4I8BA

Crystal structure of thioredoxin from schistosoma japonicum
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
105
structure length
105
Chain Sequence
SNVLHIETDDDFDSFLKENKDKLIVVDFFATWCGPCKKIAPAFEALSADRSALYVKVDVDKLEETARKYDVSAMPTFIVIKNGEKVDTVVGASIENVEAAIRKHK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Thioredoxin
publication title Expression, characterization and crystal structure of thioredoxin from Schistosoma japonicum.
pubmed doi rcsb
source organism Schistosoma japonicum
total genus 32
structure length 105
sequence length 105
chains with identical sequence B
ec nomenclature ec 1.8.1.8: Protein-disulfide reductase.
pdb deposition date 2012-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4i8bA00
4XS4A 3AY8A 3GSTA 3ZMKA 1JZOA 5ECMB 2YJ7A 4AJ6A 1SJZA 2H0HA 4MH3A 2H1AA 3IDVA 5DCHA 3JCML 3PH9A 2R5GA 2DJKA 5FHIA 3H1NA 2NPBA 3C71A 1S3DA 4XS6A 3FR9A 2E7PA 2B3SA 1K3YA 2YZUA 2R6KA 4ACSA 3CMIA 4X1UA 3VI5A 5ID2A 5KEJA 1YJ6A 1ZOFA 3ERGA 5D96A 2MBSA 4K7NA 4F03A 1X0RA 3GYKA 4L5LA 1OC8A 4MPGA 5J41A 1EP8A 5ECLB 3N5OA 2X8CA 3GIXA 1PKZA 2WDUA 4JEDA 3TKSA 5ECOB 3GH6A 1EEJA 1U87A 1A23A 1KEBA 1ILOA 2CV4A 2DBCA 2VM2A 1A0RP 4GCIA 2H74A 4ULXA 2FWEA 1Y6EA 2RUEA 4KE3A 5IMDA 3KM6A 4MF5A 1MDIA 1M9BA 1TI1A 5LNKe 1EOGA 4IHUA 1XWKA 1LU4A 4GTUA 5DALB 4ISDA 3TCOA 4YAPA 5HR3A 2HNLA 3KGKA 1GTAA 2K18A 4HU7A 4OO4A 4YH2A 2HLSA 1XPVA 1SJ6A 4O7HA 1THXA 1SKRB 3IV4A 4NMUA 4JU5A 2GTUA 4D73B 3ZRDA 4MPFA 2CAIA 1X5DA 2JACA 2GZPA 1LBKA 3UJ1A 1ON4A 1A8LA 2A4VA 5INYA 1FG4A 1YZXA 2V6OA 3QFBC 4Q5RA 2L59A 4ZBBA 4I2UA 2LRTA 2QSIA 2XC2A 3VI7A 1AQVA 1Z6MA 3APSA 5ENUA 2GLRA 1YEPA 4KCAA 1AQWA 1PRXA 5KN1A 5DALA 4G9HA 1R5PA 3O3TA 2LSTA 3TGZA 3GTUA 3L9VA 1G7EA 1NHYA 2K6VA 10GSA 1TU7A 4I5QA 4MJBA 3P7XA 5D93A 2FGXA 1AXDA 2WJUA 3EMXA 5CRWA 1XVWA 5D9XA 4D73A 1H75A 2LJRA 3F4SA 1UN2A 4PURA 3HJMA 4IELA 3M0FA 1ST9A 1TW9A 2HZEA 1V2AA 3WD6A 12GSA 5IOXA 2L6DA 3GKXA 2H8LA 5G5FA 4EUYA 4I8BA 5A4UA 5J9CA 2H6XA 4CW9A 19GSA 2LJAA 1K3LA 3HXSA 2LQQA 1UC7A 1OC9B 1TRWA 3DYRA 1X9WB 2GQKA 3A3TA 2IN3A 1XW9A 3LJRA 4J56E 4N0VA 4DSQA 3FHKA 4MZCA 1FB6A 2L5OA 2CT6A 2HI7A 5GZZB 2WS2A 1QK8A 2DLXA 2YANA 3LG6A 4LL4B 4DVCA 3SBCA 1M0UA 4EO3A 2YWOA 5KN3A 3W8SA 1F2EA 2GZZA 4RI7A 1NM3A 4EDZA 4KNDA 1SENA 2O85A 1V98A 2DIYA 3FW2A 2KP1A 4Q5NA 4K0GA 5IMCA 3KCMA 1GUKA 1K0DA 3UAPA 4EDYA 4V2LA 2XBQA 3CBUA 2GVPA 2YWIA 5DCGA 5B6MA 3KJYA 2GT6A 2FY6A 3APOA 3WYWA 3ZTLA 1OC9A 2O7KA 3TJJA 2VAFA 2I4AA 3VWUA 2IMIA 5AIXA 5CRDA 4OFNA 3LXZA 2GSQA 3VWVA 2IFQB 1DE2A 2B5EA 3KMOA 1BJXA 1OAZA 1ZZYA 2AJQB 5IPGA 4KSMA 2DC5A 1YF0A 2JSZA 1XWCA 3M3MA 1Z7PA 1V40A 2XPEA 3VPQA 1EEMA 3LQ7A 3BCKA 3CTFA 2WZ9A 3KTLA 1XBSA 3G9BA 1MDJA 1E2YA 1JZWA 2H30A 3I69A 2LRNA 11GSA 5F0GA 5IMZA 1IYIA 1ML6A 4OCFA 3DXBA 1W4VA 2L4QA 2DJ3A 1LJRA 4MJAA 3C1RA 3EURA 2FWHA 1JLVA 1HQOA 1OC3A 5J5NA 2O8VB 3KTBA 1BEDA 1ZGNA 