4BWSA

Crystal structure of the heterotrimer of pqbp1, u5-15kd and u5-52kd.
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
133
structure length
133
Chain Sequence
LPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWAMEDKQEMVDIIETVYRGARKGRGLVVSPKDYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THIOREDOXIN-LIKE PROTEIN 4A
publication title Mutations in the Pqbp1 Gene Prevent its Interaction with the Spliceosomal Protein U5-15Kd.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 42
structure length 133
sequence length 133
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02966 DIM1 Mitosis protein DIM1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4bwsA00
2LQOA 2B5YA 1FG4A 1SYXA 5HR3A 4GTUA 4J56E 1A2JA 3M8NA 2GVPA 1MDKA 4ZB9A 1TXXA 4FIWA 4GRFA 4MJCA 3CXGA 5GAPD 3CRTA 1ST9A 3APSA 4OWYA 5A4WA 4L0WA 2OACA 1URMA 5CREA 2VIMA 1NSWA 1QFNA 2BTOT 2KP2A 2IFQB 1F6MC 1UVZA 4NMUA 2PVQA 2H1DA 5GZZB 2PPTA 5ECMB 1F37A 4L8EA 2C1YA 2L5LA 3M3MA 3ZLPA 3FR6A 4MP4A 5LCZA 4TXOB 3IAM2 1OC8A 3ZMLA 5HR0A 2GT6A 4MABA 2L6CA 3GKMA 2HRNA 1XBSA 1SKSB 1NHYA 2GSRA 5CRWA 3A5WA 1B9XC 3HXSA 3CBUA 2C3QA 1K0NA 1XWGA 3MWHA 1U87A 5HFIA 1AUCA 3EMPA 1SD8A 2GDRA 3LG6A 1GUKA 1TK0B 1T8EB 3ZL5A 2B1KA 1BJXA 1RQMA 3F0IA 4MA9A 2VM2A 5H5QA 3KJYA 3HCZA 1AC1A 1QMVA 3H8QA 1W4VA 3BJ5A 1GLPA 4G2EA 2C80A 4AF2A 4ZBBA 7GSSA 4IS0A 3HZ4A 4GSTA 3FZAA 2VLVA 1F9MA 1VF4A 2VCXA 1ACVA 3FK8A 3QMXA 1GTIA 1AQWA 4F82A 4Q5RA 1JLWA 4ISDA 5DJMA 3IV4A 1V57A 3APQA 5IO0A 5JWQB 3WGXA 1F3AA 2MMOA 3CSIA 4IP6A 3CMIA 3RPPA 3DKSA 5IQYA 1BG5A 2KLXA 5L71A 4ULXA 1H75A 4J57E 1SL1B 2OE1A 4MPFA 2YN1A 2GQKA 2YPMA 2NBSA 2GZYA 3D4MA 3GMFA 4ACSA 3TRXA 4LA1A 2XC2A 3D22A 1B9YC 3E0UA 2LRNA 3DMLA 4IQ1A 5JCWA 1GSEA 2O7KA 1XWKA 4E8EA 2KUCA 2BMXA 1ZYQB 2H71A 3ZZXA 3P8WA 5CYYA 4IHUA 10GSA 4G19A 3Q18A 2CAQA 3HJPA 2L57A 2H30A 1TU8A 1EP7A 2H6XA 2KP1A 1PGTA 3BCIA 5DALA 1TRSA 1K0OA 4IKHA 4MF5A 4MDCA 1PMTA 3HKRA 1XVQA 4Q5FA 4ECBA 5DVBA 2O8VB 4IW9A 1PL1A 4KDXA 5IIZA 1PD21 1R26A 1YF1A 3W8SA 3FR3A 2OE3A 4MMMA 3R2QA 5A4UA 3SBCA 1KBNA 1JFUA 3F3QA 3LFLA 4ECCA 2I4AA 1YQ1A 3FZ4A 5CRHA 2H01A 2TRXA 3KTBA 4QL7A 3UMAA 5D93A 1U6TA 5G5EA 4NHWA 2J9HA 2L6DA 4ML1A 3C71A 3HJMA 4OCFA 2JZSA 2DLXA 1GP1A 2L4CA 4YAVA 4KUNA 3JCML 2AHEA 1Z9HA 4TRXA 4JE1A 2DBCA 1QK8A 4ZL8A 4MCUA 5JWOB 4LMWA 5JCUA 2YP6A 5LNKe 3HVSA 1J9BA 5HR2A 1QUWA 4HDEA 3VWVA 1DE1A 1XWAA 5GAND 8GSSA 2VCVA 2AV4A 3TCOA 3HZ8A 5DCHA 4N0ZA 1VF2A 5CO3A 2GZZA 2EIRA 4CHSA 2GSTA 5ID2B 1TU7A 4DSQA 4EF0A 3F63A 2GGTA 2N5FA 3G7IA 2R37A 4K0GA 3U6VA 2REMA 2XHFA 4XS1A 1SL2B 5AISA 5G31A 3FZ5A 4MH2A 1GNWA 2XPDA 4NPBA 4D73A 2OE0A 3BOAA 1TK8B 1XWCA 1O8WA 1SL0B 4OCEA 4BPYA 1V40A 4DSSB 3FEUA 2H73A 3TKSC 2CA8A 4F03A 5EY6A 2LRTA 1QXHA 5DAKB 2PU9C 3ZFBA 1V2AA 3NZNA 1PQNA 2AB6A 4K1FA 2A2SA 1ZZYA 2IIYA 1AQVA 4KGIA 4MJAA 1X9WB 3A3TA 4NXIA 3TJBA 3I9V2 3A2WA 2ZUPA 5ELGA 1OE7A 2YZHA 3D4TA 1KTEA 3VPTA 2K8SA 3O76A 5IM9A 4WR5A 2Z9SA 2MMAA 3RBTA 1SYRA 2FNOA 1Y25A 2V2GA 1A8YA 4GWRA 3UVTA 2D2ZA 4KSOA 2H19A 2JL4A 4ECJA 4MF7A 3MNGA 2NTOA 13GSA 3GURA 1T7PB 3FYGA 4PUFC 3CYNA 3HHVA 3WD6A 3Q74A 2GTUA 1O7UA 2HE3A 4KDUA 4POLA 2HZEA 2ALBA 3VLNA 4OMVA 2H6YA 2CX4A 1XVWA 3G7JA 2FCHA 1TRWA 3KM6A 2NVLA 2B6MA 2C0FA 4MJBA 4EVMA 5HFKA 1DBYA 4HS1A 3GL5A 1GUHA 1X9SB 4BWSA 3F4SA 1J08A 3NIVA 4IELA 2B7KA 2N5AA 1SU9A 2R5GA 3KMOA 4TR1A 4X43A 4KCAA 2HI7A 3QOUA 4MPGA 2PVOC 1M2AA 2B7JA 5B8BA 1AXDA 4ID0A 1GTAA 1B8XA 4LL1B 4OO5A 1X0RA 1PL2A 3RDWA 2OJLA 2GQLA 2VL3A 5KN1A 5ECNB 4ZB6A 1G0TA 1NW2A 1B48A 4HJMA 4HQSA 1U3AA 2PBJA 2C0EA 2K18A 2HZFA 2VCZA 2FWHA 3IA1A 4PGTA 4MF6A 1WE0A 2C3TA 2VLUA 1GSSA 1PRXA 3IHQA 3PGTA 2V6OA 3LORA 1V58A 1DUGA 2EIQA 4QQ7A 2MMNA 2CVBA 3V1WA 1GTBA 1IYHA 3UL3A 2AYTA 2VL2A 3F8UA 4EDYA 4ILFA 1K0MA 3C1SA 2KHPA 2FGXA 3QCPA 4MLYA 1XOBA 5IMAA 2V32A 1TTZA 1EZKA 4K7NA 5IOXA 2YWOA 4ZIJA 1EEMA 4PQHA 4PQIA 1HD2A 1Y6EA 5IMVA 3EE2A 2QSIA 1Z6NA 5ENUA 4WBJA 2I1UA 4G9HA 3S9FA 3CTGA 3N5OA 2GZPA 1XPVA 3KEBA 3MDKA 3QR6A 1KNGA 1YKAA 2ZCTA 5C04A 4NV2A 4DSRA 5C00A 1PKWA 2WGRA 5CRDA 4GF0A 3IRAA 2CZ3A 1ML6A 1OYJA 2HFDA 4I6XA 3FW2A 4KAEA 2WRTA 1PX6A 4HZ2A 3VFIA 5DQYA 2MYGA 1TKDB 1FAAA 4K8MA 2H1GA 2EIOA 1G7OA 2LJKA 1TOFA 4IGJA 4V2LA 3IC4A 3RHCA 3HVVA 4J2FA 4BL7A 2XBIA 1G6YA 2XBQA 4RUVA 1WRYA 3GA4A 1ZCPA 2LJRA 4MK3A 2I3YA 3KGKA 5G1LA 4F9ZA 4KE3A 2CX3A 2IMFA 4O7HA 4K9ZA 4BWQA 6GSWA 2HT9A 2IL3A 2WJUA 5D9WA 5LD0A 4OO4A 2GLRA 1OAZA 3US3A 3DVWA 4IP1A 2YWNA 3ISOA 2GSQA 3M1GA 2QC7A 1JZWA 4TXOA 2AJQB 4KH7A 4FYCA 4WBRD 4JZQA 1GSFA 2LRCA 4YH2A 5DBQA 4BVYA 3L78A 1K0CA 3VWWA 1S3DA 2M80A 3C7MA 3G9BA 1LJRA 1XCCA 4G10A 4WR4A 1YZXA 1HYUA 2F8FA 2R2JA 1FO5A 1YF0A 3UOMA 3TOUA 5INYA 14GSA 3VWUA 2GT5A 2DJ1A 1YJ6A 2YV9A 1R4WA 1M2DA 4AJ8A 4ZL7A 2JACA 5A5KA 2JZTA 3FY7A 2AUVA 2YOIA 1EV4A 2VL2C 3BCKA 1WJKA 1ZGNA 2VO4A 3CTFA 1GSDA 2IWTA 4BVXA 4IN0A 3PR8A 5CNWA 3M9JA 4WETA 1SK1A 1S3AA 3TKRA 1EEJA 2ON7A 3L0HA 5KN2A 1O81A 5DALB 3FZ9A 2C3NA 2CQ9A 5IPGA 2VOCA 2JADA 4I8BA 1FW1A 4GQCA 1K3OA 2H74A 3A2XA 2H70A 4OD7A 2AAWA 3L9VA 4FO5A 4I2UA 4X0XA 3GSTA 4AJ7A 3P90A 1G6WA 1Z7RA 4PURA 1DE2A 2H72A 3IE3A 2FWGA 1S3CA 2M72A 2VUPA 3TKQA 2WDUA 4HI7A 1AQXA 1PX7A 2X8CA 2K8VA 3D6IA 1XIYA 1AAZA 1GSQA 1RK4A 2K6VA 3GYKA 4PQ1A 4K2DA 2OADA 3SWLA 1IYIA 4HU9A 1YEXA 3M9KA 1SJZA 2C0GA 1OC3A 3HJOA 3ZVJA 5GSSA 2H1AA 6GSXA 1MD3A 5DJLA 3I69A 1A2LA 1KEBA 1AIUA 2WFCA 1TK5B 4GLTA 5J9BA 5HR1A 4NV5A 1WWJA 4YAPA 4POKA 4GCIA 5EL8A 1FHEA 3WT1A 1HNBA 4WEYA 1X5CA 5D9TA 2KOKA 5D73A 1W89A 5H5SA 2WCIA 4F2IA 4HOJA 6GSYA 4EE0A 4XRAA 3LYKA 4TR3A 3VI5A 1O6JA 2A4VA 5IMDA 5ECQB 4MJEA 4FYUA 2IPAA 1MD4A 4HU7A 2DJ0A 5B6NA 3GX0A 2YV7A 4EL1A 1MDIA 2N5BA 3D21A 2OBIA 4POMA 4IQAA 4IJIA 4AGSA 1OC9B 2TIRA 4ZL9A 3CRUA 2YCDA 4O92A 5CAXA 3F4RA 5JWRB 1TI1A 3RPNA 4HZ4A 3RHBA 3HA9A 3O6TA 2OBKA 2F8AA 1FVKA 5HFGA 1A0FA 5COHA 1JZRA 2IN3A 3J7Yk 3UARA 3N9JA 1EV9A 1R7HA 1UA5A 2GS3A 1YDKA 5F0GA 18GSA 3DIEA 1ON4A 4ECIA 1GSYA 1GULA 4XS4A 3QFBC 3IR4A 5B7CA 3W6GA 1Q4JA 1GRXA 3KH9A 4JEDA 4WXTA 3TKPA 5FT3A 1OKTA 1U88A 3ZVJD 3UEMA 2E0QA 4N11A 2A2RA 16GSA 4LL4B 1OE8A 3E3EA 5ID2A 1X5DA 2LKUA 2WB9A 3CSJA 2I9HA 1A23A 1WIKA 3GH9A 1MDJA 2F51A 1VF1A 4JR6A 1EGRA 3ZIJA 2YWMA 3MSZA 4KDYA 22GSA 3F3RA 1R5PA 2LJAA 3IK9A 17GSA 2CVDA 3KMNA 2LUSA 3H79A 3EURA 3P2AA 5DAKA 2RM6A 2PN8A 1UN2A 3LXZA 2P31A 2LQQA 1SKRB 1GLQA 3TKSE 4N10A 5FHIA 3LXTA 3A2VA 2P5QA 2HSYA 3OR5A 5F07A 1WP0A 1XXUA 1FOVA 3P7XA 1BX9A 20GSA 4PNGA 2C4JA 5ABRA 3DRNA 3UIWA 3LSZA 3TJFA 3GHAA 2NPBA 3ERFA 4JBBA 2RUFA 1H4OA 3C1RA 3KP9A 6GSTA 2X8GA 1ILOA 3NOFA 3GTUB 5ELAA 2ON5A 3UAPA 3PINA 5J3RA 4GSNA 1Z7PA 4ZB8A 4L0UA 2VAFA 3KH7A 3CSHA 1OKDA 5E59A 2JU5A 1MTCA 2YANA 1BEDA 1FVJA 4YQUA 1Z6MA 3GIXA 2LNTA 3QPMA 2XPEA 1DSBA 3TRQA 4L5LA 2MMZA 3LWAA 2DC5A 4KW6A 4HJ2A 2FUG2 3KCMA 4GQFA 1TI3A 3ED3A 2VCQA 2DJ2A 4O5RA 4E8HA 3QAWA 1XFLA 1WMJA 3DD3A 3IDVA 2O87A 3L9UA 5FWGA 3EYTA 1EP8A 3GKNA 2H0IA 1X5EA 6GSUA 2R4VA 3GRXA 4RI6A 3H93A 1XW6A 3UJ1A 4WF4A 2YJHA 3GKXA 1FB0A 2H75A 1HQOA 2P0GA 2H1BA 2DMLA 2WS2A 2YZUA 4N0VA 2LEGA 1T00A 5F05A 5IMCA 3M0FA 2QGVA 2L5OA 1SD9A 1U3IA 2VD1A 2O89A 2JSZA 2VL9A 4XS6A 3C8EA 3IBHA 1ABAA 3ME7A 1K3LA 3TDGA 1Z5YE 2G0FA 3GNJA 1XW5A 4X1UA 1XOAA 4P3YB 2PERA 1T4YA 2H0GA 3C73A 5G5FA 4ML6A 2DSAA 4EC0A 3IAS2 5D9XA 5KN0A 1ERWA 2C0DA 1YY7A 3WYWA 3F4TA 2MBSA 2OA7A 3LGCA 2FA4A 3Q19A 3HD5A 3D0ZA 5AGYA 5IMZA 3ZITA 3I6AA 2B3SA 4IBPA 4WF5A 5ECKB 5ECRB 5E4WA 4I2TA 1B4QA 3AY8A 5KEJA 4Q5QA 1V9WA 4EXJA 4V2MA 2IFQA 5J9CA 3GV1A 3F9UA 3H1NA 1XZOA 2RM5A 5KN3A 1I9DA 4TVEA 2F9SA 2M46A 4EO3A 3ZRDA 1C72A 2BJXA 4TR0A 2JSYA 4RI7A 3ZIVA 3RAZA 1GL8A 3WGEA 3WT2A 1R5AA 4L5OA 4H86A 1Q98A 1O8XA 4CDOA 3DXBA 2I81A 3ZTLA 5IOWA 1A2MA 2NDOA 3GKKA 4V1Ag 1RW1A 1M9AA 1EOHA 2ZNMA 2PGTA 4I5QA 1BAYA 1F2EA 2RLIA 4V2NA 2HXKA 3APOA 2G2QA 2YWIA 3MAKA 1JLVA 1M7TA 4TXVA 5GSTA 4HQZA 1UC7A 3IXRA 4IVFA 2L59A 4F0BA 1NM3A 1ZYEA 3DEXA 2CZ2A 2MZCA 2OKAA 5G2ZA 3FHKA 2E7PA 1VRSD 4NWYA 4QL9A 3KIJA 5ECHB 1O85A 2H66A 3I43A 5G1KA 2CAIA 2LV3A 4KNDA 1ZL9A 3HDCA 5DQSA 3FKFA 1M0UA 2E2MA 3WGDA 1ERUA 1I5GA 3EU3A 4JRRA 1YKCA 1XWBA 4KB3A 3O3TA 1PSQA 2VM1A 4NHZA 1FB6A 5F06A 5EPFA 2TRCP 2VD0A 2H76A 3IPZA 3GH6A 4MZCA 4PUAA 4HEA2 3J7Yb 4IJ3A 5J5NA 5DDLA 1EOGA 4F0CA 5F8BA 9GSSA 3GL3A 2HRFA 3TUEA 2IMIA 3TKSA 2FWFA 3GN3A 2B5XA 4XCSA 3EWLA 4TR4A 2FA8A 3TJGA 3FR9A 3EC3A 3EU4A 4POBA 5JCGA 1SKWB 3VURA 1K0BA 3TOTA 6GSVA 1M99A 4LMVA 1T4ZA 3Q6OA 4MZWA 1EWXA 4K0NA 4O32A 4ZBDA 1TDIA 3QD9A 5J4UA 4KA0A 1VGLA 2HYXA 3EVIA 5HQPA 1PA3A 5ECSA 2PMTA 6GSSA 1XW9A 3HVXA 5AN1A 3EINA 4RQXA 4DEJA 1QGVA 1B4PA 3QDNA 4XTSA 5IO2A 1M2BA 5IMFA 5IPHA 2RUEA 4Q5NA 4ZXGA 1A24A 5CP1A 2DIYA 1ERTA 4YQMA 1USBA 4EDZA 4OFMA 4BA7A 3QAVA 4JU5A 1PN9A 2LNSA 2CVKA 2K9FA 1LU4A 4WKWA 5H5RA 1ERVA 2FD3A 1JZOA 3F6DA 1TJDA 1BYEA 2DJKA 3TB2A 1EGOA 3ZREA 4D73B 4K6XA 1TRUA 4Z7XA 2H8LA 2VCWA 4XS4B 3QFAC 4XRDA 3ZYWA 2DMMA 5J41A 2O85A 1TP9A 3IK7A 1BQ7A 3ERWA 19GSA 2YNXA 1ZOFA 2HLSA 2HSHA 4OFNA 1O73A 4GXZA 3U5RE 5D9VA 3LQ7A 1WPIA 1CQHA 2MBTA 2X8HA 3UVHA 1LBKA 2C8UA 1SK0A 1ZMAA 4EKZA 4GSSA 5G30A 12GSA 2FLSA 2B1LA 2R6KA 1GTUA 2H0HA 5D8IA 1OC9A 1V98A 3GSSA 3UBLA 4MH3A 4K7IA 1OVNA 2JZRA 3DGQA 4FYBA 2LSTA 4N30A 4TKYA 3HY2A 4AJ6A 5B8AA 1M9BA 1THOA 4YQVA 1GH2A 3GFKA 2VLTA 1JZDA 3FRCA 3HYPA 4CW9A 5ECIB 4LLRA 2DJ3A 2FHEA 3BBYA 4XIHA 3QAGA 5CRGA 3LJRA 2V6KA 1N8JA 3PH9A 2PUKC 3TGZA 3TRPA 3LEFA 4DSSA 5D96A 2LTKA 5ECPB 2HZEB 1TRVA 4MZBA 3DYRA 1QQ2A 1HNAA 4OFTA 3KZQA 3L4NA 1MEKA 2IMEA 3E9JB 3KD0A 4K7OA 4ZBAA 3ME8A 4XHMA 4V1Ap 3VK9A 3GX8A 2EC4A 4PX1A 3UBKA 4HUAA 3L9SA 3VI7A 4KX4A 1E2YA 2QKEA 2IMKA 2R3XA 3KXOA 1VF3A 2WULA 3KTLA 2FY6A 11GSA 4TR1B 3EMXA 2CV4A 1A8LA 2F3MA 3GUSA 4I97A 5ECLB 1Z3EA 3ZMKA 1PKZA 3K8NA 3DVXA 4KSMA 4PNFA 1F3BA 2VCTA 3D5JA 3TJKA 2FWEA 3ERGA 5A4VA 1GSUA 2L4QA 3LYPA 1SJ6A 2GQMA 5EVOA 3F6FA 3G7YA 3TJJA 1CQGA 4PXOA 2ES7A 1NHOA 1K0DA 1WOUA 2X99A 1X9MB 1G7EA 2GSSA 3VPQA 1E6BA 3IOSA 4JR4A 2WZ9A 2HNLA 2H6ZA 4ZILA 3DWVA 2DJJA 4TOPA 1T1VA 1GNEA 2B5EA 5B6MA 1T3BA 2V1MA 1GWCA 4TW5A 5AIVA 1HNCA 1THXA 3BD2A 1TW9A 1A0RP 3GTUA 4FH8A 5DCGA 4EUYA 1SK2A 4DVCA 2PWJA 3W8JA 2RIIA 2LS5A 1N2AA 1SENA 1SJIA 2DIZA 1K0AA 1JHBA 5ECOB 2X64A 1K3YA 4KCEA 4RQRA 2CT6A 3KP8A 2V41A 3VWXA 2IJYA 4NAXA 2IMDA 3ZFLA 2J23A 5AIXA 3H4KA 1J0FA 1YEPA 4TN8A 1AW9A 1GUMA 2YJ7A 2E2GA 2P5RA
