4HQZA

Crystal structure of the pneumoccocal exposed lipoprotein thioredoxin sp_1000 (etrx2) from streptococcus pneumoniae strain tigr4 in complex with 2-hydroxyethyl disulfide
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
141
structure length
141
Chain Sequence
VGKDAPDFTLQSMDGKEVKLSDFKGKKVYLKFWASWCGPCKKSMPELMELAAKPDRDFEILTVIAPGIQGEKTVEQFPQWFQEQGYKDIPVLYDTKATTFQAYQIRSIPTEYLIDSQGKIGKIQFGAISNADAEAAFKEMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Thioredoxin family protein
publication title Molecular architecture of Streptococcus pneumoniae surface thioredoxin-fold lipoproteins crucial for extracellular oxidative stress resistance and maintenance of virulence.
pubmed doi rcsb
source organism Streptococcus pneumoniae
total genus 42
structure length 141
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00578 AhpC-TSA AhpC/TSA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4hqzA00
2OE3A 4G19A 4I2UA 17GSA 4TR0A 4YQUA 1PQNA 5ECSA 2VCXA 5GAPD 1GLQA 3ISOA 2ALBA 1T00A 4OD7A 2C3TA 1T4ZA 4E8HA 5INYA 2NVLA 2B7KA 5G31A 1GUKA 1QQ2A 1K3YA 5D9XA 3VLNA 4MPGA 4CHSA 3TKRA 1HNBA 2DMMA 1F37A 1WJKA 4RUVA 3KP8A 2IWTA 4K7NA 1B4PA 6GSUA 2P5QA 4Q5FA 4F2IA 3GV1A 4XCSA 1ERVA 4WR5A 4WXTA 1MDJA 4WBRD 2IN3A 4OFNA 4K7IA 4AJ7A 1TK8B 1G6WA 1YF0A 1F3BA 2EIQA 4GQCA 1PD21 2H30A 2DJ1A 4POMA 4JR4A 1B9XC 4DSSB 3KP9A 2VM1A 3ZITA 3IV4A 1K0MA 3DVXA 4GSSA 3CRTA 1PGTA 4OFMA 2A2SA 3LXZA 5D9WA 2CZ3A 3BD2A 1QXHA 1XWAA 2VCVA 2I9HA 2HRFA 4HUAA 4YH2A 4ACSA 1GP1A 1THXA 4GSNA 4EE0A 4MJCA 5C04A 1AXDA 1GTAA 5G2ZA 1QFNA 1WP0A 4BPYA 5ECHB 4MF7A 3DWVA 3M9JA 3BCKA 2QGVA 3GA4A 3KJYA 5HFGA 5D8IA 1CQGA 1PX6A 4EDYA 1W4VA 4BWSA 1DE1A 5AN1A 3TKSC 2WDUA 1XW6A 4FYCA 1GTUA 11GSA 4N0ZA 2K8VA 1Z3EA 1JZWA 2CX4A 4K2DA 2X8CA 1PKZA 2VCZA 3HZ8A 3HJPA 2C0GA 3QAGA 5CREA 3U5RE 4MF5A 3TJBA 3G7YA 1GLPA 1SK1A 2YZHA 2IMKA 3UIWA 2P0GA 4PQHA 3WGXA 2HLSA 1V2AA 4I5QA 2EIRA 4RQRA 2H1GA 2L6DA 4JRRA 18GSA 1XVWA 1EV4A 1LJRA 1J0FA 4KAEA 2B1KA 4OO5A 1YKCA 3U6VA 3TJKA 4CDOA 1TRWA 1MEKA 1XXUA 5J41A 5ECNB 3C8EA 4ILFA 1VRSD 4GQFA 1SL1B 3UEMA 1WPIA 1BJXA 3EU4A 3TKSA 3F8UA 1U87A 2JZRA 3TRQA 3RBTA 3KTBA 4HEA2 3LXTA 2YJHA 3NIVA 1NSWA 4Q5RA 3KH9A 2V6KA 3UARA 2IMDA 2KUCA 3VK9A 1U88A 2MMZA 1N2AA 3GTUA 2DC5A 4IBPA 2FA8A 2E7PA 4Q5NA 2CAIA 1XW5A 3TB2A 1M2BA 1AW9A 2VCQA 4KDUA 5H5SA 1T1VA 5HR0A 1DBYA 1JHBA 2QC7A 1SJIA 3C1RA 4IP1A 2RUFA 2E2GA 1VF4A 4ZBDA 1ZYEA 4ISDA 4TXVA 4V2NA 1O73A 2ON7A 4FYBA 13GSA 2PERA 1BQ7A 4IVFA 1XBSA 1SKSB 4TOPA 2B5EA 1QGVA 5DDLA 3GNJA 1EP8A 2NTOA 4F82A 4ZL9A 4HS1A 3ZRDA 4AGSA 1ST9A 2JL4A 2MMAA 4MZWA 3LG6A 4PURA 3FZ4A 4IS0A 5B7CA 5G5FA 2H73A 2R3XA 2DBCA 4LMWA 3VWWA 2GSRA 4LL4B 2HT9A 2CVDA 1KBNA 2LJKA 3QDNA 1BG5A 2KOKA 5DCHA 2VCWA 3GIXA 3ERGA 4PGTA 2FA4A 5L71A 1M2DA 1XVQA 4EXJA 1OKDA 4NHWA 3UAPA 1TJDA 2GGTA 5IIZA 4N11A 5JCGA 3LYPA 4KSMA 5DJMA 4XTSA 2G2QA 2HRNA 1LU4A 5FT3A 2J23A 3QOUA 3Q74A 3M9KA 4MABA 3CRUA 4DSSA 5IMDA 1X5DA 4IELA 5JCWA 5IPGA 4PNFA 2HNLA 2A2RA 4IGJA 3FR9A 3L78A 2K18A 3MSZA 1VF2A 2L5LA 14GSA 4ID0A 3FZ5A 2K8SA 4JZQA 2ES7A 4YQVA 1H75A 2VD1A 1GSFA 3DVWA 3CXGA 2JU5A 1FVJA 1FAAA 1SD8A 2LQQA 2OJLA 1F3AA 3KEBA 2DJJA 4RI6A 5GSTA 2GQLA 4MPFA 5IOWA 2C8UA 4QQ7A 4V1Ap 1OC8A 3DGQA 3N9JA 4TRXA 3FEUA 4HJ2A 5EVOA 2LTKA 2L57A 1YDKA 4GWRA 4FIWA 4ZB8A 1TW9A 2HSHA 4WETA 4L5LA 1SJ6A 4GXZA 2RM5A 3IAM2 4J57E 3A5WA 5EL8A 1NW2A 3D6IA 4PX1A 2LRCA 1HD2A 2GTUA 1TTZA 3DRNA 1XIYA 3VFIA 1XWCA 3H93A 1GSEA 2BMXA 3O76A 2H72A 19GSA 1SENA 3FR3A 1R5PA 3NOFA 4N0VA 1Z5YE 1Z6MA 2FWHA 1AQXA 3DIEA 3W8SA 5KN1A 3ME8A 5J9CA 5DALB 2V32A 2DSAA 4KW6A 1ZYQB 2XBQA 2X99A 2AUVA 4FO5A 4HQSA 4NPBA 4BVXA 4TN8A 1A8LA 3EINA 3KH7A 1N8JA 1NHOA 5ECIB 2IJYA 3LEFA 5H5QA 2H0IA 4KCEA 3MDKA 1WE0A 2IL3A 5GZZB 4DSQA 1O6JA 3HJMA 4F0BA 4XHMA 4EO3A 1EOHA 3I69A 5IO0A 2MYGA 3D4MA 2M80A 3TKPA 2DJ2A 5JCUA 2F9SA 2VLVA 3D22A 1GTBA 3D21A 2JZTA 2LEGA 4QL7A 4GRFA 1S3CA 1Z7PA 5IOXA 1OKTA 2YP6A 3F6FA 2YANA 4ZXGA 2C0DA 4EUYA 3O6TA 4I97A 1B4QA 2O8VB 4MLYA 1O8WA 2HYXA 2WJUA 2F8FA 2MBTA 3L9UA 3TOTA 1A2JA 1R5AA 4OO4A 3LSZA 1WOUA 4DEJA 5KN0A 2GT6A 2R5GA 4F9ZA 5G1LA 2FWEA 1XOBA 2GQMA 3HXSA 1EEMA 3QR6A 4EVMA 2C0FA 2CT6A 4ECIA 3ZMKA 1Q4JA 2B7JA 3GRXA 3F3RA 5J5NA 3GMFA 5ECLB 1JZRA 3TJFA 1AUCA 2M72A 3TGZA 4NXIA 2HSYA 2DJ0A 1OC9A 16GSA 4XS4A 2WRTA 3IPZA 1Z6NA 3UBKA 1S3AA 4TR1B 3LQ7A 4XRDA 1FB0A 3L4NA 5JWOB 3GSSA 2PMTA 1O8XA 2C80A 4K6XA 3O3TA 1B48A 1GUMA 4IQ1A 2VAFA 5DQSA 4FH8A 4K0NA 5CRWA 3IAS2 4F0CA 4WBJA 4N10A 1KNGA 2KP2A 1B9YC 2NPBA 4J2FA 1MD4A 22GSA 1DUGA 5IMFA 1OAZA 2LV3A 4X43A 5D93A 3F4TA 4ECBA 2N5FA 2VLUA 4TW5A 3D4TA 2GSQA 5COHA 1V9WA 5B6NA 2XC2A 1X9WB 4MA9A 4AJ6A 4L0WA 3I43A 4MDCA 2AB6A 4Q5QA 4ECCA 4K0GA 3KZQA 4OFTA 2O7KA 5JWQB 4XRAA 3HZ4A 4G9HA 2WB9A 2LRNA 4HU9A 5B6MA 3KTLA 1GTIA 1DE2A 3KD0A 4E8EA 2GT5A 3R2QA 1OVNA 1W89A 1XWKA 3BOAA 3IHQA 4POBA 4BL7A 3QD9A 1K0DA 1VGLA 3FKFA 4K1FA 3RDWA 1FW1A 2CX3A 1XOAA 1LBKA 3P7XA 1AC1A 2B6MA 3KIJA 2R4VA 2YWOA 1M0UA 2RM6A 1EOGA 2YCDA 5LD0A 5ECRB 3V1WA 1ERWA 3APSA 1YEPA 5AIXA 3ZVJA 2H1AA 4NAXA 1HNAA 1GRXA 1YKAA 5HFIA 1K0CA 3CYNA 5ENUA 4HQZA 1VF3A 3KGKA 5KN2A 3SWLA 1SK2A 2I1UA 3EU3A 1K0BA 5F07A 1S3DA 2QKEA 3M8NA 5F06A 2ON5A 6GSXA 2X8GA 3GL5A 2VL2A 2WCIA 4YAPA 1HQOA 3HYPA 1SYRA 5ELGA 3WD6A 4PXOA 1X0RA 2YZUA 3PINA 2YPMA 1BEDA 5F0GA 1TU8A 2P31A 3F63A 7GSSA 3QPMA 5FWGA 3FHKA 4MH3A 3US3A 1SL2B 1K0NA 2PPTA 2KLXA 4L5OA 4I8BA 4IP6A 2FY6A 3IXRA 1SKRB 1K0AA 4ZL8A 8GSSA 4AF2A 3CTGA 5IPHA 2XPDA 1RW1A 2P5RA 2HE3A 2CQ9A 3FZAA 3GX8A 3H4KA 1TRUA 2XHFA 5D9TA 3DEXA 4NMUA 2GS3A 2YWIA 1PKWA 3GURA 1O85A 3L0HA 2M46A 1Z7RA 2PVQA 3HKRA 12GSA 3TDGA 2Z9SA 4YAVA 2RIIA 4LA1A 4BA7A 1HNCA 1J9BA 1M2AA 3HCZA 2R2JA 4TR4A 1GSDA 5E4WA 2HFDA 3N5OA 3IE3A 3ERWA 2H75A 1R4WA 4MZBA 3F4RA 5IM9A 3A2XA 2B1LA 1MD3A 2OE1A 3IC4A 1GNWA 5IMAA 1A2MA 5D73A 3LFLA 1UA5A 1SL0B 2HI7A 3TKQA 20GSA 2A4VA 2IPAA 4DVCA 6GSWA 2FCHA 1MDKA 2FWFA 2GSSA 3DYRA 3J7Yb 1KEBA 2DIZA 3VWVA 2WS2A 2F51A 5D96A 3HD5A 4K8MA 1M9BA 2K6VA 3S9FA 1A23A 3AY8A 2LSTA 3E3EA 3ED3A 4K9ZA 5JWRB 2RLIA 3H8QA 2C1YA 3F9UA 3IOSA 3A3TA 4OWYA 1USBA 1ZOFA 2IMFA 3KM6A 4EC0A 1UN2A 2GZPA 5HR3A 1ZCPA 4O32A 2DJKA 4PQIA 3L9SA 3CSIA 4IJIA 3H79A 2YN1A 3HY2A 5A4WA 2VUPA 4WKWA 1G0TA 5F8BA 3DMLA 4ZBBA 1O81A 1PMTA 1Z9HA 4MK3A 4KDXA 3TRPA 4P3YB 5G5EA 6GSSA 2H6ZA 5ELAA 1X9SB 2H6YA 5HR2A 4D73B 3CBUA 1KTEA 3IBHA 3M1GA 3RHBA 2I4AA 1F6MC 3Q18A 3TKSE 3WT2A 2D2ZA 2TRXA 1TRSA 3BJ5A 2OE0A 5CYYA 2PUKC 4HOJA 2JSYA 4I6XA 5ECKB 1ZZYA 4EF0A 1AAZA 1PX7A 5G30A 1FHEA 1GSSA 4L8EA 4TVEA 2YWMA 1PA3A 2ZCTA 3RAZA 1H4OA 1V40A 2H6XA 3KCMA 1JLVA 2H76A 5IMCA 3C73A 1ERTA 2H0GA 4XS1A 4GTUA 1TXXA 3EMPA 3IK9A 4JBBA 2AJQB 3Q6OA 3CSHA 2DJ3A 3ZLPA 6GSVA 3IK7A 4ZB9A 4TKYA 5EY6A 2LKUA 3GKNA 1PL2A 2B3SA 1SD9A 1YJ6A 3LORA 3L9VA 5CRGA 6GSYA 1IYHA 4O7HA 5G1KA 4IW9A 4K7OA 3F3QA 5ID2B 2C3NA 2AYTA 4RQXA 1V98A 4O5RA 3GH9A 1NHYA 1U3IA 2FD3A 3P8WA 4J56E 2VM2A 4FYUA 4XIHA 2QSIA 3D0ZA 3GN3A 4JR6A 4OCFA 2B5XA 4PUFC 2L6CA 1XWGA 1IYIA 3M3MA 3WT1A 2YOIA 1EV9A 1K0OA 3IA1A 2NBSA 2MZCA 4PUAA 4PQ1A 5CP1A 4OMVA 2REMA 1TKDB 4O92A 1JZDA 3GTUB 3QMXA 2KHPA 1RK4A 3P90A 3GKXA 5B8BA 3GH6A 1FOVA 1X9MB 3HHVA 2AAWA 4MH2A 4AJ8A 1Y25A 1YY7A 1WRYA 5DVBA 2I3YA 5A5KA 3EYTA 3IDVA 1SK0A 4ZL7A 3PH9A 3I9V2 3MNGA 2MBSA 3ERFA 4F03A 4HI7A 1URMA 4IKHA 1TK0B 3H1NA 2KP1A 2CZ2A 4KA0A 5DJLA 3VPTA 2IFQB 2V41A 3KXOA 1F9MA 5DCGA 4BVYA 1GULA 1WIKA 3D5JA 1SU9A 5J4UA 5J9BA 3Q19A 1EEJA 4KCAA 4WR4A 4Z7XA 4GLTA 5AGYA 1U3AA 4MCUA 3CTFA 4ZILA 2FNOA 5ECOB 2E2MA 1WWJA 5ECMB 4ZBAA 4ECJA 3FY7A 4ML6A 5DAKB 3QCPA 3G9BA 1MDIA 1XWBA 4HDEA 3F0IA 3GKMA 1ZMAA 4NHZA 1AQVA 3A2VA 3EMXA 2V6OA 4MJAA 1PN9A 5E59A 3WGEA 3KMNA 4MZCA 5ECPB 1QMVA 3E0UA 3RPNA 3MWHA 4L0UA 1FO5A 1EGRA 4EKZA 3WGDA 2TRCP 2FLSA 1TI3A 3KMOA 5EPFA 3TJJA 2OKAA 5LCZA 1JZOA 2PU9C 4HZ4A 1VF1A 2LJAA 1ILOA 4JU5A 2XBIA 2O89A 3UOMA 3SBCA 1GL8A 2VL2C 6GSTA 4KUNA 4NV5A 3TUEA 1O7UA 5AISA 4GSTA 2F8AA 1XFLA 5DQYA 1M9AA 3ZIVA 4IHUA 2HZEB 3NZNA 3ME7A 1GNEA 2L4QA 2L5OA 1EWXA 4KH7A 2CAQA 4D73A 1E6BA 4ZB6A 3EWLA 2H74A 3ZVJD 2X64A 5IMVA 2H71A 2F3MA 2HXKA 4LLRA 1GSUA 2VO4A 2IMEA 2H01A 3QFBC 4I2TA 1ACVA 3RHCA 2FWGA 2LNSA 4V2MA 2H0HA 5ECQB 2GSTA 3EVIA 1T7PB 4KDYA 1G6YA 1TI1A 3W6GA 2V1MA 1T8EB 1A24A 2C4JA 2BJXA 1PL1A 2LNTA 3ZMLA 1HYUA 1ERUA 4IQAA 3G7JA 1FG4A 1XW9A 2MMOA 4ULXA 1FVKA 3K8NA 2H1BA 1TOFA 2XPEA 4POKA 3VURA 4HJMA 3UL3A 1BYEA 2PWJA 3BCIA 3FW2A 3RPPA 4X1UA 5DALA 2LRTA 3ZYWA 1OE8A 1YQ1A 3DKSA 3ZTLA 1TRVA 1UVZA 3HA9A 3LYKA 3C1SA 5ID2A 1I5GA 3A2WA 1EGOA 2L4CA 2L59A 2WFCA 3TOUA 2VD0A 3DD3A 2IMIA 3QFAC 1G7EA 1FB6A 3HVVA 2EIOA 5A4UA 1EZKA 4TXOB 3APOA 1B8XA 4NWYA 1OE7A 1ABAA 2FHEA 3C71A 3LJRA 10GSA 4MF6A 5IQYA 1JFUA 3EE2A 4WF5A 1ON4A 4KB3A 5ABRA 5LNKe 2VLTA 2LUSA 2OACA 5HQPA 3ZREA 3GSTA 1THOA 4EDZA 3FK8A 2GDRA 5CAXA 1OC3A 1K3LA 3GKKA 1UC7A 3W8JA 4LL1B 3LGCA 3UJ1A 3EURA 1A0RP 2GLRA 5AIVA 1M7TA 3HDCA 3M0FA 1BX9A 3ZFLA 1XZOA 2O85A 1QK8A 1TU7A 2IFQA 2VCTA 2RUEA 5J3RA 1QUWA 1ZGNA 2V2GA 1XCCA 3G7IA 1EP7A 2OBIA 1SJZA 5CO3A 2N5AA 2OADA 3TCOA 5F05A 2BTOT 1AQWA 1OC9B 2H1DA 2LQOA 3HVSA 1C72A 2AHEA 4XS4B 1E2YA 1DSBA 3MAKA 5GSSA 2VIMA 5CRDA 1T3BA 2YV7A 4RI7A 4TR3A 1GSYA 3F4SA 2K9FA 3HVXA 2EC4A 3I6AA 3CSJA 4GF0A 5DAKA 4TR1A 2PVOC 2E0QA 2CV4A 1M99A 1RQMA 2MMNA 3TRXA 3PR8A 4IN0A 5KEJA 2H19A 4NV2A 3ZIJA 4PNGA 3C7MA 2DLXA 1X5CA 3GHAA 4V1Ag 3VI7A 3FYGA 3IRAA 2O87A 4H86A 1GWCA 1I9DA 3CMIA 1R7HA 2CVBA 3TJGA 3F6DA 1PSQA 3LWAA 2H66A 4HZ2A 3GYKA 1YZXA 2FUG2 1BAYA 1SKWB 3UVTA 4JEDA 5D9VA 1GSQA 2YV9A 4ML1A 2X8HA 3HJOA 2HZFA 4YQMA 1PRXA 2DIYA 2C0EA 4IJ3A 3WYWA 1TDIA 4CW9A 3VWXA 5DBQA 3VPQA 2C3QA 2J9HA 2PGTA 4DSRA 4KGIA 4G10A 1NM3A 1U6TA 9GSSA 3FRCA 1V58A 4XS6A 1A0FA 1GH2A 1R26A 3JCML 2JZSA 3UVHA 2HZEA 2CVKA 3QAVA 2LJRA 3ZL5A 3GX0A 3OR5A 1TK5B 5CNWA 5HR1A 3BBYA 4QL9A 2GZZA 4MJBA 1YEXA 1Q98A 5C00A 5A4VA 5IO2A 3APQA 1SYXA 2PN8A 2R6KA 5HFKA 2GQKA 4V2LA 4OCEA 1OYJA 1ZL9A 1X5EA 1A8YA 1J08A 4KX4A 5H5RA 2N5BA 4WF4A 2H8LA 2WULA 4ZIJA 1GUHA 3FZ9A 2OA7A 3P2AA 4X0XA 4LMVA 3J7Yk 3ZFBA 2B5YA 2YNXA 2GVPA 2ZUPA 2DMLA 3UBLA 1WMJA 2TIRA 3EC3A 4KNDA 4GCIA 3E9JB 3ZZXA 4MJEA 4KE3A 2I81A 1A2LA 4JE1A 1K3OA 2VL9A 3GUSA 1YF1A 1F2EA 2WZ9A 4KSOA 1AIUA 2YJ7A 5B8AA 2JACA 4WEYA 2ZNMA 1T4YA 2H70A 3QAWA 3VWUA 4TXOA 4BWQA 2VL3A 3IR4A 2NDOA 2OBKA 5CRHA 5GAND 2AV4A 1JLWA 4MP4A 2WGRA 2R37A 1MTCA 3FR6A 2YWNA 5FHIA 4EL1A 2VOCA 2FGXA 4POLA 1TP9A 1G7OA 2PBJA 3DXBA 5KN3A 2LS5A 4G2EA 4N30A 5IMZA 4HU7A 3PGTA 3UMAA 2IIYA 3GFKA 1CQHA 2G0FA 2JADA 1V57A 3GL3A 1ML6A 1XPVA 2JSZA 3VI5A 2CA8A 2GZYA 4MMMA 1Y6EA