5CO3A 1THOA 4KDYA 1Z7RA 3D4MA 3DIEA 4AJ7A 4N30A 3FEUA 4YQUA 1DE1A 5GAND 3P8WA 1YF1A 3LGCA 2G0FA 2L5LA 1XZOA 3E9JB 3QMXA 3CYNA 1TRSA 3GL5A 2NDOA 1PL2A 4L0UA 4E8HA 5G1KA 1OE7A 3ZREA 3QOUA 3QAGA 2CX3A 1K0NA 1O85A 3VK9A 2F9SA 3KH9A 2FD3A 3LXTA 4DEJA 4JRRA 2HT9A 2K9FA 3EU3A 2VL2C 1M9AA 3QFAC 2KUCA 2H72A 2F8AA 3P2AA 3ZVJA 4TVEA 1VGLA 3TRQA 3O6TA 3KP9A 4F82A 1Q4JA 3EWLA 3ME8A 3C7MA 4HS1A 1MEKA 4L8EA 2VLUA 2OBIA 1J0FA 1I9DA 2PVQA 4BVYA 3KH7A 2L57A 1PA3A 2PN8A 1GH2A 4ZB8A 2IPAA 4EKZA 2YV7A 1RK4A 4MZWA 2KLXA 3F4RA 1QUWA 2ZUPA 4YQMA 2YJHA 1FO5A 1AQXA 3CXGA 2DMMA 1SYRA 1JFUA 4XRAA 4OD7A 5J9BA 2R2JA 3D4TA 1GNWA 4QL9A 20GSA 1TI3A 4OCEA 4HDEA 1WPIA 3I43A 3IR4A 1S3AA 2YZHA 2VLTA 3LYKA 4G2EA 4TW5A 4K8MA 2VM1A 3KEBA 5D8IA 3VLNA 1GP1A 1XOBA 5ID2B 2ZNMA 1EOHA 3ME7A 1DUGA 2WB9A 2REMA 1BQ7A 1DBYA 2H73A 3V1WA 1NW2A 1AUCA 4TOPA 5EVOA 1URMA 2FCHA 1B4PA 4MABA 3TKPA 3ZVJD 1YKAA 1OKTA 2FHEA 4QL7A 1TKDB 3UMAA 5ECSA 3EE2A 3LSZA 4J2FA 4KH7A 4JR6A 2IMFA 7GSSA 2B6MA 3Q6OA 1XW5A 2JU5A 4XRDA 1R4WA 2C0GA 4TXOB 4ZB6A 2CZ2A 4POMA 4MK3A 4K2DA 3WGXA 1SKWB 2G2QA 1CQGA 2HRNA 3F6DA 4EXJA 1ACVA 3NZNA 3QD9A 3M1GA 2YP6A 2M46A 1SYXA 4KDUA 3HZ8A 5ECPB 2CVKA 1G6WA 1A0FA 4TR1A 2XPDA 4ID0A 4OFMA 1XFLA 1T4ZA 3US3A 2H75A 3TJBA 1JHBA 2VCTA 4NV5A 1G7OA 1GL8A 6GSTA 4N0ZA 4TN8A 3L9UA 4X0XA 3HYPA 5JWRB 3LORA 5LCZA 2E0QA 3HA9A 17GSA 4XHMA 2F51A 5ECIB 5IQYA 4IJ3A 2H1DA 3GX0A 3H4KA 2MMZA 1HD2A 4TXOA 2X8HA 3FRCA 2IL3A 1SL1B 1VF4A 2KOKA 4FYBA 1ZMAA 4MJCA 3L78A 3F63A 3GL3A 3QDNA 2P5RA 2JZRA 5HR2A 4ZB9A 2IMEA 1XCCA 1VRSD 5F8BA 3F0IA 1T3BA 2C4JA 4MJEA 4BPYA 3GTUB 4GSTA 2A2RA 5DJLA 1PQNA 3UIWA 1WWJA 2FUG2 4MCUA 2WCIA 4KW6A 4L5OA 3G7YA 4FH8A 5C04A 3IAS2 1XWBA 3KD0A 1SKSB 1WIKA 1U88A 1XIYA 5IO2A 2XBIA 14GSA 1WMJA 4WR4A 1KBNA 2VUPA 2PBJA 1T1VA 4K9ZA 2HZEB 2ZCTA 1Z5YE 1VF2A 5ECRB 2F3MA 6GSSA 3WT1A 5EPFA 4BL7A 1OKDA 4LMVA 4NHWA 2GQLA 2MMOA 2XHFA 4KAEA 3IK9A 1DSBA 4V2MA 3L0HA 1TOFA 1ZL9A 2L6CA 2NTOA 4P3YB 1O8WA 3KIJA 1F3BA 2TIRA 2WGRA 2YV9A 2AUVA 3GHAA 4GSSA 1NSWA 3M9KA 2JL4A 2VCQA 2LKUA 3ZZXA 4GLTA 4DSRA 5B8BA 3D5JA 4J57E 4RUVA 1EV9A 3IBHA 3C1SA 4HQZA 2C1YA 2P31A 2VCWA 2B1KA 6GSWA 1Q98A 2FLSA 2KHPA 2V1MA 2C3NA 2VCZA 2V32A 4FIWA 3DMLA 1JLWA 3ERWA 4K7OA 2R3XA 3DD3A 1ERUA 3VURA 1FHEA 4NAXA 3UVTA 4GSNA 3RBTA 2C0FA 4ZL8A 3LYPA 3J7Yk 1W89A 1QMVA 4G19A 5CYYA 3IA1A 1RQMA 4OFTA 4O32A 3R2QA 5DBQA 4LLRA 1A2JA 4PQ1A 1T7PB 4WKWA 5H5QA 4EC0A 1V9WA 1XVQA 1SK0A 3GMFA 3F3RA 1SD9A 2C0EA 2HXKA 5H5RA 5LD0A 2HE3A 2MZCA 1B8XA 3LWAA 1A8YA 3ZYWA 3VWXA 3UBKA 2JZSA 1FVKA 2GDRA 1ERTA 2H70A 3D22A 2YWMA 1GLPA 4WR5A 2I3YA 2DJ0A 5GSTA 3WGEA 3SWLA 1OE8A 1A24A 3EC3A 2YPMA 2H71A 3GN3A 3HVXA 4IGJA 1AC1A 5CP1A 4TKYA 2GGTA 4TRXA 1AAZA 4MF6A 5IMVA 1F3AA 1G6YA 5D73A 3UBLA 6GSVA 3F4TA 16GSA 2VCVA 5KN2A 3C73A 4F0BA 1B9XC 3ZIVA 3H93A 4NXIA 4PNGA 3Q18A 2TRXA 1X5CA 1SK2A 5E59A 3HY2A 2DIZA 1SL2B 3MAKA 