chains in the Genus database with same CATH superfamily
2LQOA 2R0GA 2B5YA 1FG4A 1SYXA 5HR3A 4GTUA 4J56E 1A2JA 3M8NA 2GVPA 1MDKA 4ZB9A 1TXXA 4FIWA 4GRFA 4MJCA 3CXGA 4BL7B 5GAPD 3CRTA 1ST9A 3APSA 4OWYA 5A4WA 4L0WA 2OACA 1URMA 5CREA 2VIMA 1NSWA 1QFNA 2BTOT 2KP2A 2IFQB 1F6MC 1UVZA 4NMUA 2PVQA 2H1DA 5GZZB 2PPTA 5ECMB 1F37A 4L8EA 2C1YA 2L5LA 1ZYNA 3M3MA 3ZLPA 3FR6A 4MP4A 5LCZA 4TXOB 3IAM2 1OC8A 3ZMLA 5HR0A 2GT6A 4MABA 2L6CA 4BVYB 3GKMA 2HRNA 1XBSA 1SKSB 1NHYA 2GSRA 5CRWA 3A5WA 1B9XC 4K2XA 3HXSA 3CBUA 2C3QA 1K0NA 1XWGA 3MWHA 4X4JA 1U87A 5HFIA 1AUCA 3EMPA 1SD8A 2GDRA 3LG6A 1GUKA 1TK0B 1T8EB 3ZL5A 2B1KA 1BJXA 1RQMA 3F0IA 4MA9A 2VM2A 5H5QA 3KJYA 3HCZA 1AC1A 1QMVA 3H8QA 1W4VA 3BJ5A 1GLPA 4G2EA 2C80A 4AF2A 4ZBBA 7GSSA 4BVXB 4IS0A 3HZ4A 4GSTA 3FZAA 2VLVA 1F9MA 1VF4A 2VCXA 1ACVA 3FK8A 3QMXA 1GTIA 1AQWA 4F82A 4Q5RA 1JLWA 4ISDA 5DJMA 3IV4A 1V57A 3APQA 5IO0A 5JWQB 3WGXA 1F3AA 2MMOA 3CSIA 4IP6A 3CMIA 3RPPA 3DKSA 5IQYA 1BG5A 2KLXA 4MNNA 5L71A 4ULXA 1H75A 4J57E 1SL1B 2OE1A 4MPFA 2YN1A 2GQKA 2YPMA 2NBSA 4O5UA 1FOHA 2GZYA 3D4MA 3GMFA 4ACSA 3TRXA 4LA1A 2XC2A 3D22A 2X4AA 1B9YC 3E0UA 2LRNA 3DMLA 4IQ1A 5JCWA 1GSEA 2O7KA 1XWKA 4E8EA 2KUCA 4Z2UA 2BMXA 1ZYQB 2H71A 3ZZXA 3P8WA 5CYYA 4IHUA 10GSA 4G19A 3Q18A 2CAQA 3HJPA 2L57A 2H30A 1TU8A 1EP7A 2H6XA 2KP1A 1PGTA 3BCIA 5DALA 1TRSA 1K0OA 4IKHA 4MF5A 4MDCA 1PMTA 3HKRA 1XVQA 4Q5FA 4ECBA 5DVBA 2O8VB 4IW9A 1PL1A 4KDXA 5IIZA 1PD21 1R26A 1YF1A 3W8SA 3FR3A 2OE3A 4MMMA 3R2QA 5A4UA 3SBCA 1KBNA 1JFUA 3F3QA 3LFLA 4ECCA 2I4AA 1YQ1A 3FZ4A 5CRHA 2H01A 2TRXA 3KTBA 4QL7A 4K5SA 3UMAA 5D93A 1U6TA 5G5EA 4NHWA 2J9HA 2L6DA 4ML1A 3C71A 3HJMA 4OCFA 2JZSA 2DLXA 1GP1A 2L4CA 4PTSA 4YAVA 4KUNA 3JCML 2DKHA 2AHEA 1Z9HA 4TRXA 4JE1A 2DBCA 5KOWA 1QK8A 4ZL8A 4MCUA 5JWOB 4LMWA 5JCUA 2YP6A 5LNKe 3HVSA 1J9BA 5HR2A 1QUWA 4HDEA 3VWVA 1DE1A 1XWAA 5GAND 8GSSA 2VCVA 2AV4A 3TCOA 3HZ8A 5DCHA 4N0ZA 1VF2A 5CO3A 1S3RA 2GZZA 2R0PA 2EIRA 4CHSA 4EIPA 2GSTA 5ID2B 1TU7A 4DSQA 4EF0A 3F63A 2GGTA 2N5FA 3G7IA 2R37A 4K0GA 3U6VA 2REMA 2XHFA 4XS1A 1SL2B 5AISA 5G31A 4YKGA 3FZ5A 4MH2A 1GNWA 2XPDA 4NPBA 4D73A 2OE0A 3BOAA 1TK8B 1XWCA 1O8WA 4YKFA 4ICYA 1SL0B 4OCEA 4BPYA 5BMUA 1V40A 4DSSB 3FEUA 2H73A 3TKSC 2CA8A 4F03A 5EY6A 2LRTA 1QXHA 5DAKB 2PU9C 3ZFBA 1V2AA 3NZNA 1PQNA 2AB6A 4K1FA 2A2SA 1ZZYA 2IIYA 1AQVA 4KGIA 4MJAA 1X9WB 3A3TA 4NXIA 3TJBA 3I9V2 3A2WA 2UZ8A 2ZUPA 5ELGA 1OE7A 2YZHA 3D4TA 1KTEA 3VPTA 2K8SA 3O76A 5IM9A 4WR5A 1M3IA 2Z9SA 2MMAA 3RBTA 1SYRA 2FNOA 1Y25A 2V2GA 1A8YA 2X49A 4GWRA 3UVTA 2D2ZA 4KSOA 2H19A 2JL4A 4ECJA 4MF7A 2HSMA 3MNGA 2NTOA 13GSA 3GURA 1T7PB 3FYGA 4PUFC 3CYNA 3HHVA 3WD6A 3Q74A 2GTUA 1O7UA 2HE3A 4KDUA 4POLA 2HZEA 2ALBA 3VLNA 4OMVA 2H6YA 2CX4A 1XVWA 3G7JA 2HRKA 2FCHA 1TRWA 3KM6A 2NVLA 2B6MA 2C0FA 4MJBA 4EVMA 5HFKA 3MIXA 1DBYA 4HS1A 3GL5A 1GUHA 1X9SB 4BWSA 3F4SA 1J08A 3NIVA 4IELA 2B7KA 2N5AA 1SU9A 2R5GA 3KMOA 4TR1A 4X43A 4KCAA 2HI7A 3QOUA 4MPGA 2PVOC 1M2AA 2B7JA 5B8BA 1AXDA 4ID0A 1GTAA 1B8XA 4LL1B 4OO5A 1X0RA 1PL2A 3LW9A 2OJLA 3RDWA 2GQLA 3MYDA 2VL3A 5KN1A 5ECNB 4ZB6A 4G0LA 1G0TA 1NW2A 1B48A 4HJMA 4HQSA 1U3AA 2PBJA 2C0EA 2K18A 2HZFA 2VCZA 2FWHA 3IA1A 4PGTA 4MF6A 1WE0A 2C3TA 2VLUA 1GSSA 1PRXA 3IHQA 3PGTA 2V6OA 3LORA 1V58A 1DUGA 2EIQA 4QQ7A 2MMNA 2CVBA 3V1WA 1GTBA 1IYHA 3UL3A 2AYTA 2VL2A 3F8UA 4EDYA 4ILFA 1K0MA 3C1SA 2KHPA 2FGXA 3QCPA 4MLYA 1XOBA 5IMAA 2V32A 1TTZA 1EZKA 4K7NA 5IOXA 2YWOA 4ZIJA 1EEMA 4PQHA 4PQIA 1HD2A 1Y6EA 5IMVA 3EE2A 2QSIA 1Z6NA 5ENUA 4WBJA 2I1UA 4BIKA 4G9HA 3S9FA 3CTGA 3N5OA 2GZPA 1XPVA 3KEBA 3MDKA 3QR6A 1KNGA 1YKAA 2ZCTA 5C04A 4NV2A 4DSRA 5C00A 1PKWA 2WGRA 5CRDA 4GF0A 3IRAA 2CZ3A 1ML6A 1OYJA 3HVNA 2HFDA 4I6XA 3FW2A 4Z2RA 4KAEA 2WRTA 1PX6A 4HZ2A 3VFIA 5DQYA 2MYGA 1TKDB 1FAAA 4K8MA 2H1GA 2EIOA 1G7OA 2LJKA 1TOFA 4IGJA 4V2LA 3IC4A 3RHCA 3HVVA 4J2FA 4BL7A 2XBIA 1G6YA 2XBQA 4RUVA 1WRYA 3GA4A 1ZCPA 2LJRA 4MK3A 2R0CA 2I3YA 3KGKA 5G1LA 4F9ZA 4KE3A 2CX3A 2IMFA 4O7HA 4K9ZA 4BWQA 6GSWA 2HT9A 2IL3A 2WJUA 5D9WA 5LD0A 4OO4A 2GLRA 1OAZA 3US3A 3DVWA 4IP1A 2YWNA 3ISOA 2GSQA 3M1GA 2QC7A 1JZWA 4TXOA 2AJQB 4KH7A 4FYCA 4WBRD 4JZQA 1GSFA 2LRCA 4YH2A 5DBQA 4BVYA 3L78A 1K0CA 3VWWA 1S3DA 2M80A 3C7MA 3G9BA 1LJRA 1XCCA 4G10A 4WR4A 1YZXA 1HYUA 2F8FA 2R2JA 1FO5A 1YF0A 3UOMA 3TOUA 5INYA 14GSA 3VWUA 2GT5A 2DJ1A 1YJ6A 2YV9A 1R4WA 1M2DA 4AJ8A 2HRAA 4ZL7A 2JACA 5A5KA 2JZTA 3FY7A 2AUVA 2YOIA 1EV4A 2VL2C 3BCKA 1WJKA 1ZGNA 2VO4A 3CTFA 1GSDA 2IWTA 4BVXA 4IN0A 3PR8A 5CNWA 3M9JA 4WETA 1SK1A 1S3AA 3TKRA 1EEJA 2ON7A 3A5IA 3L0HA 5KN2A 1O81A 4FQUA 3FZ9A 5DALB 2C3NA 2CQ9A 5IPGA 2VOCA 2JADA 4I8BA 1FW1A 4GQCA 1K3OA 2H74A 3A2XA 2H70A 4OD7A 2AAWA 3L9VA 4FO5A 4I2UA 4X0XA 3GSTA 3FMWA 4AJ7A 3P90A 1G6WA 1Z7RA 4PURA 1DE2A 2H72A 3IE3A 2FWGA 1S3CA 2M72A 2VUPA 3TKQA 2WDUA 4HI7A 1AQXA 1PX7A 2X8CA 2K8VA 3D6IA 1XIYA 1AAZA 1GSQA 1RK4A 2K6VA 3GYKA 4PQ1A 4K2DA 2OADA 3SWLA 1IYIA 4HU9A 1YEXA 3M9KA 1SJZA 2C0GA 1OC3A 3EPTA 3HJOA 3ZVJA 5GSSA 2H1AA 4G0IA 6GSXA 4G0KA 1MD3A 5DJLA 3I69A 1A2LA 1KEBA 1AIUA 2WFCA 1TK5B 4GLTA 5J9BA 5HR1A 4NV5A 1WWJA 4YAPA 4POKA 4GCIA 5EL8A 1FHEA 3WT1A 1HNBA 4WEYA 1X5CA 5D9TA 2KOKA 5D73A 1W89A 5H5SA 2WCIA 4F2IA 4HOJA 6GSYA 4EE0A 4XRAA 3LYKA 4TR3A 3VI5A 1O6JA 2A4VA 5IMDA 5ECQB 4MJEA 4FYUA 2IPAA 1MD4A 4HU7A 2DJ0A 5B6NA 3GX0A 2YV7A 4EL1A 1MDIA 2N5BA 3D21A 2OBIA 4POMA 4IQAA 4IJIA 4AGSA 1OC9B 2TIRA 4ZL9A 3CRUA 2YCDA 4O92A 5CAXA 3F4RA 5JWRB 1TI1A 3RPNA 4HZ4A 3RHBA 3HA9A 3O6TA 2OBKA 2F8AA 1FVKA 5HFGA 1A0FA 5COHA 1JZRA 2IN3A 3J7Yk 3UARA 3N9JA 1EV9A 1R7HA 1UA5A 2GS3A 1YDKA 5F0GA 18GSA 3DIEA 1ON4A 1XG8A 4ECIA 1GSYA 1GULA 4EIQA 2QA2A 4XS4A 3QFBC 3IR4A 5B7CA 3W6GA 1Q4JA 1GRXA 3KH9A 4JEDA 4WXTA 3TKPA 5FT3A 3PPUA 1OKTA 1U88A 3ZVJD 3UEMA 2E0QA 4N11A 2A2RA 16GSA 4LL4B 1OE8A 3E3EA 5ID2A 1X5DA 2LKUA 2WB9A 3CSJA 2I9HA 1A23A 1WIKA 3GH9A 1MDJA 2F51A 1VF1A 4JR6A 1EGRA 3ZIJA 2YWMA 3MSZA 4KDYA 22GSA 3F3RA 1R5PA 3IHGA 2LJAA 3IK9A 17GSA 2CVDA 3KMNA 2LUSA 3H79A 3EURA 3P2AA 5DAKA 2RM6A 2PN8A 1UN2A 3LXZA 2P31A 2LQQA 1SKRB 1GLQA 3TKSE 4N10A 5FHIA 1PFOA 3LXTA 3A2VA 2P5QA 2HSYA 3OR5A 5F07A 1WP0A 4CY6A 1XXUA 1FOVA 3P7XA 1BX9A 20GSA 4PNGA 2C4JA 5ABRA 3DRNA 3UIWA 3LSZA 3TJFA 3GHAA 5KOXA 2NPBA 3ERFA 4JBBA 2RUFA 1H4OA 2DKIA 3C1RA 3KP9A 6GSTA 2X8GA 1ILOA 3NOFA 3GTUB 5ELAA 2ON5A 3UAPA 3PINA 5J3RA 4GSNA 1Z7PA 4ZB8A 4L0UA 2VAFA 3KH7A 3CSHA 1OKDA 5E59A 2JU5A 1MTCA 2YANA 1BEDA 4KF9A 1FVJA 4YQUA 1Z6MA 3GIXA 2LNTA 3QPMA 2XPEA 1PN0A 1DSBA 3TRQA 4L5LA 5BRTA 2MMZA 3LWAA 2DC5A 4KW6A 4HJ2A 2FUG2 3KCMA 4GQFA 1TI3A 3ED3A 2VCQA 2DJ2A 4O5RA 4E8HA 3QAWA 1XFLA 1WMJA 3DD3A 3IDVA 2O87A 4O5QA 3L9UA 5FWGA 3EYTA 1EP8A 3GKNA 2H0IA 1X5EA 6GSUA 2R4VA 3GRXA 4RI6A 3H93A 1XW6A 3UJ1A 4WF4A 2YJHA 3GKXA 1FB0A 2H75A 1HQOA 2P0GA 2H1BA 2DMLA 2WS2A 2YZUA 4N0VA 2LEGA 1T00A 5F05A 5IMCA 3M0FA 2QGVA 4HSCX 2L5OA 1SD9A 1U3IA 2VD1A 2O89A 2JSZA 2VL9A 4XS6A 3C8EA 3IBHA 1ABAA 3ME7A 1K3LA 3TDGA 4CY8A 1Z5YE 2G0FA 3GNJA 1XW5A 4X1UA 1XOAA 4P3YB 2PERA 1T4YA 2H0GA 3C73A 5G5FA 4ML6A 2DSAA 4EC0A 3IAS2 5D9XA 5KN0A 1ERWA 2C0DA 1YY7A 3WYWA 3F4TA 2MBSA 2OA7A 3LGCA 2FA4A 3Q19A 3HD5A 2A4HA 3D0ZA 5AGYA 5IMZA 3ZITA 3I6AA 2A2PA 2B3SA 4IBPA 4WF5A 5ECKB 5ECRB 5E4WA 4I2TA 1B4QA 3AY8A 5KEJA 4Q5QA 1V9WA 4EXJA 4V2MA 2IFQA 5J9CA 3GV1A 3F9UA 3H1NA 1XZOA 2RM5A 5KN3A 1I9DA 4TVEA 2F9SA 2M46A 4EO3A 3ZRDA 1C72A 2BJXA 4TR0A 2JSYA 4RI7A 3ZIVA 3RAZA 1GL8A 3WGEA 3WT2A 1R5AA 4L5OA 2QA1A 4H86A 1Q98A 1O8XA 4CDOA 3DXBA 2I81A 3ZTLA 5IOWA 1A2MA 2NDOA 3GKKA 4V1Ag 1RW1A 1M9AA 1EOHA 2ZNMA 2PGTA 4I5QA 1BAYA 1F2EA 2RLIA 4V2NA 2HXKA 3APOA 2G2QA 2YWIA 3MAKA 1JLVA 1M7TA 4TXVA 5GSTA 4HQZA 1UC7A 3IXRA 4IVFA 2L59A 4F0BA 1NM3A 1ZYEA 3DEXA 2CZ2A 2MZCA 2OKAA 5G2ZA 3FHKA 2E7PA 1VRSD 4NWYA 4QL9A 3KIJA 5ECHB 1O85A 2H66A 3I43A 5G1KA 2CAIA 2LV3A 4KNDA 1ZL9A 3HDCA 5DQSA 3FKFA 1M0UA 2E2MA 3WGDA 1ERUA 1I5GA 3EU3A 4JRRA 1YKCA 1XWBA 4KB3A 3O3TA 1PSQA 2VM1A 4NHZA 1FB6A 5F06A 5EPFA 2TRCP 2VD0A 2H76A 3IPZA 3GH6A 4MZCA 4PUAA 4HEA2 3J7Yb 4IJ3A 5J5NA 5DDLA 1EOGA 4F0CA 5F8BA 9GSSA 3GL3A 2HRFA 3TUEA 2IMIA 3TKSA 2FWFA 3GN3A 2B5XA 4XCSA 3EWLA 4TR4A 2FA8A 3TJGA 3FR9A 3EC3A 3EU4A 4POBA 5JCGA 1SKWB 3VURA 1K0BA 3TOTA 6GSVA 1M99A 4LMVA 1T4ZA 3Q6OA 4MZWA 1EWXA 4K0NA 4O32A 4ZBDA 1TDIA 3QD9A 5J4UA 4KA0A 1VGLA 2HYXA 3EVIA 5HQPA 1PA3A 5ECSA 2PMTA 6GSSA 1XW9A 3HVXA 5AN1A 3EINA 4RQXA 4DEJA 1QGVA 1B4PA 3QDNA 4XTSA 5IO2A 4USSA 1M2BA 5IMFA 5IPHA 2RUEA 4Q5NA 4ZXGA 1A24A 5CP1A 2DIYA 1ERTA 4YQMA 1USBA 4EDZA 4OFMA 4BA7A 3QAVA 4JU5A 1PN9A 2LNSA 