1GL8A

Solution structure of thioredoxin m from spinach, oxidized form
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
104
structure length
104
Chain Sequence
VQDVNDSSWKEFVLESEVPVMVDFWAPWCGPCKLIAPVIDELAKEYSGKIAVYKLNTDEAPGIATQYNIRSIPTVLFFKNGERKESIIGAVPKSTLTDSIEKYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords THIOREDOXIN
publication title Three-Dimensional Solution Structure and Stability of Thioredoxin M from Spinach.
pubmed doi rcsb
source organism Spinacia oleracea
total genus 26
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2001-08-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1gl8A00
2EC4A 1GSSA 2O87A 2X8CA 2FWGA 2OE1A 3D4TA 3J7Yk 2GGTA 7GSSA 4OO5A 1M9BA 1BX9A 4BA7A 2H6ZA 5D9TA 1X9MB 1JZWA 2HLSA 3GMFA 4MZBA 1F6MC 4F0BA 4GQFA 2YCDA 4YQVA 3G7IA 2OJLA 4AF2A 2IL3A 5KN0A 2HYXA 9GSSA 4LL4B 4MK3A 4ZBBA 2V6KA 2J9HA 2YJ7A 1G0TA 1GNEA 1TXXA 1T3BA 3ZVJA 4TVEA 5IMCA 5DALB 3ZLPA 3DEXA 1M2AA 1ABAA 2VLUA 5FT3A 2B1KA 2CT6A 3F4RA 2RUFA 1N8JA 3WT1A 6GSVA 5DALA 4NHZA 3ZFBA 1USBA 1UA5A 4N11A 3TKSA 5ECIB 3U6VA 4EDZA 1TP9A 3RDWA 4EXJA 4HEA2 4KH7A 1QFNA 5CAXA 2N5AA 3TCOA 1YF1A 3ERWA 2RUEA 3DMLA 3S9FA 1KNGA 3C1SA 4X43A 1VF3A 3IAM2 3M1GA 3GH9A 4XHMA 5IMFA 5G5FA 3W8JA 1OC9B 2RIIA 4G10A 1XVQA 2YWMA 3KTLA 3LGCA 4OCEA 3FZ5A 5GSSA 1GSYA 2MYGA 1JFUA 3RPNA 1OVNA 1OC9A 4WF4A 2JU5A 3H93A 3IAS2 2H0IA 2VM2A 2GSRA 2ZUPA 3D6IA 2E0QA 1DUGA 1G6WA 2CX4A 3CTFA 5CRDA 2VCZA 22GSA 2K6VA 3CSIA 1Z5YE 3KMOA 4Z7XA 1B8XA 11GSA 2I3YA 2XBQA 2JZSA 4TR3A 3APOA 1HD2A 1ZZYA 2MBTA 3P7XA 1I9DA 4PURA 1XVWA 1V40A 4G9HA 1X9SB 1TU8A 2H76A 2KOKA 1THOA 2LKUA 1GTUA 2XBIA 5H5RA 3PH9A 1EEJA 5JWRB 3F8UA 4JBBA 5FWGA 3RHBA 5DBQA 3IV4A 4ECIA 2XC2A 5A4WA 3TRPA 3ZYWA 5J41A 3C8EA 4WXTA 1NM3A 3ED3A 4ID0A 1GUMA 1FB6A 1GWCA 4YQMA 5EY6A 3HHVA 1K0OA 3FY7A 4N10A 2WRTA 3GX8A 12GSA 3ME8A 3IC4A 2AAWA 5DDLA 1R7HA 4L0WA 1K0BA 3VPTA 4L8EA 1X5DA 2V41A 3GNJA 1UC7A 1TRVA 4MJCA 3M9JA 4KNDA 1K0MA 1MDJA 2FUG2 5FHIA 5G5EA 5ID2B 1JZOA 5COHA 2TIRA 2B5XA 1A8YA 14GSA 2DMMA 2VO4A 3FW2A 3G9BA 2C3NA 5CYYA 2XHFA 3QR6A 1LJRA 5ID2A 3V1WA 2PVQA 4I2UA 3ZMKA 16GSA 1C72A 1EZKA 1SJZA 5IMZA 4ECJA 4IJ3A 4DSSB 1B9XC 1G6YA 1SJIA 5GZZB 3EYTA 5A4VA 1TI1A 5AGYA 2F8FA 2R4VA 1QQ2A 5A5KA 1SD9A 4DSSA 3BCIA 3KCMA 4ZB6A 2VM1A 4PQIA 3FR6A 4NMUA 1HNBA 1NHYA 4Q5NA 3GSTA 4NHWA 4IVFA 2FLSA 3L9UA 3WGDA 2AV4A 2EIRA 2C0FA 1XWKA 1GUKA 3EC3A 1AXDA 3KD0A 2E2GA 4KW6A 5CP1A 5CNWA 4ECCA 4WEYA 3EINA 5F05A 1M99A 4JE1A 3TOUA 1JLWA 4HS1A 1OC8A 3WD6A 2IMDA 3ME7A 1MD3A 2WB9A 4MA9A 3GKXA 2H75A 3LXTA 3WT2A 4MMMA 5L71A 4KDUA 3LQ7A 4I97A 4IP6A 2C3TA 4O7HA 3DWVA 3IPZA 2C80A 3EVIA 2AUVA 2IMFA 3H1NA 1FAAA 5DJLA 1K3LA 2OKAA 3KZQA 5HR2A 1GUHA 3HDCA 3TB2A 2E7PA 3KH7A 3VWXA 1OKTA 1A2MA 4YH2A 1ERVA 3LWAA 4FYBA 3UJ1A 4AGSA 3GKNA 1SK0A 1BYEA 2WDUA 4V2NA 1XWCA 2TRCP 1MDIA 3VLNA 4KAEA 2GZPA 2QC7A 4LL1B 2YNXA 4GQCA 5IMVA 2AJQB 3EU3A 2PWJA 1S3DA 4I2TA 2REMA 4K9ZA 3Q74A 2OBKA 3DGQA 1KTEA 3ZITA 2RLIA 1Q4JA 2K18A 2QGVA 4QL7A 1WP0A 3MDKA 4NXIA 1YJ6A 3ERFA 13GSA 5INYA 3HJMA 2L4CA 3KEBA 2DJ2A 4OMVA 1Z6MA 3A5WA 2CVBA 5D93A 1EP7A 2YZUA 2WJUA 4BVYA 2A2RA 2I81A 2KUCA 4I6XA 1GTBA 5CRGA 4TN8A 2BJXA 1GSDA 2NPBA 5ECSA 4O32A 1EWXA 5EL8A 3IE3A 2VIMA 2GVPA 3LORA 3KGKA 3UIWA 1T4YA 4Q5QA 1GRXA 2LJRA 5CRHA 2GQLA 1PD21 5JCGA 5HQPA 3IK7A 4KSOA 2VL9A 4JU5A 3GA4A 4HI7A 4EL1A 3DVXA 3MNGA 2DIYA 1NHOA 5KN1A 4KDXA 2P0GA 1CQGA 4F0CA 1TK8B 1BAYA 5DCGA 2XPEA 17GSA 4N0ZA 1M7TA 3BOAA 2FA4A 2YJHA 4XIHA 2M46A 4PXOA 3R2QA 4ZXGA 4OD7A 4MH3A 5JCWA 10GSA 4JRRA 3FZ9A 2AHEA 3F4TA 3MWHA 5AISA 4TRXA 3TKPA 5IOWA 2GZYA 2GZZA 2R37A 3MSZA 5ECRB 3QAVA 3M8NA 4GSNA 1FO5A 1A8LA 1R4WA 1Z7RA 3A2WA 6GSSA 2IPAA 1U6TA 2WULA 3ZIJA 3NIVA 3QPMA 4HJ2A 1O81A 2H6YA 1TI3A 4IW9A 3GTUB 1GH2A 5F0GA 4KCAA 1WPIA 1A23A 2NTOA 2H0HA 2QSIA 3FK8A 4P3YB 2A2SA 2G2QA 4XCSA 2VCWA 3D22A 2R6KA 2YPMA 3GTUA 2X64A 3Q19A 1K0NA 1TRSA 4HUAA 4WR5A 1R26A 4BWSA 3DXBA 5B8AA 4GLTA 1ERUA 4V2MA 4K0GA 4K8MA 2VD1A 5IM9A 2YOIA 3MAKA 1U87A 4F82A 2OA7A 3FEUA 1YDKA 5CRWA 3P90A 4GSSA 2MZCA 2V32A 2DIZA 3DKSA 2L5OA 1I5GA 1XW5A 2ES7A 1YY7A 2LNTA 1SL0B 2FHEA 2HRNA 1OE7A 1O85A 1FW1A 2LTKA 3TRQA 3VPQA 3LSZA 4Q5FA 3IR4A 5HFIA 3G7YA 4ILFA 3F6DA 3TOTA 5IPHA 3QFBC 1ML6A 3Q18A 2P5RA 3GKKA 2R3XA 2C8UA 2LSTA 4EE0A 2HZFA 2LRNA 1XW9A 2YP6A 3LEFA 2LJAA 1YZXA 2PU9C 4N0VA 4V1Ag 1GP1A 2D2ZA 1SKWB 3RAZA 1LBKA 4EF0A 5ECMB 2GTUA 4KCEA 2HXKA 3EMXA 4IHUA 3VWWA 2H71A 4JR6A 3WYWA 2O7KA 4LMWA 2CAQA 2CQ9A 3RHCA 1PA3A 4IGJA 2OBIA 3HJOA 3I6AA 1RK4A 4TR1B 1XOBA 4K6XA 2AYTA 4MCUA 3KP9A 1Z7PA 3HVXA 6GSXA 2B6MA 2VL2C 2YWIA 1J08A 2HT9A 1GNWA 1WMJA 3HJPA 3P2AA 2DJ0A 2VCQA 1PL2A 3E0UA 3ZMLA 4TR1A 4ML1A 3UBKA 4NWYA 5HR3A 4OCFA 5DCHA 1DBYA 4YAPA 4NV5A 1ERTA 2FWFA 1YKAA 4OO4A 4POLA 1NW2A 5J9CA 4OFNA 2V1MA 5B7CA 4KSMA 1GULA 3GN3A 4HU9A 2L6CA 3L9SA 1SU9A 3CTGA 5HFGA 4F2IA 1FVKA 1TJDA 5IO0A 2GQKA 4G2EA 4K7IA 2C0EA 2CA8A 2PUKC 5C00A 4HU7A 1PN9A 2X8GA 1F3AA 5ELAA 2JADA 1S3AA 5ABRA 3VK9A 3C73A 2NBSA 4K1FA 3F4SA 2J23A 3APSA 2GDRA 4EUYA 2C1YA 4MJAA 3UVTA 4RUVA 1HNAA 3KTBA 2HNLA 3SBCA 4LLRA 3F3RA 5ENUA 2I9HA 1X5CA 3QDNA 2DJ1A 2O8VB 1AUCA 3TKRA 5ELGA 2GQMA 4KE3A 2HI7A 4PUFC 2PERA 1XPVA 4ML6A 3UAPA 1BQ7A 5J3RA 2P31A 5F06A 3EU4A 1V57A 1W89A 4XRDA 2M80A 3IXRA 4ISDA 1EGOA 3HA9A 4XS1A 5AN1A 3I9V2 1GSEA 5IQYA 19GSA 3ZIVA 1MTCA 1SYXA 1JZDA 2YANA 2YZHA 1G7OA 1AC1A 2OE3A 4PNFA 2H1GA 1GSFA 3TKSE 4AJ6A 2EIQA 1PX6A 1B48A 1O73A 4MABA 2ON5A 3QOUA 3FYGA 1XWBA 1HNCA 1DE1A 5IMAA 3TDGA 4AJ8A 1PQNA 3H8QA 4IJIA 2L6DA 4J56E 3HVVA 2VAFA 4PQHA 4JR4A 2CV4A 1FHEA 2IIYA 3UEMA 1YKCA 2KLXA 4V1Ap 3KH9A 2PGTA 1H4OA 3GX0A 3EURA 3TJFA 3EWLA 2H1AA 2C3QA 1EEMA 3IRAA 3KXOA 4ZIJA 5G31A 1RQMA 3GUSA 1AQWA 1SENA 5DQSA 1XCCA 1S3CA 2ALBA 4EO3A 1GL8A 2CAIA 1OAZA 1IYHA 1O7UA 3EMPA 4MF6A 1XWAA 4NV2A 1SJ6A 5LD0A 2OACA 1F9MA 2WCIA 5KN2A 2H1BA 2MMNA 1XBSA 4MPGA 1ZOFA 2B5YA 2I1UA 4IBPA 4GXZA 4KGIA 1KEBA 3O76A 3L0HA 2IMIA 3I69A 2KHPA 4Q5RA 2IMEA 1K3YA 1IYIA 1MEKA 5IOXA 2MBSA 1B4QA 5ECQB 2K8SA 1EP8A 2Z9SA 1AW9A 3LYPA 4L5LA 2O89A 2DMLA 4NPBA 3GURA 4HJMA 4K7OA 1WE0A 2PVOC 1TK0B 2PMTA 4WBJA 4JZQA 5J5NA 1TOFA 2LV3A 4LA1A 2NDOA 2PN8A 2YWNA 4O92A 4IN0A 5JCUA 3KIJA 4ZBDA 2B1LA 4MP4A 2VOCA 2ZNMA 5D9WA 1URMA 5B8BA 3GL3A 2GT5A 5ECNB 2G0FA 5LCZA 1F37A 2RM6A 4GRFA 2R2JA 2DJ3A 4TKYA 3M9KA 4ACSA 1TK5B 2JACA 1T4ZA 2L5LA 4O5RA 5EVOA 4PGTA 1TTZA 5LNKe 1QMVA 1K0DA 3CSHA 3ZTLA 3CBUA 2H6XA 3VI7A 4KA0A 2E2MA 2JZRA 1HYUA 4BWQA 1A24A 4HDEA 2C4JA 1QGVA 4FIWA 5H5QA 5IPGA 3HD5A 4F9ZA 3GIXA 1FG4A 1THXA 3FZ4A 1T8EB 2VCTA 2HFDA 2F8AA 4RQRA 3F3QA 3HKRA 1J0FA 4K2DA 4LMVA 3SWLA 1VF2A 1PKZA 4QL9A 3TKSC 1TU7A 4EKZA 2VL3A 3TJKA 2PBJA 3BD2A 4ZL8A 2DBCA 3L78A 3P8WA 1QK8A 2FA8A 2X99A 1ERWA 1JZRA 3QFAC 3KJYA 2FCHA 4FYCA 1OKDA 5GAND 2HE3A 1F2EA 5D96A 4ZL7A 2V2GA 1QXHA 5CO3A 5E59A 1JLVA 3IA1A 3CRUA 2H19A 1W4VA 3JCML 3C7MA 1N2AA 1PGTA 2LJKA 3DRNA 3GH6A 1RW1A 2H73A 4KX4A 1EGRA 2FGXA 3QD9A 3ZREA 1YEXA 3CSJA 4TXOB 4GTUA 5ECKB 4K7NA 1O6JA 1WOUA 4GF0A 3KM6A 3M3MA 1T00A 3VWUA 5D73A 1E6BA 3HVSA 1GSQA 4TXOA 1PKWA 3IOSA 1R5PA 4G19A 1GTAA 1GLPA 1PMTA 4OFTA 4MJEA 5ECOB 1WWJA 3TJJA 3UBLA 2H8LA 3ZRDA 2NVLA 4TW5A 4DSQA 1A2JA 1WJKA 3TJBA 4WETA 1OYJA 5A4UA 1YF0A 2I4AA 1PSQA 4BPYA 2DLXA 3K8NA 4XS6A 1M0UA 1X9WB 3CXGA 4AJ7A 2CX3A 4TOPA 4XTSA 1XIYA 3TRXA 2JZTA 2GSTA 1AIUA 1Z6NA 1XXUA 1XZOA 1PRXA 4WBRD 1V9WA 3DVWA 3F6FA 4DSRA 2IN3A 2H70A 4MLYA 4GSTA 1FVJA 3RBTA 5IMDA 3G7JA 3UL3A 3LFLA 1VGLA 5ECPB 6GSTA 5GAPD 3LG6A 2L59A 5HR1A 1HQOA 3VWVA 4BVXA 3GSSA 2TRXA 1SK2A 5ECLB 3CRTA 2VUPA 3IHQA 3BJ5A 1T7PB 2MMAA 4IKHA 1Z3EA 2GLRA 3HZ4A 2VLVA 1SYRA 2LEGA 1AQVA 2R5GA 4IS0A 1YEPA 1BG5A 4EVMA 4POMA 2H0GA 3FHKA 3A2VA 5KEJA 5GSTA 1KBNA 2MMOA 3DIEA 3TUEA 3HXSA 4TR4A 1VF4A 2LQQA 3J7Yb 2YN1A 3O6TA 3WGXA 5EPFA 2LRTA 1ACVA 2BMXA 2H30A 5D8IA 4CDOA 2HRFA 4H86A 4D73B 6GSYA 4E8EA 3C1RA 1XFLA 3H79A 4D73A 2YV7A 3FZAA 1XWGA 2F3MA 4RQXA 5ECHB 5JWOB 2ON7A 3D4MA 5HFKA 5IIZA 2LUSA 4ULXA 3TKQA 3FRCA 4L5OA 3CYNA 3UOMA 3E3EA 2OE0A 1WRYA 1PL1A 2A4VA 2ZCTA 3FR9A 3BBYA 2GS3A 2MMZA 4IELA 1E2YA 2VCVA 3GRXA 5DAKB 2IFQB 4MZWA 1ZYEA 3QMXA 1FB0A 2LRCA 2RM5A 1SK1A 3OR5A 2IWTA 1ZCPA 2F51A 5IO2A 1O8WA 1SL1B 3ERGA 4QQ7A 5DAKA 2IFQA 1ILOA 3D0ZA 8GSSA 2LQOA 2H66A 2HZEB 1F3BA 5D9VA 1DE2A 3IDVA 5G1LA 3LYKA 3W6GA 3QAGA 4X1UA 1AAZA 3HCZA 1U3IA 3D5JA 3Q6OA 2DC5A 3U5RE 2HZEA 3GHAA 3A2XA 3PINA 18GSA 3N9JA 2KP2A 5JWQB 3KMNA 5J4UA 4MPFA 20GSA 5G2ZA 4JEDA 1Y6EA 2JSZA 2QKEA 2H1DA 3M0FA 1EOHA 1M2BA 2L4QA 1AQXA 1V2AA 3IBHA 5F07A 4ZL9A 4MF5A 2WFCA 4FO5A 1ZL9A 1R5AA 2V6OA 2XPDA 1ST9A 3I43A 3HYPA 4TR0A 5DJMA 1O8XA 2OADA 1NSWA 5B6MA 3BCKA 4J57E 5AIXA 5B6NA 2B5EA 3TGZA 3NZNA 1SKSB 4MH2A 1VRSD 3LJRA 1JHBA 3ZZXA 4BL7A 1A2LA 4MF7A 3HZ8A 1V58A 5J9BA 3F63A 2HSYA 2VLTA 1XW6A 2B7JA 1Y25A 4IP1A 2VL2A 2FD3A 3E9JB 3GYKA 1ZYQB 2C0DA 3HY2A 2CVDA 2VCXA 2H74A 3CMIA 3WGEA 1H75A 1M9AA 4EDYA 2DJJA 3GV1A 4IQAA 3QCPA 1X5EA 4I8BA 2L57A 5HR0A 3UMAA 3PR8A 4DVCA 1OE8A 1T1VA 2K8VA 2FY6A 3GL5A 4HOJA 1J9BA 4XS4B 3QAWA 2GSSA 1LU4A 2JL4A 4HQSA 1VF1A 1Q98A 1ZMAA 4HQZA 4XS4A 2C0GA 2DJKA 4ECBA 5DVBA 2N5FA 3GFKA 1X0RA 3C71A 4ZBAA 1PX7A 2H72A 1TRUA 3FKFA 5CREA 1ZGNA 5DQYA 2N5BA 3IK9A 3A3TA 4FH8A 5H5SA 3TJGA 3VI5A 4FYUA 2IJYA 4WKWA 1GLQA 5E4WA 1V98A 4YAVA 2EIOA 4F03A 6GSUA 2X8HA 2YWOA 2AB6A 2JSYA 2P5QA 3ISOA 3ZVJD 3L9VA 1B4PA 2CVKA 3O3TA 4CHSA 1TRWA 3F9UA 2LS5A 3GKMA 3NOFA 4OWYA 1Z9HA 2FWEA 4RI7A 4XRAA 4YQUA 1ON4A 1GSUA 1K3OA 3AY8A 1SKRB 3UARA 1MDKA 1BJXA 4N30A 2WS2A 5G30A 2B3SA 2CZ3A 3APQA 4V2LA 2GSQA 4KUNA 5KN3A 4HZ2A 3F0IA 4PX1A 4MJBA 1U3AA 2HSHA 1M2DA 3PGTA 1DSBA 1OC3A 4J2FA 1EV4A 3ZL5A 2O85A 4GCIA 4EC0A 4PQ1A 2FNOA 1GTIA 1XOAA 1TW9A 1BEDA 2BTOT 3LXZA 1SD8A 3EE2A 4ZILA 4MZCA 1QUWA 1U88A 2DSAA 2H01A 4KB3A 4E8HA 2F9SA 6GSWA 5G1KA 1EV9A 1A0RP 3UVHA 1B9YC 2B7KA 4X0XA 3L4NA 2PPTA 4NAXA 1A0FA 2WGRA 3KP8A 5F8BA 3FR3A 4RI6A 4HZ4A 3DD3A 5D9XA 1CQHA 1G7EA 2M72A 4MDCA 1YQ1A 1UVZA 4ZB8A 4GWRA 3ZFLA 1K0CA 1SL2B 4DEJA 2KP1A 3N5OA 4CW9A 1TDIA 5AIVA 4I5QA 2IMKA 4TXVA 2GT6A 4POBA 4PNGA 1TKDB 3VFIA 4WR4A 1UN2A 1WIKA 3DYRA 4KDYA 4PUAA 3US3A 4POKA 3RPPA 3VURA 4K0NA 3H4KA 1MD4A 2VD0A 1K0AA 4OFMA 4WF5A 2WZ9A 4L0UA 2K9FA 2YV9A 1FOVA 2CZ2A 3D21A 2FWHA 2LNSA 3W8SA 4ZB9A 5C04A 4IQ1A 1EOGA
