN A;  2X8C A;  1A0R P;  5IO0 A;  2WGR A;  1KBN A;  5C04 A;  4G0I A;  5ECM B;  1GSU A;  3G9B A;  1GNE A;  2NVL A;  4MF5 A;  1ZYE A;  2MMA A;  4TR1 B;  2FNO A;  3RHC A;  2XHF A;  1EP7 A;  4G10 A;  5DAL B;  3ZVJ D;  3LXT A;  5G5E A;  1DBY A;  1DE2 A;  3SWL A;  4IEL A;  4WEY A;  2H01 A;  4K6X A;  1E2Y A;  5ABR A;  3KD0 A;  1Z6N A;  3IV4 A;  3F4R A;  3WD6 A;  3F6D A;  1TKD B;  4TW5 A;  3IRA A;  2JZS A;  2HLS A;  2JZR A;  3BOA A;  4K1F A;  2N5B A;  4K7O A;  3ERG A;  1ABA A;  1EV9 A;  4Q5F A;  1Z7P A;  5J3R A;  5HFG A;  4TXV A;  1AQW A;  1XXU A;  2H8L A;  4CW9 A;  3MDK A;  3MIX A;  3NZN A;  1XWC A;  5KOX A;  2YJH A;  1B4P A;  3C1R A;  3VI7 A;  3G7Y A;  3GL3 A;  4RUV A;  1M3J A;  2I3Y A;  1IYI A;  2GGT A;  2NDO A;  3EUR A;  2H70 A;  2GZZ A;  1B9Y C;  5DAK A;  2RII A;  1THO A;  1ZZY A;  3QFA C;  1M9A A;  5F8B A;  3E0U A;  1SJ6 A;  2LUS A;  1M9B A;  2IFQ A;  5LCZ A;  1MDK A;  1NHO A;  1B9X C;  3BCI A;  2NTO A;  5DAK B;  4GF0 A;  4MPF A;  4AJ8 A;  1ERU A;  4PUA A;  2YN1 A;  1TDI A;  2CAQ A;  2IFQ B;  1SD8 A;  2H19 A;  3FR9 A;  3GUR A;  3TCO A;  5GST A;  5KN3 A;  3EC3 A;  1YKA A;  2B5X A;  2RM6 A;  2D2Z A;  2YPM A;  2F9S A;  2KHP A;  1S3C A;  2LS5 A;  4KAE A;  4HSC X;  1K0A A;  2MYG A;  2LRC A;  4MZB A;  2CAI A;  2R3X A;  2CX3 A;  1FB6 A;  3UAR A;  2H1B A;  2XPE A;  4HQZ A;  5IM9 A;  2R4V A;  4EIP A;  2B7J A;  3EU4 A;  4X1U A;  5ECK B;  1BJX A;  3CRU A;  2JAD A;  3IA1 A;  3M8N A;  1XW5 A;  4DSQ A;  3IXR A;  3A5W A;  2OAC A;  4LMW A;  1A24 A;  2LQQ A;  2ON5 A;  4FYU A;  2K8V A;  3KH7 A;  2HZF A;  4ML6 A;  2CZ2 A;  5ECI B;  1Y6E A;  4LMV A;  3WT2 A;  3TUE A;  1BED A;  2IMI A;  2TIR A;  4V2M A;  2YP6 A;  1WJK A;  1YF0 A;  2RUE A;  4Z2R A;  1SJI A;  1HNB A;  2VL9 A;  4IQ1 A;  3Q6O A;  3GST A;  1GLP A;  3HD5 A;  2VAF A;  1QQ2 A;  1EEM A;  3GN3 A;  5INY A;  1GP1 A;  4GTU A;  2H0H A;  1K3O A;  3LSZ A;  4NWY A;  3ZZX A;  1R5A A;  4TVE A;  4WKW A;  3HHV A;  3WGX A;  4EL1 A;  1S3R A;  1JZD A;  3CQF A;  4GQC A;  5COH A;  1QK8 A;  2L6D A;  5A4V A;  4E8H A;  1R26 A;  1TXX A;  2DBC A;  5ECL B;  4IKH A;  5IQY A;  4YKG A;  3PR8 A;  2B5E A;  4QL9 A;  1OE8 A;  13GS A;  4I2U A;  2YWI A;  1ILO A;  4OMV A;  3FEU A;  1TJD A;  2V6O A;  2HSM A;  3GRX A;  3LYP A;  2GQL A;  1XOA A;  3ISO A;  1ZYN A;  2HRN A;  2LKU A;  4KW6 A;  5IMD A;  3HDC A;  3TJB A;  5CO3 A;  5JWR B;  3D22 A;  2VD0 A;  2WJU A;  3BJ5 A;  5GAP D;  1EEJ A;  1PN9 A;  1CQG A;  5ECR B;  1WMJ A;  3IBH A;  1DE1 A;  1HNA A;  2VM1 A;  1KEB A;  3TOT A;  1FB0 A;  1V2A A;  3N5O A;  3KP8 A;  4TR4 A;  5JCG A;  4IS0 A;  2OE1 A;  3EMP A;  1QFN A;  8GSS A;  3IAM 2;  3I9V 2;  2L6C A;  2AAW A;  3VWX A;  2IIY A;  4Z2U A;  3MNG A;  2L5L A;  4PUR A;  3TKR A;  5DQY A;  1K0N A;  1VF3 A;  4XS1 A;  1EGO A;  5L71 A;  4G9H A;  2EIR A;  2MMO A;  4MDC A;  2OKA A;  4MCU A;  3IDV A;  4YKF A;  1S3D A;  3ZRD A;  4WF5 A;  1GTI A;  4HU7 A;  4ZBB A;  5DBQ A;  5B6N A;  3MWH A;  2KOK A;  2H6Z A;  3O3T A;  1AXD A;  4GWR A;  4QQ7 A;  3QPM A;  5KN0 A;  3U6V A;  4K7N A;  4KDU A;  2HRA A;  4EXJ A;  3IPZ A;  5CNW A;  5D73 A;  1GSD A;  1QUW A;  3HVX A;  5DCG A;  3TKS E;  3FY7 A;  1SD9 A;  4PQI A;  2IMF A;  4ECC A;  1YJ6 A;  1UVZ A;  1X5C A;  2DJ2 A;  1USB A;  4X0X A;  4ZXG A;  3L0H A;  2CZ3 A;  2IWT A;  4USS A;  5GAN D;  3US3 A;  1SU9 A;  4FH8 A;  1GUM A;  4N0Z A;  1ZOF A;  3O76 A;  4GRF A;  2LQO A;  5D9V A;  5ECP B;  1KTE A;  2CX4 A;  3ME8 A;  4NXI A;  3M1G A;  1ERW A;  4A5P A;  5HR0 A;  1ERV A;  4GXZ A;  1S3A A;  3RPN A;  1O8W A;  2DML A;  1HYU A;  3KZQ A;  4J56 E;  4F03 A;  1ZCP A;  4PQH A;  6GSU A;  1ZMA A;  4F2I A;  