4IVFA 1QQ2A 4PGTA 5FT3A 1ERVA 1CQHA 1F9MA 4TR4A 3E0UA 2LQOA 1O8XA 2L4CA 5JWQB 3OR5A 4L0WA 3FZAA 3FZ5A 2H1GA 1FAAA 3EMPA 4PUAA 5EL8A 2CVBA 2OJLA 1TJDA 3Q19A 3VFIA 1QXHA 1WE0A 1YKCA 4PNFA 1USBA 4ECJA 4X43A 5CAXA 4N11A 6GSXA 2LJKA 1OVNA 4CHSA 1O73A 2YWNA 4O92A 2EIRA 2FWGA 2R4VA 3TOTA 3TUEA 5ABRA 1BG5A 3F3QA 3D0ZA 1R5AA 2GT5A 2OBKA 3QCPA 5ELAA 3VWWA 3EVIA 1T4YA 13GSA 4GRFA 1G0TA 2N5AA 2WFCA 1F6MC 3FKFA 3A2XA 1GSFA 2HZFA 5J4UA 3BOAA 3PINA 2IMKA 4HZ4A 1GTUA 3HJPA 2YOIA 3DWVA 4AF2A 1Z9HA 2IJYA 4IQAA 4OO5A 1M2BA 4NPBA 2J9HA 5D9WA 3DEXA 3IXRA 4ML1A 5DAKB 4BWSA 3ED3A 5F06A 1WRYA 2C3TA 5JCWA 2LRCA 4IS0A 4MH2A 1O81A 1B48A 3LEFA 1T8EB 1MD4A 1GSQA 3TJGA 4XCSA 3HJOA 2LEGA 2B1LA 1GSEA 1U6TA 4I6XA 3P90A 3IE3A 3KP8A 3O76A 2PGTA 3RAZA 2HYXA 2J23A 1MTCA 4TR3A 1BAYA 2O87A 2P0GA 2OKAA 2RM5A 3H79A 3NOFA 2H0IA 4ECCA 1S3CA 2Z9SA 2RIIA 4FYCA 5KN0A 4WETA 2OE0A 1R26A 3HKRA 1M99A 3EYTA 3L9SA 4PXOA 3FR3A 1K0MA 2FWFA 1WOUA 2CZ3A 5ELGA 3QAVA 5DAKA 1EZKA 4BWQA 2C0DA 4K0NA 3TB2A 1ERWA 3CTGA 4WBJA 2H76A 1HNAA 4HOJA 4XIHA 4XS1A 5IIZA 2QGVA 4GXZA 1UVZA 4RI6A 4KSOA 2LNSA 1JZRA 5EY6A 1ABAA 3CSHA 5IMAA 3APQA 1XWGA 4WXTA 4ZBAA 4RQRA 2H66A 2MMAA 4K1FA 3FZ9A 5F05A 5JCUA 1A2LA 4IKHA 1BYEA 1F37A 4OMVA 1K3OA 3ERFA 5AISA 3GV1A 1YY7A 4KCEA 3IRAA 5HQPA 2OACA 1PX7A 2PMTA 2BJXA 3S9FA 4TR1B 5J3RA 2WRTA 2FA4A 2BMXA 2MBTA 4KA0A 3RHBA 1UA5A 4IJIA 1FW1A 4KUNA 2M72A 2AYTA 2HSHA 3D21A 2D2ZA 5DQYA 3MDKA 1B9YC 5CRGA 1FOVA 2MYGA 1KNGA 4GQCA 2VL3A 2WULA 4V1Ap 3F9UA 3EINA 9GSSA 3FYGA 4WEYA 1GTBA 1M7TA 4EVMA 4EF0A 3IHQA 2GS3A 3NIVA 4V2NA 1U3IA 3W8JA 4ZILA 1JZDA 5A4WA 1IYHA 3GKNA 3KXOA 2HRFA 3C8EA 2AHEA 1TRUA 2VD1A 3RDWA 22GSA 3FK8A 4KB3A 1RW1A 4ZL7A 5DJMA 4IP1A 3RPNA 1WP0A 2N5BA 2B7JA 2FNOA 4G10A 3TKQA 3TKSC 5HR1A 3FR6A 5DQSA 5IM9A 3TKRA 1VF1A 2DSAA 3GRXA 3A2WA 4LA1A 5GAPD 1MD3A 5IO0A 3HCZA 5G2ZA 5DDLA 5HFIA 3PGTA 1PD21 5L71A 3N9JA 4ECBA 1QGVA 2GSRA 2DJ1A 2E2GA 1X9SB 18GSA 4MDCA 5IMFA 2C80A 1GULA 5HR0A 3ZIJA 1GUHA 4HZ2A 3UVHA 2K8SA 4JZQA 4EE0A 4RQXA 1HYUA 1GLQA 2M80A 5C00A 3GSSA 2A2SA 4HJMA 1TK5B 2I81A 4F0CA 3HVSA 3DVWA 5E4WA 4TR0A 2AAWA 3UL3A 2BTOT 4BA7A 1WJKA 2X64A 2DJ2A 1PSQA 3IC4A 2YNXA 1GSUA 3BD2A 4ML6A 4HUAA 2ALBA 3TRPA 3GUSA 3GA4A 3DGQA 3A5WA 2DMLA 3ISOA 1A2MA 4MP4A 2X8GA 4K7IA 2V41A 4JBBA 3CRTA 1SL0B 1PN9A 4MLYA 4JR4A 4QQ7A 4AGSA 2ON7A 2VIMA 5AGYA 4WF5A 1V58A 1EWXA 4XTSA 2C8UA 1GSYA 4F2IA 2QC7A 2QKEA 2VCXA 4KX4A 2YN1A 1X9MB 2I1UA 1K0OA 3WT2A 3IOSA 5JWOB 3I9V2 2B5YA 1I5GA 1R7HA 1YDKA 4LMWA 2PWJA 3HHVA 1HNBA 2H19A 3QPMA 4GF0A 3HDCA 5DVBA 3UOMA 3K8NA 2LS5A 3D6IA 2V6KA 3U5RE 1PKWA 4LL1B 4HU9A 3IK7A 4HEA2 1M2AA 2VO4A 6GSUA 3GNJA 2ES7A 3MSZA 4POKA 4KGIA 3M9JA 5A5KA 2MMNA 5B8AA 2AB6A 1PGTA 1YEXA 2OA7A 3DKSA 1E6BA 1H4OA 3TKSE 5ECKB 2N5FA 4YAVA 1K0AA 4Q5QA 3ZFLA 3GFKA 3A2VA 5FWGA 3ZITA 5H5SA 3KZQA 5CREA 1GNEA 1TDIA 1GWCA 1B4QA 3RHCA 5AN1A 3CRUA 1GTIA 