chains in the Genus database with same CATH superfamily
2EC4A 1GSSA 2O87A 2X8CA 2FWGA 2OE1A 3D4TA 3J7Yk 2GGTA 7GSSA 4OO5A 1M9BA 1BX9A 4BA7A 2H6ZA 5D9TA 1X9MB 1JZWA 2HLSA 3GMFA 4MZBA 1F6MC 4F0BA 4GQFA 2YCDA 4YQVA 3G7IA 2OJLA 4AF2A 2IL3A 5KN0A 2HYXA 9GSSA 4LL4B 4MK3A 4ZBBA 2V6KA 2J9HA 2YJ7A 1G0TA 1GNEA 1TXXA 1T3BA 3ZVJA 4TVEA 4ICYA 5IMCA 5DALB 3ZLPA 3DEXA 1M2AA 1ABAA 2VLUA 5FT3A 2B1KA 2CT6A 3F4RA 2RUFA 1N8JA 3WT1A 6GSVA 5DALA 4NHZA 3ZFBA 1USBA 1UA5A 4N11A 3TKSA 5ECIB 3U6VA 4EDZA 1TP9A 3RDWA 4EXJA 4HEA2 4KH7A 1QFNA 5CAXA 2N5AA 3TCOA 1YF1A 3ERWA 2RUEA 4Z2UA 3DMLA 3S9FA 1KNGA 3C1SA 4X43A 1VF3A 3IAM2 3M1GA 3GH9A 4XHMA 5IMFA 5G5FA 3W8JA 1OC9B 2RIIA 4G10A 1XVQA 2YWMA 3KTLA 4O5QA 3LGCA 4OCEA 3FZ5A 5GSSA 1GSYA 4O5UA 2MYGA 1JFUA 3RPNA 1OVNA 1OC9A 4WF4A 2JU5A 3H93A 3IAS2 2H0IA 2VM2A 2GSRA 2ZUPA 4K2XA 4K5SA 3D6IA 2E0QA 1DUGA 1G6WA 2CX4A 3CTFA 5CRDA 2VCZA 22GSA 2K6VA 3CSIA 1Z5YE 3KMOA 4Z7XA 1ZYNA 1B8XA 11GSA 2I3YA 2XBQA 2JZSA 4TR3A 3APOA 1HD2A 1ZZYA 2MBTA 3P7XA 1I9DA 4PURA 1XVWA 1V40A 4G9HA 1M3JA 1X9SB 1TU8A 2H76A 2KOKA 1THOA 2LKUA 1GTUA 2XBIA 5H5RA 3PH9A 1EEJA 5JWRB 3F8UA 4JBBA 5FWGA 3RHBA 5DBQA 3IV4A 4ECIA 2XC2A 5A4WA 3TRPA 3ZYWA 5J41A 3C8EA 4WXTA 1NM3A 3ED3A 4ID0A 1GUMA 1FB6A 1GWCA 4YQMA 5EY6A 3HHVA 1K0OA 3FY7A 4N10A 2WRTA 3GX8A 12GSA 3ME8A 3IC4A 2AAWA 5DDLA 1R7HA 4L0WA 1K0BA 3VPTA 4L8EA 1X5DA 2V41A 5KOXA 3GNJA 1UC7A 1TRVA 4MJCA 3M9JA 4KNDA 1K0MA 1MDJA 2FUG2 5FHIA 5G5EA 5ID2B 1JZOA 5COHA 2TIRA 2B5XA 1A8YA 14GSA 2DMMA 2VO4A 3FW2A 3G9BA 2C3NA 5CYYA 2XHFA 3QR6A 1LJRA 5ID2A 3V1WA 2PVQA 4I2UA 3ZMKA 16GSA 1C72A 1EZKA 1SJZA 5IMZA 4ECJA 4IJ3A 4DSSB 1B9XC 1G6YA 1SJIA 5GZZB 3EYTA 5A4VA 1TI1A 5AGYA 2F8FA 2R4VA 1QQ2A 5A5KA 1SD9A 4DSSA 3BCIA 3KCMA 4ZB6A 2VM1A 4PQIA 3FR6A 4NMUA 1HNBA 1NHYA 4Q5NA 3GSTA 4NHWA 4USSA 4IVFA 4CY6A 4BIKA 5KOWA 2FLSA 3L9UA 3WGDA 2AV4A 2EIRA 2C0FA 1XWKA 1GUKA 3EC3A 1AXDA 3KD0A 2E2GA 4KW6A 5CP1A 5CNWA 4ECCA 4WEYA 3EINA 5F05A 1M99A 4JE1A 3TOUA 1JLWA 4HS1A 1OC8A 3WD6A 2IMDA 3ME7A 1MD3A 2WB9A 4MA9A 3GKXA 5BMUA 2H75A 3LXTA 3WT2A 4MMMA 5L71A 4KDUA 3LQ7A 4I97A 4IP6A 2C3TA 4O7HA 3DWVA 3IPZA 2C80A 3EVIA 2AUVA 2IMFA 3H1NA 1FAAA 5DJLA 1K3LA 2OKAA 3KZQA 5HR2A 1GUHA 3HDCA 3TB2A 2E7PA 3KH7A 3VWXA 1OKTA 1A2MA 4YH2A 1ERVA 3LWAA 4FYBA 3UJ1A 4AGSA 3GKNA 1SK0A 1BYEA 2WDUA 4V2NA 1XWCA 2TRCP 1MDIA 3VLNA 4KAEA 2GZPA 2QC7A 4LL1B 2YNXA 4GQCA 5IMVA 2AJQB 3EU3A 2PWJA 1S3DA 4I2TA 2REMA 4K9ZA 3Q74A 2OBKA 3DGQA 1KTEA 3ZITA 2RLIA 1Q4JA 2K18A 2QGVA 4QL7A 1WP0A 3MDKA 4NXIA 1YJ6A 3ERFA 13GSA 5INYA 3HJMA 1FOHA 2L4CA 4BVYB 3KEBA 2DJ2A 4OMVA 1Z6MA 3A5WA 2CVBA 2DKIA 5D93A 1EP7A 2YZUA 2WJUA 4BVYA 2A2RA 2I81A 2KUCA 4I6XA 1GTBA 5CRGA 4TN8A 2BJXA 1GSDA 2NPBA 5ECSA 4O32A 1EWXA 5EL8A 3IE3A 2VIMA 2GVPA 3LORA 3KGKA 3UIWA 1T4YA 4Q5QA 1GRXA 1XG8A 2LJRA 5CRHA 2GQLA 1PD21 5JCGA 5HQPA 3IK7A 4KSOA 2VL9A 4JU5A 3GA4A 4HI7A 4EL1A 3DVXA 3MNGA 2DIYA 1NHOA 5KN1A 4KDXA 2P0GA 1CQGA 3A5IA 4F0CA 1TK8B 1BAYA 5DCGA 2XPEA 17GSA 4N0ZA 1M7TA 3BOAA 2FA4A 2YJHA 4XIHA 2M46A 4PXOA 3R2QA 4ZXGA 4OD7A 4MH3A 5JCWA 10GSA 1M3IA 3FZ9A 2AHEA 4JRRA 3F4TA 3MWHA 5AISA 4TRXA 3TKPA 5IOWA 2GZYA 2GZZA 2R37A 3MSZA 5ECRB 3QAVA 3M8NA 4GSNA 4G0LA 1FO5A 4Z2RA 1A8LA 1R4WA 1Z7RA 3A2WA 6GSSA 2IPAA 1U6TA 2WULA 4MNNA 3ZIJA 3NIVA 3QPMA 4HJ2A 1O81A 2H6YA 1TI3A 4IW9A 3GTUB 1GH2A 5F0GA 4KCAA 1WPIA 1A23A 2NTOA 2H0HA 2QSIA 3FK8A 4P3YB 2A2SA 2G2QA 4XCSA 3D22A 2VCWA 1PFOA 2R6KA 2YPMA 3GTUA 2X64A 3Q19A 4K5RA 1K0NA 1TRSA 4HUAA 4WR5A 1R26A 4BWSA 3DXBA 5B8AA 4GLTA 1ERUA 4V2MA 4K0GA 4K8MA 2VD1A 5IM9A 2HRKA 3PPUA 4YKFA 3CQFA 2YOIA 3MAKA 1U87A 4F82A 2OA7A 3FEUA 1YDKA 5CRWA 3P90A 4GSSA 2MZCA 2V32A 2DIZA 3DKSA 2L5OA 1I5GA 1XW5A 2ES7A 1YY7A 2LNTA 1SL0B 2FHEA 2HRNA 2X4AA 1OE7A 1O85A 1FW1A 2LTKA 3TRQA 3VPQA 3LSZA 4Q5FA 3IR4A 5HFIA 3G7YA 4ILFA 3F6DA 3TOTA 5IPHA 3QFBC 1ML6A 3Q18A 2P5RA 3GKKA 2A2PA 2R3XA 2C8UA 2LSTA 4EE0A 2HZFA 2LRNA 1XW9A 2YP6A 3LEFA 2LJAA 1YZXA 2PU9C 4N0VA 4V1Ag 1GP1A 2D2ZA 1SKWB 3RAZA 1LBKA 4EF0A 5ECMB 2GTUA 4KCEA 2HXKA 3EMXA 1EOGA 4IHUA 3VWWA 2H71A 4JR6A 3WYWA 2O7KA 4LMWA 2CAQA 2CQ9A 3RHCA 1PA3A 4IGJA 2OBIA 3HJOA 3I6AA 1RK4A 4TR1B 1XOBA 4K6XA 2AYTA 4MCUA 3KP9A 1Z7PA 3HVXA 6GSXA 2B6MA 2VL2C 2YWIA 1J08A 2HT9A 1GNWA 1WMJA 3HJPA 3P2AA 2DJ0A 2VCQA 1PL2A 3E0UA 3ZMLA 4TR1A 4ML1A 3UBKA 4NWYA 5HR3A 4OCFA 5DCHA 1DBYA 4YAPA 4NV5A 1ERTA 2FWFA 1YKAA 4OO4A 4POLA 1NW2A 5J9CA 4OFNA 2V1MA 5B7CA 4KSMA 1GULA 3GN3A 4HU9A 2L6CA 3L9SA 1SU9A 3CTGA 5HFGA 4F2IA 1FVKA 1TJDA 5IO0A 2GQKA 4G2EA 4K7IA 2C0EA 2CA8A 2PUKC 5C00A 4HU7A 1PN9A 2X8GA 1F3AA 5ELAA 2JADA 1S3AA 5ABRA 3VK9A 3C73A 2NBSA 4K1FA 3F4SA 2J23A 3APSA 2GDRA 4EUYA 2C1YA 4MJAA 3UVTA 4RUVA 1HNAA 3KTBA 4EIQA 2HNLA 3SBCA 4LLRA 3F3RA 5ENUA 2I9HA 1X5CA 3QDNA 2DJ1A 2O8VB 1AUCA 3TKRA 5ELGA 2GQMA 4KE3A 2HI7A 4PUFC 2PERA 1XPVA 4ML6A 3UAPA 1BQ7A 5J3RA 2P31A 5F06A 3EU4A 1V57A 1W89A 4XRDA 2M80A 3IXRA 4ISDA 1EGOA 3HA9A 4XS1A 5AN1A 3I9V2 1GSEA 5IQYA 19GSA 3ZIVA 1MTCA 1SYXA 1JZDA 2YANA 2YZHA 1G7OA 1AC1A 2OE3A 4PNFA 2H1GA 1GSFA 3TKSE 4AJ6A 2EIQA 1PX6A 1B48A 1O73A 4MABA 2ON5A 3QOUA 3FYGA 1XWBA 1HNCA 1DE1A 5IMAA 3TDGA 4AJ8A 1PQNA 3H8QA 4IJIA 2L6DA 4J56E 3HVVA 2VAFA 4PQHA 4JR4A 2CV4A 1FHEA 2IIYA 3UEMA 1YKCA 2KLXA 4V1Ap 3KH9A 2PGTA 1H4OA 3GX0A 3EURA 3TJFA 3EWLA 2H1AA 2C3QA 1EEMA 3IRAA 3KXOA 4ZIJA 5G31A 1RQMA 3GUSA 1AQWA 1SENA 5DQSA 1XCCA 1S3CA 2ALBA 4EO3A 1GL8A 2CAIA 1OAZA 1IYHA 1O7UA 3EMPA 4MF6A 1XWAA 4NV2A 1SJ6A 5LD0A 2OACA 1F9MA 2WCIA 5KN2A 2H1BA 2MMNA 1XBSA 4MPGA 1ZOFA 2B5YA 2I1UA 4IBPA 4GXZA 4KGIA 1KEBA 3O76A 3L0HA 2IMIA 3IC8A 3I69A 2KHPA 4Q5RA 2IMEA 1K3YA 1IYIA 1MEKA 5IOXA 2QA1A 2MBSA 1B4QA 5ECQB 2K8SA 1EP8A 2Z9SA 1AW9A 3LYPA 4L5LA 2O89A 2DMLA 4NPBA 3GURA 4HJMA 4K7OA 1WE0A 2PVOC 1TK0B 2PMTA 4WBJA 4JZQA 5J5NA 1TOFA 2LV3A 4LA1A 2NDOA 2PN8A 2YWNA 4O92A 4IN0A 5JCUA 3KIJA 4ZBDA 2B1LA 4MP4A 2VOCA 2ZNMA 5D9WA 1PN0A 1URMA 5B8BA 3GL3A 2GT5A 5ECNB 2G0FA 5LCZA 1F37A 2RM6A 4GRFA 2R2JA 2DJ3A 4TKYA 3M9KA 4ACSA 1TK5B 4KF9A 2JACA 1T4ZA 2L5LA 4O5RA 5EVOA 4PGTA 1TTZA 5LNKe 1QMVA 1K0DA 3CSHA 3ZTLA 3CBUA 2H6XA 3VI7A 4KA0A 2E2MA 2JZRA 1HYUA 4BWQA 1A24A 4HDEA 2C4JA 1QGVA 4FIWA 5H5QA 5IPGA 3HD5A 4F9ZA 3GIXA 1FG4A 1THXA 3FZ4A 3LW9A 1T8EB 2VCTA 2HFDA 2F8AA 4RQRA 3F3QA 3HKRA 3HVNA 1J0FA 4K2DA 4LMVA 3SWLA 1VF2A 1PKZA 4QL9A 3TKSC 1TU7A 4EKZA 2VL3A 2HSMA 3TJKA 2PBJA 3BD2A 4ZL8A 2DBCA 3L78A 3P8WA 1QK8A 2FA8A 2X99A 1ERWA 1JZRA 3QFAC 3KJYA 2FCHA 4FYCA 1OKDA 5GAND 2HE3A 1F2EA 5D96A 4ZL7A 2V2GA 1QXHA 5CO3A 5E59A 1JLVA 2QA2A 3IA1A 3CRUA 2H19A 1W4VA 3JCML 3C7MA 1N2AA 1PGTA 2LJKA 3DRNA 3GH6A 1RW1A 1S3RA 2H73A 2R0CA 4KX4A 1EGRA 2FGXA 3QD9A 3ZREA 1YEXA 3CSJA 4TXOB 4GTUA 5ECKB 4K7NA 1O6JA 1WOUA 4GF0A 3KM6A 3M3MA 1T00A 3VWUA 5D73A 1E6BA 3HVSA 1GSQA 4TXOA 1PKWA 2A4HA 3IOSA 1R5PA 4G19A 1GTAA 1GLPA 4Z2TA 1PMTA 4OFTA 4MJEA 5ECOB 1WWJA 3TJJA 3UBLA 2H8LA 3ZRDA 2NVLA 4TW5A 4DSQA 1A2JA 1WJKA 3TJBA 4WETA 1OYJA 5A4UA 1YF0A 2I4AA 1PSQA 4BPYA 2DLXA 3K8NA 4XS6A 1M0UA 1X9WB 3CXGA 4AJ7A 2CX3A 4TOPA 4XTSA 1XIYA 3TRXA 2JZTA 2GSTA 1AIUA 1Z6NA 1XXUA 1XZOA 1PRXA 4WBRD 1V9WA 3DVWA 3F6FA 4DSRA 2IN3A 2H70A 4MLYA 4GSTA 1FVJA 4BVXB 3RBTA 5IMDA 3G7JA 3UL3A 3LFLA 1VGLA 5ECPB 6GSTA 5GAPD 3LG6A 2L59A 5HR1A 1HQOA 3VWVA 4BVXA 3GSSA 2TRXA 1SK2A 5ECLB 3CRTA 2VUPA 3IHQA 3BJ5A 1T7PB 2MMAA 2HRAA 4IKHA 1Z3EA 2GLRA 3HZ4A 2VLVA 1SYRA 2LEGA 1AQVA 2R5GA 4IS0A 1YEPA 1BG5A 4EVMA 4POMA 2H0GA 3FHKA 3A2VA 5KEJA 5GSTA 1KBNA 2MMOA 3DIEA 3TUEA 3HXSA 4TR4A 1VF4A 2LQQA 4X4JA 3J7Yb 2YN1A 3O6TA 3WGXA 5EPFA 2LRTA 1ACVA 2BMXA 2H30A 5D8IA 4CDOA 5BRTA 2HRFA 4H86A 4D73B 6GSYA 4E8EA 3C1RA 4HSCX 1XFLA 2X49A 3H79A 4G0KA 4D73A 2YV7A 3FZAA 1XWGA 2F3MA 2R0PA 4RQXA 5ECHB 5JWOB 2ON7A 3D4MA 5HFKA 5IIZA 2LUSA 4ULXA 3TKQA 3FRCA 3IHGA 4L5OA 3CYNA 3UOMA 3E3EA 2OE0A 1WRYA 1PL1A 2A4VA 2ZCTA 3FR9A 3BBYA 2GS3A 2MMZA 4EIPA 4IELA 1E2YA 4A5PA 2VCVA 3GRXA 5DAKB 2IFQB 4MZWA 1ZYEA 3QMXA 1FB0A 2LRCA 2RM5A 1SK1A 3OR5A 2IWTA 1ZCPA 2F51A 5IO2A 1O8WA 1SL1B 3ERGA 4QQ7A 5DAKA 2IFQA 1ILOA 3D0ZA 8GSSA 2LQOA 2H66A 2HZEB 1F3BA 5D9VA 1DE2A 3IDVA 5G1LA 3LYKA 3W6GA 3QAGA 4X1UA 1AAZA 3HCZA 1U3IA 3D5JA 3Q6OA 2DC5A 3U5RE 2HZEA 3MIXA 3GHAA 3A2XA 3PINA 18GSA 3N9JA 2KP2A 5JWQB 3KMNA 5J4UA 4MPFA 20GSA 5G2ZA 4JEDA 1Y6EA 2JSZA 2QKEA 2H1DA 3M0FA 1EOHA 1M2BA 2L4QA 1AQXA 1V2AA 3IBHA 5F07A 4ZL9A 4MF5A 2WFCA 4FO5A 1ZL9A 1R5AA 2V6OA 2XPDA 4G0IA 1ST9A 3I43A 3HYPA 4TR0A 5DJMA 1O8XA 4BL7B 2OADA 1NSWA 5B6MA 3BCKA 4J57E 5AIXA 5B6NA 2B5EA 3TGZA 3NZNA 1SKSB 4MH2A 1VRSD 3LJRA 1JHBA 3ZZXA 4BL7A 1A2LA 