1VRS D;  3QAV A;  1IYH A;  4L0U A;  1JZR A;  1OC8 A;  3ZFB A;  3FZ9 A;  1PGT A;  1B4Q A;  3UOM A;  2OE3 A;  1RQM A;  2VL2 C;  2H30 A;  5E59 A;  1RK4 A;  4MLY A;  2G0F A;  3HCZ A;  3LEF A;  1GUH A;  1BYE A;  5G2Z A;  2FA8 A;  4WF4 A;  1X9W B;  4V1A p;  2P31 A;  5EVO A;  3ERF A;  3H1N A;  2OE0 A;  2K6V A;  1K3Y A;  3BCK A;  5CRE A;  3I6A A;  2VCV A;  1T1V A;  2H75 A;  3AY8 A;  2JZT A;  5C00 A;  1BAY A;  4IJ3 A;  1G7O A;  4EO3 A;  2GSR A;  5F05 A;  6GSY A;  2GDR A;  4BVY A;  3CYN A;  3DVW A;  7GSS A;  4G0K A;  3VPT A;  2H76 A;  3TDG A;  2H72 A;  3IE3 A;  2L57 A;  3BBY A;  1VF2 A;  2VLV A;  1GUL A;  3H93 A;  3KTL A;  1N8J A;  2V41 A;  3H8Q A;  2V1M A;  4BVY B;  1OKT A;  1PA3 A;  2GSS A;  3GSS A;  5A4W A;  4HZ4 A;  5J9C A;  4N0V A;  3J7Y k;  1DUG A;  2M72 A;  2OBI A;  3UMA A;  2E2G A;  3DYR A;  2LST A;  1TK8 B;  2HE3 A;  4OFT A;  1FOV A;  4TXO A;  2RUF A;  2H1D A;  3EWL A;  1YF1 A;  3A3T A;  3DWV A;  3KMO A;  2LEG A;  2ZCT A;  2R5G A;  4YAV A;  2DKI A;  4PQ1 A;  1I5G A;  2J23 A;  4NAX A;  1TK5 B;  3JCM L;  3LGC A;  3GX8 A;  4GSS A;  4TXO B;  2IME A;  4HS1 A;  1TTZ A;  1VF1 A;  3O6T A;  1XOB A;  1NM3 A;  4Q5R A;  2VM2 A;  1M2D A;  3I43 A;  2X8H A;  5HFI A;  3CTF A;  1M2B A;  2V2G A;  1UA5 A;  2F8A A;  11GS A;  2MMN A;  4XHM A;  4IBP A;  4NPB A;  5ID2 A;  1GRX A;  5DVB A;  2H73 A;  1QMV A;  2TRC P;  1Z3E A;  3C7M A;  2UZ8 A;  4K2D A;  4BIK A;  1TRV A;  4BVX A;  3I69 A;  5AGY A;  2KP1 A;  1MDJ A;  3EYT A;  3M3M A;  1O85 A;  4IVF A;  5ID2 B;  3GA4 A;  4RI7 A;  1V9W A;  4L5L A;  5FT3 A;  3GX0 A;  3L78 A;  4BVX B;  4H86 A;  4Z7X A;  1EGR A;  2GZY A;  4KDY A;  1NW2 A;  4OO5 A;  5G5F A;  2VLU A;  2LJK A;  2A4V A;  1W89 A;  5F0G A;  1U88 A;  4I8B A;  1R7H A;  1U87 A;  5FWG A;  3W8S A;  2CVD A;  1JZW A;  3DVX A;  4K0G A;  1T4Z A;  5JWQ B;  3Q18 A;  1FG4 A;  1W4V A;  2GT5 A;  4N10 A;  4ZIJ A;  5ECN B;  1OYJ A;  1MDI A;  2HFD A;  3VUR A;  4ZIL A;  4MJC A;  2X8G A;  1GNW A;  3F6F A;  2VCZ A;  2PPT A;  2IPA A;  1TK0 B;  1PD2 1;  3UEM A;  4KGI A;  1X5D A;  3F3Q A;  2HYX A;  1T00 A;  4IN0 A;  5ECO B;  2HRF A;  2QSI A;  2NPB A;  1AQX A;  2E7P A;  1T3B A;  1U3A A;  4K7I A;  4MZW A;  5B8B A;  2R0G A;  5F06 A;  2MBS A;  3APS A;  2FUG 2;  4XS6 A;  2DLX A;  4GQF A;  1K0C A;  2V32 A;  3VWW A;  3GH6 A;  4K5S A;  2DC5 A;  1AAZ A;  2I1U A;  2C8U A;  4O32 A;  3HY2 A;  1ZYQ B;  2REM A;  3P7X A;  2B7K A;  2F51 A;  3QAW A;  1K0M A;  3VPQ A;  4ECI A;  1GH2 A;  2IJY A;  2B1L A;  1YKC A;  4EE0 A;  3L4N A;  4O5Q A;  5G31 A;  4OCF A;  1F37 A;  1JHB A;  5IMV A;  2CQ9 A;  2NBS A;  4OFM A;  1B8X A;  4L8E A;  3IC4 A;  2H1A A;  3FYG A;  4PGT A;  1ON4 A;  2C1Y A;  2H0I A;  2WFC A;  3QOU A;  1FHE A;  4F0B A;  1SL1 B;  4KCA A;  1SK1 A;  1T7P B;  3LWA A;  5DQS A;  4KUN A;  2P5Q A;  2QGV A;  3M0F A;  3GHA A;  2E2M A;  1TU8 A;  1J9B A;  4KSM A;  5ELG A;  5ECQ B;  1SJZ A;  4J2F A;  3CSI A;  3C73 A;  3GUS A;  2PBJ A;  3GKX A;  19GS A;  1OC9 A;  4XRA A;  5HR1 A;  5AIV A;  1PRX A;  1XWA A;  4QL7 A;  3F0I A;  5G30 A;  4O92 A;  4GCI A;  3UBL A;  2LNT A;  5HQP A;  2VLT A;  4IP1 A;  1OC9 B;  3GTU A;  5AIS A;  1GSE A;  5IMZ A;  12GS A;  3LJR A;  1O81 A;  2F3M A;  4MZC A;  2VCX A;  2XBI A;  1F9M A;  5EPF A;  2CT6 A;  2FWE A;  2VCW A;  3CBU A;  1EOH A;  3GTU B;  1ZYP A;  4MMM A;  1AC1 A;  2YV7 A;  2A2S A;  4MA9 A;  4ZB8 A;  5IPH A;  1Z5Y E;  2AV4 A;  3GNJ A;  1Z7R A;  1O6J A;  5E4W A;  3H79 A;  2PU9 C;  4XS4 A;  5HFK A;  2WDU A;  1UC7 A;  1Q98 A;  2C0D A;  1V98 A;  3OR5 A;  5KN1 A;  4KE3 A;  3KXO A;  5A5K A;  1FVJ A;  4YQM A;  3TJG A;  3LXZ A;  4XS4 B;  3LFL A;  2PVO