2EIOA 3RPPA 4O5RA 1XOAA 2ON5A 3BCIA 4PQHA 1Z3EA 1GUMA 1XW6A 5D9VA 1O6JA 2E2MA 1TK8B 1TP9A 3TJFA 1YQ1A 4AJ8A 2TRCP 3KMNA 1N8JA 2I9HA 3FY7A 4JE1A 1TTZA 1ZYQB 1J9BA 3F6FA 2EC4A 4PUFC 1TK0B 5AIVA 5G31A 4N10A 3HVVA 5JCGA 2OE1A 2LUSA 3G7IA 4PX1A 1EV4A 2JSYA 1C72A 5IPHA 1GRXA 3GKKA 4MZBA 2LNTA 2CVDA 2R37A 2JZTA 3M8NA 2GSTA 1K0CA 4I2TA 4HJ2A 5B7CA 5G5EA 4ECIA 2CQ9A 3GURA 1QFNA 3IPZA 4PQIA 3ZMLA 2PVOC 3GX8A 5CNWA 1FVJA 1J08A 4POBA 5D9TA 4DSSB 2CAQA 1SJIA 2V2GA 1O7UA 2B7KA 2HFDA 1N2AA 4EL1A 1GSDA 2HSYA 3G7JA 1EP7A 1M2DA 2IFQA 4FYUA 3I6AA 3TRXA 1NHOA 2RLIA 2IMDA 5ECQB 3MWHA 1AW9A 2H1BA 1K0BA 2FA8A 1TXXA 4ZL9A 2LV3A 4Z7XA 5IOWA 4V1Ag 5ECNB 5COHA 1HNCA 2OE3A 4YQVA 1KTEA 2KP2A 3J7Yb 4CDOA 5CRHA 5B6NA 1PL1A 2GSSA 2DJJA 1PX6A 1MDKA 3E3EA 4GWRA 1FB0A 2NBSA 5ECHB 3H8QA 2GQMA 4OWYA 2H01A 4IP6A 5GSSA 1ZYEA 2EIQA 5HFKA 2F8FA 1XXUA 4IN0A 2X99A 1SD8A 1OYJA 3LFLA 3W6GA 4DSSA 3DVXA 4KDXA 4FO5A 1Y25A 2IWTA 2CA8A 3ZLPA 2VOCA 2YCDA 3UARA 2O89A 2VL9A 2PPTA 4GQFA 4K6XA 3WGDA 2VL2A 3U6VA 2RM6A 3HZ4A 2NVLA 4IQ1A 8GSSA 2H0GA 3DRNA 3CSJA 1T00A 4ZBDA 4WBRD 3QR6A 2RUFA 2JADA 1PMTA 3TJKA 2PU9C 4TXVA 5HFGA 4MF7A 1SU9A 2PUKC 5F07A 1AIUA 1ZCPA 3GKMA 3TDGA 3BJ5A 4NWYA 2PERA 4XS4B 1EGOA 2B5XA 2AV4A 2C3QA 3EU4A 4MA9A 1Z6NA 4IBPA 1X5EA 4WF4A 6GSYA 1VF3A 4MMMA 3TOUA 4BVXA 4HI7A 3PR8A 4I97A 1TU8A 3VPTA 3MNGA 3QAWA 2IIYA 3ZFBA 3BBYA 2VLVA 5A4VA 2LTKA 4IW9A 4E8EA 4F9ZA 1TRVA 3GH9A 4NHZA 3HD5A 1V57A 4NV2A 1EGRA 1SK1A 1GSSA 4Q5FA 3IAM2 2K8VA 3L4NA 5G30A 2VD0A 4HQSA 5G1LA 3F8UA 2H6ZA 1U3AA 3Q74A 4ILFA 4ZXGA 3FZ4A 3CSIA 4H86A 4POLA 3ZL5A 1BX9A 2P5QA 3UEMA 2H6YA 1XWAA 2GZYA 2CX4A 4ZIJA 2OADA
chains in the Genus database with same CATH superfamily
4XS4A 3AY8A 3GSTA 3ZMKA 1JZOA 5ECMB 2YJ7A 4AJ6A 1SJZA 2H0HA 4MH3A 2H1AA 3IDVA 5DCHA 3JCML 3PH9A 3FMWA 2R5GA 2DJKA 5FHIA 3H1NA 2NPBA 3C71A 1S3DA 4XS6A 4MNNA 3FR9A 2E7PA 2B3SA 1K3YA 2YZUA 2R6KA 4ACSA 3CMIA 4X1UA 3VI5A 5ID2A 5KEJA 1YJ6A 1ZOFA 3ERGA 5D96A 2MBSA 4K7NA 4F03A 1X0RA 3GYKA 4L5LA 1OC8A 4MPGA 5J41A 1EP8A 2A2PA 5ECLB 3N5OA 2X8CA 4O5QA 3GIXA 1PKZA 2X49A 2WDUA 4JEDA 3TKSA 5ECOB 3GH6A 1EEJA 1U87A 1A23A 1KEBA 1ILOA 2CV4A 2DBCA 2VM2A 1A0RP 3MYDA 4GCIA 2H74A 4ULXA 2FWEA 1Y6EA 2RUEA 4KE3A 5IMDA 3KM6A 4MF5A 1PFOA 1MDIA 1M9BA 1TI1A 5LNKe 1EOGA 4IHUA 1XWKA 1LU4A 4GTUA 5DALB 4ISDA 4CY8A 3TCOA 4YAPA 5HR3A 2HNLA 3KGKA 1GTAA 2K18A 4HU7A 4OO4A 3MIXA 4YH2A 2HLSA 1XPVA 1SJ6A 4O7HA 1THXA 1SKRB 3IV4A 4NMUA 4JU5A 2GTUA 4D73B 3ZRDA 4MPFA 2CAIA 1X5DA 2JACA 2GZPA 1LBKA 3IC8A 3UJ1A 1ON4A 1A8LA 2A4VA 5INYA 1FG4A 1YZXA 2V6OA 3QFBC 4Q5RA 2L59A 4ZBBA 4I2UA 2LRTA 2QSIA 2XC2A 3VI7A 1AQVA 1Z6MA 3APSA 5ENUA 2GLRA 1YEPA 4KCAA 1AQWA 1PRXA 5KN1A 5DALA 4G9HA 1R5PA 3O3TA 2LSTA 3TGZA 3GTUA 3L9VA 1G7EA 1NHYA 2K6VA 10GSA 1TU7A 4I5QA 4MJBA 3P7XA 5D93A 2FGXA 1AXDA 2WJUA 3EMXA 5CRWA 1XVWA 5D9XA 4D73A 1H75A 2LJRA 3F4SA 1UN2A 4PURA 3HJMA 