2BMXA

Mycobacterium tuberculosis ahpc
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
169
structure length
169
Chain Sequence
PLLTIGDQFPAYQLTALIGGDLSKVDAKQPGDYFTTITSDEHPGKWRVVFFWPKDFTFVCPTEIAAFSKLNDEFEDRDAQILGVSIDSEFAHFQWRAQHNDLKTLPFPMLSDIKRELSQAAGVLNADGVADRVTFIVDPNNEIQFVSATAGSVGRNVDEVLRVLDALQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords ALKYL HYDROPEROXIDASE C
publication title Structure and Mechanism of the Alkyl Hydroperoxidase Ahpc, a Key Element of the Mycobacterium Tuberculosis Defense System Against Oxidative Stress.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 46
structure length 169
sequence length 169
chains with identical sequence B, C
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2005-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00578 AhpC-TSA AhpC/TSA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2bmxA00
2K8SA 1F3BA 1TKDB 3QAWA 4MH2A 4DEJA 3W6GA 1HNBA 4CDOA 4N30A 1XBSA 4IP6A 5CRWA 3S9FA 2NDOA 2H30A 2EC4A 2OE0A 1W4VA 2FWGA 2H76A 1JZDA 2H19A 1G0TA 5DALB 3ZMLA 1H75A 5J41A 3L9UA 1SKWB 5D8IA 1A2LA 3GX0A 1XWCA 2R6KA 4IP1A 2JZTA 2ZCTA 4GTUA 3IAM2 2JACA 2WGRA 2NBSA 4YAVA 1JLWA 4WKWA 5CNWA 5AISA 2MBSA 2K9FA 3ZL5A 1EZKA 5IPGA 1AC1A 3GMFA 3FW2A 4NXIA 3LXZA 1XW6A 4IJIA 4XHMA 1M9AA 4CW9A 1ERVA 2GZZA 2WRTA 3TKSE 5J9BA 1M7TA 3LWAA 5LD0A 3QCPA 2O7KA 2M80A 2GVPA 4QL9A 4F9ZA 1VGLA 1LU4A 4V2MA 2I4AA 3TKSA 1EEJA 1IYIA 1GLPA 2PBJA 4ZL8A 4LLRA 17GSA 6GSVA 3KTBA 2H75A 4LL1B 2IPAA 2B7JA 3VWVA 4JRRA 3D4TA 4ILFA 2PMTA 2IMIA 2CAQA 4KGIA 1TK8B 2EIOA 20GSA 5HFGA 5EPFA 4XS6A 1E2YA 1GUMA 3CMIA 4I2UA 4BVXA 4MF6A 3VI5A 3VFIA 5IOXA 3HZ8A 3RHBA 4D73A 1ZGNA 2MZCA 2FLSA 1LBKA 1T8EB 1WOUA 5EVOA 3FZ5A 3PR8A 5H5SA 3QPMA 3H93A 4MZWA 5AIXA 1Z7PA 1XW5A 3E3EA 5CAXA 4ZL9A 3GKMA 3UIWA 2QC7A 1GSQA 2V2GA 3GH9A 4OCFA 3C1SA 1SK1A 3IV4A 3EMXA 1TRUA 1A24A 3UMAA 2PVQA 4IHUA 3FY7A 1T3BA 5HR1A 1NHOA 2I9HA 3EYTA 3HCZA 2N5AA 1T4ZA 1EOHA 2ES7A 3I9V2 1SKRB 5GZZB 4MPGA 1ABAA 3DRNA 1R5AA 2LNSA 1OC9A 2PVOC 3G7YA 2G2QA 4BWQA 5A4VA 3CSHA 3FYGA 3QAGA 5KEJA 4PX1A 4L5LA 1HYUA 2OJLA 4CHSA 5B8AA 1FG4A 1Z5YE 1TTZA 1TRWA 2VL2A 4AJ8A 4IGJA 14GSA 5AIVA 5DQYA 4V2LA 3HJPA 1ZYEA 2PPTA 2YZUA 3TRXA 2VCQA 1THOA 3O76A 3KMOA 3GKNA 2LJAA 2H0GA 3US3A 4K9ZA 4JZQA 3ZRDA 2F9SA 2IMFA 4OO4A 2C3TA 2H8LA 1OC3A 10GSA 3HD5A 3ME8A 2VO4A 5B8BA 1PRXA 4K8MA 2FUG2 3MWHA 5J9CA 3UEMA 5DJMA 2YV7A 4OD7A 1VF2A 5GSTA 4KNDA 3RPPA 1K0CA 2PERA 4G9HA 3C1RA 2D2ZA 3GRXA 3M1GA 4MJEA 4XS4A 4QL7A 3GN3A 2GQLA 2OA7A 4OMVA 2IMEA 1F3AA 3WGEA 1URMA 3AY8A 4XRAA 4KCEA 4ZBBA 1XOAA 1GSFA 1SU9A 1V58A 1OC8A 3KIJA 2HSYA 3IK9A 4GQCA 5HR0A 2R5GA 2RM5A 3F6DA 2OKAA 2HNLA 3VPTA 2K8VA 3MDKA 5FWGA 3GL3A 2H1DA 5D73A 5ECQB 4LMVA 3TDGA 3RPNA 1PL1A 2MMZA 3EVIA 5ECOB 3EINA 1OYJA 4KW6A 4HDEA 1WPIA 5JWQB 1GULA 1S3AA 3ERFA 4GLTA 1PGTA 3UVHA 1EEMA 5IMVA 4BVYA 4LMWA 2V32A 4I97A 4L0UA 1AXDA 3LG6A 3D22A 1A23A 5DCGA 1U88A 2K18A 4GXZA 2FD3A 4F03A 3TGZA 3IBHA 4G2EA 2B5YA 3L0HA 4N0ZA 4BA7A 2FWHA 2KUCA 1BJXA 2H6ZA 1XW9A 4TOPA 1GNWA 2RM6A 3VWUA 2B5XA 3C71A 1S3DA 3DEXA 1N8JA 2I1UA 3FRCA 2TRCP 3HY2A 4EE0A 2L6CA 1IYHA 5FHIA 3KP9A 3L78A 5IO0A 4F0BA 5IMAA 2VUPA 1XWGA 2P5QA 2IL3A 4P3YB 5A4WA 2X8GA 4K7IA 5AGYA 2FY6A 1X9WB 2L5LA 1F37A 3OR5A 3GSTA 2RUEA 1ML6A 4WBRD 5A5KA 2CVKA 2OACA 4HEA2 2HRNA 3H4KA 3D5JA 2B6MA 2YWNA 3QR6A 2VCXA 5ECPB 1OC9B 1T7PB 1H4OA 1X5DA 4MDCA 1DUGA 4RI6A 1VRSD 1VF3A 3TOUA 1M2BA 1I9DA 1NW2A 4MABA 4I5QA 1G7OA 4FYCA 5IMZA 4BPYA 2GSSA 3TRQA 1T4YA 3DMLA 3GIXA 4JU5A 1SENA 4QQ7A 2FWFA 1QQ2A 4EUYA 2E0QA 2IWTA 3IE3A 1YQ1A 4TR1A 1O85A 3VURA 5KN0A 2RLIA 1USBA 2XPDA 4IQAA 4KE3A 1PKZA 2X99A 2YCDA 3PINA 1B4QA 1ZL9A 5G2ZA 2HZFA 1GL8A 4YQUA 1RW1A 3L4NA 3KGKA 1ZCPA 4KUNA 4MLYA 3RAZA 1F2EA 4XRDA 4ZB6A 3GNJA 3WGDA 1QK8A 1N2AA 4I6XA 5J5NA 1LJRA 3HHVA 5GAND 4XS4B 1WE0A 1ERUA 2YWIA 4YH2A 2HXKA 1YEPA 1GWCA 1I5GA 4GSNA 3MNGA 3CSJA 4OCEA 1G6WA 1PN9A 1Y6EA 2VCVA 5JCUA 1TI1A 1UC7A 1MDIA 1A8YA 2DJ3A 3FEUA 1KTEA 2LS5A 1EGRA 2FGXA 1DBYA 3QFAC 5GAPD 3NOFA 1AQXA 4EF0A 4ID0A 1GTUA 3TRPA 1QFNA 4MZBA 3VWXA 4KDUA 5DJLA 2CQ9A 1A0FA 3HXSA 3K8NA 1GNEA 3ERGA 2P5RA 2VL3A 5IIZA 5JCGA 2E2GA 5LCZA 1A2MA 1A8LA 1BAYA 3O6TA 1YZXA 3A2XA 2QKEA 2ON5A 2P0GA 4OO5A 2J9HA 1YF1A 1GSEA 2JSYA 3ERWA 4KDXA 3UL3A 2OE1A 4NV5A 2G0FA 1XZOA 3WD6A 5HR2A 2GSTA 1GSSA 4GF0A 5DAKA 4F2IA 3GTUA 4MMMA 4NPBA 1ERTA 2C0FA 1SD8A 3SWLA 2VAFA 3KH7A 3P7XA 1QMVA 3F6FA 5ECMB 1SJZA 2H6XA 1HD2A 2DJ0A 2LJKA 2I81A 1GTIA 1ILOA 2ZNMA 3HKRA 4TXVA 4XS1A 2KLXA 4XTSA 4HJMA 1HQOA 3QAVA 4LA1A 1J0FA 5B6NA 5F8BA 3ZIVA 4F82A 3L9SA 1K3LA 2Z9SA 4GQFA 4MF5A 2L59A 1ZZYA 2VM1A 3TUEA 3ZLPA 2PU9C 2YWMA 2DLXA 3FR3A 5D9VA 3DVXA 4NHZA 3F8UA 3G7JA 2HSHA 6GSUA 1SL1B 1XIYA 1R5PA 2DIYA 1X9SB 1JFUA 5CREA 1K0MA 2LJRA 1R26A 2FA4A 5CRGA 3M9JA 4K6XA 5DCHA 2NVLA 4PQHA 1JZRA 5IMFA 3FHKA 3D21A 3NZNA 2CVDA 1JHBA 4MP4A 1NM3A 4J2FA 1U3AA 2H72A 1GP1A 4ML1A 1TK5B 3HA9A 4TR1B 3DGQA 3IDVA 4FO5A 2A2SA 3HYPA 3GH6A 4ZILA 4PURA 3U5RE 3LJRA 4L8EA 3ZZXA 2I3YA 2YP6A 4GWRA 1PX6A 13GSA 2O87A 1XXUA 1TW9A 1TRVA 4FYBA 1JZOA 5CRHA 3LQ7A 3Q18A 3CYNA 3WT2A 4OWYA 4WXTA 2VOCA 5IMDA 1K0AA 1WP0A 3TJKA 3UBLA 1X0RA 4JE1A 1AIUA 1Z3EA 2WJUA 3C73A 4DSSA 3IK7A 4XIHA 1WMJA 1VF4A 2BTOT 4POBA 2B5EA 1ZMAA 1V40A 3PH9A 1Z7RA 3FZAA 1B9XC 3IRAA 1OKDA 4V1Ap 1CQHA 3W8JA 2DSAA 12GSA 1V57A 3A2WA 1RK4A 4Q5QA 2ON7A 1GSYA 4OFNA 1QUWA 1UA5A 1K0BA 3IC4A 4IS0A 3F4TA 4PUFC 2GS3A 2GLRA 3E9JB 4ZL7A 2WULA 3UAPA 2RUFA 3D4MA 2AJQB 4ISDA 3CXGA 2LRTA 5KN2A 2YANA 3DWVA 4EL1A 2GTUA 18GSA 3KMNA 5HFKA 4MA9A 2PN8A 2VD0A 2NPBA 3TJGA 4BL7A 4WR4A 4O7HA 3TKSC 1YF0A 2DJJA 2J23A 2XBIA 2WS2A 1MDJA 5ELGA 1SK0A 3QD9A 3ISOA 3FK8A 5ID2A 3GTUB 3CBUA 5AN1A 2LUSA 3VI7A 2R3XA 2WCIA 4KH7A 3U6VA 1M9BA 2L5OA 2C3NA 3BOAA 5DVBA 5G5FA 3HJOA 2FHEA 2DJ2A 2OBIA 4HU9A 1BQ7A 4BWSA 1U3IA 5G1LA 3HJMA 3EC3A 4YAPA 1B9YC 1X9MB 1B48A 4MJAA 3APQA 1OKTA 2RIIA 1EV4A 1SYXA 1R7HA 3H1NA 3WYWA 2GSRA 1JLVA 4ZBAA 1ON4A 2DC5A 2CZ2A 4JR4A 4Q5NA 4EVMA 4RQRA 4IJ3A 2CX4A 3FR6A 3VLNA 1AQWA 2KOKA 4N11A 3LYKA 3ZTLA 2H1GA 2GGTA 2TRXA 4HJ2A 2E2MA 1THXA 2MYGA 3KTLA 3KEBA 4HS1A 1SK2A 3BD2A 5JWOB 2JSZA 3P8WA 5GSSA 1SYRA 5E59A 5CO3A 2IMDA 4K0GA 1OAZA 4KX4A 22GSA 2HZEA 1GUKA 2HLSA 1MDKA 3JCML 4D73B 1PMTA 4N10A 1FW1A 4E8HA 2R2JA 1XVWA 1FB6A 3F4SA 2DJ1A 3BCKA 4ECCA 2DJKA 2CV4A 4YQMA 2LTKA 2OBKA 2JADA 2R4VA 1M99A 4HZ2A 3ZFBA 3BCIA 1TK0B 2JU5A 2BJXA 1T1VA 5CYYA 1SD9A 2C1YA 2VL2C 2K6VA 1KEBA 3GYKA 4ML6A 4HQSA 3GKKA 4N0VA 2NTOA 4ZXGA 2H73A 3GHAA 1Y25A 2PGTA 4O92A 4PQ1A 4GCIA 5E4WA 6GSWA 5ECIB 1ZYQB 3TKQA 4EKZA 3UVTA 3PGTA 1MD4A 1O6JA 2AUVA 4WR5A 4OFTA 4XCSA 5DDLA 1M0UA 3QMXA 3F63A 2HT9A 3HVVA 8GSSA 5L71A 2VLUA 3M0FA 2H6YA 1NSWA 2B1LA 3ZFLA 1QGVA 2GDRA 2C0EA 2R37A 1O7UA 3C8EA 1O8WA 4TRXA 3KD0A 2L57A 4GSSA 1Z9HA 4WF5A 2DBCA 3FR9A 5EL8A 5ECRB 2L4CA 1UN2A 3DXBA 1V9WA 1PX7A 5LNKe 3D0ZA 2IFQA 2GQMA 1M2AA 5D96A 3KM6A 4G19A 3V1WA 2C0DA 3P2AA 1K3YA 3H8QA 3ZVJA 3APOA 3QFBC 4Z7XA 2PUKC 2REMA 1FO5A 4HUAA 4V1Ag 2YWOA 2L4QA 5ID2B 4KDYA 3DYRA 1RQMA 4YQVA 3RHCA 4K7NA 4EO3A 2V1MA 4ZB8A 1FVJA 3VPQA 3RDWA 2IJYA 1KBNA 3I43A 2QSIA 3G9BA 3MSZA 5G31A 1SKSB 1OE8A 2O89A 1TU8A 1SJ6A 4PQIA 3GURA 3CTGA 1YKAA 3ZYWA 4HI7A 2EIRA 4TW5A 5D9XA 1Q4JA 4TR0A 2IIYA 1J9BA 4WF4A 2F3MA 3ZMKA 3KH9A 5G5EA 3GKXA 4JR6A 4K7OA 1W89A 3N5OA 4JBBA 3KZQA 2VM2A 1PQNA 3TKRA 2YZHA 5D9TA 2MMOA 2GZYA 3F3RA 1GUHA 4TXOA 2CX3A 5G1KA 2YNXA 1FHEA 5J4UA 3M9KA 3EMPA 3TCOA 2WZ9A 1MEKA 2HZEB 2L6DA 4EXJA 1XPVA 3BJ5A 2H71A 3FZ9A 1EP7A 2OADA 4X0XA 1YJ6A 4TR3A 1MD3A 3WT1A 3BBYA 3TKPA 3MAKA 1V2AA 2OE3A 3GFKA 1K0OA 1PD21 7GSSA 4I2TA 3ZIJA 4K1FA 4DVCA 2GT5A 3G7IA 3CRTA 4TR4A 2FWEA 2LQQA 1DE2A 4NV2A 2WFCA 4Q5FA 3UOMA 4MK3A 3DVWA 1K3OA 11GSA 4AJ6A 3KCMA 5IM9A 4GSTA 1BG5A 2HRFA 5KN3A 2AV4A 4PXOA 4IW9A 1TRSA 1JZWA 4OFMA 2VLTA 2AHEA 4MJBA 5F06A 2GZPA 1ST9A 5IQYA 4RQXA 5ELAA 3H79A 1KNGA 1FB0A 1XCCA 3LFLA 4ZIJA 2VIMA 5JCWA 1ZOFA 4GRFA 2C4JA 4AGSA 3TJJA 3R2QA 1SL0B 4WETA 5IMCA 3DD3A 4EC0A 1A2JA 4MF7A 3VWWA 1SJIA 2AB6A 2M46A 2X8HA 1AQVA 1GH2A 4F0CA 2O8VB 1YY7A 3UBKA 5HR3A 3EURA 3TJFA 4HOJA 1XWKA 2VD1A 2GSQA 1EWXA 1K0DA 3CRUA 1TXXA 4PNGA 1M2DA 4ECJA 2IMKA 3ED3A 2N5FA 2LV3A 2LRCA 2XPEA 5HQPA 1XWAA 2KP2A 3IPZA 2IFQB 3HZ4A 4AJ7A 1R4WA 3J7Yb 3IHQA 2A2RA 2PWJA 1HNCA 1XWBA 5ECHB 1DE1A 2VL9A 5ECNB 4FIWA 1G7EA 1X5EA 5EY6A 3LXTA 5A4UA 1EP8A 4TN8A 3ZVJD 4NMUA 3E0UA 3M8NA 2P31A 2HI7A 4IQ1A 1NHYA 3J7Yk 2VCTA 3Q6OA 3IAS2 4FH8A 2KHPA 4J56E 3LEFA 2A4VA 2WDUA 2MMAA 3ZITA 2VCWA 1VF1A 2YJHA 1AAZA 1PKWA 2VLVA 2B3SA 4O32A 4WEYA 1B8XA 1B4PA 6GSYA 3EWLA 5ABRA 4H86A 3F0IA 4L5OA 1O81A 2ZUPA 6GSTA 3GA4A 4WBJA 3TOTA 3TB2A 4MCUA 4NAXA 2YN1A 1G6YA 1EGOA 4POKA 4MJCA 2HE3A 1WWJA 5ECSA 3LYPA 1QXHA 2TIRA 3IR4A 4IKHA 1GLQA 4TXOB 2IN3A 4X1UA 2H1AA 2CZ3A 4ACSA 3CSIA 1S3CA 2FNOA 5IPHA 1GSUA 4V2NA 2F8FA 5DAKB 1GSDA 1EOGA 3KXOA 2H70A 1F6MC 4O5RA 2MMNA 2YPMA 16GSA 9GSSA 5B7CA 5CP1A 1J08A 3D6IA 3UARA 1C72A 4EDYA 2LQOA 2XHFA 3HVXA 4G10A 2BMXA 5C00A 1A0RP 5H5QA 4AF2A 2C80A 2LEGA 2DIZA 5JWRB 3A3TA 4TVEA 1YEXA 3QOUA 1AW9A 4TKYA 4RI7A 2X8CA 3HVSA 3A5WA 3L9VA 4PGTA 4HU7A 4IVFA 3LGCA 2M72A 1PSQA 5C04A 4E8EA 4ECBA 3IOSA 1CQGA 1TOFA 2AYTA 1YKCA 1WIKA 1Z6MA 2H74A 1K0NA 5IOWA 5DALA 4ECIA 4DSRA 4HQZA 1OE7A 3GSSA 3EU3A 2JZSA 2DMMA 1BEDA 4POMA 3N9JA 2HYXA 3M3MA 1OVNA 5COHA 3ME7A 3RBTA 2YOIA 4PNFA 1E6BA 1XFLA 2XC2A 2C8UA 1PL2A 4FYUA 1EV9A 4IN0A 1DSBA 1HNAA 1ACVA 1FOVA 4J57E 5HFIA 2F51A 1TJDA 1X5CA 2B7KA 4POLA 1ERWA 1XVQA 1YDKA 1XOBA 3LSZA 5ENUA 2CAIA 2CA8A 3WGXA 4KB3A 2O85A 4KCAA 3HDCA 2H66A 5J3RA 2AAWA 4I8BA 2N5BA 1GTBA 4IBPA 2YV9A 5CRDA 4MH3A 1SL2B 3FKFA 2MBTA 2KP1A 2LRNA 3TJBA 2V6KA 3KP8A 4NWYA 4DSSB 3EE2A 1O73A 2ALBA 5H5RA 3LORA 1FAAA 2B1KA 1WRYA 3APSA 4K0NA 2YJ7A 1GTAA 5F0GA 1PA3A 4EDZA 3CTFA 3UJ1A 2F8AA 5D9WA 2H01A 1U6TA 4RUVA 6GSSA 3EU4A 4DSQA 3ZREA 5B6MA 1BYEA 2V6OA 4KAEA 2C0GA 3P90A 3NIVA 4LL4B 3FZ4A 4ZB9A 5KN1A 2WB9A 4PUAA 1UVZA 3GX8A 2LSTA 4IELA 3Q74A 2JL4A 2VCZA 5FT3A 1TU7A 3W8SA 1TDIA 6GSXA 5ECKB 2GQKA 4MZCA 5G30A 1AUCA 2LNTA 4KSMA 1Z6NA 1WJKA 4Q5RA 3GUSA 2CT6A 4JEDA 2X64A 5IO2A 1TP9A 3KJYA 4NHWA 3GL5A 5D93A 5DBQA 2C3QA 2H0IA 1GRXA 4L0WA 3QDNA 5DQSA 3O3TA 2JZRA 3C7MA 2DMLA 5ECLB 19GSA 1F9MA 2FCHA 4KA0A 2V41A 2GT6A 3VK9A 1Q98A 5INYA 3F3QA 1FVKA 3SBCA 3F4RA 2EIQA 4X43A 5F07A 4MPFA 4HZ4A 3DIEA 4ULXA 2FA8A 3I6AA 4KSOA 2CVBA 3A2VA 3GV1A 4ZBDA 4K2DA 2QGVA 3IXRA 2H1BA 3IA1A 2LKUA 1MTCA 1U87A 3F9UA 2HFDA 2E7PA 1T00A 2H0HA 1BX9A 2XBQA 5F05A 1V98A 3DKSA 3I69A 1O8XA 1TI3A 3Q19A