C;  1SL2 B;  2MZC A;  1X9M B;  3H4K A;  4OCE A;  4CDO A;  4RQX A;  4WR5 A;  3ZLP A;  2DKH A;  4POM A;  5HR3 A;  2PER A;  2GTU A;  2ZUP A;  1BG5 A;  1GTU A;  2FCH A;  2H0G A;  2C3N A;  3HZ8 A;  1WRY A;  1GSS A;  4TOP A;  4X43 A;  3IK9 A;  2N5A A;  2WS2 A;  3QR6 A;  4JED A;  1ZGN A;  4ML1 A;  1WWJ A;  2L5O A;  2DJ3 A;  4MK3 A;  1OE7 A;  4TRX A;  3W8J A;  3P90 A;  3RPP A;  1TP9 A;  2PN8 A;  4KND A;  5JCW A;  1A2M A;  4HJ2 A;  2LRN A;  4BL7 A;  3GH9 A;  3FHK A;  4JE1 A;  4V2L A;  5EY6 A;  1PL1 A;  2VOC A;  4YH2 A;  4O7H A;  1GWC A;  1F3A A;  1XIY A;  3HA9 A;  4Q5N A;  5IMF A;  6GSW A;  3VK9 A;  2WRT A;  2VD1 A;  2O87 A;  4BL7 B;  4EF0 A;  2CVK A;  4JBB A;  4AF2 A;  10GS A;  1AQV A;  4XCS A;  3R2Q A;  3APQ A;  1OVN A;  2KLX A;  4GSN A;  1PMT A;  2X49 A;  4N30 A;  2P5R A;  3HVV A;  4KB3 A;  4EKZ A;  2JL4 A;  9GSS A;  3UVT A;  1TI3 A;  4OD7 A;  2I9H A;  5BMU A;  1G6Y A;  2QC7 A;  2EIQ A;  1SK2 A;  4ZL8 A;  4MJB A;  1GUK A;  1WOU A;  2QA2 A;  1NHY A;  5D9T A;  1K0O A;  5KN2 A;  3A2V A;  3HJP A;  1SKW B;  2L4Q A;  1GSQ A;  5J4U A;  3EU3 A;  3BD2 A;  4PNG A;  3DD3 A;  3D4T A;  1XWB A;  3TRQ A;  5AN1 A;  2YAN A;  6GSV A;  2LNS A;  1GSY A;  3TJK A;  2QKE A;  2HI7 A;  4JZQ A;  1HD2 A;  4I2T A;  3FR6 A;  2P0G A;  4F0C A;  3ZIV A;  2DIZ A;  2XBQ A;  3GIX A;  1M99 A;  3IHQ A;  1XG8 A;  3E9J B;  3TGZ A;  1O8X A;  1Z6M A;  3ERW A;  3LQ7 A;  2VUP A;  3L9S A;  3VFI A;  4F9Z A;  4HUA A;  2H6X A;  5J5N A;  3UVH A;  2C3Q A;  3D21 A;  4JU5 A;  4CHS A;  1SEN A;  1PQN A;  3L9V A;  5IOX A;  2A2P A;  3N9J A;  3DML A;  3G7J A;  4NV5 A;  2M46 A;  1JFU A;  2WB9 A;  2LTK A;  4KF9 A;  2KUC A;  3HKR A;  2BTO T;  2VL2 A;  4EDZ A;  5H5R A;  1WP0 A;  4ICY A;  1YDK A;  4ZBA A;  4TR0 A;  1B48 A;  2WZ9 A;  1X0R A;  2Z9S A;  2K18 A;  2OAD A;  5CRD A;  2FWF A;  3TKS C;  1BX9 A;  1MD4 A;  1XPV A;  3C71 A;  4JRR A;  3ZRE A;  2YWN A;  3CXG A;  5LD0 A;  5GSS A;  1C72 A;  2R0C A;  3IAS 2;  4EVM A;  3FK8 A;  3UAP A;  1K3L A;  4EDY A;  3TJF A;  2K9F A;  3MYD A;  4WR4 A;  1HNC A;  3S9F A;  3KM6 A;  1T8E B;  1MD3 A;  2O85 A;  3UBK A;  17GS A;  1A8L A;  1AUC A;  2FGX A;  2H71 A;  3RDW A;  1XW9 A;  6GSX A;  1TI1 A;  1NSW A;  4MP4 A;  3EVI A;  4XTS A;  3F9U A;  1JLV A;  3E3E A;  1SL0 B;  5IMC A;  2DSA A;  1H75 A;  4GST A;  4MF7 A;  2C0F A;  3CRT A;  2AYT A;  3F3R A;  2YCD A;  2IMK A;  3TKP A;  4ZL7 A;  2YWM A;  4ISD A;  4KH7 A;  5B8A A;  2L4C A;  4TN8 A;  2LRT A;  4DEJ A;  4IGJ A;  3VWV A;  3KJY A;  2YJ7 A;  1PSQ A;  1A2L A;  3K8N A;  2VIM A;  4NHW A;  3L9U A;  4MJA A;  3HJM A;  4K5R A;  1XWK A;  4HZ2 A;  4NMU A;  2N5F A;  2O7K A;  4YQU A;  1R5P A;  3DGQ A;  2HXK A;  1DSB A;  3MSZ A;  4K9Z A;  4RQR A;  1RW1 A;  2MMZ A;  2I4A A;  3UJ1 A;  1SKS B;  2PMT A;  1SYR A;  1A0F A;  1MTC A;  4PTS A;  4I97 A;  4IW9 A;  5CRG A;  5D9X A;  4Z2T A;  4K2X A;  2EIO A;  3ZFL A;  3GKM A;  1PX6 A;  3HZ4 A;  3TB2 A;  5HR2 A;  1EV4 A;  2BJX A;  2M80 A;  1FVK A;  1BQ7 A;  4HU9 A;  4E8E A;  3RAZ A;  5IMA A;  1O7U A;  3ZML A;  1G7E A;  1LJR A;  3P8W A;  2YV9 A;  5ECS A;  4PX1 A;  3D6I A;  1HQO A;  3FW2 A;  2O89 A;  1O73 A;  2VL3 A;  3CSH A;  4IJI A;  2HSH A;  3EPT A;  3V1W A;  3FZA A;  1I9D A;  3GFK A;  1OKD A;  3RBT A;  1QXH A;  1N2A A;  2BMX A;  4IHU A;  2R0P A;  1WPI A;  3FZ4 A;  3KGK A;  1Z9H A;  4HEA 2;  3IOS A;  4L5O A;  5G1K A;  2L59 A;  3PIN A;  2DJK A;  3DEX A;  3ZVJ A;  1XVQ A;  4NHZ A;  2KP2 A;  3FMW A;  5B6M A;  1U3I A;  2LJR A;  4MPG A;  1PL2 A;  1QGV A;  3Q74 A;  4CY8 A;  3FRC A;  2YZU A;  1F3B A;  2V6K A;  3F4S A;  5IO2 A;  2HSY A;  5KOW A;  3ZMK A;  2FD3 A;  4J57 E;  