4IELA 3M0FA 1ST9A 1TW9A 2HZEA 1V2AA 3WD6A 12GSA 5IOXA 2L6DA 3GKXA 2H8LA 5G5FA 4EUYA 4I8BA 5A4UA 5J9CA 2H6XA 4YKGA 4CW9A 19GSA 2LJAA 1K3LA 3HXSA 2LQQA 1UC7A 2DKIA 1OC9B 1TRWA 3DYRA 1X9WB 2GQKA 3A3TA 2IN3A 1XW9A 3LJRA 4J56E 4N0VA 4DSQA 3FHKA 4MZCA 1FB6A 2L5OA 2CT6A 2HI7A 5GZZB 2WS2A 1QK8A 2DLXA 2QA1A 4ICYA 2YANA 3LG6A 4LL4B 4DVCA 2DKHA 3SBCA 1M0UA 4EO3A 2YWOA 5KN3A 3W8SA 1F2EA 2GZZA 4RI7A 1NM3A 4EDZA 4KNDA 1SENA 2O85A 1V98A 2DIYA 3FW2A 2KP1A 4Q5NA 4K0GA 5IMCA 3KCMA 1GUKA 1K0DA 3UAPA 4EDYA 4V2LA 2XBQA 3CBUA 2GVPA 2YWIA 5DCGA 5B6MA 3KJYA 2GT6A 2FY6A 3APOA 3WYWA 3ZTLA 1OC9A 2O7KA 3R3EA 3TJJA 2VAFA 2I4AA 4EIQA 3VWUA 2IMIA 5AIXA 5CRDA 4OFNA 3LXZA 2GSQA 3VWVA 2IFQB 1DE2A 2B5EA 3KMOA 1BJXA 1OAZA 1ZZYA 2AJQB 5IPGA 4KSMA 2DC5A 1YF0A 2JSZA 1XWCA 3M3MA 1Z7PA 1V40A 2XPEA 3VPQA 1EEMA 3LQ7A 3BCKA 3CTFA 2WZ9A 3KTLA 1XBSA 3G9BA 1MDJA 1E2YA 1JZWA 2H30A 3I69A 2LRNA 11GSA 5F0GA 5IMZA 1IYIA 1ML6A 4OCFA 3DXBA 1W4VA 2L4QA 2DJ3A 1LJRA 4MJAA 3C1RA 3EURA 2FWHA 1JLVA 1HQOA 1OC3A 5J5NA 2O8VB 3KTBA 1BEDA 1ZGNA 5CO3A 1THOA 4KDYA 1Z7RA 3D4MA 3DIEA 4AJ7A 4N30A 3FEUA 4YQUA 1DE1A 5GAND 3P8WA 1YF1A 3LGCA 2G0FA 2L5LA 1XZOA 3E9JB 3QMXA 3CYNA 1TRSA 3GL5A 2NDOA 1PL2A 4L0UA 4E8HA 5G1KA 1OE7A 3ZREA 3IHGA 3QOUA 3QAGA 2CX3A 1K0NA 1O85A 3VK9A 2F9SA 3KH9A 2FD3A 3LXTA 4DEJA 4JRRA 2HT9A 2K9FA 3EU3A 2VL2C 1M9AA 3QFAC 2KUCA 2H72A 2F8AA 3P2AA 3ZVJA 4TVEA 1VGLA 3TRQA 3O6TA 3KP9A 4F82A 1Q4JA 3EWLA 3ME8A 3C7MA 4HS1A 1MEKA 4L8EA 2VLUA 2OBIA 1J0FA 1I9DA 4BIKA 2PVQA 4BVYA 3KH7A 2L57A 1PA3A 2PN8A 1GH2A 4ZB8A 2IPAA 4EKZA 2YV7A 1RK4A 4MZWA 2KLXA 3F4RA 1QUWA 2ZUPA 4YQMA 2YJHA 1FO5A 1AQXA 3CXGA 2DMMA 1SYRA 1JFUA 4XRAA 4OD7A 5J9BA 2R2JA 3D4TA 1GNWA 4QL9A 20GSA 1TI3A 4OCEA 4HDEA 1WPIA 3I43A 3IR4A 1S3AA 2YZHA 2VLTA 3LYKA 4G2EA 4TW5A 4K8MA 2VM1A 3KEBA 5D8IA 3VLNA 1GP1A 1XOBA 5ID2B 2ZNMA 1EOHA 3ME7A 1DUGA 2WB9A 2REMA 1BQ7A 1DBYA 2H73A 4HSCX 3V1WA 1NW2A 1AUCA 4TOPA 5EVOA 1URMA 2FCHA 1B4PA 4MABA 3TKPA 3ZVJD 1YKAA 1OKTA 2FHEA 4QL7A 1TKDB 3UMAA 2R0GA 5ECSA 3EE2A 3LSZA 4J2FA 4KH7A 4JR6A 2IMFA 3HVNA 7GSSA 2B6MA 3Q6OA 1XW5A 2JU5A 4XRDA 1R4WA 2C0GA 4TXOB 4ZB6A 2CZ2A 4POMA 4MK3A 4K2DA 3WGXA 1SKWB 2G2QA 1CQGA 2HRNA 3F6DA 4EXJA 1ACVA 3NZNA 3QD9A 3M1GA 2YP6A 5KOWA 2M46A 1SYXA 4KDUA 3HZ8A 5ECPB 2CVKA 1G6WA 1A0FA 4TR1A 2XPDA 4ID0A 4OFMA 1XFLA 1T4ZA 3US3A 2H75A 3TJBA 1JHBA 2VCTA 4NV5A 1G7OA 1GL8A 6GSTA 4N0ZA 4TN8A 3L9UA 4X0XA 3HYPA 5JWRB 3LORA 5LCZA 2E0QA 3HA9A 17GSA 4XHMA 2F51A 5ECIB 5IQYA 4IJ3A 2H1DA 3GX0A 3H4KA 2MMZA 1HD2A 4TXOA 2X8HA 3FRCA 2IL3A 1SL1B 1VF4A 2KOKA 4FYBA 1ZMAA 4MJCA 3L78A 3F63A 3GL3A 3QDNA 2P5RA 2JZRA 5HR2A 4ZB9A 2IMEA 1XCCA 1VRSD 5F8BA 3F0IA 1T3BA 2C4JA 4MJEA 4BPYA 3GTUB 1ZYPA 2A2RA 4GSTA 2UZ8A 5DJLA 1PQNA 3UIWA 1WWJA 2FUG2 4MCUA 2WCIA 4KW6A 4L5OA 3G7YA 4FH8A 5C04A 3IAS2 1XWBA 3KD0A 1SKSB 1WIKA 1U88A 1XIYA 5BMUA 5IO2A 2XBIA 14GSA 4CY6A 1WMJA 4WR4A 