chains in the Genus database with same CATH superfamily
2K8SA 1F3BA 1TKDB 3QAWA 4MH2A 4DEJA 3W6GA 1HNBA 4CDOA 4N30A 1XBSA 4IP6A 5CRWA 3S9FA 2NDOA 2H30A 2EC4A 2OE0A 1W4VA 2FWGA 2H76A 1JZDA 2H19A 1G0TA 5DALB 3ZMLA 1H75A 5J41A 3L9UA 1SKWB 5D8IA 1A2LA 3GX0A 1XWCA 2R6KA 4IP1A 2JZTA 2ZCTA 4GTUA 3IAM2 2JACA 2WGRA 2NBSA 2DKIA 4YAVA 1JLWA 4WKWA 5CNWA 5AISA 2MBSA 2K9FA 3ZL5A 1EZKA 2R0PA 5IPGA 1AC1A 3GMFA 3FW2A 4NXIA 3LXZA 1XW6A 4IJIA 4XHMA 1M9AA 4CW9A 1ERVA 2GZZA 2WRTA 3TKSE 5J9BA 1M7TA 3LWAA 5LD0A 3QCPA 2O7KA 2M80A 2GVPA 4QL9A 4F9ZA 1VGLA 1LU4A 4V2MA 2I4AA 3TKSA 1EEJA 3IHGA 1IYIA 1GLPA 2PBJA 4ZL8A 4LLRA 17GSA 6GSVA 3KTBA 2H75A 4LL1B 2IPAA 2B7JA 3VWVA 4JRRA 3D4TA 4ILFA 2PMTA 2IMIA 3MYDA 2CAQA 4KGIA 1TK8B 2EIOA 20GSA 5HFGA 5EPFA 4XS6A 1E2YA 1GUMA 3CMIA 4I2UA 4A5PA 4BVXA 4MF6A 3VI5A 3VFIA 5IOXA 3HZ8A 3RHBA 4D73A 1ZGNA 2MZCA 2FLSA 1LBKA 1T8EB 1WOUA 5EVOA 3FZ5A 3PR8A 5H5SA 3QPMA 3H93A 4MZWA 1M3IA 5AIXA 4HSCX 1Z7PA 1XW5A 3E3EA 5CAXA 4ZL9A 3GKMA 3UIWA 2QA1A 2QC7A 1GSQA 2V2GA 3GH9A 4OCFA 3C1SA 1SK1A 3IV4A 3EMXA 1TRUA 1A24A 3UMAA 2PVQA 4IHUA 3FY7A 1T3BA 4FQUA 5HR1A 1NHOA 2I9HA 3EYTA 3HCZA 2N5AA 1T4ZA 1EOHA 2ES7A 3I9V2 1SKRB 5GZZB 4MPGA 1ABAA 3DRNA 1R5AA 2LNSA 1OC9A 2PVOC 3G7YA 2G2QA 4BWQA 5A4VA 3CSHA 3FYGA 3QAGA 5KEJA 4PX1A 4L5LA 1HYUA 2OJLA 4CHSA 5B8AA 1FG4A 1Z5YE 1TTZA 1TRWA 2VL2A 4AJ8A 4IGJA 14GSA 5AIVA 5DQYA 4V2LA 3HJPA 1ZYEA 2PPTA 2YZUA 3TRXA 2VCQA 1THOA 3O76A 3KMOA 3GKNA 2LJAA 2H0GA 3US3A 4K9ZA 4JZQA 3ZRDA 1XG8A 2F9SA 2IMFA 4OO4A 2C3TA 2H8LA 4BIKA 1OC3A 10GSA 3HD5A 3ME8A 2VO4A 5B8BA 1PRXA 4K8MA 2FUG2 3MWHA 5J9CA 3UEMA 5DJMA 2YV7A 4OD7A 1VF2A 5GSTA 3FMWA 4KNDA 3RPPA 1K0CA 2PERA 4G9HA 3C1RA 2D2ZA 3GRXA 3M1GA 4MJEA 4XS4A 4QL7A 3GN3A 2GQLA 2OA7A 4OMVA 2IMEA 1F3AA 3WGEA 1URMA 3AY8A 4XRAA 4KCEA 4ZBBA 1XOAA 1GSFA 1SU9A 1V58A 1OC8A 3KIJA 2HSYA 4YKGA 3IK9A 4GQCA 5HR0A 2R5GA 2RM5A 3F6DA 2OKAA 2HNLA 3VPTA 2K8VA 3MDKA 5FWGA 3GL3A 2H1DA 5D73A 5ECQB 4LMVA 3TDGA 3RPNA 1PL1A 2MMZA 3EVIA 5ECOB 3EINA 1OYJA 4KW6A 4HDEA 1WPIA 5JWQB 1GULA 1S3AA 3ERFA 4GLTA 5BRTA 1PGTA 3UVHA 1EEMA 5IMVA 4BVYA 4G0LA 4LMWA 2V32A 4I97A 4L0UA 1AXDA 3LG6A 3D22A 1A23A 5DCGA 1U88A 2K18A 4GXZA 2FD3A 4F03A 3TGZA 3IBHA 4G2EA 2B5YA 3L0HA 4N0ZA 4BA7A 2FWHA 2KUCA 4BVXB 1BJXA 2H6ZA 3A5IA 1XW9A 4TOPA 1GNWA 2RM6A 3VWUA 2B5XA 3C71A 1S3DA 3DEXA 1N8JA 2I1UA 3FRCA 2TRCP 3HY2A 4EE0A 2L6CA 2X4AA 4Z2UA 1IYHA 5FHIA 3KP9A 3L78A 5IO0A 4F0BA 5IMAA 2VUPA 1XWGA 2P5QA 2IL3A 4P3YB 5A4WA 2X8GA 4K7IA 5AGYA 2FY6A 1X9WB 2L5LA 1F37A 3OR5A 3GSTA 2RUEA 1ML6A 4WBRD 5A5KA 2CVKA 2OACA 4HEA2 2HRNA 3H4KA 3D5JA 2B6MA 2YWNA 3QR6A 2VCXA 5ECPB 1OC9B 1T7PB 1H4OA 1X5DA 4MDCA 1DUGA 4RI6A 2HSMA 1VRSD 1VF3A 3TOUA 1M2BA 1I9DA 1NW2A 4MABA 4I5QA 1G7OA 4FYCA 5IMZA 4BPYA 2GSSA 3TRQA 1T4YA 3DMLA 3GIXA 4JU5A 1SENA 4QQ7A 2FWFA 1QQ2A 4EUYA 2E0QA 3HVNA 2IWTA 3IE3A 4PTSA 1YQ1A 4TR1A 1O85A 3VURA 5KN0A 2RLIA 1USBA 2XPDA 4IQAA 4KE3A 1PKZA 2X99A 2YCDA 3PINA 1B4QA 1ZL9A 5G2ZA 2HZFA 1GL8A 4YQUA 1RW1A 3L4NA 3KGKA 1ZCPA 4KUNA 4MLYA 3RAZA 1F2EA 4XRDA 2QA2A 4ZB6A 3GNJA 3WGDA 1QK8A 1N2AA 4I6XA 5J5NA 1LJRA 3HHVA 5GAND 4XS4B 1WE0A 1ERUA 2YWIA 4YH2A 2HXKA 1YEPA 1GWCA 1I5GA 4GSNA 3MNGA 3CSJA 4OCEA 1G6WA 2R0GA 1PN9A 1Y6EA 2VCVA 5JCUA 1TI1A 1UC7A 1MDIA 1A8YA 2DJ3A 3FEUA 1KTEA 2LS5A 1EGRA 2FGXA 1DBYA 3QFAC 5GAPD 3NOFA 1AQXA 4EF0A 4ID0A 1GTUA 3TRPA 1QFNA 4MZBA 3VWXA 4KDUA 5DJLA 2CQ9A 1A0FA 3HXSA 3K8NA 1GNEA 3ERGA 2P5RA 2VL3A 3IC8A 4BVYB 5IIZA 5JCGA 2E2GA 5LCZA 1A2MA 1A8LA 1BAYA 3O6TA 1YZXA 3A2XA 2QKEA 2ON5A 2P0GA 4OO5A 2J9HA 1YF1A 1GSEA 2JSYA 3ERWA 4KDXA 3UL3A 2OE1A 4NV5A 2G0FA 1XZOA 3WD6A 5HR2A 2GSTA 1GSSA 4GF0A 5DAKA 4K5RA 4F2IA 3GTUA 4NPBA 4MMMA 1ERTA 2C0FA 1SD8A 3SWLA 2VAFA 3KH7A 3P7XA 1QMVA 3F6FA 5ECMB 1SJZA 2H6XA 1HD2A 2DJ0A 2LJKA 2I81A 1GTIA 1ILOA 2ZNMA 3HKRA 4TXVA 4XS1A 2KLXA 4XTSA 4HJMA 1HQOA 3QAVA 4LA1A 1PFOA 1J0FA 5B6NA 5F8BA 3ZIVA 4F82A 3L9SA 1K3LA 2Z9SA 4GQFA 4MF5A 2L59A 3MIXA 1ZZYA 2VM1A 3R3EA 3TUEA 3ZLPA 2PU9C 2YWMA 2DLXA 3FR3A 5D9VA 3DVXA 4NHZA 4G0KA 3F8UA 3G7JA 2HSHA 6GSUA 1SL1B 1XIYA 1R5PA 2DIYA 1X9SB 1JFUA 5CREA 1K0MA 2LJRA 1R26A 2FA4A 3LW9A 5CRGA 3M9JA 4K6XA 5DCHA 2NVLA 4PQHA 1JZRA 5IMFA 3CQFA 3FHKA 3D21A 3NZNA 2CVDA 1JHBA 4MP4A 1NM3A 4J2FA 1U3AA 2H72A 1GP1A 4ML1A 1TK5B 3HA9A 4TR1B 3DGQA 3IDVA 1ZYNA 4FO5A 2A2SA 3HYPA 3GH6A 4ZILA 4PURA 3U5RE 3LJRA 4L8EA 3ZZXA 2I3YA 2YP6A 4GWRA 4Z2TA 1PX6A 13GSA 2O87A 1XXUA 1TW9A 1TRVA 4FYBA 1JZOA 5CRHA 3LQ7A 3Q18A 3CYNA 1ZYPA 3WT2A 4OWYA 4WXTA 2VOCA 5IMDA 1K0AA 1WP0A 3TJKA 3UBLA 1X0RA 4JE1A 1AIUA 1Z3EA 2WJUA 3C73A 4DSSA 3IK7A 4XIHA 1WMJA 1VF4A 2BTOT 4POBA 2B5EA 1ZMAA 1V40A 3PH9A 1Z7RA 3FZAA 1B9XC 3IRAA 1OKDA 4V1Ap 1CQHA 3W8JA 2DSAA 12GSA 1V57A 3A2WA 4K2XA 1RK4A 4Q5QA 2ON7A 1GSYA 4OFNA 1QUWA 1UA5A 1K0BA 3IC4A 4EIPA 4IS0A 3F4TA 4O5QA 4PUFC 2GS3A 2GLRA 3E9JB 4ZL7A 2WULA 3UAPA 2RUFA 3D4MA 2AJQB 4ISDA 3CXGA 2LRTA 5KN2A 2YANA 3DWVA 4EL1A 2GTUA 18GSA 3KMNA 5HFKA 4MA9A 2PN8A 2VD0A 2NPBA 3TJGA 4BL7A 4WR4A 4O7HA 3TKSC 1YF0A 2DJJA 2J23A 2XBIA 2WS2A 1MDJA 5ELGA 1SK0A 2UZ8A 3ISOA 3QD9A 3FK8A 5ID2A 3GTUB 3CBUA 5AN1A 2LUSA 3VI7A 2R3XA 2WCIA 4KH7A 3U6VA 1M9BA 2L5OA 2C3NA 3BOAA 5DVBA 5G5FA 3HJOA 2FHEA 2DJ2A 2OBIA 4HU9A 1BQ7A 4BWSA 1U3IA 5G1LA 3HJMA 3EC3A 4YAPA 1B9YC 1X9MB 1B48A 4MJAA 3APQA 1OKTA 2RIIA 1EV4A 1SYXA 1R7HA 3H1NA 3WYWA 2GSRA 1JLVA 4ZBAA 1ON4A 4CY8A 2DC5A 2CZ2A 4JR4A 4Q5NA 4EVMA 4RQRA 4IJ3A 2CX4A 3FR6A 3VLNA 1AQWA 2KOKA 4N11A 1PN0A 3LYKA 3ZTLA 4X4JA 2H1GA 2GGTA 2TRXA 4HJ2A 2E2MA 1THXA 2MYGA 3KTLA 3KEBA 4HS1A 1SK2A 3BD2A 5JWOB 2JSZA 3P8WA 5GSSA 1SYRA 5E59A 5CO3A 2IMDA 4K0GA 1OAZA 4KX4A 22GSA 2HZEA 1GUKA 2HLSA 1MDKA 3JCML 4D73B 1PMTA 4N10A 1FW1A 4E8HA 2R2JA 1XVWA 1FB6A 3F4SA 2DJ1A 3BCKA 4ECCA 2DJKA 2CV4A 4YQMA 2LTKA 2OBKA 2JADA 2R4VA 1M99A 4HZ2A 3ZFBA 3BCIA 1TK0B 2JU5A 2BJXA 1T1VA 5CYYA 1SD9A 2C1YA 2VL2C 2K6VA 4ICYA 1KEBA 4O5UA 3GYKA 4ML6A 4HQSA 3GKKA 4N0VA 2NTOA 4ZXGA 2H73A 3GHAA 1Y25A 2PGTA 4O92A 4PQ1A 4GCIA 5E4WA 6GSWA 5ECIB 1ZYQB 3TKQA 4EKZA 3UVTA 3PGTA 1MD4A 1O6JA 2AUVA 4WR5A 4OFTA 4XCSA 5DDLA 1M0UA 3QMXA 3F63A 2HT9A 3HVVA 8GSSA 5L71A 2VLUA 3M0FA 2H6YA 1NSWA 2B1LA 2X49A 3ZFLA 1QGVA 2GDRA 2C0EA 2R37A 1O7UA 3EPTA 3C8EA 1O8WA 4TRXA 3KD0A 5KOWA 2L57A 4GSSA 1Z9HA 4WF5A 2DBCA 3FR9A 5EL8A 5ECRB 2L4CA 1UN2A 3DXBA 1V9WA 1PX7A 5LNKe 3D0ZA 2IFQA 2GQMA 4BL7B 1M2AA 5D96A 3KM6A 4G19A 3V1WA 2C0DA 3P2AA 1K3YA 3H8QA 3ZVJA 3APOA 3QFBC 4Z7XA 2PUKC 2REMA 1FO5A 4HUAA 4V1Ag 2YWOA 2L4QA 5ID2B 4KDYA 3DYRA 1RQMA 4YQVA 3RHCA 4K7NA 4EO3A 2V1MA 4ZB8A 1FVJA 3VPQA 3RDWA 2IJYA 1KBNA 3I43A 2QSIA 3G9BA 3MSZA 5G31A 1SKSB 1OE8A 2O89A 4MNNA 1TU8A 1SJ6A 4PQIA 3GURA 1FOHA 3CTGA 1YKAA 3ZYWA 4HI7A 2EIRA 3PPUA 4TW5A 5D9XA 1Q4JA 4TR0A 2IIYA 1J9BA 4WF4A 2F3MA 2A4HA 2HRKA 3ZMKA 3KH9A 5G5EA 3GKXA 4JR6A 1M3JA 4K7OA 1W89A 3N5OA 4JBBA 3KZQA 2VM2A 1PQNA 3TKRA 2YZHA 5D9TA 2MMOA 2GZYA 3F3RA 1GUHA 4TXOA 2CX3A 5G1KA 2YNXA 1FHEA 5J4UA 3M9KA 3EMPA 3TCOA 2WZ9A 1MEKA 2HZEB 2L6DA 4EXJA 1XPVA 3BJ5A 2H71A 3FZ9A 1EP7A 2OADA 4X0XA 1YJ6A 4TR3A 1MD3A 3WT1A 3BBYA 3TKPA 3MAKA 1V2AA 2OE3A 3GFKA 1K0OA 1PD21 7GSSA 4I2TA 3ZIJA 4K1FA 4DVCA 2GT5A 3G7IA 3CRTA 4TR4A 2FWEA 2LQQA 1DE2A 4NV2A 2WFCA 4Q5FA 3UOMA 4Z2RA 4MK3A 3DVWA 1K3OA 11GSA 4AJ6A 3KCMA 5IM9A 4GSTA 1BG5A 2HRFA 5KN3A 2AV4A 4PXOA 4IW9A 1TRSA 1JZWA 4OFMA 2VLTA 2AHEA 4MJBA 5F06A 2GZPA 1ST9A 5IQYA 4RQXA 5ELAA 3H79A 1KNGA 1FB0A 1XCCA 3LFLA 4ZIJA 2VIMA 5JCWA 1ZOFA 4GRFA 2C4JA 2HRAA 4AGSA 3TJJA 3R2QA 1SL0B 4WETA 5IMCA 3DD3A 4EC0A 1A2JA 4MF7A 3VWWA 1SJIA 2AB6A 2M46A 2X8HA 1AQVA 1GH2A 4F0CA 2O8VB 1YY7A 3UBKA 5HR3A 3EURA 3TJFA 4HOJA 1XWKA 2VD1A 2GSQA 1EWXA 1K0DA 3CRUA 1TXXA 4PNGA 2R0CA 1M2DA 4ECJA 2IMKA 3ED3A 2N5FA 2LV3A 2LRCA 2XPEA 5HQPA 1XWAA 2KP2A 1S3RA 3IPZA 2IFQB 3HZ4A 4AJ7A 1R4WA 3J7Yb 3IHQA 2A2RA 2PWJA 1HNCA 1XWBA 5ECHB 1DE1A 2VL9A 5ECNB 4FIWA 1G7EA 1X5EA 5EY6A 3LXTA 5A4UA 1EP8A 4TN8A 3ZVJD 4NMUA 3E0UA 3M8NA 2P31A 4KF9A 2HI7A 4IQ1A 1NHYA 3J7Yk 2VCTA 3Q6OA 3IAS2 4FH8A 2KHPA 4J56E 3LEFA 2A4VA 2WDUA 2MMAA 3ZITA 2VCWA 1VF1A 2YJHA 1AAZA 1PKWA 2VLVA 2B3SA 4O32A 4WEYA 1B8XA 1B4PA 6GSYA 3EWLA 5ABRA 4H86A 3F0IA 4L5OA 1O81A 2ZUPA 6GSTA 3GA4A 4WBJA 3TOTA 3TB2A 4MCUA 4NAXA 2YN1A 1G6YA 1EGOA 4POKA 4MJCA 2HE3A 1WWJA 5ECSA 3LYPA 1QXHA 2TIRA 3IR4A 4IKHA 1GLQA 4TXOB 2IN3A 4X1UA 2H1AA 2CZ3A 4ACSA 