2R0GA 4MF7A 3HZ8A 1V58A 5J9BA 3F63A 2HSYA 2VLTA 1XW6A 2B7JA 1Y25A 4IP1A 2VL2A 2FD3A 3E9JB 3GYKA 1ZYQB 2C0DA 3HY2A 2CVDA 2VCXA 2H74A 3CMIA 3WGEA 1H75A 1M9AA 4EDYA 2DJJA 3GV1A 4IQAA 3QCPA 1X5EA 4I8BA 2L57A 5HR0A 3UMAA 3PR8A 4DVCA 1OE8A 1T1VA 2K8VA 2FY6A 3GL5A 4HOJA 1J9BA 4XS4B 3QAWA 2GSSA 1LU4A 2JL4A 4HQSA 1VF1A 1Q98A 1ZMAA 4HQZA 4XS4A 2C0GA 2DJKA 4ECBA 5DVBA 2N5FA 3GFKA 1X0RA 3C71A 4ZBAA 1PX7A 4FQUA 2H72A 1TRUA 3FKFA 5CREA 1ZGNA 5DQYA 2N5BA 3IK9A 3A3TA 4FH8A 5H5SA 3TJGA 3VI5A 4FYUA 2IJYA 2DKHA 1GLQA 4WKWA 5E4WA 1V98A 4YAVA 2EIOA 4F03A 6GSUA 2X8HA 4CY8A 2YWOA 2AB6A 2JSYA 2P5QA 3ISOA 3ZVJD 3L9VA 1B4PA 2CVKA 2UZ8A 4PTSA 3O3TA 4CHSA 1TRWA 3F9UA 2LS5A 3GKMA 3NOFA 4OWYA 1Z9HA 2FWEA 4RI7A 4XRAA 4YQUA 1ON4A 1GSUA 1K3OA 3AY8A 1SKRB 3UARA 1MDKA 1BJXA 4N30A 2WS2A 5G30A 2B3SA 2CZ3A 3APQA 3MYDA 4V2LA 2GSQA 4KUNA 5KN3A 4HZ2A 3F0IA 4PX1A 4YKGA 4MJBA 1ZYPA 1U3AA 2HSHA 1M2DA 3R3EA 3PGTA 1DSBA 1OC3A 4J2FA 1EV4A 3ZL5A 2O85A 4GCIA 4EC0A 4PQ1A 2FNOA 1GTIA 1XOAA 1TW9A 1BEDA 2BTOT 3LXZA 1SD8A 3EE2A 4ZILA 4MZCA 1QUWA 1U88A 2DSAA 3FMWA 2H01A 4KB3A 4E8HA 2F9SA 6GSWA 5G1KA 1EV9A 1A0RP 3UVHA 1B9YC 2B7KA 4X0XA 3L4NA 2PPTA 4NAXA 1A0FA 2WGRA 3KP8A 5F8BA 3FR3A 4RI6A 4HZ4A 3DD3A 5D9XA 1CQHA 1G7EA 2M72A 4MDCA 1YQ1A 1UVZA 4ZB8A 4GWRA 3ZFLA 1K0CA 1SL2B 4DEJA 2KP1A 3N5OA 4CW9A 1TDIA 5AIVA 4I5QA 2IMKA 4TXVA 2GT6A 4POBA 4PNGA 1TKDB 3VFIA 4WR4A 1UN2A 1WIKA 3DYRA 4KDYA 4PUAA 3US3A 4POKA 3RPPA 3VURA 4K0NA 3H4KA 1MD4A 2VD0A 1K0AA 4OFMA 4WF5A 2WZ9A 4L0UA 2K9FA 2YV9A 1FOVA 2CZ2A 3D21A 2FWHA 2LNSA 3W8SA 4ZB9A 5C04A 4IQ1A 3EPTA
chains in the Genus database with same CATH topology
2EC4A 1GSSA 2O87A 2X8CA 2FWGA 2OE1A 3D4TA 3J7Yk 2GGTA 7GSSA 4OO5A 1M9BA 1BX9A 4BA7A 2H6ZA 5D9TA 1X9MB 1JZWA 2HLSA 3GMFA 4MZBA 1F6MC 4F0BA 4GQFA 2YCDA 4YQVA 3G7IA 2OJLA 4AF2A 2IL3A 5KN0A 2HYXA 9GSSA 4LL4B 4MK3A 4ZBBA 2V6KA 2J9HA 2YJ7A 1G0TA 1GNEA 1TXXA 1T3BA 3ZVJA 4TVEA 4ICYA 5IMCA 5DALB 3ZLPA 3DEXA 1M2AA 1ABAA 2VLUA 5FT3A 2B1KA 2CT6A 3F4RA 2RUFA 1N8JA 3WT1A 6GSVA 5DALA 4NHZA 3ZFBA 1USBA 1UA5A 4N11A 3TKSA 5ECIB 3U6VA 4EDZA 1TP9A 3RDWA 4EXJA 4HEA2 4KH7A 1QFNA 5CAXA 2N5AA 3TCOA 1YF1A 3ERWA 2RUEA 4Z2UA 3DMLA 3S9FA 1KNGA 3C1SA 4X43A 1VF3A 3IAM2 3M1GA 3GH9A 4XHMA 5IMFA 5G5FA 3W8JA 1OC9B 2RIIA 4G10A 1XVQA 2YWMA 3KTLA 4O5QA 3LGCA 4OCEA 3FZ5A 5GSSA 1GSYA 4O5UA 2MYGA 1JFUA 3RPNA 1OVNA 1OC9A 4WF4A 2JU5A 3H93A 3IAS2 2H0IA 2VM2A 2GSRA 2ZUPA 4K2XA 4K5SA 3D6IA 2E0QA 1DUGA 1G6WA 2CX4A 3CTFA 5CRDA 2VCZA 22GSA 2K6VA 3CSIA 1Z5YE 3KMOA 4Z7XA 1ZYNA 1B8XA 11GSA 2I3YA 2XBQA 2JZSA 4TR3A 3APOA 1HD2A 1ZZYA 2MBTA 3P7XA 1I9DA 4PURA 1XVWA 1V40A 4G9HA 1X9SB 1TU8A 2H76A 2KOKA 1THOA 2LKUA 1GTUA 2XBIA 5H5RA 3PH9A 1EEJA 5JWRB 3F8UA 4JBBA 5FWGA 3RHBA 5DBQA 3IV4A 4ECIA 2XC2A 5A4WA 3TRPA 3ZYWA 5J41A 3C8EA 4WXTA 1NM3A 3ED3A 4ID0A 1GUMA 1FB6A 1GWCA 4YQMA 5EY6A 3HHVA 1K0OA 3FY7A 4N10A 2WRTA 3GX8A 12GSA 3ME8A 3IC4A 2AAWA 5DDLA 1R7HA 4L0WA 1K0BA 3VPTA 4L8EA 1X5DA 2V41A 5KOXA 3GNJA 1UC7A 1TRVA 4MJCA 3M9JA 4KNDA 1K0MA 1MDJA 2FUG2 5FHIA 5G5EA 5ID2B 1JZOA 5COHA 2TIRA 2B5XA 1A8YA 14GSA 2DMMA 2VO4A 3FW2A 3G9BA 2C3NA 5CYYA 2XHFA 3QR6A 1LJRA 5ID2A 3V1WA 2PVQA 4I2UA 3ZMKA 16GSA 1C72A 1EZKA 1SJZA 5IMZA 4ECJA 4IJ3A 4DSSB 1B9XC 1G6YA 1SJIA 5GZZB 3EYTA 5A4VA 1TI1A 5AGYA 2F8FA 2R4VA 1QQ2A 5A5KA 1SD9A 4DSSA 3BCIA 3KCMA 4ZB6A 2VM1A 4PQIA 3FR6A 4NMUA 1HNBA 1NHYA 4Q5NA 3GSTA 4NHWA 4USSA 4IVFA 4CY6A 5KOWA 2FLSA 3L9UA 3WGDA 2AV4A 2EIRA 2C0FA 1XWKA 1GUKA 3EC3A 1AXDA 3KD0A 2E2GA 4KW6A 5CP1A 5CNWA 4ECCA 4WEYA 3EINA 5F05A 1M99A 4JE1A 3TOUA 1JLWA 4HS1A 1OC8A 3WD6A 2IMDA 3ME7A 1MD3A 2WB9A 4MA9A 3GKXA 5BMUA 2H75A 3LXTA 3WT2A 4MMMA 5L71A 4KDUA 3LQ7A 4I97A 4IP6A 2C3TA 4O7HA 3DWVA 3IPZA 2C80A 3EVIA 2AUVA 2IMFA 3H1NA 1FAAA 5DJLA 1K3LA 2OKAA 3KZQA 5HR2A 1GUHA 3HDCA 3TB2A 2E7PA 3KH7A 3VWXA 1OKTA 1A2MA 4YH2A 1ERVA 3LWAA 4FYBA 3UJ1A 4AGSA 3GKNA 1SK0A 1BYEA 2WDUA 4V2NA 1XWCA 2TRCP 1MDIA 3VLNA 4KAEA 2GZPA 2QC7A 4LL1B 2YNXA 4GQCA 5IMVA 2AJQB 3EU3A 2PWJA 1S3DA 4I2TA 2REMA 4K9ZA 3Q74A 2OBKA 3DGQA 1KTEA 3ZITA 2RLIA 1Q4JA 2K18A 2QGVA 4QL7A 1WP0A 3MDKA 4NXIA 1YJ6A 3ERFA 13GSA 5INYA 3HJMA 1FOHA 2L4CA 4BVYB 3KEBA 2DJ2A 4OMVA 1Z6MA 3A5WA 2CVBA 2DKIA 5D93A 1EP7A 2YZUA 2WJUA 4BVYA 2A2RA 2I81A 2KUCA 4I6XA 1GTBA 5CRGA 4TN8A 2BJXA 1GSDA 2NPBA 5ECSA 4O32A 1EWXA 5EL8A 3IE3A 2VIMA 2GVPA 3LORA 3KGKA 3UIWA 1T4YA 4Q5QA 1GRXA 2LJRA 5CRHA 2GQLA 1PD21 5JCGA 5HQPA 3IK7A 4KSOA 2VL9A 4JU5A 3GA4A 4HI7A 4EL1A 3DVXA 3MNGA 2DIYA 1NHOA 5KN1A 4KDXA 2P0GA 1CQGA 3A5IA 4F0CA 1TK8B 1BAYA 5DCGA 2XPEA 17GSA 4N0ZA 1M7TA 3BOAA 2FA4A 2YJHA 4XIHA 2M46A 4PXOA 3R2QA 4ZXGA 4OD7A 4MH3A 5JCWA 10GSA 4JRRA 3FZ9A 2AHEA 3F4TA 3MWHA 5AISA 4TRXA 3TKPA 5IOWA 2GZYA 2GZZA 2R37A 3MSZA 5ECRB 3QAVA 3M8NA 4GSNA 4G0LA 1FO5A 4Z2RA 1A8LA 1R4WA 1Z7RA 3A2WA 6GSSA 2IPAA 1U6TA 2WULA 4MNNA 3ZIJA 3NIVA 3QPMA 4HJ2A 1O81A 2H6YA 1TI3A 4IW9A 3GTUB 1GH2A 5F0GA 4KCAA 1WPIA 1A23A 2NTOA 2H0HA 2QSIA 3FK8A 4P3YB 2A2SA 2G2QA 4XCSA 2VCWA 3D22A 2R6KA 2YPMA 3GTUA 2X64A 3Q19A 4K5RA 1K0NA 1TRSA 4HUAA 4WR5A 1R26A 4BWSA 3DXBA 5B8AA 4GLTA 1ERUA 4V2MA 4K0GA 4K8MA 2VD1A 5IM9A 2HRKA 3PPUA 4YKFA 2YOIA 3MAKA 1U87A 4F82A 2OA7A 3FEUA 1YDKA 5CRWA 3P90A 4GSSA 2MZCA 2V32A 2DIZA 3DKSA 2L5OA 1I5GA 1XW5A 2ES7A 1YY7A 2LNTA 1SL0B 2FHEA 2HRNA 2X4AA 1OE7A 1O85A 1FW1A 2LTKA 3TRQA 3VPQA 3LSZA 4Q5FA 3IR4A 5HFIA 3G7YA 4ILFA 3F6DA 3TOTA 5IPHA 3QFBC 1ML6A 3Q18A 2P5RA 3GKKA 2A2PA 2R3XA 2C8UA 2LSTA 4EE0A 2HZFA 2LRNA 1XW9A 2YP6A 3LEFA 2LJAA 1YZXA 2PU9C 4N0VA 4V1Ag 1GP1A 2D2ZA 1SKWB 3RAZA 1LBKA 4EF0A 5ECMB 2GTUA 4KCEA 2HXKA 3EMXA 1EOGA 4IHUA 3VWWA 2H71A 4JR6A 3WYWA 2O7KA 4LMWA 2CAQA 2CQ9A 3RHCA 1PA3A 4IGJA 2OBIA 3HJOA 3I6AA 1RK4A 4TR1B 1XOBA 4K6XA 2AYTA 4MCUA 3KP9A 1Z7PA 3HVXA 6GSXA 2B6MA 2VL2C 2YWIA 1J08A 2HT9A 1GNWA 1WMJA 3HJPA 3P2AA 2DJ0A 2VCQA 1PL2A 3E0UA 3ZMLA 4TR1A 4ML1A 3UBKA 4NWYA 5HR3A 4OCFA 5DCHA 1DBYA 4YAPA 4NV5A 1ERTA 2FWFA 1YKAA 4OO4A 4POLA 1NW2A 5J9CA 4OFNA 2V1MA 5B7CA 4KSMA 1GULA 3GN3A 4HU9A 2L6CA 3L9SA 1SU9A 3CTGA 5HFGA 4F2IA 1FVKA 1TJDA 5IO0A 2GQKA 4G2EA 4K7IA 2C0EA 2CA8A 2PUKC 5C00A 4HU7A 1PN9A 2X8GA 1F3AA 5ELAA 2JADA 1S3AA 5ABRA 3VK9A 3C73A 2NBSA 4K1FA 3F4SA 2J23A 3APSA 2GDRA 4EUYA 2C1YA 4MJAA 3UVTA 4RUVA 1HNAA 3KTBA 4EIQA 2HNLA 3SBCA 4LLRA 3F3RA 5ENUA 2I9HA 1X5CA 3QDNA 2DJ1A 2O8VB 1AUCA 3TKRA 5ELGA 2GQMA 4KE3A 2HI7A 4PUFC 2PERA 1XPVA 4ML6A 3UAPA 1BQ7A 5J3RA 2P31A 5F06A 3EU4A 1V57A 1W89A 4XRDA 2M80A 3IXRA 4ISDA 1EGOA 3HA9A 4XS1A 5AN1A 3I9V2 1GSEA 5IQYA 19GSA 3ZIVA 1MTCA 1SYXA 1JZDA 2YANA 2YZHA 1G7OA 1AC1A 2OE3A 4PNFA 2H1GA 1GSFA 3TKSE 4AJ6A 2EIQA 1PX6A 1B48A 1O73A 4MABA 2ON5A 3QOUA 3FYGA 1XWBA 1HNCA 1DE1A 5IMAA 3TDGA 4AJ8A 1PQNA 3H8QA 4IJIA 2L6DA 4J56E 3HVVA 2VAFA 4PQHA 4JR4A 2CV4A 1FHEA 2IIYA 3UEMA 1YKCA 2KLXA 4V1Ap 3KH9A 2PGTA 1H4OA 3GX0A 3EURA 3TJFA 3EWLA 2H1AA 2C3QA 1EEMA 3IRAA 3KXOA 4ZIJA 5G31A 1RQMA 3GUSA 1AQWA 1SENA 5DQSA 1XCCA 1S3CA 2ALBA 4EO3A 1GL8A 2CAIA 1OAZA 1IYHA 1O7UA 3EMPA 4MF6A 1XWAA 4NV2A 1SJ6A 5LD0A 2OACA 1F9MA 2WCIA 5KN2A 2H1BA 2MMNA 1XBSA 4MPGA 1ZOFA 2B5YA 2I1UA 4IBPA 4GXZA 4KGIA 1KEBA 3O76A 3L0HA 2IMIA 3IC8A 3I69A 2KHPA 4Q5RA 2IMEA 1K3YA 1IYIA 1MEKA 5IOXA 2QA1A 2MBSA 1B4QA 5ECQB 2K8SA 1EP8A 2Z9SA 1AW9A 3LYPA 4L5LA 2O89A 2DMLA 4NPBA 3GURA 4HJMA 4K7OA 1WE0A 2PVOC 1TK0B 2PMTA 4WBJA 4JZQA 5J5NA 1TOFA 2LV3A 4LA1A 2NDOA 2PN8A 2YWNA 4O92A 4IN0A 5JCUA 3KIJA 4ZBDA 2B1LA 4MP4A 2VOCA 2ZNMA 5D9WA 1PN0A 1URMA 5B8BA 3GL3A 2GT5A 5ECNB 2G0FA 5LCZA 1F37A 2RM6A 4GRFA 2R2JA 2DJ3A 4TKYA 3M9KA 4ACSA 1TK5B 4KF9A 2JACA 1T4ZA 2L5LA 4O5RA 5EVOA 4PGTA 1TTZA 5LNKe 1QMVA 1K0DA 3CSHA 3ZTLA 3CBUA 2H6XA 3VI7A 4KA0A 2E2MA 2JZRA 1HYUA 4BWQA 1A24A 4HDEA 2C4JA 1QGVA 4FIWA 5H5QA 5IPGA 3HD5A 4F9ZA 3GIXA 1FG4A 1THXA 3FZ4A 3LW9A 1T8EB 2VCTA 2HFDA 2F8AA 4RQRA 3F3QA 3HKRA 1J0FA 4K2DA 4LMVA 3SWLA 1VF2A 1PKZA 4QL9A 3TKSC 1TU7A 4EKZA 2VL3A 2HSMA 3TJKA 2PBJA 3BD2A 4ZL8A 2DBCA 3L78A 3P8WA 1QK8A 2FA8A 2X99A 1ERWA 1JZRA 3QFAC 3KJYA 2FCHA 4FYCA 1OKDA 5GAND 2HE3A 1F2EA 5D96A 4ZL7A 2V2GA 1QXHA 5CO3A 5E59A 1JLVA 2QA2A 3IA1A 3CRUA 2H19A 1W4VA 3JCML 3C7MA 1N2AA 1PGTA 2LJKA 3DRNA 3GH6A 1RW1A 2H73A 2R0CA 4KX4A 1EGRA 2FGXA 3QD9A 3ZREA 1YEXA 3CSJA 4TXOB 4GTUA 5ECKB 4K7NA 1O6JA 1WOUA 4GF0A 3KM6A 3M3MA 1T00A 3VWUA 5D73A 1E6BA 3HVSA 1GSQA 4TXOA 1PKWA 2A4HA 3IOSA 1R5PA 4G19A 1GTAA 1GLPA 4Z2TA 1PMTA 4OFTA 4MJEA 5ECOB 1WWJA 3TJJA 3UBLA 2H8LA 3ZRDA 2NVLA 4TW5A 4DSQA 1A2JA 1WJKA 3TJBA 4WETA 1OYJA 5A4UA 1YF0A 2I4AA 1PSQA 4BPYA 2DLXA 3K8NA 4XS6A 1M0UA 1X9WB 3CXGA 4AJ7A 2CX3A 4TOPA 4XTSA 1XIYA 3TRXA 2JZTA 2GSTA 1AIUA 1Z6NA 1XXUA 1XZOA 1PRXA 4WBRD 1V9WA 3DVWA 3F6FA 4DSRA 2IN3A 2H70A 4MLYA 4GSTA 1FVJA 4BVXB 3RBTA 5IMDA 3G7JA 3UL3A 3LFLA 1VGLA 5ECPB 6GSTA 5GAPD 3LG6A 2L59A 5HR1A 1HQOA 3VWVA 4BVXA 3GSSA 2TRXA 1SK2A 5ECLB 3CRTA 2VUPA 3IHQA 3BJ5A 1T7PB 2MMAA 2HRAA 4IKHA 1Z3EA 2GLRA 3HZ4A 2VLVA 1SYRA 2LEGA 1AQVA 2R5GA 4IS0A 1YEPA 1BG5A 4EVMA 4POMA 2H0GA 3FHKA 3A2VA 5KEJA 5GSTA 1KBNA 2MMOA 3DIEA 3TUEA 3HXSA 4TR4A 1VF4A 2LQQA 4X4JA 3J7Yb 2YN1A 3O6TA 3WGXA 5EPFA 2LRTA 1ACVA 2BMXA 2H30A 5D8IA 4CDOA 5BRTA 2HRFA 4H86A 4D73B 6GSYA 4E8EA 3C1RA 1XFLA 2X49A 3H79A 4G0KA 4D73A 2YV7A 3FZAA 1XWGA 2F3MA 2R0PA 4RQXA 5ECHB 5JWOB 2ON7A 3D4MA 5HFKA 5IIZA 2LUSA 4ULXA 3TKQA 3FRCA 3IHGA 4L5OA 3CYNA 3UOMA 3E3EA 2OE0A 1WRYA 1PL1A 2A4VA 2ZCTA 3FR9A 3BBYA 2GS3A 2MMZA 4EIPA 4IELA 1E2YA 4A5PA 2VCVA 3GRXA 