2CVKA 2K9FA 1LU4A 4WKWA 5H5RA 1ERVA 2FD3A 1JZOA 3F6DA 1TJDA 1BYEA 2DJKA 3TB2A 1EGOA 3CQFA 3ZREA 4D73B 4K6XA 1TRUA 4Z7XA 2H8LA 2VCWA 4XS4B 3QFAC 4XRDA 3ZYWA 2DMMA 5J41A 2O85A 1TP9A 3IK7A 1BQ7A 3ERWA 19GSA 2YNXA 1ZOFA 2HLSA 2HSHA 4OFNA 1O73A 4GXZA 3U5RE 5D9VA 3LQ7A 1WPIA 1CQHA 2MBTA 2X8HA 3UVHA 1LBKA 2C8UA 1SK0A 1ZMAA 4EKZA 4GSSA 5G30A 12GSA 2FLSA 2B1LA 2R6KA 1GTUA 2H0HA 5D8IA 1OC9A 1V98A 3GSSA 3UBLA 4MH3A 4K7IA 1OVNA 2JZRA 3DGQA 4FYBA 2LSTA 4N30A 4TKYA 3HY2A 4AJ6A 5B8AA 1M9BA 1THOA 4YQVA 1GH2A 3GFKA 2VLTA 1JZDA 3FRCA 3HYPA 4CW9A 5ECIB 4LLRA 2DJ3A 4K5RA 2FHEA 3BBYA 4XIHA 3QAGA 5CRGA 3LJRA 2V6KA 1N8JA 3PH9A 2PUKC 1ZYPA 3TGZA 3TRPA 3LEFA 4DSSA 5D96A 2LTKA 5ECPB 2HZEB 1TRVA 4MZBA 3DYRA 1QQ2A 1HNAA 4OFTA 3KZQA 3L4NA 1MEKA 2IMEA 3E9JB 3IC8A 3KD0A 4K7OA 4ZBAA 4XHMA 3ME8A 4V1Ap 3VK9A 3GX8A 2EC4A 4PX1A 3UBKA 4HUAA 3L9SA 3VI7A 4KX4A 1E2YA 2QKEA 2IMKA 2R3XA 3KXOA 1VF3A 2WULA 3KTLA 2FY6A 11GSA 4TR1B 3EMXA 2CV4A 1A8LA 2F3MA 3GUSA 4I97A 5ECLB 1Z3EA 1M3JA 3ZMKA 1PKZA 3K8NA 3DVXA 4KSMA 4PNFA 1F3BA 2VCTA 3D5JA 3TJKA 2FWEA 3ERGA 5A4VA 1GSUA 2L4QA 3LYPA 1SJ6A 2GQMA 5EVOA 3F6FA 3G7YA 3TJJA 1CQGA 4PXOA 2ES7A 1NHOA 1K0DA 1WOUA 2X99A 1X9MB 3R3EA 1G7EA 2GSSA 3VPQA 1E6BA 3IOSA 4JR4A 2WZ9A 2HNLA 2H6ZA 4ZILA 3DWVA 2DJJA 4TOPA 1T1VA 1GNEA 2B5EA 5B6MA 1T3BA 2V1MA 1GWCA 4TW5A 5AIVA 1HNCA 1THXA 3BD2A 1TW9A 1A0RP 3GTUA 4FH8A 5DCGA 4EUYA 1SK2A 4DVCA 2PWJA 3W8JA 2RIIA 2LS5A 1N2AA 1SENA 1SJIA 2DIZA 1K0AA 1JHBA 5ECOB 2X64A 1K3YA 4KCEA 4RQRA 4A5PA 2CT6A 3KP8A 2V41A 3VWXA 2IJYA 4NAXA 2IMDA 3ZFLA 2J23A 5AIXA 4Z2TA 3H4KA 1J0FA 1YEPA 4TN8A 1AW9A 1GUMA 2YJ7A 2E2GA 2P5RA
chains in the Genus database with same CATH topology
2LQOA 2R0GA 2B5YA 1FG4A 1SYXA 5HR3A 4GTUA 4J56E 1A2JA 3M8NA 2GVPA 1MDKA 4ZB9A 1TXXA 4FIWA 4GRFA 4MJCA 3CXGA 4BL7B 5GAPD 3CRTA 1ST9A 3APSA 4OWYA 5A4WA 4L0WA 2OACA 1URMA 5CREA 2VIMA 1NSWA 1QFNA 2BTOT 2KP2A 2IFQB 1F6MC 1UVZA 4NMUA 2PVQA 2H1DA 5GZZB 2PPTA 5ECMB 1F37A 4L8EA 2C1YA 2L5LA 1ZYNA 3M3MA 3ZLPA 3FR6A 4MP4A 5LCZA 4TXOB 3IAM2 1OC8A 3ZMLA 5HR0A 2GT6A 4MABA 2L6CA 4BVYB 3GKMA 2HRNA 1XBSA 1SKSB 1NHYA 2GSRA 5CRWA 3A5WA 1B9XC 4K2XA 3HXSA 3CBUA 2C3QA 1K0NA 1XWGA 3MWHA 4X4JA 1U87A 5HFIA 1AUCA 3EMPA 1SD8A 2GDRA 3LG6A 1GUKA 1TK0B 1T8EB 3ZL5A 2B1KA 1BJXA 1RQMA 3F0IA 4MA9A 2VM2A 5H5QA 3KJYA 3HCZA 1AC1A 1QMVA 3H8QA 1W4VA 3BJ5A 1GLPA 4G2EA 2C80A 4AF2A 4ZBBA 7GSSA 4BVXB 4IS0A 3HZ4A 4GSTA 3FZAA 2VLVA 1F9MA 1VF4A 2VCXA 1ACVA 3FK8A 3QMXA 1GTIA 1AQWA 4F82A 4Q5RA 1JLWA 4ISDA 5DJMA 3IV4A 1V57A 3APQA 5IO0A 5JWQB 3WGXA 1F3AA 2MMOA 3CSIA 4IP6A 3CMIA 3RPPA 3DKSA 5IQYA 1BG5A 2KLXA 4MNNA 5L71A 4ULXA 1H75A 4J57E 1SL1B 2OE1A 4MPFA 2YN1A 2GQKA 2YPMA 2NBSA 4O5UA 1FOHA 2GZYA 3D4MA 3GMFA 4ACSA 3TRXA 4LA1A 2XC2A 3D22A 2X4AA 1B9YC 3E0UA 2LRNA 3DMLA 4IQ1A 5JCWA 1GSEA 2O7KA 1XWKA 4E8EA 2KUCA 4Z2UA 2BMXA 1ZYQB 2H71A 3ZZXA 3P8WA 5CYYA 4IHUA 10GSA 4G19A 3Q18A 2CAQA 3HJPA 2L57A 2H30A 1TU8A 1EP7A 2H6XA 2KP1A 1PGTA 3BCIA 5DALA 1TRSA 1K0OA 4IKHA 4MF5A 4MDCA 1PMTA 3HKRA 1XVQA 4Q5FA 4ECBA 5DVBA 2O8VB 4IW9A 1PL1A 4KDXA 5IIZA 1PD21 1R26A 1YF1A 3W8SA 3FR3A 2OE3A 4MMMA 3R2QA 5A4UA 3SBCA 1KBNA 1JFUA 3F3QA 3LFLA 4ECCA 2I4AA 1YQ1A 3FZ4A 5CRHA 2H01A 2TRXA 3KTBA 4QL7A 4K5SA 3UMAA 5D93A 1U6TA 5G5EA 4NHWA 2J9HA 2L6DA 4ML1A 3C71A 3HJMA 4OCFA 2JZSA 2DLXA 1GP1A 2L4CA 4PTSA 4YAVA 4KUNA 3JCML 2DKHA 2AHEA 1Z9HA 4TRXA 4JE1A 2DBCA 5KOWA 1QK8A 4ZL8A 4MCUA 5JWOB 4LMWA 5JCUA 2YP6A 5LNKe 3HVSA 1J9BA 5HR2A 1QUWA 4HDEA 3VWVA 1DE1A 1XWAA 5GAND 8GSSA 2VCVA 2AV4A 3TCOA 3HZ8A 5DCHA 4N0ZA 1VF2A 5CO3A 2GZZA 2R0PA 2EIRA 4CHSA 4EIPA 2GSTA 5ID2B 1TU7A 4DSQA 4EF0A 3F63A 2GGTA 2N5FA 3G7IA 2R37A 4K0GA 3U6VA 2REMA 2XHFA 4XS1A 1SL2B 5AISA 5G31A 4YKGA 3FZ5A 4MH2A 1GNWA 2XPDA 4NPBA 4D73A 2OE0A 3BOAA 1TK8B 1XWCA 1O8WA 4YKFA 4ICYA 1SL0B 4OCEA 4BPYA 5BMUA 1V40A 4DSSB 3FEUA 2H73A 3TKSC 2CA8A 4F03A 5EY6A 2LRTA 1QXHA 5DAKB 2PU9C 3ZFBA 1V2AA 3NZNA 1PQNA 2AB6A 4K1FA 2A2SA 1ZZYA 2IIYA 1AQVA 4KGIA 4MJAA 1X9WB 3A3TA 4NXIA 3TJBA 3I9V2 3A2WA 2UZ8A 2ZUPA 5ELGA 1OE7A 2YZHA 3D4TA 1KTEA 3VPTA 2K8SA 3O76A 5IM9A 4WR5A 2Z9SA 2MMAA 3RBTA 1SYRA 2FNOA 1Y25A 2V2GA 1A8YA 2X49A 4GWRA 3UVTA 2D2ZA 4KSOA 2H19A 2JL4A 4ECJA 4MF7A 2HSMA 3MNGA 2NTOA 13GSA 3GURA 1T7PB 3FYGA 4PUFC 3CYNA 3HHVA 3WD6A 3Q74A 2GTUA 1O7UA 2HE3A 4KDUA 4POLA 2HZEA 2ALBA 3VLNA 4OMVA 2H6YA 2CX4A 1XVWA 3G7JA 2HRKA 2FCHA 1TRWA 3KM6A 2NVLA 2B6MA 2C0FA 4MJBA 4EVMA 5HFKA 3MIXA 1DBYA 4HS1A 3GL5A 1GUHA 1X9SB 4BWSA 3F4SA 1J08A 3NIVA 4IELA 2B7KA 2N5AA 1SU9A 2R5GA 3KMOA 4TR1A 4X43A 4KCAA 2HI7A 3QOUA 4MPGA 2PVOC 1M2AA 2B7JA 5B8BA 1AXDA 4ID0A 1GTAA 1B8XA 4LL1B 4OO5A 1X0RA 1PL2A 3LW9A 2OJLA 3RDWA 2GQLA 3MYDA 2VL3A 5KN1A 5ECNB 4ZB6A 4G0LA 1G0TA 1NW2A 1B48A 4HJMA 4HQSA 1U3AA 2PBJA 2C0EA 2K18A 2HZFA 2VCZA 2FWHA 3IA1A 4PGTA 4MF6A 1WE0A 2C3TA 2VLUA 1GSSA 1PRXA 3IHQA 3PGTA 2V6OA 3LORA 1V58A 1DUGA 2EIQA 4QQ7A 2MMNA 2CVBA 3V1WA 1GTBA 1IYHA 3UL3A 2AYTA 2VL2A 3F8UA 4EDYA 4ILFA 1K0MA 3C1SA 2KHPA 2FGXA 3QCPA 4MLYA 1XOBA 5IMAA 2V32A 1TTZA 1EZKA 4K7NA 5IOXA 2YWOA 4ZIJA 1EEMA 4PQHA 4PQIA 1HD2A 1Y6EA 5IMVA 3EE2A 2QSIA 1Z6NA 5ENUA 4WBJA 2I1UA 4G9HA 3S9FA 3CTGA 3N5OA 2GZPA 1XPVA 3KEBA 3MDKA 3QR6A 1KNGA 1YKAA 2ZCTA 5C04A 4NV2A 4DSRA 5C00A 1PKWA 2WGRA 5CRDA 4GF0A 3IRAA 2CZ3A 1ML6A 1OYJA 2HFDA 4I6XA 3FW2A 4Z2RA 4KAEA 2WRTA 1PX6A 4HZ2A 3VFIA 5DQYA 2MYGA 1TKDB 1FAAA 4K8MA 2H1GA 2EIOA 1G7OA 2LJKA 1TOFA 4IGJA 4V2LA 3IC4A 3RHCA 3HVVA 4J2FA 4BL7A 2XBIA 1G6YA 2XBQA 4RUVA 1WRYA 3GA4A 1ZCPA 2LJRA 4MK3A 2R0CA 2I3YA 3KGKA 5G1LA 4F9ZA 4KE3A 2CX3A 2IMFA 4O7HA 4K9ZA 4BWQA 6GSWA 2HT9A 2IL3A 2WJUA 5D9WA 5LD0A 4OO4A 2GLRA 1OAZA 3US3A 3DVWA 4IP1A 2YWNA 3ISOA 2GSQA 3M1GA 2QC7A 1JZWA 4TXOA 2AJQB 4KH7A 4FYCA 4WBRD 4JZQA 1GSFA 2LRCA 4YH2A 5DBQA 4BVYA 3L78A 1K0CA 3VWWA 1S3DA 2M80A 3C7MA 3G9BA 1LJRA 1XCCA 4G10A 4WR4A 1YZXA 1HYUA 2F8FA 2R2JA 1FO5A 1YF0A 3UOMA 3TOUA 5INYA 14GSA 3VWUA 2GT5A 2DJ1A 1YJ6A 2YV9A 1R4WA 1M2DA 4AJ8A 2HRAA 4ZL7A 2JACA 5A5KA 2JZTA 3FY7A 2AUVA 2YOIA 1EV4A 2VL2C 3BCKA 1WJKA 1ZGNA 2VO4A 3CTFA 1GSDA 2IWTA 4BVXA 4IN0A 3PR8A 5CNWA 3M9JA 4WETA 1SK1A 1S3AA 3TKRA 1EEJA 2ON7A 3A5IA 3L0HA 5KN2A 1O81A 4FQUA 3FZ9A 5DALB 2C3NA 2CQ9A 5IPGA 2VOCA 2JADA 4I8BA 1FW1A 4GQCA 1K3OA 2H74A 3A2XA 2H70A 4OD7A 2AAWA 3L9VA 4FO5A 4I2UA 4X0XA 3GSTA 3FMWA 4AJ7A 3P90A 1G6WA 1Z7RA 4PURA 1DE2A 2H72A 3IE3A 2FWGA 1S3CA 2M72A 2VUPA 3TKQA 2WDUA 4HI7A 1AQXA 1PX7A 2X8CA 2K8VA 3D6IA 1XIYA 1AAZA 1GSQA 1RK4A 2K6VA 3GYKA 4PQ1A 4K2DA 2OADA 3SWLA 1IYIA 4HU9A 1YEXA 3M9KA 1SJZA 2C0GA 1OC3A 3EPTA 3HJOA 3ZVJA 5GSSA 2H1AA 4G0IA 6GSXA 4G0KA 1MD3A 5DJLA 3I69A 1A2LA 1KEBA 1AIUA 2WFCA 1TK5B 4GLTA 5J9BA 5HR1A 4NV5A 1WWJA 4YAPA 4POKA 4GCIA 5EL8A 1FHEA 3WT1A 1HNBA 4WEYA 1X5CA 5D9TA 2KOKA 5D73A 1W89A 5H5SA 2WCIA 4F2IA 4HOJA 6GSYA 4EE0A 4XRAA 3LYKA 4TR3A 3VI5A 1O6JA 2A4VA 5IMDA 5ECQB 4MJEA 4FYUA 2IPAA 1MD4A 4HU7A 2DJ0A 5B6NA 3GX0A 2YV7A 4EL1A 1MDIA 2N5BA 3D21A 2OBIA 4POMA 4IQAA 4IJIA 4AGSA 1OC9B 2TIRA 4ZL9A 3CRUA 2YCDA 4O92A 5CAXA 3F4RA 5JWRB 1TI1A 3RPNA 4HZ4A 3RHBA 3HA9A 3O6TA 2OBKA 2F8AA 1FVKA 5HFGA 1A0FA 5COHA 1JZRA 2IN3A 3J7Yk 3UARA 3N9JA 1EV9A 1R7HA 1UA5A 2GS3A 1YDKA 5F0GA 18GSA 3DIEA 1ON4A 4ECIA 1GSYA 1GULA 4EIQA 2QA2A 4XS4A 3QFBC 3IR4A 5B7CA 3W6GA 1Q4JA 1GRXA 3KH9A 4JEDA 4WXTA 3TKPA 5FT3A 3PPUA 1OKTA 1U88A 3ZVJD 3UEMA 2E0QA 4N11A 2A2RA 16GSA 4LL4B 1OE8A 3E3EA 5ID2A 1X5DA 2LKUA 2WB9A 3CSJA 2I9HA 1A23A 1WIKA 3GH9A 1MDJA 2F51A 1VF1A 4JR6A 1EGRA 3ZIJA 2YWMA 3MSZA 4KDYA 22GSA 3F3RA 1R5PA 3IHGA 2LJAA 3IK9A 17GSA 2CVDA 3KMNA 2LUSA 3H79A 3EURA 3P2AA 5DAKA 2RM6A 2PN8A 1UN2A 3LXZA 2P31A 2LQQA 1SKRB 1GLQA 3TKSE 4N10A 5FHIA 3LXTA 3A2VA 2P5QA 2HSYA 3OR5A 5F07A 1WP0A 4CY6A 1XXUA 1FOVA 3P7XA 1BX9A 20GSA 4PNGA 2C4JA 5ABRA 3DRNA 3UIWA 3LSZA 3TJFA 3GHAA 5KOXA 2NPBA 3ERFA 4JBBA 2RUFA 1H4OA 2DKIA 3C1RA 3KP9A 6GSTA 2X8GA 1ILOA 3NOFA 3GTUB 5ELAA 2ON5A 3UAPA 3PINA 5J3RA 4GSNA 1Z7PA 4ZB8A 4L0UA 2VAFA 3KH7A 3CSHA 1OKDA 5E59A 2JU5A 1MTCA 2YANA 1BEDA 4KF9A 1FVJA 4YQUA 1Z6MA 3GIXA 2LNTA 3QPMA 2XPEA 1PN0A 1DSBA 3TRQA 4L5LA 5BRTA 2MMZA 3LWAA 2DC5A 4KW6A 4HJ2A 2FUG2 3KCMA 4GQFA 1TI3A 3ED3A 2VCQA 2DJ2A 4O5RA 4E8HA 3QAWA 1XFLA 1WMJA 3DD3A 3IDVA 2O87A 4O5QA 3L9UA 5FWGA 3EYTA 1EP8A 3GKNA 2H0IA 1X5EA 6GSUA 2R4VA 3GRXA 4RI6A 3H93A 1XW6A 3UJ1A 4WF4A 2YJHA 3GKXA 1FB0A 2H75A 1HQOA 2P0GA 2H1BA 2DMLA 2WS2A 2YZUA 4N0VA 2LEGA 1T00A 5F05A 5IMCA 3M0FA 2QGVA 2L5OA 1SD9A 1U3IA 2VD1A 2O89A 2JSZA 2VL9A 4XS6A 3C8EA 3IBHA 1ABAA 3ME7A 1K3LA 3TDGA 4CY8A 1Z5YE 2G0FA 3GNJA 1XW5A 4X1UA 1XOAA 4P3YB 2PERA 1T4YA 2H0GA 3C73A 5G5FA 4ML6A 2DSAA 4EC0A 3IAS2 5D9XA 5KN0A 1ERWA 2C0DA 1YY7A 3WYWA 3F4TA 2MBSA 2OA7A 3LGCA 2FA4A 3Q19A 3HD5A 2A4HA 3D0ZA 5AGYA 5IMZA 3ZITA 3I6AA 2A2PA 2B3SA 4IBPA 4WF5A 5ECKB 5ECRB 5E4WA 4I2TA 1B4QA 3AY8A 5KEJA 4Q5QA 1V9WA 4EXJA 4V2MA 2IFQA 5J9CA 3GV1A 3F9UA 3H1NA 1XZOA 2RM5A 5KN3A 1I9DA 4TVEA 2F9SA 2M46A 4EO3A 3ZRDA 1C72A 2BJXA 4TR0A 2JSYA 4RI7A 3ZIVA 3RAZA 1GL8A 3WGEA 3WT2A 1R5AA 4L5OA 2QA1A 4H86A 1Q98A 1O8XA 4CDOA 3DXBA 2I81A 3ZTLA 5IOWA 1A2MA 2NDOA 3GKKA 4V1Ag 1RW1A 1M9AA 1EOHA 2ZNMA 2PGTA 4I5QA 1BAYA 1F2EA 2RLIA 4V2NA 2HXKA 3APOA 2G2QA 2YWIA 3MAKA 1JLVA 1M7TA 4TXVA 5GSTA 4HQZA 1UC7A 3IXRA 4IVFA 2L59A 4F0BA 1NM3A 1ZYEA 3DEXA 2CZ2A 2MZCA 2OKAA 5G2ZA 3FHKA 2E7PA 1VRSD 4NWYA 4QL9A 3KIJA 5ECHB 1O85A 2H66A 3I43A 5G1KA 2CAIA 2LV3A 4KNDA 1ZL9A 3HDCA 5DQSA 3FKFA 1M0UA 2E2MA 3WGDA 1ERUA 