3CSIA 1S3CA 2FNOA 5IPHA 1GSUA 4V2NA 2F8FA 5DAKB 1GSDA 1EOGA 3KXOA 2H70A 1F6MC 4O5RA 2MMNA 2YPMA 16GSA 9GSSA 5B7CA 5CP1A 1J08A 3D6IA 3UARA 1C72A 4EDYA 2LQOA 2XHFA 3HVXA 4G10A 2DKHA 2BMXA 5C00A 1A0RP 5H5QA 4AF2A 2C80A 2LEGA 2DIZA 5JWRB 3A3TA 4TVEA 1YEXA 3QOUA 1AW9A 4TKYA 4RI7A 2X8CA 3HVSA 3A5WA 3L9VA 4PGTA 4CY6A 4HU7A 4IVFA 3LGCA 2M72A 1PSQA 5C04A 4E8EA 4ECBA 3IOSA 1CQGA 1TOFA 2AYTA 1YKCA 1WIKA 1Z6MA 2H74A 1K0NA 5IOWA 5DALA 4ECIA 4DSRA 4HQZA 1OE7A 3GSSA 3EU3A 2JZSA 2DMMA 1BEDA 4POMA 3N9JA 2HYXA 3M3MA 1OVNA 5COHA 3ME7A 3RBTA 2YOIA 4PNFA 1E6BA 1XFLA 2XC2A 2C8UA 1PL2A 4K5SA 5BMUA 4FYUA 1EV9A 4IN0A 1DSBA 1HNAA 1ACVA 1FOVA 4J57E 5HFIA 2F51A 1TJDA 1X5CA 2B7KA 4POLA 1ERWA 1XVQA 1YDKA 1XOBA 3LSZA 5ENUA 2CAIA 2CA8A 3WGXA 4KB3A 2O85A 4KCAA 3HDCA 2H66A 5J3RA 2AAWA 4I8BA 2N5BA 4G0IA 1GTBA 4IBPA 2YV9A 2A2PA 5CRDA 4MH3A 1SL2B 3FKFA 2MBTA 2KP1A 2LRNA 3TJBA 2V6KA 3KP8A 4NWYA 4DSSB 3EE2A 1O73A 2ALBA 5H5RA 3LORA 5KOXA 1FAAA 2B1KA 1WRYA 3APSA 4K0NA 2YJ7A 1GTAA 5F0GA 1PA3A 4EDZA 3CTFA 3UJ1A 2F8AA 5D9WA 2H01A 1U6TA 4RUVA 6GSSA 3EU4A 4DSQA 3ZREA 5B6MA 1BYEA 2V6OA 4KAEA 2C0GA 3P90A 3NIVA 4LL4B 3FZ4A 4ZB9A 5KN1A 2WB9A 4PUAA 1UVZA 3GX8A 2LSTA 4IELA 3Q74A 2JL4A 2VCZA 5FT3A 1TU7A 3W8SA 1TDIA 6GSXA 5ECKB 2GQKA 4MZCA 5G30A 1AUCA 2LNTA 4KSMA 1Z6NA 1WJKA 4Q5RA 3GUSA 4EIQA 2CT6A 4JEDA 2X64A 5IO2A 1TP9A 3KJYA 4NHWA 3GL5A 5D93A 5DBQA 2C3QA 2H0IA 1GRXA 4L0WA 3QDNA 5DQSA 3O3TA 2JZRA 3C7MA 2DMLA 5ECLB 19GSA 1F9MA 2FCHA 4KA0A 2V41A 2GT6A 3VK9A 1Q98A 5INYA 3F3QA 1FVKA 3SBCA 3F4RA 2EIQA 4YKFA 4X43A 5F07A 4MPFA 4HZ4A 4USSA 3DIEA 4ULXA 2FA8A 3I6AA 4KSOA 2CVBA 3A2VA 3GV1A 4ZBDA 4K2DA 2QGVA 3IXRA 2H1BA 3IA1A 2LKUA 1MTCA 1U87A 3F9UA 2HFDA 2E7PA 1T00A 2H0HA 1BX9A 2XBQA 5F05A 1V98A 3DKSA 3I69A 1O8XA 1TI3A 3Q19A
chains in the Genus database with same CATH topology
2K8SA 1F3BA 1TKDB 3QAWA 4MH2A 4DEJA 3W6GA 1HNBA 4CDOA 4N30A 1XBSA 4IP6A 5CRWA 3S9FA 2NDOA 2H30A 2EC4A 2OE0A 1W4VA 2FWGA 2H76A 1JZDA 2H19A 1G0TA 5DALB 3ZMLA 1H75A 5J41A 3L9UA 1SKWB 5D8IA 1A2LA 3GX0A 1XWCA 2R6KA 4IP1A 2JZTA 2ZCTA 4GTUA 3IAM2 2JACA 2WGRA 2NBSA 2DKIA 4YAVA 1JLWA 4WKWA 5CNWA 5AISA 2MBSA 2K9FA 3ZL5A 1EZKA 2R0PA 5IPGA 1AC1A 3GMFA 3FW2A 4NXIA 3LXZA 1XW6A 4IJIA 4XHMA 1M9AA 4CW9A 1ERVA 2GZZA 2WRTA 3TKSE 5J9BA 1M7TA 3LWAA 5LD0A 3QCPA 2O7KA 2M80A 2GVPA 4QL9A 4F9ZA 1VGLA 1LU4A 4V2MA 2I4AA 3TKSA 1EEJA 3IHGA 1IYIA 1GLPA 2PBJA 4ZL8A 4LLRA 17GSA 6GSVA 3KTBA 2H75A 4LL1B 2IPAA 2B7JA 3VWVA 4JRRA 3D4TA 4ILFA 2PMTA 2IMIA 3MYDA 2CAQA 4KGIA 1TK8B 2EIOA 20GSA 5HFGA 5EPFA 4XS6A 1E2YA 1GUMA 3CMIA 4I2UA 4A5PA 4BVXA 4MF6A 3VI5A 3VFIA 5IOXA 3HZ8A 3RHBA 4D73A 1ZGNA 2MZCA 2FLSA 1LBKA 1T8EB 1WOUA 5EVOA 3FZ5A 3PR8A 5H5SA 3QPMA 3H93A 4MZWA 5AIXA 1Z7PA 1XW5A 3E3EA 5CAXA 4ZL9A 3GKMA 3UIWA 2QA1A 2QC7A 1GSQA 2V2GA 3GH9A 4OCFA 3C1SA 1SK1A 3IV4A 3EMXA 1TRUA 1A24A 3UMAA 2PVQA 4IHUA 3FY7A 1T3BA 4FQUA 5HR1A 1NHOA 2I9HA 3EYTA 3HCZA 2N5AA 1T4ZA 1EOHA 2ES7A 3I9V2 1SKRB 5GZZB 4MPGA 1ABAA 3DRNA 1R5AA 2LNSA 1OC9A 2PVOC 3G7YA 2G2QA 4BWQA 5A4VA 3CSHA 3FYGA 3QAGA 5KEJA 4PX1A 4L5LA 1HYUA 2OJLA 4CHSA 5B8AA 1FG4A 1Z5YE 1TTZA 1TRWA 2VL2A 4AJ8A 4IGJA 14GSA 5AIVA 5DQYA 4V2LA 3HJPA 1ZYEA 2PPTA 2YZUA 3TRXA 2VCQA 1THOA 3O76A 3KMOA 3GKNA 2LJAA 2H0GA 3US3A 4K9ZA 4JZQA 3ZRDA 2F9SA 2IMFA 4OO4A 2C3TA 2H8LA 1OC3A 10GSA 3HD5A 3ME8A 2VO4A 5B8BA 1PRXA 4K8MA 2FUG2 3MWHA 5J9CA 3UEMA 5DJMA 2YV7A 4OD7A 1VF2A 5GSTA 3FMWA 4KNDA 3RPPA 1K0CA 2PERA 4G9HA 3C1RA 2D2ZA 3GRXA 3M1GA 4MJEA 4XS4A 4QL7A 3GN3A 2GQLA 2OA7A 4OMVA 2IMEA 1F3AA 3WGEA 1URMA 3AY8A 4XRAA 4KCEA 4ZBBA 1XOAA 1GSFA 1SU9A 1V58A 1OC8A 3KIJA 2HSYA 4YKGA 3IK9A 4GQCA 5HR0A 2R5GA 2RM5A 3F6DA 2OKAA 2HNLA 3VPTA 2K8VA 3MDKA 5FWGA 3GL3A 2H1DA 5D73A 5ECQB 4LMVA 3TDGA 3RPNA 1PL1A 2MMZA 3EVIA 5ECOB 3EINA 1OYJA 4KW6A 4HDEA 1WPIA 5JWQB 1GULA 1S3AA 3ERFA 4GLTA 5BRTA 1PGTA 3UVHA 1EEMA 5IMVA 4BVYA 4G0LA 4LMWA 2V32A 4I97A 4L0UA 1AXDA 3LG6A 3D22A 1A23A 5DCGA 1U88A 2K18A 4GXZA 2FD3A 4F03A 3TGZA 3IBHA 4G2EA 2B5YA 3L0HA 4N0ZA 4BA7A 2FWHA 2KUCA 4BVXB 1BJXA 2H6ZA 3A5IA 1XW9A 4TOPA 1GNWA 2RM6A 3VWUA 2B5XA 3C71A 1S3DA 3DEXA 1N8JA 2I1UA 3FRCA 2TRCP 3HY2A 4EE0A 2L6CA 2X4AA 4Z2UA 1IYHA 5FHIA 3KP9A 3L78A 5IO0A 4F0BA 5IMAA 2VUPA 1XWGA 2P5QA 2IL3A 4P3YB 5A4WA 2X8GA 4K7IA 5AGYA 2FY6A 1X9WB 2L5LA 1F37A 3OR5A 3GSTA 2RUEA 1ML6A 4WBRD 5A5KA 2CVKA 2OACA 4HEA2 2HRNA 3H4KA 3D5JA 2B6MA 2YWNA 3QR6A 2VCXA 5ECPB 1OC9B 1T7PB 1H4OA 1X5DA 4MDCA 1DUGA 4RI6A 2HSMA 1VRSD 1VF3A 3TOUA 1M2BA 1I9DA 1NW2A 4MABA 4I5QA 1G7OA 4FYCA 5IMZA 4BPYA 2GSSA 3TRQA 1T4YA 3DMLA 3GIXA 4JU5A 1SENA 4QQ7A 2FWFA 1QQ2A 4EUYA 2E0QA 2IWTA 3IE3A 4PTSA 1YQ1A 4TR1A 1O85A 3VURA 5KN0A 2RLIA 1USBA 2XPDA 4IQAA 4KE3A 1PKZA 2X99A 2YCDA 3PINA 1B4QA 1ZL9A 5G2ZA 2HZFA 1GL8A 4YQUA 1RW1A 3L4NA 3KGKA 1ZCPA 4KUNA 4MLYA 3RAZA 1F2EA 4XRDA 2QA2A 4ZB6A 3GNJA 3WGDA 1QK8A 1N2AA 4I6XA 5J5NA 1LJRA 3HHVA 5GAND 4XS4B 1WE0A 1ERUA 2YWIA 4YH2A 2HXKA 1YEPA 1GWCA 1I5GA 4GSNA 3MNGA 3CSJA 4OCEA 1G6WA 2R0GA 1PN9A 1Y6EA 2VCVA 5JCUA 1TI1A 1UC7A 1MDIA 1A8YA 2DJ3A 3FEUA 1KTEA 2LS5A 1EGRA 2FGXA 1DBYA 3QFAC 5GAPD 3NOFA 1AQXA 4EF0A 4ID0A 1GTUA 3TRPA 1QFNA 4MZBA 3VWXA 4KDUA 5DJLA 2CQ9A 1A0FA 3HXSA 3K8NA 1GNEA 3ERGA 2P5RA 2VL3A 3IC8A 4BVYB 5IIZA 5JCGA 2E2GA 5LCZA 1A2MA 1A8LA 1BAYA 3O6TA 1YZXA 3A2XA 2QKEA 2ON5A 2P0GA 4OO5A 2J9HA 1YF1A 1GSEA 2JSYA 3ERWA 4KDXA 3UL3A 2OE1A 4NV5A 2G0FA 1XZOA 3WD6A 5HR2A 2GSTA 1GSSA 4GF0A 5DAKA 4K5RA 4F2IA 3GTUA 4NPBA 4MMMA 1ERTA 2C0FA 1SD8A 3SWLA 2VAFA 3KH7A 3P7XA 1QMVA 3F6FA 5ECMB 1SJZA 2H6XA 1HD2A 2DJ0A 2LJKA 2I81A 1GTIA 1ILOA 2ZNMA 3HKRA 4TXVA 4XS1A 2KLXA 4XTSA 4HJMA 1HQOA 3QAVA 4LA1A 1J0FA 5B6NA 5F8BA 3ZIVA 4F82A 3L9SA 1K3LA 2Z9SA 4GQFA 4MF5A 2L59A 3MIXA 1ZZYA 2VM1A 3R3EA 3TUEA 3ZLPA 2PU9C 2YWMA 2DLXA 3FR3A 5D9VA 3DVXA 4NHZA 4G0KA 3F8UA 3G7JA 2HSHA 6GSUA 1SL1B 1XIYA 1R5PA 2DIYA 1X9SB 1JFUA 5CREA 1K0MA 2LJRA 1R26A 2FA4A 3LW9A 5CRGA 3M9JA 4K6XA 5DCHA 2NVLA 4PQHA 1JZRA 5IMFA 3FHKA 3D21A 3NZNA 2CVDA 1JHBA 4MP4A 1NM3A 4J2FA 1U3AA 2H72A 1GP1A 4ML1A 1TK5B 3HA9A 4TR1B 3DGQA 3IDVA 1ZYNA 4FO5A 2A2SA 3HYPA 3GH6A 4ZILA 4PURA 3U5RE 3LJRA 4L8EA 3ZZXA 2I3YA 2YP6A 4GWRA 4Z2TA 1PX6A 13GSA 2O87A 1XXUA 1TW9A 1TRVA 4FYBA 1JZOA 5CRHA 3LQ7A 3Q18A 3CYNA 1ZYPA 3WT2A 4OWYA 4WXTA 2VOCA 5IMDA 1K0AA 1WP0A 3TJKA 3UBLA 1X0RA 4JE1A 1AIUA 1Z3EA 2WJUA 3C73A 4DSSA 3IK7A 4XIHA 1WMJA 1VF4A 2BTOT 4POBA 2B5EA 1ZMAA 1V40A 3PH9A 1Z7RA 3FZAA 1B9XC 3IRAA 1OKDA 4V1Ap 1CQHA 3W8JA 2DSAA 12GSA 1V57A 3A2WA 4K2XA 1RK4A 4Q5QA 2ON7A 1GSYA 4OFNA 1QUWA 1UA5A 1K0BA 3IC4A 4EIPA 4IS0A 3F4TA 4O5QA 4PUFC 2GS3A 2GLRA 3E9JB 4ZL7A 2WULA 3UAPA 2RUFA 3D4MA 2AJQB 4ISDA 3CXGA 2LRTA 5KN2A 2YANA 3DWVA 4EL1A 2GTUA 18GSA 3KMNA 5HFKA 4MA9A 2PN8A 2VD0A 2NPBA 3TJGA 4BL7A 4WR4A 4O7HA 3TKSC 1YF0A 2DJJA 2J23A 2XBIA 2WS2A 1MDJA 5ELGA 1SK0A 2UZ8A 3ISOA 3QD9A 3FK8A 5ID2A 3GTUB 3CBUA 5AN1A 2LUSA 3VI7A 2R3XA 2WCIA 4KH7A 3U6VA 1M9BA 2L5OA 2C3NA 3BOAA 5DVBA 5G5FA 3HJOA 2FHEA 2DJ2A 2OBIA 4HU9A 1BQ7A 4BWSA 1U3IA 5G1LA 3HJMA 3EC3A 4YAPA 1B9YC 1X9MB 1B48A 4MJAA 3APQA 1OKTA 2RIIA 1EV4A 1SYXA 1R7HA 3H1NA 3WYWA 2GSRA 1JLVA 4ZBAA 1ON4A 4CY8A 2DC5A 2CZ2A 4JR4A 4Q5NA 4EVMA 4RQRA 4IJ3A 2CX4A 3FR6A 3VLNA 1AQWA 2KOKA 4N11A 1PN0A 3LYKA 3ZTLA 4X4JA 2H1GA 2GGTA 2TRXA 4HJ2A 2E2MA 1THXA 2MYGA 3KTLA 3KEBA 4HS1A 1SK2A 3BD2A 5JWOB 2JSZA 3P8WA 5GSSA 1SYRA 5E59A 5CO3A 2IMDA 4K0GA 1OAZA 4KX4A 22GSA 2HZEA 1GUKA 2HLSA 1MDKA 3JCML 4D73B 1PMTA 4N10A 1FW1A 4E8HA 2R2JA 1XVWA 1FB6A 3F4SA 2DJ1A 3BCKA 4ECCA 2DJKA 2CV4A 4YQMA 2LTKA 2OBKA 2JADA 2R4VA 1M99A 4HZ2A 3ZFBA 3BCIA 1TK0B 2JU5A 2BJXA 1T1VA 5CYYA 1SD9A 2C1YA 2VL2C 2K6VA 4ICYA 1KEBA 4O5UA 3GYKA 4ML6A 4HQSA 3GKKA 4N0VA 2NTOA 4ZXGA 2H73A 3GHAA 1Y25A 2PGTA 4O92A 4PQ1A 4GCIA 5E4WA 6GSWA 5ECIB 1ZYQB 3TKQA 4EKZA 3UVTA 3PGTA 1MD4A 1O6JA 2AUVA 4WR5A 4OFTA 4XCSA 5DDLA 1M0UA 3QMXA 3F63A 2HT9A 3HVVA 8GSSA 5L71A 2VLUA 3M0FA 2H6YA 1NSWA 2B1LA 2X49A 3ZFLA 1QGVA 2GDRA 2C0EA 2R37A 1O7UA 3EPTA 3C8EA 1O8WA 4TRXA 3KD0A 5KOWA 2L57A 4GSSA 1Z9HA 4WF5A 2DBCA 3FR9A 5EL8A 5ECRB 2L4CA 1UN2A 3DXBA 1V9WA 1PX7A 5LNKe 3D0ZA 2IFQA 2GQMA 4BL7B 1M2AA 5D96A 3KM6A 4G19A 3V1WA 2C0DA 3P2AA 1K3YA 3H8QA 3ZVJA 3APOA 3QFBC 4Z7XA 2PUKC 2REMA 1FO5A 4HUAA 4V1Ag 2YWOA 2L4QA 5ID2B 4KDYA 3DYRA 1RQMA 4YQVA 3RHCA 4K7NA 4EO3A 2V1MA 4ZB8A 1FVJA 3VPQA 3RDWA 2IJYA 1KBNA 3I43A 2QSIA 3G9BA 3MSZA 5G31A 1SKSB 1OE8A 2O89A 4MNNA 1TU8A 1SJ6A 4PQIA 3GURA 1FOHA 3CTGA 1YKAA 3ZYWA 4HI7A 2EIRA 3PPUA 4TW5A 5D9XA 1Q4JA 4TR0A 2IIYA 1J9BA 4WF4A 2F3MA 2A4HA 2HRKA 3ZMKA 3KH9A 5G5EA 3GKXA 4JR6A 4K7OA 1W89A 3N5OA 4JBBA 3KZQA 2VM2A 1PQNA 3TKRA 2YZHA 5D9TA 2MMOA 2GZYA 3F3RA 1GUHA 4TXOA 2CX3A 5G1KA 2YNXA 1FHEA 5J4UA 3M9KA 3EMPA 3TCOA 2WZ9A 1MEKA 2HZEB 2L6DA 4EXJA 1XPVA 3BJ5A 2H71A 3FZ9A 1EP7A 2OADA 4X0XA 1YJ6A 4TR3A 1MD3A 3WT1A 3BBYA 3TKPA 3MAKA 1V2AA 2OE3A 3GFKA 1K0OA 1PD21 7GSSA 4I2TA 3ZIJA 4K1FA 4DVCA 2GT5A 3G7IA 3CRTA 4TR4A 2FWEA 2LQQA 1DE2A 4NV2A 2WFCA 4Q5FA 3UOMA 4Z2RA 4MK3A 3DVWA 1K3OA 11GSA 4AJ6A 3KCMA 5IM9A 4GSTA 1BG5A 2HRFA 5KN3A 2AV4A 4PXOA 4IW9A 1TRSA 1JZWA 4OFMA 2VLTA 2AHEA 4MJBA 5F06A 2GZPA 1ST9A 5IQYA 4RQXA 5ELAA 3H79A 1KNGA 1FB0A 1XCCA 3LFLA 4ZIJA 2VIMA 5JCWA 1ZOFA 4GRFA 2C4JA 2HRAA 4AGSA 3TJJA 3R2QA 1SL0B 4WETA 5IMCA 3DD3A 4EC0A 1A2JA 4MF7A 3VWWA 1SJIA 2AB6A 2M46A 2X8HA 1AQVA 1GH2A 4F0CA 2O8VB 1YY7A 3UBKA 5HR3A 3EURA 3TJFA 4HOJA 1XWKA 2VD1A 2GSQA 1EWXA 1K0DA 3CRUA 1TXXA 4PNGA 2R0CA 1M2DA 4ECJA 2IMKA 