2X64 A;  1VGL A;  1XWG A;  1GTA A;  2OJL A;  2E0Q A;  4ECJ A;  4HDE A;  2PGT A;  4V1A g;  2X4A A;  5KEJ A;  1SK0 A;  14GS A;  3G7I A;  4ACS A;  5FHI A;  2X99 A;  3M9K A;  4K8M A;  4ECB A;  1WIK A;  3KMN A;  3VI5 A;  5J41 A;  2JU5 A;  5A4U A;  6GSS A;  3TKQ A;  4DSR A;  2OBK A;  2HNL A;  4FIW A;  3LW9 A;  3QD9 A;  1XZO A;  4XIH A;  2HRK A;  16GS A;  5ELA A;  4DVC A;  4O5R A;  1TRW A;  2TRX A;  3KTB A;  1EWX A;  3DRN A;  1LU4 A;  2ON7 A;  3PH9 A;  3GL5 A;  4F82 A;  4YAP A;  3UIW A;  1F2E A;  2XC2 A;  3GKN A;  3WGD A;  4TKY A;  4EIQ A;  3F4T A;  1UN2 A;  3FR3 A;  4IQA A;  5DJM A;  3IK7 A;  2YOI A;  1YEP A;  3DKS A;  1EZK A;  3F8U A;  4WBJ A;  1XBS A;  3NIV A;  5H5S A;  3HJO A;  2FHE A;  1WE0 A;  4EUY A;  2ALB A;  4DSS A;  5CP1 A;  6GST A;  1XVW A;  3HVS A;  4FQU A;  3KEB A;  1J0F A;  1H4O A;  3R3E A;  2FLS A;  2WCI A;  4Q5Q A;  3LYK A;  3WYW A;  1ACV A;  2DJ0 A;  5LNK e;  4KA0 A;  4ZB9 A;  3CTG A;  2FWG A;  4DSS B;  2GS3 A;  4L0W A;  1ML6 A;  3KP9 A;  1TU7 A;  4K0N A;  2HZE A;  2GQM A;  1SKR B;  3EMX A;  5CAX A;  18GS A;  1Q4J A;  4IP6 A;  4BA7 A;  3HYP A;  2AUV A;  3GMF A;  1A2J A;  2C0E A;  2AJQ B;  5JCU A;  2HZE B;  4X4J A;  4ULX A;  2C0G A;  5DJL A;  3C1S A;  20GS A;  3ZYW A;  2WUL A;  1GSF A;  5G1L A;  2IMD A;  3QMX A;  4OO4 A;  2C3T A;  3DIE A;  3VWU A;  2YWO A;  3GYK A;  5CYY A;  2LV3 A;  3A2W A;  1PX7 A;  4N11 A;  2GST A;  2DJ1 A;  5CRH A;  3TOU A;  3GKK A;  4LLR A;  4XRD A;  1JLW A;  1TW9 A;  2EC4 A;  3UL3 A;  2GQK A;  3Q19 A;  22GS A;  1YEX A;  2PVQ A;  2HT9 A;  3SBC A;  5F07 A;  5ECH B;  2I81 A;  4ID0 A;  4JR4 A;  2GT6 A;  4GLT A;  4FO5 A;  4AJ6 A;  3KIJ A;  2ZNM A;  1XCC A;  3EE2 A;  4OFN A;  1TOF A;  2F8F A;  2A4H A;  2AB6 A;  4G2E A;  2VCT A;  4G19 A;  4KSO A;  3TJJ A;  3WT1 A;  4KDX A;  1G6W A;  1X5E A;  4MH3 A;  2B6M A;  1A23 A;  3RHB A;  1V57 A;  3ED3 A;  3IR4 A;  3QAG A;  1J08 A;  3EIN A;  4MNN A;  4OWY A;  2C80 A;  2R6K A;  3ZIJ A;  2MBT A;  1AIU A;  5DDL A;  4AGS A;  2H74 A;  3QFB C;  1SYX A;  4V2N A;  4MH2 A;  1GTB A;  1U6T A;  2B5Y A;  3ZL5 A;  1KNG A;  2A2R A;  3IC8 A;  5AIX A;  1OC3 A;  3QCP A;  3HXS A;  4RI6 A;  2PWJ A;  5BRT A;  3DXB A;  4JR6 A;  1M0U A;  2R2J A;  4FYC A;  2GSQ A;  4MF6 A;  1FO5 A;  1GL8 A;  2R37 A;  5DCH A;  1LBK A;  3D4M A;  1PKW A;  3A2X A;  4WBR D;  2CV4 A;  2C4J A;  4HJM A;  3NOF A;  1THX A;  2K8S A;  2RLI A;  2H1G A;  3HVN A;  3A5I A;  3ZTL A;  1XFL A;  3M9J A;  4BWQ A;  5B7C A;  4CY6 A;  1EOG A;  3WGE A;  1V58 A;  3LOR A;  4YQV A;  1EP8 A;  4D73 A;  1ERT A;  3FZ5 A;  3ME7 A;  4ZB6 A;  3CMI A;  5D9W A;  2DIY A;  4KCE A;  2FA4 A;  2VO4 A;  5EL8 A;  4KX4 A;  5JWO B;  3VLN A;  2JSZ A;  4D73 B;  1ZL9 A;  3IHG A;  4POL A;  1V40 A;  2H66 A;  3J7Y b;  5CRW A;  1CQH A;  2RM5 A;  2J9H A;  4PXO A;  1T4Y A;  5D93 A;  4LL4 B;  2YNX A;  3D0Z A;  1Y25 A;  2O8V B;  3PGT A;  1A8Y A;  4WXT A;  2CA8 A;  1K0B A;  1M7T A;  3C8E A;  3TRP A;  2FY6 A;  1K0D A;  4I5Q A;  4POK A;  5IPG A;  1YZX A;  2QA1 A;  1GLQ A;  5GZZ B;  2XPD A;  3ZIT A;  4FYB A;  4BPY A;  4ILF A;  2OA7 A;  4PNF A;  1F6M C;  4O5U A;  3KCM A;  1M3I A;  2GVP A;  3PPU A;  1YQ1 A;  3GV1 A;  4TR3 A;  2VCQ A;  3P2A A;  4HQS A;  3W6G A;  4MJE A;  1FAA A;  2GLR A;  1TRS A;  1YY7 A; 
#chains in the Genus database with same CATH homology