1KBNA 2VUPA 2PBJA 1T1VA 4K9ZA 2HZEB 2ZCTA 1Z5YE 1VF2A 5ECRB 2F3MA 6GSSA 3WT1A 5EPFA 4BL7A 1OKDA 4LMVA 4NHWA 2GQLA 2MMOA 2XHFA 4KAEA 3IK9A 1DSBA 4V2MA 3L0HA 1TOFA 1ZL9A 2L6CA 2NTOA 4P3YB 1O8WA 3KIJA 1F3BA 2TIRA 2WGRA 2YV9A 2AUVA 3GHAA 4GSSA 1NSWA 3M9KA 2JL4A 2VCQA 2LKUA 3ZZXA 4GLTA 4DSRA 5B8BA 3D5JA 4J57E 4RUVA 1EV9A 3IBHA 3C1SA 4HQZA 2C1YA 2P31A 2VCWA 2B1KA 6GSWA 1Q98A 2FLSA 2KHPA 2V1MA 2C3NA 2VCZA 2V32A 4FIWA 4K5SA 3DMLA 1JLWA 3ERWA 4K7OA 2R3XA 3DD3A 1ERUA 3VURA 4O5UA 1FHEA 4NAXA 3UVTA 4GSNA 3RBTA 2C0FA 4ZL8A 3LYPA 3J7Yk 1W89A 1QMVA 4G19A 5CYYA 3IA1A 1RQMA 4OFTA 4O32A 3R2QA 5DBQA 4LLRA 1A2JA 4PQ1A 1T7PB 4WKWA 5H5QA 4EC0A 1V9WA 1XVQA 1SK0A 3GMFA 3F3RA 1SD9A 2C0EA 2HXKA 5H5RA 5LD0A 2HE3A 2MZCA 1B8XA 4USSA 3LWAA 1A8YA 3ZYWA 3VWXA 3UBKA 2JZSA 1FVKA 2GDRA 1ERTA 2H70A 3D22A 2YWMA 1GLPA 4WR5A 2I3YA 2DJ0A 5GSTA 3WGEA 3SWLA 1OE8A 1A24A 3EC3A 2YPMA 2H71A 3GN3A 3HVXA 4IGJA 1AC1A 5CP1A 4TKYA 2GGTA 4TRXA 1AAZA 4MF6A 5IMVA 1F3AA 1G6YA 5D73A 1M3JA 3UBLA 6GSVA 3F4TA 16GSA 2VCVA 5KN2A 3C73A 4F0BA 1B9XC 3ZIVA 3H93A 4NXIA 4PNGA 3Q18A 2TRXA 1X5CA 1SK2A 5E59A 3HY2A 2DIZA 1SL2B 3MAKA 4IVFA 1QQ2A 4PGTA 5FT3A 1ERVA 1CQHA 1F9MA 4KF9A 4TR4A 3E0UA 2LQOA 1O8XA 2L4CA 5JWQB 3OR5A 4L0WA 3FZAA 3FZ5A 2H1GA 1FAAA 3EMPA 4PUAA 5EL8A 2CVBA 2OJLA 1TJDA 5BRTA 3Q19A 3VFIA 1QXHA 1WE0A 1YKCA 4PNFA 1USBA 4ECJA 4X43A 5CAXA 4N11A 6GSXA 2LJKA 1OVNA 4CHSA 1O73A 2YWNA 4O92A 2EIRA 2FWGA 2R4VA 3TOTA 3TUEA 5ABRA 1BG5A 3F3QA 4BVYB 3D0ZA 1R5AA 2GT5A 2OBKA 3QCPA 5ELAA 3VWWA 3EVIA 1T4YA 2HRAA 13GSA 4GRFA 1G0TA 2N5AA 2WFCA 1F6MC 3FKFA 3A2XA 1GSFA 2HZFA 5J4UA 3BOAA 3PINA 2IMKA 4HZ4A 1GTUA 3HJPA 4Z2UA 2YOIA 3DWVA 4AF2A 1Z9HA 2IJYA 4IQAA 4OO5A 1M2BA 4NPBA 2J9HA 5D9WA 3DEXA 3IXRA 4ML1A 5DAKB 4BWSA 3ED3A 5F06A 1WRYA 2C3TA 5JCWA 2LRCA 4IS0A 4MH2A 1O81A 4A5PA 1B48A 3LEFA 1T8EB 1MD4A 1XG8A 1GSQA 3TJGA 4XCSA 3HJOA 2LEGA 2B1LA 1GSEA 1U6TA 4I6XA 3P90A 3IE3A 3KP8A 3O76A 2PGTA 3RAZA 2HYXA 2HRKA 5KOXA 2J23A 1MTCA 4TR3A 1BAYA 2O87A 2P0GA 2OKAA 2RM5A 3H79A 3NOFA 2H0IA 4ECCA 1S3CA 2Z9SA 2RIIA 4FYCA 4PTSA 5KN0A 4WETA 2OE0A 1R26A 3HKRA 1M99A 3EYTA 3L9SA 4PXOA 3FR3A 1K0MA 2FWFA 1WOUA 2CZ3A 5ELGA 3QAVA 5DAKA 1EZKA 4BWQA 2C0DA 4K0NA 3TB2A 1ERWA 3CTGA 4WBJA 2H76A 1HNAA 4HOJA 4XIHA 4XS1A 5IIZA 2QGVA 4GXZA 4X4JA 1UVZA 4RI6A 4KSOA 2LNSA 1JZRA 5EY6A 1ABAA 3CSHA 5IMAA 3APQA 1XWGA 4WXTA 4ZBAA 4RQRA 2H66A 2MMAA 4K1FA 3FZ9A 5F05A 5JCUA 1A2LA 4IKHA 1BYEA 1F37A 4OMVA 2X4AA 1K3OA 3ERFA 1ZYNA 5AISA 3GV1A 1YY7A 4KCEA 3IRAA 5HQPA 2OACA 1PX7A 2PMTA 2BJXA 3S9FA 4TR1B 5J3RA 2WRTA 2FA4A 2BMXA 2MBTA 4KA0A 3RHBA 1UA5A 4IJIA 1FW1A 4KUNA 2M72A 4G0KA 2AYTA 2HSHA 3D21A 2D2ZA 3MDKA 5DQYA 1B9YC 5CRGA 1FOVA 2MYGA 1KNGA 4GQCA 2VL3A 2WULA 4V1Ap 3F9UA 3EINA 9GSSA 3FYGA 4WEYA 1GTBA 1M7TA 4EVMA 4EF0A 3IHQA 2GS3A 3NIVA 4V2NA 1U3IA 3W8JA 4ZILA 1JZDA 5A4WA 1IYHA 3GKNA 3KXOA 2HRFA 3C8EA 2AHEA 1TRUA 