3ED3A 2N5FA 2LV3A 2LRCA 2XPEA 5HQPA 1XWAA 2KP2A 3IPZA 2IFQB 3HZ4A 4AJ7A 1R4WA 3J7Yb 3IHQA 2A2RA 2PWJA 1HNCA 1XWBA 5ECHB 1DE1A 2VL9A 5ECNB 4FIWA 1G7EA 1X5EA 5EY6A 3LXTA 5A4UA 1EP8A 4TN8A 3ZVJD 4NMUA 3E0UA 3M8NA 2P31A 4KF9A 2HI7A 4IQ1A 1NHYA 3J7Yk 2VCTA 3Q6OA 3IAS2 4FH8A 2KHPA 4J56E 3LEFA 2A4VA 2WDUA 2MMAA 3ZITA 2VCWA 1VF1A 2YJHA 1AAZA 1PKWA 2VLVA 2B3SA 4O32A 4WEYA 1B8XA 1B4PA 6GSYA 3EWLA 5ABRA 4H86A 3F0IA 4L5OA 1O81A 2ZUPA 6GSTA 3GA4A 4WBJA 3TOTA 3TB2A 4MCUA 4NAXA 2YN1A 1G6YA 1EGOA 4POKA 4MJCA 2HE3A 1WWJA 5ECSA 3LYPA 1QXHA 2TIRA 3IR4A 4IKHA 1GLQA 4TXOB 2IN3A 4X1UA 2H1AA 2CZ3A 4ACSA 3CSIA 1S3CA 2FNOA 5IPHA 1GSUA 4V2NA 2F8FA 5DAKB 1GSDA 1EOGA 3KXOA 2H70A 1F6MC 4O5RA 2MMNA 2YPMA 16GSA 9GSSA 5B7CA 5CP1A 1J08A 3D6IA 3UARA 1C72A 4EDYA 2LQOA 2XHFA 3HVXA 4G10A 2DKHA 2BMXA 5C00A 1A0RP 5H5QA 4AF2A 2C80A 2LEGA 2DIZA 5JWRB 3A3TA 4TVEA 1YEXA 3QOUA 1AW9A 4TKYA 4RI7A 2X8CA 3HVSA 3A5WA 3L9VA 4PGTA 4CY6A 4HU7A 4IVFA 3LGCA 2M72A 1PSQA 5C04A 4E8EA 4ECBA 3IOSA 1CQGA 1TOFA 2AYTA 1YKCA 1WIKA 1Z6MA 2H74A 1K0NA 5IOWA 5DALA 4ECIA 4DSRA 4HQZA 1OE7A 3GSSA 3EU3A 2JZSA 2DMMA 1BEDA 4POMA 3N9JA 2HYXA 3M3MA 1OVNA 5COHA 3ME7A 3RBTA 2YOIA 4PNFA 1E6BA 1XFLA 2XC2A 2C8UA 1PL2A 4K5SA 5BMUA 4FYUA 1EV9A 4IN0A 1DSBA 1HNAA 1ACVA 1FOVA 4J57E 5HFIA 2F51A 1TJDA 1X5CA 2B7KA 4POLA 1ERWA 1XVQA 1YDKA 1XOBA 3LSZA 5ENUA 2CAIA 2CA8A 3WGXA 4KB3A 2O85A 4KCAA 3HDCA 2H66A 5J3RA 2AAWA 4I8BA 2N5BA 4G0IA 1GTBA 4IBPA 2YV9A 2A2PA 5CRDA 4MH3A 1SL2B 3FKFA 2MBTA 2KP1A 2LRNA 3TJBA 2V6KA 3KP8A 4NWYA 4DSSB 3EE2A 1O73A 2ALBA 5H5RA 3LORA 5KOXA 1FAAA 2B1KA 1WRYA 3APSA 4K0NA 2YJ7A 1GTAA 5F0GA 1PA3A 4EDZA 3CTFA 3UJ1A 2F8AA 5D9WA 2H01A 1U6TA 4RUVA 6GSSA 3EU4A 4DSQA 3ZREA 5B6MA 1BYEA 2V6OA 4KAEA 2C0GA 3P90A 3NIVA 4LL4B 3FZ4A 4ZB9A 5KN1A 2WB9A 4PUAA 1UVZA 3GX8A 2LSTA 4IELA 3Q74A 2JL4A 2VCZA 5FT3A 1TU7A 3W8SA 1TDIA 6GSXA 5ECKB 2GQKA 4MZCA 5G30A 1AUCA 2LNTA 4KSMA 1Z6NA 1WJKA 4Q5RA 3GUSA 4EIQA 2CT6A 4JEDA 2X64A 5IO2A 1TP9A 3KJYA 4NHWA 3GL5A 5D93A 5DBQA 2C3QA 2H0IA 1GRXA 4L0WA 3QDNA 5DQSA 3O3TA 2JZRA 3C7MA 2DMLA 5ECLB 19GSA 1F9MA 2FCHA 4KA0A 2V41A 2GT6A 3VK9A 1Q98A 5INYA 3F3QA 1FVKA 3SBCA 3F4RA 2EIQA 4YKFA 4X43A 5F07A 4MPFA 4HZ4A 4USSA 3DIEA 4ULXA 2FA8A 3I6AA 4KSOA 2CVBA 3A2VA 3GV1A 4ZBDA 4K2DA 2QGVA 3IXRA 2H1BA 3IA1A 2LKUA 1MTCA 1U87A 3F9UA 2HFDA 2E7PA 1T00A 2H0HA 1BX9A 2XBQA 5F05A 1V98A 3DKSA 3I69A 1O8XA 1TI3A 3Q19A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K8S A;  1F3B A;  1TKD B;  3QAW A;  4MH2 A;  4DEJ A;  3W6G A;  1HNB A;  4CDO A;  4N30 A;  1XBS A;  4IP6 A;  5CRW A;  3S9F A;  2NDO A;  2H30 A;  2EC4 A;  2OE0 A;  1W4V A;  2FWG A;  2H76 A;  1JZD A;  2H19 A;  1G0T A;  5DAL B;  3ZML A;  1H75 A;  5J41 A;  3L9U A;  1SKW B;  5D8I A;  1A2L A;  3GX0 A;  1XWC A;  2R6K A;  4IP1 A;  2JZT A;  2ZCT A;  4GTU A;  3IAM 2;  2JAC A;  2WGR A;  2NBS A;  4YAV A;  1JLW A;  4WKW A;  5CNW A;  5AIS A;  2MBS A;  2K9F A;  3ZL5 A;  1EZK A;  5IPG A;  1AC1 A;  3GMF A;  3FW2 A;  4NXI A;  3LXZ A;  1XW6 A;  4IJI A;  4XHM A;  1M9A A;  4CW9 A;  1ERV A;  2GZZ A;  2WRT A;  3TKS E;  5J9B A;  1M7T A;  3LWA A;  5LD0 A;  3QCP A;  2O7K A;  2M80 A;  2GVP A;  4QL9 A;  4F9Z A;  1VGL A;  1LU4 A;  4V2M A;  2I4A A;  3TKS A;  1EEJ A;  1IYI A;  1GLP A;  2PBJ A;  4ZL8 A;  4LLR A;  17GS A;  6GSV A;  3KTB A;  2H75 A;  4LL1 B;  2IPA A;  2B7J A;  3VWV A;  4JRR A;  3D4T A;  4ILF A;  2PMT A;  2IMI A;  2CAQ A;  4KGI A;  1TK8 B;  2EIO A;  20GS A;  5HFG A;  5EPF A;  4XS6 A;  1E2Y A;  1GUM A;  3CMI A;  4I2U A;  4BVX A;  4MF6 A;  3VI5 A;  3VFI A;  5IOX A;  3HZ8 A;  3RHB A;  4D73 A;  1ZGN A;  2MZC A;  2FLS A;  1LBK A;  1T8E B;  1WOU A;  5EVO A;  3FZ5 A;  3PR8 A;  5H5S A;  3QPM A;  3H93 A;  4MZW A;  5AIX A;  1Z7P A;  1XW5 A;  3E3E A;  5CAX A;  4ZL9 A;  3GKM A;  3UIW A;  2QC7 A;  1GSQ A;  2V2G A;  3GH9 A;  4OCF A;  3C1S A;  1SK1 A;  3IV4 A;  3EMX A;  1TRU A;  1A24 A;  3UMA A;  2PVQ A;  4IHU A;  3FY7 A;  1T3B A;  5HR1 A;  1NHO A;  2I9H A;  3EYT A;  3HCZ A;  2N5A A;  1T4Z A;  1EOH A;  2ES7 A;  3I9V 2;  1SKR B;  5GZZ B;  4MPG A;  1ABA A;  3DRN A;  1R5A A;  2LNS A;  1OC9 A;  2PVO C;  3G7Y A;  2G2Q A;  4BWQ A;  5A4V A;  3CSH A;  3FYG A;  3QAG A;  5KEJ A;  4PX1 A;  4L5L A;  1HYU A;  2OJL A;  4CHS A;  5B8A A;  1FG4 A;  1Z5Y E;  1TTZ A;  1TRW A;  2VL2 A;  4AJ8 A;  4IGJ A;  14GS A;  5AIV A;  5DQY A;  4V2L A;  3HJP A;  1ZYE A;  2PPT A;  2YZU A;  3TRX A;  2VCQ A;  1THO A;  3O76 A;  3KMO A;  3GKN A;  2LJA A;  2H0G A;  3US3 A;  4K9Z A;  4JZQ A;  3ZRD A;  2F9S A;  2IMF A;  4OO4 A;  2C3T A;  2H8L A;  1OC3 A;  10GS A;  3HD5 A;  3ME8 A;  2VO4 A;  5B8B A;  1PRX A;  4K8M A;  2FUG 2;  3MWH A;  5J9C A;  3UEM A;  5DJM A;  2YV7 A;  4OD7 A;  1VF2 A;  5GST A;  4KND A;  3RPP A;  1K0C A;  2PER A;  4G9H A;  3C1R A;  2D2Z A;  3GRX A;  3M1G A;  4MJE A;  4XS4 A;  4QL7 A;  3GN3 A;  2GQL A;  2OA7 A;  4OMV A;  2IME A;  1F3A A;  3WGE A;  1URM A;  3AY8 A;  4XRA A;  4KCE A;  4ZBB A;  1XOA A;  1GSF A;  1SU9 A;  1V58 A;  1OC8 A;  3KIJ A;  2HSY A;  3IK9 A;  4GQC A;  5HR0 A;  2R5G A;  2RM5 A;  3F6D A;  2OKA A;  2HNL A;  3VPT A;  2K8V A;  3MDK A;  5FWG A;  3GL3 A;  2H1D A;  5D73 A;  5ECQ B;  4LMV A;  3TDG A;  3RPN A;  1PL1 A;  2MMZ A;  3EVI A;  5ECO B;  3EIN A;  1OYJ A;  4KW6 A;  4HDE A;  1WPI A;  5JWQ B;  1GUL A;  1S3A A;  3ERF A;  4GLT A;  1PGT A;  3UVH A;  1EEM A;  5IMV A;  4BVY A;  4LMW A;  2V32 A;  4I97 A;  4L0U A;  1AXD A;  3LG6 A;  3D22 A;  1A23 A;  5DCG A;  1U88 A;  2K18 A;  4GXZ A;  2FD3 A;  4F03 A;  3TGZ A;  3IBH A;  4G2E A;  2B5Y A;  3L0H A;  4N0Z A;  4BA7 A;  2FWH A;  2KUC A;  1BJX A;  2H6Z A;  1XW9 A;  4TOP A;  1GNW A;  2RM6 A;  3VWU A;  2B5X A;  3C71 A;  1S3D A;  3DEX A;  1N8J A;  2I1U A;  3FRC A;  2TRC P;  3HY2 A;  4EE0 A;  2L6C A;  1IYH A;  5FHI A;  3KP9 A;  3L78 A;  5IO0 A;  4F0B A;  5IMA A;  2VUP A;  1XWG A;  2P5Q A;  2IL3 A;  4P3Y B;  5A4W A;  2X8G A;  4K7I A;  5AGY A;  2FY6 A;  1X9W B;  2L5L A;  1F37 A;  3OR5 A;  3GST A;  2RUE A;  1ML6 A;  4WBR D;  5A5K A;  2CVK A;  2OAC A;  4HEA 2;  2HRN A;  3H4K A;  3D5J A;  2B6M A;  2YWN A;  3QR6 A;  2VCX A;  5ECP B;  1OC9 B;  1T7P B;  1H4O A;  1X5D A;  4MDC A;  1DUG A;  4RI6 A;  1VRS D;  1VF3 A;  3TOU A;  1M2B A;  1I9D A;  1NW2 A;  4MAB A;  4I5Q A;  1G7O A;  4FYC A;  5IMZ A;  4BPY A;  2GSS A;  3TRQ A;  1T4Y A;  3DML A;  3GIX A;  4JU5 A;  1SEN A;  4QQ7 A;  2FWF A;  1QQ2 A;  4EUY A;  2E0Q A;  2IWT A;  3IE3 A;  1YQ1 A;  4TR1 A;  1O85 A;  3VUR A;  5KN0 A;  2RLI A;  1USB A;  2XPD A;  4IQA A;  4KE3 A;  1PKZ A;  2X99 A;  2YCD A;  3PIN A;  1B4Q A;  1ZL9 A;  5G2Z A;  2HZF A;  1GL8 A;  4YQU A;  1RW1 A;  3L4N A;  3KGK A;  1ZCP A;  4KUN A;  4MLY A;  3RAZ A;  1F2E A;  4XRD A;  4ZB6 A;  3GNJ A;  3WGD A;  1QK8 A;  1N2A A;  4I6X A;  5J5N A;  1LJR A;  3HHV A;  5GAN D;  4XS4 B;  1WE0 A;  1ERU A;  2YWI A;  4YH2 A;  2HXK A;  1YEP A;  1GWC A;  1I5G A;  4GSN A;  3MNG A;  3CSJ A;  4OCE A;  1G6W A;  1PN9 A;  1Y6E A;  2VCV A;  5JCU A;  1TI1 A;  1UC7 A;  1MDI A;  1A8Y A;  2DJ3 A;  3FEU A;  1KTE A;  2LS5 A;  1EGR A;  2FGX A;  1DBY A;  3QFA C;  5GAP D;  3NOF A;  1AQX A;  4EF0 A;  4ID0 A;  1GTU A;  3TRP A;  1QFN A;  4MZB A;  3VWX A;  4KDU A;  5DJL A;  2CQ9 A;  1A0F A;  3HXS A;  3K8N A;  1GNE A;  3ERG A;  2P5R A;  2VL3 A;  5IIZ A;  5JCG A;  2E2G A;  5LCZ A;  1A2M A;  1A8L A;  1BAY A;  3O6T A;  1YZX A;  3A2X A;  2QKE A;  2ON5 A;  2P0G A;  4OO5 A;  2J9H A;  1YF1 A;  1GSE A;  2JSY A;  3ERW A;  4KDX A;  3UL3 A;  2OE1 A;  4NV5 A;  2G0F A;  1XZO A;  3WD6 A;  5HR2 A;  2GST A;  1GSS A;  4GF0 A;  5DAK A;  4F2I A;  3GTU A;  4MMM A;  4NPB A;  1ERT A;  2C0F A;  1SD8 A;  3SWL A;  2VAF A;  3KH7 A;  3P7X A;  1QMV A;  3F6F A;  5ECM B;  1SJZ A;  2H6X A;  1HD2 A;  2DJ0 A;  2LJK A;  2I81 A;  1GTI A;  1ILO A;  2ZNM A;  3HKR A;  4TXV A;  4XS1 A;  2KLX A;  4XTS A;  4HJM A;  1HQO A;  3QAV A;  4LA1 A;  1J0F A;  5B6N A;  5F8B A;  3ZIV A;  4F82 A;  3L9S A;  1K3L A;  2Z9S A;  4GQF A;  4MF5 A;  2L59 A;  1ZZY A;  2VM1 A;  3TUE A;  3ZLP A;  2PU9 C;  2YWM A;  2DLX A;  3FR3 A;  5D9V A;  3DVX A;  4NHZ A;  3F8U A;  3G7J A;  2HSH A;  6GSU A;  1SL1 B;  1XIY A;  1R5P A;  2DIY A;  1X9S B;  1JFU A;  5CRE A;  1K0M A;  2LJR A;  1R26 A;  2FA4 A;  5CRG A;  3M9J A;  4K6X A;  5DCH A;  2NVL A;  4PQH A;  1JZR A;  5IMF A;  3FHK A;  3D21 A;  3NZN A;  2CVD A;  1JHB A;  4MP4 A;  1NM3 A;  4J2F A;  1U3A A;  2H72 A;  1GP1 A;  4ML1 A;  1TK5 B;  3HA9 A;  4TR1 B;  3DGQ A;  3IDV A;  4FO5 A;  2A2S A;  3HYP A;  3GH6 A;  4ZIL A;  4PUR A;  3U5R E;  3LJR A;  4L8E A;  3ZZX A;  2I3Y A;  2YP6 A;  4GWR A;  1PX6 A;  13GS A;  2O87 A;  1XXU A;  1TW9 A;  1TRV A;  4FYB A;  1JZO A;  5CRH A;  3LQ7 A;  3Q18 A;  3CYN A;  3WT2 A;  4OWY A;  4WXT A;  2VOC A;  5IMD A;  1K0A A;  1WP0 A;  3TJK A;  3UBL A;  1X0R A;  4JE1 A;  1AIU A;  1Z3E A;  2WJU A;  3C73 A;  4DSS A;  3IK7 A;  4XIH A;  1WMJ A;  1VF4 A;  2BTO T;  4POB A;  2B5E A;  1ZMA A;  1V40 A;  3PH9 A;  1Z7R A;  3FZA A;  1B9X C;  3IRA A;  1OKD A;  4V1A p;  1CQH A;  3W8J A;  2DSA A;  12GS A;  1V57 A;  3A2W A;  1RK4 A;  4Q5Q A;  2ON7 A;  1GSY A;  4OFN A;  1QUW A;  1UA5 A;  1K0B A;  3IC4 A;  4IS0 A;  3F4T A;  4PUF C;  2GS3 A;  2GLR A;  3E9J B;  4ZL7 A;  2WUL A;  3UAP A;  2RUF A;  3D4M A;  2AJQ B;  4ISD A;  3CXG A;  2LRT A;  5KN2 A;  2YAN A;  3DWV A;  4EL1 A;  2GTU A;  18GS A;  