1I5GA 3EU3A 4JRRA 1YKCA 1XWBA 4KB3A 3O3TA 1PSQA 2VM1A 4NHZA 1FB6A 5F06A 5EPFA 2TRCP 2VD0A 2H76A 3IPZA 3GH6A 4MZCA 4PUAA 4HEA2 3J7Yb 4IJ3A 5J5NA 5DDLA 1EOGA 4F0CA 5F8BA 9GSSA 3GL3A 2HRFA 3TUEA 2IMIA 3TKSA 2FWFA 3GN3A 2B5XA 4XCSA 3EWLA 4TR4A 2FA8A 3TJGA 3FR9A 3EC3A 3EU4A 4POBA 5JCGA 1SKWB 3VURA 1K0BA 3TOTA 6GSVA 1M99A 4LMVA 1T4ZA 3Q6OA 4MZWA 1EWXA 4K0NA 4O32A 4ZBDA 1TDIA 3QD9A 5J4UA 4KA0A 1VGLA 2HYXA 3EVIA 5HQPA 1PA3A 5ECSA 2PMTA 6GSSA 1XW9A 3HVXA 5AN1A 3EINA 4RQXA 4DEJA 1QGVA 1B4PA 3QDNA 4XTSA 5IO2A 4USSA 1M2BA 5IMFA 5IPHA 2RUEA 4Q5NA 4ZXGA 1A24A 5CP1A 2DIYA 1ERTA 4YQMA 1USBA 4EDZA 4OFMA 4BA7A 3QAVA 4JU5A 1PN9A 2LNSA 2CVKA 2K9FA 1LU4A 4WKWA 5H5RA 1ERVA 2FD3A 1JZOA 3F6DA 1TJDA 1BYEA 2DJKA 3TB2A 1EGOA 3ZREA 4D73B 4K6XA 1TRUA 4Z7XA 2H8LA 2VCWA 4XS4B 3QFAC 4XRDA 3ZYWA 2DMMA 5J41A 2O85A 1TP9A 3IK7A 1BQ7A 3ERWA 19GSA 2YNXA 1ZOFA 2HLSA 2HSHA 4OFNA 1O73A 4GXZA 3U5RE 5D9VA 3LQ7A 1WPIA 1CQHA 2MBTA 2X8HA 3UVHA 1LBKA 2C8UA 1SK0A 1ZMAA 4EKZA 4GSSA 5G30A 12GSA 2FLSA 2B1LA 2R6KA 1GTUA 2H0HA 5D8IA 1OC9A 1V98A 3GSSA 3UBLA 4MH3A 4K7IA 1OVNA 2JZRA 3DGQA 4FYBA 2LSTA 4N30A 4TKYA 3HY2A 4AJ6A 5B8AA 1M9BA 1THOA 4YQVA 1GH2A 3GFKA 2VLTA 1JZDA 3FRCA 3HYPA 4CW9A 5ECIB 4LLRA 2DJ3A 4K5RA 2FHEA 3BBYA 4XIHA 3QAGA 5CRGA 3LJRA 2V6KA 1N8JA 3PH9A 2PUKC 1ZYPA 3TGZA 3TRPA 3LEFA 4DSSA 5D96A 2LTKA 5ECPB 2HZEB 1TRVA 4MZBA 3DYRA 1QQ2A 1HNAA 4OFTA 3KZQA 3L4NA 1MEKA 2IMEA 3E9JB 3IC8A 3KD0A 4K7OA 4ZBAA 4XHMA 3ME8A 4V1Ap 3VK9A 3GX8A 2EC4A 4PX1A 3UBKA 4HUAA 3L9SA 3VI7A 4KX4A 1E2YA 2QKEA 2IMKA 2R3XA 3KXOA 1VF3A 2WULA 3KTLA 2FY6A 11GSA 4TR1B 3EMXA 2CV4A 1A8LA 2F3MA 3GUSA 4I97A 5ECLB 1Z3EA 3ZMKA 1PKZA 3K8NA 3DVXA 4KSMA 4PNFA 1F3BA 2VCTA 3D5JA 3TJKA 2FWEA 3ERGA 5A4VA 1GSUA 2L4QA 3LYPA 1SJ6A 2GQMA 5EVOA 3F6FA 3G7YA 3TJJA 1CQGA 4PXOA 2ES7A 1NHOA 1K0DA 1WOUA 2X99A 1X9MB 3R3EA 1G7EA 2GSSA 3VPQA 1E6BA 3IOSA 4JR4A 2WZ9A 2HNLA 2H6ZA 4ZILA 3DWVA 2DJJA 4TOPA 1T1VA 1GNEA 2B5EA 5B6MA 1T3BA 2V1MA 1GWCA 4TW5A 5AIVA 1HNCA 1THXA 3BD2A 1TW9A 1A0RP 3GTUA 4FH8A 5DCGA 4EUYA 1SK2A 4DVCA 2PWJA 3W8JA 2RIIA 2LS5A 1N2AA 1SENA 1SJIA 2DIZA 1K0AA 1JHBA 5ECOB 2X64A 1K3YA 4KCEA 4RQRA 4A5PA 2CT6A 3KP8A 2V41A 3VWXA 2IJYA 4NAXA 2IMDA 3ZFLA 2J23A 5AIXA 4Z2TA 3H4KA 1J0FA 1YEPA 4TN8A 1AW9A 1GUMA 2YJ7A 2E2GA 2P5RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LQO A;  2B5Y A;  1FG4 A;  1SYX A;  5HR3 A;  4GTU A;  4J56 E;  1A2J A;  3M8N A;  2GVP A;  1MDK A;  4ZB9 A;  1TXX A;  4FIW A;  4GRF A;  4MJC A;  3CXG A;  5GAP D;  3CRT A;  1ST9 A;  3APS A;  4OWY A;  5A4W A;  4L0W A;  2OAC A;  1URM A;  5CRE A;  2VIM A;  1NSW A;  1QFN A;  2BTO T;  2KP2 A;  2IFQ B;  1F6M C;  1UVZ A;  4NMU A;  2PVQ A;  2H1D A;  5GZZ B;  2PPT A;  5ECM B;  1F37 A;  4L8E A;  2C1Y A;  2L5L A;  3M3M A;  3ZLP A;  3FR6 A;  4MP4 A;  5LCZ A;  4TXO B;  3IAM 2;  1OC8 A;  3ZML A;  5HR0 A;  2GT6 A;  4MAB A;  2L6C A;  3GKM A;  2HRN A;  1XBS A;  1SKS B;  1NHY A;  2GSR A;  5CRW A;  3A5W A;  1B9X C;  3HXS A;  3CBU A;  2C3Q A;  1K0N A;  1XWG A;  3MWH A;  1U87 A;  5HFI A;  1AUC A;  3EMP A;  1SD8 A;  2GDR A;  3LG6 A;  1GUK A;  1TK0 B;  1T8E B;  3ZL5 A;  2B1K A;  1BJX A;  1RQM A;  3F0I A;  4MA9 A;  2VM2 A;  5H5Q A;  3KJY A;  3HCZ A;  1AC1 A;  1QMV A;  3H8Q A;  1W4V A;  3BJ5 A;  1GLP A;  4G2E A;  2C80 A;  4AF2 A;  4ZBB A;  7GSS A;  4IS0 A;  3HZ4 A;  4GST A;  3FZA A;  2VLV A;  1F9M A;  1VF4 A;  2VCX A;  1ACV A;  3FK8 A;  3QMX A;  1GTI A;  1AQW A;  4F82 A;  4Q5R A;  1JLW A;  4ISD A;  5DJM A;  3IV4 A;  1V57 A;  3APQ A;  5IO0 A;  5JWQ B;  3WGX A;  1F3A A;  2MMO A;  3CSI A;  4IP6 A;  3CMI A;  3RPP A;  3DKS A;  5IQY A;  1BG5 A;  2KLX A;  5L71 A;  4ULX A;  1H75 A;  4J57 E;  1SL1 B;  2OE1 A;  4MPF A;  2YN1 A;  2GQK A;  2YPM A;  2NBS A;  2GZY A;  3D4M A;  3GMF A;  4ACS A;  3TRX A;  4LA1 A;  2XC2 A;  3D22 A;  1B9Y C;  3E0U A;  2LRN A;  3DML A;  4IQ1 A;  5JCW A;  1GSE A;  2O7K A;  1XWK A;  4E8E A;  2KUC A;  2BMX A;  1ZYQ B;  2H71 A;  3ZZX A;  3P8W A;  5CYY A;  4IHU A;  10GS A;  4G19 A;  3Q18 A;  2CAQ A;  3HJP A;  2L57 A;  2H30 A;  1TU8 A;  1EP7 A;  2H6X A;  2KP1 A;  1PGT A;  3BCI A;  5DAL A;  1TRS A;  1K0O A;  4IKH A;  4MF5 A;  4MDC A;  1PMT A;  3HKR A;  1XVQ A;  4Q5F A;  4ECB A;  5DVB A;  2O8V B;  4IW9 A;  1PL1 A;  4KDX A;  5IIZ A;  1PD2 1;  1R26 A;  1YF1 A;  3W8S A;  3FR3 A;  2OE3 A;  4MMM A;  3R2Q A;  5A4U A;  3SBC A;  1KBN A;  1JFU A;  3F3Q A;  3LFL A;  4ECC A;  2I4A A;  1YQ1 A;  3FZ4 A;  5CRH A;  2H01 A;  2TRX A;  3KTB A;  4QL7 A;  3UMA A;  5D93 A;  1U6T A;  5G5E A;  4NHW A;  2J9H A;  2L6D A;  4ML1 A;  3C71 A;  3HJM A;  4OCF A;  2JZS A;  2DLX A;  1GP1 A;  2L4C A;  4YAV A;  4KUN A;  3JCM L;  2AHE A;  1Z9H A;  4TRX A;  4JE1 A;  2DBC A;  1QK8 A;  4ZL8 A;  4MCU A;  5JWO B;  4LMW A;  5JCU A;  2YP6 A;  5LNK e;  3HVS A;  1J9B A;  5HR2 A;  1QUW A;  4HDE A;  3VWV A;  1DE1 A;  1XWA A;  5GAN D;  8GSS A;  2VCV A;  2AV4 A;  3TCO A;  3HZ8 A;  5DCH A;  4N0Z A;  1VF2 A;  5CO3 A;  2GZZ A;  2EIR A;  4CHS A;  2GST A;  5ID2 B;  1TU7 A;  4DSQ A;  4EF0 A;  3F63 A;  2GGT A;  2N5F A;  3G7I A;  2R37 A;  4K0G A;  3U6V A;  2REM A;  2XHF A;  4XS1 A;  1SL2 B;  5AIS A;  5G31 A;  3FZ5 A;  4MH2 A;  1GNW A;  2XPD A;  4NPB A;  4D73 A;  2OE0 A;  3BOA A;  1TK8 B;  1XWC A;  1O8W A;  1SL0 B;  4OCE A;  4BPY A;  1V40 A;  4DSS B;  3FEU A;  2H73 A;  3TKS C;  2CA8 A;  4F03 A;  5EY6 A;  2LRT A;  1QXH A;  5DAK B;  2PU9 C;  3ZFB A;  1V2A A;  3NZN A;  1PQN A;  2AB6 A;  4K1F A;  2A2S A;  1ZZY A;  2IIY A;  1AQV A;  4KGI A;  4MJA A;  1X9W B;  3A3T A;  4NXI A;  3TJB A;  3I9V 2;  3A2W A;  2ZUP A;  5ELG A;  1OE7 A;  2YZH A;  3D4T A;  1KTE A;  3VPT A;  2K8S A;  3O76 A;  5IM9 A;  4WR5 A;  2Z9S A;  2MMA A;  3RBT A;  1SYR A;  2FNO A;  1Y25 A;  2V2G A;  1A8Y A;  4GWR A;  3UVT A;  2D2Z A;  4KSO A;  2H19 A;  2JL4 A;  4ECJ A;  4MF7 A;  3MNG A;  2NTO A;  13GS A;  3GUR A;  1T7P B;  3FYG A;  4PUF C;  3CYN A;  3HHV A;  3WD6 A;  3Q74 A;  2GTU A;  1O7U A;  2HE3 A;  4KDU A;  4POL A;  2HZE A;  2ALB A;  3VLN A;  4OMV A;  2H6Y A;  2CX4 A;  1XVW A;  3G7J A;  2FCH A;  1TRW A;  3KM6 A;  2NVL A;  2B6M A;  2C0F A;  4MJB A;  4EVM A;  5HFK A;  1DBY A;  4HS1 A;  3GL5 A;  1GUH A;  1X9S B;  4BWS A;  3F4S A;  1J08 A;  3NIV A;  4IEL A;  2B7K A;  2N5A A;  1SU9 A;  2R5G A;  3KMO A;  4TR1 A;  4X43 A;  4KCA A;  2HI7 A;  3QOU A;  4MPG A;  2PVO C;  1M2A A;  2B7J A;  5B8B A;  1AXD A;  4ID0 A;  1GTA A;  1B8X A;  4LL1 B;  4OO5 A;  1X0R A;  1PL2 A;  3RDW A;  2OJL A;  2GQL A;  2VL3 A;  5KN1 A;  5ECN B;  4ZB6 A;  1G0T A;  1NW2 A;  1B48 A;  4HJM A;  4HQS A;  1U3A A;  2PBJ A;  2C0E A;  2K18 A;  2HZF A;  2VCZ A;  2FWH A;  3IA1 A;  4PGT A;  4MF6 A;  1WE0 A;  2C3T A;  2VLU A;  1GSS A;  1PRX A;  3IHQ A;  3PGT A;  2V6O A;  3LOR A;  1V58 A;  1DUG A;  2EIQ A;  4QQ7 A;  2MMN A;  2CVB A;  3V1W A;  1GTB A;  1IYH A;  3UL3 A;  2AYT A;  2VL2 A;  3F8U A;  4EDY A;  4ILF A;  1K0M A;  3C1S A;  2KHP A;  2FGX A;  3QCP A;  4MLY A;  1XOB A;  5IMA A;  2V32 A;  1TTZ A;  1EZK A;  4K7N A;  5IOX A;  2YWO A;  4ZIJ A;  1EEM A;  4PQH A;  4PQI A;  1HD2 A;  1Y6E A;  5IMV A;  3EE2 A;  2QSI A;  1Z6N A;  5ENU A;  4WBJ A;  2I1U A;  4G9H A;  3S9F A;  3CTG A;  3N5O A;  2GZP A;  1XPV A;  3KEB A;  3MDK A;  3QR6 A;  1KNG A;  1YKA A;  2ZCT A;  5C04 A;  4NV2 A;  4DSR A;  5C00 A;  1PKW A;  2WGR A;  5CRD A;  4GF0 A;  3IRA A;  2CZ3 A;  1ML6 A;  1OYJ A;  2HFD A;  4I6X A;  3FW2 A;  4KAE A;  2WRT A;  1PX6 A;  4HZ2 A;  3VFI A;  5DQY A;  2MYG A;  1TKD B;  1FAA A;  4K8M A;  2H1G A;  2EIO A;  1G7O A;  2LJK A;  1TOF A;  4IGJ A;  4V2L A;  3IC4 A;  3RHC A;  3HVV A;  4J2F A;  4BL7 A;  2XBI A;  1G6Y A;  2XBQ A;  4RUV A;  1WRY A;  3GA4 A;  1ZCP A;  2LJR A;  4MK3 A;  2I3Y A;  3KGK A;  5G1L A;  4F9Z A;  4KE3 A;  2CX3 A;  2IMF A;  4O7H A;  4K9Z A;  4BWQ A;  6GSW A;  2HT9 A;  2IL3 A;  2WJU A;  5D9W A;  5LD0 A;  4OO4 A;  2GLR A;  1OAZ A;  3US3 A;  3DVW A;  4IP1 A;  2YWN A;  3ISO A;  2GSQ A;  3M1G A;  2QC7 A;  1JZW A;  4TXO A;  2AJQ B;  4KH7 A;  4FYC A;  4WBR D;  4JZQ A;  1GSF A;  2LRC A;  4YH2 A;  5DBQ A;  4BVY A;  3L78 A;  1K0C A;  3VWW A;  1S3D A;  2M80 A;  3C7M A;  3G9B A;  1LJR A;  1XCC A;  4G10 A;  4WR4 A;  1YZX A;  1HYU A;  2F8F A;  2R2J A;  1FO5 A;  1YF0 A;  3UOM A;  3TOU A;  5INY A;  14GS A;  3VWU A;  2GT5 A;  2DJ1 A;  1YJ6 A;  2YV9 A;  1R4W A;  1M2D A;  4AJ8 A;  4ZL7 A;  2JAC A;  5A5K A;  2JZT A;  3FY7 A;  2AUV A;  2YOI A;  1EV4 A;  2VL2 C;  3BCK A;  1WJK A;  1ZGN A;  2VO4 A;  3CTF A;  1GSD A;  2IWT A;  4BVX A;  4IN0 A;  3PR8 A;  5CNW A;  3M9J A;  4WET A;  1SK1 A;  1S3A A;  3TKR A;  1EEJ A;  2ON7 A;  3L0H A;  5KN2 A;  1O81 A;  5DAL B;  3FZ9 A;  2C3N A;  2CQ9 A;  5IPG A;  2VOC A;  2JAD A;  4I8B A;  1FW1 A;  4GQC A;  1K3O A;  2H74 A;  3A2X A;  2H70 A;  4OD7 A;  2AAW A;  3L9V A;  4FO5 A;  4I2U A;  4X0X A;  3GST A;  4AJ7 A;  3P90 A;  1G6W A;  1Z7R A;  4PUR A;  1DE2 A;  2H72 A;  3IE3 A;  2FWG A;  1S3C A;  2M72 A;  2VUP A;  3TKQ A;  2WDU A;  4HI7 A;  1AQX A;  1PX7 A;  2X8C A;  2K8V A;  3D6I A;  1XIY A;  1AAZ A;  1GSQ A;  1RK4 A;  2K6V A;  3GYK A;  4PQ1 A;  4K2D A;  2OAD A;  3SWL A;  1IYI A;  4HU9 A;  1YEX A;  3M9K A;  1SJZ A;  2C0G A;  1OC3 A;  3HJO A;  3ZVJ A;  5GSS A;  2H1A A;  6GSX A;  1MD3 A;  5DJL A;  3I69 A;  1A2L A;  1KEB A;  1AIU A;  2WFC A;  1TK5 B;  4GLT A;  5J9B A;  5HR1 