chains in the Genus database with same CATH superfamily
2OE3A 4G19A 4I2UA 17GSA 4TR0A 4YQUA 1PQNA 5ECSA 2VCXA 5GAPD 1GLQA 3ISOA 2ALBA 1T00A 4OD7A 2C3TA 1T4ZA 4E8HA 5INYA 2NVLA 2B7KA 5G31A 1GUKA 1QQ2A 1K3YA 5D9XA 3VLNA 4MPGA 4CHSA 3TKRA 1HNBA 2DMMA 1F37A 1WJKA 4RUVA 3KP8A 2HRKA 2IWTA 4K7NA 1B4PA 6GSUA 2P5QA 4Q5FA 4F2IA 3GV1A 4XCSA 1ERVA 4WR5A 4WXTA 1MDJA 4WBRD 1ZYPA 2IN3A 4OFNA 4K7IA 4AJ7A 1TK8B 1G6WA 1YF0A 1F3BA 2EIQA 4GQCA 1PD21 2H30A 2DJ1A 4POMA 4JR4A 1B9XC 4DSSB 3KP9A 2VM1A 3ZITA 3IV4A 1K0MA 4G0LA 5KOWA 3DVXA 4GSSA 3CRTA 1PGTA 4OFMA 2A2SA 3LXZA 5D9WA 2CZ3A 3BD2A 1QXHA 1XWAA 2VCVA 2I9HA 2HRFA 4HUAA 4YH2A 4ACSA 1GP1A 1THXA 4GSNA 4EE0A 4MJCA 5C04A 1AXDA 4A5PA 1GTAA 5G2ZA 1QFNA 1WP0A 4BPYA 5ECHB 4MF7A 3DWVA 3M9JA 3BCKA 2QGVA 3GA4A 3KJYA 5HFGA 5D8IA 1CQGA 1PX6A 4EDYA 1W4VA 4BWSA 1DE1A 5AN1A 3TKSC 2WDUA 1XW6A 4FYCA 1GTUA 11GSA 4N0ZA 2K8VA 1Z3EA 3IC8A 1JZWA 2CX4A 4K2DA 2X8CA 1PKZA 2VCZA 3HZ8A 3HJPA 2C0GA 4CY8A 3QAGA 5CREA 3U5RE 4MF5A 3TJBA 3G7YA 4Z2UA 1GLPA 1SK1A 2YZHA 2IMKA 3UIWA 2P0GA 4PQHA 3WGXA 2HLSA 1V2AA 4I5QA 2EIRA 4RQRA 2H1GA 4K5SA 2L6DA 4JRRA 18GSA 1XVWA 2X4AA 1EV4A 1LJRA 1J0FA 4KAEA 2B1KA 4OO5A 1YKCA 5KOXA 3U6VA 3TJKA 4CDOA 1TRWA 1MEKA 1XXUA 5J41A 5ECNB 4BVXB 3C8EA 4ILFA 1VRSD 4GQFA 1SL1B 3UEMA 1WPIA 1BJXA 3EU4A 3TKSA 3F8UA 1U87A 2JZRA 3TRQA 3RBTA 3KTBA 4HEA2 3LXTA 2YJHA 3NIVA 1NSWA 4Q5RA 3KH9A 2V6KA 3IHGA 3UARA 2IMDA 2KUCA 3VK9A 1U88A 2MMZA 5BRTA 1N2AA 3GTUA 2DC5A 4IBPA 2FA8A 2E7PA 4Q5NA 2CAIA 1XW5A 3TB2A 1M2BA 1AW9A 2VCQA 4KDUA 5H5SA 1T1VA 5HR0A 1DBYA 1JHBA 2QC7A 1SJIA 3C1RA 4K2XA 4IP1A 2RUFA 2E2GA 1VF4A 4ZBDA 1ZYEA 4ISDA 1FOHA 4TXVA 4V2NA 1O73A 2ON7A 4FYBA 13GSA 2PERA 1BQ7A 4IVFA 1XBSA 1SKSB 4TOPA 2B5EA 1QGVA 5DDLA 3GNJA 1EP8A 2NTOA 4F82A 4ZL9A 4HS1A 3ZRDA 4AGSA 1ST9A 2JL4A 2MMAA 4MZWA 3LG6A 4PURA 3FZ4A 4IS0A 5B7CA 5G5FA 2H73A 2R3XA 2DBCA 4LMWA 3VWWA 2GSRA 4LL4B 2HT9A 3PPUA 2CVDA 1KBNA 2LJKA 3QDNA 1BG5A 2KOKA 5DCHA 2VCWA 3GIXA 3ERGA 4PGTA 2FA4A 5L71A 1M2DA 1XVQA 4EXJA 1OKDA 4NHWA 3UAPA 1TJDA 2GGTA 5IIZA 4N11A 5JCGA 3LYPA 4KSMA 5DJMA 4XTSA 2G2QA 2HRNA 1LU4A 5FT3A 2J23A 3QOUA 3Q74A 3M9KA 4MABA 3CRUA 4DSSA 5IMDA 1X5DA 4IELA 5JCWA 3FMWA 5IPGA 4PNFA 2HNLA 2A2RA 4IGJA 3FR9A 3L78A 2K18A 3MSZA 1VF2A 2L5LA 14GSA 4ID0A 3FZ5A 2K8SA 4JZQA 2ES7A 4YQVA 1H75A 2VD1A 1GSFA 3DVWA 3CXGA 2JU5A 1FVJA 1FAAA 1SD8A 2LQQA 2OJLA 1F3AA 3KEBA 4BL7B 2DJJA 4RI6A 5GSTA 2GQLA 4MPFA 5IOWA 2C8UA 4QQ7A 4V1Ap 1OC8A 3DGQA 3N9JA 4TRXA 3FEUA 4HJ2A 5EVOA 2LTKA 2L57A 1YDKA 4GWRA 4FIWA 4ZB8A 1TW9A 2HSHA 4WETA 4L5LA 1SJ6A 4GXZA 2RM5A 3IAM2 4J57E 3A5WA 5EL8A 1NW2A 3D6IA 4PX1A 2LRCA 1HD2A 4FQUA 2GTUA 1TTZA 3DRNA 1XIYA 3VFIA 1XWCA 3H93A 1GSEA 2BMXA 3O76A 2H72A 19GSA 1SENA 3FR3A 1R5PA 3NOFA 4N0VA 1Z5YE 1Z6MA 2FWHA 1AQXA 3DIEA 3W8SA 5KN1A 3ME8A 5J9CA 5DALB 2V32A 2DSAA 4KW6A 1ZYQB 2XBQA 2X99A 2AUVA 4FO5A 4HQSA 4NPBA 4BVXA 4TN8A 1A8LA 3EINA 3KH7A 1N8JA 1NHOA 5ECIB 2IJYA 3LEFA 5H5QA 2H0IA 4KCEA 2DKIA 2A2PA 3MDKA 1WE0A 2IL3A 5GZZB 4DSQA 1O6JA 3HJMA 4F0BA 4XHMA 4EO3A 5BMUA 1EOHA 3I69A 5IO0A 2MYGA 3D4MA 2M80A 3TKPA 2DJ2A 5JCUA 2F9SA 2VLVA 3D22A 1GTBA 3D21A 2JZTA 2LEGA 4QL7A 4GRFA 1S3CA 1Z7PA 5IOXA 1OKTA 2YP6A 3F6FA 2YANA 4ZXGA 2C0DA 4EUYA 3O6TA 4I97A 1B4QA 2O8VB 4MLYA 1O8WA 2HYXA 2WJUA 2F8FA 2MBTA 3L9UA 3TOTA 1A2JA 1R5AA 4OO4A 3LSZA 1WOUA 4O5UA 4DEJA 5KN0A 3MIXA 2GT6A 2R5GA 4F9ZA 5G1LA 4EIQA 2FWEA 1XOBA 2GQMA 3HXSA 1EEMA 3QR6A 4EVMA 2C0FA 2CT6A 4ECIA 3ZMKA 1Q4JA 2B7JA 3GRXA 3F3RA 2UZ8A 5J5NA 3GMFA 5ECLB 1JZRA 3TJFA 1AUCA 2M72A 3TGZA 4NXIA 2HSYA 2DJ0A 1OC9A 16GSA 4ICYA 4XS4A 2WRTA 3IPZA 1Z6NA 3UBKA 1S3AA 4TR1B 3LQ7A 4XRDA 1FB0A 3L4NA 5JWOB 3GSSA 2PMTA 1O8XA 2C80A 4K6XA 3O3TA 1B48A 2X49A 1GUMA 4IQ1A 2VAFA 5DQSA 4FH8A 4K0NA 5CRWA 3IAS2 4F0CA 4WBJA 4N10A 1KNGA 2KP2A 1B9YC 2NPBA 4J2FA 1MD4A 22GSA 1DUGA 5IMFA 1OAZA 2LV3A 4X43A 5D93A 3F4TA 4ECBA 2N5FA 2VLUA 4TW5A 3D4TA 2GSQA 5COHA 1V9WA 5B6NA 2XC2A 1X9WB 4MA9A 4AJ6A 4L0WA 3I43A 4MDCA 2AB6A 4Q5QA 4ECCA 4K0GA 3KZQA 4OFTA 2O7KA 5JWQB 4YKFA 4XRAA 3HZ4A 4G9HA 2WB9A 2LRNA 4HU9A 4Z2TA 5B6MA 3KTLA 1GTIA 1DE2A 3KD0A 4E8EA 2GT5A 3R2QA 1OVNA 1W89A 1XWKA 3BOAA 3IHQA 4POBA 4BL7A 3QD9A 1K0DA 1VGLA 3FKFA 4K1FA 3RDWA 1FW1A 2CX3A 1XOAA 1LBKA 3P7XA 1AC1A 2B6MA 3KIJA 2R4VA 2YWOA 1M0UA 2RM6A 1EOGA 2YCDA 5LD0A 5ECRB 3V1WA 1ERWA 3APSA 1YEPA 5AIXA 3ZVJA 2H1AA 4NAXA 1HNAA 1GRXA 1YKAA 5HFIA 1K0CA 3CYNA 5ENUA 4HQZA 1VF3A 3KGKA 5KN2A 3SWLA 1SK2A 2I1UA 3EU3A 1K0BA 5F07A 1S3DA 2QKEA 3M8NA 5F06A 2ON5A 6GSXA 2X8GA 3GL5A 2VL2A 2WCIA 4YAPA 1HQOA 3HYPA 4BIKA 1SYRA 5ELGA 3WD6A 4PXOA 1X0RA 2YZUA 3PINA 2R0GA 2YPMA 4MNNA 1BEDA 5F0GA 1TU8A 2P31A 3F63A 7GSSA 3QPMA 5FWGA 1S3RA 3FHKA 4MH3A 3US3A 1SL2B 4HSCX 1K0NA 2PPTA 2KLXA 4L5OA 4I8BA 4IP6A 2FY6A 3IXRA 1SKRB 1K0AA 4ZL8A 8GSSA 4AF2A 3CTGA 5IPHA 2XPDA 1RW1A 2P5RA 2HE3A 2CQ9A 2DKHA 3FZAA 3GX8A 3H4KA 1TRUA 2XHFA 5D9TA 3DEXA 4NMUA 2GS3A 2YWIA 1PKWA 3GURA 1O85A 3L0HA 2M46A 1Z7RA 2PVQA 3HKRA 12GSA 3TDGA 2Z9SA 4YAVA 2RIIA 4LA1A 4BA7A 1HNCA 1J9BA 1M2AA 4BVYB 3HCZA 2R2JA 4TR4A 1GSDA 5E4WA 2HFDA 3N5OA 3IE3A 3ERWA 2H75A 1R4WA 4MZBA 3F4RA 5IM9A 3A2XA 2B1LA 1MD3A 2OE1A 3IC4A 1GNWA 5IMAA 1A2MA 5D73A 3LFLA 1UA5A 1SL0B 2HI7A 3TKQA 20GSA 2A4VA 2IPAA 4DVCA 6GSWA 2FCHA 1MDKA 2FWFA 2GSSA 3DYRA 3J7Yb 1KEBA 2DIZA 3VWVA 2WS2A 2F51A 5D96A 3HD5A 4K8MA 1M9BA 2K6VA 3S9FA 1A23A 3AY8A 2LSTA 3E3EA 3ED3A 4K9ZA 3MYDA 4CY6A 5JWRB 2RLIA 3H8QA 2C1YA 3F9UA 3IOSA 3A3TA 4OWYA 2HSMA 1USBA 1ZOFA 2IMFA 3KM6A 4EC0A 1UN2A 2GZPA 5HR3A 1ZCPA 4O32A 2DJKA 4PQIA 3L9SA 3CSIA 4IJIA 3H79A 2YN1A 3HY2A 5A4WA 2VUPA 4WKWA 1G0TA 5F8BA 3DMLA 4ZBBA 1O81A 1PMTA 1Z9HA 4MK3A 4KDXA 3TRPA 4P3YB 5G5EA 6GSSA 2H6ZA 5ELAA 1X9SB 2H6YA 5HR2A 4D73B 3CBUA 1KTEA 3IBHA 3M1GA 3RHBA 2I4AA 1F6MC 3Q18A 3TKSE 3WT2A 2D2ZA 2TRXA 1TRSA 3BJ5A 2OE0A 5CYYA 2PUKC 4HOJA 2JSYA 4I6XA 5ECKB 1ZZYA 4EF0A 1AAZA 1PX7A 5G30A 1FHEA 1GSSA 4L8EA 4TVEA 2YWMA 1PA3A 2ZCTA 3RAZA 1H4OA 1V40A 2H6XA 3KCMA 1JLVA 2H76A 5IMCA 3C73A 1ERTA 2H0GA 4XS1A 4GTUA 1TXXA 3EMPA 3IK9A 4JBBA 2AJQB 3Q6OA 3CSHA 2DJ3A 3ZLPA 6GSVA 3IK7A 4ZB9A 4TKYA 5EY6A 2LKUA 3GKNA 1PL2A 2B3SA 1SD9A 1YJ6A 3LORA 3L9VA 5CRGA 6GSYA 1IYHA 4O7HA 4K5RA 4IW9A 4K7OA 5G1KA 3F3QA 5ID2B 2C3NA 2AYTA 4RQXA 1V98A 4O5RA 3GH9A 1NHYA 1U3IA 2FD3A 3P8WA 4J56E 2VM2A 4FYUA 4XIHA 2QSIA 3D0ZA 3GN3A 4JR6A 4OCFA 2B5XA 4PUFC 2L6CA 1XWGA 1IYIA 4EIPA 3M3MA 3WT1A 2YOIA 1EV9A 1K0OA 3IA1A 2NBSA 2MZCA 4PUAA 4PQ1A 5CP1A 4OMVA 2REMA 1TKDB 4O92A 1JZDA 3GTUB 3QMXA 2KHPA 1RK4A 3P90A 3GKXA 5B8BA 3GH6A 1FOVA 1X9MB 3HHVA 2AAWA 4MH2A 4AJ8A 1Y25A 1YY7A 1WRYA 5DVBA 2I3YA 5A5KA 3EYTA 1XG8A 3IDVA 1SK0A 4ZL7A 3PH9A 3I9V2 3MNGA 2MBSA 3ERFA 4F03A 4HI7A 1URMA 4IKHA 1TK0B 3H1NA 2KP1A 2CZ2A 4KA0A 5DJLA 3VPTA 2IFQB 2V41A 3KXOA 1F9MA 5DCGA 4BVYA 1GULA 1WIKA 3D5JA 1SU9A 5J4UA 3A5IA 3CQFA 5J9BA 3Q19A 1EEJA 4KCAA 4WR4A 4Z7XA 4GLTA 5AGYA 1U3AA 4MCUA 3CTFA 2A4HA 4ZILA 2FNOA 5ECOB 2E2MA 1WWJA 5ECMB 4ZBAA 4ECJA 3FY7A 4ML6A 5DAKB 3QCPA 3G9BA 1MDIA 1XWBA 4HDEA 3F0IA 3GKMA 1ZMAA 4NHZA 1AQVA 3A2VA 3EMXA 2V6OA 4MJAA 1PN9A 5E59A 3WGEA 3KMNA 4MZCA 5ECPB 1QMVA 3E0UA 3RPNA 3MWHA 4L0UA 1FO5A 1EGRA 4EKZA 3WGDA 2TRCP 2FLSA 1TI3A 3KMOA 5EPFA 3TJJA 2OKAA 5LCZA 1JZOA 2PU9C 4HZ4A 1VF1A 2LJAA 1ILOA 4JU5A 2XBIA 4Z2RA 2O89A 3UOMA 3SBCA 1GL8A 2VL2C 6GSTA 4KUNA 4NV5A 3TUEA 1O7UA 5AISA 4GSTA 2F8AA 1XFLA 5DQYA 1M9AA 3ZIVA 4IHUA 2HZEB 3NZNA 3ME7A 1GNEA 2L4QA 2L5OA 1EWXA 4KH7A 2CAQA 4D73A 1E6BA 4ZB6A 3EWLA 2H74A 3ZVJD 1PFOA 2X64A 5IMVA 2H71A 2F3MA 2HXKA 4LLRA 1GSUA 2VO4A 2IMEA 2H01A 3QFBC 2HRAA 4I2TA 1ACVA 3RHCA 2FWGA 2LNSA 4V2MA 2H0HA 5ECQB 2GSTA 3EVIA 1T7PB 4KDYA 1G6YA 1TI1A 3W6GA 2V1MA 1T8EB 1A24A 2C4JA 2BJXA 1PL1A 2LNTA 3ZMLA 1HYUA 1ERUA 4IQAA 4G0KA 3G7JA 1FG4A 1XW9A 2MMOA 4ULXA 1FVKA 3K8NA 2H1BA 1TOFA 2XPEA 4POKA 3VURA 4HJMA 3UL3A 1BYEA 2PWJA 3BCIA 3FW2A 3RPPA 4X1UA 5DALA 2LRTA 3ZYWA 1OE8A 1YQ1A 3DKSA 3ZTLA 1TRVA 1UVZA 4PTSA 3HA9A 3LYKA 3C1SA 3LW9A 5ID2A 1I5GA 3A2WA 1EGOA 2L4CA 2L59A 2WFCA 3TOUA 2VD0A 3DD3A 2IMIA 3QFAC 1G7EA 1FB6A 3HVVA 2EIOA 5A4UA 1EZKA 4TXOB 3APOA 1B8XA 4NWYA 1OE7A 1ABAA 2FHEA 3C71A 3LJRA 10GSA 4MF6A 5IQYA 1JFUA 3EE2A 4WF5A 1ON4A 4KB3A 5ABRA 5LNKe 2VLTA 2LUSA 2OACA 5HQPA 3ZREA 3GSTA 1THOA 4EDZA 3FK8A 2GDRA 5CAXA 1OC3A 1K3LA 3GKKA 1UC7A 3W8JA 