3KMN A;  5HFK A;  4MA9 A;  2PN8 A;  2VD0 A;  2NPB A;  3TJG A;  4BL7 A;  4WR4 A;  4O7H A;  3TKS C;  1YF0 A;  2DJJ A;  2J23 A;  2XBI A;  2WS2 A;  1MDJ A;  5ELG A;  1SK0 A;  3QD9 A;  3ISO A;  3FK8 A;  5ID2 A;  3GTU B;  3CBU A;  5AN1 A;  2LUS A;  3VI7 A;  2R3X A;  2WCI A;  4KH7 A;  3U6V A;  1M9B A;  2L5O A;  2C3N A;  3BOA A;  5DVB A;  5G5F A;  3HJO A;  2FHE A;  2DJ2 A;  2OBI A;  4HU9 A;  1BQ7 A;  4BWS A;  1U3I A;  5G1L A;  3HJM A;  3EC3 A;  4YAP A;  1B9Y C;  1X9M B;  1B48 A;  4MJA A;  3APQ A;  1OKT A;  2RII A;  1EV4 A;  1SYX A;  1R7H A;  3H1N A;  3WYW A;  2GSR A;  1JLV A;  4ZBA A;  1ON4 A;  2DC5 A;  2CZ2 A;  4JR4 A;  4Q5N A;  4EVM A;  4RQR A;  4IJ3 A;  2CX4 A;  3FR6 A;  3VLN A;  1AQW A;  2KOK A;  4N11 A;  3LYK A;  3ZTL A;  2H1G A;  2GGT A;  2TRX A;  4HJ2 A;  2E2M A;  1THX A;  2MYG A;  3KTL A;  3KEB A;  4HS1 A;  1SK2 A;  3BD2 A;  5JWO B;  2JSZ A;  3P8W A;  5GSS A;  1SYR A;  5E59 A;  5CO3 A;  2IMD A;  4K0G A;  1OAZ A;  4KX4 A;  22GS A;  2HZE A;  1GUK A;  2HLS A;  1MDK A;  3JCM L;  4D73 B;  1PMT A;  4N10 A;  1FW1 A;  4E8H A;  2R2J A;  1XVW A;  1FB6 A;  3F4S A;  2DJ1 A;  3BCK A;  4ECC A;  2DJK A;  2CV4 A;  4YQM A;  2LTK A;  2OBK A;  2JAD A;  2R4V A;  1M99 A;  4HZ2 A;  3ZFB A;  3BCI A;  1TK0 B;  2JU5 A;  2BJX A;  1T1V A;  5CYY A;  1SD9 A;  2C1Y A;  2VL2 C;  2K6V A;  1KEB A;  3GYK A;  4ML6 A;  4HQS A;  3GKK A;  4N0V A;  2NTO A;  4ZXG A;  2H73 A;  3GHA A;  1Y25 A;  2PGT A;  4O92 A;  4PQ1 A;  4GCI A;  5E4W A;  6GSW A;  5ECI B;  1ZYQ B;  3TKQ A;  4EKZ A;  3UVT A;  3PGT A;  1MD4 A;  1O6J A;  2AUV A;  4WR5 A;  4OFT A;  4XCS A;  5DDL A;  1M0U A;  3QMX A;  3F63 A;  2HT9 A;  3HVV A;  8GSS A;  5L71 A;  2VLU A;  3M0F A;  2H6Y A;  1NSW A;  2B1L A;  3ZFL A;  1QGV A;  2GDR A;  2C0E A;  2R37 A;  1O7U A;  3C8E A;  1O8W A;  4TRX A;  3KD0 A;  2L57 A;  4GSS A;  1Z9H A;  4WF5 A;  2DBC A;  3FR9 A;  5EL8 A;  5ECR B;  2L4C A;  1UN2 A;  3DXB A;  1V9W A;  1PX7 A;  5LNK e;  3D0Z A;  2IFQ A;  2GQM A;  1M2A A;  5D96 A;  3KM6 A;  4G19 A;  3V1W A;  2C0D A;  3P2A A;  1K3Y A;  3H8Q A;  3ZVJ A;  3APO A;  3QFB C;  4Z7X A;  2PUK C;  2REM A;  1FO5 A;  4HUA A;  4V1A g;  2YWO A;  2L4Q A;  5ID2 B;  4KDY A;  3DYR A;  1RQM A;  4YQV A;  3RHC A;  4K7N A;  4EO3 A;  2V1M A;  4ZB8 A;  1FVJ A;  3VPQ A;  3RDW A;  2IJY A;  1KBN A;  3I43 A;  2QSI A;  3G9B A;  3MSZ A;  5G31 A;  1SKS B;  1OE8 A;  2O89 A;  1TU8 A;  1SJ6 A;  4PQI A;  3GUR A;  3CTG A;  1YKA A;  3ZYW A;  4HI7 A;  2EIR A;  4TW5 A;  5D9X A;  1Q4J A;  4TR0 A;  2IIY A;  1J9B A;  4WF4 A;  2F3M A;  3ZMK A;  3KH9 A;  5G5E A;  3GKX A;  4JR6 A;  4K7O A;  1W89 A;  3N5O A;  4JBB A;  3KZQ A;  2VM2 A;  1PQN A;  3TKR A;  2YZH A;  5D9T A;  2MMO A;  2GZY A;  3F3R A;  1GUH A;  4TXO A;  2CX3 A;  5G1K A;  2YNX A;  1FHE A;  5J4U A;  3M9K A;  3EMP A;  3TCO A;  2WZ9 A;  1MEK A;  2HZE B;  2L6D A;  4EXJ A;  1XPV A;  3BJ5 A;  2H71 A;  3FZ9 A;  1EP7 A;  2OAD A;  4X0X A;  1YJ6 A;  4TR3 A;  1MD3 A;  3WT1 A;  3BBY A;  3TKP A;  3MAK A;  1V2A A;  2OE3 A;  3GFK A;  1K0O A;  1PD2 1;  7GSS A;  4I2T A;  3ZIJ A;  4K1F A;  4DVC A;  2GT5 A;  3G7I A;  3CRT A;  4TR4 A;  2FWE A;  2LQQ A;  1DE2 A;  4NV2 A;  2WFC A;  4Q5F A;  3UOM A;  4MK3 A;  3DVW A;  1K3O A;  11GS A;  4AJ6 A;  3KCM A;  5IM9 A;  4GST A;  1BG5 A;  2HRF A;  5KN3 A;  2AV4 A;  4PXO A;  4IW9 A;  1TRS A;  1JZW A;  4OFM A;  2VLT A;  2AHE A;  4MJB A;  5F06 A;  2GZP A;  1ST9 A;  5IQY A;  4RQX A;  5ELA A;  3H79 A;  1KNG A;  1FB0 A;  1XCC A;  3LFL A;  4ZIJ A;  2VIM A;  5JCW A;  1ZOF A;  4GRF A;  2C4J A;  4AGS A;  3TJJ A;  3R2Q A;  1SL0 B;  4WET A;  5IMC A;  3DD3 A;  4EC0 A;  1A2J A;  4MF7 A;  3VWW A;  1SJI A;  2AB6 A;  2M46 A;  2X8H A;  1AQV A;  1GH2 A;  4F0C A;  2O8V B;  1YY7 A;  3UBK A;  5HR3 A;  3EUR A;  3TJF A;  4HOJ A;  1XWK A;  2VD1 A;  2GSQ A;  1EWX A;  1K0D A;  3CRU A;  1TXX A;  4PNG A;  1M2D A;  4ECJ A;  2IMK A;  3ED3 A;  2N5F A;  2LV3 A;  2LRC A;  2XPE A;  5HQP A;  1XWA A;  2KP2 A;  3IPZ A;  2IFQ B;  3HZ4 A;  4AJ7 A;  1R4W A;  3J7Y b;  3IHQ A;  2A2R A;  2PWJ A;  1HNC A;  1XWB A;  5ECH B;  1DE1 A;  2VL9 A;  5ECN B;  4FIW A;  1G7E A;  1X5E A;  5EY6 A;  3LXT A;  5A4U A;  1EP8 A;  4TN8 A;  3ZVJ D;  4NMU A;  3E0U A;  3M8N A;  2P31 A;  2HI7 A;  4IQ1 A;  1NHY A;  3J7Y k;  2VCT A;  3Q6O A;  3IAS 2;  4FH8 A;  2KHP A;  4J56 E;  3LEF A;  2A4V A;  2WDU A;  2MMA A;  3ZIT A;  2VCW A;  1VF1 A;  2YJH A;  1AAZ A;  1PKW A;  2VLV A;  2B3S A;  4O32 A;  4WEY A;  1B8X A;  1B4P A;  6GSY A;  3EWL A;  5ABR A;  4H86 A;  3F0I A;  4L5O A;  1O81 A;  2ZUP A;  6GST A;  3GA4 A;  4WBJ A;  3TOT A;  3TB2 A;  4MCU A;  4NAX A;  2YN1 A;  1G6Y A;  1EGO A;  4POK A;  4MJC A;  2HE3 A;  1WWJ A;  5ECS A;  3LYP A;  1QXH A;  2TIR A;  3IR4 A;  4IKH A;  1GLQ A;  4TXO B;  2IN3 A;  4X1U A;  2H1A A;  2CZ3 A;  4ACS A;  3CSI A;  1S3C A;  2FNO A;  5IPH A;  1GSU A;  4V2N A;  2F8F A;  5DAK B;  1GSD A;  1EOG A;  3KXO A;  2H70 A;  1F6M C;  4O5R A;  2MMN A;  2YPM A;  16GS A;  9GSS A;  5B7C A;  5CP1 A;  1J08 A;  3D6I A;  3UAR A;  1C72 A;  4EDY A;  2LQO A;  2XHF A;  3HVX A;  4G10 A;  2BMX A;  5C00 A;  1A0R P;  5H5Q A;  4AF2 A;  2C80 A;  2LEG A;  2DIZ A;  5JWR B;  3A3T A;  4TVE A;  1YEX A;  3QOU A;  1AW9 A;  4TKY A;  4RI7 A;  2X8C A;  3HVS A;  3A5W A;  3L9V A;  4PGT A;  4HU7 A;  4IVF A;  3LGC A;  2M72 A;  1PSQ A;  5C04 A;  4E8E A;  4ECB A;  3IOS A;  1CQG A;  1TOF A;  2AYT A;  1YKC A;  1WIK A;  1Z6M A;  2H74 A;  1K0N A;  5IOW A;  5DAL A;  4ECI A;  4DSR A;  4HQZ A;  1OE7 A;  3GSS A;  3EU3 A;  2JZS A;  2DMM A;  1BED A;  4POM A;  3N9J A;  2HYX A;  3M3M A;  1OVN A;  5COH A;  3ME7 A;  3RBT A;  2YOI A;  4PNF A;  1E6B A;  1XFL A;  2XC2 A;  2C8U A;  1PL2 A;  4FYU A;  1EV9 A;  4IN0 A;  1DSB A;  1HNA A;  1ACV A;  1FOV A;  4J57 E;  5HFI A;  2F51 A;  1TJD A;  1X5C A;  2B7K A;  4POL A;  1ERW A;  1XVQ A;  1YDK A;  1XOB A;  3LSZ A;  5ENU A;  2CAI A;  2CA8 A;  3WGX A;  4KB3 A;  2O85 A;  4KCA A;  3HDC A;  2H66 A;  5J3R A;  2AAW A;  4I8B A;  2N5B A;  1GTB A;  4IBP A;  2YV9 A;  5CRD A;  4MH3 A;  1SL2 B;  3FKF A;  2MBT A;  2KP1 A;  2LRN A;  3TJB A;  2V6K A;  3KP8 A;  4NWY A;  4DSS B;  3EE2 A;  1O73 A;  2ALB A;  5H5R A;  3LOR A;  1FAA A;  2B1K A;  1WRY A;  3APS A;  4K0N A;  2YJ7 A;  1GTA A;  5F0G A;  1PA3 A;  4EDZ A;  3CTF A;  3UJ1 A;  2F8A A;  5D9W A;  2H01 A;  1U6T A;  4RUV A;  6GSS A;  3EU4 A;  4DSQ A;  3ZRE A;  5B6M A;  1BYE A;  2V6O A;  4KAE A;  2C0G A;  3P90 A;  3NIV A;  4LL4 B;  3FZ4 A;  4ZB9 A;  5KN1 A;  2WB9 A;  4PUA A;  1UVZ A;  3GX8 A;  2LST A;  4IEL A;  3Q74 A;  2JL4 A;  2VCZ A;  5FT3 A;  1TU7 A;  3W8S A;  1TDI A;  6GSX A;  5ECK B;  2GQK A;  4MZC A;  5G30 A;  1AUC A;  2LNT A;  4KSM A;  1Z6N A;  1WJK A;  4Q5R A;  3GUS A;  2CT6 A;  4JED A;  2X64 A;  5IO2 A;  1TP9 A;  3KJY A;  4NHW A;  3GL5 A;  5D93 A;  5DBQ A;  2C3Q A;  2H0I A;  1GRX A;  4L0W A;  3QDN A;  5DQS A;  3O3T A;  2JZR A;  3C7M A;  2DML A;  5ECL B;  19GS A;  1F9M A;  2FCH A;  4KA0 A;  2V41 A;  2GT6 A;  3VK9 A;  1Q98 A;  5INY A;  3F3Q A;  1FVK A;  3SBC A;  3F4R A;  2EIQ A;  4X43 A;  5F07 A;  4MPF A;  4HZ4 A;  3DIE A;  4ULX A;  2FA8 A;  3I6A A;  4KSO A;  2CVB A;  3A2V A;  3GV1 A;  4ZBD A;  4K2D A;  2QGV A;  3IXR A;  2H1B A;  3IA1 A;  2LKU A;  1MTC A;  1U87 A;  3F9U A;  2HFD A;  2E7P A;  1T00 A;  2H0H A;  1BX9 A;  2XBQ A;  5F05 A;  1V98 A;  3DKS A;  3I69 A;  1O8X A;  1TI3 A;  3Q19 A; 
#chains in the Genus database with same CATH topology
 2K8S A;  1F3B A;  1TKD B;  3QAW A;  4MH2 A;  4DEJ A;  3W6G A;  1HNB A;  4CDO A;  4N30 A;  1XBS A;  4IP6 A;  5CRW A;  3S9F A;  2NDO A;  2H30 A;  2EC4 A;  2OE0 A;  1W4V A;  2FWG A;  2H76 A;  1JZD A;  2H19 A;  1G0T A;  5DAL B;  3ZML A;  1H75 A;  5J41 A;  3L9U A;  1SKW B;  5D8I A;  1A2L A;  3GX0 A;  1XWC A;  2R6K A;  4IP1 A;  2JZT A;  2ZCT A;  4GTU A;  3IAM 2;  2JAC A;  2WGR A;  2NBS A;  2DKI A;  4YAV A;  1JLW A;  4WKW A;  5CNW A;  5AIS A;  2MBS A;  2K9F A;  3ZL5 A;  1EZK A;  2R0P A;  5IPG A;  1AC1 A;  3GMF A;  3FW2 A;  4NXI A;  3LXZ A;  1XW6 A;  4IJI A;  4XHM A;  1M9A A;  4CW9 A;  1ERV A;  2GZZ A;  2WRT A;  3TKS E;  5J9B A;  1M7T A;  3LWA A;  5LD0 A;  3QCP A;  2O7K A;  2M80 A;  2GVP A;  4QL9 A;  4F9Z A;  1VGL A;  1LU4 A;  4V2M A;  2I4A A;  3TKS A;  1EEJ A;  3IHG A;  1IYI A;  1GLP A;  2PBJ A;  4ZL8 A;  4LLR A;  17GS A;  6GSV A;  3KTB A;  2H75 A;  4LL1 B;  2IPA A;  2B7J A;  3VWV A;  4JRR A;  3D4T A;  4ILF A;  2PMT A;  2IMI A;  3MYD A;  2CAQ A;  4KGI A;  1TK8 B;  2EIO A;  20GS A;  5HFG A;  5EPF A;  4XS6 A;  1E2Y A;  1GUM A;  3CMI A;  4I2U A;  4A5P A;  4BVX A;  4MF6 A;  3VI5 A;  3VFI A;  5IOX A;  3HZ8 A;  3RHB A;  4D73 A;  1ZGN A;  2MZC A;  2FLS A;  1LBK A;  1T8E B;  1WOU A;  5EVO A;  3FZ5 A;  3PR8 A;  5H5S A;  3QPM A;  3H93 A;  4MZW A;  1M3I A;  5AIX A;  4HSC X;  1Z7P A;  1XW5 A;  3E3E A;  5CAX A;  4ZL9 A;  3GKM A;  3UIW A;  2QA1 A;  2QC7 A;  1GSQ A;  2V2G A;  3GH9 A;  4OCF A;  3C1S A;  1SK1 A;  3IV4 A;  3EMX A;  1TRU A;  1A24 A;  3UMA A;  2PVQ A;  4IHU A;  3FY7 A;  1T3B A;  4FQU A;  5HR1 A;  1NHO A;  2I9H A;  3EYT A;  3HCZ A;  2N5A A;  1T4Z A;  1EOH A;  2ES7 A;  3I9V 2;  1SKR B;  5GZZ B;  4MPG A;  1ABA A;  3DRN A;  1R5A A;  2LNS A;  1OC9 A;  2PVO C;  3G7Y A;  2G2Q A;  4BWQ A;  5A4V A;  3CSH A;  3FYG A;  3QAG A;  5KEJ A;  4PX1 A;  4L5L A;  1HYU A;  2OJL A;  4CHS A;  5B8A