 3D5J A;  2H6Y A;  3TKS A;  3KH9 A;  2YZH A;  2GZP A;  4NV2 A;  5H5Q A;  4HI7 A;  2JAC A;  5ENU A;  2FWH A;  5D8I A;  4AJ7 A;  1G0T A;  4BWS A;  1E6B A;  5D96 A;  2IN3 A;  2DMM A;  1FW1 A;  4EC0 A;  3U5R E;  4LL1 B;  4P3Y B;  3F63 A;  4LA1 A;  1JZO A;  2DJJ A;  3FKF A;  1OAZ A;  2AHE A;  1ST9 A;  2ES7 A;  2B3S A;  4WET A;  1URM A;  1TRU A;  1M2A A;  5IOW A;  3LG6 A;  2IL3 A;  3MAK A;  1PKZ A;  2JSY A;  4ZBD A;  5J9B A;  1PN0 A;  1FOH A;  4I6X A;  4HOJ A;  5IIZ A;  4G0L A;  3CSJ A;  1X9S B;  2B1K A;  4MAB A;  2G2Q A;  1XW6 A;  3TRX A;  1VF4 A;  1AW9 A;  4POB A;  2PUK C;  2LJA A;  3APO A;  4TR1 A;  1R4W A;  5DAL A;  1MEK A;  4PUF C;  4ZL9 A;  2CVB A;  3QDN A;  2X8C A;  1A0R P;  5IO0 A;  2WGR A;  1KBN A;  5C04 A;  4G0I A;  5ECM B;  1GSU A;  3G9B A;  1GNE A;  2NVL A;  4MF5 A;  1ZYE A;  2MMA A;  4TR1 B;  2FNO A;  3RHC A;  2XHF A;  1EP7 A;  4G10 A;  5DAL B;  3ZVJ D;  3LXT A;  5G5E A;  1DBY A;  1DE2 A;  3SWL A;  4IEL A;  4WEY A;  2H01 A;  4K6X A;  1E2Y A;  5ABR A;  3KD0 A;  1Z6N A;  3IV4 A;  3F4R A;  3WD6 A;  3F6D A;  1TKD B;  4TW5 A;  3IRA A;  2JZS A;  2HLS A;  2JZR A;  3BOA A;  4K1F A;  2N5B A;  4K7O A;  3ERG A;  1ABA A;  1EV9 A;  4Q5F A;  1Z7P A;  5J3R A;  5HFG A;  4TXV A;  1AQW A;  1XXU A;  2H8L A;  4CW9 A;  3MDK A;  3MIX A;  3NZN A;  1XWC A;  5KOX A;  2YJH A;  1B4P A;  3C1R A;  3VI7 A;  3G7Y A;  3GL3 A;  4RUV A;  2I3Y A;  1IYI A;  2GGT A;  2NDO A;  3EUR A;  2H70 A;  2GZZ A;  1B9Y C;  5DAK A;  2RII A;  1THO A;  1ZZY A;  3QFA C;  1M9A A;  5F8B A;  3E0U A;  1SJ6 A;  2LUS A;  1M9B A;  2IFQ A;  5LCZ A;  1MDK A;  1NHO A;  1B9X C;  3BCI A;  2NTO A;  5DAK B;  4GF0 A;  4MPF A;  4AJ8 A;  1ERU A;  4PUA A;  2YN1 A;  1TDI A;  2CAQ A;  2IFQ B;  1SD8 A;  2H19 A;  3FR9 A;  3GUR A;  3TCO A;  5GST A;  5KN3 A;  3EC3 A;  1YKA A;  2B5X A;  2RM6 A;  2D2Z A;  2YPM A;  2F9S A;  2KHP A;  1S3C A;  2LS5 A;  4KAE A;  1K0A A;  2MYG A;  2LRC A;  4MZB A;  2CAI A;  2R3X A;  2CX3 A;  1FB6 A;  3UAR A;  2H1B A;  2XPE A;  4HQZ A;  5IM9 A;  2R4V A;  4EIP A;  2B7J A;  3EU4 A;  4X1U A;  5ECK B;  1BJX A;  3CRU A;  2JAD A;  3IA1 A;  3M8N A;  1XW5 A;  4DSQ A;  3IXR A;  3A5W A;  2OAC A;  4LMW A;  1A24 A;  2LQQ A;  2ON5 A;  4FYU A;  2K8V A;  3KH7 A;  2HZF A;  4ML6 A;  2CZ2 A;  5ECI B;  1Y6E A;  4LMV A;  3WT2 A;  3TUE A;  1BED A;  2IMI A;  2TIR A;  4V2M A;  2YP6 A;  1WJK A;  1YF0 A;  2RUE A;  4Z2R A;  1SJI A;  1HNB A;  2VL9 A;  4IQ1 A;  3Q6O A;  3GST A;  1GLP A;  3HD5 A;  2VAF A;  1QQ2 A;  1EEM A;  3GN3 A;  5INY A;  1GP1 A;  4GTU A;  2H0H A;  1K3O A;  3LSZ A;  4NWY A;  3ZZX A;  1R5A A;  4TVE A;  4WKW A;  3HHV A;  3WGX A;  4EL1 A;  1JZD A;  4GQC A;  5COH A;  1QK8 A;  2L6D A;  5A4V A;  4E8H A;  1R26 A;  1TXX A;  2DBC A;  5ECL B;  4IKH A;  5IQY A;  4YKG A;  3PR8 A;  2B5E A;  4QL9 A;  1OE8 A;  13GS A;  4I2U A;  2YWI A;  1ILO A;  4OMV A;  3FEU A;  1TJD A;  2V6O A;  2HSM A;  3GRX A;  3LYP A;  2GQL A;  1XOA A;  3ISO A;  1ZYN A;  2HRN A;  2LKU A;  4KW6 A;  5IMD A;  3HDC A;  3TJB A;  5CO3 A;  5JWR B;  3D22 A;  2VD0 A;  2WJU A;  3BJ5 A;  5GAP D;  1EEJ A;  1PN9 A;  1CQG A;  5ECR B;  1WMJ A;  3IBH A;  1DE1 A;  1HNA A;  2VM1 A;  1KEB A;  3TOT A;  1FB0 A;  1V2A A;  3N5O A;  3KP8 A;  4TR4 A;  5JCG A;  4IS0 A;  2OE1 A;  3EMP A;  1QFN A;  8GSS A;  3IAM 2;  3I9V 2;  2L6C A;  2AAW A;  3VWX A;  2IIY A;  4Z2U A;  3MNG A;  2L5L A;  4PUR A;  3TKR A;  5DQY A;  1K0N A;  1VF3 A;  4XS1 A;  1EGO A;  5L71 A;  4G9H A;  2EIR A;  2MMO A;  4MDC A;  2OKA A;  4MCU A;  3IDV A;  4YKF A;  1S3D A;  3ZRD A;  4WF5 A;  1GTI A;  4HU7 A;  4ZBB A;  5DBQ A;  5B6N A;  3MWH A;  2KOK A;  2H6Z A;  3O3T A;  1AXD A;  4GWR A;  4QQ7 A;  3QPM A;  5KN0 A;  3U6V A;  4K7N A;  4KDU A;  2HRA A;  4EXJ A;  3IPZ A;  5CNW A;  5D73 A;  1GSD A;  1QUW A;  3HVX A;  5DCG A;  3TKS E;  3FY7 A;  1SD9 A;  4PQI A;  2IMF A;  4ECC A;  1YJ6 A;  1UVZ A;  1X5C A;  2DJ2 A;  1USB A;  4X0X A;  4ZXG A;  3L0H A;  2CZ3 A;  