5DAKB 2IFQB 4MZWA 1ZYEA 3QMXA 1FB0A 2LRCA 2RM5A 1SK1A 3OR5A 2IWTA 1ZCPA 2F51A 5IO2A 1O8WA 1SL1B 3ERGA 4QQ7A 5DAKA 2IFQA 1ILOA 3D0ZA 8GSSA 2LQOA 2H66A 2HZEB 1F3BA 5D9VA 1DE2A 3IDVA 5G1LA 3LYKA 3W6GA 3QAGA 4X1UA 1AAZA 3HCZA 1U3IA 3D5JA 3Q6OA 2DC5A 3U5RE 2HZEA 3MIXA 3GHAA 3A2XA 3PINA 18GSA 3N9JA 2KP2A 5JWQB 3KMNA 5J4UA 4MPFA 20GSA 5G2ZA 4JEDA 1Y6EA 2JSZA 2QKEA 2H1DA 3M0FA 1EOHA 1M2BA 2L4QA 1AQXA 1V2AA 3IBHA 5F07A 4ZL9A 4MF5A 2WFCA 4FO5A 1ZL9A 1R5AA 2V6OA 2XPDA 4G0IA 1ST9A 3I43A 3HYPA 4TR0A 5DJMA 1O8XA 4BL7B 2OADA 1NSWA 5B6MA 3BCKA 4J57E 5AIXA 5B6NA 2B5EA 3TGZA 3NZNA 1SKSB 4MH2A 1VRSD 3LJRA 1JHBA 3ZZXA 4BL7A 1A2LA 2R0GA 4MF7A 3HZ8A 1V58A 5J9BA 3F63A 2HSYA 2VLTA 1XW6A 2B7JA 1Y25A 4IP1A 2VL2A 2FD3A 3E9JB 3GYKA 1ZYQB 2C0DA 3HY2A 2CVDA 2VCXA 2H74A 3CMIA 3WGEA 1H75A 1M9AA 4EDYA 2DJJA 3GV1A 4IQAA 3QCPA 1X5EA 4I8BA 2L57A 5HR0A 3UMAA 3PR8A 4DVCA 1OE8A 1T1VA 2K8VA 2FY6A 3GL5A 4HOJA 1J9BA 4XS4B 3QAWA 2GSSA 1LU4A 2JL4A 4HQSA 1VF1A 1Q98A 1ZMAA 4HQZA 4XS4A 2C0GA 2DJKA 4ECBA 5DVBA 2N5FA 3GFKA 1X0RA 3C71A 4ZBAA 1PX7A 4FQUA 2H72A 1TRUA 3FKFA 5CREA 1ZGNA 5DQYA 2N5BA 3IK9A 3A3TA 4FH8A 5H5SA 3TJGA 3VI5A 4FYUA 2IJYA 2DKHA 1GLQA 4WKWA 5E4WA 1V98A 4YAVA 2EIOA 4F03A 6GSUA 2X8HA 4CY8A 2YWOA 2AB6A 2JSYA 2P5QA 3ISOA 3ZVJD 3L9VA 1B4PA 2CVKA 2UZ8A 4PTSA 3O3TA 4CHSA 1TRWA 3F9UA 2LS5A 3GKMA 3NOFA 4OWYA 1Z9HA 2FWEA 4RI7A 4XRAA 4YQUA 1ON4A 1GSUA 1K3OA 3AY8A 1SKRB 3UARA 1MDKA 1BJXA 4N30A 2WS2A 5G30A 2B3SA 2CZ3A 3APQA 3MYDA 4V2LA 2GSQA 4KUNA 5KN3A 4HZ2A 3F0IA 4PX1A 4YKGA 4MJBA 1ZYPA 1U3AA 2HSHA 1M2DA 3R3EA 3PGTA 1DSBA 1OC3A 4J2FA 1EV4A 3ZL5A 2O85A 4GCIA 4EC0A 4PQ1A 2FNOA 1GTIA 1XOAA 1TW9A 1BEDA 2BTOT 3LXZA 1SD8A 3EE2A 4ZILA 4MZCA 1QUWA 1U88A 2DSAA 3FMWA 2H01A 4KB3A 4E8HA 2F9SA 6GSWA 5G1KA 1EV9A 1A0RP 3UVHA 1B9YC 2B7KA 4X0XA 3L4NA 2PPTA 4NAXA 1A0FA 2WGRA 3KP8A 5F8BA 3FR3A 4RI6A 4HZ4A 3DD3A 5D9XA 1CQHA 1G7EA 2M72A 4MDCA 1YQ1A 1UVZA 4ZB8A 4GWRA 3ZFLA 1K0CA 1SL2B 4DEJA 2KP1A 3N5OA 4CW9A 1TDIA 5AIVA 4I5QA 2IMKA 4TXVA 2GT6A 4POBA 4PNGA 1TKDB 3VFIA 4WR4A 1UN2A 1WIKA 3DYRA 4KDYA 4PUAA 3US3A 4POKA 3RPPA 3VURA 4K0NA 3H4KA 1MD4A 2VD0A 1K0AA 4OFMA 4WF5A 2WZ9A 4L0UA 2K9FA 2YV9A 1FOVA 2CZ2A 3D21A 2FWHA 2LNSA 3W8SA 4ZB9A 5C04A 4IQ1A 3EPTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EC4 A;  1GSS A;  2O87 A;  2X8C A;  2FWG A;  2OE1 A;  3D4T A;  3J7Y k;  2GGT A;  7GSS A;  4OO5 A;  1M9B A;  1BX9 A;  4BA7 A;  2H6Z A;  5D9T A;  1X9M B;  1JZW A;  2HLS A;  3GMF A;  4MZB A;  1F6M C;  4F0B A;  4GQF A;  2YCD A;  4YQV A;  3G7I A;  2OJL A;  4AF2 A;  2IL3 A;  5KN0 A;  2HYX A;  9GSS A;  4LL4 B;  4MK3 A;  4ZBB A;  2V6K A;  2J9H A;  2YJ7 A;  1G0T A;  1GNE A;  1TXX A;  1T3B A;  3ZVJ A;  4TVE A;  5IMC A;  5DAL B;  3ZLP A;  3DEX A;  1M2A A;  1ABA A;  2VLU A;  5FT3 A;  2B1K A;  2CT6 A;  3F4R A;  2RUF A;  1N8J A;  3WT1 A;  6GSV A;  5DAL A;  4NHZ A;  3ZFB A;  1USB A;  1UA5 A;  4N11 A;  3TKS A;  5ECI B;  3U6V A;  4EDZ A;  1TP9 A;  3RDW A;  4EXJ A;  4HEA 2;  4KH7 A;  1QFN A;  5CAX A;  2N5A A;  3TCO A;  1YF1 A;  3ERW A;  2RUE A;  3DML A;  3S9F A;  1KNG A;  3C1S A;  4X43 A;  1VF3 A;  3IAM 2;  3M1G A;  3GH9 A;  4XHM A;  5IMF A;  5G5F A;  3W8J A;  1OC9 B;  2RII A;  4G10 A;  1XVQ A;  2YWM A;  3KTL A;  3LGC A;  4OCE A;  3FZ5 A;  5GSS A;  1GSY A;  2MYG A;  1JFU A;  3RPN A;  1OVN A;  1OC9 A;  4WF4 A;  2JU5 A;  3H93 A;  3IAS 2;  2H0I A;  2VM2 A;  2GSR A;  2ZUP A;  3D6I A;  2E0Q A;  1DUG A;  1G6W A;  2CX4 A;  3CTF A;  5CRD A;  2VCZ A;  22GS A;  2K6V A;  3CSI A;  1Z5Y E;  3KMO A;  4Z7X A;  1B8X A;  11GS A;  2I3Y A;  2XBQ A;  2JZS A;  4TR3 A;  3APO A;  1HD2 A;  1ZZY A;  2MBT A;  3P7X A;  1I9D A;  4PUR A;  1XVW A;  1V40 A;  4G9H A;  1X9S B;  1TU8 A;  2H76 A;  2KOK A;  1THO A;  2LKU A;  1GTU A;  2XBI A;  5H5R A;  3PH9 A;  1EEJ A;  5JWR B;  3F8U A;  4JBB A;  5FWG A;  3RHB A;  5DBQ A;  3IV4 A;  4ECI A;  2XC2 A;  5A4W A;  3TRP A;  3ZYW A;  5J41 A;  3C8E A;  4WXT A;  1NM3 A;  3ED3 A;  4ID0 A;  1GUM A;  1FB6 A;  1GWC A;  4YQM A;  5EY6 A;  3HHV A;  1K0O A;  3FY7 A;  4N10 A;  2WRT A;  3GX8 A;  12GS A;  3ME8 A;  3IC4 A;  2AAW A;  5DDL A;  1R7H A;  4L0W A;  1K0B A;  3VPT A;  4L8E A;  1X5D A;  2V41 A;  3GNJ A;  1UC7 A;  1TRV A;  4MJC A;  3M9J A;  4KND A;  1K0M A;  1MDJ A;  2FUG 2;  5FHI A;  5G5E A;  5ID2 B;  1JZO A;  5COH A;  2TIR A;  2B5X A;  1A8Y A;  14GS A;  2DMM A;  2VO4 A;  3FW2 A;  3G9B A;  2C3N A;  5CYY A;  2XHF A;  3QR6 A;  1LJR A;  5ID2 A;  3V1W A;  2PVQ A;  4I2U A;  3ZMK A;  16GS A;  1C72 A;  1EZK A;  1SJZ A;  5IMZ A;  4ECJ A;  4IJ3 A;  4DSS B;  1B9X C;  1G6Y A;  1SJI A;  5GZZ B;  3EYT A;  5A4V A;  1TI1 A;  5AGY A;  2F8F A;  2R4V A;  1QQ2 A;  5A5K A;  1SD9 A;  4DSS A;  3BCI A;  3KCM A;  4ZB6 A;  2VM1 A;  4PQI A;  3FR6 A;  4NMU A;  1HNB A;  1NHY A;  4Q5N A;  3GST A;  4NHW A;  4IVF A;  2FLS A;  3L9U A;  3WGD A;  2AV4 A;  2EIR A;  2C0F A;  1XWK A;  1GUK A;  3EC3 A;  1AXD A;  3KD0 A;  2E2G A;  4KW6 A;  5CP1 A;  5CNW A;  4ECC A;  4WEY A;  3EIN A;  5F05 A;  1M99 A;  4JE1 A;  3TOU A;  1JLW A;  4HS1 A;  1OC8 A;  3WD6 A;  2IMD A;  3ME7 A;  1MD3 A;  2WB9 A;  4MA9 A;  3GKX A;  2H75 A;  3LXT A;  3WT2 A;  4MMM A;  5L71 A;  4KDU A;  3LQ7 A;  4I97 A;  4IP6 A;  2C3T A;  4O7H A;  3DWV A;  3IPZ A;  2C80 A;  3EVI A;  2AUV A;  2IMF A;  3H1N A;  1FAA A;  5DJL A;  1K3L A;  2OKA A;  3KZQ A;  5HR2 A;  1GUH A;  3HDC A;  3TB2 A;  2E7P A;  3KH7 A;  3VWX A;  1OKT A;  1A2M A;  4YH2 A;  1ERV A;  3LWA A;  4FYB A;  3UJ1 A;  4AGS A;  3GKN A;  1SK0 A;  1BYE A;  2WDU A;  4V2N A;  1XWC A;  2TRC P;  1MDI A;  3VLN A;  4KAE A;  2GZP A;  2QC7 A;  4LL1 B;  2YNX A;  4GQC A;  5IMV A;  2AJQ B;  3EU3 A;  2PWJ A;  1S3D A;  4I2T A;  2REM A;  4K9Z A;  3Q74 A;  2OBK A;  3DGQ A;  1KTE A;  3ZIT A;  2RLI A;  1Q4J A;  2K18 A;  2QGV A;  4QL7 A;  1WP0 A;  3MDK A;  4NXI A;  1YJ6 A;  3ERF A;  13GS A;  5INY A;  3HJM A;  2L4C A;  3KEB A;  2DJ2 A;  4OMV A;  1Z6M A;  3A5W A;  2CVB A;  5D93 A;  1EP7 A;  2YZU A;  2WJU A;  4BVY A;  2A2R A;  2I81 A;  2KUC A;  4I6X A;  1GTB A;  5CRG A;  4TN8 A;  2BJX A;  1GSD A;  2NPB A;  5ECS A;  4O32 A;  1EWX A;  5EL8 A;  3IE3 A;  2VIM A;  2GVP A;  3LOR A;  3KGK A;  3UIW A;  1T4Y A;  4Q5Q A;  1GRX A;  2LJR A;  5CRH A;  2GQL A;  1PD2 1;  5JCG A;  5HQP A;  3IK7 A;  4KSO A;  2VL9 A;  4JU5 A;  3GA4 A;  4HI7 A;  4EL1 A;  3DVX A;  3MNG A;  2DIY A;  1NHO A;  5KN1 A;  4KDX A;  2P0G A;  1CQG A;  4F0C A;  1TK8 B;  1BAY A;  5DCG A;  2XPE A;  17GS A;  4N0Z A;  1M7T A;  3BOA A;  2FA4 A;  2YJH A;  4XIH A;  2M46 A;  4PXO A;  3R2Q A;  4ZXG A;  4OD7 A;  4MH3 A;  5JCW A;  10GS A;  4JRR A;  3FZ9 A;  2AHE A;  3F4T A;  3MWH A;  5AIS A;  4TRX A;  3TKP A;  5IOW A;  2GZY A;  2GZZ A;  2R37 A;  3MSZ A;  5ECR B;  3QAV A;  3M8N A;  4GSN A;  1FO5 A;  1A8L A;  1R4W A;  1Z7R A;  3A2W A;  6GSS A;  2IPA A;  1U6T A;  2WUL A;  3ZIJ A;  3NIV A;  3QPM A;  4HJ2 A;  1O81 A;  2H6Y A;  1TI3 A;  4IW9 A;  3GTU B;  1GH2 A;  5F0G A;  4KCA A;  1WPI A;  1A23 A;  2NTO A;  2H0H A;  2QSI A;  3FK8 A;  4P3Y B;  2A2S A;  2G2Q A;  4XCS A;  2VCW A;  3D22 A;  2R6K A;  2YPM A;  3GTU A;  2X64 A;  3Q19 A;  1K0N A;  1TRS A;  4HUA A;  4WR5 A;  1R26 A;  4BWS A;  3DXB A;  5B8A A;  4GLT A;  1ERU A;  4V2M A;  4K0G A;  4K8M A;  2VD1 A;  5IM9 A;  2YOI A;  3MAK A;  1U87 A;  4F82 A;  2OA7 A;  3FEU A;  1YDK A;  5CRW A;  3P90 A;  4GSS A;  2MZC A;  2V32 A;  2DIZ A;  3DKS A;  2L5O A;  1I5G A;  1XW5 A;  2ES7 A;  1YY7 A;  2LNT A;  1SL0 B;  2FHE A;  2HRN A;  1OE7 A;  1O85 A;  1FW1 A;  2LTK A;  3TRQ A;  3VPQ A;  3LSZ A;  4Q5F A;  3IR4 A;  5HFI A;  3G7Y A;  4ILF A;  3F6D A;  3TOT A;  5IPH A;  3QFB C;  1ML6 A;  3Q18 A;  2P5R A;  3GKK A;  2R3X A;  2C8U A;  2LST A;  4EE0 A;  2HZF A;  2LRN A;  1XW9 A;  2YP6 A;  3LEF A;  2LJA A;  1YZX A;  2PU9 C;  4N0V A;  4V1A g;  1GP1 A;  2D2Z A;  1SKW B;  3RAZ A;  1LBK A;  4EF0 A;  5ECM B;  2GTU A;  4KCE A;  2HXK A;  3EMX A;  4IHU A;  3VWW A;  2H71 A;  4JR6 A;  3WYW A;  2O7K A;  4LMW A;  2CAQ A;  2CQ9 A;  3RHC A;  1PA3 A;  4IGJ A;  2OBI A;  3HJO A;  3I6A A;  1RK4 A;  4TR1 B;  1XOB A;  4K6X A;  2AYT A;  4MCU A;  3KP9 A;  1Z7P A;  3HVX A;  6GSX A;  2B6M A;  2VL2 C;  2YWI A;  1J08 A;  2HT9 A;  1GNW A;  1WMJ A;  3HJP A;  3P2A A;  2DJ0 A;  2VCQ A;  1PL2 A;  3E0U A;  3ZML A;  4TR1 A;  4ML1 A;  3UBK A;  4NWY A;  5HR3 A;  4OCF A;  5DCH A;  1DBY A;  4YAP A;  4NV5 A;  1ERT A;  2FWF A;  1YKA A;  4OO4 A;  4POL A;  1NW2 A;  5J9C A;  4OFN A;  2V1M A;  5B7C A;  4KSM A;  1GUL A;  3GN3 A;  4HU9 A;  2L6C A;  3L9S A;  1SU9 A;  3CTG A;  5HFG A;  4F2I A;  1FVK A;  1TJD A;  5IO0 A;  2GQK A;  4G2E A;  4K7I A;  2C0E A;  2CA8 A;  2PUK C;  5C00 A;  4HU7 A;  1PN9 A;  2X8G A;  1F3A A;  5ELA A;  2JAD A;  1S3A A;  5ABR A;  3VK9 A;  3C73 A;  2NBS A;  4K1F A;  3F4S A;  2J23 A;  3APS A;  2GDR A;  4EUY A;  2C1Y A;  4MJA A;  3UVT A;  4RUV A;  1HNA A;  3KTB A;  2HNL A;  3SBC A;  4LLR A;  3F3R A;  5ENU A;  2I9H A;  1X5C A;  3QDN A;  2DJ1 A;  2O8V B;  1AUC A;  3TKR A;  5ELG A;  2GQM A;  4KE3 A;  2HI7 A;  4PUF C;  2PER A;  1XPV A;  4ML6 A;  3UAP A;  1BQ7 A;  5J3R A;  2P31 A;  5F06 A;  3EU4 A;  1V57 A;  1W89 A;  4XRD A;  2M80 A;  3IXR A;  4ISD A;  1EGO A;  3HA9 A;  4XS1 A;  5AN1 A;  3I9V 2;  1GSE A;  5IQY A;  19GS A;  3ZIV A;  1MTC A;  1SYX A;  1JZD A;  2YAN A;  2YZH A;  