2VD1A 3RDWA 22GSA 3FK8A 4KB3A 1RW1A 4ZL7A 5DJMA 4IP1A 3RPNA 1WP0A 2N5BA 2B7JA 2FNOA 4G10A 3TKQA 3TKSC 5HR1A 3FR6A 5DQSA 5IM9A 3TKRA 1VF1A 2DSAA 3GRXA 3A2WA 4LA1A 5GAPD 1MD3A 5IO0A 3HCZA 5G2ZA 5DDLA 5HFIA 3PGTA 1PD21 5L71A 3N9JA 4ECBA 1QGVA 2GSRA 2DJ1A 4BL7B 2E2GA 1S3RA 1X9SB 18GSA 4MDCA 5IMFA 2C80A 1GULA 5HR0A 3LW9A 3ZIJA 1GUHA 4HZ2A 3UVHA 2K8SA 4JZQA 4EE0A 4RQXA 1HYUA 1GLQA 2M80A 5C00A 3GSSA 2A2SA 4HJMA 1TK5B 2I81A 4F0CA 3HVSA 3DVWA 5E4WA 4TR0A 2AAWA 3UL3A 2BTOT 4BA7A 1WJKA 2X64A 2DJ2A 1PSQA 3IC4A 2YNXA 1GSUA 2HSMA 3BD2A 4ML6A 4HUAA 2ALBA 3TRPA 3GUSA 3GA4A 3DGQA 3A5WA 2DMLA 3ISOA 1A2MA 4MP4A 2X8GA 4K7IA 2V41A 4JBBA 3CRTA 1SL0B 1PN9A 4MLYA 4JR4A 4QQ7A 4AGSA 2ON7A 2VIMA 5AGYA 4WF5A 4EIPA 1V58A 1EWXA 4XTSA 2C8UA 1GSYA 4F2IA 2QC7A 2QKEA 2VCXA 4KX4A 2YN1A 1X9MB 2I1UA 1K0OA 3WT2A 3IOSA 5JWOB 3I9V2 2B5YA 1I5GA 1R7HA 1YDKA 4LMWA 2PWJA 3HHVA 1HNBA 2H19A 3QPMA 4Z2RA 4GF0A 3HDCA 5DVBA 3UOMA 3K8NA 3EPTA 2LS5A 3CQFA 3D6IA 2V6KA 3U5RE 1PKWA 4LL1B 4HU9A 3IK7A 4HEA2 1M2AA 2VO4A 6GSUA 3GNJA 2ES7A 3MSZA 4POKA 4KGIA 3M9JA 5A5KA 2MMNA 5B8AA 4FQUA 2AB6A 1PGTA 1YEXA 2OA7A 3DKSA 1E6BA 1H4OA 3TKSE 5ECKB 2N5FA 4YAVA 1K0AA 4Q5QA 3ZFLA 3GFKA 3A2VA 5FWGA 3ZITA 5H5SA 3KZQA 5CREA 1GNEA 1TDIA 1GWCA 1B4QA 3RHCA 5AN1A 2R0CA 3CRUA 1GTIA 2EIOA 3RPPA 4O5RA 1XOAA 4YKFA 2ON5A 3BCIA 4PQHA 1Z3EA 1GUMA 1XW6A 5D9VA 1O6JA 2E2MA 1TK8B 1TP9A 3TJFA 1YQ1A 4AJ8A 2TRCP 3KMNA 1N8JA 2I9HA 3FY7A 4JE1A 1TTZA 1ZYQB 1J9BA 4K5RA 3F6FA 2EC4A 4PUFC 1TK0B 5AIVA 5G31A 4N10A 3HVVA 5JCGA 2OE1A 2LUSA 3G7IA 4PX1A 1EV4A 2JSYA 1C72A 5IPHA 1GRXA 3GKKA 4MZBA 2LNTA 2CVDA 2R37A 2JZTA 3M8NA 2GSTA 2QA2A 1K0CA 4I2TA 4HJ2A 5B7CA 5G5EA 4ECIA 2CQ9A 3GURA 1QFNA 4K2XA 3IPZA 4PQIA 3ZMLA 4G0LA 2PVOC 3GX8A 5CNWA 1FVJA 1J08A 4POBA 5D9TA 4DSSB 2CAQA 1SJIA 2A4HA 2V2GA 1O7UA 2B7KA 2HFDA 1N2AA 1PN0A 4EL1A 1GSDA 2HSYA 3G7JA 1EP7A 1M2DA 2IFQA 4FYUA 3I6AA 3TRXA 1NHOA 2RLIA 2IMDA 3A5IA 5ECQB 3MWHA 1AW9A 2H1BA 1K0BA 2FA8A 1TXXA 4ZL9A 2LV3A 4Z7XA 5IOWA 4V1Ag 5ECNB 5COHA 1HNCA 2OE3A 4YQVA 1KTEA 2KP2A 3J7Yb 4CDOA 5CRHA 5B6NA 1PL1A 2GSSA 3PPUA 2DJJA 1PX6A 1MDKA 3E3EA 4GWRA 1FB0A 2NBSA 5ECHB 3H8QA 2GQMA 4OWYA 4BVXB 2H01A 4IP6A 5GSSA 1ZYEA 2EIQA 5HFKA 2F8FA 1XXUA 4IN0A 2X99A 1SD8A 1OYJA 3LFLA 3W6GA 4DSSA 3DVXA 4KDXA 4FO5A 1Y25A 2IWTA 2CA8A 3ZLPA 2VOCA 2YCDA 3UARA 2O89A 2VL9A 2PPTA 4GQFA 4K6XA 4Z2TA 3WGDA 2VL2A 3U6VA 2RM6A 1M3IA 3HZ4A 2NVLA 4IQ1A 8GSSA 2H0GA 3DRNA 1FOHA 3CSJA 1T00A 4ZBDA 4WBRD 3QR6A 2RUFA 2JADA 1PMTA 3TJKA 2PU9C 4TXVA 5HFGA 4MF7A 1SU9A 2PUKC 5F07A 1AIUA 1ZCPA 3GKMA 3TDGA 3BJ5A 4NWYA 2PERA 4XS4B 1EGOA 2B5XA 2AV4A 2C3QA 3EU4A 4MA9A 1Z6NA 4IBPA 1X5EA 4WF4A 6GSYA 1VF3A 4MMMA 3TOUA 4BVXA 4HI7A 3PR8A 2R0PA 4I97A 1TU8A 3VPTA 3MNGA 3QAWA 2IIYA 3ZFBA 3BBYA 2VLVA 5A4VA 2LTKA 4IW9A 4E8EA 4F9ZA 1TRVA 3GH9A 4NHZA 4G0IA 3HD5A 1V57A 4NV2A 1EGRA 1SK1A 1GSSA 4Q5FA 3IAM2 2K8VA 3L4NA 5G30A 2VD0A 4HQSA 5G1LA 3F8UA 2H6ZA 1U3AA 3Q74A 4ILFA 4ZXGA 3FZ4A 3CSIA 4H86A 4POLA 3ZL5A 1BX9A 2P5QA 3UEMA 2H6YA 1XWAA 2GZYA 2CX4A 4ZIJA 2OADA