4KF9A 3LGCA 4LL1B 3UJ1A 3EURA 1A0RP 2GLRA 5AIVA 1M7TA 3HDCA 3M0FA 1BX9A 3ZFLA 1XZOA 2O85A 1QK8A 3HVNA 1TU7A 2IFQA 2VCTA 2RUEA 5J3RA 1QUWA 1ZGNA 2V2GA 1XCCA 3G7IA 1EP7A 2OBIA 1SJZA 5CO3A 2N5AA 2OADA 3TCOA 5F05A 2BTOT 1AQWA 1OC9B 2H1DA 2LQOA 3HVSA 1C72A 2AHEA 4XS4B 1E2YA 1DSBA 3MAKA 5GSSA 2VIMA 1M3JA 5CRDA 1T3BA 2YV7A 4RI7A 4TR3A 1GSYA 3F4SA 2K9FA 2QA2A 3HVXA 2EC4A 3I6AA 3CSJA 4GF0A 5DAKA 4TR1A 2PVOC 2E0QA 2CV4A 1M99A 1RQMA 2MMNA 3TRXA 3PR8A 4IN0A 5KEJA 2H19A 4NV2A 3ZIJA 4PNGA 4USSA 3C7MA 2DLXA 1X5CA 3GHAA 4V1Ag 3VI7A 3FYGA 3IRAA 2O87A 4H86A 1GWCA 1I9DA 3CMIA 1R7HA 2CVBA 3TJGA 3F6DA 1PSQA 3LWAA 2H66A 3R3EA 4HZ2A 3GYKA 1YZXA 2FUG2 1BAYA 1SKWB 3UVTA 4JEDA 5D9VA 1GSQA 2YV9A 4ML1A 2X8HA 3HJOA 2HZFA 1M3IA 1PRXA 2DIYA 4YQMA 2C0EA 4IJ3A 3WYWA 1TDIA 4CW9A 3VWXA 4O5QA 5DBQA 3VPQA 2C3QA 2J9HA 2PGTA 4DSRA 4KGIA 4G10A 1NM3A 1U6TA 9GSSA 3FRCA 1V58A 4XS6A 1A0FA 1GH2A 1R26A 3JCML 2JZSA 3UVHA 2HZEA 2CVKA 3QAVA 2LJRA 3ZL5A 3GX0A 3OR5A 1TK5B 5CNWA 5HR1A 3BBYA 4QL9A 2GZZA 4MJBA 1YEXA 1Q98A 5C00A 5A4VA 5IO2A 3APQA 1SYXA 2PN8A 2R6KA 5HFKA 2GQKA 4V2LA 1ZYNA 4OCEA 1OYJA 1ZL9A 1X5EA 1A8YA 1J08A 4KX4A 5H5RA 2N5BA 4WF4A 2H8LA 1PN0A 2WULA 4ZIJA 1GUHA 2R0CA 3FZ9A 2OA7A 3P2AA 4X0XA 4LMVA 3J7Yk 3ZFBA 2B5YA 2YNXA 2GVPA 2ZUPA 2R0PA 2DMLA 3UBLA 1WMJA 2TIRA 3EC3A 4KNDA 4GCIA 3E9JB 3ZZXA 4MJEA 4KE3A 2I81A 1A2LA 3EPTA 4JE1A 1K3OA 2VL9A 3GUSA 1YF1A 1F2EA 4X4JA 2WZ9A 4KSOA 1AIUA 2YJ7A 5B8AA 2JACA 4WEYA 2ZNMA 1T4YA 2H70A 3QAWA 3VWUA 4TXOA 4BWQA 2VL3A 3IR4A 2NDOA 2OBKA 5CRHA 5GAND 4YKGA 2AV4A 1JLWA 4MP4A 2WGRA 2R37A 1MTCA 3FR6A 2YWNA 5FHIA 4EL1A 2VOCA 2FGXA 2QA1A 4POLA 1TP9A 1G7OA 2PBJA 3DXBA 5KN3A 2LS5A 4G2EA 4N30A 5IMZA 4HU7A 3PGTA 3UMAA 2IIYA 3GFKA 1CQHA 2G0FA 2JADA 4G0IA 1V57A 3GL3A 1ML6A 1XPVA 2JSZA 3VI5A 2CA8A 2GZYA 4MMMA 1Y6EA
chains in the Genus database with same CATH topology
2OE3A 4G19A 4I2UA 17GSA 4TR0A 4YQUA 1PQNA 5ECSA 2VCXA 5GAPD 1GLQA 3ISOA 2ALBA 1T00A 4OD7A 2C3TA 1T4ZA 4E8HA 5INYA 2NVLA 2B7KA 5G31A 1GUKA 1QQ2A 1K3YA 5D9XA 3VLNA 4MPGA 4CHSA 3TKRA 1HNBA 2DMMA 1F37A 1WJKA 4RUVA 3KP8A 2HRKA 2IWTA 4K7NA 1B4PA 6GSUA 2P5QA 4Q5FA 4F2IA 3GV1A 4XCSA 1ERVA 4WR5A 4WXTA 1MDJA 4WBRD 1ZYPA 2IN3A 4OFNA 4K7IA 4AJ7A 1TK8B 1G6WA 1YF0A 1F3BA 2EIQA 4GQCA 1PD21 2H30A 2DJ1A 4POMA 4JR4A 1B9XC 4DSSB 3KP9A 2VM1A 3ZITA 3IV4A 1K0MA 4G0LA 5KOWA 3DVXA 4GSSA 3CRTA 1PGTA 4OFMA 2A2SA 3LXZA 5D9WA 2CZ3A 3BD2A 1QXHA 1XWAA 2VCVA 2I9HA 2HRFA 4HUAA 4YH2A 4ACSA 1GP1A 1THXA 4GSNA 4EE0A 4MJCA 5C04A 1AXDA 4A5PA 1GTAA 5G2ZA 1QFNA 1WP0A 4BPYA 5ECHB 4MF7A 3DWVA 3M9JA 3BCKA 2QGVA 3GA4A 3KJYA 5HFGA 5D8IA 1CQGA 1PX6A 4EDYA 1W4VA 4BWSA 1DE1A 5AN1A 3TKSC 2WDUA 1XW6A 4FYCA 1GTUA 11GSA 4N0ZA 2K8VA 1Z3EA 3IC8A 1JZWA 2CX4A 4K2DA 2X8CA 1PKZA 2VCZA 3HZ8A 3HJPA 2C0GA 4CY8A 3QAGA 5CREA 3U5RE 4MF5A 3TJBA 3G7YA 4Z2UA 1GLPA 1SK1A 2YZHA 2IMKA 3UIWA 2P0GA 4PQHA 3WGXA 2HLSA 1V2AA 4I5QA 2EIRA 4RQRA 2H1GA 4K5SA 2L6DA 4JRRA 18GSA 1XVWA 2X4AA 1EV4A 1LJRA 1J0FA 4KAEA 2B1KA 4OO5A 1YKCA 5KOXA 3U6VA 3TJKA 4CDOA 1TRWA 1MEKA 1XXUA 5J41A 5ECNB 4BVXB 3C8EA 4ILFA 1VRSD 4GQFA 1SL1B 3UEMA 1WPIA 1BJXA 3EU4A 3TKSA 3F8UA 1U87A 2JZRA 3TRQA 3RBTA 3KTBA 4HEA2 3LXTA 2YJHA 3NIVA 1NSWA 4Q5RA 3KH9A 2V6KA 3IHGA 3UARA 2IMDA 2KUCA 3VK9A 1U88A 2MMZA 5BRTA 1N2AA 3GTUA 2DC5A 4IBPA 2FA8A 2E7PA 4Q5NA 2CAIA 1XW5A 3TB2A 1M2BA 1AW9A 2VCQA 4KDUA 5H5SA 1T1VA 5HR0A 1DBYA 1JHBA 2QC7A 1SJIA 3C1RA 4K2XA 4IP1A 2RUFA 2E2GA 1VF4A 4ZBDA 1ZYEA 4ISDA 1FOHA 4TXVA 4V2NA 1O73A 2ON7A 4FYBA 13GSA 2PERA 1BQ7A 4IVFA 1XBSA 1SKSB 4TOPA 2B5EA 1QGVA 5DDLA 3GNJA 1EP8A 2NTOA 4F82A 4ZL9A 4HS1A 3ZRDA 4AGSA 1ST9A 2JL4A 2MMAA 4MZWA 3LG6A 4PURA 3FZ4A 4IS0A 5B7CA 5G5FA 2H73A 2R3XA 2DBCA 4LMWA 3VWWA 2GSRA 4LL4B 2HT9A 3PPUA 2CVDA 1KBNA 2LJKA 3QDNA 1BG5A 2KOKA 5DCHA 2VCWA 3GIXA 3ERGA 4PGTA 2FA4A 5L71A 1M2DA 1XVQA 4EXJA 1OKDA 4NHWA 3UAPA 1TJDA 2GGTA 5IIZA 4N11A 5JCGA 3LYPA 4KSMA 5DJMA 4XTSA 2G2QA 2HRNA 1LU4A 5FT3A 2J23A 3QOUA 3Q74A 3M9KA 4MABA 3CRUA 4DSSA 5IMDA 1X5DA 4IELA 5JCWA 3FMWA 5IPGA 4PNFA 2HNLA 2A2RA 4IGJA 3FR9A 3L78A 2K18A 3MSZA 1VF2A 2L5LA 14GSA 4ID0A 3FZ5A 2K8SA 4JZQA 2ES7A 4YQVA 1H75A 2VD1A 1GSFA 3DVWA 3CXGA 2JU5A 1FVJA 1FAAA 1SD8A 2LQQA 2OJLA 1F3AA 3KEBA 4BL7B 2DJJA 4RI6A 5GSTA 2GQLA 4MPFA 5IOWA 2C8UA 4QQ7A 4V1Ap 1OC8A 3DGQA 3N9JA 4TRXA 3FEUA 4HJ2A 5EVOA 2LTKA 2L57A 1YDKA 4GWRA 4FIWA 4ZB8A 1TW9A 2HSHA 4WETA 4L5LA 1SJ6A 4GXZA 2RM5A 3IAM2 4J57E 3A5WA 5EL8A 1NW2A 3D6IA 4PX1A 2LRCA 1HD2A 4FQUA 2GTUA 1TTZA 3DRNA 1XIYA 3VFIA 1XWCA 3H93A 1GSEA 2BMXA 3O76A 2H72A 19GSA 1SENA 3FR3A 1R5PA 3NOFA 4N0VA 1Z5YE 1Z6MA 2FWHA 1AQXA 3DIEA 3W8SA 5KN1A 3ME8A 5J9CA 5DALB 2V32A 2DSAA 4KW6A 1ZYQB 2XBQA 2X99A 2AUVA 4FO5A 4HQSA 4NPBA 4BVXA 4TN8A 1A8LA 3EINA 3KH7A 1N8JA 1NHOA 5ECIB 2IJYA 3LEFA 5H5QA 2H0IA 4KCEA 2DKIA 2A2PA 3MDKA 1WE0A 2IL3A 5GZZB 4DSQA 1O6JA 3HJMA 4F0BA 4XHMA 4EO3A 5BMUA 1EOHA 3I69A 5IO0A 2MYGA 3D4MA 2M80A 3TKPA 2DJ2A 5JCUA 2F9SA 2VLVA 3D22A 1GTBA 3D21A 2JZTA 2LEGA 4QL7A 4GRFA 1S3CA 1Z7PA 5IOXA 1OKTA 2YP6A 3F6FA 2YANA 4ZXGA 2C0DA 4EUYA 3O6TA 4I97A 1B4QA 2O8VB 4MLYA 1O8WA 2HYXA 2WJUA 2F8FA 2MBTA 3L9UA 3TOTA 1A2JA 1R5AA 4OO4A 3LSZA 1WOUA 4O5UA 4DEJA 5KN0A 3MIXA 2GT6A 2R5GA 4F9ZA 5G1LA 4EIQA 2FWEA 1XOBA 2GQMA 3HXSA 1EEMA 3QR6A 4EVMA 2C0FA 2CT6A 4ECIA 3ZMKA 1Q4JA 2B7JA 3GRXA 3F3RA 2UZ8A 5J5NA 3GMFA 5ECLB 1JZRA 3TJFA 1AUCA 2M72A 3TGZA 4NXIA 2HSYA 2DJ0A 1OC9A 16GSA 4ICYA 4XS4A 2WRTA 3IPZA 1Z6NA 3UBKA 1S3AA 4TR1B 3LQ7A 4XRDA 1FB0A 3L4NA 5JWOB 3GSSA 2PMTA 1O8XA 2C80A 4K6XA 3O3TA 1B48A 2X49A 1GUMA 4IQ1A 2VAFA 5DQSA 4FH8A 4K0NA 5CRWA 3IAS2 4F0CA 4WBJA 4N10A 1KNGA 2KP2A 1B9YC 2NPBA 4J2FA 1MD4A 22GSA 1DUGA 5IMFA 1OAZA 2LV3A 4X43A 5D93A 3F4TA 4ECBA 2N5FA 2VLUA 4TW5A 3D4TA 2GSQA 5COHA 1V9WA 5B6NA 2XC2A 1X9WB 4MA9A 4AJ6A 4L0WA 3I43A 4MDCA 2AB6A 4Q5QA 4ECCA 4K0GA 3KZQA 4OFTA 2O7KA 5JWQB 4YKFA 4XRAA 3HZ4A 4G9HA 2WB9A 2LRNA 4HU9A 4Z2TA 5B6MA 3KTLA 1GTIA 1DE2A 3KD0A 4E8EA 2GT5A 3R2QA 1OVNA 1W89A 1XWKA 3BOAA 3IHQA 4POBA 4BL7A 3QD9A 1K0DA 1VGLA 3FKFA 4K1FA 3RDWA 1FW1A 2CX3A 1XOAA 1LBKA 3P7XA 1AC1A 2B6MA 3KIJA 2R4VA 2YWOA 1M0UA 2RM6A 1EOGA 2YCDA 5LD0A 5ECRB 3V1WA 1ERWA 3APSA 1YEPA 5AIXA 3ZVJA 2H1AA 4NAXA 1HNAA 1GRXA 1YKAA 5HFIA 1K0CA 3CYNA 5ENUA 4HQZA 1VF3A 3KGKA 5KN2A 3SWLA 1SK2A 2I1UA 3EU3A 1K0BA 5F07A 1S3DA 2QKEA 3M8NA 5F06A 2ON5A 6GSXA 2X8GA 3GL5A 2VL2A 2WCIA 4YAPA 1HQOA 3HYPA 1SYRA 5ELGA 3WD6A 4PXOA 1X0RA 2YZUA 3PINA 2R0GA 2YPMA 4MNNA 1BEDA 5F0GA 1TU8A 2P31A 3F63A 7GSSA 3QPMA 5FWGA 3FHKA 4MH3A 3US3A 1SL2B 1K0NA 2PPTA 2KLXA 4L5OA 4I8BA 4IP6A 2FY6A 3IXRA 1SKRB 1K0AA 4ZL8A 8GSSA 4AF2A 3CTGA 5IPHA 2XPDA 1RW1A 2P5RA 2HE3A 2CQ9A 2DKHA 3FZAA 3GX8A 3H4KA 1TRUA 2XHFA 5D9TA 3DEXA 4NMUA 2GS3A 2YWIA 1PKWA 3GURA 1O85A 3L0HA 2M46A 1Z7RA 2PVQA 3HKRA 12GSA 3TDGA 2Z9SA 4YAVA 2RIIA 4LA1A 4BA7A 1HNCA 1J9BA 1M2AA 4BVYB 3HCZA 2R2JA 4TR4A 1GSDA 5E4WA 2HFDA 3N5OA 3IE3A 3ERWA 2H75A 1R4WA 4MZBA 3F4RA 5IM9A 3A2XA 2B1LA 1MD3A 2OE1A 3IC4A 1GNWA 5IMAA 1A2MA 5D73A 3LFLA 1UA5A 1SL0B 2HI7A 3TKQA 20GSA 2A4VA 2IPAA 4DVCA 6GSWA 2FCHA 1MDKA 2FWFA 2GSSA 3DYRA 3J7Yb 1KEBA 2DIZA 3VWVA 2WS2A 2F51A 5D96A 3HD5A 4K8MA 1M9BA 2K6VA 3S9FA 1A23A 3AY8A 2LSTA 3E3EA 3ED3A 4K9ZA 3MYDA 4CY6A 5JWRB 2RLIA 3H8QA 2C1YA 3F9UA 3IOSA 3A3TA 4OWYA 2HSMA 1USBA 1ZOFA 2IMFA 3KM6A 4EC0A 1UN2A 2GZPA 5HR3A 1ZCPA 4O32A 2DJKA 4PQIA 3L9SA 3CSIA 4IJIA 3H79A 2YN1A 3HY2A 5A4WA 2VUPA 4WKWA 1G0TA 5F8BA 3DMLA 4ZBBA 1O81A 1PMTA 1Z9HA 4MK3A 4KDXA 3TRPA 4P3YB 5G5EA 6GSSA 2H6ZA 5ELAA 1X9SB 2H6YA 5HR2A 4D73B 3CBUA 1KTEA 3IBHA 3M1GA 3RHBA 2I4AA 1F6MC 3Q18A 3TKSE 3WT2A 2D2ZA 2TRXA 1TRSA 3BJ5A 2OE0A 5CYYA 2PUKC 4HOJA 2JSYA 4I6XA 5ECKB 1ZZYA 4EF0A 1AAZA 1PX7A 5G30A 1FHEA 1GSSA 4L8EA 4TVEA 2YWMA 1PA3A 2ZCTA 3RAZA 1H4OA 1V40A 2H6XA 3KCMA 1JLVA 2H76A 5IMCA 3C73A 1ERTA 2H0GA 4XS1A 4GTUA 1TXXA 3EMPA 3IK9A 4JBBA 2AJQB 3Q6OA 3CSHA 2DJ3A 3ZLPA 6GSVA 3IK7A 4ZB9A 4TKYA 5EY6A 2LKUA 3GKNA 1PL2A 2B3SA 1SD9A 1YJ6A 3LORA 3L9VA 5CRGA 6GSYA 1IYHA 4O7HA 4K5RA 4IW9A 4K7OA 5G1KA 3F3QA 5ID2B 2C3NA 2AYTA 4RQXA 1V98A 4O5RA 3GH9A 1NHYA 1U3IA 2FD3A 3P8WA 4J56E 2VM2A 4FYUA 4XIHA 2QSIA 3D0ZA 3GN3A 4JR6A 4OCFA 2B5XA 4PUFC 2L6CA 1XWGA 1IYIA 4EIPA 3M3MA 3WT1A 2YOIA 1EV9A 1K0OA 3IA1A 2NBSA 2MZCA 4PUAA 4PQ1A 5CP1A 4OMVA 2REMA 1TKDB 4O92A 1JZDA 3GTUB 3QMXA 2KHPA 1RK4A 3P90A 3GKXA 5B8BA 3GH6A 1FOVA 1X9MB 3HHVA 2AAWA 4MH2A 4AJ8A 1Y25A 1YY7A 1WRYA 5DVBA 2I3YA 5A5KA 3EYTA 3IDVA 1SK0A 4ZL7A 3PH9A 3I9V2 3MNGA 2MBSA 3ERFA 4F03A 4HI7A 1URMA 4IKHA 1TK0B 3H1NA 2KP1A 2CZ2A 4KA0A 5DJLA 3VPTA 2IFQB 2V41A 3KXOA 1F9MA 5DCGA 4BVYA 1GULA 1WIKA 3D5JA 1SU9A 5J4UA 3A5IA 5J9BA 3Q19A 1EEJA 4KCAA 4WR4A 4Z7XA 4GLTA 5AGYA 1U3AA 4MCUA 3CTFA 2A4HA 4ZILA 2FNOA 5ECOB 2E2MA 1WWJA 5ECMB 4ZBAA 4ECJA 3FY7A 4ML6A 5DAKB 3QCPA 3G9BA 1MDIA 1XWBA 4HDEA 3F0IA 3GKMA 1ZMAA 4NHZA 1AQVA 3A2VA 3EMXA 2V6OA 4MJAA 1PN9A 5E59A 3WGEA 3KMNA 4MZCA 5ECPB 1QMVA 3E0UA 3RPNA 3MWHA 4L0UA 1FO5A 1EGRA 4EKZA 3WGDA 2TRCP 2FLSA 1TI3A 3KMOA 5EPFA 3TJJA 2OKAA 5LCZA 1JZOA 2PU9C 4HZ4A 1VF1A 2LJAA 1ILOA 4JU5A 2XBIA 4Z2RA 2O89A 3UOMA 3SBCA 1GL8A 2VL2C 6GSTA 4KUNA 4NV5A 3TUEA 1O7UA 5AISA 4GSTA 2F8AA 1XFLA 5DQYA 1M9AA 3ZIVA 4IHUA 2HZEB 3NZNA 3ME7A 1GNEA 2L4QA 2L5OA 1EWXA 4KH7A 2CAQA 4D73A 1E6BA 4ZB6A 3EWLA 2H74A 3ZVJD 2X64A 5IMVA 2H71A 2F3MA 2HXKA 4LLRA 1GSUA 2VO4A 2IMEA 2H01A 3QFBC 2HRAA 4I2TA 1ACVA 3RHCA 2FWGA 2LNSA 4V2MA 2H0HA 5ECQB 2GSTA 3EVIA 1T7PB 4KDYA 1G6YA 1TI1A 