1G7O A;  1AC1 A;  2OE3 A;  4PNF A;  2H1G A;  1GSF A;  3TKS E;  4AJ6 A;  2EIQ A;  1PX6 A;  1B48 A;  1O73 A;  4MAB A;  2ON5 A;  3QOU A;  3FYG A;  1XWB A;  1HNC A;  1DE1 A;  5IMA A;  3TDG A;  4AJ8 A;  1PQN A;  3H8Q A;  4IJI A;  2L6D A;  4J56 E;  3HVV A;  2VAF A;  4PQH A;  4JR4 A;  2CV4 A;  1FHE A;  2IIY A;  3UEM A;  1YKC A;  2KLX A;  4V1A p;  3KH9 A;  2PGT A;  1H4O A;  3GX0 A;  3EUR A;  3TJF A;  3EWL A;  2H1A A;  2C3Q A;  1EEM A;  3IRA A;  3KXO A;  4ZIJ A;  5G31 A;  1RQM A;  3GUS A;  1AQW A;  1SEN A;  5DQS A;  1XCC A;  1S3C A;  2ALB A;  4EO3 A;  1GL8 A;  2CAI A;  1OAZ A;  1IYH A;  1O7U A;  3EMP A;  4MF6 A;  1XWA A;  4NV2 A;  1SJ6 A;  5LD0 A;  2OAC A;  1F9M A;  2WCI A;  5KN2 A;  2H1B A;  2MMN A;  1XBS A;  4MPG A;  1ZOF A;  2B5Y A;  2I1U A;  4IBP A;  4GXZ A;  4KGI A;  1KEB A;  3O76 A;  3L0H A;  2IMI A;  3I69 A;  2KHP A;  4Q5R A;  2IME A;  1K3Y A;  1IYI A;  1MEK A;  5IOX A;  2MBS A;  1B4Q A;  5ECQ B;  2K8S A;  1EP8 A;  2Z9S A;  1AW9 A;  3LYP A;  4L5L A;  2O89 A;  2DML A;  4NPB A;  3GUR A;  4HJM A;  4K7O A;  1WE0 A;  2PVO C;  1TK0 B;  2PMT A;  4WBJ A;  4JZQ A;  5J5N A;  1TOF A;  2LV3 A;  4LA1 A;  2NDO A;  2PN8 A;  2YWN A;  4O92 A;  4IN0 A;  5JCU A;  3KIJ A;  4ZBD A;  2B1L A;  4MP4 A;  2VOC A;  2ZNM A;  5D9W A;  1URM A;  5B8B A;  3GL3 A;  2GT5 A;  5ECN B;  2G0F A;  5LCZ A;  1F37 A;  2RM6 A;  4GRF A;  2R2J A;  2DJ3 A;  4TKY A;  3M9K A;  4ACS A;  1TK5 B;  2JAC A;  1T4Z A;  2L5L A;  4O5R A;  5EVO A;  4PGT A;  1TTZ A;  5LNK e;  1QMV A;  1K0D A;  3CSH A;  3ZTL A;  3CBU A;  2H6X A;  3VI7 A;  4KA0 A;  2E2M A;  2JZR A;  1HYU A;  4BWQ A;  1A24 A;  4HDE A;  2C4J A;  1QGV A;  4FIW A;  5H5Q A;  5IPG A;  3HD5 A;  4F9Z A;  3GIX A;  1FG4 A;  1THX A;  3FZ4 A;  1T8E B;  2VCT A;  2HFD A;  2F8A A;  4RQR A;  3F3Q A;  3HKR A;  1J0F A;  4K2D A;  4LMV A;  3SWL A;  1VF2 A;  1PKZ A;  4QL9 A;  3TKS C;  1TU7 A;  4EKZ A;  2VL3 A;  3TJK A;  2PBJ A;  3BD2 A;  4ZL8 A;  2DBC A;  3L78 A;  3P8W A;  1QK8 A;  2FA8 A;  2X99 A;  1ERW A;  1JZR A;  3QFA C;  3KJY A;  2FCH A;  4FYC A;  1OKD A;  5GAN D;  2HE3 A;  1F2E A;  5D96 A;  4ZL7 A;  2V2G A;  1QXH A;  5CO3 A;  5E59 A;  1JLV A;  3IA1 A;  3CRU A;  2H19 A;  1W4V A;  3JCM L;  3C7M A;  1N2A A;  1PGT A;  2LJK A;  3DRN A;  3GH6 A;  1RW1 A;  2H73 A;  4KX4 A;  1EGR A;  2FGX A;  3QD9 A;  3ZRE A;  1YEX A;  3CSJ A;  4TXO B;  4GTU A;  5ECK B;  4K7N A;  1O6J A;  1WOU A;  4GF0 A;  3KM6 A;  3M3M A;  1T00 A;  3VWU A;  5D73 A;  1E6B A;  3HVS A;  1GSQ A;  4TXO A;  1PKW A;  3IOS A;  1R5P A;  4G19 A;  1GTA A;  1GLP A;  1PMT A;  4OFT A;  4MJE A;  5ECO B;  1WWJ A;  3TJJ A;  3UBL A;  2H8L A;  3ZRD A;  2NVL A;  4TW5 A;  4DSQ A;  1A2J A;  1WJK A;  3TJB A;  4WET A;  1OYJ A;  5A4U A;  1YF0 A;  2I4A A;  1PSQ A;  4BPY A;  2DLX A;  3K8N A;  4XS6 A;  1M0U A;  1X9W B;  3CXG A;  4AJ7 A;  2CX3 A;  4TOP A;  4XTS A;  1XIY A;  3TRX A;  2JZT A;  2GST A;  1AIU A;  1Z6N A;  1XXU A;  1XZO A;  1PRX A;  4WBR D;  1V9W A;  3DVW A;  3F6F A;  4DSR A;  2IN3 A;  2H70 A;  4MLY A;  4GST A;  1FVJ A;  3RBT A;  5IMD A;  3G7J A;  3UL3 A;  3LFL A;  1VGL A;  5ECP B;  6GST A;  5GAP D;  3LG6 A;  2L59 A;  5HR1 A;  1HQO A;  3VWV A;  4BVX A;  3GSS A;  2TRX A;  1SK2 A;  5ECL B;  3CRT A;  2VUP A;  3IHQ A;  3BJ5 A;  1T7P B;  2MMA A;  4IKH A;  1Z3E A;  2GLR A;  3HZ4 A;  2VLV A;  1SYR A;  2LEG A;  1AQV A;  2R5G A;  4IS0 A;  1YEP A;  1BG5 A;  4EVM A;  4POM A;  2H0G A;  3FHK A;  3A2V A;  5KEJ A;  5GST A;  1KBN A;  2MMO A;  3DIE A;  3TUE A;  3HXS A;  4TR4 A;  1VF4 A;  2LQQ A;  3J7Y b;  2YN1 A;  3O6T A;  3WGX A;  5EPF A;  2LRT A;  1ACV A;  2BMX A;  2H30 A;  5D8I A;  4CDO A;  2HRF A;  4H86 A;  4D73 B;  6GSY A;  4E8E A;  3C1R A;  1XFL A;  3H79 A;  4D73 A;  2YV7 A;  3FZA A;  1XWG A;  2F3M A;  4RQX A;  5ECH B;  5JWO B;  2ON7 A;  3D4M A;  5HFK A;  5IIZ A;  2LUS A;  4ULX A;  3TKQ A;  3FRC A;  4L5O A;  3CYN A;  3UOM A;  3E3E A;  2OE0 A;  1WRY A;  1PL1 A;  2A4V A;  2ZCT A;  3FR9 A;  3BBY A;  2GS3 A;  2MMZ A;  4IEL A;  1E2Y A;  2VCV A;  3GRX A;  5DAK B;  2IFQ B;  4MZW A;  1ZYE A;  3QMX A;  1FB0 A;  2LRC A;  2RM5 A;  1SK1 A;  3OR5 A;  2IWT A;  1ZCP A;  2F51 A;  5IO2 A;  1O8W A;  1SL1 B;  3ERG A;  4QQ7 A;  5DAK A;  2IFQ A;  1ILO A;  3D0Z A;  8GSS A;  2LQO A;  2H66 A;  2HZE B;  1F3B A;  5D9V A;  1DE2 A;  3IDV A;  5G1L A;  3LYK A;  3W6G A;  3QAG A;  4X1U A;  1AAZ A;  3HCZ A;  1U3I A;  3D5J A;  3Q6O A;  2DC5 A;  3U5R E;  2HZE A;  3GHA A;  3A2X A;  3PIN A;  18GS A;  3N9J A;  2KP2 A;  5JWQ B;  3KMN A;  5J4U A;  4MPF A;  20GS A;  5G2Z A;  4JED A;  1Y6E A;  2JSZ A;  2QKE A;  2H1D A;  3M0F A;  1EOH A;  1M2B A;  2L4Q A;  1AQX A;  1V2A A;  3IBH A;  5F07 A;  4ZL9 A;  4MF5 A;  2WFC A;  4FO5 A;  1ZL9 A;  1R5A A;  2V6O A;  2XPD A;  1ST9 A;  3I43 A;  3HYP A;  4TR0 A;  5DJM A;  1O8X A;  2OAD A;  1NSW A;  5B6M A;  3BCK A;  4J57 E;  5AIX A;  5B6N A;  2B5E A;  3TGZ A;  3NZN A;  1SKS B;  4MH2 A;  1VRS D;  3LJR A;  1JHB A;  3ZZX A;  4BL7 A;  1A2L A;  4MF7 A;  3HZ8 A;  1V58 A;  5J9B A;  3F63 A;  2HSY A;  2VLT A;  1XW6 A;  2B7J A;  1Y25 A;  4IP1 A;  2VL2 A;  2FD3 A;  3E9J B;  3GYK A;  1ZYQ B;  2C0D A;  3HY2 A;  2CVD A;  2VCX A;  2H74 A;  3CMI A;  3WGE A;  1H75 A;  1M9A A;  4EDY A;  2DJJ A;  3GV1 A;  4IQA A;  3QCP A;  1X5E A;  4I8B A;  2L57 A;  5HR0 A;  3UMA A;  3PR8 A;  4DVC A;  1OE8 A;  1T1V A;  2K8V A;  2FY6 A;  3GL5 A;  4HOJ A;  1J9B A;  4XS4 B;  3QAW A;  2GSS A;  1LU4 A;  2JL4 A;  4HQS A;  1VF1 A;  1Q98 A;  1ZMA A;  4HQZ A;  4XS4 A;  2C0G A;  2DJK A;  4ECB A;  5DVB A;  2N5F A;  3GFK A;  1X0R A;  3C71 A;  4ZBA A;  1PX7 A;  2H72 A;  1TRU A;  3FKF A;  5CRE A;  1ZGN A;  5DQY A;  2N5B A;  3IK9 A;  3A3T A;  4FH8 A;  5H5S A;  3TJG A;  3VI5 A;  4FYU A;  2IJY A;  4WKW A;  1GLQ A;  5E4W A;  1V98 A;  4YAV A;  2EIO A;  4F03 A;  6GSU A;  2X8H A;  2YWO A;  2AB6 A;  2JSY A;  2P5Q A;  3ISO A;  3ZVJ D;  3L9V A;  1B4P A;  2CVK A;  3O3T A;  4CHS A;  1TRW A;  3F9U A;  2LS5 A;  3GKM A;  3NOF A;  4OWY A;  1Z9H A;  2FWE A;  4RI7 A;  4XRA A;  4YQU A;  1ON4 A;  1GSU A;  1K3O A;  3AY8 A;  1SKR B;  3UAR A;  1MDK A;  1BJX A;  4N30 A;  2WS2 A;  5G30 A;  2B3S A;  2CZ3 A;  3APQ A;  4V2L A;  2GSQ A;  4KUN A;  5KN3 A;  4HZ2 A;  3F0I A;  4PX1 A;  4MJB A;  1U3A A;  2HSH A;  1M2D A;  3PGT A;  1DSB A;  1OC3 A;  4J2F A;  1EV4 A;  3ZL5 A;  2O85 A;  4GCI A;  4EC0 A;  4PQ1 A;  2FNO A;  1GTI A;  1XOA A;  1TW9 A;  1BED A;  2BTO T;  3LXZ A;  1SD8 A;  3EE2 A;  4ZIL A;  4MZC A;  1QUW A;  1U88 A;  2DSA A;  2H01 A;  4KB3 A;  4E8H A;  2F9S A;  6GSW A;  5G1K A;  1EV9 A;  1A0R P;  3UVH A;  1B9Y C;  2B7K A;  4X0X A;  3L4N A;  2PPT A;  4NAX A;  1A0F A;  2WGR A;  3KP8 A;  5F8B A;  3FR3 A;  4RI6 A;  4HZ4 A;  3DD3 A;  5D9X A;  1CQH A;  1G7E A;  2M72 A;  4MDC A;  1YQ1 A;  1UVZ A;  4ZB8 A;  4GWR A;  3ZFL A;  1K0C A;  1SL2 B;  4DEJ A;  2KP1 A;  3N5O A;  4CW9 A;  1TDI A;  5AIV A;  4I5Q A;  2IMK A;  4TXV A;  2GT6 A;  4POB A;  4PNG A;  1TKD B;  3VFI A;  4WR4 A;  1UN2 A;  1WIK A;  3DYR A;  4KDY A;  4PUA A;  3US3 A;  4POK A;  3RPP A;  3VUR A;  4K0N A;  3H4K A;  1MD4 A;  2VD0 A;  1K0A A;  4OFM A;  4WF5 A;  2WZ9 A;  4L0U A;  2K9F A;  2YV9 A;  1FOV A;  2CZ2 A;  3D21 A;  2FWH A;  2LNS A;  3W8S A;  4ZB9 A;  5C04 A;  4IQ1 A;  1EOG A; 
#chains in the Genus database with same CATH topology
 2EC4 A;  1GSS A;  2O87 A;  2X8C A;  2FWG A;  2OE1 A;  3D4T A;  3J7Y k;  2GGT A;  7GSS A;  4OO5 A;  1M9B A;  1BX9 A;  4BA7 A;  2H6Z A;  5D9T A;  1X9M B;  1JZW A;  2HLS A;  3GMF A;  4MZB A;  1F6M C;  4F0B A;  4GQF A;  2YCD A;  4YQV A;  3G7I A;  2OJL A;  4AF2 A;  2IL3 A;  5KN0 A;  2HYX A;  9GSS A;  4LL4 B;  4MK3 A;  4ZBB A;  2V6K A;  2J9H A;  2YJ7 A;  1G0T A;  1GNE A;  1TXX A;  1T3B A;  3ZVJ A;  4TVE A;  4ICY A;  5IMC A;  5DAL B;  3ZLP A;  3DEX A;  1M2A A;  1ABA A;  2VLU A;  5FT3 A;  2B1K A;  2CT6 A;  3F4R A;  2RUF A;  1N8J A;  3WT1 A;  6GSV A;  5DAL A;  4NHZ A;  3ZFB A;  1USB A;  1UA5 A;  4N11 A;  3TKS A;  5ECI B;  3U6V A;  4EDZ A;  1TP9 A;  3RDW A;  4EXJ A;  4HEA 2;  4KH7 A;  1QFN A;  5CAX A;  2N5A A;  3TCO A;  1YF1 A;  3ERW A;  2RUE A;  4Z2U A;  3DML A;  3S9F A;  1KNG A;  3C1S A;  4X43 A;  1VF3 A;  3IAM 2;  3M1G A;  3GH9 A;  4XHM A;  5IMF A;  5G5F A;  3W8J A;  1OC9 B;  2RII A;  4G10 A;  1XVQ A;  2YWM A;  3KTL A;  4O5Q A;  3LGC A;  4OCE A;  3FZ5 A;  5GSS A;  1GSY A;  4O5U A;  2MYG A;  1JFU A;  3RPN A;  1OVN A;  1OC9 A;  4WF4 A;  2JU5 A;  3H93 A;  3IAS 2;  2H0I A;  2VM2 A;  2GSR A;  2ZUP A;  4K2X A;  4K5S A;  3D6I A;  2E0Q A;  1DUG A;  1G6W A;  2CX4 A;  3CTF A;  5CRD A;  2VCZ A;  22GS A;  2K6V A;  3CSI A;  1Z5Y E;  3KMO A;  4Z7X A;  1ZYN A;  1B8X A;  11GS A;  2I3Y A;  2XBQ A;  2JZS A;  4TR3 A;  3APO A;  1HD2 A;  1ZZY A;  2MBT A;  3P7X A;  1I9D A;  4PUR A;  1XVW A;  1V40 A;  4G9H A;  1M3J A;  1X9S B;  1TU8 A;  2H76 A;  2KOK A;  1THO A;  2LKU A;  1GTU A;  2XBI A;  5H5R A;  3PH9 A;  1EEJ A;  5JWR B;  3F8U A;  4JBB A;  5FWG A;  3RHB A;  5DBQ A;  3IV4 A;  4ECI A;  2XC2 A;  5A4W A;  3TRP A;  3ZYW A;  5J41 A;  3C8E A;  4WXT A;  1NM3 A;  3ED3 A;  4ID0 A;  1GUM A;  1FB6 A;  1GWC A;  4YQM A;  5EY6 A;  3HHV A;  1K0O A;  3FY7 A;  4N10 A;  2WRT A;  3GX8 A;  12GS A;  3ME8 A;  3IC4 A;  2AAW A;  5DDL A;  1R7H A;  4L0W A;  1K0B A;  3VPT A;  4L8E A;  1X5D A;  2V41 A;  5KOX A;  