A;  4NV5 A;  1WWJ A;  4YAP A;  4POK A;  4GCI A;  5EL8 A;  1FHE A;  3WT1 A;  1HNB A;  4WEY A;  1X5C A;  5D9T A;  2KOK A;  5D73 A;  1W89 A;  5H5S A;  2WCI A;  4F2I A;  4HOJ A;  6GSY A;  4EE0 A;  4XRA A;  3LYK A;  4TR3 A;  3VI5 A;  1O6J A;  2A4V A;  5IMD A;  5ECQ B;  4MJE A;  4FYU A;  2IPA A;  1MD4 A;  4HU7 A;  2DJ0 A;  5B6N A;  3GX0 A;  2YV7 A;  4EL1 A;  1MDI A;  2N5B A;  3D21 A;  2OBI A;  4POM A;  4IQA A;  4IJI A;  4AGS A;  1OC9 B;  2TIR A;  4ZL9 A;  3CRU A;  2YCD A;  4O92 A;  5CAX A;  3F4R A;  5JWR B;  1TI1 A;  3RPN A;  4HZ4 A;  3RHB A;  3HA9 A;  3O6T A;  2OBK A;  2F8A A;  1FVK A;  5HFG A;  1A0F A;  5COH A;  1JZR A;  2IN3 A;  3J7Y k;  3UAR A;  3N9J A;  1EV9 A;  1R7H A;  1UA5 A;  2GS3 A;  1YDK A;  5F0G A;  18GS A;  3DIE A;  1ON4 A;  4ECI A;  1GSY A;  1GUL A;  4XS4 A;  3QFB C;  3IR4 A;  5B7C A;  3W6G A;  1Q4J A;  1GRX A;  3KH9 A;  4JED A;  4WXT A;  3TKP A;  5FT3 A;  1OKT A;  1U88 A;  3ZVJ D;  3UEM A;  2E0Q A;  4N11 A;  2A2R A;  16GS A;  4LL4 B;  1OE8 A;  3E3E A;  5ID2 A;  1X5D A;  2LKU A;  2WB9 A;  3CSJ A;  2I9H A;  1A23 A;  1WIK A;  3GH9 A;  1MDJ A;  2F51 A;  1VF1 A;  4JR6 A;  1EGR A;  3ZIJ A;  2YWM A;  3MSZ A;  4KDY A;  22GS A;  3F3R A;  1R5P A;  2LJA A;  3IK9 A;  17GS A;  2CVD A;  3KMN A;  2LUS A;  3H79 A;  3EUR A;  3P2A A;  5DAK A;  2RM6 A;  2PN8 A;  1UN2 A;  3LXZ A;  2P31 A;  2LQQ A;  1SKR B;  1GLQ A;  3TKS E;  4N10 A;  5FHI A;  3LXT A;  3A2V A;  2P5Q A;  2HSY A;  3OR5 A;  5F07 A;  1WP0 A;  1XXU A;  1FOV A;  3P7X A;  1BX9 A;  20GS A;  4PNG A;  2C4J A;  5ABR A;  3DRN A;  3UIW A;  3LSZ A;  3TJF A;  3GHA A;  2NPB A;  3ERF A;  4JBB A;  2RUF A;  1H4O A;  3C1R A;  3KP9 A;  6GST A;  2X8G A;  1ILO A;  3NOF A;  3GTU B;  5ELA A;  2ON5 A;  3UAP A;  3PIN A;  5J3R A;  4GSN A;  1Z7P A;  4ZB8 A;  4L0U A;  2VAF A;  3KH7 A;  3CSH A;  1OKD A;  5E59 A;  2JU5 A;  1MTC A;  2YAN A;  1BED A;  1FVJ A;  4YQU A;  1Z6M A;  3GIX A;  2LNT A;  3QPM A;  2XPE A;  1DSB A;  3TRQ A;  4L5L A;  2MMZ A;  3LWA A;  2DC5 A;  4KW6 A;  4HJ2 A;  2FUG 2;  3KCM A;  4GQF A;  1TI3 A;  3ED3 A;  2VCQ A;  2DJ2 A;  4O5R A;  4E8H A;  3QAW A;  1XFL A;  1WMJ A;  3DD3 A;  3IDV A;  2O87 A;  3L9U A;  5FWG A;  3EYT A;  1EP8 A;  3GKN A;  2H0I A;  1X5E A;  6GSU A;  2R4V A;  3GRX A;  4RI6 A;  3H93 A;  1XW6 A;  3UJ1 A;  4WF4 A;  2YJH A;  3GKX A;  1FB0 A;  2H75 A;  1HQO A;  2P0G A;  2H1B A;  2DML A;  2WS2 A;  2YZU A;  4N0V A;  2LEG A;  1T00 A;  5F05 A;  5IMC A;  3M0F A;  2QGV A;  2L5O A;  1SD9 A;  1U3I A;  2VD1 A;  2O89 A;  2JSZ A;  2VL9 A;  4XS6 A;  3C8E A;  3IBH A;  1ABA A;  3ME7 A;  1K3L A;  3TDG A;  1Z5Y E;  2G0F A;  3GNJ A;  1XW5 A;  4X1U A;  1XOA A;  4P3Y B;  2PER A;  1T4Y A;  2H0G A;  3C73 A;  5G5F A;  4ML6 A;  2DSA A;  4EC0 A;  3IAS 2;  5D9X A;  5KN0 A;  1ERW A;  2C0D A;  1YY7 A;  3WYW A;  3F4T A;  2MBS A;  2OA7 A;  3LGC A;  2FA4 A;  3Q19 A;  3HD5 A;  3D0Z A;  5AGY A;  5IMZ A;  3ZIT A;  3I6A A;  2B3S A;  4IBP A;  4WF5 A;  5ECK B;  5ECR B;  5E4W A;  4I2T A;  1B4Q A;  3AY8 A;  5KEJ A;  4Q5Q A;  1V9W A;  4EXJ A;  4V2M A;  2IFQ A;  5J9C A;  3GV1 A;  3F9U A;  3H1N A;  1XZO A;  2RM5 A;  5KN3 A;  1I9D A;  4TVE A;  2F9S A;  2M46 A;  4EO3 A;  3ZRD A;  1C72 A;  2BJX A;  4TR0 A;  2JSY A;  4RI7 A;  3ZIV A;  3RAZ A;  1GL8 A;  3WGE A;  3WT2 A;  1R5A A;  4L5O A;  4H86 A;  1Q98 A;  1O8X A;  4CDO A;  3DXB A;  2I81 A;  3ZTL A;  5IOW A;  1A2M A;  2NDO A;  3GKK A;  4V1A g;  1RW1 A;  1M9A A;  1EOH A;  2ZNM A;  2PGT A;  4I5Q A;  1BAY A;  1F2E A;  2RLI A;  4V2N A;  2HXK A;  3APO A;  2G2Q A;  2YWI A;  3MAK A;  1JLV A;  1M7T A;  4TXV A;  5GST A;  4HQZ A;  1UC7 A;  3IXR A;  4IVF A;  2L59 A;  4F0B A;  1NM3 A;  1ZYE A;  3DEX A;  2CZ2 A;  2MZC A;  2OKA A;  5G2Z A;  3FHK A;  2E7P A;  1VRS D;  4NWY A;  4QL9 A;  3KIJ A;  5ECH B;  1O85 A;  2H66 A;  3I43 A;  5G1K A;  2CAI A;  2LV3 A;  4KND A;  1ZL9 A;  3HDC A;  5DQS A;  3FKF A;  1M0U A;  2E2M A;  3WGD A;  1ERU A;  1I5G A;  3EU3 A;  4JRR A;  1YKC A;  1XWB A;  4KB3 A;  3O3T A;  1PSQ A;  2VM1 A;  4NHZ A;  1FB6 A;  5F06 A;  5EPF A;  2TRC P;  2VD0 A;  2H76 A;  3IPZ A;  3GH6 A;  4MZC A;  4PUA A;  4HEA 2;  3J7Y b;  4IJ3 A;  5J5N A;  5DDL A;  1EOG A;  4F0C A;  5F8B A;  9GSS A;  3GL3 A;  2HRF A;  3TUE A;  2IMI A;  3TKS A;  2FWF A;  3GN3 A;  2B5X A;  4XCS A;  3EWL A;  4TR4 A;  2FA8 A;  3TJG A;  3FR9 A;  3EC3 A;  3EU4 A;  4POB A;  5JCG A;  1SKW B;  3VUR A;  1K0B A;  3TOT A;  6GSV A;  1M99 A;  4LMV A;  1T4Z A;  3Q6O A;  4MZW A;  1EWX A;  4K0N A;  4O32 A;  4ZBD A;  1TDI A;  3QD9 A;  5J4U A;  4KA0 A;  1VGL A;  2HYX A;  3EVI A;  5HQP A;  1PA3 A;  5ECS A;  2PMT A;  6GSS A;  1XW9 A;  3HVX A;  5AN1 A;  3EIN A;  4RQX A;  4DEJ A;  1QGV A;  1B4P A;  3QDN A;  4XTS A;  5IO2 A;  1M2B A;  5IMF A;  5IPH A;  2RUE A;  4Q5N A;  4ZXG A;  1A24 A;  5CP1 A;  2DIY A;  1ERT A;  4YQM A;  1USB A;  4EDZ A;  4OFM A;  4BA7 A;  3QAV A;  4JU5 A;  1PN9 A;  2LNS A;  2CVK A;  2K9F A;  1LU4 A;  4WKW A;  5H5R A;  1ERV A;  2FD3 A;  1JZO A;  3F6D A;  1TJD A;  1BYE A;  2DJK A;  3TB2 A;  1EGO A;  3ZRE A;  4D73 B;  4K6X A;  1TRU A;  4Z7X A;  2H8L A;  2VCW A;  4XS4 B;  3QFA C;  4XRD A;  3ZYW A;  2DMM A;  5J41 A;  2O85 A;  1TP9 A;  3IK7 A;  1BQ7 A;  3ERW A;  19GS A;  2YNX A;  1ZOF A;  2HLS A;  2HSH A;  4OFN A;  1O73 A;  4GXZ A;  3U5R E;  5D9V A;  3LQ7 A;  1WPI A;  1CQH A;  2MBT A;  2X8H A;  3UVH A;  1LBK A;  2C8U A;  1SK0 A;  1ZMA A;  4EKZ A;  4GSS A;  5G30 A;  12GS A;  2FLS A;  2B1L A;  2R6K A;  1GTU A;  2H0H A;  5D8I A;  1OC9 A;  1V98 A;  3GSS A;  3UBL A;  4MH3 A;  4K7I A;  1OVN A;  2JZR A;  3DGQ A;  4FYB A;  2LST A;  4N30 A;  4TKY A;  3HY2 A;  4AJ6 A;  5B8A A;  1M9B A;  1THO A;  4YQV A;  1GH2 A;  3GFK A;  2VLT A;  1JZD A;  3FRC A;  3HYP A;  4CW9 A;  5ECI B;  4LLR A;  2DJ3 A;  2FHE A;  3BBY A;  4XIH A;  3QAG A;  5CRG A;  3LJR A;  2V6K A;  1N8J A;  3PH9 A;  2PUK C;  3TGZ A;  3TRP A;  3LEF A;  4DSS A;  5D96 A;  2LTK A;  5ECP B;  2HZE B;  1TRV A;  4MZB A;  3DYR A;  1QQ2 A;  1HNA A;  4OFT A;  3KZQ A;  3L4N A;  1MEK A;  2IME A;  3E9J B;  3KD0 A;  4K7O A;  4ZBA A;  3ME8 A;  4XHM A;  4V1A p;  3VK9 A;  3GX8 A;  2EC4 A;  4PX1 A;  3UBK A;  4HUA A;  3L9S A;  3VI7 A;  4KX4 A;  1E2Y A;  2QKE A;  2IMK A;  2R3X A;  3KXO A;  1VF3 A;  2WUL A;  3KTL A;  2FY6 A;  11GS A;  4TR1 B;  3EMX A;  2CV4 A;  1A8L A;  2F3M A;  3GUS A;  4I97 A;  5ECL B;  1Z3E A;  3ZMK A;  1PKZ A;  3K8N A;  3DVX A;  4KSM A;  4PNF A;  1F3B A;  2VCT A;  3D5J A;  3TJK A;  2FWE A;  3ERG A;  5A4V A;  1GSU A;  2L4Q A;  3LYP A;  1SJ6 A;  2GQM A;  5EVO A;  3F6F A;  3G7Y A;  3TJJ A;  1CQG A;  4PXO A;  2ES7 A;  1NHO A;  1K0D A;  1WOU A;  2X99 A;  1X9M B;  1G7E A;  2GSS A;  3VPQ A;  1E6B A;  3IOS A;  4JR4 A;  2WZ9 A;  2HNL A;  2H6Z A;  4ZIL A;  3DWV A;  2DJJ A;  4TOP A;  1T1V A;  1GNE A;  2B5E A;  5B6M A;  1T3B A;  2V1M A;  1GWC A;  4TW5 A;  5AIV A;  1HNC A;  1THX A;  3BD2 A;  1TW9 A;  1A0R P;  3GTU A;  4FH8 A;  5DCG A;  4EUY A;  1SK2 A;  4DVC A;  2PWJ A;  3W8J A;  2RII A;  2LS5 A;  1N2A A;  1SEN A;  1SJI A;  2DIZ A;  1K0A A;  1JHB A;  5ECO B;  2X64 A;  1K3Y A;  4KCE A;  4RQR A;  2CT6 A;  3KP8 A;  2V41 A;  3VWX A;  2IJY A;  4NAX A;  2IMD A;  3ZFL A;  2J23 A;  5AIX A;  3H4K A;  1J0F A;  1YEP A;  4TN8 A;  1AW9 A;  1GUM A;  2YJ7 A;  2E2G A;  2P5R A; 
#chains in the Genus database with same CATH topology
 2LQO A;  2R0G A;  2B5Y A;  1FG4 A;  1SYX A;  5HR3 A;  4GTU A;  4J56 E;  1A2J A;  3M8N A;  2GVP A;  1MDK A;  4ZB9 A;  1TXX A;  4FIW A;  4GRF A;  4MJC A;  3CXG A;  4BL7 B;  5GAP D;  3CRT A;  1ST9 A;  3APS A;  4OWY A;  5A4W A;  4L0W A;  2OAC A;  1URM A;  5CRE A;  2VIM A;  1NSW A;  1QFN A;  2BTO T;  2KP2 A;  2IFQ B;  1F6M C;  1UVZ A;  4NMU A;  2PVQ A;  2H1D A;  5GZZ B;  2PPT A;  5ECM B;  1F37 A;  4L8E A;  2C1Y A;  2L5L A;  1ZYN A;  3M3M A;  3ZLP A;  3FR6 A;  4MP4 A;  5LCZ A;  4TXO B;  3IAM 2;  1OC8 A;  3ZML A;  5HR0 A;  2GT6 A;  4MAB A;  2L6C A;  4BVY B;  3GKM A;  2HRN A;  1XBS A;  1SKS B;  1NHY A;  2GSR A;  5CRW A;  3A5W A;  1B9X C;  4K2X A;  3HXS A;  3CBU A;  2C3Q A;  1K0N A;  1XWG A;  3MWH A;  4X4J A;  1U87 A;  5HFI A;  1AUC A;  3EMP A;  1SD8 A;  2GDR A;  3LG6 A;  1GUK A;  1TK0 B;  1T8E B;  3ZL5 A;  2B1K A;  1BJX A;  1RQM A;  3F0I A;  4MA9 A;  2VM2 A;  5H5Q A;  3KJY A;  3HCZ A;  1AC1 A;  1QMV A;  3H8Q A;  1W4V A;  3BJ5 A;  1GLP A;  4G2E A;  2C80 A;  4AF2 A;  4ZBB A;  7GSS A;  4BVX B;  4IS0 A;  3HZ4 A;  4GST A;  3FZA A;  2VLV A;  1F9M A;  1VF4 A;  2VCX A;  1ACV A;  3FK8 A;  3QMX A;  1GTI A;  1AQW A;  4F82 A;  4Q5R A;  1JLW A;  4ISD A;  5DJM A;  3IV4 A;  1V57 A;  3APQ A;  5IO0 A;  5JWQ B;  3WGX A;  1F3A A;  2MMO A;  3CSI A;  4IP6 A;  3CMI A;  3RPP A;  3DKS A;  5IQY A;  1BG5 A;  2KLX A;  4MNN A;  5L71 A;  4ULX A;  1H75 A;  4J57 E;  1SL1 B;  2OE1 A;  4MPF A;  2YN1 A;  2GQK A;  2YPM A;  2NBS A;  4O5U A;  1FOH A;  2GZY A;  3D4M A;  3GMF A;  4ACS A;  3TRX A;  4LA1 A;  2XC2 A;  3D22 A;  2X4A A;  1B9Y C;  3E0U A;  2LRN A;  3DML A;  4IQ1 A;  5JCW A;  1GSE A;  2O7K A;  1XWK A;  4E8E A;  2KUC A;  4Z2U A;  2BMX A;  1ZYQ B;  2H71 A;  3ZZX A;  3P8W A;  5CYY A;  4IHU A;  10GS A;  4G19 A;  3Q18 A;  2CAQ A;  3HJP A;  2L57 A;  2H30 A;  1TU8 A;  1EP7 A;  2H6X A;  2KP1 A;  1PGT A;  3BCI A;  5DAL A;  1TRS A;  1K0O A;  4IKH A;  4MF5 A;  4MDC A;  1PMT A;  3HKR