3W6GA 2V1MA 1T8EB 1A24A 2C4JA 2BJXA 1PL1A 2LNTA 3ZMLA 1HYUA 1ERUA 4IQAA 4G0KA 3G7JA 1FG4A 1XW9A 2MMOA 4ULXA 1FVKA 3K8NA 2H1BA 1TOFA 2XPEA 4POKA 3VURA 4HJMA 3UL3A 1BYEA 2PWJA 3BCIA 3FW2A 3RPPA 4X1UA 5DALA 2LRTA 3ZYWA 1OE8A 1YQ1A 3DKSA 3ZTLA 1TRVA 1UVZA 4PTSA 3HA9A 3LYKA 3C1SA 3LW9A 5ID2A 1I5GA 3A2WA 1EGOA 2L4CA 2L59A 2WFCA 3TOUA 2VD0A 3DD3A 2IMIA 3QFAC 1G7EA 1FB6A 3HVVA 2EIOA 5A4UA 1EZKA 4TXOB 3APOA 1B8XA 4NWYA 1OE7A 1ABAA 2FHEA 3C71A 3LJRA 10GSA 4MF6A 5IQYA 1JFUA 3EE2A 4WF5A 1ON4A 4KB3A 5ABRA 5LNKe 2VLTA 2LUSA 2OACA 5HQPA 3ZREA 3GSTA 1THOA 4EDZA 3FK8A 2GDRA 5CAXA 1OC3A 1K3LA 3GKKA 1UC7A 3W8JA 4KF9A 3LGCA 4LL1B 3UJ1A 3EURA 1A0RP 2GLRA 5AIVA 1M7TA 3HDCA 3M0FA 1BX9A 3ZFLA 1XZOA 2O85A 1QK8A 1TU7A 2IFQA 2VCTA 2RUEA 5J3RA 1QUWA 1ZGNA 2V2GA 1XCCA 3G7IA 1EP7A 2OBIA 1SJZA 5CO3A 2N5AA 2OADA 3TCOA 5F05A 2BTOT 1AQWA 1OC9B 2H1DA 2LQOA 3HVSA 1C72A 2AHEA 4XS4B 1E2YA 1DSBA 3MAKA 5GSSA 2VIMA 5CRDA 1T3BA 2YV7A 4RI7A 4TR3A 1GSYA 3F4SA 2K9FA 2QA2A 3HVXA 2EC4A 3I6AA 3CSJA 4GF0A 5DAKA 4TR1A 2PVOC 2E0QA 2CV4A 1M99A 1RQMA 2MMNA 3TRXA 3PR8A 4IN0A 5KEJA 2H19A 4NV2A 3ZIJA 4PNGA 4USSA 3C7MA 2DLXA 1X5CA 3GHAA 4V1Ag 3VI7A 3FYGA 3IRAA 2O87A 4H86A 1GWCA 1I9DA 3CMIA 1R7HA 2CVBA 3TJGA 3F6DA 1PSQA 3LWAA 2H66A 3R3EA 4HZ2A 3GYKA 1YZXA 2FUG2 1BAYA 1SKWB 3UVTA 4JEDA 5D9VA 1GSQA 2YV9A 4ML1A 2X8HA 3HJOA 2HZFA 4YQMA 1PRXA 2DIYA 2C0EA 4IJ3A 3WYWA 1TDIA 4CW9A 3VWXA 4O5QA 5DBQA 3VPQA 2C3QA 2J9HA 2PGTA 4DSRA 4KGIA 4G10A 1NM3A 1U6TA 9GSSA 3FRCA 1V58A 4XS6A 1A0FA 1GH2A 1R26A 3JCML 2JZSA 3UVHA 2HZEA 2CVKA 3QAVA 2LJRA 3ZL5A 3GX0A 3OR5A 1TK5B 5CNWA 5HR1A 3BBYA 4QL9A 2GZZA 4MJBA 1YEXA 1Q98A 5C00A 5A4VA 5IO2A 3APQA 1SYXA 2PN8A 2R6KA 5HFKA 2GQKA 4V2LA 1ZYNA 4OCEA 1OYJA 1ZL9A 1X5EA 1A8YA 1J08A 4KX4A 5H5RA 2N5BA 4WF4A 2H8LA 1PN0A 2WULA 4ZIJA 1GUHA 2R0CA 3FZ9A 2OA7A 3P2AA 4X0XA 4LMVA 3J7Yk 3ZFBA 2B5YA 2YNXA 2GVPA 2ZUPA 2R0PA 2DMLA 3UBLA 1WMJA 2TIRA 3EC3A 4KNDA 4GCIA 3E9JB 3ZZXA 4MJEA 4KE3A 2I81A 1A2LA 3EPTA 4JE1A 1K3OA 2VL9A 3GUSA 1YF1A 1F2EA 4X4JA 2WZ9A 4KSOA 1AIUA 2YJ7A 5B8AA 2JACA 4WEYA 2ZNMA 1T4YA 2H70A 3QAWA 3VWUA 4TXOA 4BWQA 2VL3A 3IR4A 2NDOA 2OBKA 5CRHA 5GAND 4YKGA 2AV4A 1JLWA 4MP4A 2WGRA 2R37A 1MTCA 3FR6A 2YWNA 5FHIA 4EL1A 2VOCA 2FGXA 2QA1A 4POLA 1TP9A 1G7OA 2PBJA 3DXBA 5KN3A 2LS5A 4G2EA 4N30A 5IMZA 4HU7A 3PGTA 3UMAA 2IIYA 3GFKA 1CQHA 2G0FA 2JADA 4G0IA 1V57A 3GL3A 1ML6A 1XPVA 2JSZA 3VI5A 2CA8A 2GZYA 4MMMA 1Y6EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OE3 A;  4G19 A;  4I2U A;  17GS A;  4TR0 A;  4YQU A;  1PQN A;  5ECS A;  2VCX A;  5GAP D;  1GLQ A;  3ISO A;  2ALB A;  1T00 A;  4OD7 A;  2C3T A;  1T4Z A;  4E8H A;  5INY A;  2NVL A;  2B7K A;  5G31 A;  1GUK A;  1QQ2 A;  1K3Y A;  5D9X A;  3VLN A;  4MPG A;  4CHS A;  3TKR A;  1HNB A;  2DMM A;  1F37 A;  1WJK A;  4RUV A;  3KP8 A;  2IWT A;  4K7N A;  1B4P A;  6GSU A;  2P5Q A;  4Q5F A;  4F2I A;  3GV1 A;  4XCS A;  1ERV A;  4WR5 A;  4WXT A;  1MDJ A;  4WBR D;  2IN3 A;  4OFN A;  4K7I A;  4AJ7 A;  1TK8 B;  1G6W A;  1YF0 A;  1F3B A;  2EIQ A;  4GQC A;  1PD2 1;  2H30 A;  2DJ1 A;  4POM A;  4JR4 A;  1B9X C;  4DSS B;  3KP9 A;  2VM1 A;  3ZIT A;  3IV4 A;  1K0M A;  3DVX A;  4GSS A;  3CRT A;  1PGT A;  4OFM A;  2A2S A;  3LXZ A;  5D9W A;  2CZ3 A;  3BD2 A;  1QXH A;  1XWA A;  2VCV A;  2I9H A;  2HRF A;  4HUA A;  4YH2 A;  4ACS A;  1GP1 A;  1THX A;  4GSN A;  4EE0 A;  4MJC A;  5C04 A;  1AXD A;  1GTA A;  5G2Z A;  1QFN A;  1WP0 A;  4BPY A;  5ECH B;  4MF7 A;  3DWV A;  3M9J A;  3BCK A;  2QGV A;  3GA4 A;  3KJY A;  5HFG A;  5D8I A;  1CQG A;  1PX6 A;  4EDY A;  1W4V A;  4BWS A;  1DE1 A;  5AN1 A;  3TKS C;  2WDU A;  1XW6 A;  4FYC A;  1GTU A;  11GS A;  4N0Z A;  2K8V A;  1Z3E A;  1JZW A;  2CX4 A;  4K2D A;  2X8C A;  1PKZ A;  2VCZ A;  3HZ8 A;  3HJP A;  2C0G A;  3QAG A;  5CRE A;  3U5R E;  4MF5 A;  3TJB A;  3G7Y A;  1GLP A;  1SK1 A;  2YZH A;  2IMK A;  3UIW A;  2P0G A;  4PQH A;  3WGX A;  2HLS A;  1V2A A;  4I5Q A;  2EIR A;  4RQR A;  2H1G A;  2L6D A;  4JRR A;  18GS A;  1XVW A;  1EV4 A;  1LJR A;  1J0F A;  4KAE A;  2B1K A;  4OO5 A;  1YKC A;  3U6V A;  3TJK A;  4CDO A;  1TRW A;  1MEK A;  1XXU A;  5J41 A;  5ECN B;  3C8E A;  4ILF A;  1VRS D;  4GQF A;  1SL1 B;  3UEM A;  1WPI A;  1BJX A;  3EU4 A;  3TKS A;  3F8U A;  1U87 A;  2JZR A;  3TRQ A;  3RBT A;  3KTB A;  4HEA 2;  3LXT A;  2YJH A;  3NIV A;  1NSW A;  4Q5R A;  3KH9 A;  2V6K A;  3UAR A;  2IMD A;  2KUC A;  3VK9 A;  1U88 A;  2MMZ A;  1N2A A;  3GTU A;  2DC5 A;  4IBP A;  2FA8 A;  2E7P A;  4Q5N A;  2CAI A;  1XW5 A;  3TB2 A;  1M2B A;  1AW9 A;  2VCQ A;  4KDU A;  5H5S A;  1T1V A;  5HR0 A;  1DBY A;  1JHB A;  2QC7 A;  1SJI A;  3C1R A;  4IP1 A;  2RUF A;  2E2G A;  1VF4 A;  4ZBD A;  1ZYE A;  4ISD A;  4TXV A;  4V2N A;  1O73 A;  2ON7 A;  4FYB A;  13GS A;  2PER A;  1BQ7 A;  4IVF A;  1XBS A;  1SKS B;  4TOP A;  2B5E A;  1QGV A;  5DDL A;  3GNJ A;  1EP8 A;  2NTO A;  4F82 A;  4ZL9 A;  4HS1 A;  3ZRD A;  4AGS A;  1ST9 A;  2JL4 A;  2MMA A;  4MZW A;  3LG6 A;  4PUR A;  3FZ4 A;  4IS0 A;  5B7C A;  5G5F A;  2H73 A;  2R3X A;  2DBC A;  4LMW A;  3VWW A;  2GSR A;  4LL4 B;  2HT9 A;  2CVD A;  1KBN A;  2LJK A;  3QDN A;  1BG5 A;  2KOK A;  5DCH A;  2VCW A;  3GIX A;  3ERG A;  4PGT A;  2FA4 A;  5L71 A;  1M2D A;  1XVQ A;  4EXJ A;  1OKD A;  4NHW A;  3UAP A;  1TJD A;  2GGT A;  5IIZ A;  4N11 A;  5JCG A;  3LYP A;  4KSM A;  5DJM A;  4XTS A;  2G2Q A;  2HRN A;  1LU4 A;  5FT3 A;  2J23 A;  3QOU A;  3Q74 A;  3M9K A;  4MAB A;  3CRU A;  4DSS A;  5IMD A;  1X5D A;  4IEL A;  5JCW A;  5IPG A;  4PNF A;  2HNL A;  2A2R A;  4IGJ A;  3FR9 A;  3L78 A;  2K18 A;  3MSZ A;  1VF2 A;  2L5L A;  14GS A;  4ID0 A;  3FZ5 A;  2K8S A;  4JZQ A;  2ES7 A;  4YQV A;  1H75 A;  2VD1 A;  1GSF A;  3DVW A;  3CXG A;  2JU5 A;  1FVJ A;  1FAA A;  1SD8 A;  2LQQ A;  2OJL A;  1F3A A;  3KEB A;  2DJJ A;  4RI6 A;  5GST A;  2GQL A;  4MPF A;  5IOW A;  2C8U A;  4QQ7 A;  4V1A p;  1OC8 A;  3DGQ A;  3N9J A;  4TRX A;  3FEU A;  4HJ2 A;  5EVO A;  2LTK A;  2L57 A;  1YDK A;  4GWR A;  4FIW A;  4ZB8 A;  1TW9 A;  2HSH A;  4WET A;  4L5L A;  1SJ6 A;  4GXZ A;  2RM5 A;  3IAM 2;  4J57 E;  3A5W A;  5EL8 A;  1NW2 A;  3D6I A;  4PX1 A;  2LRC A;  1HD2 A;  2GTU A;  1TTZ A;  3DRN A;  1XIY A;  3VFI A;  1XWC A;  3H93 A;  1GSE A;  2BMX A;  3O76 A;  2H72 A;  19GS A;  1SEN A;  3FR3 A;  1R5P A;  3NOF A;  4N0V A;  1Z5Y E;  1Z6M A;  2FWH A;  1AQX A;  3DIE A;  3W8S A;  5KN1 A;  3ME8 A;  5J9C A;  5DAL B;  2V32 A;  2DSA A;  4KW6 A;  1ZYQ B;  2XBQ A;  2X99 A;  2AUV A;  4FO5 A;  4HQS A;  4NPB A;  4BVX A;  4TN8 A;  1A8L A;  3EIN A;  3KH7 A;  1N8J A;  1NHO A;  5ECI B;  2IJY A;  3LEF A;  5H5Q A;  2H0I A;  4KCE A;  3MDK A;  1WE0 A;  2IL3 A;  5GZZ B;  4DSQ A;  1O6J A;  3HJM A;  4F0B A;  4XHM A;  4EO3 A;  1EOH A;  3I69 A;  5IO0 A;  2MYG A;  3D4M A;  2M80 A;  3TKP A;  2DJ2 A;  5JCU A;  2F9S A;  2VLV A;  3D22 A;  1GTB A;  3D21 A;  2JZT A;  2LEG A;  4QL7 A;  4GRF A;  1S3C A;  1Z7P A;  5IOX A;  1OKT A;  2YP6 A;  3F6F A;  2YAN A;  4ZXG A;  2C0D A;  4EUY A;  3O6T A;  4I97 A;  1B4Q A;  2O8V B;  4MLY A;  1O8W A;  2HYX A;  2WJU A;  2F8F A;  2MBT A;  3L9U A;  3TOT A;  1A2J A;  1R5A A;  4OO4 A;  3LSZ A;  1WOU A;  4DEJ A;  5KN0 A;  2GT6 A;  2R5G A;  4F9Z A;  5G1L A;  2FWE A;  1XOB A;  2GQM A;  3HXS A;  1EEM A;  3QR6 A;  4EVM A;  2C0F A;  2CT6 A;  4ECI A;  3ZMK A;  1Q4J A;  2B7J A;  3GRX A;  3F3R A;  5J5N A;  3GMF A;  5ECL B;  1JZR A;  3TJF A;  1AUC A;  2M72 A;  3TGZ A;  4NXI A;  2HSY A;  2DJ0 A;  1OC9 A;  16GS A;  4XS4 A;  2WRT A;  3IPZ A;  1Z6N A;  3UBK A;  1S3A A;  4TR1 B;  3LQ7 A;  4XRD A;  1FB0 A;  3L4N A;  5JWO B;  3GSS A;  2PMT A;  1O8X A;  2C80 A;  4K6X A;  3O3T A;  1B48 A;  1GUM A;  4IQ1 A;  2VAF A;  5DQS A;  4FH8 A;  4K0N A;  5CRW A;  3IAS 2;  4F0C A;  4WBJ A;  4N10 A;  1KNG A;  2KP2 A;  1B9Y C;  2NPB A;  4J2F A;  1MD4 A;  22GS A;  1DUG A;  5IMF A;  1OAZ A;  2LV3 A;  4X43 A;  5D93 A;  3F4T A;  4ECB A;  2N5F A;  2VLU A;  4TW5 A;  3D4T A;  2GSQ A;  5COH A;  1V9W A;  5B6N A;  2XC2 A;  1X9W B;  4MA9 A;  4AJ6 A;  4L0W A;  3I43 A;  4MDC A;  2AB6 A;  4Q5Q A;  4ECC A;  4K0G A;  3KZQ A;  4OFT A;  2O7K A;  5JWQ B;  4XRA A;  3HZ4 A;  4G9H A;  2WB9 A;  2LRN A;  4HU9 A;  5B6M A;  3KTL A;  1GTI A;  1DE2 A;  3KD0 A;  4E8E A;  2GT5 A;  3R2Q A;  1OVN A;  1W89 A;  1XWK A;  3BOA A;  3IHQ A;  4POB A;  4BL7 A;  3QD9 A;  1K0D A;  1VGL A;  3FKF A;  4K1F A;  3RDW A;  1FW1 A;  2CX3 A;  1XOA A;  1LBK A;  3P7X A;  1AC1 A;  2B6M A;  3KIJ A;  2R4V A;  2YWO A;  1M0U A;  2RM6 A;  1EOG A;  2YCD A;  5LD0 A;  5ECR B;  3V1W A;  1ERW A;  3APS A;  1YEP A;  5AIX A;  3ZVJ A;  2H1A A;  4NAX A;  1HNA A;  1GRX A;  1YKA A;  5HFI A;  1K0C A;  3CYN A;  5ENU A;  4HQZ A;  1VF3 A;  3KGK A;  5KN2 A;  3SWL A;  1SK2 A;  2I1U A;  3EU3 A;  1K0B A;  5F07 A;  1S3D A;  2QKE A;  3M8N A;  5F06 A;  2ON5 A;  6GSX A;  2X8G A;  3GL5 A;  2VL2 A;  2WCI A;  4YAP A;  1HQO A;  3HYP A;  1SYR A;  5ELG A;  3WD6 A;  4PXO A;  1X0R A;  2YZU A;  3PIN A;  2YPM A;  1BED A;  5F0G A;  1TU8 A;  2P31 A;  3F63 A;  7GSS A;  3QPM A;  5FWG A;  3FHK A;  4MH3 A;  3US3 A;  1SL2 B;  1K0N A;  2PPT A;  2KLX A;  4L5O A;  4I8B A;  4IP6 A;  2FY6 A;  3IXR A;  1SKR B;  1K0A A;  4ZL8 A;  8GSS A;  4AF2 A;  3CTG A;  5IPH A;  2XPD A;  1RW1 A;  2P5R A;  2HE3 A;  2CQ9 A;  3FZA A;  3GX8 A;  3H4K A;  1TRU A;  2XHF A;  5D9T A;  3DEX A;  4NMU A;  2GS3 A;  