A;  1FG4 A;  1Z5Y E;  1TTZ A;  1TRW A;  2VL2 A;  4AJ8 A;  4IGJ A;  14GS A;  5AIV A;  5DQY A;  4V2L A;  3HJP A;  1ZYE A;  2PPT A;  2YZU A;  3TRX A;  2VCQ A;  1THO A;  3O76 A;  3KMO A;  3GKN A;  2LJA A;  2H0G A;  3US3 A;  4K9Z A;  4JZQ A;  3ZRD A;  1XG8 A;  2F9S A;  2IMF A;  4OO4 A;  2C3T A;  2H8L A;  4BIK A;  1OC3 A;  10GS A;  3HD5 A;  3ME8 A;  2VO4 A;  5B8B A;  1PRX A;  4K8M A;  2FUG 2;  3MWH A;  5J9C A;  3UEM A;  5DJM A;  2YV7 A;  4OD7 A;  1VF2 A;  5GST A;  3FMW A;  4KND A;  3RPP A;  1K0C A;  2PER A;  4G9H A;  3C1R A;  2D2Z A;  3GRX A;  3M1G A;  4MJE A;  4XS4 A;  4QL7 A;  3GN3 A;  2GQL A;  2OA7 A;  4OMV A;  2IME A;  1F3A A;  3WGE A;  1URM A;  3AY8 A;  4XRA A;  4KCE A;  4ZBB A;  1XOA A;  1GSF A;  1SU9 A;  1V58 A;  1OC8 A;  3KIJ A;  2HSY A;  4YKG A;  3IK9 A;  4GQC A;  5HR0 A;  2R5G A;  2RM5 A;  3F6D A;  2OKA A;  2HNL A;  3VPT A;  2K8V A;  3MDK A;  5FWG A;  3GL3 A;  2H1D A;  5D73 A;  5ECQ B;  4LMV A;  3TDG A;  3RPN A;  1PL1 A;  2MMZ A;  3EVI A;  5ECO B;  3EIN A;  1OYJ A;  4KW6 A;  4HDE A;  1WPI A;  5JWQ B;  1GUL A;  1S3A A;  3ERF A;  4GLT A;  5BRT A;  1PGT A;  3UVH A;  1EEM A;  5IMV A;  4BVY A;  4G0L A;  4LMW A;  2V32 A;  4I97 A;  4L0U A;  1AXD A;  3LG6 A;  3D22 A;  1A23 A;  5DCG A;  1U88 A;  2K18 A;  4GXZ A;  2FD3 A;  4F03 A;  3TGZ A;  3IBH A;  4G2E A;  2B5Y A;  3L0H A;  4N0Z A;  4BA7 A;  2FWH A;  2KUC A;  4BVX B;  1BJX A;  2H6Z A;  3A5I A;  1XW9 A;  4TOP A;  1GNW A;  2RM6 A;  3VWU A;  2B5X A;  3C71 A;  1S3D A;  3DEX A;  1N8J A;  2I1U A;  3FRC A;  2TRC P;  3HY2 A;  4EE0 A;  2L6C A;  2X4A A;  4Z2U A;  1IYH A;  5FHI A;  3KP9 A;  3L78 A;  5IO0 A;  4F0B A;  5IMA A;  2VUP A;  1XWG A;  2P5Q A;  2IL3 A;  4P3Y B;  5A4W A;  2X8G A;  4K7I A;  5AGY A;  2FY6 A;  1X9W B;  2L5L A;  1F37 A;  3OR5 A;  3GST A;  2RUE A;  1ML6 A;  4WBR D;  5A5K A;  2CVK A;  2OAC A;  4HEA 2;  2HRN A;  3H4K A;  3D5J A;  2B6M A;  2YWN A;  3QR6 A;  2VCX A;  5ECP B;  1OC9 B;  1T7P B;  1H4O A;  1X5D A;  4MDC A;  1DUG A;  4RI6 A;  2HSM A;  1VRS D;  1VF3 A;  3TOU A;  1M2B A;  1I9D A;  1NW2 A;  4MAB A;  4I5Q A;  1G7O A;  4FYC A;  5IMZ A;  4BPY A;  2GSS A;  3TRQ A;  1T4Y A;  3DML A;  3GIX A;  4JU5 A;  1SEN A;  4QQ7 A;  2FWF A;  1QQ2 A;  4EUY A;  2E0Q A;  3HVN A;  2IWT A;  3IE3 A;  4PTS A;  1YQ1 A;  4TR1 A;  1O85 A;  3VUR A;  5KN0 A;  2RLI A;  1USB A;  2XPD A;  4IQA A;  4KE3 A;  1PKZ A;  2X99 A;  2YCD A;  3PIN A;  1B4Q A;  1ZL9 A;  5G2Z A;  2HZF A;  1GL8 A;  4YQU A;  1RW1 A;  3L4N A;  3KGK A;  1ZCP A;  4KUN A;  4MLY A;  3RAZ A;  1F2E A;  4XRD A;  2QA2 A;  4ZB6 A;  3GNJ A;  3WGD A;  1QK8 A;  1N2A A;  4I6X A;  5J5N A;  1LJR A;  3HHV A;  5GAN D;  4XS4 B;  1WE0 A;  1ERU A;  2YWI A;  4YH2 A;  2HXK A;  1YEP A;  1GWC A;  1I5G A;  4GSN A;  3MNG A;  3CSJ A;  4OCE A;  1G6W A;  2R0G A;  1PN9 A;  1Y6E A;  2VCV A;  5JCU A;  1TI1 A;  1UC7 A;  1MDI A;  1A8Y A;  2DJ3 A;  3FEU A;  1KTE A;  2LS5 A;  1EGR A;  2FGX A;  1DBY A;  3QFA C;  5GAP D;  3NOF A;  1AQX A;  4EF0 A;  4ID0 A;  1GTU A;  3TRP A;  1QFN A;  4MZB A;  3VWX A;  4KDU A;  5DJL A;  2CQ9 A;  1A0F A;  3HXS A;  3K8N A;  1GNE A;  3ERG A;  2P5R A;  2VL3 A;  3IC8 A;  4BVY B;  5IIZ A;  5JCG A;  2E2G A;  5LCZ A;  1A2M A;  1A8L A;  1BAY A;  3O6T A;  1YZX A;  3A2X A;  2QKE A;  2ON5 A;  2P0G A;  4OO5 A;  2J9H A;  1YF1 A;  1GSE A;  2JSY A;  3ERW A;  4KDX A;  3UL3 A;  2OE1 A;  4NV5 A;  2G0F A;  1XZO A;  3WD6 A;  5HR2 A;  2GST A;  1GSS A;  4GF0 A;  5DAK A;  4K5R A;  4F2I A;  3GTU A;  4NPB A;  4MMM A;  1ERT A;  2C0F A;  1SD8 A;  3SWL A;  2VAF A;  3KH7 A;  3P7X A;  1QMV A;  3F6F A;  5ECM B;  1SJZ A;  2H6X A;  1HD2 A;  2DJ0 A;  2LJK A;  2I81 A;  1GTI A;  1ILO A;  2ZNM A;  3HKR A;  4TXV A;  4XS1 A;  2KLX A;  4XTS A;  4HJM A;  1HQO A;  3QAV A;  4LA1 A;  1PFO A;  1J0F A;  5B6N A;  5F8B A;  3ZIV A;  4F82 A;  3L9S A;  1K3L A;  2Z9S A;  4GQF A;  4MF5 A;  2L59 A;  3MIX A;  1ZZY A;  2VM1 A;  3R3E A;  3TUE A;  3ZLP A;  2PU9 C;  2YWM A;  2DLX A;  3FR3 A;  5D9V A;  3DVX A;  4NHZ A;  4G0K A;  3F8U A;  3G7J A;  2HSH A;  6GSU A;  1SL1 B;  1XIY A;  1R5P A;  2DIY A;  1X9S B;  1JFU A;  5CRE A;  1K0M A;  2LJR A;  1R26 A;  2FA4 A;  3LW9 A;  5CRG A;  3M9J A;  4K6X A;  5DCH A;  2NVL A;  4PQH A;  1JZR A;  5IMF A;  3CQF A;  3FHK A;  3D21 A;  3NZN A;  2CVD A;  1JHB A;  4MP4 A;  1NM3 A;  4J2F A;  1U3A A;  2H72 A;  1GP1 A;  4ML1 A;  1TK5 B;  3HA9 A;  4TR1 B;  3DGQ A;  3IDV A;  1ZYN A;  4FO5 A;  2A2S A;  3HYP A;  3GH6 A;  4ZIL A;  4PUR A;  3U5R E;  3LJR A;  4L8E A;  3ZZX A;  2I3Y A;  2YP6 A;  4GWR A;  4Z2T A;  1PX6 A;  13GS A;  2O87 A;  1XXU A;  1TW9 A;  1TRV A;  4FYB A;  1JZO A;  5CRH A;  3LQ7 A;  3Q18 A;  3CYN A;  1ZYP A;  3WT2 A;  4OWY A;  4WXT A;  2VOC A;  5IMD A;  1K0A A;  1WP0 A;  3TJK A;  3UBL A;  1X0R A;  4JE1 A;  1AIU A;  1Z3E A;  2WJU A;  3C73 A;  4DSS A;  3IK7 A;  4XIH A;  1WMJ A;  1VF4 A;  2BTO T;  4POB A;  2B5E A;  1ZMA A;  1V40 A;  3PH9 A;  1Z7R A;  3FZA A;  1B9X C;  3IRA A;  1OKD A;  4V1A p;  1CQH A;  3W8J A;  2DSA A;  12GS A;  1V57 A;  3A2W A;  4K2X A;  1RK4 A;  4Q5Q A;  2ON7 A;  1GSY A;  4OFN A;  1QUW A;  1UA5 A;  1K0B A;  3IC4 A;  4EIP A;  4IS0 A;  3F4T A;  4O5Q A;  4PUF C;  2GS3 A;  2GLR A;  3E9J B;  4ZL7 A;  2WUL A;  3UAP A;  2RUF A;  3D4M A;  2AJQ B;  4ISD A;  3CXG A;  2LRT A;  5KN2 A;  2YAN A;  3DWV A;  4EL1 A;  2GTU A;  18GS A;  3KMN A;  5HFK A;  4MA9 A;  2PN8 A;  2VD0 A;  2NPB A;  3TJG A;  4BL7 A;  4WR4 A;  4O7H A;  3TKS C;  1YF0 A;  2DJJ A;  2J23 A;  2XBI A;  2WS2 A;  1MDJ A;  5ELG A;  1SK0 A;  2UZ8 A;  3ISO A;  3QD9 A;  3FK8 A;  5ID2 A;  3GTU B;  3CBU A;  5AN1 A;  2LUS A;  3VI7 A;  2R3X A;  2WCI A;  4KH7 A;  3U6V A;  1M9B A;  2L5O A;  2C3N A;  3BOA A;  5DVB A;  5G5F A;  3HJO A;  2FHE A;  2DJ2 A;  2OBI A;  4HU9 A;  1BQ7 A;  4BWS A;  1U3I A;  5G1L A;  3HJM A;  3EC3 A;  4YAP A;  1B9Y C;  1X9M B;  1B48 A;  4MJA A;  3APQ A;  1OKT A;  2RII A;  1EV4 A;  1SYX A;  1R7H A;  3H1N A;  3WYW A;  2GSR A;  1JLV A;  4ZBA A;  1ON4 A;  4CY8 A;  2DC5 A;  2CZ2 A;  4JR4 A;  4Q5N A;  4EVM A;  4RQR A;  4IJ3 A;  2CX4 A;  3FR6 A;  3VLN A;  1AQW A;  2KOK A;  4N11 A;  1PN0 A;  3LYK A;  3ZTL A;  4X4J A;  2H1G A;  2GGT A;  2TRX A;  4HJ2 A;  2E2M A;  1THX A;  2MYG A;  3KTL A;  3KEB A;  4HS1 A;  1SK2 A;  3BD2 A;  5JWO B;  2JSZ A;  3P8W A;  5GSS A;  1SYR A;  5E59 A;  5CO3 A;  2IMD A;  4K0G A;  1OAZ A;  4KX4 A;  22GS A;  2HZE A;  1GUK A;  2HLS A;  1MDK A;  3JCM L;  4D73 B;  1PMT A;  4N10 A;  1FW1 A;  4E8H A;  2R2J A;  1XVW A;  1FB6 A;  3F4S A;  2DJ1 A;  3BCK A;  4ECC A;  2DJK A;  2CV4 A;  4YQM A;  2LTK A;  2OBK A;  2JAD A;  2R4V A;  1M99 A;  4HZ2 A;  3ZFB A;  3BCI A;  1TK0 B;  2JU5 A;  2BJX A;  1T1V A;  5CYY A;  1SD9 A;  2C1Y A;  2VL2 C;  2K6V A;  4ICY A;  1KEB A;  4O5U A;  3GYK A;  4ML6 A;  4HQS A;  3GKK A;  4N0V A;  2NTO A;  4ZXG A;  2H73 A;  3GHA A;  1Y25 A;  2PGT A;  4O92 A;  4PQ1 A;  4GCI A;  5E4W A;  6GSW A;  5ECI B;  1ZYQ B;  3TKQ A;  4EKZ A;  3UVT A;  3PGT A;  1MD4 A;  1O6J A;  2AUV A;  4WR5 A;  4OFT A;  4XCS A;  5DDL A;  1M0U A;  3QMX A;  3F63 A;  2HT9 A;  3HVV A;  8GSS A;  5L71 A;  2VLU A;  3M0F A;  2H6Y A;  1NSW A;  2B1L A;  2X49 A;  3ZFL A;  1QGV A;  2GDR A;  2C0E A;  2R37 A;  1O7U A;  3EPT A;  3C8E A;  1O8W A;  4TRX A;  3KD0 A;  5KOW A;  2L57 A;  4GSS A;  1Z9H A;  4WF5 A;  2DBC A;  3FR9 A;  5EL8 A;  5ECR B;  2L4C A;  1UN2 A;  3DXB A;  1V9W A;  1PX7 A;  5LNK e;  3D0Z A;  2IFQ A;  2GQM A;  4BL7 B;  1M2A A;  5D96 A;  3KM6 A;  4G19 A;  3V1W A;  2C0D A;  3P2A A;  1K3Y A;  3H8Q A;  3ZVJ A;  3APO A;  3QFB C;  4Z7X A;  2PUK C;  2REM A;  1FO5 A;  4HUA A;  4V1A g;  2YWO A;  2L4Q A;  5ID2 B;  4KDY A;  3DYR A;  1RQM A;  4YQV A;  3RHC A;  4K7N A;  4EO3 A;  2V1M A;  4ZB8 A;  1FVJ A;  3VPQ A;  3RDW A;  2IJY A;  1KBN A;  3I43 A;  2QSI A;  3G9B A;  3MSZ A;  5G31 A;  1SKS B;  1OE8 A;  2O89 A;  4MNN A;  1TU8 A;  1SJ6 A;  4PQI A;  3GUR A;  1FOH A;  3CTG A;  1YKA A;  3ZYW A;  4HI7 A;  2EIR A;  3PPU A;  4TW5 A;  5D9X A;  1Q4J A;  4TR0 A;  2IIY A;  1J9B A;  4WF4 A;  2F3M A;  2A4H A;  2HRK A;  3ZMK A;  3KH9 A;  5G5E A;  3GKX A;  4JR6 A;  1M3J A;  4K7O A;  1W89 A;  3N5O A;  4JBB A;  3KZQ A;  2VM2 A;  1PQN A;  3TKR A;  2YZH A;  5D9T A;  2MMO A;  2GZY A;  3F3R A;  1GUH A;  4TXO A;  2CX3 A;  5G1K A;  2YNX A;  1FHE A;  5J4U A;  3M9K A;  3EMP A;  3TCO A;  2WZ9 A;  1MEK A;  2HZE B;  2L6D A;  4EXJ A;  1XPV A;  3BJ5 A;  2H71 A;  3FZ9 A;  1EP7 A;  2OAD A;  4X0X A;  1YJ6 A;  4TR3 A;  1MD3 A;  3WT1 A;  3BBY A;  3TKP A;  3MAK A;  1V2A A;  2OE3 A;  3GFK A;  1K0O A;  1PD2 1;  7GSS A;  4I2T A;  3ZIJ A;  4K1F A;  4DVC A;  2GT5 A;  3G7I A;  3CRT A;  4TR4 A;  2FWE A;  2LQQ A;  1DE2 A;  4NV2 A;  2WFC A;  4Q5F A;  3UOM A;  4Z2R A;  4MK3 A;  3DVW A;  1K3O A;  11GS A;  4AJ6 A;  3KCM A;  5IM9 A;  4GST A;  1BG5 A;  2HRF A;  5KN3 A;  2AV4 A;  4PXO A;  4IW9 A;  1TRS A;  1JZW A;  4OFM A;  2VLT A;  2AHE A;  4MJB A;  5F06 A;  2GZP A;  1ST9 A;  5IQY A;  4RQX A;  5ELA A;  3H79 A;  1KNG A;  1FB0 A;  1XCC A;  3LFL A;  4ZIJ A;  2VIM A;  5JCW A;  1ZOF A;  4GRF A;  2C4J A;  2HRA A;  4AGS A;  3TJJ A;  3R2Q A;  1SL0 B;  4WET A;  5IMC A;  3DD3 A;  4EC0 A;  1A2J A;  4MF7 A;  3VWW A;  1SJI A;  2AB6 A;  2M46 A;  2X8H A;  1AQV A;  1GH2 A;  4F0C A;  2O8V B;  1YY7 A;  3UBK A;  5HR3 A;  3EUR A;  3TJF A;  4HOJ A;  1XWK A;  