2IWT A;  4USS A;  5GAN D;  3US3 A;  1SU9 A;  4FH8 A;  1GUM A;  4N0Z A;  1ZOF A;  3O76 A;  4GRF A;  2LQO A;  5D9V A;  5ECP B;  1KTE A;  2CX4 A;  3ME8 A;  4NXI A;  3M1G A;  1ERW A;  4A5P A;  5HR0 A;  1ERV A;  4GXZ A;  1S3A A;  3RPN A;  1O8W A;  2DML A;  1HYU A;  3KZQ A;  4J56 E;  4F03 A;  1ZCP A;  4PQH A;  6GSU A;  1ZMA A;  4F2I A;  1VRS D;  3QAV A;  1IYH A;  4L0U A;  1JZR A;  1OC8 A;  3ZFB A;  3FZ9 A;  1PGT A;  1B4Q A;  3UOM A;  2OE3 A;  1RQM A;  2VL2 C;  2H30 A;  5E59 A;  1RK4 A;  4MLY A;  2G0F A;  3HCZ A;  3LEF A;  1GUH A;  1BYE A;  5G2Z A;  2FA8 A;  4WF4 A;  1X9W B;  4V1A p;  2P31 A;  5EVO A;  3ERF A;  3H1N A;  2OE0 A;  2K6V A;  1K3Y A;  3BCK A;  5CRE A;  3I6A A;  2VCV A;  1T1V A;  2H75 A;  3AY8 A;  2JZT A;  5C00 A;  1BAY A;  4IJ3 A;  1G7O A;  4EO3 A;  2GSR A;  5F05 A;  6GSY A;  2GDR A;  4BVY A;  3CYN A;  3DVW A;  7GSS A;  4G0K A;  3VPT A;  2H76 A;  3TDG A;  2H72 A;  3IE3 A;  2L57 A;  3BBY A;  1VF2 A;  2VLV A;  1GUL A;  3H93 A;  3KTL A;  1N8J A;  2V41 A;  3H8Q A;  2V1M A;  4BVY B;  1OKT A;  1PA3 A;  2GSS A;  3GSS A;  5A4W A;  4HZ4 A;  5J9C A;  4N0V A;  3J7Y k;  1DUG A;  2M72 A;  2OBI A;  3UMA A;  2E2G A;  3DYR A;  2LST A;  1TK8 B;  2HE3 A;  4OFT A;  1FOV A;  4TXO A;  2RUF A;  2H1D A;  3EWL A;  1YF1 A;  3A3T A;  3DWV A;  3KMO A;  2LEG A;  2ZCT A;  2R5G A;  4YAV A;  2DKI A;  4PQ1 A;  1I5G A;  2J23 A;  4NAX A;  1TK5 B;  3JCM L;  3LGC A;  3GX8 A;  4GSS A;  4TXO B;  2IME A;  4HS1 A;  1TTZ A;  1VF1 A;  3O6T A;  1XOB A;  1NM3 A;  4Q5R A;  2VM2 A;  1M2D A;  3I43 A;  2X8H A;  5HFI A;  3CTF A;  1M2B A;  2V2G A;  1UA5 A;  2F8A A;  11GS A;  2MMN A;  4XHM A;  4IBP A;  4NPB A;  5ID2 A;  1GRX A;  5DVB A;  2H73 A;  1QMV A;  2TRC P;  1Z3E A;  3C7M A;  2UZ8 A;  4K2D A;  1TRV A;  4BVX A;  3I69 A;  5AGY A;  2KP1 A;  1MDJ A;  3EYT A;  3M3M A;  1O85 A;  4IVF A;  5ID2 B;  3GA4 A;  4RI7 A;  1V9W A;  4L5L A;  5FT3 A;  3GX0 A;  3L78 A;  4BVX B;  4H86 A;  4Z7X A;  1EGR A;  2GZY A;  4KDY A;  1NW2 A;  4OO5 A;  5G5F A;  2VLU A;  2LJK A;  2A4V A;  1W89 A;  5F0G A;  1U88 A;  4I8B A;  1R7H A;  1U87 A;  5FWG A;  3W8S A;  2CVD A;  1JZW A;  3DVX A;  4K0G A;  1T4Z A;  5JWQ B;  3Q18 A;  1FG4 A;  1W4V A;  2GT5 A;  4N10 A;  4ZIJ A;  5ECN B;  1OYJ A;  1MDI A;  2HFD A;  3VUR A;  4ZIL A;  4MJC A;  2X8G A;  1GNW A;  3F6F A;  2VCZ A;  2PPT A;  2IPA A;  1TK0 B;  1PD2 1;  3UEM A;  4KGI A;  1X5D A;  3F3Q A;  2HYX A;  1T00 A;  4IN0 A;  5ECO B;  2HRF A;  2QSI A;  2NPB A;  1AQX A;  2E7P A;  1T3B A;  1U3A A;  4K7I A;  4MZW A;  5B8B A;  2R0G A;  5F06 A;  2MBS A;  3APS A;  2FUG 2;  4XS6 A;  2DLX A;  4GQF A;  1K0C A;  2V32 A;  3VWW A;  3GH6 A;  4K5S A;  2DC5 A;  1AAZ A;  2I1U A;  2C8U A;  4O32 A;  3HY2 A;  1ZYQ B;  2REM A;  3P7X A;  2B7K A;  2F51 A;  3QAW A;  1K0M A;  3VPQ A;  4ECI A;  1GH2 A;  2IJY A;  2B1L A;  1YKC A;  4EE0 A;  3L4N A;  4O5Q A;  5G31 A;  4OCF A;  1F37 A;  1JHB A;  5IMV A;  2CQ9 A;  2NBS A;  4OFM A;  1B8X A;  4L8E A;  3IC4 A;  2H1A A;  3FYG A;  4PGT A;  1ON4 A;  2C1Y A;  2H0I A;  2WFC A;  3QOU A;  1FHE A;  4F0B A;  1SL1 B;  4KCA A;  1SK1 A;  1T7P B;  3LWA A;  5DQS A;  4KUN A;  2P5Q A;  2QGV A;  3M0F A;  3GHA A;  2E2M A;  1TU8 A;  1J9B A;  4KSM A;  5ELG A;  5ECQ B;  1SJZ A;  4J2F A;  3CSI A;  3C73 A;  3GUS A;  2PBJ A;  3GKX A;  19GS A;  1OC9 A;  4XRA A;  5HR1 A;  5AIV A;  1PRX A;  1XWA A;  4QL7 A;  3F0I A;  5G30 A;  4O92 A;  4GCI A;  3UBL A;  2LNT A;  5HQP A;  2VLT A;  4IP1 A;  1OC9 B;  3GTU A;  5AIS A;  1GSE A;  5IMZ A;  12GS A;  3LJR A;  1O81 A;  2F3M A;  4MZC A;  2VCX A;  2XBI A;  1F9M A;  5EPF A;  2CT6 A;  2FWE A;  2VCW A;  3CBU A;  1EOH