2YWI A;  1PKW A;  3GUR A;  1O85 A;  3L0H A;  2M46 A;  1Z7R A;  2PVQ A;  3HKR A;  12GS A;  3TDG A;  2Z9S A;  4YAV A;  2RII A;  4LA1 A;  4BA7 A;  1HNC A;  1J9B A;  1M2A A;  3HCZ A;  2R2J A;  4TR4 A;  1GSD A;  5E4W A;  2HFD A;  3N5O A;  3IE3 A;  3ERW A;  2H75 A;  1R4W A;  4MZB A;  3F4R A;  5IM9 A;  3A2X A;  2B1L A;  1MD3 A;  2OE1 A;  3IC4 A;  1GNW A;  5IMA A;  1A2M A;  5D73 A;  3LFL A;  1UA5 A;  1SL0 B;  2HI7 A;  3TKQ A;  20GS A;  2A4V A;  2IPA A;  4DVC A;  6GSW A;  2FCH A;  1MDK A;  2FWF A;  2GSS A;  3DYR A;  3J7Y b;  1KEB A;  2DIZ A;  3VWV A;  2WS2 A;  2F51 A;  5D96 A;  3HD5 A;  4K8M A;  1M9B A;  2K6V A;  3S9F A;  1A23 A;  3AY8 A;  2LST A;  3E3E A;  3ED3 A;  4K9Z A;  5JWR B;  2RLI A;  3H8Q A;  2C1Y A;  3F9U A;  3IOS A;  3A3T A;  4OWY A;  1USB A;  1ZOF A;  2IMF A;  3KM6 A;  4EC0 A;  1UN2 A;  2GZP A;  5HR3 A;  1ZCP A;  4O32 A;  2DJK A;  4PQI A;  3L9S A;  3CSI A;  4IJI A;  3H79 A;  2YN1 A;  3HY2 A;  5A4W A;  2VUP A;  4WKW A;  1G0T A;  5F8B A;  3DML A;  4ZBB A;  1O81 A;  1PMT A;  1Z9H A;  4MK3 A;  4KDX A;  3TRP A;  4P3Y B;  5G5E A;  6GSS A;  2H6Z A;  5ELA A;  1X9S B;  2H6Y A;  5HR2 A;  4D73 B;  3CBU A;  1KTE A;  3IBH A;  3M1G A;  3RHB A;  2I4A A;  1F6M C;  3Q18 A;  3TKS E;  3WT2 A;  2D2Z A;  2TRX A;  1TRS A;  3BJ5 A;  2OE0 A;  5CYY A;  2PUK C;  4HOJ A;  2JSY A;  4I6X A;  5ECK B;  1ZZY A;  4EF0 A;  1AAZ A;  1PX7 A;  5G30 A;  1FHE A;  1GSS A;  4L8E A;  4TVE A;  2YWM A;  1PA3 A;  2ZCT A;  3RAZ A;  1H4O A;  1V40 A;  2H6X A;  3KCM A;  1JLV A;  2H76 A;  5IMC A;  3C73 A;  1ERT A;  2H0G A;  4XS1 A;  4GTU A;  1TXX A;  3EMP A;  3IK9 A;  4JBB A;  2AJQ B;  3Q6O A;  3CSH A;  2DJ3 A;  3ZLP A;  6GSV A;  3IK7 A;  4ZB9 A;  4TKY A;  5EY6 A;  2LKU A;  3GKN A;  1PL2 A;  2B3S A;  1SD9 A;  1YJ6 A;  3LOR A;  3L9V A;  5CRG A;  6GSY A;  1IYH A;  4O7H A;  5G1K A;  4IW9 A;  4K7O A;  3F3Q A;  5ID2 B;  2C3N A;  2AYT A;  4RQX A;  1V98 A;  4O5R A;  3GH9 A;  1NHY A;  1U3I A;  2FD3 A;  3P8W A;  4J56 E;  2VM2 A;  4FYU A;  4XIH A;  2QSI A;  3D0Z A;  3GN3 A;  4JR6 A;  4OCF A;  2B5X A;  4PUF C;  2L6C A;  1XWG A;  1IYI A;  3M3M A;  3WT1 A;  2YOI A;  1EV9 A;  1K0O A;  3IA1 A;  2NBS A;  2MZC A;  4PUA A;  4PQ1 A;  5CP1 A;  4OMV A;  2REM A;  1TKD B;  4O92 A;  1JZD A;  3GTU B;  3QMX A;  2KHP A;  1RK4 A;  3P90 A;  3GKX A;  5B8B A;  3GH6 A;  1FOV A;  1X9M B;  3HHV A;  2AAW A;  4MH2 A;  4AJ8 A;  1Y25 A;  1YY7 A;  1WRY A;  5DVB A;  2I3Y A;  5A5K A;  3EYT A;  3IDV A;  1SK0 A;  4ZL7 A;  3PH9 A;  3I9V 2;  3MNG A;  2MBS A;  3ERF A;  4F03 A;  4HI7 A;  1URM A;  4IKH A;  1TK0 B;  3H1N A;  2KP1 A;  2CZ2 A;  4KA0 A;  5DJL A;  3VPT A;  2IFQ B;  2V41 A;  3KXO A;  1F9M A;  5DCG A;  4BVY A;  1GUL A;  1WIK A;  3D5J A;  1SU9 A;  5J4U A;  5J9B A;  3Q19 A;  1EEJ A;  4KCA A;  4WR4 A;  4Z7X A;  4GLT A;  5AGY A;  1U3A A;  4MCU A;  3CTF A;  4ZIL A;  2FNO A;  5ECO B;  2E2M A;  1WWJ A;  5ECM B;  4ZBA A;  4ECJ A;  3FY7 A;  4ML6 A;  5DAK B;  3QCP A;  3G9B A;  1MDI A;  1XWB A;  4HDE A;  3F0I A;  3GKM A;  1ZMA A;  4NHZ A;  1AQV A;  3A2V A;  3EMX A;  2V6O A;  4MJA A;  1PN9 A;  5E59 A;  3WGE A;  3KMN A;  4MZC A;  5ECP B;  1QMV A;  3E0U A;  3RPN A;  3MWH A;  4L0U A;  1FO5 A;  1EGR A;  4EKZ A;  3WGD A;  2TRC P;  2FLS A;  1TI3 A;  3KMO A;  5EPF A;  3TJJ A;  2OKA A;  5LCZ A;  1JZO A;  2PU9 C;  4HZ4 A;  1VF1 A;  2LJA A;  1ILO A;  4JU5 A;  2XBI A;  2O89 A;  3UOM A;  3SBC A;  1GL8 A;  2VL2 C;  6GST A;  4KUN A;  4NV5 A;  3TUE A;  1O7U A;  5AIS A;  4GST A;  2F8A A;  1XFL A;  5DQY A;  1M9A A;  3ZIV A;  4IHU A;  2HZE B;  3NZN A;  3ME7 A;  1GNE A;  2L4Q A;  2L5O A;  1EWX A;  4KH7 A;  2CAQ A;  4D73 A;  1E6B A;  4ZB6 A;  3EWL A;  2H74 A;  3ZVJ D;  2X64 A;  5IMV A;  2H71 A;  2F3M A;  2HXK A;  4LLR A;  1GSU A;  2VO4 A;  2IME A;  2H01 A;  3QFB C;  4I2T A;  1ACV A;  3RHC A;  2FWG A;  2LNS A;  4V2M A;  2H0H A;  5ECQ B;  2GST A;  3EVI A;  1T7P B;  4KDY A;  1G6Y A;  1TI1 A;  3W6G A;  2V1M A;  1T8E B;  1A24 A;  2C4J A;  2BJX A;  1PL1 A;  2LNT A;  3ZML A;  1HYU A;  1ERU A;  4IQA A;  3G7J A;  1FG4 A;  1XW9 A;  2MMO A;  4ULX A;  1FVK A;  3K8N A;  2H1B A;  1TOF A;  2XPE A;  4POK A;  3VUR A;  4HJM A;  3UL3 A;  1BYE A;  2PWJ A;  3BCI A;  3FW2 A;  3RPP A;  4X1U A;  5DAL A;  2LRT A;  3ZYW A;  1OE8 A;  1YQ1 A;  3DKS A;  3ZTL A;  1TRV A;  1UVZ A;  3HA9 A;  3LYK A;  3C1S A;  5ID2 A;  1I5G A;  3A2W A;  1EGO A;  2L4C A;  2L59 A;  2WFC A;  3TOU A;  2VD0 A;  3DD3 A;  2IMI A;  3QFA C;  1G7E A;  1FB6 A;  3HVV A;  2EIO A;  5A4U A;  1EZK A;  4TXO B;  3APO A;  1B8X A;  4NWY A;  1OE7 A;  1ABA A;  2FHE A;  3C71 A;  3LJR A;  10GS A;  4MF6 A;  5IQY A;  1JFU A;  3EE2 A;  4WF5 A;  1ON4 A;  4KB3 A;  5ABR A;  5LNK e;  2VLT A;  2LUS A;  2OAC A;  5HQP A;  3ZRE A;  3GST A;  1THO A;  4EDZ A;  3FK8 A;  2GDR A;  5CAX A;  1OC3 A;  1K3L A;  3GKK A;  1UC7 A;  3W8J A;  4LL1 B;  3LGC A;  3UJ1 A;  3EUR A;  1A0R P;  2GLR A;  5AIV A;  1M7T A;  3HDC A;  3M0F A;  1BX9 A;  3ZFL A;  1XZO A;  2O85 A;  1QK8 A;  1TU7 A;  2IFQ A;  2VCT A;  2RUE A;  5J3R A;  1QUW A;  1ZGN A;  2V2G A;  1XCC A;  3G7I A;  1EP7 A;  2OBI A;  1SJZ A;  5CO3 A;  2N5A A;  2OAD A;  3TCO A;  5F05 A;  2BTO T;  1AQW A;  1OC9 B;  2H1D A;  2LQO A;  3HVS A;  1C72 A;  2AHE A;  4XS4 B;  1E2Y A;  1DSB A;  3MAK A;  5GSS A;  2VIM A;  5CRD A;  1T3B A;  2YV7 A;  4RI7 A;  4TR3 A;  1GSY A;  3F4S A;  2K9F A;  3HVX A;  2EC4 A;  3I6A A;  3CSJ A;  4GF0 A;  5DAK A;  4TR1 A;  2PVO C;  2E0Q A;  2CV4 A;  1M99 A;  1RQM A;  2MMN A;  3TRX A;  3PR8 A;  4IN0 A;  5KEJ A;  2H19 A;  4NV2 A;  3ZIJ A;  4PNG A;  3C7M A;  2DLX A;  1X5C A;  3GHA A;  4V1A g;  3VI7 A;  3FYG A;  3IRA A;  2O87 A;  4H86 A;  1GWC A;  1I9D A;  3CMI A;  1R7H A;  2CVB A;  3TJG A;  3F6D A;  1PSQ A;  3LWA A;  2H66 A;  4HZ2 A;  3GYK A;  1YZX A;  2FUG 2;  1BAY A;  1SKW B;  3UVT A;  4JED A;  5D9V A;  1GSQ A;  2YV9 A;  4ML1 A;  2X8H A;  3HJO A;  2HZF A;  4YQM A;  1PRX A;  2DIY A;  2C0E A;  4IJ3 A;  3WYW A;  1TDI A;  4CW9 A;  3VWX A;  5DBQ A;  3VPQ A;  2C3Q A;  2J9H A;  2PGT A;  4DSR A;  4KGI A;  4G10 A;  1NM3 A;  1U6T A;  9GSS A;  3FRC A;  1V58 A;  4XS6 A;  1A0F A;  1GH2 A;  1R26 A;  3JCM L;  2JZS A;  3UVH A;  2HZE A;  2CVK A;  3QAV A;  2LJR A;  3ZL5 A;  3GX0 A;  3OR5 A;  1TK5 B;  5CNW A;  5HR1 A;  3BBY A;  4QL9 A;  2GZZ A;  4MJB A;  1YEX A;  1Q98 A;  5C00 A;  5A4V A;  5IO2 A;  3APQ A;  1SYX A;  2PN8 A;  2R6K A;  5HFK A;  2GQK A;  4V2L A;  4OCE A;  1OYJ A;  1ZL9 A;  1X5E A;  1A8Y A;  1J08 A;  4KX4 A;  5H5R A;  2N5B A;  4WF4 A;  2H8L A;  2WUL A;  4ZIJ A;  1GUH A;  3FZ9 A;  2OA7 A;  3P2A A;  4X0X A;  4LMV A;  3J7Y k;  3ZFB A;  2B5Y A;  2YNX A;  2GVP A;  2ZUP A;  2DML A;  3UBL A;  1WMJ A;  2TIR A;  3EC3 A;  4KND A;  4GCI A;  3E9J B;  3ZZX A;  4MJE A;  4KE3 A;  2I81 A;  1A2L A;  4JE1 A;  1K3O A;  2VL9 A;  3GUS A;  1YF1 A;  1F2E A;  2WZ9 A;  4KSO A;  1AIU A;  2YJ7 A;  5B8A A;  2JAC A;  4WEY A;  2ZNM A;  1T4Y A;  2H70 A;  3QAW A;  3VWU A;  4TXO A;  4BWQ A;  2VL3 A;  3IR4 A;  2NDO A;  2OBK A;  5CRH A;  5GAN D;  2AV4 A;  1JLW A;  4MP4 A;  2WGR A;  2R37 A;  1MTC A;  3FR6 A;  2YWN A;  5FHI A;  4EL1 A;  2VOC A;  2FGX A;  4POL A;  1TP9 A;  1G7O A;  2PBJ A;  3DXB A;  5KN3 A;  2LS5 A;  4G2E A;  4N30 A;  5IMZ A;  4HU7 A;  3PGT A;  3UMA A;  2IIY A;  3GFK A;  1CQH A;  2G0F A;  2JAD A;  1V57 A;  3GL3 A;  1ML6 A;  1XPV A;  2JSZ A;  3VI5 A;  2CA8 A;  2GZY A;  4MMM A;  1Y6E A; 
#chains in the Genus database with same CATH topology
 2OE3 A;  4G19 A;  4I2U A;  17GS A;  4TR0 A;  4YQU A;  1PQN A;  5ECS A;  2VCX A;  5GAP D;  1GLQ A;  3ISO A;  2ALB A;  1T00 A;  4OD7 A;  2C3T A;  1T4Z A;  4E8H A;  5INY A;  2NVL A;  2B7K A;  5G31 A;  1GUK A;  1QQ2 A;  1K3Y A;  5D9X A;  3VLN A;  4MPG A;  4CHS A;  3TKR A;  1HNB A;  2DMM A;  1F37 A;  1WJK A;  4RUV A;  3KP8 A;  2HRK A;  2IWT A;  4K7N A;  1B4P A;  6GSU A;  2P5Q A;  4Q5F A;  4F2I A;  3GV1 A;  4XCS A;  1ERV A;  4WR5 A;  4WXT A;  1MDJ A;  4WBR D;  1ZYP A;  2IN3 A;  4OFN A;  4K7I A;  4AJ7 A;  1TK8 B;  1G6W A;  1YF0 A;  1F3B A;  2EIQ A;  4GQC A;  1PD2 1;  2H30 A;  2DJ1 A;  4POM A;  4JR4 A;  1B9X C;  4DSS B;  3KP9 A;  2VM1 A;  3ZIT A;  3IV4 A;  1K0M A;  4G0L A;  5KOW A;  3DVX A;  4GSS A;  3CRT A;  1PGT A;  4OFM A;  2A2S A;  3LXZ A;  5D9W A;  2CZ3 A;  3BD2 A;  1QXH A;  1XWA A;  2VCV A;  2I9H A;  2HRF A;  4HUA A;  4YH2 A;  4ACS A;  1GP1 A;  1THX A;  4GSN A;  4EE0 A;  4MJC A;  5C04 A;  1AXD A;  4A5P A;  1GTA A;  5G2Z A;  1QFN A;  1WP0 A;  4BPY A;  5ECH B;  4MF7 A;  3DWV A;  3M9J A;  3BCK A;  2QGV A;  3GA4 A;  3KJY A;  5HFG A;  5D8I A;  1CQG A;  1PX6 A;  4EDY A;  1W4V A;  4BWS A;  1DE1 A;  5AN1 A;  3TKS C;  2WDU A;  1XW6 A;  4FYC A;  1GTU A;  11GS A;  4N0Z A;  2K8V A;  1Z3E A;  3IC8 A;  1JZW A;  2CX4 A;  4K2D A;  2X8C A;  1PKZ A;  2VCZ A;  3HZ8 A;  3HJP A;  2C0G A;  4CY8 A;  3QAG A;  5CRE A;  3U5R E;  4MF5 A;  3TJB A;  3G7Y A;  4Z2U A;  1GLP A;  1SK1 A;  2YZH A;  2IMK A;  3UIW A;  2P0G A;  4PQH A;  3WGX A;  2HLS A;  1V2A A;  4I5Q A;  2EIR A;  4RQR A;  2H1G A;  4K5S A;  2L6D A;  4JRR A;  18GS A;  1XVW A;  2X4A A;  1EV4 A;  1LJR A;  1J0F A;  4KAE A;  2B1K A;  4OO5 A;  1YKC A;  5KOX A;  3U6V A;  3TJK A;  4CDO A;  1TRW A;  1MEK A;  1XXU A;  5J41 A;  5ECN B;  4BVX B;  3C8E A;  4ILF A;  1VRS D;  4GQF A;  1SL1 B;  3UEM A;  1WPI A;  1BJX A;  3EU4 A;  3TKS A;  