A;  1XVQ A;  4Q5F A;  4ECB A;  5DVB A;  2O8V B;  4IW9 A;  1PL1 A;  4KDX A;  5IIZ A;  1PD2 1;  1R26 A;  1YF1 A;  3W8S A;  3FR3 A;  2OE3 A;  4MMM A;  3R2Q A;  5A4U A;  3SBC A;  1KBN A;  1JFU A;  3F3Q A;  3LFL A;  4ECC A;  2I4A A;  1YQ1 A;  3FZ4 A;  5CRH A;  2H01 A;  2TRX A;  3KTB A;  4QL7 A;  4K5S A;  3UMA A;  5D93 A;  1U6T A;  5G5E A;  4NHW A;  2J9H A;  2L6D A;  4ML1 A;  3C71 A;  3HJM A;  4OCF A;  2JZS A;  2DLX A;  1GP1 A;  2L4C A;  4PTS A;  4YAV A;  4KUN A;  3JCM L;  2DKH A;  2AHE A;  1Z9H A;  4TRX A;  4JE1 A;  2DBC A;  5KOW A;  1QK8 A;  4ZL8 A;  4MCU A;  5JWO B;  4LMW A;  5JCU A;  2YP6 A;  5LNK e;  3HVS A;  1J9B A;  5HR2 A;  1QUW A;  4HDE A;  3VWV A;  1DE1 A;  1XWA A;  5GAN D;  8GSS A;  2VCV A;  2AV4 A;  3TCO A;  3HZ8 A;  5DCH A;  4N0Z A;  1VF2 A;  5CO3 A;  1S3R A;  2GZZ A;  2R0P A;  2EIR A;  4CHS A;  4EIP A;  2GST A;  5ID2 B;  1TU7 A;  4DSQ A;  4EF0 A;  3F63 A;  2GGT A;  2N5F A;  3G7I A;  2R37 A;  4K0G A;  3U6V A;  2REM A;  2XHF A;  4XS1 A;  1SL2 B;  5AIS A;  5G31 A;  4YKG A;  3FZ5 A;  4MH2 A;  1GNW A;  2XPD A;  4NPB A;  4D73 A;  2OE0 A;  3BOA A;  1TK8 B;  1XWC A;  1O8W A;  4YKF A;  4ICY A;  1SL0 B;  4OCE A;  4BPY A;  5BMU A;  1V40 A;  4DSS B;  3FEU A;  2H73 A;  3TKS C;  2CA8 A;  4F03 A;  5EY6 A;  2LRT A;  1QXH A;  5DAK B;  2PU9 C;  3ZFB A;  1V2A A;  3NZN A;  1PQN A;  2AB6 A;  4K1F A;  2A2S A;  1ZZY A;  2IIY A;  1AQV A;  4KGI A;  4MJA A;  1X9W B;  3A3T A;  4NXI A;  3TJB A;  3I9V 2;  3A2W A;  2UZ8 A;  2ZUP A;  5ELG A;  1OE7 A;  2YZH A;  3D4T A;  1KTE A;  3VPT A;  2K8S A;  3O76 A;  5IM9 A;  4WR5 A;  1M3I A;  2Z9S A;  2MMA A;  3RBT A;  1SYR A;  2FNO A;  1Y25 A;  2V2G A;  1A8Y A;  2X49 A;  4GWR A;  3UVT A;  2D2Z A;  4KSO A;  2H19 A;  2JL4 A;  4ECJ A;  4MF7 A;  2HSM A;  3MNG A;  2NTO A;  13GS A;  3GUR A;  1T7P B;  3FYG A;  4PUF C;  3CYN A;  3HHV A;  3WD6 A;  3Q74 A;  2GTU A;  1O7U A;  2HE3 A;  4KDU A;  4POL A;  2HZE A;  2ALB A;  3VLN A;  4OMV A;  2H6Y A;  2CX4 A;  1XVW A;  3G7J A;  2HRK A;  2FCH A;  1TRW A;  3KM6 A;  2NVL A;  2B6M A;  2C0F A;  4MJB A;  4EVM A;  5HFK A;  3MIX A;  1DBY A;  4HS1 A;  3GL5 A;  1GUH A;  1X9S B;  4BWS A;  3F4S A;  1J08 A;  3NIV A;  4IEL A;  2B7K A;  2N5A A;  1SU9 A;  2R5G A;  3KMO A;  4TR1 A;  4X43 A;  4KCA A;  2HI7 A;  3QOU A;  4MPG A;  2PVO C;  1M2A A;  2B7J A;  5B8B A;  1AXD A;  4ID0 A;  1GTA A;  1B8X A;  4LL1 B;  4OO5 A;  1X0R A;  1PL2 A;  3LW9 A;  2OJL A;  3RDW A;  2GQL A;  3MYD A;  2VL3 A;  5KN1 A;  5ECN B;  4ZB6 A;  4G0L A;  1G0T A;  1NW2 A;  1B48 A;  4HJM A;  4HQS A;  1U3A A;  2PBJ A;  2C0E A;  2K18 A;  2HZF A;  2VCZ A;  2FWH A;  3IA1 A;  4PGT A;  4MF6 A;  1WE0 A;  2C3T A;  2VLU A;  1GSS A;  1PRX A;  3IHQ A;  3PGT A;  2V6O A;  3LOR A;  1V58 A;  1DUG A;  2EIQ A;  4QQ7 A;  2MMN A;  2CVB A;  3V1W A;  1GTB A;  1IYH A;  3UL3 A;  2AYT A;  2VL2 A;  3F8U A;  4EDY A;  4ILF A;  1K0M A;  3C1S A;  2KHP A;  2FGX A;  3QCP A;  4MLY A;  1XOB A;  5IMA A;  2V32 A;  1TTZ A;  1EZK A;  4K7N A;  5IOX A;  2YWO A;  4ZIJ A;  1EEM A;  4PQH A;  4PQI A;  1HD2 A;  1Y6E A;  5IMV A;  3EE2 A;  2QSI A;  1Z6N A;  5ENU A;  4WBJ A;  2I1U A;  4BIK A;  4G9H A;  3S9F A;  3CTG A;  3N5O A;  2GZP A;  1XPV A;  3KEB A;  3MDK A;  3QR6 A;  1KNG A;  1YKA A;  2ZCT A;  5C04 A;  4NV2 A;  4DSR A;  5C00 A;  1PKW A;  2WGR A;  5CRD A;  4GF0 A;  3IRA A;  2CZ3 A;  1ML6 A;  1OYJ A;  3HVN A;  2HFD A;  4I6X A;  3FW2 A;  4Z2R A;  4KAE A;  2WRT A;  1PX6 A;  4HZ2 A;  3VFI A;  5DQY A;  2MYG A;  1TKD B;  1FAA A;  4K8M A;  2H1G A;  2EIO A;  1G7O A;  2LJK A;  1TOF A;  4IGJ A;  4V2L A;  3IC4 A;  3RHC A;  3HVV A;  4J2F A;  4BL7 A;  2XBI A;  1G6Y A;  2XBQ A;  4RUV A;  1WRY A;  3GA4 A;  1ZCP A;  2LJR A;  4MK3 A;  2R0C A;  2I3Y A;  3KGK A;  5G1L A;  4F9Z A;  4KE3 A;  2CX3 A;  2IMF A;  4O7H A;  4K9Z A;  4BWQ A;  6GSW A;  2HT9 A;  2IL3 A;  2WJU A;  5D9W A;  5LD0 A;  4OO4 A;  2GLR A;  1OAZ A;  3US3 A;  3DVW A;  4IP1 A;  2YWN A;  3ISO A;  2GSQ A;  3M1G A;  2QC7 A;  1JZW A;  4TXO A;  2AJQ B;  4KH7 A;  4FYC A;  4WBR D;  4JZQ A;  1GSF A;  2LRC A;  4YH2 A;  5DBQ A;  4BVY A;  3L78 A;  1K0C A;  3VWW A;  1S3D A;  2M80 A;  3C7M A;  3G9B A;  1LJR A;  1XCC A;  4G10 A;  4WR4 A;  1YZX A;  1HYU A;  2F8F A;  2R2J A;  1FO5 A;  1YF0 A;  3UOM A;  3TOU A;  5INY A;  14GS A;  3VWU A;  2GT5 A;  2DJ1 A;  1YJ6 A;  2YV9 A;  1R4W A;  1M2D A;  4AJ8 A;  2HRA A;  4ZL7 A;  2JAC A;  5A5K A;  2JZT A;  3FY7 A;  2AUV A;  2YOI A;  1EV4 A;  2VL2 C;  3BCK A;  1WJK A;  1ZGN A;  2VO4 A;  3CTF A;  1GSD A;  2IWT A;  4BVX A;  4IN0 A;  3PR8 A;  5CNW A;  3M9J A;  4WET A;  1SK1 A;  1S3A A;  3TKR A;  1EEJ A;  2ON7 A;  3A5I A;  3L0H A;  5KN2 A;  1O81 A;  4FQU A;  3FZ9 A;  5DAL B;  2C3N A;  2CQ9 A;  5IPG A;  2VOC A;  2JAD A;  4I8B A;  1FW1 A;  4GQC A;  1K3O A;  2H74 A;  3A2X A;  2H70 A;  4OD7 A;  2AAW A;  3L9V A;  4FO5 A;  4I2U A;  4X0X A;  3GST A;  3FMW A;  4AJ7 A;  3P90 A;  1G6W A;  1Z7R A;  4PUR A;  1DE2 A;  2H72 A;  3IE3 A;  2FWG A;  1S3C A;  2M72 A;  2VUP A;  3TKQ A;  2WDU A;  4HI7 A;  1AQX A;  1PX7 A;  2X8C A;  2K8V A;  3D6I A;  1XIY A;  1AAZ A;  1GSQ A;  1RK4 A;  2K6V A;  3GYK A;  4PQ1 A;  4K2D A;  2OAD A;  3SWL A;  1IYI A;  4HU9 A;  1YEX A;  3M9K A;  1SJZ A;  2C0G A;  1OC3 A;  3EPT A;  3HJO A;  3ZVJ A;  5GSS A;  2H1A A;  4G0I A;  6GSX A;  4G0K A;  1MD3 A;  5DJL A;  3I69 A;  1A2L A;  1KEB A;  1AIU A;  2WFC A;  1TK5 B;  4GLT A;  5J9B A;  5HR1 A;  4NV5 A;  1WWJ A;  4YAP A;  4POK A;  4GCI A;  5EL8 A;  1FHE A;  3WT1 A;  1HNB A;  4WEY A;  1X5C A;  5D9T A;  2KOK A;  5D73 A;  1W89 A;  5H5S A;  2WCI A;  4F2I A;  4HOJ A;  6GSY A;  4EE0 A;  4XRA A;  3LYK A;  4TR3 A;  3VI5 A;  1O6J A;  2A4V A;  5IMD A;  5ECQ B;  4MJE A;  4FYU A;  2IPA A;  1MD4 A;  4HU7 A;  2DJ0 A;  5B6N A;  3GX0 A;  2YV7 A;  4EL1 A;  1MDI A;  2N5B A;  3D21 A;  2OBI A;  4POM A;  4IQA A;  4IJI A;  4AGS A;  1OC9 B;  2TIR A;  4ZL9 A;  3CRU A;  2YCD A;  4O92 A;  5CAX A;  3F4R A;  5JWR B;  1TI1 A;  3RPN A;  4HZ4 A;  3RHB A;  3HA9 A;  3O6T A;  2OBK A;  2F8A A;  1FVK A;  5HFG A;  1A0F A;  5COH A;  1JZR A;  2IN3 A;  3J7Y k;  3UAR A;  3N9J A;  1EV9 A;  1R7H A;  1UA5 A;  2GS3 A;  1YDK A;  5F0G A;  18GS A;  3DIE A;  1ON4 A;  1XG8 A;  4ECI A;  1GSY A;  1GUL A;  4EIQ A;  2QA2 A;  4XS4 A;  3QFB C;  3IR4 A;  5B7C A;  3W6G A;  1Q4J A;  1GRX A;  3KH9 A;  4JED A;  4WXT A;  3TKP A;  5FT3 A;  3PPU A;  1OKT A;  1U88 A;  3ZVJ D;  3UEM A;  2E0Q A;  4N11 A;  2A2R A;  16GS A;  4LL4 B;  1OE8 A;  3E3E A;  5ID2 A;  1X5D A;  2LKU A;  2WB9 A;  3CSJ A;  2I9H A;  1A23 A;  1WIK A;  3GH9 A;  1MDJ A;  2F51 A;  1VF1 A;  4JR6 A;  1EGR A;  3ZIJ A;  2YWM A;  3MSZ A;  4KDY A;  22GS A;  3F3R A;  1R5P A;  3IHG A;  2LJA A;  3IK9 A;  17GS A;  2CVD A;  3KMN A;  2LUS A;  3H79 A;  3EUR A;  3P2A A;  5DAK A;  2RM6 A;  2PN8 A;  1UN2 A;  3LXZ A;  2P31 A;  2LQQ A;  1SKR B;  1GLQ A;  3TKS E;  4N10 A;  5FHI A;  1PFO A;  3LXT A;  3A2V A;  2P5Q A;  2HSY A;  3OR5 A;  5F07 A;  1WP0 A;  4CY6 A;  1XXU A;  1FOV A;  3P7X A;  1BX9 A;  20GS A;  4PNG A;  2C4J A;  5ABR A;  3DRN A;  3UIW A;  3LSZ A;  3TJF A;  3GHA A;  5KOX A;  2NPB A;  3ERF A;  4JBB A;  2RUF A;  1H4O A;  2DKI A;  3C1R A;  3KP9 A;  6GST A;  2X8G A;  1ILO A;  3NOF A;  3GTU B;  5ELA A;  2ON5 A;  3UAP A;  3PIN A;  5J3R A;  4GSN A;  1Z7P A;  4ZB8 A;  4L0U A;  2VAF A;  3KH7 A;  3CSH A;  1OKD A;  5E59 A;  2JU5 A;  1MTC A;  2YAN A;  1BED A;  4KF9 A;  1FVJ A;  4YQU A;  1Z6M A;  3GIX A;  2LNT A;  3QPM A;  2XPE A;  1PN0 A;  1DSB A;  3TRQ A;  4L5L A;  5BRT A;  2MMZ A;  3LWA A;  2DC5 A;  4KW6 A;  4HJ2 A;  2FUG 2;  3KCM A;  4GQF A;  1TI3 A;  3ED3 A;  2VCQ A;  2DJ2 A;  4O5R A;  4E8H A;  3QAW A;  1XFL A;  1WMJ A;  3DD3 A;  3IDV A;  2O87 A;  4O5Q A;  3L9U A;  5FWG A;  3EYT A;  1EP8 A;  3GKN A;  2H0I A;  1X5E A;  6GSU A;  2R4V A;  3GRX A;  4RI6 A;  3H93 A;  1XW6 A;  3UJ1 A;  4WF4 A;  2YJH A;  3GKX A;  1FB0 A;  2H75 A;  1HQO A;  2P0G A;  2H1B A;  2DML A;  2WS2 A;  2YZU A;  4N0V A;  2LEG A;  1T00 A;  5F05 A;  5IMC A;  3M0F A;  2QGV A;  4HSC X;  2L5O A;  1SD9 A;  1U3I A;  2VD1 A;  2O89 A;  2JSZ A;  2VL9 A;  4XS6 A;  3C8E A;  3IBH A;  1ABA A;  3ME7 A;  1K3L A;  3TDG A;  4CY8 A;  1Z5Y E;  2G0F A;  3GNJ A;  1XW5 A;  4X1U A;  1XOA A;  4P3Y B;  2PER A;  1T4Y A;  2H0G A;  3C73 A;  5G5F A;  4ML6 A;  2DSA A;  4EC0 A;  3IAS 2;  5D9X A;  5KN0 A;  1ERW A;  2C0D A;  1YY7 A;  3WYW A;  3F4T A;  2MBS A;  2OA7 A;  3LGC A;  2FA4 A;  3Q19 A;  3HD5 A;  2A4H A;  3D0Z A;  5AGY A;  5IMZ A;  3ZIT A;  3I6A A;  2A2P A;  2B3S A;  4IBP A;  4WF5 A;  5ECK B;  5ECR B;  5E4W A;  4I2T A;  1B4Q A;  3AY8 A;  5KEJ A;  4Q5Q A;  1V9W A;  4EXJ A;  4V2M A;  2IFQ A;  5J9C A;  3GV1 A;  3F9U A;  3H1N A;  1XZO A;  2RM5 A;  5KN3 A;  1I9D A;  4TVE A;  2F9S A;  2M46 A;  4EO3 A;  3ZRD A;  1C72 A;  2BJX A;  4TR0 A;  2JSY A;  4RI7 A;  3ZIV A;  3RAZ A;  1GL8 A;  3WGE A;  3WT2 A;  1R5A A;  4L5O A;  2QA1 A;  4H86 A;  1Q98 A;  1O8X A;  4CDO A;  3DXB A;  2I81 A;  3ZTL A;  5IOW A;  1A2M A;  2NDO A;  3GKK A;  4V1A g;  1RW1 A;  1M9A A;  1EOH A;  2ZNM A;  2PGT A;  4I5Q A;  1BAY A;  1F2E A;  2RLI A;  4V2N A;  2HXK A;  3APO A;  2G2Q A;  2YWI A;  3MAK A;  1JLV A;  1M7T A;  4TXV A;  5GST A;  4HQZ A;  1UC7 A;  3IXR A;  4IVF A;  2L59 A;  4F0B A;  1NM3 A;  1ZYE A;  3DEX A;  2CZ2 A;  2MZC A;  