2VD1 A;  2GSQ A;  1EWX A;  1K0D A;  3CRU A;  1TXX A;  4PNG A;  2R0C A;  1M2D A;  4ECJ A;  2IMK A;  3ED3 A;  2N5F A;  2LV3 A;  2LRC A;  2XPE A;  5HQP A;  1XWA A;  2KP2 A;  1S3R A;  3IPZ A;  2IFQ B;  3HZ4 A;  4AJ7 A;  1R4W A;  3J7Y b;  3IHQ A;  2A2R A;  2PWJ A;  1HNC A;  1XWB A;  5ECH B;  1DE1 A;  2VL9 A;  5ECN B;  4FIW A;  1G7E A;  1X5E A;  5EY6 A;  3LXT A;  5A4U A;  1EP8 A;  4TN8 A;  3ZVJ D;  4NMU A;  3E0U A;  3M8N A;  2P31 A;  4KF9 A;  2HI7 A;  4IQ1 A;  1NHY A;  3J7Y k;  2VCT A;  3Q6O A;  3IAS 2;  4FH8 A;  2KHP A;  4J56 E;  3LEF A;  2A4V A;  2WDU A;  2MMA A;  3ZIT A;  2VCW A;  1VF1 A;  2YJH A;  1AAZ A;  1PKW A;  2VLV A;  2B3S A;  4O32 A;  4WEY A;  1B8X A;  1B4P A;  6GSY A;  3EWL A;  5ABR A;  4H86 A;  3F0I A;  4L5O A;  1O81 A;  2ZUP A;  6GST A;  3GA4 A;  4WBJ A;  3TOT A;  3TB2 A;  4MCU A;  4NAX A;  2YN1 A;  1G6Y A;  1EGO A;  4POK A;  4MJC A;  2HE3 A;  1WWJ A;  5ECS A;  3LYP A;  1QXH A;  2TIR A;  3IR4 A;  4IKH A;  1GLQ A;  4TXO B;  2IN3 A;  4X1U A;  2H1A A;  2CZ3 A;  4ACS A;  3CSI A;  1S3C A;  2FNO A;  5IPH A;  1GSU A;  4V2N A;  2F8F A;  5DAK B;  1GSD A;  1EOG A;  3KXO A;  2H70 A;  1F6M C;  4O5R A;  2MMN A;  2YPM A;  16GS A;  9GSS A;  5B7C A;  5CP1 A;  1J08 A;  3D6I A;  3UAR A;  1C72 A;  4EDY A;  2LQO A;  2XHF A;  3HVX A;  4G10 A;  2DKH A;  2BMX A;  5C00 A;  1A0R P;  5H5Q A;  4AF2 A;  2C80 A;  2LEG A;  2DIZ A;  5JWR B;  3A3T A;  4TVE A;  1YEX A;  3QOU A;  1AW9 A;  4TKY A;  4RI7 A;  2X8C A;  3HVS A;  3A5W A;  3L9V A;  4PGT A;  4CY6 A;  4HU7 A;  4IVF A;  3LGC A;  2M72 A;  1PSQ A;  5C04 A;  4E8E A;  4ECB A;  3IOS A;  1CQG A;  1TOF A;  2AYT A;  1YKC A;  1WIK A;  1Z6M A;  2H74 A;  1K0N A;  5IOW A;  5DAL A;  4ECI A;  4DSR A;  4HQZ A;  1OE7 A;  3GSS A;  3EU3 A;  2JZS A;  2DMM A;  1BED A;  4POM A;  3N9J A;  2HYX A;  3M3M A;  1OVN A;  5COH A;  3ME7 A;  3RBT A;  2YOI A;  4PNF A;  1E6B A;  1XFL A;  2XC2 A;  2C8U A;  1PL2 A;  4K5S A;  5BMU A;  4FYU A;  1EV9 A;  4IN0 A;  1DSB A;  1HNA A;  1ACV A;  1FOV A;  4J57 E;  5HFI A;  2F51 A;  1TJD A;  1X5C A;  2B7K A;  4POL A;  1ERW A;  1XVQ A;  1YDK A;  1XOB A;  3LSZ A;  5ENU A;  2CAI A;  2CA8 A;  3WGX A;  4KB3 A;  2O85 A;  4KCA A;  3HDC A;  2H66 A;  5J3R A;  2AAW A;  4I8B A;  2N5B A;  4G0I A;  1GTB A;  4IBP A;  2YV9 A;  2A2P A;  5CRD A;  4MH3 A;  1SL2 B;  3FKF A;  2MBT A;  2KP1 A;  2LRN A;  3TJB A;  2V6K A;  3KP8 A;  4NWY A;  4DSS B;  3EE2 A;  1O73 A;  2ALB A;  5H5R A;  3LOR A;  5KOX A;  1FAA A;  2B1K A;  1WRY A;  3APS A;  4K0N A;  2YJ7 A;  1GTA A;  5F0G A;  1PA3 A;  4EDZ A;  3CTF A;  3UJ1 A;  2F8A A;  5D9W A;  2H01 A;  1U6T A;  4RUV A;  6GSS A;  3EU4 A;  4DSQ A;  3ZRE A;  5B6M A;  1BYE A;  2V6O A;  4KAE A;  2C0G A;  3P90 A;  3NIV A;  4LL4 B;  3FZ4 A;  4ZB9 A;  5KN1 A;  2WB9 A;  4PUA A;  1UVZ A;  3GX8 A;  2LST A;  4IEL A;  3Q74 A;  2JL4 A;  2VCZ A;  5FT3 A;  1TU7 A;  3W8S A;  1TDI A;  6GSX A;  5ECK B;  2GQK A;  4MZC A;  5G30 A;  1AUC A;  2LNT A;  4KSM A;  1Z6N A;  1WJK A;  4Q5R A;  3GUS A;  4EIQ A;  2CT6 A;  4JED A;  2X64 A;  5IO2 A;  1TP9 A;  3KJY A;  4NHW A;  3GL5 A;  5D93 A;  5DBQ A;  2C3Q A;  2H0I A;  1GRX A;  4L0W A;  3QDN A;  5DQS A;  3O3T A;  2JZR A;  3C7M A;  2DML A;  5ECL B;  19GS A;  1F9M A;  2FCH A;  4KA0 A;  2V41 A;  2GT6 A;  3VK9 A;  1Q98 A;  5INY A;  3F3Q A;  1FVK A;  3SBC A;  3F4R A;  2EIQ A;  4YKF A;  4X43 A;  5F07 A;  4MPF A;  4HZ4 A;  4USS A;  3DIE A;  4ULX A;  2FA8 A;  3I6A A;  4KSO A;  2CVB A;  3A2V A;  3GV1 A;  4ZBD A;  4K2D A;  2QGV A;  3IXR A;  2H1B A;  3IA1 A;  2LKU A;  1MTC A;  1U87 A;  3F9U A;  2HFD A;  2E7P A;  1T00 A;  2H0H A;  1BX9 A;  2XBQ A;  5F05 A;  1V98 A;  3DKS A;  3I69 A;  1O8X A;  1TI3 A;  3Q19 A; 
#chains in the Genus database with same CATH homology
 2K8S A;  1F3B A;  1TKD B;  3QAW A;  4MH2 A;  4DEJ A;  3W6G A;  1HNB A;  4CDO A;  4N30 A;  1XBS A;  4IP6 A;  5CRW A;  3S9F A;  2NDO A;  2H30 A;  2EC4 A;  2OE0 A;  1W4V A;  2FWG A;  2H76 A;  1JZD A;  2H19 A;  1G0T A;  5DAL B;  3ZML A;  1H75 A;  5J41 A;  3L9U A;  1SKW B;  5D8I A;  1A2L A;  3GX0 A;  1XWC A;  2R6K A;  4IP1 A;  2JZT A;  2ZCT A;  4GTU A;  3IAM 2;  2JAC A;  2WGR A;  2NBS A;  2DKI A;  4YAV A;  1JLW A;  4WKW A;  5CNW A;  5AIS A;  2MBS A;  2K9F A;  3ZL5 A;  1EZK A;  2R0P A;  5IPG A;  1AC1 A;  3GMF A;  3FW2 A;  4NXI A;  3LXZ A;  1XW6 A;  4IJI A;  4XHM A;  1M9A A;  4CW9 A;  1ERV A;  2GZZ A;  2WRT A;  3TKS E;  5J9B A;  1M7T A;  3LWA A;  5LD0 A;  3QCP A;  2O7K A;  2M80 A;  2GVP A;  4QL9 A;  4F9Z A;  1VGL A;  1LU4 A;  4V2M A;  2I4A A;  3TKS A;  1EEJ A;  3IHG A;  1IYI A;  1GLP A;  2PBJ A;  4ZL8 A;  4LLR A;  17GS A;  6GSV A;  3KTB A;  2H75 A;  4LL1 B;  2IPA A;  2B7J A;  3VWV A;  4JRR A;  3D4T A;  4ILF A;  2PMT A;  2IMI A;  3MYD A;  2CAQ A;  4KGI A;  1TK8 B;  2EIO A;  20GS A;  5HFG A;  5EPF A;  4XS6 A;  1E2Y A;  1GUM A;  3CMI A;  4I2U A;  4A5P A;  4BVX A;  4MF6 A;  3VI5 A;  3VFI A;  5IOX A;  3HZ8 A;  3RHB A;  4D73 A;  1ZGN A;  2MZC A;  2FLS A;  1LBK A;  1T8E B;  1WOU A;  5EVO A;  3FZ5 A;  3PR8 A;  5H5S A;  3QPM A;  3H93 A;  4MZW A;  5AIX A;  1Z7P A;  1XW5 A;  3E3E A;  5CAX A;  4ZL9 A;  3GKM A;  3UIW A;  2QA1 A;  2QC7 A;  1GSQ A;  2V2G A;  3GH9 A;  4OCF A;  3C1S A;  1SK1 A;  3IV4 A;  3EMX A;  1TRU A;  1A24 A;  3UMA A;  2PVQ A;  4IHU A;  3FY7 A;  1T3B A;  4FQU A;  5HR1 A;  1NHO A;  2I9H A;  3EYT A;  3HCZ A;  2N5A A;  1T4Z A;  1EOH A;  2ES7 A;  3I9V 2;  1SKR B;  5GZZ B;  4MPG A;  1ABA A;  3DRN A;  1R5A A;  2LNS A;  1OC9 A;  2PVO C;  3G7Y A;  2G2Q A;  4BWQ A;  5A4V A;  3CSH A;  3FYG A;  3QAG A;  5KEJ A;  4PX1 A;  4L5L A;  1HYU A;  2OJL A;  4CHS A;  5B8A A;  1FG4 A;  1Z5Y E;  1TTZ A;  1TRW A;  2VL2 A;  4AJ8 A;  4IGJ A;  14GS A;  5AIV A;  5DQY A;  4V2L A;  3HJP A;  1ZYE A;  2PPT A;  2YZU A;  3TRX A;  2VCQ A;  1THO A;  3O76 A;  3KMO A;  3GKN A;  2LJA A;  2H0G A;  3US3 A;  4K9Z A;  4JZQ A;  3ZRD A;  2F9S A;  2IMF A;  4OO4 A;  2C3T A;  2H8L A;  1OC3 A;  10GS A;  3HD5 A;  3ME8 A;  2VO4 A;  5B8B A;  1PRX A;  4K8M A;  2FUG 2;  3MWH A;  5J9C A;  3UEM A;  5DJM A;  2YV7 A;  4OD7 A;  1VF2 A;  5GST A;  3FMW A;  4KND A;  3RPP A;  1K0C A;  2PER A;  4G9H A;  3C1R A;  2D2Z A;  3GRX A;  3M1G A;  4MJE A;  4XS4 A;  4QL7 A;  3GN3 A;  2GQL A;  2OA7 A;  4OMV A;  2IME A;  1F3A A;  3WGE A;  1URM A;  3AY8 A;  4XRA A;  4KCE A;  4ZBB A;  1XOA A;  1GSF A;  1SU9 A;  1V58 A;  1OC8 A;  3KIJ A;  2HSY A;  4YKG A;  3IK9 A;  4GQC A;  5HR0 A;  2R5G A;  2RM5 A;  3F6D A;  2OKA A;  2HNL A;  3VPT A;  2K8V A;  3MDK A;  5FWG A;  3GL3 A;  2H1D A;  5D73 A;  5ECQ B;  4LMV A;  3TDG A;  3RPN A;  1PL1 A;  2MMZ A;  3EVI A;  5ECO B;  3EIN A;  1OYJ A;  4KW6 A;  4HDE A;  1WPI A;  5JWQ B;  1GUL A;  1S3A A;  3ERF A;  4GLT A;  5BRT A;  1PGT A;  3UVH A;  1EEM A;  5IMV A;  4BVY A;  4G0L A;  4LMW A;  2V32 A;  4I97 A;  4L0U A;  1AXD A;  3LG6 A;  3D22 A;  1A23 A;  5DCG A;  1U88 A;  2K18 A;  4GXZ A;  2FD3 A;  4F03 A;  3TGZ A;  3IBH A;  4G2E A;  2B5Y A;  3L0H A;  4N0Z A;  4BA7 A;  2FWH A;  2KUC A;  4BVX B;  1BJX A;  2H6Z A;  3A5I A;  1XW9 A;  4TOP A;  1GNW A;  2RM6 A;  3VWU A;  2B5X A;  3C71 A;  1S3D A;  3DEX A;  1N8J A;  2I1U A;  3FRC A;  2TRC P;  3HY2 A;  4EE0 A;  2L6C A;  2X4A A;  4Z2U A;  1IYH A;  5FHI A;  3KP9 A;  3L78 A;  5IO0 A;  4F0B A;  5IMA A;  2VUP A;  1XWG A;  2P5Q A;  2IL3 A;  4P3Y B;  5A4W A;  2X8G A;  4K7I A;  5AGY A;  2FY6 A;  1X9W B;  2L5L A;  1F37 A;  3OR5 A;  3GST A;  2RUE A;  1ML6 A;  4WBR D;  5A5K A;  2CVK A;  2OAC A;  4HEA 2;  2HRN A;  3H4K A;  3D5J A;  2B6M A;  2YWN A;  3QR6 A;  2VCX A;  5ECP B;  1OC9 B;  1T7P B;  1H4O A;  1X5D A;  4MDC A;  1DUG A;  4RI6 A;  2HSM A;  1VRS D;  1VF3 A;  3TOU A;  1M2B A;  1I9D A;  1NW2 A;  4MAB A;  4I5Q A;  1G7O A;  4FYC A;  5IMZ A;  4BPY A;  2GSS A;  3TRQ A;  1T4Y A;  3DML A;  3GIX A;  4JU5 A;  1SEN A;  4QQ7 A;  2FWF A;  1QQ2 A;  4EUY A;  2E0Q A;  2IWT A;  3IE3 A;  4PTS A;  1YQ1 A;  4TR1 A;  1O85 A;  3VUR A;  5KN0 A;  2RLI A;  1USB A;  2XPD A;  4IQA A;  4KE3 A;  1PKZ A;  2X99 A;  2YCD A;  3PIN A;  1B4Q A;  1ZL9 A;  5G2Z A;  2HZF A;  1GL8 A;  4YQU A;  1RW1 A;  3L4N A;  3KGK A;  1ZCP A;  4KUN A;  4MLY A;  3RAZ A;  1F2E A;  4XRD A;  2QA2 A;  4ZB6 A;  3GNJ A;  3WGD A;  1QK8 A;  1N2A A;  4I6X A;  5J5N A;  1LJR A;  3HHV A;  5GAN D;  4XS4 B;  1WE0 A;  1ERU A;  2YWI A;  4YH2 A;  2HXK A;  1YEP A;  1GWC A;  1I5G A;  4GSN A;  3MNG A;  3CSJ A;  4OCE A;  1G6W A;  2R0G A;  1PN9 A;  1Y6E A;  2VCV A;  5JCU A;  1TI1 A;  1UC7 A;  1MDI A;  1A8Y A;  2DJ3 A;  3FEU A;  1KTE A;  2LS5 A;  1EGR A;  2FGX A;  1DBY A;  3QFA C;  5GAP D;  3NOF A;  1AQX A;  4EF0 A;  4ID0 A;  1GTU A;  3TRP A;  1QFN A;  4MZB A;  3VWX A;  4KDU A;  5DJL A;  2CQ9 A;  1A0F A;  3HXS A;  3K8N A;  1GNE A;  3ERG A;  2P5R A;  2VL3 A;  3IC8 A;  4BVY B;  5IIZ A;  5JCG A;  2E2G A;  5LCZ A;  1A2M A;  1A8L A;  1BAY A;  3O6T A;  1YZX A;  3A2X A;  2QKE A;  2ON5 A;  2P0G A;  4OO5 A;  2J9H A;  1YF1 A;  1GSE A;  2JSY A;  3ERW A;  4KDX A;  3UL3 A;  2OE1 A;  4NV5 A;  2G0F A;  1XZO A;  3WD6 A;  5HR2 A;  2GST A;  1GSS A;  4GF0 A;  5DAK A;  4K5R A;  4F2I A;  3GTU A;  4NPB A;  4MMM A;  1ERT A;  2C0F A;  1SD8 A;  3SWL A;  2VAF A;  3KH7 A;  3P7X A;  1QMV A;  3F6F A;  5ECM B;  1SJZ A;  2H6X A;  1HD2 A;  2DJ0 A;  2LJK A;  2I81 A;  1GTI A;  1ILO A;  2ZNM A;  3HKR A;  4TXV A;  4XS1 A;  2KLX