3F8U A;  1U87 A;  2JZR A;  3TRQ A;  3RBT A;  3KTB A;  4HEA 2;  3LXT A;  2YJH A;  3NIV A;  1NSW A;  4Q5R A;  3KH9 A;  2V6K A;  3IHG A;  3UAR A;  2IMD A;  2KUC A;  3VK9 A;  1U88 A;  2MMZ A;  5BRT A;  1N2A A;  3GTU A;  2DC5 A;  4IBP A;  2FA8 A;  2E7P A;  4Q5N A;  2CAI A;  1XW5 A;  3TB2 A;  1M2B A;  1AW9 A;  2VCQ A;  4KDU A;  5H5S A;  1T1V A;  5HR0 A;  1DBY A;  1JHB A;  2QC7 A;  1SJI A;  3C1R A;  4K2X A;  4IP1 A;  2RUF A;  2E2G A;  1VF4 A;  4ZBD A;  1ZYE A;  4ISD A;  1FOH A;  4TXV A;  4V2N A;  1O73 A;  2ON7 A;  4FYB A;  13GS A;  2PER A;  1BQ7 A;  4IVF A;  1XBS A;  1SKS B;  4TOP A;  2B5E A;  1QGV A;  5DDL A;  3GNJ A;  1EP8 A;  2NTO A;  4F82 A;  4ZL9 A;  4HS1 A;  3ZRD A;  4AGS A;  1ST9 A;  2JL4 A;  2MMA A;  4MZW A;  3LG6 A;  4PUR A;  3FZ4 A;  4IS0 A;  5B7C A;  5G5F A;  2H73 A;  2R3X A;  2DBC A;  4LMW A;  3VWW A;  2GSR A;  4LL4 B;  2HT9 A;  3PPU A;  2CVD A;  1KBN A;  2LJK A;  3QDN A;  1BG5 A;  2KOK A;  5DCH A;  2VCW A;  3GIX A;  3ERG A;  4PGT A;  2FA4 A;  5L71 A;  1M2D A;  1XVQ A;  4EXJ A;  1OKD A;  4NHW A;  3UAP A;  1TJD A;  2GGT A;  5IIZ A;  4N11 A;  5JCG A;  3LYP A;  4KSM A;  5DJM A;  4XTS A;  2G2Q A;  2HRN A;  1LU4 A;  5FT3 A;  2J23 A;  3QOU A;  3Q74 A;  3M9K A;  4MAB A;  3CRU A;  4DSS A;  5IMD A;  1X5D A;  4IEL A;  5JCW A;  3FMW A;  5IPG A;  4PNF A;  2HNL A;  2A2R A;  4IGJ A;  3FR9 A;  3L78 A;  2K18 A;  3MSZ A;  1VF2 A;  2L5L A;  14GS A;  4ID0 A;  3FZ5 A;  2K8S A;  4JZQ A;  2ES7 A;  4YQV A;  1H75 A;  2VD1 A;  1GSF A;  3DVW A;  3CXG A;  2JU5 A;  1FVJ A;  1FAA A;  1SD8 A;  2LQQ A;  2OJL A;  1F3A A;  3KEB A;  4BL7 B;  2DJJ A;  4RI6 A;  5GST A;  2GQL A;  4MPF A;  5IOW A;  2C8U A;  4QQ7 A;  4V1A p;  1OC8 A;  3DGQ A;  3N9J A;  4TRX A;  3FEU A;  4HJ2 A;  5EVO A;  2LTK A;  2L57 A;  1YDK A;  4GWR A;  4FIW A;  4ZB8 A;  1TW9 A;  2HSH A;  4WET A;  4L5L A;  1SJ6 A;  4GXZ A;  2RM5 A;  3IAM 2;  4J57 E;  3A5W A;  5EL8 A;  1NW2 A;  3D6I A;  4PX1 A;  2LRC A;  1HD2 A;  4FQU A;  2GTU A;  1TTZ A;  3DRN A;  1XIY A;  3VFI A;  1XWC A;  3H93 A;  1GSE A;  2BMX A;  3O76 A;  2H72 A;  19GS A;  1SEN A;  3FR3 A;  1R5P A;  3NOF A;  4N0V A;  1Z5Y E;  1Z6M A;  2FWH A;  1AQX A;  3DIE A;  3W8S A;  5KN1 A;  3ME8 A;  5J9C A;  5DAL B;  2V32 A;  2DSA A;  4KW6 A;  1ZYQ B;  2XBQ A;  2X99 A;  2AUV A;  4FO5 A;  4HQS A;  4NPB A;  4BVX A;  4TN8 A;  1A8L A;  3EIN A;  3KH7 A;  1N8J A;  1NHO A;  5ECI B;  2IJY A;  3LEF A;  5H5Q A;  2H0I A;  4KCE A;  2DKI A;  2A2P A;  3MDK A;  1WE0 A;  2IL3 A;  5GZZ B;  4DSQ A;  1O6J A;  3HJM A;  4F0B A;  4XHM A;  4EO3 A;  5BMU A;  1EOH A;  3I69 A;  5IO0 A;  2MYG A;  3D4M A;  2M80 A;  3TKP A;  2DJ2 A;  5JCU A;  2F9S A;  2VLV A;  3D22 A;  1GTB A;  3D21 A;  2JZT A;  2LEG A;  4QL7 A;  4GRF A;  1S3C A;  1Z7P A;  5IOX A;  1OKT A;  2YP6 A;  3F6F A;  2YAN A;  4ZXG A;  2C0D A;  4EUY A;  3O6T A;  4I97 A;  1B4Q A;  2O8V B;  4MLY A;  1O8W A;  2HYX A;  2WJU A;  2F8F A;  2MBT A;  3L9U A;  3TOT A;  1A2J A;  1R5A A;  4OO4 A;  3LSZ A;  1WOU A;  4O5U A;  4DEJ A;  5KN0 A;  3MIX A;  2GT6 A;  2R5G A;  4F9Z A;  5G1L A;  4EIQ A;  2FWE A;  1XOB A;  2GQM A;  3HXS A;  1EEM A;  3QR6 A;  4EVM A;  2C0F A;  2CT6 A;  4ECI A;  3ZMK A;  1Q4J A;  2B7J A;  3GRX A;  3F3R A;  2UZ8 A;  5J5N A;  3GMF A;  5ECL B;  1JZR A;  3TJF A;  1AUC A;  2M72 A;  3TGZ A;  4NXI A;  2HSY A;  2DJ0 A;  1OC9 A;  16GS A;  4ICY A;  4XS4 A;  2WRT A;  3IPZ A;  1Z6N A;  3UBK A;  1S3A A;  4TR1 B;  3LQ7 A;  4XRD A;  1FB0 A;  3L4N A;  5JWO B;  3GSS A;  2PMT A;  1O8X A;  2C80 A;  4K6X A;  3O3T A;  1B48 A;  2X49 A;  1GUM A;  4IQ1 A;  2VAF A;  5DQS A;  4FH8 A;  4K0N A;  5CRW A;  3IAS 2;  4F0C A;  4WBJ A;  4N10 A;  1KNG A;  2KP2 A;  1B9Y C;  2NPB A;  4J2F A;  1MD4 A;  22GS A;  1DUG A;  5IMF A;  1OAZ A;  2LV3 A;  4X43 A;  5D93 A;  3F4T A;  4ECB A;  2N5F A;  2VLU A;  4TW5 A;  3D4T A;  2GSQ A;  5COH A;  1V9W A;  5B6N A;  2XC2 A;  1X9W B;  4MA9 A;  4AJ6 A;  4L0W A;  3I43 A;  4MDC A;  2AB6 A;  4Q5Q A;  4ECC A;  4K0G A;  3KZQ A;  4OFT A;  2O7K A;  5JWQ B;  4YKF A;  4XRA A;  3HZ4 A;  4G9H A;  2WB9 A;  2LRN A;  4HU9 A;  4Z2T A;  5B6M A;  3KTL A;  1GTI A;  1DE2 A;  3KD0 A;  4E8E A;  2GT5 A;  3R2Q A;  1OVN A;  1W89 A;  1XWK A;  3BOA A;  3IHQ A;  4POB A;  4BL7 A;  3QD9 A;  1K0D A;  1VGL A;  3FKF A;  4K1F A;  3RDW A;  1FW1 A;  2CX3 A;  1XOA A;  1LBK A;  3P7X A;  1AC1 A;  2B6M A;  3KIJ A;  2R4V A;  2YWO A;  1M0U A;  2RM6 A;  1EOG A;  2YCD A;  5LD0 A;  5ECR B;  3V1W A;  1ERW A;  3APS A;  1YEP A;  5AIX A;  3ZVJ A;  2H1A A;  4NAX A;  1HNA A;  1GRX A;  1YKA A;  5HFI A;  1K0C A;  3CYN A;  5ENU A;  4HQZ A;  1VF3 A;  3KGK A;  5KN2 A;  3SWL A;  1SK2 A;  2I1U A;  3EU3 A;  1K0B A;  5F07 A;  1S3D A;  2QKE A;  3M8N A;  5F06 A;  2ON5 A;  6GSX A;  2X8G A;  3GL5 A;  2VL2 A;  2WCI A;  4YAP A;  1HQO A;  3HYP A;  4BIK A;  1SYR A;  5ELG A;  3WD6 A;  4PXO A;  1X0R A;  2YZU A;  3PIN A;  2R0G A;  2YPM A;  4MNN A;  1BED A;  5F0G A;  1TU8 A;  2P31 A;  3F63 A;  7GSS A;  3QPM A;  5FWG A;  1S3R A;  3FHK A;  4MH3 A;  3US3 A;  1SL2 B;  4HSC X;  1K0N A;  2PPT A;  2KLX A;  4L5O A;  4I8B A;  4IP6 A;  2FY6 A;  3IXR A;  1SKR B;  1K0A A;  4ZL8 A;  8GSS A;  4AF2 A;  3CTG A;  5IPH A;  2XPD A;  1RW1 A;  2P5R A;  2HE3 A;  2CQ9 A;  2DKH A;  3FZA A;  3GX8 A;  3H4K A;  1TRU A;  2XHF A;  5D9T A;  3DEX A;  4NMU A;  2GS3 A;  2YWI A;  1PKW A;  3GUR A;  1O85 A;  3L0H A;  2M46 A;  1Z7R A;  2PVQ A;  3HKR A;  12GS A;  3TDG A;  2Z9S A;  4YAV A;  2RII A;  4LA1 A;  4BA7 A;  1HNC A;  1J9B A;  1M2A A;  4BVY B;  3HCZ A;  2R2J A;  4TR4 A;  1GSD A;  5E4W A;  2HFD A;  3N5O A;  3IE3 A;  3ERW A;  2H75 A;  1R4W A;  4MZB A;  3F4R A;  5IM9 A;  3A2X A;  2B1L A;  1MD3 A;  2OE1 A;  3IC4 A;  1GNW A;  5IMA A;  1A2M A;  5D73 A;  3LFL A;  1UA5 A;  1SL0 B;  2HI7 A;  3TKQ A;  20GS A;  2A4V A;  2IPA A;  4DVC A;  6GSW A;  2FCH A;  1MDK A;  2FWF A;  2GSS A;  3DYR A;  3J7Y b;  1KEB A;  2DIZ A;  3VWV A;  2WS2 A;  2F51 A;  5D96 A;  3HD5 A;  4K8M A;  1M9B A;  2K6V A;  3S9F A;  1A23 A;  3AY8 A;  2LST A;  3E3E A;  3ED3 A;  4K9Z A;  3MYD A;  4CY6 A;  5JWR B;  2RLI A;  3H8Q A;  2C1Y A;  3F9U A;  3IOS A;  3A3T A;  4OWY A;  2HSM A;  1USB A;  1ZOF A;  2IMF A;  3KM6 A;  4EC0 A;  1UN2 A;  2GZP A;  5HR3 A;  1ZCP A;  4O32 A;  2DJK A;  4PQI A;  3L9S A;  3CSI A;  4IJI A;  3H79 A;  2YN1 A;  3HY2 A;  5A4W A;  2VUP A;  4WKW A;  1G0T A;  5F8B A;  3DML A;  4ZBB A;  1O81 A;  1PMT A;  1Z9H A;  4MK3 A;  4KDX A;  3TRP A;  4P3Y B;  5G5E A;  6GSS A;  2H6Z A;  5ELA A;  1X9S B;  2H6Y A;  5HR2 A;  4D73 B;  3CBU A;  1KTE A;  3IBH A;  3M1G A;  3RHB A;  2I4A A;  1F6M C;  3Q18 A;  3TKS E;  3WT2 A;  2D2Z A;  2TRX A;  1TRS A;  3BJ5 A;  2OE0 A;  5CYY A;  2PUK C;  4HOJ A;  2JSY A;  4I6X A;  5ECK B;  1ZZY A;  4EF0 A;  1AAZ A;  1PX7 A;  5G30 A;  1FHE A;  1GSS A;  4L8E A;  4TVE A;  2YWM A;  1PA3 A;  2ZCT A;  3RAZ A;  1H4O A;  1V40 A;  2H6X A;  3KCM A;  1JLV A;  2H76 A;  5IMC A;  3C73 A;  1ERT A;  2H0G A;  4XS1 A;  4GTU A;  1TXX A;  3EMP A;  3IK9 A;  4JBB A;  2AJQ B;  3Q6O A;  3CSH A;  2DJ3 A;  3ZLP A;  6GSV A;  3IK7 A;  4ZB9 A;  4TKY A;  5EY6 A;  2LKU A;  3GKN A;  1PL2 A;  2B3S A;  1SD9 A;  1YJ6 A;  3LOR A;  3L9V A;  5CRG A;  6GSY A;  1IYH A;  4O7H A;  4K5R A;  4IW9 A;  4K7O A;  5G1K A;  3F3Q A;  5ID2 B;  2C3N A;  2AYT A;  4RQX A;  1V98 A;  4O5R A;  3GH9 A;  1NHY A;  1U3I A;  2FD3 A;  3P8W A;  4J56 E;  2VM2 A;  4FYU A;  4XIH A;  2QSI A;  3D0Z A;  3GN3 A;  4JR6 A;  4OCF A;  2B5X A;  4PUF C;  2L6C A;  1XWG A;  1IYI A;  4EIP A;  3M3M A;  3WT1 A;  2YOI A;  1EV9 A;  1K0O A;  3IA1 A;  2NBS A;  2MZC A;  4PUA A;  4PQ1 A;  5CP1 A;  4OMV A;  2REM A;  1TKD B;  4O92 A;  1JZD A;  3GTU B;  3QMX A;  2KHP A;  1RK4 A;  3P90 A;  3GKX A;  5B8B A;  3GH6 A;  1FOV A;  1X9M B;  3HHV A;  2AAW A;  4MH2 A;  4AJ8 A;  1Y25 A;  1YY7 A;  1WRY A;  5DVB A;  2I3Y A;  5A5K A;  3EYT A;  1XG8 A;  3IDV A;  1SK0 A;  4ZL7 A;  3PH9 A;  3I9V 2;  3MNG A;  2MBS A;  3ERF A;  4F03 A;  4HI7 A;  1URM A;  4IKH A;  1TK0 B;  3H1N A;  2KP1 A;  2CZ2 A;  4KA0 A;  5DJL A;  3VPT A;  2IFQ B;  2V41 A;  3KXO A;  1F9M A;  5DCG A;  4BVY A;  1GUL A;  1WIK A;  3D5J A;  1SU9 A;  5J4U A;  3A5I A;  3CQF A;  5J9B A;  3Q19 A;  1EEJ A;  4KCA A;  4WR4 A;  4Z7X A;  4GLT A;  5AGY A;  1U3A A;  4MCU A;  3CTF A;  2A4H A;  4ZIL A;  2FNO A;  5ECO B;  2E2M A;  1WWJ A;  5ECM B;  4ZBA A;  4ECJ A;  3FY7 A;  4ML6 A;  5DAK B;  3QCP A;  3G9B A;  1MDI A;  1XWB A;  4HDE A;  3F0I A;  3GKM A;  1ZMA A;  4NHZ A;  1AQV A;  3A2V A;  3EMX A;  2V6O A;  4MJA A;  1PN9 A;  5E59 A;  3WGE A;  3KMN A;  4MZC A;  5ECP B;  1QMV A;  3E0U A;  3RPN A;  3MWH A;  4L0U A;  1FO5 A;  1EGR A;  4EKZ A;  3WGD A;  2TRC P;  2FLS A;  1TI3 A;  3KMO A;  5EPF A;  3TJJ A;  2OKA A;  5LCZ A;  1JZO A;  2PU9 C;  4HZ4 A;  1VF1 A;  2LJA A;  1ILO A;  4JU5 A;  2XBI A;  4Z2R A;  2O89 A;  3UOM A;  3SBC A;  1GL8 A;  2VL2 C;  6GST A;  4KUN A;  4NV5 A;  3TUE A;  1O7U A;  5AIS A;  4GST A;  2F8A A;  1XFL A;  5DQY A;  1M9A A;  3ZIV A;  4IHU A;  2HZE B;  3NZN A;  3ME7 A;  1GNE A;  2L4Q A;  2L5O A;  1EWX A;  4KH7 A;  2CAQ A;  4D73 A;  1E6B A;  4ZB6 A;  3EWL A;  2H74 A;  3ZVJ D;  1PFO A;  2X64 A;  5IMV A;  2H71 A;  2F3M A;  2HXK A;  4LLR A;  1GSU A;  2VO4 A;  2IME A;  2H01 A;  3QFB C;  2HRA A;  4I2T A;  1ACV A;  3RHC A;  2FWG A;  2LNS A;  4V2M A;  2H0H A;  5ECQ B;  