2OKA A;  5G2Z A;  3FHK A;  2E7P A;  1VRS D;  4NWY A;  4QL9 A;  3KIJ A;  5ECH B;  1O85 A;  2H66 A;  3I43 A;  5G1K A;  2CAI A;  2LV3 A;  4KND A;  1ZL9 A;  3HDC A;  5DQS A;  3FKF A;  1M0U A;  2E2M A;  3WGD A;  1ERU A;  1I5G A;  3EU3 A;  4JRR A;  1YKC A;  1XWB A;  4KB3 A;  3O3T A;  1PSQ A;  2VM1 A;  4NHZ A;  1FB6 A;  5F06 A;  5EPF A;  2TRC P;  2VD0 A;  2H76 A;  3IPZ A;  3GH6 A;  4MZC A;  4PUA A;  4HEA 2;  3J7Y b;  4IJ3 A;  5J5N A;  5DDL A;  1EOG A;  4F0C A;  5F8B A;  9GSS A;  3GL3 A;  2HRF A;  3TUE A;  2IMI A;  3TKS A;  2FWF A;  3GN3 A;  2B5X A;  4XCS A;  3EWL A;  4TR4 A;  2FA8 A;  3TJG A;  3FR9 A;  3EC3 A;  3EU4 A;  4POB A;  5JCG A;  1SKW B;  3VUR A;  1K0B A;  3TOT A;  6GSV A;  1M99 A;  4LMV A;  1T4Z A;  3Q6O A;  4MZW A;  1EWX A;  4K0N A;  4O32 A;  4ZBD A;  1TDI A;  3QD9 A;  5J4U A;  4KA0 A;  1VGL A;  2HYX A;  3EVI A;  5HQP A;  1PA3 A;  5ECS A;  2PMT A;  6GSS A;  1XW9 A;  3HVX A;  5AN1 A;  3EIN A;  4RQX A;  4DEJ A;  1QGV A;  1B4P A;  3QDN A;  4XTS A;  5IO2 A;  4USS A;  1M2B A;  5IMF A;  5IPH A;  2RUE A;  4Q5N A;  4ZXG A;  1A24 A;  5CP1 A;  2DIY A;  1ERT A;  4YQM A;  1USB A;  4EDZ A;  4OFM A;  4BA7 A;  3QAV A;  4JU5 A;  1PN9 A;  2LNS A;  2CVK A;  2K9F A;  1LU4 A;  4WKW A;  5H5R A;  1ERV A;  2FD3 A;  1JZO A;  3F6D A;  1TJD A;  1BYE A;  2DJK A;  3TB2 A;  1EGO A;  3CQF A;  3ZRE A;  4D73 B;  4K6X A;  1TRU A;  4Z7X A;  2H8L A;  2VCW A;  4XS4 B;  3QFA C;  4XRD A;  3ZYW A;  2DMM A;  5J41 A;  2O85 A;  1TP9 A;  3IK7 A;  1BQ7 A;  3ERW A;  19GS A;  2YNX A;  1ZOF A;  2HLS A;  2HSH A;  4OFN A;  1O73 A;  4GXZ A;  3U5R E;  5D9V A;  3LQ7 A;  1WPI A;  1CQH A;  2MBT A;  2X8H A;  3UVH A;  1LBK A;  2C8U A;  1SK0 A;  1ZMA A;  4EKZ A;  4GSS A;  5G30 A;  12GS A;  2FLS A;  2B1L A;  2R6K A;  1GTU A;  2H0H A;  5D8I A;  1OC9 A;  1V98 A;  3GSS A;  3UBL A;  4MH3 A;  4K7I A;  1OVN A;  2JZR A;  3DGQ A;  4FYB A;  2LST A;  4N30 A;  4TKY A;  3HY2 A;  4AJ6 A;  5B8A A;  1M9B A;  1THO A;  4YQV A;  1GH2 A;  3GFK A;  2VLT A;  1JZD A;  3FRC A;  3HYP A;  4CW9 A;  5ECI B;  4LLR A;  2DJ3 A;  4K5R A;  2FHE A;  3BBY A;  4XIH A;  3QAG A;  5CRG A;  3LJR A;  2V6K A;  1N8J A;  3PH9 A;  2PUK C;  1ZYP A;  3TGZ A;  3TRP A;  3LEF A;  4DSS A;  5D96 A;  2LTK A;  5ECP B;  2HZE B;  1TRV A;  4MZB A;  3DYR A;  1QQ2 A;  1HNA A;  4OFT A;  3KZQ A;  3L4N A;  1MEK A;  2IME A;  3E9J B;  3IC8 A;  3KD0 A;  4K7O A;  4ZBA A;  4XHM A;  3ME8 A;  4V1A p;  3VK9 A;  3GX8 A;  2EC4 A;  4PX1 A;  3UBK A;  4HUA A;  3L9S A;  3VI7 A;  4KX4 A;  1E2Y A;  2QKE A;  2IMK A;  2R3X A;  3KXO A;  1VF3 A;  2WUL A;  3KTL A;  2FY6 A;  11GS A;  4TR1 B;  3EMX A;  2CV4 A;  1A8L A;  2F3M A;  3GUS A;  4I97 A;  5ECL B;  1Z3E A;  1M3J A;  3ZMK A;  1PKZ A;  3K8N A;  3DVX A;  4KSM A;  4PNF A;  1F3B A;  2VCT A;  3D5J A;  3TJK A;  2FWE A;  3ERG A;  5A4V A;  1GSU A;  2L4Q A;  3LYP A;  1SJ6 A;  2GQM A;  5EVO A;  3F6F A;  3G7Y A;  3TJJ A;  1CQG A;  4PXO A;  2ES7 A;  1NHO A;  1K0D A;  1WOU A;  2X99 A;  1X9M B;  3R3E A;  1G7E A;  2GSS A;  3VPQ A;  1E6B A;  3IOS A;  4JR4 A;  2WZ9 A;  2HNL A;  2H6Z A;  4ZIL A;  3DWV A;  2DJJ A;  4TOP A;  1T1V A;  1GNE A;  2B5E A;  5B6M A;  1T3B A;  2V1M A;  1GWC A;  4TW5 A;  5AIV A;  1HNC A;  1THX A;  3BD2 A;  1TW9 A;  1A0R P;  3GTU A;  4FH8 A;  5DCG A;  4EUY A;  1SK2 A;  4DVC A;  2PWJ A;  3W8J A;  2RII A;  2LS5 A;  1N2A A;  1SEN A;  1SJI A;  2DIZ A;  1K0A A;  1JHB A;  5ECO B;  2X64 A;  1K3Y A;  4KCE A;  4RQR A;  4A5P A;  2CT6 A;  3KP8 A;  2V41 A;  3VWX A;  2IJY A;  4NAX A;  2IMD A;  3ZFL A;  2J23 A;  5AIX A;  4Z2T A;  3H4K A;  1J0F A;  1YEP A;  4TN8 A;  1AW9 A;  1GUM A;  2YJ7 A;  2E2G A;  2P5R A; 
#chains in the Genus database with same CATH homology
 2LQO A;  2R0G A;  2B5Y A;  1FG4 A;  1SYX A;  5HR3 A;  4GTU A;  4J56 E;  1A2J A;  3M8N A;  2GVP A;  1MDK A;  4ZB9 A;  1TXX A;  4FIW A;  4GRF A;  4MJC A;  3CXG A;  4BL7 B;  5GAP D;  3CRT A;  1ST9 A;  3APS A;  4OWY A;  5A4W A;  4L0W A;  2OAC A;  1URM A;  5CRE A;  2VIM A;  1NSW A;  1QFN A;  2BTO T;  2KP2 A;  2IFQ B;  1F6M C;  1UVZ A;  4NMU A;  2PVQ A;  2H1D A;  5GZZ B;  2PPT A;  5ECM B;  1F37 A;  4L8E A;  2C1Y A;  2L5L A;  1ZYN A;  3M3M A;  3ZLP A;  3FR6 A;  4MP4 A;  5LCZ A;  4TXO B;  3IAM 2;  1OC8 A;  3ZML A;  5HR0 A;  2GT6 A;  4MAB A;  2L6C A;  4BVY B;  3GKM A;  2HRN A;  1XBS A;  1SKS B;  1NHY A;  2GSR A;  5CRW A;  3A5W A;  1B9X C;  4K2X A;  3HXS A;  3CBU A;  2C3Q A;  1K0N A;  1XWG A;  3MWH A;  4X4J A;  1U87 A;  5HFI A;  1AUC A;  3EMP A;  1SD8 A;  2GDR A;  3LG6 A;  1GUK A;  1TK0 B;  1T8E B;  3ZL5 A;  2B1K A;  1BJX A;  1RQM A;  3F0I A;  4MA9 A;  2VM2 A;  5H5Q A;  3KJY A;  3HCZ A;  1AC1 A;  1QMV A;  3H8Q A;  1W4V A;  3BJ5 A;  1GLP A;  4G2E A;  2C80 A;  4AF2 A;  4ZBB A;  7GSS A;  4BVX B;  4IS0 A;  3HZ4 A;  4GST A;  3FZA A;  2VLV A;  1F9M A;  1VF4 A;  2VCX A;  1ACV A;  3FK8 A;  3QMX A;  1GTI A;  1AQW A;  4F82 A;  4Q5R A;  1JLW A;  4ISD A;  5DJM A;  3IV4 A;  1V57 A;  3APQ A;  5IO0 A;  5JWQ B;  3WGX A;  1F3A A;  2MMO A;  3CSI A;  4IP6 A;  3CMI A;  3RPP A;  3DKS A;  5IQY A;  1BG5 A;  2KLX A;  4MNN A;  5L71 A;  4ULX A;  1H75 A;  4J57 E;  1SL1 B;  2OE1 A;  4MPF A;  2YN1 A;  2GQK A;  2YPM A;  2NBS A;  4O5U A;  1FOH A;  2GZY A;  3D4M A;  3GMF A;  4ACS A;  3TRX A;  4LA1 A;  2XC2 A;  3D22 A;  2X4A A;  1B9Y C;  3E0U A;  2LRN A;  3DML A;  4IQ1 A;  5JCW A;  1GSE A;  2O7K A;  1XWK A;  4E8E A;  2KUC A;  4Z2U A;  2BMX A;  1ZYQ B;  2H71 A;  3ZZX A;  3P8W A;  5CYY A;  4IHU A;  10GS A;  4G19 A;  3Q18 A;  2CAQ A;  3HJP A;  2L57 A;  2H30 A;  1TU8 A;  1EP7 A;  2H6X A;  2KP1 A;  1PGT A;  3BCI A;  5DAL A;  1TRS A;  1K0O A;  4IKH A;  4MF5 A;  4MDC A;  1PMT A;  3HKR A;  1XVQ A;  4Q5F A;  4ECB A;  5DVB A;  2O8V B;  4IW9 A;  1PL1 A;  4KDX A;  5IIZ A;  1PD2 1;  1R26 A;  1YF1 A;  3W8S A;  3FR3 A;  2OE3 A;  4MMM A;  3R2Q A;  5A4U A;  3SBC A;  1KBN A;  1JFU A;  3F3Q A;  3LFL A;  4ECC A;  2I4A A;  1YQ1 A;  3FZ4 A;  5CRH A;  2H01 A;  2TRX A;  3KTB A;  4QL7 A;  4K5S A;  3UMA A;  5D93 A;  1U6T A;  5G5E A;  4NHW A;  2J9H A;  2L6D A;  4ML1 A;  3C71 A;  3HJM A;  4OCF A;  2JZS A;  2DLX A;  1GP1 A;  2L4C A;  4PTS A;  4YAV A;  4KUN A;  3JCM L;  2DKH A;  2AHE A;  1Z9H A;  4TRX A;  4JE1 A;  2DBC A;  5KOW A;  1QK8 A;  4ZL8 A;  4MCU A;  5JWO B;  4LMW A;  5JCU A;  2YP6 A;  5LNK e;  3HVS A;  1J9B A;  5HR2 A;  1QUW A;  4HDE A;  3VWV A;  1DE1 A;  1XWA A;  5GAN D;  8GSS A;  2VCV A;  2AV4 A;  3TCO A;  3HZ8 A;  5DCH A;  4N0Z A;  1VF2 A;  5CO3 A;  2GZZ A;  2R0P A;  2EIR A;  4CHS A;  4EIP A;  2GST A;  5ID2 B;  1TU7 A;  4DSQ A;  4EF0 A;  3F63 A;  2GGT A;  2N5F A;  3G7I A;  2R37 A;  4K0G A;  3U6V A;  2REM A;  2XHF A;  4XS1 A;  1SL2 B;  5AIS A;  5G31 A;  4YKG A;  3FZ5 A;  4MH2 A;  1GNW A;  2XPD A;  4NPB A;  4D73 A;  2OE0 A;  3BOA A;  1TK8 B;  1XWC A;  1O8W A;  4YKF A;  4ICY A;  1SL0 B;  4OCE A;  4BPY A;  5BMU A;  1V40 A;  4DSS B;  3FEU A;  2H73 A;  3TKS C;  2CA8 A;  4F03 A;  5EY6 A;  2LRT A;  1QXH A;  5DAK B;  2PU9 C;  3ZFB A;  1V2A A;  3NZN A;  1PQN A;  2AB6 A;  4K1F A;  2A2S A;  1ZZY A;  2IIY A;  1AQV A;  4KGI A;  4MJA A;  1X9W B;  3A3T A;  4NXI A;  3TJB A;  3I9V 2;  3A2W A;  2UZ8 A;  2ZUP A;  5ELG A;  1OE7 A;  2YZH A;  3D4T A;  1KTE A;  3VPT A;  2K8S A;  3O76 A;  5IM9 A;  4WR5 A;  2Z9S A;  2MMA A;  3RBT A;  1SYR A;  2FNO A;  1Y25 A;  2V2G A;  1A8Y A;  2X49 A;  4GWR A;  3UVT A;  2D2Z A;  4KSO A;  2H19 A;  2JL4 A;  4ECJ A;  4MF7 A;  2HSM A;  3MNG A;  2NTO A;  13GS A;  3GUR A;  1T7P B;  3FYG A;  4PUF C;  3CYN A;  3HHV A;  3WD6 A;  3Q74 A;  2GTU A;  1O7U A;  2HE3 A;  4KDU A;  4POL A;  2HZE A;  2ALB A;  3VLN A;  4OMV A;  2H6Y A;  2CX4 A;  1XVW A;  3G7J A;  2HRK A;  2FCH A;  1TRW A;  3KM6 A;  2NVL A;  2B6M A;  2C0F A;  4MJB A;  4EVM A;  5HFK A;  3MIX A;  1DBY A;  4HS1 A;  3GL5 A;  1GUH A;  1X9S B;  4BWS A;  3F4S A;  1J08 A;  3NIV A;  4IEL A;  2B7K A;  2N5A A;  1SU9 A;  2R5G A;  3KMO A;  4TR1 A;  4X43 A;  4KCA A;  2HI7 A;  3QOU A;  4MPG A;  2PVO C;  1M2A A;  2B7J A;  5B8B A;  1AXD A;  4ID0 A;  1GTA A;  1B8X A;  4LL1 B;  4OO5 A;  1X0R A;  1PL2 A;  3LW9 A;  2OJL A;  3RDW A;  2GQL A;  3MYD A;  2VL3 A;  5KN1 A;  5ECN B;  4ZB6 A;  4G0L A;  1G0T A;  1NW2 A;  1B48 A;  4HJM A;  4HQS A;  1U3A A;  2PBJ A;  2C0E A;  2K18 A;  2HZF A;  2VCZ A;  2FWH A;  3IA1 A;  4PGT A;  4MF6 A;  1WE0 A;  2C3T A;  2VLU A;  1GSS A;  1PRX A;  3IHQ A;  3PGT A;  2V6O A;  3LOR A;  1V58 A;  1DUG A;  2EIQ A;  4QQ7 A;  2MMN A;  2CVB A;  3V1W A;  1GTB A;  1IYH A;  3UL3 A;  2AYT A;  2VL2 A;  3F8U A;  4EDY A;  4ILF A;  1K0M A;  3C1S A;  2KHP A;  2FGX A;  3QCP A;  4MLY A;  1XOB A;  5IMA A;  2V32 A;  1TTZ A;  1EZK A;  4K7N A;  5IOX A;  2YWO A;  4ZIJ A;  1EEM A;  4PQH A;  4PQI A;  1HD2 A;  1Y6E A;  5IMV A;  3EE2 A;  2QSI A;  1Z6N A;  5ENU A;  4WBJ A;  2I1U A;  4G9H A;  3S9F A;  3CTG A;  3N5O A;  2GZP A;  1XPV A;  3KEB A;  3MDK A;  3QR6 A;  1KNG A;  1YKA A;  2ZCT A;  5C04 A;  4NV2 A;  4DSR A;  5C00 A;  1PKW A;  2WGR A;  5CRD A;  4GF0 A;  3IRA A;  2CZ3 A;  1ML6 A;  1OYJ A;  2HFD A;  4I6X A;  3FW2 A;  4Z2R A;  4KAE A;  2WRT A;  1PX6 A;  4HZ2 A;  3VFI A;  5DQY A;  2MYG A;  1TKD B;  1FAA A;  4K8M A;  2H1G A;  2EIO A;  1G7O A;  2LJK A;  1TOF A;  4IGJ A;  4V2L A;  3IC4 A;  3RHC A;  3HVV A;  4J2F A;  4BL7 A;  2XBI A;  1G6Y A;  2XBQ A;  