3GNJ A;  1UC7 A;  1TRV A;  4MJC A;  3M9J A;  4KND A;  1K0M A;  1MDJ A;  2FUG 2;  5FHI A;  5G5E A;  5ID2 B;  1JZO A;  5COH A;  2TIR A;  2B5X A;  1A8Y A;  14GS A;  2DMM A;  2VO4 A;  3FW2 A;  3G9B A;  2C3N A;  5CYY A;  2XHF A;  3QR6 A;  1LJR A;  5ID2 A;  3V1W A;  2PVQ A;  4I2U A;  3ZMK A;  16GS A;  1C72 A;  1EZK A;  1SJZ A;  5IMZ A;  4ECJ A;  4IJ3 A;  4DSS B;  1B9X C;  1G6Y A;  1SJI A;  5GZZ B;  3EYT A;  5A4V A;  1TI1 A;  5AGY A;  2F8F A;  2R4V A;  1QQ2 A;  5A5K A;  1SD9 A;  4DSS A;  3BCI A;  3KCM A;  4ZB6 A;  2VM1 A;  4PQI A;  3FR6 A;  4NMU A;  1HNB A;  1NHY A;  4Q5N A;  3GST A;  4NHW A;  4USS A;  4IVF A;  4CY6 A;  4BIK A;  5KOW A;  2FLS A;  3L9U A;  3WGD A;  2AV4 A;  2EIR A;  2C0F A;  1XWK A;  1GUK A;  3EC3 A;  1AXD A;  3KD0 A;  2E2G A;  4KW6 A;  5CP1 A;  5CNW A;  4ECC A;  4WEY A;  3EIN A;  5F05 A;  1M99 A;  4JE1 A;  3TOU A;  1JLW A;  4HS1 A;  1OC8 A;  3WD6 A;  2IMD A;  3ME7 A;  1MD3 A;  2WB9 A;  4MA9 A;  3GKX A;  5BMU A;  2H75 A;  3LXT A;  3WT2 A;  4MMM A;  5L71 A;  4KDU A;  3LQ7 A;  4I97 A;  4IP6 A;  2C3T A;  4O7H A;  3DWV A;  3IPZ A;  2C80 A;  3EVI A;  2AUV A;  2IMF A;  3H1N A;  1FAA A;  5DJL A;  1K3L A;  2OKA A;  3KZQ A;  5HR2 A;  1GUH A;  3HDC A;  3TB2 A;  2E7P A;  3KH7 A;  3VWX A;  1OKT A;  1A2M A;  4YH2 A;  1ERV A;  3LWA A;  4FYB A;  3UJ1 A;  4AGS A;  3GKN A;  1SK0 A;  1BYE A;  2WDU A;  4V2N A;  1XWC A;  2TRC P;  1MDI A;  3VLN A;  4KAE A;  2GZP A;  2QC7 A;  4LL1 B;  2YNX A;  4GQC A;  5IMV A;  2AJQ B;  3EU3 A;  2PWJ A;  1S3D A;  4I2T A;  2REM A;  4K9Z A;  3Q74 A;  2OBK A;  3DGQ A;  1KTE A;  3ZIT A;  2RLI A;  1Q4J A;  2K18 A;  2QGV A;  4QL7 A;  1WP0 A;  3MDK A;  4NXI A;  1YJ6 A;  3ERF A;  13GS A;  5INY A;  3HJM A;  1FOH A;  2L4C A;  4BVY B;  3KEB A;  2DJ2 A;  4OMV A;  1Z6M A;  3A5W A;  2CVB A;  2DKI A;  5D93 A;  1EP7 A;  2YZU A;  2WJU A;  4BVY A;  2A2R A;  2I81 A;  2KUC A;  4I6X A;  1GTB A;  5CRG A;  4TN8 A;  2BJX A;  1GSD A;  2NPB A;  5ECS A;  4O32 A;  1EWX A;  5EL8 A;  3IE3 A;  2VIM A;  2GVP A;  3LOR A;  3KGK A;  3UIW A;  1T4Y A;  4Q5Q A;  1GRX A;  1XG8 A;  2LJR A;  5CRH A;  2GQL A;  1PD2 1;  5JCG A;  5HQP A;  3IK7 A;  4KSO A;  2VL9 A;  4JU5 A;  3GA4 A;  4HI7 A;  4EL1 A;  3DVX A;  3MNG A;  2DIY A;  1NHO A;  5KN1 A;  4KDX A;  2P0G A;  1CQG A;  3A5I A;  4F0C A;  1TK8 B;  1BAY A;  5DCG A;  2XPE A;  17GS A;  4N0Z A;  1M7T A;  3BOA A;  2FA4 A;  2YJH A;  4XIH A;  2M46 A;  4PXO A;  3R2Q A;  4ZXG A;  4OD7 A;  4MH3 A;  5JCW A;  10GS A;  1M3I A;  3FZ9 A;  2AHE A;  4JRR A;  3F4T A;  3MWH A;  5AIS A;  4TRX A;  3TKP A;  5IOW A;  2GZY A;  2GZZ A;  2R37 A;  3MSZ A;  5ECR B;  3QAV A;  3M8N A;  4GSN A;  4G0L A;  1FO5 A;  4Z2R A;  1A8L A;  1R4W A;  1Z7R A;  3A2W A;  6GSS A;  2IPA A;  1U6T A;  2WUL A;  4MNN A;  3ZIJ A;  3NIV A;  3QPM A;  4HJ2 A;  1O81 A;  2H6Y A;  1TI3 A;  4IW9 A;  3GTU B;  1GH2 A;  5F0G A;  4KCA A;  1WPI A;  1A23 A;  2NTO A;  2H0H A;  2QSI A;  3FK8 A;  4P3Y B;  2A2S A;  2G2Q A;  4XCS A;  3D22 A;  2VCW A;  1PFO A;  2R6K A;  2YPM A;  3GTU A;  2X64 A;  3Q19 A;  4K5R A;  1K0N A;  1TRS A;  4HUA A;  4WR5 A;  1R26 A;  4BWS A;  3DXB A;  5B8A A;  4GLT A;  1ERU A;  4V2M A;  4K0G A;  4K8M A;  2VD1 A;  5IM9 A;  2HRK A;  3PPU A;  4YKF A;  3CQF A;  2YOI A;  3MAK A;  1U87 A;  4F82 A;  2OA7 A;  3FEU A;  1YDK A;  5CRW A;  3P90 A;  4GSS A;  2MZC A;  2V32 A;  2DIZ A;  3DKS A;  2L5O A;  1I5G A;  1XW5 A;  2ES7 A;  1YY7 A;  2LNT A;  1SL0 B;  2FHE A;  2HRN A;  2X4A A;  1OE7 A;  1O85 A;  1FW1 A;  2LTK A;  3TRQ A;  3VPQ A;  3LSZ A;  4Q5F A;  3IR4 A;  5HFI A;  3G7Y A;  4ILF A;  3F6D A;  3TOT A;  5IPH A;  3QFB C;  1ML6 A;  3Q18 A;  2P5R A;  3GKK A;  2A2P A;  2R3X A;  2C8U A;  2LST A;  4EE0 A;  2HZF A;  2LRN A;  1XW9 A;  2YP6 A;  3LEF A;  2LJA A;  1YZX A;  2PU9 C;  4N0V A;  4V1A g;  1GP1 A;  2D2Z A;  1SKW B;  3RAZ A;  1LBK A;  4EF0 A;  5ECM B;  2GTU A;  4KCE A;  2HXK A;  3EMX A;  1EOG A;  4IHU A;  3VWW A;  2H71 A;  4JR6 A;  3WYW A;  2O7K A;  4LMW A;  2CAQ A;  2CQ9 A;  3RHC A;  1PA3 A;  4IGJ A;  2OBI A;  3HJO A;  3I6A A;  1RK4 A;  4TR1 B;  1XOB A;  4K6X A;  2AYT A;  4MCU A;  3KP9 A;  1Z7P A;  3HVX A;  6GSX A;  2B6M A;  2VL2 C;  2YWI A;  1J08 A;  2HT9 A;  1GNW A;  1WMJ A;  3HJP A;  3P2A A;  2DJ0 A;  2VCQ A;  1PL2 A;  3E0U A;  3ZML A;  4TR1 A;  4ML1 A;  3UBK A;  4NWY A;  5HR3 A;  4OCF A;  5DCH A;  1DBY A;  4YAP A;  4NV5 A;  1ERT A;  2FWF A;  1YKA A;  4OO4 A;  4POL A;  1NW2 A;  5J9C A;  4OFN A;  2V1M A;  5B7C A;  4KSM A;  1GUL A;  3GN3 A;  4HU9 A;  2L6C A;  3L9S A;  1SU9 A;  3CTG A;  5HFG A;  4F2I A;  1FVK A;  1TJD A;  5IO0 A;  2GQK A;  4G2E A;  4K7I A;  2C0E A;  2CA8 A;  2PUK C;  5C00 A;  4HU7 A;  1PN9 A;  2X8G A;  1F3A A;  5ELA A;  2JAD A;  1S3A A;  5ABR A;  3VK9 A;  3C73 A;  2NBS A;  4K1F A;  3F4S A;  2J23 A;  3APS A;  2GDR A;  4EUY A;  2C1Y A;  4MJA A;  3UVT A;  4RUV A;  1HNA A;  3KTB A;  4EIQ A;  2HNL A;  3SBC A;  4LLR A;  3F3R A;  5ENU A;  2I9H A;  1X5C A;  3QDN A;  2DJ1 A;  2O8V B;  1AUC A;  3TKR A;  5ELG A;  2GQM A;  4KE3 A;  2HI7 A;  4PUF C;  2PER A;  1XPV A;  4ML6 A;  3UAP A;  1BQ7 A;  5J3R A;  2P31 A;  5F06 A;  3EU4 A;  1V57 A;  1W89 A;  4XRD A;  2M80 A;  3IXR A;  4ISD A;  1EGO A;  3HA9 A;  4XS1 A;  5AN1 A;  3I9V 2;  1GSE A;  5IQY A;  19GS A;  3ZIV A;  1MTC A;  1SYX A;  1JZD A;  2YAN A;  2YZH A;  1G7O A;  1AC1 A;  2OE3 A;  4PNF A;  2H1G A;  1GSF A;  3TKS E;  4AJ6 A;  2EIQ A;  1PX6 A;  1B48 A;  1O73 A;  4MAB A;  2ON5 A;  3QOU A;  3FYG A;  1XWB A;  1HNC A;  1DE1 A;  5IMA A;  3TDG A;  4AJ8 A;  1PQN A;  3H8Q A;  4IJI A;  2L6D A;  4J56 E;  3HVV A;  2VAF A;  4PQH A;  4JR4 A;  2CV4 A;  1FHE A;  2IIY A;  3UEM A;  1YKC A;  2KLX A;  4V1A p;  3KH9 A;  2PGT A;  1H4O A;  3GX0 A;  3EUR A;  3TJF A;  3EWL A;  2H1A A;  2C3Q A;  1EEM A;  3IRA A;  3KXO A;  4ZIJ A;  5G31 A;  1RQM A;  3GUS A;  1AQW A;  1SEN A;  5DQS A;  1XCC A;  1S3C A;  2ALB A;  4EO3 A;  1GL8 A;  2CAI A;  1OAZ A;  1IYH A;  1O7U A;  3EMP A;  4MF6 A;  1XWA A;  4NV2 A;  1SJ6 A;  5LD0 A;  2OAC A;  1F9M A;  2WCI A;  5KN2 A;  2H1B A;  2MMN A;  1XBS A;  4MPG A;  1ZOF A;  2B5Y A;  2I1U A;  4IBP A;  4GXZ A;  4KGI A;  1KEB A;  3O76 A;  3L0H A;  2IMI A;  3IC8 A;  3I69 A;  2KHP A;  4Q5R A;  2IME A;  1K3Y A;  1IYI A;  1MEK A;  5IOX A;  2QA1 A;  2MBS A;  1B4Q A;  5ECQ B;  2K8S A;  1EP8 A;  2Z9S A;  1AW9 A;  3LYP A;  4L5L A;  2O89 A;  2DML A;  4NPB A;  3GUR A;  4HJM A;  4K7O A;  1WE0 A;  2PVO C;  1TK0 B;  2PMT A;  4WBJ A;  4JZQ A;  5J5N A;  1TOF A;  2LV3 A;  4LA1 A;  2NDO A;  2PN8 A;  2YWN A;  4O92 A;  4IN0 A;  5JCU A;  3KIJ A;  4ZBD A;  2B1L A;  4MP4 A;  2VOC A;  2ZNM A;  5D9W A;  1PN0 A;  1URM A;  5B8B A;  3GL3 A;  2GT5 A;  5ECN B;  2G0F A;  5LCZ A;  1F37 A;  2RM6 A;  4GRF A;  2R2J A;  2DJ3 A;  4TKY A;  3M9K A;  4ACS A;  1TK5 B;  4KF9 A;  2JAC A;  1T4Z A;  2L5L A;  4O5R A;  5EVO A;  4PGT A;  1TTZ A;  5LNK e;  1QMV A;  1K0D A;  3CSH A;  3ZTL A;  3CBU A;  2H6X A;  3VI7 A;  4KA0 A;  2E2M A;  2JZR A;  1HYU A;  4BWQ A;  1A24 A;  4HDE A;  2C4J A;  1QGV A;  4FIW A;  5H5Q A;  5IPG A;  3HD5 A;  4F9Z A;  3GIX A;  1FG4 A;  1THX A;  3FZ4 A;  3LW9 A;  1T8E B;  2VCT A;  2HFD A;  2F8A A;  4RQR A;  3F3Q A;  3HKR A;  3HVN A;  1J0F A;  4K2D A;  4LMV A;  3SWL A;  1VF2 A;  1PKZ A;  4QL9 A;  3TKS C;  1TU7 A;  4EKZ A;  2VL3 A;  2HSM A;  3TJK A;  2PBJ A;  3BD2 A;  4ZL8 A;  2DBC A;  3L78 A;  3P8W A;  1QK8 A;  2FA8 A;  2X99 A;  1ERW A;  1JZR A;  3QFA C;  3KJY A;  2FCH A;  4FYC A;  1OKD A;  5GAN D;  2HE3 A;  1F2E A;  5D96 A;  4ZL7 A;  2V2G A;  1QXH A;  5CO3 A;  5E59 A;  1JLV A;  2QA2 A;  3IA1 A;  3CRU A;  2H19 A;  1W4V A;  3JCM L;  3C7M A;  1N2A A;  1PGT A;  2LJK A;  3DRN A;  3GH6 A;  1RW1 A;  1S3R A;  2H73 A;  2R0C A;  4KX4 A;  1EGR A;  2FGX A;  3QD9 A;  3ZRE A;  1YEX A;  3CSJ A;  4TXO B;  4GTU A;  5ECK B;  4K7N A;  1O6J A;  1WOU A;  4GF0 A;  3KM6 A;  3M3M A;  1T00 A;  3VWU A;  5D73 A;  1E6B A;  3HVS A;  1GSQ A;  4TXO A;  1PKW A;  2A4H A;  3IOS A;  1R5P A;  4G19 A;  1GTA A;  1GLP A;  4Z2T A;  1PMT A;  4OFT A;  4MJE A;  5ECO B;  1WWJ A;  3TJJ A;  3UBL A;  2H8L A;  3ZRD A;  2NVL A;  4TW5 A;  4DSQ A;  1A2J A;  1WJK A;  3TJB A;  4WET A;  1OYJ A;  5A4U A;  1YF0 A;  2I4A A;  1PSQ A;  4BPY A;  2DLX A;  3K8N A;  4XS6 A;  1M0U A;  1X9W B;  3CXG A;  4AJ7 A;  2CX3 A;  4TOP A;  4XTS A;  1XIY A;  3TRX A;  2JZT A;  2GST A;  1AIU A;  1Z6N A;  1XXU A;  1XZO A;  1PRX A;  4WBR D;  1V9W A;  3DVW A;  3F6F A;  4DSR A;  2IN3 A;  2H70 A;  4MLY A;  4GST A;  1FVJ A;  4BVX B;  3RBT A;  5IMD A;  3G7J A;  3UL3 A;  3LFL A;  1VGL A;  5ECP B;  6GST A;  5GAP D;  3LG6 A;  2L59 A;  5HR1 A;  1HQO A;  3VWV A;  4BVX A;  3GSS A;  2TRX A;  1SK2 A;  5ECL B;  3CRT A;  2VUP A;  3IHQ A;  3BJ5 A;  1T7P B;  2MMA A;  2HRA A;  4IKH A;  1Z3E A;  2GLR A;  3HZ4 A;  2VLV A;  1SYR A;  2LEG A;  1AQV A;  2R5G A;  4IS0 A;  1YEP A;  1BG5 A;  4EVM A;  4POM A;  2H0G A;  3FHK A;  3A2V A;  5KEJ A;  5GST A;  1KBN A;  2MMO A;  3DIE A;  3TUE A;  3HXS A;  4TR4 A;  1VF4 A;  2LQQ A;  4X4J A;  3J7Y b;  2YN1 A;  3O6T A;  3WGX A;  5EPF A;  2LRT A;  1ACV A;  2BMX A;  2H30 A;  5D8I A;  4CDO A;  5BRT A;  2HRF A;  4H86 A;  4D73 B;  6GSY A;  4E8E A;  3C1R A;  4HSC X;  1XFL A;  2X49 A;  3H79 A;  4G0K A;  4D73 A;  2YV7 A;  3FZA A;  1XWG A;  2F3M A;  2R0P A;  