A;  3GTU B;  1ZYP A;  4MMM A;  1AC1 A;  2YV7 A;  2A2S A;  4MA9 A;  4ZB8 A;  5IPH A;  1Z5Y E;  2AV4 A;  3GNJ A;  1Z7R A;  1O6J A;  5E4W A;  3H79 A;  2PU9 C;  4XS4 A;  5HFK A;  2WDU A;  1UC7 A;  1Q98 A;  2C0D A;  1V98 A;  3OR5 A;  5KN1 A;  4KE3 A;  3KXO A;  5A5K A;  1FVJ A;  4YQM A;  3TJG A;  3LXZ A;  4XS4 B;  3LFL A;  2PVO C;  1SL2 B;  2MZC A;  1X9M B;  3H4K A;  4OCE A;  4CDO A;  4RQX A;  4WR5 A;  3ZLP A;  2DKH A;  4POM A;  5HR3 A;  2PER A;  2GTU A;  2ZUP A;  1BG5 A;  1GTU A;  2FCH A;  2H0G A;  2C3N A;  3HZ8 A;  1WRY A;  1GSS A;  4TOP A;  4X43 A;  3IK9 A;  2N5A A;  2WS2 A;  3QR6 A;  4JED A;  1ZGN A;  4ML1 A;  1WWJ A;  2L5O A;  2DJ3 A;  4MK3 A;  1OE7 A;  4TRX A;  3W8J A;  3P90 A;  3RPP A;  1TP9 A;  2PN8 A;  4KND A;  5JCW A;  1A2M A;  4HJ2 A;  2LRN A;  4BL7 A;  3GH9 A;  3FHK A;  4JE1 A;  4V2L A;  5EY6 A;  1PL1 A;  2VOC A;  4YH2 A;  4O7H A;  1GWC A;  1F3A A;  1XIY A;  3HA9 A;  4Q5N A;  5IMF A;  6GSW A;  3VK9 A;  2WRT A;  2VD1 A;  2O87 A;  4BL7 B;  4EF0 A;  2CVK A;  4JBB A;  4AF2 A;  10GS A;  1AQV A;  4XCS A;  3R2Q A;  3APQ A;  1OVN A;  2KLX A;  4GSN A;  1PMT A;  2X49 A;  4N30 A;  2P5R A;  3HVV A;  4KB3 A;  4EKZ A;  2JL4 A;  9GSS A;  3UVT A;  1TI3 A;  4OD7 A;  2I9H A;  5BMU A;  1G6Y A;  2QC7 A;  2EIQ A;  1SK2 A;  4ZL8 A;  4MJB A;  1GUK A;  1WOU A;  2QA2 A;  1NHY A;  5D9T A;  1K0O A;  5KN2 A;  3A2V A;  3HJP A;  1SKW B;  2L4Q A;  1GSQ A;  5J4U A;  3EU3 A;  3BD2 A;  4PNG A;  3DD3 A;  3D4T A;  1XWB A;  3TRQ A;  5AN1 A;  2YAN A;  6GSV A;  2LNS A;  1GSY A;  3TJK A;  2QKE A;  2HI7 A;  4JZQ A;  1HD2 A;  4I2T A;  3FR6 A;  2P0G A;  4F0C A;  3ZIV A;  2DIZ A;  2XBQ A;  3GIX A;  1M99 A;  3IHQ A;  3E9J B;  3TGZ A;  1O8X A;  1Z6M A;  3ERW A;  3LQ7 A;  2VUP A;  3L9S A;  3VFI A;  4F9Z A;  4HUA A;  2H6X A;  5J5N A;  3UVH A;  2C3Q A;  3D21 A;  4JU5 A;  4CHS A;  1SEN A;  1PQN A;  3L9V A;  5IOX A;  2A2P A;  3N9J A;  3DML A;  3G7J A;  4NV5 A;  2M46 A;  1JFU A;  2WB9 A;  2LTK A;  4KF9 A;  2KUC A;  3HKR A;  2BTO T;  2VL2 A;  4EDZ A;  5H5R A;  1WP0 A;  4ICY A;  1YDK A;  4ZBA A;  4TR0 A;  1B48 A;  2WZ9 A;  1X0R A;  2Z9S A;  2K18 A;  2OAD A;  5CRD A;  2FWF A;  3TKS C;  1BX9 A;  1MD4 A;  1XPV A;  3C71 A;  4JRR A;  3ZRE A;  2YWN A;  3CXG A;  5LD0 A;  5GSS A;  1C72 A;  2R0C A;  3IAS 2;  4EVM A;  3FK8 A;  3UAP A;  1K3L A;  4EDY A;  3TJF A;  2K9F A;  3MYD A;  4WR4 A;  1HNC A;  3S9F A;  3KM6 A;  1T8E B;  1MD3 A;  2O85 A;  3UBK A;  17GS A;  1A8L A;  1AUC A;  2FGX A;  2H71 A;  3RDW A;  1XW9 A;  6GSX A;  1TI1 A;  1NSW A;  4MP4 A;  3EVI A;  4XTS A;  3F9U A;  1JLV A;  3E3E A;  1SL0 B;  5IMC A;  2DSA A;  1H75 A;  4GST A;  4MF7 A;  2C0F A;  3CRT A;  2AYT A;  3F3R A;  2YCD A;  2IMK A;  3TKP A;  4ZL7 A;  2YWM A;  4ISD A;  4KH7 A;  5B8A A;  2L4C A;  4TN8 A;  2LRT A;  4DEJ A;  4IGJ A;  3VWV A;  3KJY A;  2YJ7 A;  1PSQ A;  1A2L A;  3K8N A;  2VIM A;  4NHW A;  3L9U A;  4MJA A;  3HJM A;  4K5R A;  1XWK A;  4HZ2 A;  4NMU A;  2N5F A;  2O7K A;  4YQU A;  1R5P A;  3DGQ A;  2HXK A;  1DSB A;  3MSZ A;  4K9Z A;  4RQR A;  1RW1 A;  2MMZ A;  2I4A A;  3UJ1 A;  1SKS B;  2PMT A;  1SYR A;  1A0F A;  1MTC A;  4PTS A;  4I97 A;  4IW9 A;  5CRG A;  5D9X A;  4Z2T A;  4K2X A;  2EIO A;  3ZFL A;  3GKM A;  1PX6 A;  3HZ4 A;  3TB2 A;  5HR2 A;  1EV4 A;  2BJX A;  2M80 A;  1FVK A;  1BQ7 A;  4HU9 A;  4E8E A;  3RAZ A;  5IMA A;  1O7U A;  3ZML A;  1G7E A;  1LJR A;  3P8W A;  2YV9 A;  5ECS A;  4PX1 A;  3D6I A;  1HQO A;  3FW2 A;  2O89 A;  1O73 A;  2VL3 A;  3CSH A;  4IJI A;  2HSH A;  3EPT A;  3V1W A;  3FZA A;  1I9D A;  3GFK A;  1OKD A;  3RBT A;  1QXH A;  1N2A A;  2BMX A;  4IHU A;  2R0P A;  1WPI A;  