2GST A;  3EVI A;  1T7P B;  4KDY A;  1G6Y A;  1TI1 A;  3W6G A;  2V1M A;  1T8E B;  1A24 A;  2C4J A;  2BJX A;  1PL1 A;  2LNT A;  3ZML A;  1HYU A;  1ERU A;  4IQA A;  4G0K A;  3G7J A;  1FG4 A;  1XW9 A;  2MMO A;  4ULX A;  1FVK A;  3K8N A;  2H1B A;  1TOF A;  2XPE A;  4POK A;  3VUR A;  4HJM A;  3UL3 A;  1BYE A;  2PWJ A;  3BCI A;  3FW2 A;  3RPP A;  4X1U A;  5DAL A;  2LRT A;  3ZYW A;  1OE8 A;  1YQ1 A;  3DKS A;  3ZTL A;  1TRV A;  1UVZ A;  4PTS A;  3HA9 A;  3LYK A;  3C1S A;  3LW9 A;  5ID2 A;  1I5G A;  3A2W A;  1EGO A;  2L4C A;  2L59 A;  2WFC A;  3TOU A;  2VD0 A;  3DD3 A;  2IMI A;  3QFA C;  1G7E A;  1FB6 A;  3HVV A;  2EIO A;  5A4U A;  1EZK A;  4TXO B;  3APO A;  1B8X A;  4NWY A;  1OE7 A;  1ABA A;  2FHE A;  3C71 A;  3LJR A;  10GS A;  4MF6 A;  5IQY A;  1JFU A;  3EE2 A;  4WF5 A;  1ON4 A;  4KB3 A;  5ABR A;  5LNK e;  2VLT A;  2LUS A;  2OAC A;  5HQP A;  3ZRE A;  3GST A;  1THO A;  4EDZ A;  3FK8 A;  2GDR A;  5CAX A;  1OC3 A;  1K3L A;  3GKK A;  1UC7 A;  3W8J A;  4KF9 A;  3LGC A;  4LL1 B;  3UJ1 A;  3EUR A;  1A0R P;  2GLR A;  5AIV A;  1M7T A;  3HDC A;  3M0F A;  1BX9 A;  3ZFL A;  1XZO A;  2O85 A;  1QK8 A;  3HVN A;  1TU7 A;  2IFQ A;  2VCT A;  2RUE A;  5J3R A;  1QUW A;  1ZGN A;  2V2G A;  1XCC A;  3G7I A;  1EP7 A;  2OBI A;  1SJZ A;  5CO3 A;  2N5A A;  2OAD A;  3TCO A;  5F05 A;  2BTO T;  1AQW A;  1OC9 B;  2H1D A;  2LQO A;  3HVS A;  1C72 A;  2AHE A;  4XS4 B;  1E2Y A;  1DSB A;  3MAK A;  5GSS A;  2VIM A;  1M3J A;  5CRD A;  1T3B A;  2YV7 A;  4RI7 A;  4TR3 A;  1GSY A;  3F4S A;  2K9F A;  2QA2 A;  3HVX A;  2EC4 A;  3I6A A;  3CSJ A;  4GF0 A;  5DAK A;  4TR1 A;  2PVO C;  2E0Q A;  2CV4 A;  1M99 A;  1RQM A;  2MMN A;  3TRX A;  3PR8 A;  4IN0 A;  5KEJ A;  2H19 A;  4NV2 A;  3ZIJ A;  4PNG A;  4USS A;  3C7M A;  2DLX A;  1X5C A;  3GHA A;  4V1A g;  3VI7 A;  3FYG A;  3IRA A;  2O87 A;  4H86 A;  1GWC A;  1I9D A;  3CMI A;  1R7H A;  2CVB A;  3TJG A;  3F6D A;  1PSQ A;  3LWA A;  2H66 A;  3R3E A;  4HZ2 A;  3GYK A;  1YZX A;  2FUG 2;  1BAY A;  1SKW B;  3UVT A;  4JED A;  5D9V A;  1GSQ A;  2YV9 A;  4ML1 A;  2X8H A;  3HJO A;  2HZF A;  1M3I A;  1PRX A;  2DIY A;  4YQM A;  2C0E A;  4IJ3 A;  3WYW A;  1TDI A;  4CW9 A;  3VWX A;  4O5Q A;  5DBQ A;  3VPQ A;  2C3Q A;  2J9H A;  2PGT A;  4DSR A;  4KGI A;  4G10 A;  1NM3 A;  1U6T A;  9GSS A;  3FRC A;  1V58 A;  4XS6 A;  1A0F A;  1GH2 A;  1R26 A;  3JCM L;  2JZS A;  3UVH A;  2HZE A;  2CVK A;  3QAV A;  2LJR A;  3ZL5 A;  3GX0 A;  3OR5 A;  1TK5 B;  5CNW A;  5HR1 A;  3BBY A;  4QL9 A;  2GZZ A;  4MJB A;  1YEX A;  1Q98 A;  5C00 A;  5A4V A;  5IO2 A;  3APQ A;  1SYX A;  2PN8 A;  2R6K A;  5HFK A;  2GQK A;  4V2L A;  1ZYN A;  4OCE A;  1OYJ A;  1ZL9 A;  1X5E A;  1A8Y A;  1J08 A;  4KX4 A;  5H5R A;  2N5B A;  4WF4 A;  2H8L A;  1PN0 A;  2WUL A;  4ZIJ A;  1GUH A;  2R0C A;  3FZ9 A;  2OA7 A;  3P2A A;  4X0X A;  4LMV A;  3J7Y k;  3ZFB A;  2B5Y A;  2YNX A;  2GVP A;  2ZUP A;  2R0P A;  2DML A;  3UBL A;  1WMJ A;  2TIR A;  3EC3 A;  4KND A;  4GCI A;  3E9J B;  3ZZX A;  4MJE A;  4KE3 A;  2I81 A;  1A2L A;  3EPT A;  4JE1 A;  1K3O A;  2VL9 A;  3GUS A;  1YF1 A;  1F2E A;  4X4J A;  2WZ9 A;  4KSO A;  1AIU A;  2YJ7 A;  5B8A A;  2JAC A;  4WEY A;  2ZNM A;  1T4Y A;  2H70 A;  3QAW A;  3VWU A;  4TXO A;  4BWQ A;  2VL3 A;  3IR4 A;  2NDO A;  2OBK A;  5CRH A;  5GAN D;  4YKG A;  2AV4 A;  1JLW A;  4MP4 A;  2WGR A;  2R37 A;  1MTC A;  3FR6 A;  2YWN A;  5FHI A;  4EL1 A;  2VOC A;  2FGX A;  2QA1 A;  4POL A;  1TP9 A;  1G7O A;  2PBJ A;  3DXB A;  5KN3 A;  2LS5 A;  4G2E A;  4N30 A;  5IMZ A;  4HU7 A;  3PGT A;  3UMA A;  2IIY A;  3GFK A;  1CQH A;  2G0F A;  2JAD A;  4G0I A;  1V57 A;  3GL3 A;  1ML6 A;  1XPV A;  2JSZ A;  3VI5 A;  2CA8 A;  2GZY A;  4MMM A;  1Y6E A; 
#chains in the Genus database with same CATH homology
 2OE3 A;  4G19 A;  4I2U A;  17GS A;  4TR0 A;  4YQU A;  1PQN A;  5ECS A;  2VCX A;  5GAP D;  1GLQ A;  3ISO A;  2ALB A;  1T00 A;  4OD7 A;  2C3T A;  1T4Z A;  4E8H A;  5INY A;  2NVL A;  2B7K A;  5G31 A;  1GUK A;  1QQ2 A;  1K3Y A;  5D9X A;  3VLN A;  4MPG A;  4CHS A;  3TKR A;  1HNB A;  2DMM A;  1F37 A;  1WJK A;  4RUV A;  3KP8 A;  2HRK A;  2IWT A;  4K7N A;  1B4P A;  6GSU A;  2P5Q A;  4Q5F A;  4F2I A;  3GV1 A;  4XCS A;  1ERV A;  4WR5 A;  4WXT A;  1MDJ A;  4WBR D;  1ZYP A;  2IN3 A;  4OFN A;  4K7I A;  4AJ7 A;  1TK8 B;  1G6W A;  1YF0 A;  1F3B A;  2EIQ A;  4GQC A;  1PD2 1;  2H30 A;  2DJ1 A;  4POM A;  4JR4 A;  1B9X C;  4DSS B;  3KP9 A;  2VM1 A;  3ZIT A;  3IV4 A;  1K0M A;  4G0L A;  5KOW A;  3DVX A;  4GSS A;  3CRT A;  1PGT A;  4OFM A;  2A2S A;  3LXZ A;  5D9W A;  2CZ3 A;  3BD2 A;  1QXH A;  1XWA A;  2VCV A;  2I9H A;  2HRF A;  4HUA A;  4YH2 A;  4ACS A;  1GP1 A;  1THX A;  4GSN A;  4EE0 A;  4MJC A;  5C04 A;  1AXD A;  4A5P A;  1GTA A;  5G2Z A;  1QFN A;  1WP0 A;  4BPY A;  5ECH B;  4MF7 A;  3DWV A;  3M9J A;  3BCK A;  2QGV A;  3GA4 A;  3KJY A;  5HFG A;  5D8I A;  1CQG A;  1PX6 A;  4EDY A;  1W4V A;  4BWS A;  1DE1 A;  5AN1 A;  3TKS C;  2WDU A;  1XW6 A;  4FYC A;  1GTU A;  11GS A;  4N0Z A;  2K8V A;  1Z3E A;  3IC8 A;  1JZW A;  2CX4 A;  4K2D A;  2X8C A;  1PKZ A;  2VCZ A;  3HZ8 A;  3HJP A;  2C0G A;  4CY8 A;  3QAG A;  5CRE A;  3U5R E;  4MF5 A;  3TJB A;  3G7Y A;  4Z2U A;  1GLP A;  1SK1 A;  2YZH A;  2IMK A;  3UIW A;  2P0G A;  4PQH A;  3WGX A;  2HLS A;  1V2A A;  4I5Q A;  2EIR A;  4RQR A;  2H1G A;  4K5S A;  2L6D A;  4JRR A;  18GS A;  1XVW A;  2X4A A;  1EV4 A;  1LJR A;  1J0F A;  4KAE A;  2B1K A;  4OO5 A;  1YKC A;  5KOX A;  3U6V A;  3TJK A;  4CDO A;  1TRW A;  1MEK A;  1XXU A;  5J41 A;  5ECN B;  4BVX B;  3C8E A;  4ILF A;  1VRS D;  4GQF A;  1SL1 B;  3UEM A;  1WPI A;  1BJX A;  3EU4 A;  3TKS A;  3F8U A;  1U87 A;  2JZR A;  3TRQ A;  3RBT A;  3KTB A;  4HEA 2;  3LXT A;  2YJH A;  3NIV A;  1NSW A;  4Q5R A;  3KH9 A;  2V6K A;  3IHG A;  3UAR A;  2IMD A;  2KUC A;  3VK9 A;  1U88 A;  2MMZ A;  5BRT A;  1N2A A;  3GTU A;  2DC5 A;  4IBP A;  2FA8 A;  2E7P A;  4Q5N A;  2CAI A;  1XW5 A;  3TB2 A;  1M2B A;  1AW9 A;  2VCQ A;  4KDU A;  5H5S A;  1T1V A;  5HR0 A;  1DBY A;  1JHB A;  2QC7 A;  1SJI A;  3C1R A;  4K2X A;  4IP1 A;  2RUF A;  2E2G A;  1VF4 A;  4ZBD A;  1ZYE A;  4ISD A;  1FOH A;  4TXV A;  4V2N A;  1O73 A;  2ON7 A;  4FYB A;  13GS A;  2PER A;  1BQ7 A;  4IVF A;  1XBS A;  1SKS B;  4TOP A;  2B5E A;  1QGV A;  5DDL A;  3GNJ A;  1EP8 A;  2NTO A;  4F82 A;  4ZL9 A;  4HS1 A;  3ZRD A;  4AGS A;  1ST9 A;  2JL4 A;  2MMA A;  4MZW A;  3LG6 A;  4PUR A;  3FZ4 A;  4IS0 A;  5B7C A;  5G5F A;  2H73 A;  2R3X A;  2DBC A;  4LMW A;  3VWW A;  2GSR A;  4LL4 B;  2HT9 A;  3PPU A;  2CVD A;  1KBN A;  2LJK A;  3QDN A;  1BG5 A;  2KOK A;  5DCH A;  2VCW A;  3GIX A;  3ERG A;  4PGT A;  2FA4 A;  5L71 A;  1M2D A;  1XVQ A;  4EXJ A;  1OKD A;  4NHW A;  3UAP A;  1TJD A;  2GGT A;  5IIZ A;  4N11 A;  5JCG A;  3LYP A;  4KSM A;  5DJM A;  4XTS A;  2G2Q A;  2HRN A;  1LU4 A;  5FT3 A;  2J23 A;  3QOU A;  3Q74 A;  3M9K A;  4MAB A;  3CRU A;  4DSS A;  5IMD A;  1X5D A;  4IEL A;  5JCW A;  3FMW A;  5IPG A;  4PNF A;  2HNL A;  2A2R A;  4IGJ A;  3FR9 A;  3L78 A;  2K18 A;  3MSZ A;  1VF2 A;  2L5L A;  14GS A;  4ID0 A;  3FZ5 A;  2K8S A;  4JZQ A;  2ES7 A;  4YQV A;  1H75 A;  2VD1 A;  1GSF A;  3DVW A;  3CXG A;  2JU5 A;  1FVJ A;  1FAA A;  1SD8 A;  2LQQ A;  2OJL A;  1F3A A;  3KEB A;  4BL7 B;  2DJJ A;  4RI6 A;  5GST A;  2GQL A;  4MPF A;  5IOW A;  2C8U A;  4QQ7 A;  4V1A p;  1OC8 A;  3DGQ A;  3N9J A;  4TRX A;  3FEU A;  4HJ2 A;  5EVO A;  2LTK A;  2L57 A;  1YDK A;  4GWR A;  4FIW A;  4ZB8 A;  1TW9 A;  2HSH A;  4WET A;  4L5L A;  1SJ6 A;  4GXZ A;  2RM5 A;  3IAM 2;  4J57 E;  3A5W A;  5EL8 A;  1NW2 A;  3D6I A;  4PX1 A;  2LRC A;  1HD2 A;  4FQU A;  2GTU A;  1TTZ A;  3DRN A;  1XIY A;  3VFI A;  1XWC A;  3H93 A;  1GSE A;  2BMX A;  3O76 A;  2H72 A;  19GS A;  1SEN A;  3FR3 A;  1R5P A;  3NOF A;  4N0V A;  1Z5Y E;  1Z6M A;  2FWH A;  1AQX A;  3DIE A;  3W8S A;  5KN1 A;  3ME8 A;  5J9C A;  5DAL B;  2V32 A;  2DSA A;  4KW6 A;  1ZYQ B;  2XBQ A;  2X99 A;  2AUV A;  4FO5 A;  4HQS A;  4NPB A;  4BVX A;  4TN8 A;  1A8L A;  3EIN A;  3KH7 A;  1N8J A;  1NHO A;  5ECI B;  2IJY A;  3LEF A;  5H5Q A;  2H0I A;  4KCE A;  2DKI A;  2A2P A;  3MDK A;  1WE0 A;  2IL3 A;  5GZZ B;  4DSQ A;  1O6J A;  3HJM A;  4F0B A;  4XHM A;  4EO3 A;  5BMU A;  1EOH A;  3I69 A;  5IO0 A;  2MYG A;  3D4M A;  2M80 A;  3TKP A;  2DJ2 A;  5JCU A;  2F9S A;  2VLV A;  3D22 A;  1GTB A;  3D21 A;  2JZT A;  2LEG A;  4QL7 A;  4GRF A;  1S3C A;  1Z7P A;  5IOX A;  1OKT A;  2YP6 A;  3F6F A;  2YAN A;  4ZXG A;  2C0D A;  4EUY A;  3O6T A;  4I97 A;  1B4Q A;  2O8V B;  4MLY A;  1O8W A;  2HYX A;  2WJU A;  2F8F A;  2MBT A;  3L9U A;  3TOT A;  1A2J A;  1R5A A;  4OO4 A;  3LSZ A;  1WOU A;  4O5U A;  4DEJ A;  5KN0 A;  3MIX A;  2GT6 A;  2R5G A;  4F9Z A;  5G1L A;  4EIQ A;  2FWE A;  1XOB A;  2GQM A;  3HXS A;  1EEM A;  3QR6 A;  4EVM A;  2C0F A;  2CT6 A;  4ECI A;  3ZMK A;  1Q4J A;  2B7J A;  3GRX A;  3F3R A;  2UZ8 A;  5J5N A;  3GMF A;  5ECL B;  1JZR A;  3TJF A;  1AUC A;  2M72 A;  3TGZ A;  4NXI A;  2HSY A;  2DJ0 A;  1OC9 A;  16GS A;  4ICY A;  4XS4 A;  2WRT A;  3IPZ A;  1Z6N A;  3UBK A;  1S3A A;  4TR1 B;  3LQ7 A;  4XRD A;  1FB0 A;  3L4N A;  5JWO B;  3GSS A;  2PMT A;  1O8X A;  2C80 A;  4K6X A;  3O3T A;  1B48 A;  2X49 A;  1GUM A;  4IQ1 A;  2VAF A;  5DQS A;  4FH8 A;  4K0N A;  5CRW A;  3IAS 2;  4F0C A;  4WBJ A;  4N10 A;  1KNG A;  2KP2 