4RQX A;  5ECH B;  5JWO B;  2ON7 A;  3D4M A;  5HFK A;  5IIZ A;  2LUS A;  4ULX A;  3TKQ A;  3FRC A;  3IHG A;  4L5O A;  3CYN A;  3UOM A;  3E3E A;  2OE0 A;  1WRY A;  1PL1 A;  2A4V A;  2ZCT A;  3FR9 A;  3BBY A;  2GS3 A;  2MMZ A;  4EIP A;  4IEL A;  1E2Y A;  4A5P A;  2VCV A;  3GRX A;  5DAK B;  2IFQ B;  4MZW A;  1ZYE A;  3QMX A;  1FB0 A;  2LRC A;  2RM5 A;  1SK1 A;  3OR5 A;  2IWT A;  1ZCP A;  2F51 A;  5IO2 A;  1O8W A;  1SL1 B;  3ERG A;  4QQ7 A;  5DAK A;  2IFQ A;  1ILO A;  3D0Z A;  8GSS A;  2LQO A;  2H66 A;  2HZE B;  1F3B A;  5D9V A;  1DE2 A;  3IDV A;  5G1L A;  3LYK A;  3W6G A;  3QAG A;  4X1U A;  1AAZ A;  3HCZ A;  1U3I A;  3D5J A;  3Q6O A;  2DC5 A;  3U5R E;  2HZE A;  3MIX A;  3GHA A;  3A2X A;  3PIN A;  18GS A;  3N9J A;  2KP2 A;  5JWQ B;  3KMN A;  5J4U A;  4MPF A;  20GS A;  5G2Z A;  4JED A;  1Y6E A;  2JSZ A;  2QKE A;  2H1D A;  3M0F A;  1EOH A;  1M2B A;  2L4Q A;  1AQX A;  1V2A A;  3IBH A;  5F07 A;  4ZL9 A;  4MF5 A;  2WFC A;  4FO5 A;  1ZL9 A;  1R5A A;  2V6O A;  2XPD A;  4G0I A;  1ST9 A;  3I43 A;  3HYP A;  4TR0 A;  5DJM A;  1O8X A;  4BL7 B;  2OAD A;  1NSW A;  5B6M A;  3BCK A;  4J57 E;  5AIX A;  5B6N A;  2B5E A;  3TGZ A;  3NZN A;  1SKS B;  4MH2 A;  1VRS D;  3LJR A;  1JHB A;  3ZZX A;  4BL7 A;  1A2L A;  2R0G A;  4MF7 A;  3HZ8 A;  1V58 A;  5J9B A;  3F63 A;  2HSY A;  2VLT A;  1XW6 A;  2B7J A;  1Y25 A;  4IP1 A;  2VL2 A;  2FD3 A;  3E9J B;  3GYK A;  1ZYQ B;  2C0D A;  3HY2 A;  2CVD A;  2VCX A;  2H74 A;  3CMI A;  3WGE A;  1H75 A;  1M9A A;  4EDY A;  2DJJ A;  3GV1 A;  4IQA A;  3QCP A;  1X5E A;  4I8B A;  2L57 A;  5HR0 A;  3UMA A;  3PR8 A;  4DVC A;  1OE8 A;  1T1V A;  2K8V A;  2FY6 A;  3GL5 A;  4HOJ A;  1J9B A;  4XS4 B;  3QAW A;  2GSS A;  1LU4 A;  2JL4 A;  4HQS A;  1VF1 A;  1Q98 A;  1ZMA A;  4HQZ A;  4XS4 A;  2C0G A;  2DJK A;  4ECB A;  5DVB A;  2N5F A;  3GFK A;  1X0R A;  3C71 A;  4ZBA A;  1PX7 A;  4FQU A;  2H72 A;  1TRU A;  3FKF A;  5CRE A;  1ZGN A;  5DQY A;  2N5B A;  3IK9 A;  3A3T A;  4FH8 A;  5H5S A;  3TJG A;  3VI5 A;  4FYU A;  2IJY A;  2DKH A;  1GLQ A;  4WKW A;  5E4W A;  1V98 A;  4YAV A;  2EIO A;  4F03 A;  6GSU A;  2X8H A;  4CY8 A;  2YWO A;  2AB6 A;  2JSY A;  2P5Q A;  3ISO A;  3ZVJ D;  3L9V A;  1B4P A;  2CVK A;  2UZ8 A;  4PTS A;  3O3T A;  4CHS A;  1TRW A;  3F9U A;  2LS5 A;  3GKM A;  3NOF A;  4OWY A;  1Z9H A;  2FWE A;  4RI7 A;  4XRA A;  4YQU A;  1ON4 A;  1GSU A;  1K3O A;  3AY8 A;  1SKR B;  3UAR A;  1MDK A;  1BJX A;  4N30 A;  2WS2 A;  5G30 A;  2B3S A;  2CZ3 A;  3APQ A;  3MYD A;  4V2L A;  2GSQ A;  4KUN A;  5KN3 A;  4HZ2 A;  3F0I A;  4PX1 A;  4YKG A;  4MJB A;  1ZYP A;  1U3A A;  2HSH A;  1M2D A;  3R3E A;  3PGT A;  1DSB A;  1OC3 A;  4J2F A;  1EV4 A;  3ZL5 A;  2O85 A;  4GCI A;  4EC0 A;  4PQ1 A;  2FNO A;  1GTI A;  1XOA A;  1TW9 A;  1BED A;  2BTO T;  3LXZ A;  1SD8 A;  3EE2 A;  4ZIL A;  4MZC A;  1QUW A;  1U88 A;  2DSA A;  3FMW A;  2H01 A;  4KB3 A;  4E8H A;  2F9S A;  6GSW A;  5G1K A;  1EV9 A;  1A0R P;  3UVH A;  1B9Y C;  2B7K A;  4X0X A;  3L4N A;  2PPT A;  4NAX A;  1A0F A;  2WGR A;  3KP8 A;  5F8B A;  3FR3 A;  4RI6 A;  4HZ4 A;  3DD3 A;  5D9X A;  1CQH A;  1G7E A;  2M72 A;  4MDC A;  1YQ1 A;  1UVZ A;  4ZB8 A;  4GWR A;  3ZFL A;  1K0C A;  1SL2 B;  4DEJ A;  2KP1 A;  3N5O A;  4CW9 A;  1TDI A;  5AIV A;  4I5Q A;  2IMK A;  4TXV A;  2GT6 A;  4POB A;  4PNG A;  1TKD B;  3VFI A;  4WR4 A;  1UN2 A;  1WIK A;  3DYR A;  4KDY A;  4PUA A;  3US3 A;  4POK A;  3RPP A;  3VUR A;  4K0N A;  3H4K A;  1MD4 A;  2VD0 A;  1K0A A;  4OFM A;  4WF5 A;  2WZ9 A;  4L0U A;  2K9F A;  2YV9 A;  1FOV A;  2CZ2 A;  3D21 A;  2FWH A;  2LNS A;  3W8S A;  4ZB9 A;  5C04 A;  4IQ1 A;  3EPT A; 
#chains in the Genus database with same CATH homology
 2EC4 A;  1GSS A;  2O87 A;  2X8C A;  2FWG A;  2OE1 A;  3D4T A;  3J7Y k;  2GGT A;  7GSS A;  4OO5 A;  1M9B A;  1BX9 A;  4BA7 A;  2H6Z A;  5D9T A;  1X9M B;  1JZW A;  2HLS A;  3GMF A;  4MZB A;  1F6M C;  4F0B A;  4GQF A;  2YCD A;  4YQV A;  3G7I A;  2OJL A;  4AF2 A;  2IL3 A;  5KN0 A;  2HYX A;  9GSS A;  4LL4 B;  4MK3 A;  4ZBB A;  2V6K A;  2J9H A;  2YJ7 A;  1G0T A;  1GNE A;  1TXX A;  1T3B A;  3ZVJ A;  4TVE A;  4ICY A;  5IMC A;  5DAL B;  3ZLP A;  3DEX A;  1M2A A;  1ABA A;  2VLU A;  5FT3 A;  2B1K A;  2CT6 A;  3F4R A;  2RUF A;  1N8J A;  3WT1 A;  6GSV A;  5DAL A;  4NHZ A;  3ZFB A;  1USB A;  1UA5 A;  4N11 A;  3TKS A;  5ECI B;  3U6V A;  4EDZ A;  1TP9 A;  3RDW A;  4EXJ A;  4HEA 2;  4KH7 A;  1QFN A;  5CAX A;  2N5A A;  3TCO A;  1YF1 A;  3ERW A;  2RUE A;  4Z2U A;  3DML A;  3S9F A;  1KNG A;  3C1S A;  4X43 A;  1VF3 A;  3IAM 2;  3M1G A;  3GH9 A;  4XHM A;  5IMF A;  5G5F A;  3W8J A;  1OC9 B;  2RII A;  4G10 A;  1XVQ A;  2YWM A;  3KTL A;  4O5Q A;  3LGC A;  4OCE A;  3FZ5 A;  5GSS A;  1GSY A;  4O5U A;  2MYG A;  1JFU A;  3RPN A;  1OVN A;  1OC9 A;  4WF4 A;  2JU5 A;  3H93 A;  3IAS 2;  2H0I A;  2VM2 A;  2GSR A;  2ZUP A;  4K2X A;  4K5S A;  3D6I A;  2E0Q A;  1DUG A;  1G6W A;  2CX4 A;  3CTF A;  5CRD A;  2VCZ A;  22GS A;  2K6V A;  3CSI A;  1Z5Y E;  3KMO A;  4Z7X A;  1ZYN A;  1B8X A;  11GS A;  2I3Y A;  2XBQ A;  2JZS A;  4TR3 A;  3APO A;  1HD2 A;  1ZZY A;  2MBT A;  3P7X A;  1I9D A;  4PUR A;  1XVW A;  1V40 A;  4G9H A;  1X9S B;  1TU8 A;  2H76 A;  2KOK A;  1THO A;  2LKU A;  1GTU A;  2XBI A;  5H5R A;  3PH9 A;  1EEJ A;  5JWR B;  3F8U A;  4JBB A;  5FWG A;  3RHB A;  5DBQ A;  3IV4 A;  4ECI A;  2XC2 A;  5A4W A;  3TRP A;  3ZYW A;  5J41 A;  3C8E A;  4WXT A;  1NM3 A;  3ED3 A;  4ID0 A;  1GUM A;  1FB6 A;  1GWC A;  4YQM A;  5EY6 A;  3HHV A;  1K0O A;  3FY7 A;  4N10 A;  2WRT A;  3GX8 A;  12GS A;  3ME8 A;  3IC4 A;  2AAW A;  5DDL A;  1R7H A;  4L0W A;  1K0B A;  3VPT A;  4L8E A;  1X5D A;  2V41 A;  5KOX A;  3GNJ A;  1UC7 A;  1TRV A;  4MJC A;  3M9J A;  4KND A;  1K0M A;  1MDJ A;  2FUG 2;  5FHI A;  5G5E A;  5ID2 B;  1JZO A;  5COH A;  2TIR A;  2B5X A;  1A8Y A;  14GS A;  2DMM A;  2VO4 A;  3FW2 A;  3G9B A;  2C3N A;  5CYY A;  2XHF A;  3QR6 A;  1LJR A;  5ID2 A;  3V1W A;  2PVQ A;  4I2U A;  3ZMK A;  16GS A;  1C72 A;  1EZK A;  1SJZ A;  5IMZ A;  4ECJ A;  4IJ3 A;  4DSS B;  1B9X C;  1G6Y A;  1SJI A;  5GZZ B;  3EYT A;  5A4V A;  1TI1 A;  5AGY A;  2F8F A;  2R4V A;  1QQ2 A;  5A5K A;  1SD9 A;  4DSS A;  3BCI A;  3KCM A;  4ZB6 A;  2VM1 A;  4PQI A;  3FR6 A;  4NMU A;  1HNB A;  1NHY A;  4Q5N A;  3GST A;  4NHW A;  4USS A;  4IVF A;  4CY6 A;  5KOW A;  2FLS A;  3L9U A;  3WGD A;  2AV4 A;  2EIR A;  2C0F A;  1XWK A;  1GUK A;  3EC3 A;  1AXD A;  3KD0 A;  2E2G A;  4KW6 A;  5CP1 A;  5CNW A;  4ECC A;  4WEY A;  3EIN A;  5F05 A;  1M99 A;  4JE1 A;  3TOU A;  1JLW A;  4HS1 A;  1OC8 A;  3WD6 A;  2IMD A;  3ME7 A;  1MD3 A;  2WB9 A;  4MA9 A;  3GKX A;  5BMU A;  2H75 A;  3LXT A;  3WT2 A;  4MMM A;  5L71 A;  4KDU A;  3LQ7 A;  4I97 A;  4IP6 A;  2C3T A;  4O7H A;  3DWV A;  3IPZ A;  2C80 A;  3EVI A;  2AUV A;  2IMF A;  3H1N A;  1FAA A;  5DJL A;  1K3L A;  2OKA A;  3KZQ A;  5HR2 A;  1GUH A;  3HDC A;  3TB2 A;  2E7P A;  3KH7 A;  3VWX A;  1OKT A;  1A2M A;  4YH2 A;  1ERV A;  3LWA A;  4FYB A;  3UJ1 A;  4AGS A;  3GKN A;  1SK0 A;  1BYE A;  2WDU A;  4V2N A;  1XWC A;  2TRC P;  1MDI A;  3VLN A;  4KAE A;  2GZP A;  2QC7 A;  4LL1 B;  2YNX A;  4GQC A;  5IMV A;  2AJQ B;  3EU3 A;  2PWJ A;  1S3D A;  4I2T A;  2REM A;  4K9Z A;  3Q74 A;  2OBK A;  3DGQ A;  1KTE A;  3ZIT A;  2RLI A;  1Q4J A;  2K18 A;  2QGV A;  4QL7 A;  1WP0 A;  3MDK A;  4NXI A;  1YJ6 A;  3ERF A;  13GS A;  5INY A;  3HJM A;  1FOH A;  2L4C A;  4BVY B;  3KEB A;  2DJ2 A;  4OMV A;  1Z6M A;  3A5W A;  2CVB A;  2DKI A;  5D93 A;  1EP7 A;  2YZU A;  2WJU A;  4BVY A;  2A2R A;  2I81 A;  2KUC A;  4I6X A;  1GTB A;  5CRG A;  4TN8 A;  2BJX A;  1GSD A;  2NPB A;  5ECS A;  4O32 A;  1EWX A;  5EL8 A;  3IE3 A;  2VIM A;  2GVP A;  3LOR A;  3KGK A;  3UIW A;  1T4Y A;  4Q5Q A;  1GRX A;  2LJR A;  5CRH A;  2GQL A;  1PD2 1;  5JCG A;  5HQP A;  3IK7 A;  4KSO A;  2VL9 A;  4JU5 A;  3GA4 A;  4HI7 A;  4EL1 A;  3DVX A;  3MNG A;  2DIY A;  1NHO A;  5KN1 A;  4KDX A;  2P0G A;  1CQG A;  3A5I A;  4F0C A;  1TK8 B;  1BAY A;  5DCG A;  2XPE A;  17GS A;  4N0Z A;  1M7T A;  3BOA A;  2FA4 A;  2YJH A;  4XIH A;  2M46 A;  4PXO A;  3R2Q A;  4ZXG A;  4OD7 A;  4MH3 A;  5JCW A;  10GS A;  4JRR A;  3FZ9 A;  2AHE A;  3F4T A;  3MWH A;  5AIS A;  4TRX A;  3TKP A;  5IOW A;  2GZY A;  2GZZ A;  2R37 A;  3MSZ A;  5ECR B;  3QAV A;  3M8N A;  4GSN A;  4G0L A;  1FO5 A;  4Z2R A;  1A8L A;  1R4W A;  1Z7R A;  3A2W A;  6GSS A;  2IPA A;  1U6T A;  2WUL A;  4MNN A;  3ZIJ A;  3NIV A;  3QPM A;  4HJ2 A;  1O81 A;  2H6Y A;  1TI3 A;  4IW9 A;  3GTU B;  1GH2 A;  5F0G A;  4KCA A;  1WPI A;  1A23 A;  2NTO A;  2H0H A;  2QSI A;  3FK8 A;  4P3Y B;  2A2S A;  2G2Q A;  4XCS A;  2VCW A;  3D22 A;  2R6K A;  2YPM A;  3GTU A;  2X64 A;  3Q19 A;  4K5R A;  1K0N A;  1TRS A;  4HUA A;  4WR5 A;  1R26 A;  4BWS A;  3DXB A;  5B8A A;  4GLT A;  1ERU A;  4V2M A;  4K0G A;  4K8M A;  2VD1 A;  5IM9 A;  2HRK A;  3PPU A;  4YKF A;  2YOI A;  3MAK A;  1U87 A;  4F82 A;  2OA7 A;  3FEU A;  1YDK A;  5CRW A;  3P90 A;  4GSS A;  2MZC A;  2V32 A;  2DIZ A;  3DKS A;  2L5O A;  1I5G A;  1XW5 A;  2ES7 A;  1YY7 A;  2LNT A;  1SL0 B;  2FHE A;  2HRN A;  2X4A A;  1OE7 A;  1O85 A;  1FW1 A;  2LTK A;  3TRQ A;  3VPQ A;  3LSZ A;  4Q5F A;  3IR4 A;  5HFI A;  3G7Y A;  4ILF A;  3F6D A;  3TOT A;  5IPH A;  3QFB C;  1ML6 A;  3Q18 A;  2P5R A;  3GKK