3FZ4 A;  3KGK A;  1Z9H A;  4HEA 2;  3IOS A;  4L5O A;  5G1K A;  2L59 A;  3PIN A;  2DJK A;  3DEX A;  3ZVJ A;  1XVQ A;  4NHZ A;  2KP2 A;  3FMW A;  5B6M A;  1U3I A;  2LJR A;  4MPG A;  1PL2 A;  1QGV A;  3Q74 A;  4CY8 A;  3FRC A;  2YZU A;  1F3B A;  2V6K A;  3F4S A;  5IO2 A;  2HSY A;  5KOW A;  3ZMK A;  2FD3 A;  4J57 E;  2X64 A;  1VGL A;  1XWG A;  1GTA A;  2OJL A;  2E0Q A;  4ECJ A;  4HDE A;  2PGT A;  4V1A g;  2X4A A;  5KEJ A;  1SK0 A;  14GS A;  3G7I A;  4ACS A;  5FHI A;  2X99 A;  3M9K A;  4K8M A;  4ECB A;  1WIK A;  3KMN A;  3VI5 A;  5J41 A;  2JU5 A;  5A4U A;  6GSS A;  3TKQ A;  4DSR A;  2OBK A;  2HNL A;  4FIW A;  3LW9 A;  3QD9 A;  1XZO A;  4XIH A;  2HRK A;  16GS A;  5ELA A;  4DVC A;  4O5R A;  1TRW A;  2TRX A;  3KTB A;  1EWX A;  3DRN A;  1LU4 A;  2ON7 A;  3PH9 A;  3GL5 A;  4F82 A;  4YAP A;  3UIW A;  1F2E A;  2XC2 A;  3GKN A;  3WGD A;  4TKY A;  4EIQ A;  3F4T A;  1UN2 A;  3FR3 A;  4IQA A;  5DJM A;  3IK7 A;  2YOI A;  1YEP A;  3DKS A;  1EZK A;  3F8U A;  4WBJ A;  1XBS A;  3NIV A;  5H5S A;  3HJO A;  2FHE A;  1WE0 A;  4EUY A;  2ALB A;  4DSS A;  5CP1 A;  6GST A;  1XVW A;  3HVS A;  4FQU A;  3KEB A;  1J0F A;  1H4O A;  3R3E A;  2FLS A;  2WCI A;  4Q5Q A;  3LYK A;  3WYW A;  1ACV A;  2DJ0 A;  5LNK e;  4KA0 A;  4ZB9 A;  3CTG A;  2FWG A;  4DSS B;  2GS3 A;  4L0W A;  1ML6 A;  3KP9 A;  1TU7 A;  4K0N A;  2HZE A;  2GQM A;  1SKR B;  3EMX A;  5CAX A;  18GS A;  1Q4J A;  4IP6 A;  4BA7 A;  3HYP A;  2AUV A;  3GMF A;  1A2J A;  2C0E A;  2AJQ B;  5JCU A;  2HZE B;  4X4J A;  4ULX A;  2C0G A;  5DJL A;  3C1S A;  20GS A;  3ZYW A;  2WUL A;  1GSF A;  5G1L A;  2IMD A;  3QMX A;  4OO4 A;  2C3T A;  3DIE A;  3VWU A;  2YWO A;  3GYK A;  5CYY A;  2LV3 A;  3A2W A;  1PX7 A;  4N11 A;  2GST A;  2DJ1 A;  5CRH A;  3TOU A;  3GKK A;  4LLR A;  4XRD A;  1JLW A;  1TW9 A;  2EC4 A;  3UL3 A;  2GQK A;  3Q19 A;  22GS A;  1YEX A;  2PVQ A;  2HT9 A;  3SBC A;  5F07 A;  5ECH B;  2I81 A;  4ID0 A;  4JR4 A;  2GT6 A;  4GLT A;  4FO5 A;  4AJ6 A;  3KIJ A;  2ZNM A;  1XCC A;  3EE2 A;  4OFN A;  1TOF A;  2F8F A;  2A4H A;  2AB6 A;  4G2E A;  2VCT A;  4G19 A;  4KSO A;  3TJJ A;  3WT1 A;  4KDX A;  1G6W A;  1X5E A;  4MH3 A;  2B6M A;  1A23 A;  3RHB A;  1V57 A;  3ED3 A;  3IR4 A;  3QAG A;  1J08 A;  3EIN A;  4MNN A;  4OWY A;  2C80 A;  2R6K A;  3ZIJ A;  2MBT A;  1AIU A;  5DDL A;  4AGS A;  2H74 A;  3QFB C;  1SYX A;  4V2N A;  4MH2 A;  1GTB A;  1U6T A;  2B5Y A;  3ZL5 A;  1KNG A;  2A2R A;  3IC8 A;  5AIX A;  1OC3 A;  3QCP A;  3HXS A;  4RI6 A;  2PWJ A;  5BRT A;  3DXB A;  4JR6 A;  1M0U A;  2R2J A;  4FYC A;  2GSQ A;  4MF6 A;  1FO5 A;  1GL8 A;  2R37 A;  5DCH A;  1LBK A;  3D4M A;  1PKW A;  3A2X A;  4WBR D;  2CV4 A;  2C4J A;  4HJM A;  3NOF A;  1THX A;  2K8S A;  2RLI A;  2H1G A;  3A5I A;  3ZTL A;  1XFL A;  3M9J A;  4BWQ A;  5B7C A;  4CY6 A;  1EOG A;  3WGE A;  1V58 A;  3LOR A;  4YQV A;  1EP8 A;  4D73 A;  1ERT A;  3FZ5 A;  3ME7 A;  4ZB6 A;  3CMI A;  5D9W A;  2DIY A;  4KCE A;  2FA4 A;  2VO4 A;  5EL8 A;  4KX4 A;  5JWO B;  3VLN A;  2JSZ A;  4D73 B;  1ZL9 A;  3IHG A;  4POL A;  1V40 A;  2H66 A;  3J7Y b;  5CRW A;  1CQH A;  2RM5 A;  2J9H A;  4PXO A;  1T4Y A;  5D93 A;  4LL4 B;  2YNX A;  3D0Z A;  1Y25 A;  2O8V B;  3PGT A;  1A8Y A;  4WXT A;  2CA8 A;  1K0B A;  1M7T A;  3C8E A;  3TRP A;  2FY6 A;  1K0D A;  4I5Q A;  4POK A;  5IPG A;  1YZX A;  2QA1 A;  1GLQ A;  5GZZ B;  2XPD A;  3ZIT A;  4FYB A;  4BPY A;  4ILF A;  2OA7 A;  4PNF A;  1F6M C;  4O5U A;  3KCM A;  2GVP A;  3PPU A;  1YQ1 A;  3GV1 A;  4TR3 A;  2VCQ A;  3P2A A;  4HQS A;  3W6G A;  4MJE A;  1FAA A;  2GLR A;  1TRS A;  1YY7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...