A;  4XTS A;  4HJM A;  1HQO A;  3QAV A;  4LA1 A;  1J0F A;  5B6N A;  5F8B A;  3ZIV A;  4F82 A;  3L9S A;  1K3L A;  2Z9S A;  4GQF A;  4MF5 A;  2L59 A;  3MIX A;  1ZZY A;  2VM1 A;  3R3E A;  3TUE A;  3ZLP A;  2PU9 C;  2YWM A;  2DLX A;  3FR3 A;  5D9V A;  3DVX A;  4NHZ A;  4G0K A;  3F8U A;  3G7J A;  2HSH A;  6GSU A;  1SL1 B;  1XIY A;  1R5P A;  2DIY A;  1X9S B;  1JFU A;  5CRE A;  1K0M A;  2LJR A;  1R26 A;  2FA4 A;  3LW9 A;  5CRG A;  3M9J A;  4K6X A;  5DCH A;  2NVL A;  4PQH A;  1JZR A;  5IMF A;  3FHK A;  3D21 A;  3NZN A;  2CVD A;  1JHB A;  4MP4 A;  1NM3 A;  4J2F A;  1U3A A;  2H72 A;  1GP1 A;  4ML1 A;  1TK5 B;  3HA9 A;  4TR1 B;  3DGQ A;  3IDV A;  1ZYN A;  4FO5 A;  2A2S A;  3HYP A;  3GH6 A;  4ZIL A;  4PUR A;  3U5R E;  3LJR A;  4L8E A;  3ZZX A;  2I3Y A;  2YP6 A;  4GWR A;  4Z2T A;  1PX6 A;  13GS A;  2O87 A;  1XXU A;  1TW9 A;  1TRV A;  4FYB A;  1JZO A;  5CRH A;  3LQ7 A;  3Q18 A;  3CYN A;  1ZYP A;  3WT2 A;  4OWY A;  4WXT A;  2VOC A;  5IMD A;  1K0A A;  1WP0 A;  3TJK A;  3UBL A;  1X0R A;  4JE1 A;  1AIU A;  1Z3E A;  2WJU A;  3C73 A;  4DSS A;  3IK7 A;  4XIH A;  1WMJ A;  1VF4 A;  2BTO T;  4POB A;  2B5E A;  1ZMA A;  1V40 A;  3PH9 A;  1Z7R A;  3FZA A;  1B9X C;  3IRA A;  1OKD A;  4V1A p;  1CQH A;  3W8J A;  2DSA A;  12GS A;  1V57 A;  3A2W A;  4K2X A;  1RK4 A;  4Q5Q A;  2ON7 A;  1GSY A;  4OFN A;  1QUW A;  1UA5 A;  1K0B A;  3IC4 A;  4EIP A;  4IS0 A;  3F4T A;  4O5Q A;  4PUF C;  2GS3 A;  2GLR A;  3E9J B;  4ZL7 A;  2WUL A;  3UAP A;  2RUF A;  3D4M A;  2AJQ B;  4ISD A;  3CXG A;  2LRT A;  5KN2 A;  2YAN A;  3DWV A;  4EL1 A;  2GTU A;  18GS A;  3KMN A;  5HFK A;  4MA9 A;  2PN8 A;  2VD0 A;  2NPB A;  3TJG A;  4BL7 A;  4WR4 A;  4O7H A;  3TKS C;  1YF0 A;  2DJJ A;  2J23 A;  2XBI A;  2WS2 A;  1MDJ A;  5ELG A;  1SK0 A;  2UZ8 A;  3ISO A;  3QD9 A;  3FK8 A;  5ID2 A;  3GTU B;  3CBU A;  5AN1 A;  2LUS A;  3VI7 A;  2R3X A;  2WCI A;  4KH7 A;  3U6V A;  1M9B A;  2L5O A;  2C3N A;  3BOA A;  5DVB A;  5G5F A;  3HJO A;  2FHE A;  2DJ2 A;  2OBI A;  4HU9 A;  1BQ7 A;  4BWS A;  1U3I A;  5G1L A;  3HJM A;  3EC3 A;  4YAP A;  1B9Y C;  1X9M B;  1B48 A;  4MJA A;  3APQ A;  1OKT A;  2RII A;  1EV4 A;  1SYX A;  1R7H A;  3H1N A;  3WYW A;  2GSR A;  1JLV A;  4ZBA A;  1ON4 A;  4CY8 A;  2DC5 A;  2CZ2 A;  4JR4 A;  4Q5N A;  4EVM A;  4RQR A;  4IJ3 A;  2CX4 A;  3FR6 A;  3VLN A;  1AQW A;  2KOK A;  4N11 A;  1PN0 A;  3LYK A;  3ZTL A;  4X4J A;  2H1G A;  2GGT A;  2TRX A;  4HJ2 A;  2E2M A;  1THX A;  2MYG A;  3KTL A;  3KEB A;  4HS1 A;  1SK2 A;  3BD2 A;  5JWO B;  2JSZ A;  3P8W A;  5GSS A;  1SYR A;  5E59 A;  5CO3 A;  2IMD A;  4K0G A;  1OAZ A;  4KX4 A;  22GS A;  2HZE A;  1GUK A;  2HLS A;  1MDK A;  3JCM L;  4D73 B;  1PMT A;  4N10 A;  1FW1 A;  4E8H A;  2R2J A;  1XVW A;  1FB6 A;  3F4S A;  2DJ1 A;  3BCK A;  4ECC A;  2DJK A;  2CV4 A;  4YQM A;  2LTK A;  2OBK A;  2JAD A;  2R4V A;  1M99 A;  4HZ2 A;  3ZFB A;  3BCI A;  1TK0 B;  2JU5 A;  2BJX A;  1T1V A;  5CYY A;  1SD9 A;  2C1Y A;  2VL2 C;  2K6V A;  4ICY A;  1KEB A;  4O5U A;  3GYK A;  4ML6 A;  4HQS A;  3GKK A;  4N0V A;  2NTO A;  4ZXG A;  2H73 A;  3GHA A;  1Y25 A;  2PGT A;  4O92 A;  4PQ1 A;  4GCI A;  5E4W A;  6GSW A;  5ECI B;  1ZYQ B;  3TKQ A;  4EKZ A;  3UVT A;  3PGT A;  1MD4 A;  1O6J A;  2AUV A;  4WR5 A;  4OFT A;  4XCS A;  5DDL A;  1M0U A;  3QMX A;  3F63 A;  2HT9 A;  3HVV A;  8GSS A;  5L71 A;  2VLU A;  3M0F A;  2H6Y A;  1NSW A;  2B1L A;  2X49 A;  3ZFL A;  1QGV A;  2GDR A;  2C0E A;  2R37 A;  1O7U A;  3EPT A;  3C8E A;  1O8W A;  4TRX A;  3KD0 A;  5KOW A;  2L57 A;  4GSS A;  1Z9H A;  4WF5 A;  2DBC A;  3FR9 A;  5EL8 A;  5ECR B;  2L4C A;  1UN2 A;  3DXB A;  1V9W A;  1PX7 A;  5LNK e;  3D0Z A;  2IFQ A;  2GQM A;  4BL7 B;  1M2A A;  5D96 A;  3KM6 A;  4G19 A;  3V1W A;  2C0D A;  3P2A A;  1K3Y A;  3H8Q A;  3ZVJ A;  3APO A;  3QFB C;  4Z7X A;  2PUK C;  2REM A;  1FO5 A;  4HUA A;  4V1A g;  2YWO A;  2L4Q A;  5ID2 B;  4KDY A;  3DYR A;  1RQM A;  4YQV A;  3RHC A;  4K7N A;  4EO3 A;  2V1M A;  4ZB8 A;  1FVJ A;  3VPQ A;  3RDW A;  2IJY A;  1KBN A;  3I43 A;  2QSI A;  3G9B A;  3MSZ A;  5G31 A;  1SKS B;  1OE8 A;  2O89 A;  4MNN A;  1TU8 A;  1SJ6 A;  4PQI A;  3GUR A;  1FOH A;  3CTG A;  1YKA A;  3ZYW A;  4HI7 A;  2EIR A;  3PPU A;  4TW5 A;  5D9X A;  1Q4J A;  4TR0 A;  2IIY A;  1J9B A;  4WF4 A;  2F3M A;  2A4H A;  2HRK A;  3ZMK A;  3KH9 A;  5G5E A;  3GKX A;  4JR6 A;  4K7O A;  1W89 A;  3N5O A;  4JBB A;  3KZQ A;  2VM2 A;  1PQN A;  3TKR A;  2YZH A;  5D9T A;  2MMO A;  2GZY A;  3F3R A;  1GUH A;  4TXO A;  2CX3 A;  5G1K A;  2YNX A;  1FHE A;  5J4U A;  3M9K A;  3EMP A;  3TCO A;  2WZ9 A;  1MEK A;  2HZE B;  2L6D A;  4EXJ A;  1XPV A;  3BJ5 A;  2H71 A;  3FZ9 A;  1EP7 A;  2OAD A;  4X0X A;  1YJ6 A;  4TR3 A;  1MD3 A;  3WT1 A;  3BBY A;  3TKP A;  3MAK A;  1V2A A;  2OE3 A;  3GFK A;  1K0O A;  1PD2 1;  7GSS A;  4I2T A;  3ZIJ A;  4K1F A;  4DVC A;  2GT5 A;  3G7I A;  3CRT A;  4TR4 A;  2FWE A;  2LQQ A;  1DE2 A;  4NV2 A;  2WFC A;  4Q5F A;  3UOM A;  4Z2R A;  4MK3 A;  3DVW A;  1K3O A;  11GS A;  4AJ6 A;  3KCM A;  5IM9 A;  4GST A;  1BG5 A;  2HRF A;  5KN3 A;  2AV4 A;  4PXO A;  4IW9 A;  1TRS A;  1JZW A;  4OFM A;  2VLT A;  2AHE A;  4MJB A;  5F06 A;  2GZP A;  1ST9 A;  5IQY A;  4RQX A;  5ELA A;  3H79 A;  1KNG A;  1FB0 A;  1XCC A;  3LFL A;  4ZIJ A;  2VIM A;  5JCW A;  1ZOF A;  4GRF A;  2C4J A;  2HRA A;  4AGS A;  3TJJ A;  3R2Q A;  1SL0 B;  4WET A;  5IMC A;  3DD3 A;  4EC0 A;  1A2J A;  4MF7 A;  3VWW A;  1SJI A;  2AB6 A;  2M46 A;  2X8H A;  1AQV A;  1GH2 A;  4F0C A;  2O8V B;  1YY7 A;  3UBK A;  5HR3 A;  3EUR A;  3TJF A;  4HOJ A;  1XWK A;  2VD1 A;  2GSQ A;  1EWX A;  1K0D A;  3CRU A;  1TXX A;  4PNG A;  2R0C A;  1M2D A;  4ECJ A;  2IMK A;  3ED3 A;  2N5F A;  2LV3 A;  2LRC A;  2XPE A;  5HQP A;  1XWA A;  2KP2 A;  3IPZ A;  2IFQ B;  3HZ4 A;  4AJ7 A;  1R4W A;  3J7Y b;  3IHQ A;  2A2R A;  2PWJ A;  1HNC A;  1XWB A;  5ECH B;  1DE1 A;  2VL9 A;  5ECN B;  4FIW A;  1G7E A;  1X5E A;  5EY6 A;  3LXT A;  5A4U A;  1EP8 A;  4TN8 A;  3ZVJ D;  4NMU A;  3E0U A;  3M8N A;  2P31 A;  4KF9 A;  2HI7 A;  4IQ1 A;  1NHY A;  3J7Y k;  2VCT A;  3Q6O A;  3IAS 2;  4FH8 A;  2KHP A;  4J56 E;  3LEF A;  2A4V A;  2WDU A;  2MMA A;  3ZIT A;  2VCW A;  1VF1 A;  2YJH A;  1AAZ A;  1PKW A;  2VLV A;  2B3S A;  4O32 A;  4WEY A;  1B8X A;  1B4P A;  6GSY A;  3EWL A;  5ABR A;  4H86 A;  3F0I A;  4L5O A;  1O81 A;  2ZUP A;  6GST A;  3GA4 A;  4WBJ A;  3TOT A;  3TB2 A;  4MCU A;  4NAX A;  2YN1 A;  1G6Y A;  1EGO A;  4POK A;  4MJC A;  2HE3 A;  1WWJ A;  5ECS A;  3LYP A;  1QXH A;  2TIR A;  3IR4 A;  4IKH A;  1GLQ A;  4TXO B;  2IN3 A;  4X1U A;  2H1A A;  2CZ3 A;  4ACS A;  3CSI A;  1S3C A;  2FNO A;  5IPH A;  1GSU A;  4V2N A;  2F8F A;  5DAK B;  1GSD A;  1EOG A;  3KXO A;  2H70 A;  1F6M C;  4O5R A;  2MMN A;  2YPM A;  16GS A;  9GSS A;  5B7C A;  5CP1 A;  1J08 A;  3D6I A;  3UAR A;  1C72 A;  4EDY A;  2LQO A;  2XHF A;  3HVX A;  4G10 A;  2DKH A;  2BMX A;  5C00 A;  1A0R P;  5H5Q A;  4AF2 A;  2C80 A;  2LEG A;  2DIZ A;  5JWR B;  3A3T A;  4TVE A;  1YEX A;  3QOU A;  1AW9 A;  4TKY A;  4RI7 A;  2X8C A;  3HVS A;  3A5W A;  3L9V A;  4PGT A;  4CY6 A;  4HU7 A;  4IVF A;  3LGC A;  2M72 A;  1PSQ A;  5C04 A;  4E8E A;  4ECB A;  3IOS A;  1CQG A;  1TOF A;  2AYT A;  1YKC A;  1WIK A;  1Z6M A;  2H74 A;  1K0N A;  5IOW A;  5DAL A;  4ECI A;  4DSR A;  4HQZ A;  1OE7 A;  3GSS A;  3EU3 A;  2JZS A;  2DMM A;  1BED A;  4POM A;  3N9J A;  2HYX A;  3M3M A;  1OVN A;  5COH A;  3ME7 A;  3RBT A;  2YOI A;  4PNF A;  1E6B A;  1XFL A;  2XC2 A;  2C8U A;  1PL2 A;  4K5S A;  5BMU A;  4FYU A;  1EV9 A;  4IN0 A;  1DSB A;  1HNA A;  1ACV A;  1FOV A;  4J57 E;  5HFI A;  2F51 A;  1TJD A;  1X5C A;  2B7K A;  4POL A;  1ERW A;  1XVQ A;  1YDK A;  1XOB A;  3LSZ A;  5ENU A;  2CAI A;  2CA8 A;  3WGX A;  4KB3 A;  2O85 A;  4KCA A;  3HDC A;  2H66 A;  5J3R A;  2AAW A;  4I8B A;  2N5B A;  4G0I A;  1GTB A;  4IBP A;  2YV9 A;  2A2P A;  5CRD A;  4MH3 A;  1SL2 B;  3FKF A;  2MBT A;  2KP1 A;  2LRN A;  3TJB A;  2V6K A;  3KP8 A;  4NWY A;  4DSS B;  3EE2 A;  1O73 A;  2ALB A;  5H5R A;  3LOR A;  5KOX A;  1FAA A;  2B1K A;  1WRY A;  3APS A;  4K0N A;  2YJ7 A;  1GTA A;  5F0G A;  1PA3 A;  4EDZ A;  3CTF A;  3UJ1 A;  2F8A A;  5D9W A;  2H01 A;  1U6T A;  4RUV A;  6GSS A;  3EU4 A;  4DSQ A;  3ZRE A;  5B6M A;  1BYE A;  2V6O A;  4KAE A;  2C0G A;  3P90 A;  3NIV A;  4LL4 B;  3FZ4 A;  4ZB9 A;  5KN1 A;  2WB9 A;  4PUA A;  1UVZ A;  3GX8 A;  2LST A;  4IEL A;  3Q74 A;  2JL4 A;  2VCZ A;  5FT3 A;  1TU7 A;  3W8S A;  1TDI A;  6GSX A;  5ECK B;  2GQK A;  4MZC A;  5G30 A;  1AUC A;  2LNT A;  4KSM A;  1Z6N A;  1WJK A;  4Q5R A;  3GUS A;  4EIQ A;  2CT6 A;  4JED A;  2X64 A;  5IO2 A;  1TP9 A;  3KJY A;  4NHW A;  3GL5 A;  5D93 A;  5DBQ A;  2C3Q A;  2H0I A;  1GRX A;  4L0W A;  3QDN A;  5DQS A;  3O3T A;  2JZR A;  3C7M A;  2DML A;  5ECL B;  19GS A;  1F9M A;  2FCH A;  4KA0 A;  2V41 A;  2GT6 A;  3VK9 A;  1Q98 A;  5INY A;  3F3Q A;  1FVK A;  3SBC A;  3F4R A;  2EIQ A;  4YKF A;  4X43 A;  5F07 A;  4MPF A;  4HZ4 A;  4USS A;  3DIE A;  4ULX A;  2FA8 A;  3I6A A;  4KSO A;  2CVB A;  3A2V A;  3GV1 A;  4ZBD A;  4K2D A;  2QGV A;  3IXR A;  2H1B A;  3IA1 A;  2LKU A;  1MTC A;  1U87 A;  3F9U A;  2HFD A;  2E7P A;  1T00 A;  2H0H A;  1BX9 A;  2XBQ A;  5F05 A;  1V98 A;  3DKS A;  3I69 A;  1O8X A;  1TI3 A;  3Q19 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...