4RUV A;  1WRY A;  3GA4 A;  1ZCP A;  2LJR A;  4MK3 A;  2R0C A;  2I3Y A;  3KGK A;  5G1L A;  4F9Z A;  4KE3 A;  2CX3 A;  2IMF A;  4O7H A;  4K9Z A;  4BWQ A;  6GSW A;  2HT9 A;  2IL3 A;  2WJU A;  5D9W A;  5LD0 A;  4OO4 A;  2GLR A;  1OAZ A;  3US3 A;  3DVW A;  4IP1 A;  2YWN A;  3ISO A;  2GSQ A;  3M1G A;  2QC7 A;  1JZW A;  4TXO A;  2AJQ B;  4KH7 A;  4FYC A;  4WBR D;  4JZQ A;  1GSF A;  2LRC A;  4YH2 A;  5DBQ A;  4BVY A;  3L78 A;  1K0C A;  3VWW A;  1S3D A;  2M80 A;  3C7M A;  3G9B A;  1LJR A;  1XCC A;  4G10 A;  4WR4 A;  1YZX A;  1HYU A;  2F8F A;  2R2J A;  1FO5 A;  1YF0 A;  3UOM A;  3TOU A;  5INY A;  14GS A;  3VWU A;  2GT5 A;  2DJ1 A;  1YJ6 A;  2YV9 A;  1R4W A;  1M2D A;  4AJ8 A;  2HRA A;  4ZL7 A;  2JAC A;  5A5K A;  2JZT A;  3FY7 A;  2AUV A;  2YOI A;  1EV4 A;  2VL2 C;  3BCK A;  1WJK A;  1ZGN A;  2VO4 A;  3CTF A;  1GSD A;  2IWT A;  4BVX A;  4IN0 A;  3PR8 A;  5CNW A;  3M9J A;  4WET A;  1SK1 A;  1S3A A;  3TKR A;  1EEJ A;  2ON7 A;  3A5I A;  3L0H A;  5KN2 A;  1O81 A;  4FQU A;  3FZ9 A;  5DAL B;  2C3N A;  2CQ9 A;  5IPG A;  2VOC A;  2JAD A;  4I8B A;  1FW1 A;  4GQC A;  1K3O A;  2H74 A;  3A2X A;  2H70 A;  4OD7 A;  2AAW A;  3L9V A;  4FO5 A;  4I2U A;  4X0X A;  3GST A;  3FMW A;  4AJ7 A;  3P90 A;  1G6W A;  1Z7R A;  4PUR A;  1DE2 A;  2H72 A;  3IE3 A;  2FWG A;  1S3C A;  2M72 A;  2VUP A;  3TKQ A;  2WDU A;  4HI7 A;  1AQX A;  1PX7 A;  2X8C A;  2K8V A;  3D6I A;  1XIY A;  1AAZ A;  1GSQ A;  1RK4 A;  2K6V A;  3GYK A;  4PQ1 A;  4K2D A;  2OAD A;  3SWL A;  1IYI A;  4HU9 A;  1YEX A;  3M9K A;  1SJZ A;  2C0G A;  1OC3 A;  3EPT A;  3HJO A;  3ZVJ A;  5GSS A;  2H1A A;  4G0I A;  6GSX A;  4G0K A;  1MD3 A;  5DJL A;  3I69 A;  1A2L A;  1KEB A;  1AIU A;  2WFC A;  1TK5 B;  4GLT A;  5J9B A;  5HR1 A;  4NV5 A;  1WWJ A;  4YAP A;  4POK A;  4GCI A;  5EL8 A;  1FHE A;  3WT1 A;  1HNB A;  4WEY A;  1X5C A;  5D9T A;  2KOK A;  5D73 A;  1W89 A;  5H5S A;  2WCI A;  4F2I A;  4HOJ A;  6GSY A;  4EE0 A;  4XRA A;  3LYK A;  4TR3 A;  3VI5 A;  1O6J A;  2A4V A;  5IMD A;  5ECQ B;  4MJE A;  4FYU A;  2IPA A;  1MD4 A;  4HU7 A;  2DJ0 A;  5B6N A;  3GX0 A;  2YV7 A;  4EL1 A;  1MDI A;  2N5B A;  3D21 A;  2OBI A;  4POM A;  4IQA A;  4IJI A;  4AGS A;  1OC9 B;  2TIR A;  4ZL9 A;  3CRU A;  2YCD A;  4O92 A;  5CAX A;  3F4R A;  5JWR B;  1TI1 A;  3RPN A;  4HZ4 A;  3RHB A;  3HA9 A;  3O6T A;  2OBK A;  2F8A A;  1FVK A;  5HFG A;  1A0F A;  5COH A;  1JZR A;  2IN3 A;  3J7Y k;  3UAR A;  3N9J A;  1EV9 A;  1R7H A;  1UA5 A;  2GS3 A;  1YDK A;  5F0G A;  18GS A;  3DIE A;  1ON4 A;  4ECI A;  1GSY A;  1GUL A;  4EIQ A;  2QA2 A;  4XS4 A;  3QFB C;  3IR4 A;  5B7C A;  3W6G A;  1Q4J A;  1GRX A;  3KH9 A;  4JED A;  4WXT A;  3TKP A;  5FT3 A;  3PPU A;  1OKT A;  1U88 A;  3ZVJ D;  3UEM A;  2E0Q A;  4N11 A;  2A2R A;  16GS A;  4LL4 B;  1OE8 A;  3E3E A;  5ID2 A;  1X5D A;  2LKU A;  2WB9 A;  3CSJ A;  2I9H A;  1A23 A;  1WIK A;  3GH9 A;  1MDJ A;  2F51 A;  1VF1 A;  4JR6 A;  1EGR A;  3ZIJ A;  2YWM A;  3MSZ A;  4KDY A;  22GS A;  3F3R A;  1R5P A;  3IHG A;  2LJA A;  3IK9 A;  17GS A;  2CVD A;  3KMN A;  2LUS A;  3H79 A;  3EUR A;  3P2A A;  5DAK A;  2RM6 A;  2PN8 A;  1UN2 A;  3LXZ A;  2P31 A;  2LQQ A;  1SKR B;  1GLQ A;  3TKS E;  4N10 A;  5FHI A;  3LXT A;  3A2V A;  2P5Q A;  2HSY A;  3OR5 A;  5F07 A;  1WP0 A;  4CY6 A;  1XXU A;  1FOV A;  3P7X A;  1BX9 A;  20GS A;  4PNG A;  2C4J A;  5ABR A;  3DRN A;  3UIW A;  3LSZ A;  3TJF A;  3GHA A;  5KOX A;  2NPB A;  3ERF A;  4JBB A;  2RUF A;  1H4O A;  2DKI A;  3C1R A;  3KP9 A;  6GST A;  2X8G A;  1ILO A;  3NOF A;  3GTU B;  5ELA A;  2ON5 A;  3UAP A;  3PIN A;  5J3R A;  4GSN A;  1Z7P A;  4ZB8 A;  4L0U A;  2VAF A;  3KH7 A;  3CSH A;  1OKD A;  5E59 A;  2JU5 A;  1MTC A;  2YAN A;  1BED A;  4KF9 A;  1FVJ A;  4YQU A;  1Z6M A;  3GIX A;  2LNT A;  3QPM A;  2XPE A;  1PN0 A;  1DSB A;  3TRQ A;  4L5L A;  5BRT A;  2MMZ A;  3LWA A;  2DC5 A;  4KW6 A;  4HJ2 A;  2FUG 2;  3KCM A;  4GQF A;  1TI3 A;  3ED3 A;  2VCQ A;  2DJ2 A;  4O5R A;  4E8H A;  3QAW A;  1XFL A;  1WMJ A;  3DD3 A;  3IDV A;  2O87 A;  4O5Q A;  3L9U A;  5FWG A;  3EYT A;  1EP8 A;  3GKN A;  2H0I A;  1X5E A;  6GSU A;  2R4V A;  3GRX A;  4RI6 A;  3H93 A;  1XW6 A;  3UJ1 A;  4WF4 A;  2YJH A;  3GKX A;  1FB0 A;  2H75 A;  1HQO A;  2P0G A;  2H1B A;  2DML A;  2WS2 A;  2YZU A;  4N0V A;  2LEG A;  1T00 A;  5F05 A;  5IMC A;  3M0F A;  2QGV A;  2L5O A;  1SD9 A;  1U3I A;  2VD1 A;  2O89 A;  2JSZ A;  2VL9 A;  4XS6 A;  3C8E A;  3IBH A;  1ABA A;  3ME7 A;  1K3L A;  3TDG A;  4CY8 A;  1Z5Y E;  2G0F A;  3GNJ A;  1XW5 A;  4X1U A;  1XOA A;  4P3Y B;  2PER A;  1T4Y A;  2H0G A;  3C73 A;  5G5F A;  4ML6 A;  2DSA A;  4EC0 A;  3IAS 2;  5D9X A;  5KN0 A;  1ERW A;  2C0D A;  1YY7 A;  3WYW A;  3F4T A;  2MBS A;  2OA7 A;  3LGC A;  2FA4 A;  3Q19 A;  3HD5 A;  2A4H A;  3D0Z A;  5AGY A;  5IMZ A;  3ZIT A;  3I6A A;  2A2P A;  2B3S A;  4IBP A;  4WF5 A;  5ECK B;  5ECR B;  5E4W A;  4I2T A;  1B4Q A;  3AY8 A;  5KEJ A;  4Q5Q A;  1V9W A;  4EXJ A;  4V2M A;  2IFQ A;  5J9C A;  3GV1 A;  3F9U A;  3H1N A;  1XZO A;  2RM5 A;  5KN3 A;  1I9D A;  4TVE A;  2F9S A;  2M46 A;  4EO3 A;  3ZRD A;  1C72 A;  2BJX A;  4TR0 A;  2JSY A;  4RI7 A;  3ZIV A;  3RAZ A;  1GL8 A;  3WGE A;  3WT2 A;  1R5A A;  4L5O A;  2QA1 A;  4H86 A;  1Q98 A;  1O8X A;  4CDO A;  3DXB A;  2I81 A;  3ZTL A;  5IOW A;  1A2M A;  2NDO A;  3GKK A;  4V1A g;  1RW1 A;  1M9A A;  1EOH A;  2ZNM A;  2PGT A;  4I5Q A;  1BAY A;  1F2E A;  2RLI A;  4V2N A;  2HXK A;  3APO A;  2G2Q A;  2YWI A;  3MAK A;  1JLV A;  1M7T A;  4TXV A;  5GST A;  4HQZ A;  1UC7 A;  3IXR A;  4IVF A;  2L59 A;  4F0B A;  1NM3 A;  1ZYE A;  3DEX A;  2CZ2 A;  2MZC A;  2OKA A;  5G2Z A;  3FHK A;  2E7P A;  1VRS D;  4NWY A;  4QL9 A;  3KIJ A;  5ECH B;  1O85 A;  2H66 A;  3I43 A;  5G1K A;  2CAI A;  2LV3 A;  4KND A;  1ZL9 A;  3HDC A;  5DQS A;  3FKF A;  1M0U A;  2E2M A;  3WGD A;  1ERU A;  1I5G A;  3EU3 A;  4JRR A;  1YKC A;  1XWB A;  4KB3 A;  3O3T A;  1PSQ A;  2VM1 A;  4NHZ A;  1FB6 A;  5F06 A;  5EPF A;  2TRC P;  2VD0 A;  2H76 A;  3IPZ A;  3GH6 A;  4MZC A;  4PUA A;  4HEA 2;  3J7Y b;  4IJ3 A;  5J5N A;  5DDL A;  1EOG A;  4F0C A;  5F8B A;  9GSS A;  3GL3 A;  2HRF A;  3TUE A;  2IMI A;  3TKS A;  2FWF A;  3GN3 A;  2B5X A;  4XCS A;  3EWL A;  4TR4 A;  2FA8 A;  3TJG A;  3FR9 A;  3EC3 A;  3EU4 A;  4POB A;  5JCG A;  1SKW B;  3VUR A;  1K0B A;  3TOT A;  6GSV A;  1M99 A;  4LMV A;  1T4Z A;  3Q6O A;  4MZW A;  1EWX A;  4K0N A;  4O32 A;  4ZBD A;  1TDI A;  3QD9 A;  5J4U A;  4KA0 A;  1VGL A;  2HYX A;  3EVI A;  5HQP A;  1PA3 A;  5ECS A;  2PMT A;  6GSS A;  1XW9 A;  3HVX A;  5AN1 A;  3EIN A;  4RQX A;  4DEJ A;  1QGV A;  1B4P A;  3QDN A;  4XTS A;  5IO2 A;  4USS A;  1M2B A;  5IMF A;  5IPH A;  2RUE A;  4Q5N A;  4ZXG A;  1A24 A;  5CP1 A;  2DIY A;  1ERT A;  4YQM A;  1USB A;  4EDZ A;  4OFM A;  4BA7 A;  3QAV A;  4JU5 A;  1PN9 A;  2LNS A;  2CVK A;  2K9F A;  1LU4 A;  4WKW A;  5H5R A;  1ERV A;  2FD3 A;  1JZO A;  3F6D A;  1TJD A;  1BYE A;  2DJK A;  3TB2 A;  1EGO A;  3ZRE A;  4D73 B;  4K6X A;  1TRU A;  4Z7X A;  2H8L A;  2VCW A;  4XS4 B;  3QFA C;  4XRD A;  3ZYW A;  2DMM A;  5J41 A;  2O85 A;  1TP9 A;  3IK7 A;  1BQ7 A;  3ERW A;  19GS A;  2YNX A;  1ZOF A;  2HLS A;  2HSH A;  4OFN A;  1O73 A;  4GXZ A;  3U5R E;  5D9V A;  3LQ7 A;  1WPI A;  1CQH A;  2MBT A;  2X8H A;  3UVH A;  1LBK A;  2C8U A;  1SK0 A;  1ZMA A;  4EKZ A;  4GSS A;  5G30 A;  12GS A;  2FLS A;  2B1L A;  2R6K A;  1GTU A;  2H0H A;  5D8I A;  1OC9 A;  1V98 A;  3GSS A;  3UBL A;  4MH3 A;  4K7I A;  1OVN A;  2JZR A;  3DGQ A;  4FYB A;  2LST A;  4N30 A;  4TKY A;  3HY2 A;  4AJ6 A;  5B8A A;  1M9B A;  1THO A;  4YQV A;  1GH2 A;  3GFK A;  2VLT A;  1JZD A;  3FRC A;  3HYP A;  4CW9 A;  5ECI B;  4LLR A;  2DJ3 A;  4K5R A;  2FHE A;  3BBY A;  4XIH A;  3QAG A;  5CRG A;  3LJR A;  2V6K A;  1N8J A;  3PH9 A;  2PUK C;  1ZYP A;  3TGZ A;  3TRP A;  3LEF A;  4DSS A;  5D96 A;  2LTK A;  5ECP B;  2HZE B;  1TRV A;  4MZB A;  3DYR A;  1QQ2 A;  1HNA A;  4OFT A;  3KZQ A;  3L4N A;  1MEK A;  2IME A;  3E9J B;  3IC8 A;  3KD0 A;  4K7O A;  4ZBA A;  4XHM A;  3ME8 A;  4V1A p;  3VK9 A;  3GX8 A;  2EC4 A;  4PX1 A;  3UBK A;  4HUA A;  3L9S A;  3VI7 A;  4KX4 A;  1E2Y A;  2QKE A;  2IMK A;  2R3X A;  3KXO A;  1VF3 A;  2WUL A;  3KTL A;  2FY6 A;  11GS A;  4TR1 B;  3EMX A;  2CV4 A;  1A8L A;  2F3M A;  3GUS A;  4I97 A;  5ECL B;  1Z3E A;  3ZMK A;  1PKZ A;  3K8N A;  3DVX A;  4KSM A;  4PNF A;  1F3B A;  2VCT A;  3D5J A;  3TJK A;  2FWE A;  3ERG A;  5A4V A;  1GSU A;  2L4Q A;  3LYP A;  1SJ6 A;  2GQM A;  5EVO A;  3F6F A;  3G7Y A;  3TJJ A;  1CQG A;  4PXO A;  2ES7 A;  1NHO A;  1K0D A;  1WOU A;  2X99 A;  1X9M B;  3R3E A;  1G7E A;  2GSS A;  3VPQ A;  1E6B A;  3IOS A;  4JR4 A;  2WZ9 A;  2HNL A;  2H6Z A;  4ZIL A;  3DWV A;  2DJJ A;  4TOP A;  1T1V A;  1GNE A;  2B5E A;  5B6M A;  1T3B A;  2V1M A;  1GWC A;  4TW5 A;  5AIV A;  1HNC A;  1THX A;  3BD2 A;  1TW9 A;  1A0R P;  3GTU A;  4FH8 A;  5DCG A;  4EUY A;  1SK2 A;  4DVC A;  2PWJ A;  3W8J A;  2RII A;  2LS5 A;  1N2A A;  1SEN A;  1SJI A;  2DIZ A;  1K0A A;  1JHB A;  5ECO B;  2X64 A;  1K3Y A;  4KCE A;  4RQR A;  4A5P A;  2CT6 A;  3KP8 A;  2V41 A;  3VWX A;  2IJY A;  4NAX A;  2IMD A;  3ZFL A;  2J23 A;  5AIX A;  4Z2T A;  3H4K A;  1J0F A;  1YEP A;  4TN8 A;  1AW9 A;  1GUM A;  2YJ7 A;  2E2G A;  2P5R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...