A;  2A2P A;  2R3X A;  2C8U A;  2LST A;  4EE0 A;  2HZF A;  2LRN A;  1XW9 A;  2YP6 A;  3LEF A;  2LJA A;  1YZX A;  2PU9 C;  4N0V A;  4V1A g;  1GP1 A;  2D2Z A;  1SKW B;  3RAZ A;  1LBK A;  4EF0 A;  5ECM B;  2GTU A;  4KCE A;  2HXK A;  3EMX A;  1EOG A;  4IHU A;  3VWW A;  2H71 A;  4JR6 A;  3WYW A;  2O7K A;  4LMW A;  2CAQ A;  2CQ9 A;  3RHC A;  1PA3 A;  4IGJ A;  2OBI A;  3HJO A;  3I6A A;  1RK4 A;  4TR1 B;  1XOB A;  4K6X A;  2AYT A;  4MCU A;  3KP9 A;  1Z7P A;  3HVX A;  6GSX A;  2B6M A;  2VL2 C;  2YWI A;  1J08 A;  2HT9 A;  1GNW A;  1WMJ A;  3HJP A;  3P2A A;  2DJ0 A;  2VCQ A;  1PL2 A;  3E0U A;  3ZML A;  4TR1 A;  4ML1 A;  3UBK A;  4NWY A;  5HR3 A;  4OCF A;  5DCH A;  1DBY A;  4YAP A;  4NV5 A;  1ERT A;  2FWF A;  1YKA A;  4OO4 A;  4POL A;  1NW2 A;  5J9C A;  4OFN A;  2V1M A;  5B7C A;  4KSM A;  1GUL A;  3GN3 A;  4HU9 A;  2L6C A;  3L9S A;  1SU9 A;  3CTG A;  5HFG A;  4F2I A;  1FVK A;  1TJD A;  5IO0 A;  2GQK A;  4G2E A;  4K7I A;  2C0E A;  2CA8 A;  2PUK C;  5C00 A;  4HU7 A;  1PN9 A;  2X8G A;  1F3A A;  5ELA A;  2JAD A;  1S3A A;  5ABR A;  3VK9 A;  3C73 A;  2NBS A;  4K1F A;  3F4S A;  2J23 A;  3APS A;  2GDR A;  4EUY A;  2C1Y A;  4MJA A;  3UVT A;  4RUV A;  1HNA A;  3KTB A;  4EIQ A;  2HNL A;  3SBC A;  4LLR A;  3F3R A;  5ENU A;  2I9H A;  1X5C A;  3QDN A;  2DJ1 A;  2O8V B;  1AUC A;  3TKR A;  5ELG A;  2GQM A;  4KE3 A;  2HI7 A;  4PUF C;  2PER A;  1XPV A;  4ML6 A;  3UAP A;  1BQ7 A;  5J3R A;  2P31 A;  5F06 A;  3EU4 A;  1V57 A;  1W89 A;  4XRD A;  2M80 A;  3IXR A;  4ISD A;  1EGO A;  3HA9 A;  4XS1 A;  5AN1 A;  3I9V 2;  1GSE A;  5IQY A;  19GS A;  3ZIV A;  1MTC A;  1SYX A;  1JZD A;  2YAN A;  2YZH A;  1G7O A;  1AC1 A;  2OE3 A;  4PNF A;  2H1G A;  1GSF A;  3TKS E;  4AJ6 A;  2EIQ A;  1PX6 A;  1B48 A;  1O73 A;  4MAB A;  2ON5 A;  3QOU A;  3FYG A;  1XWB A;  1HNC A;  1DE1 A;  5IMA A;  3TDG A;  4AJ8 A;  1PQN A;  3H8Q A;  4IJI A;  2L6D A;  4J56 E;  3HVV A;  2VAF A;  4PQH A;  4JR4 A;  2CV4 A;  1FHE A;  2IIY A;  3UEM A;  1YKC A;  2KLX A;  4V1A p;  3KH9 A;  2PGT A;  1H4O A;  3GX0 A;  3EUR A;  3TJF A;  3EWL A;  2H1A A;  2C3Q A;  1EEM A;  3IRA A;  3KXO A;  4ZIJ A;  5G31 A;  1RQM A;  3GUS A;  1AQW A;  1SEN A;  5DQS A;  1XCC A;  1S3C A;  2ALB A;  4EO3 A;  1GL8 A;  2CAI A;  1OAZ A;  1IYH A;  1O7U A;  3EMP A;  4MF6 A;  1XWA A;  4NV2 A;  1SJ6 A;  5LD0 A;  2OAC A;  1F9M A;  2WCI A;  5KN2 A;  2H1B A;  2MMN A;  1XBS A;  4MPG A;  1ZOF A;  2B5Y A;  2I1U A;  4IBP A;  4GXZ A;  4KGI A;  1KEB A;  3O76 A;  3L0H A;  2IMI A;  3IC8 A;  3I69 A;  2KHP A;  4Q5R A;  2IME A;  1K3Y A;  1IYI A;  1MEK A;  5IOX A;  2QA1 A;  2MBS A;  1B4Q A;  5ECQ B;  2K8S A;  1EP8 A;  2Z9S A;  1AW9 A;  3LYP A;  4L5L A;  2O89 A;  2DML A;  4NPB A;  3GUR A;  4HJM A;  4K7O A;  1WE0 A;  2PVO C;  1TK0 B;  2PMT A;  4WBJ A;  4JZQ A;  5J5N A;  1TOF A;  2LV3 A;  4LA1 A;  2NDO A;  2PN8 A;  2YWN A;  4O92 A;  4IN0 A;  5JCU A;  3KIJ A;  4ZBD A;  2B1L A;  4MP4 A;  2VOC A;  2ZNM A;  5D9W A;  1PN0 A;  1URM A;  5B8B A;  3GL3 A;  2GT5 A;  5ECN B;  2G0F A;  5LCZ A;  1F37 A;  2RM6 A;  4GRF A;  2R2J A;  2DJ3 A;  4TKY A;  3M9K A;  4ACS A;  1TK5 B;  4KF9 A;  2JAC A;  1T4Z A;  2L5L A;  4O5R A;  5EVO A;  4PGT A;  1TTZ A;  5LNK e;  1QMV A;  1K0D A;  3CSH A;  3ZTL A;  3CBU A;  2H6X A;  3VI7 A;  4KA0 A;  2E2M A;  2JZR A;  1HYU A;  4BWQ A;  1A24 A;  4HDE A;  2C4J A;  1QGV A;  4FIW A;  5H5Q A;  5IPG A;  3HD5 A;  4F9Z A;  3GIX A;  1FG4 A;  1THX A;  3FZ4 A;  3LW9 A;  1T8E B;  2VCT A;  2HFD A;  2F8A A;  4RQR A;  3F3Q A;  3HKR A;  1J0F A;  4K2D A;  4LMV A;  3SWL A;  1VF2 A;  1PKZ A;  4QL9 A;  3TKS C;  1TU7 A;  4EKZ A;  2VL3 A;  2HSM A;  3TJK A;  2PBJ A;  3BD2 A;  4ZL8 A;  2DBC A;  3L78 A;  3P8W A;  1QK8 A;  2FA8 A;  2X99 A;  1ERW A;  1JZR A;  3QFA C;  3KJY A;  2FCH A;  4FYC A;  1OKD A;  5GAN D;  2HE3 A;  1F2E A;  5D96 A;  4ZL7 A;  2V2G A;  1QXH A;  5CO3 A;  5E59 A;  1JLV A;  2QA2 A;  3IA1 A;  3CRU A;  2H19 A;  1W4V A;  3JCM L;  3C7M A;  1N2A A;  1PGT A;  2LJK A;  3DRN A;  3GH6 A;  1RW1 A;  2H73 A;  2R0C A;  4KX4 A;  1EGR A;  2FGX A;  3QD9 A;  3ZRE A;  1YEX A;  3CSJ A;  4TXO B;  4GTU A;  5ECK B;  4K7N A;  1O6J A;  1WOU A;  4GF0 A;  3KM6 A;  3M3M A;  1T00 A;  3VWU A;  5D73 A;  1E6B A;  3HVS A;  1GSQ A;  4TXO A;  1PKW A;  2A4H A;  3IOS A;  1R5P A;  4G19 A;  1GTA A;  1GLP A;  4Z2T A;  1PMT A;  4OFT A;  4MJE A;  5ECO B;  1WWJ A;  3TJJ A;  3UBL A;  2H8L A;  3ZRD A;  2NVL A;  4TW5 A;  4DSQ A;  1A2J A;  1WJK A;  3TJB A;  4WET A;  1OYJ A;  5A4U A;  1YF0 A;  2I4A A;  1PSQ A;  4BPY A;  2DLX A;  3K8N A;  4XS6 A;  1M0U A;  1X9W B;  3CXG A;  4AJ7 A;  2CX3 A;  4TOP A;  4XTS A;  1XIY A;  3TRX A;  2JZT A;  2GST A;  1AIU A;  1Z6N A;  1XXU A;  1XZO A;  1PRX A;  4WBR D;  1V9W A;  3DVW A;  3F6F A;  4DSR A;  2IN3 A;  2H70 A;  4MLY A;  4GST A;  1FVJ A;  4BVX B;  3RBT A;  5IMD A;  3G7J A;  3UL3 A;  3LFL A;  1VGL A;  5ECP B;  6GST A;  5GAP D;  3LG6 A;  2L59 A;  5HR1 A;  1HQO A;  3VWV A;  4BVX A;  3GSS A;  2TRX A;  1SK2 A;  5ECL B;  3CRT A;  2VUP A;  3IHQ A;  3BJ5 A;  1T7P B;  2MMA A;  2HRA A;  4IKH A;  1Z3E A;  2GLR A;  3HZ4 A;  2VLV A;  1SYR A;  2LEG A;  1AQV A;  2R5G A;  4IS0 A;  1YEP A;  1BG5 A;  4EVM A;  4POM A;  2H0G A;  3FHK A;  3A2V A;  5KEJ A;  5GST A;  1KBN A;  2MMO A;  3DIE A;  3TUE A;  3HXS A;  4TR4 A;  1VF4 A;  2LQQ A;  4X4J A;  3J7Y b;  2YN1 A;  3O6T A;  3WGX A;  5EPF A;  2LRT A;  1ACV A;  2BMX A;  2H30 A;  5D8I A;  4CDO A;  5BRT A;  2HRF A;  4H86 A;  4D73 B;  6GSY A;  4E8E A;  3C1R A;  1XFL A;  2X49 A;  3H79 A;  4G0K A;  4D73 A;  2YV7 A;  3FZA A;  1XWG A;  2F3M A;  2R0P A;  4RQX A;  5ECH B;  5JWO B;  2ON7 A;  3D4M A;  5HFK A;  5IIZ A;  2LUS A;  4ULX A;  3TKQ A;  3FRC A;  3IHG A;  4L5O A;  3CYN A;  3UOM A;  3E3E A;  2OE0 A;  1WRY A;  1PL1 A;  2A4V A;  2ZCT A;  3FR9 A;  3BBY A;  2GS3 A;  2MMZ A;  4EIP A;  4IEL A;  1E2Y A;  4A5P A;  2VCV A;  3GRX A;  5DAK B;  2IFQ B;  4MZW A;  1ZYE A;  3QMX A;  1FB0 A;  2LRC A;  2RM5 A;  1SK1 A;  3OR5 A;  2IWT A;  1ZCP A;  2F51 A;  5IO2 A;  1O8W A;  1SL1 B;  3ERG A;  4QQ7 A;  5DAK A;  2IFQ A;  1ILO A;  3D0Z A;  8GSS A;  2LQO A;  2H66 A;  2HZE B;  1F3B A;  5D9V A;  1DE2 A;  3IDV A;  5G1L A;  3LYK A;  3W6G A;  3QAG A;  4X1U A;  1AAZ A;  3HCZ A;  1U3I A;  3D5J A;  3Q6O A;  2DC5 A;  3U5R E;  2HZE A;  3MIX A;  3GHA A;  3A2X A;  3PIN A;  18GS A;  3N9J A;  2KP2 A;  5JWQ B;  3KMN A;  5J4U A;  4MPF A;  20GS A;  5G2Z A;  4JED A;  1Y6E A;  2JSZ A;  2QKE A;  2H1D A;  3M0F A;  1EOH A;  1M2B A;  2L4Q A;  1AQX A;  1V2A A;  3IBH A;  5F07 A;  4ZL9 A;  4MF5 A;  2WFC A;  4FO5 A;  1ZL9 A;  1R5A A;  2V6O A;  2XPD A;  4G0I A;  1ST9 A;  3I43 A;  3HYP A;  4TR0 A;  5DJM A;  1O8X A;  4BL7 B;  2OAD A;  1NSW A;  5B6M A;  3BCK A;  4J57 E;  5AIX A;  5B6N A;  2B5E A;  3TGZ A;  3NZN A;  1SKS B;  4MH2 A;  1VRS D;  3LJR A;  1JHB A;  3ZZX A;  4BL7 A;  1A2L A;  2R0G A;  4MF7 A;  3HZ8 A;  1V58 A;  5J9B A;  3F63 A;  2HSY A;  2VLT A;  1XW6 A;  2B7J A;  1Y25 A;  4IP1 A;  2VL2 A;  2FD3 A;  3E9J B;  3GYK A;  1ZYQ B;  2C0D A;  3HY2 A;  2CVD A;  2VCX A;  2H74 A;  3CMI A;  3WGE A;  1H75 A;  1M9A A;  4EDY A;  2DJJ A;  3GV1 A;  4IQA A;  3QCP A;  1X5E A;  4I8B A;  2L57 A;  5HR0 A;  3UMA A;  3PR8 A;  4DVC A;  1OE8 A;  1T1V A;  2K8V A;  2FY6 A;  3GL5 A;  4HOJ A;  1J9B A;  4XS4 B;  3QAW A;  2GSS A;  1LU4 A;  2JL4 A;  4HQS A;  1VF1 A;  1Q98 A;  1ZMA A;  4HQZ A;  4XS4 A;  2C0G A;  2DJK A;  4ECB A;  5DVB A;  2N5F A;  3GFK A;  1X0R A;  3C71 A;  4ZBA A;  1PX7 A;  4FQU A;  2H72 A;  1TRU A;  3FKF A;  5CRE A;  1ZGN A;  5DQY A;  2N5B A;  3IK9 A;  3A3T A;  4FH8 A;  5H5S A;  3TJG A;  3VI5 A;  4FYU A;  2IJY A;  2DKH A;  1GLQ A;  4WKW A;  5E4W A;  1V98 A;  4YAV A;  2EIO A;  4F03 A;  6GSU A;  2X8H A;  4CY8 A;  2YWO A;  2AB6 A;  2JSY A;  2P5Q A;  3ISO A;  3ZVJ D;  3L9V A;  1B4P A;  2CVK A;  2UZ8 A;  4PTS A;  3O3T A;  4CHS A;  1TRW A;  3F9U A;  2LS5 A;  3GKM A;  3NOF A;  4OWY A;  1Z9H A;  2FWE A;  4RI7 A;  4XRA A;  4YQU A;  1ON4 A;  1GSU A;  1K3O A;  3AY8 A;  1SKR B;  3UAR A;  1MDK A;  1BJX A;  4N30 A;  2WS2 A;  5G30 A;  2B3S A;  2CZ3 A;  3APQ A;  3MYD A;  4V2L A;  2GSQ A;  4KUN A;  5KN3 A;  4HZ2 A;  3F0I A;  4PX1 A;  4YKG A;  4MJB A;  1ZYP A;  1U3A A;  2HSH A;  1M2D A;  3R3E A;  3PGT A;  1DSB A;  1OC3 A;  4J2F A;  1EV4 A;  3ZL5 A;  2O85 A;  4GCI A;  4EC0 A;  4PQ1 A;  2FNO A;  1GTI A;  1XOA A;  1TW9 A;  1BED A;  2BTO T;  3LXZ A;  1SD8 A;  3EE2 A;  4ZIL A;  4MZC A;  1QUW A;  1U88 A;  2DSA A;  3FMW A;  2H01 A;  4KB3 A;  4E8H A;  2F9S A;  6GSW A;  5G1K A;  1EV9 A;  1A0R P;  3UVH A;  1B9Y C;  2B7K A;  4X0X A;  3L4N A;  2PPT A;  4NAX A;  1A0F A;  2WGR A;  3KP8 A;  5F8B A;  3FR3 A;  4RI6 A;  4HZ4 A;  3DD3 A;  5D9X A;  1CQH A;  1G7E A;  2M72 A;  4MDC A;  1YQ1 A;  1UVZ A;  4ZB8 A;  4GWR A;  3ZFL A;  1K0C A;  1SL2 B;  4DEJ A;  2KP1 A;  3N5O A;  4CW9 A;  1TDI A;  5AIV A;  4I5Q A;  2IMK A;  4TXV A;  2GT6 A;  4POB A;  4PNG A;  1TKD B;  3VFI A;  4WR4 A;  1UN2 A;  1WIK A;  3DYR A;  4KDY A;  4PUA A;  3US3 A;  4POK A;  3RPP A;  3VUR A;  4K0N A;  3H4K A;  1MD4 A;  2VD0 A;  1K0A A;  4OFM A;  4WF5 A;  2WZ9 A;  4L0U A;  2K9F A;  2YV9 A;  1FOV A;  2CZ2 A;  3D21 A;  2FWH A;  2LNS A;  3W8S A;  4ZB9 A;  5C04 A;  4IQ1 A;  3EPT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...