A;  1B9Y C;  2NPB A;  4J2F A;  1MD4 A;  22GS A;  1DUG A;  5IMF A;  1OAZ A;  2LV3 A;  4X43 A;  5D93 A;  3F4T A;  4ECB A;  2N5F A;  2VLU A;  4TW5 A;  3D4T A;  2GSQ A;  5COH A;  1V9W A;  5B6N A;  2XC2 A;  1X9W B;  4MA9 A;  4AJ6 A;  4L0W A;  3I43 A;  4MDC A;  2AB6 A;  4Q5Q A;  4ECC A;  4K0G A;  3KZQ A;  4OFT A;  2O7K A;  5JWQ B;  4YKF A;  4XRA A;  3HZ4 A;  4G9H A;  2WB9 A;  2LRN A;  4HU9 A;  4Z2T A;  5B6M A;  3KTL A;  1GTI A;  1DE2 A;  3KD0 A;  4E8E A;  2GT5 A;  3R2Q A;  1OVN A;  1W89 A;  1XWK A;  3BOA A;  3IHQ A;  4POB A;  4BL7 A;  3QD9 A;  1K0D A;  1VGL A;  3FKF A;  4K1F A;  3RDW A;  1FW1 A;  2CX3 A;  1XOA A;  1LBK A;  3P7X A;  1AC1 A;  2B6M A;  3KIJ A;  2R4V A;  2YWO A;  1M0U A;  2RM6 A;  1EOG A;  2YCD A;  5LD0 A;  5ECR B;  3V1W A;  1ERW A;  3APS A;  1YEP A;  5AIX A;  3ZVJ A;  2H1A A;  4NAX A;  1HNA A;  1GRX A;  1YKA A;  5HFI A;  1K0C A;  3CYN A;  5ENU A;  4HQZ A;  1VF3 A;  3KGK A;  5KN2 A;  3SWL A;  1SK2 A;  2I1U A;  3EU3 A;  1K0B A;  5F07 A;  1S3D A;  2QKE A;  3M8N A;  5F06 A;  2ON5 A;  6GSX A;  2X8G A;  3GL5 A;  2VL2 A;  2WCI A;  4YAP A;  1HQO A;  3HYP A;  1SYR A;  5ELG A;  3WD6 A;  4PXO A;  1X0R A;  2YZU A;  3PIN A;  2R0G A;  2YPM A;  4MNN A;  1BED A;  5F0G A;  1TU8 A;  2P31 A;  3F63 A;  7GSS A;  3QPM A;  5FWG A;  3FHK A;  4MH3 A;  3US3 A;  1SL2 B;  1K0N A;  2PPT A;  2KLX A;  4L5O A;  4I8B A;  4IP6 A;  2FY6 A;  3IXR A;  1SKR B;  1K0A A;  4ZL8 A;  8GSS A;  4AF2 A;  3CTG A;  5IPH A;  2XPD A;  1RW1 A;  2P5R A;  2HE3 A;  2CQ9 A;  2DKH A;  3FZA A;  3GX8 A;  3H4K A;  1TRU A;  2XHF A;  5D9T A;  3DEX A;  4NMU A;  2GS3 A;  2YWI A;  1PKW A;  3GUR A;  1O85 A;  3L0H A;  2M46 A;  1Z7R A;  2PVQ A;  3HKR A;  12GS A;  3TDG A;  2Z9S A;  4YAV A;  2RII A;  4LA1 A;  4BA7 A;  1HNC A;  1J9B A;  1M2A A;  4BVY B;  3HCZ A;  2R2J A;  4TR4 A;  1GSD A;  5E4W A;  2HFD A;  3N5O A;  3IE3 A;  3ERW A;  2H75 A;  1R4W A;  4MZB A;  3F4R A;  5IM9 A;  3A2X A;  2B1L A;  1MD3 A;  2OE1 A;  3IC4 A;  1GNW A;  5IMA A;  1A2M A;  5D73 A;  3LFL A;  1UA5 A;  1SL0 B;  2HI7 A;  3TKQ A;  20GS A;  2A4V A;  2IPA A;  4DVC A;  6GSW A;  2FCH A;  1MDK A;  2FWF A;  2GSS A;  3DYR A;  3J7Y b;  1KEB A;  2DIZ A;  3VWV A;  2WS2 A;  2F51 A;  5D96 A;  3HD5 A;  4K8M A;  1M9B A;  2K6V A;  3S9F A;  1A23 A;  3AY8 A;  2LST A;  3E3E A;  3ED3 A;  4K9Z A;  3MYD A;  4CY6 A;  5JWR B;  2RLI A;  3H8Q A;  2C1Y A;  3F9U A;  3IOS A;  3A3T A;  4OWY A;  2HSM A;  1USB A;  1ZOF A;  2IMF A;  3KM6 A;  4EC0 A;  1UN2 A;  2GZP A;  5HR3 A;  1ZCP A;  4O32 A;  2DJK A;  4PQI A;  3L9S A;  3CSI A;  4IJI A;  3H79 A;  2YN1 A;  3HY2 A;  5A4W A;  2VUP A;  4WKW A;  1G0T A;  5F8B A;  3DML A;  4ZBB A;  1O81 A;  1PMT A;  1Z9H A;  4MK3 A;  4KDX A;  3TRP A;  4P3Y B;  5G5E A;  6GSS A;  2H6Z A;  5ELA A;  1X9S B;  2H6Y A;  5HR2 A;  4D73 B;  3CBU A;  1KTE A;  3IBH A;  3M1G A;  3RHB A;  2I4A A;  1F6M C;  3Q18 A;  3TKS E;  3WT2 A;  2D2Z A;  2TRX A;  1TRS A;  3BJ5 A;  2OE0 A;  5CYY A;  2PUK C;  4HOJ A;  2JSY A;  4I6X A;  5ECK B;  1ZZY A;  4EF0 A;  1AAZ A;  1PX7 A;  5G30 A;  1FHE A;  1GSS A;  4L8E A;  4TVE A;  2YWM A;  1PA3 A;  2ZCT A;  3RAZ A;  1H4O A;  1V40 A;  2H6X A;  3KCM A;  1JLV A;  2H76 A;  5IMC A;  3C73 A;  1ERT A;  2H0G A;  4XS1 A;  4GTU A;  1TXX A;  3EMP A;  3IK9 A;  4JBB A;  2AJQ B;  3Q6O A;  3CSH A;  2DJ3 A;  3ZLP A;  6GSV A;  3IK7 A;  4ZB9 A;  4TKY A;  5EY6 A;  2LKU A;  3GKN A;  1PL2 A;  2B3S A;  1SD9 A;  1YJ6 A;  3LOR A;  3L9V A;  5CRG A;  6GSY A;  1IYH A;  4O7H A;  4K5R A;  4IW9 A;  4K7O A;  5G1K A;  3F3Q A;  5ID2 B;  2C3N A;  2AYT A;  4RQX A;  1V98 A;  4O5R A;  3GH9 A;  1NHY A;  1U3I A;  2FD3 A;  3P8W A;  4J56 E;  2VM2 A;  4FYU A;  4XIH A;  2QSI A;  3D0Z A;  3GN3 A;  4JR6 A;  4OCF A;  2B5X A;  4PUF C;  2L6C A;  1XWG A;  1IYI A;  4EIP A;  3M3M A;  3WT1 A;  2YOI A;  1EV9 A;  1K0O A;  3IA1 A;  2NBS A;  2MZC A;  4PUA A;  4PQ1 A;  5CP1 A;  4OMV A;  2REM A;  1TKD B;  4O92 A;  1JZD A;  3GTU B;  3QMX A;  2KHP A;  1RK4 A;  3P90 A;  3GKX A;  5B8B A;  3GH6 A;  1FOV A;  1X9M B;  3HHV A;  2AAW A;  4MH2 A;  4AJ8 A;  1Y25 A;  1YY7 A;  1WRY A;  5DVB A;  2I3Y A;  5A5K A;  3EYT A;  3IDV A;  1SK0 A;  4ZL7 A;  3PH9 A;  3I9V 2;  3MNG A;  2MBS A;  3ERF A;  4F03 A;  4HI7 A;  1URM A;  4IKH A;  1TK0 B;  3H1N A;  2KP1 A;  2CZ2 A;  4KA0 A;  5DJL A;  3VPT A;  2IFQ B;  2V41 A;  3KXO A;  1F9M A;  5DCG A;  4BVY A;  1GUL A;  1WIK A;  3D5J A;  1SU9 A;  5J4U A;  3A5I A;  5J9B A;  3Q19 A;  1EEJ A;  4KCA A;  4WR4 A;  4Z7X A;  4GLT A;  5AGY A;  1U3A A;  4MCU A;  3CTF A;  2A4H A;  4ZIL A;  2FNO A;  5ECO B;  2E2M A;  1WWJ A;  5ECM B;  4ZBA A;  4ECJ A;  3FY7 A;  4ML6 A;  5DAK B;  3QCP A;  3G9B A;  1MDI A;  1XWB A;  4HDE A;  3F0I A;  3GKM A;  1ZMA A;  4NHZ A;  1AQV A;  3A2V A;  3EMX A;  2V6O A;  4MJA A;  1PN9 A;  5E59 A;  3WGE A;  3KMN A;  4MZC A;  5ECP B;  1QMV A;  3E0U A;  3RPN A;  3MWH A;  4L0U A;  1FO5 A;  1EGR A;  4EKZ A;  3WGD A;  2TRC P;  2FLS A;  1TI3 A;  3KMO A;  5EPF A;  3TJJ A;  2OKA A;  5LCZ A;  1JZO A;  2PU9 C;  4HZ4 A;  1VF1 A;  2LJA A;  1ILO A;  4JU5 A;  2XBI A;  4Z2R A;  2O89 A;  3UOM A;  3SBC A;  1GL8 A;  2VL2 C;  6GST A;  4KUN A;  4NV5 A;  3TUE A;  1O7U A;  5AIS A;  4GST A;  2F8A A;  1XFL A;  5DQY A;  1M9A A;  3ZIV A;  4IHU A;  2HZE B;  3NZN A;  3ME7 A;  1GNE A;  2L4Q A;  2L5O A;  1EWX A;  4KH7 A;  2CAQ A;  4D73 A;  1E6B A;  4ZB6 A;  3EWL A;  2H74 A;  3ZVJ D;  2X64 A;  5IMV A;  2H71 A;  2F3M A;  2HXK A;  4LLR A;  1GSU A;  2VO4 A;  2IME A;  2H01 A;  3QFB C;  2HRA A;  4I2T A;  1ACV A;  3RHC A;  2FWG A;  2LNS A;  4V2M A;  2H0H A;  5ECQ B;  2GST A;  3EVI A;  1T7P B;  4KDY A;  1G6Y A;  1TI1 A;  3W6G A;  2V1M A;  1T8E B;  1A24 A;  2C4J A;  2BJX A;  1PL1 A;  2LNT A;  3ZML A;  1HYU A;  1ERU A;  4IQA A;  4G0K A;  3G7J A;  1FG4 A;  1XW9 A;  2MMO A;  4ULX A;  1FVK A;  3K8N A;  2H1B A;  1TOF A;  2XPE A;  4POK A;  3VUR A;  4HJM A;  3UL3 A;  1BYE A;  2PWJ A;  3BCI A;  3FW2 A;  3RPP A;  4X1U A;  5DAL A;  2LRT A;  3ZYW A;  1OE8 A;  1YQ1 A;  3DKS A;  3ZTL A;  1TRV A;  1UVZ A;  4PTS A;  3HA9 A;  3LYK A;  3C1S A;  3LW9 A;  5ID2 A;  1I5G A;  3A2W A;  1EGO A;  2L4C A;  2L59 A;  2WFC A;  3TOU A;  2VD0 A;  3DD3 A;  2IMI A;  3QFA C;  1G7E A;  1FB6 A;  3HVV A;  2EIO A;  5A4U A;  1EZK A;  4TXO B;  3APO A;  1B8X A;  4NWY A;  1OE7 A;  1ABA A;  2FHE A;  3C71 A;  3LJR A;  10GS A;  4MF6 A;  5IQY A;  1JFU A;  3EE2 A;  4WF5 A;  1ON4 A;  4KB3 A;  5ABR A;  5LNK e;  2VLT A;  2LUS A;  2OAC A;  5HQP A;  3ZRE A;  3GST A;  1THO A;  4EDZ A;  3FK8 A;  2GDR A;  5CAX A;  1OC3 A;  1K3L A;  3GKK A;  1UC7 A;  3W8J A;  4KF9 A;  3LGC A;  4LL1 B;  3UJ1 A;  3EUR A;  1A0R P;  2GLR A;  5AIV A;  1M7T A;  3HDC A;  3M0F A;  1BX9 A;  3ZFL A;  1XZO A;  2O85 A;  1QK8 A;  1TU7 A;  2IFQ A;  2VCT A;  2RUE A;  5J3R A;  1QUW A;  1ZGN A;  2V2G A;  1XCC A;  3G7I A;  1EP7 A;  2OBI A;  1SJZ A;  5CO3 A;  2N5A A;  2OAD A;  3TCO A;  5F05 A;  2BTO T;  1AQW A;  1OC9 B;  2H1D A;  2LQO A;  3HVS A;  1C72 A;  2AHE A;  4XS4 B;  1E2Y A;  1DSB A;  3MAK A;  5GSS A;  2VIM A;  5CRD A;  1T3B A;  2YV7 A;  4RI7 A;  4TR3 A;  1GSY A;  3F4S A;  2K9F A;  2QA2 A;  3HVX A;  2EC4 A;  3I6A A;  3CSJ A;  4GF0 A;  5DAK A;  4TR1 A;  2PVO C;  2E0Q A;  2CV4 A;  1M99 A;  1RQM A;  2MMN A;  3TRX A;  3PR8 A;  4IN0 A;  5KEJ A;  2H19 A;  4NV2 A;  3ZIJ A;  4PNG A;  4USS A;  3C7M A;  2DLX A;  1X5C A;  3GHA A;  4V1A g;  3VI7 A;  3FYG A;  3IRA A;  2O87 A;  4H86 A;  1GWC A;  1I9D A;  3CMI A;  1R7H A;  2CVB A;  3TJG A;  3F6D A;  1PSQ A;  3LWA A;  2H66 A;  3R3E A;  4HZ2 A;  3GYK A;  1YZX A;  2FUG 2;  1BAY A;  1SKW B;  3UVT A;  4JED A;  5D9V A;  1GSQ A;  2YV9 A;  4ML1 A;  2X8H A;  3HJO A;  2HZF A;  4YQM A;  1PRX A;  2DIY A;  2C0E A;  4IJ3 A;  3WYW A;  1TDI A;  4CW9 A;  3VWX A;  4O5Q A;  5DBQ A;  3VPQ A;  2C3Q A;  2J9H A;  2PGT A;  4DSR A;  4KGI A;  4G10 A;  1NM3 A;  1U6T A;  9GSS A;  3FRC A;  1V58 A;  4XS6 A;  1A0F A;  1GH2 A;  1R26 A;  3JCM L;  2JZS A;  3UVH A;  2HZE A;  2CVK A;  3QAV A;  2LJR A;  3ZL5 A;  3GX0 A;  3OR5 A;  1TK5 B;  5CNW A;  5HR1 A;  3BBY A;  4QL9 A;  2GZZ A;  4MJB A;  1YEX A;  1Q98 A;  5C00 A;  5A4V A;  5IO2 A;  3APQ A;  1SYX A;  2PN8 A;  2R6K A;  5HFK A;  2GQK A;  4V2L A;  1ZYN A;  4OCE A;  1OYJ A;  1ZL9 A;  1X5E A;  1A8Y A;  1J08 A;  4KX4 A;  5H5R A;  2N5B A;  4WF4 A;  2H8L A;  1PN0 A;  2WUL A;  4ZIJ A;  1GUH A;  2R0C A;  3FZ9 A;  2OA7 A;  3P2A A;  4X0X A;  4LMV A;  3J7Y k;  3ZFB A;  2B5Y A;  2YNX A;  2GVP A;  2ZUP A;  2R0P A;  2DML A;  3UBL A;  1WMJ A;  2TIR A;  3EC3 A;  4KND A;  4GCI A;  3E9J B;  3ZZX A;  4MJE A;  4KE3 A;  2I81 A;  1A2L A;  3EPT A;  4JE1 A;  1K3O A;  2VL9 A;  3GUS A;  1YF1 A;  1F2E A;  4X4J A;  2WZ9 A;  4KSO A;  1AIU A;  2YJ7 A;  5B8A A;  2JAC A;  4WEY A;  2ZNM A;  1T4Y A;  2H70 A;  3QAW A;  3VWU A;  4TXO A;  4BWQ A;  2VL3 A;  3IR4 A;  2NDO A;  2OBK A;  5CRH A;  5GAN D;  4YKG A;  2AV4 A;  1JLW A;  4MP4 A;  2WGR A;  2R37 A;  1MTC A;  3FR6 A;  2YWN A;  5FHI A;  4EL1 A;  2VOC A;  2FGX A;  2QA1 A;  4POL A;  1TP9 A;  1G7O A;  2PBJ A;  3DXB A;  5KN3 A;  2LS5 A;  4G2E A;  4N30 A;  5IMZ A;  4HU7 A;  3PGT A;  3UMA A;  2IIY A;  3GFK A;  1CQH A;  2G0F A;  2JAD A;  4G0I A;  1V57 A;  3GL3 A;  1ML6 A;  1XPV A;  2JSZ A;  3VI5 A;  2CA8 A;  2GZY A;  4MMM A;  1Y6E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...