chains in the Genus database with same CATH topology
4XS4A 3AY8A 3GSTA 3ZMKA 1JZOA 5ECMB 2YJ7A 4AJ6A 1SJZA 2H0HA 4MH3A 2H1AA 3IDVA 5DCHA 3JCML 3PH9A 3FMWA 2R5GA 2DJKA 5FHIA 3H1NA 2NPBA 3C71A 1S3DA 4XS6A 4MNNA 3FR9A 2E7PA 2B3SA 1K3YA 2YZUA 2R6KA 4ACSA 3CMIA 4X1UA 3VI5A 5ID2A 5KEJA 1YJ6A 1ZOFA 3ERGA 5D96A 2MBSA 4K7NA 4F03A 1X0RA 3GYKA 4L5LA 1OC8A 4MPGA 5J41A 1EP8A 2A2PA 5ECLB 3N5OA 2X8CA 4O5QA 3GIXA 1PKZA 2X49A 2WDUA 4JEDA 3TKSA 5ECOB 3GH6A 1EEJA 1U87A 1A23A 1KEBA 1ILOA 2CV4A 2DBCA 2VM2A 1A0RP 3MYDA 4GCIA 2H74A 4ULXA 2FWEA 1Y6EA 2RUEA 4KE3A 5IMDA 3KM6A 4MF5A 1MDIA 1M9BA 1TI1A 5LNKe 1EOGA 4IHUA 1XWKA 1LU4A 4GTUA 5DALB 4ISDA 4CY8A 3TCOA 4YAPA 5HR3A 2HNLA 3KGKA 1GTAA 2K18A 4HU7A 4OO4A 3MIXA 4YH2A 2HLSA 1XPVA 1SJ6A 4O7HA 1THXA 1SKRB 3IV4A 4NMUA 4JU5A 2GTUA 4D73B 3ZRDA 4MPFA 2CAIA 1X5DA 2JACA 2GZPA 1LBKA 3IC8A 3UJ1A 1ON4A 1A8LA 2A4VA 5INYA 1FG4A 1YZXA 2V6OA 3QFBC 4Q5RA 2L59A 4ZBBA 4I2UA 2LRTA 2QSIA 2XC2A 3VI7A 1AQVA 1Z6MA 3APSA 5ENUA 2GLRA 1YEPA 4KCAA 1AQWA 1PRXA 5KN1A 5DALA 4G9HA 1R5PA 3O3TA 2LSTA 3TGZA 3GTUA 3L9VA 1G7EA 1NHYA 2K6VA 10GSA 1TU7A 4I5QA 4MJBA 3P7XA 5D93A 2FGXA 1AXDA 2WJUA 3EMXA 5CRWA 1XVWA 5D9XA 4D73A 1H75A 2LJRA 3F4SA 1UN2A 4PURA 3HJMA 4IELA 3M0FA 1ST9A 1TW9A 2HZEA 1V2AA 3WD6A 12GSA 5IOXA 2L6DA 3GKXA 2H8LA 5G5FA 4EUYA 4I8BA 5A4UA 5J9CA 2H6XA 4YKGA 4CW9A 19GSA 2LJAA 1K3LA 3HXSA 2LQQA 1UC7A 2DKIA 1OC9B 1TRWA 3DYRA 1X9WB 2GQKA 3A3TA 2IN3A 1XW9A 3LJRA 4J56E 4N0VA 4DSQA 3FHKA 4MZCA 1FB6A 2L5OA 2CT6A 2HI7A 5GZZB 2WS2A 1QK8A 2DLXA 2QA1A 4ICYA 2YANA 3LG6A 4LL4B 4DVCA 2DKHA 3SBCA 1M0UA 4EO3A 2YWOA 5KN3A 3W8SA 1F2EA 2GZZA 4RI7A 1NM3A 4EDZA 4KNDA 1SENA 2O85A 1V98A 2DIYA 3FW2A 2KP1A 4Q5NA 4K0GA 5IMCA 3KCMA 1GUKA 1K0DA 3UAPA 4EDYA 4V2LA 2XBQA 3CBUA 2GVPA 2YWIA 5DCGA 5B6MA 3KJYA 2GT6A 2FY6A 3APOA 3WYWA 3ZTLA 1OC9A 2O7KA 3R3EA 3TJJA 2VAFA 2I4AA 4EIQA 3VWUA 2IMIA 5AIXA 5CRDA 4OFNA 3LXZA 2GSQA 3VWVA 2IFQB 1DE2A 2B5EA 3KMOA 1BJXA 1OAZA 1ZZYA 2AJQB 5IPGA 4KSMA 2DC5A 1YF0A 2JSZA 1XWCA 3M3MA 1Z7PA 1V40A 2XPEA 3VPQA 1EEMA 3LQ7A 3BCKA 3CTFA 2WZ9A 3KTLA 1XBSA 3G9BA 1MDJA 1E2YA 1JZWA 2H30A 3I69A 2LRNA 11GSA 5F0GA 5IMZA 1IYIA 1ML6A 4OCFA 3DXBA 1W4VA 2L4QA 2DJ3A 1LJRA 4MJAA 3C1RA 3EURA 2FWHA 1JLVA 1HQOA 1OC3A 5J5NA 2O8VB 3KTBA 1BEDA 1ZGNA 5CO3A 1THOA 4KDYA 1Z7RA 3D4MA 3DIEA 4AJ7A 4N30A 3FEUA 4YQUA 1DE1A 5GAND 3P8WA 1YF1A 3LGCA 2G0FA 2L5LA 1XZOA 3E9JB 3QMXA 3CYNA 1TRSA 3GL5A 2NDOA 1PL2A 4L0UA 4E8HA 5G1KA 1OE7A 3ZREA 3IHGA 3QOUA 3QAGA 2CX3A 1K0NA 1O85A 3VK9A 2F9SA 3KH9A 2FD3A 3LXTA 4DEJA 4JRRA 2HT9A 2K9FA 3EU3A 2VL2C 1M9AA 3QFAC 2KUCA 2H72A 2F8AA 3P2AA 3ZVJA 4TVEA 1VGLA 3TRQA 3O6TA 3KP9A 4F82A 1Q4JA 3EWLA 3ME8A 3C7MA 4HS1A 1MEKA 4L8EA 2VLUA 2OBIA 1J0FA 1I9DA 2PVQA 4BVYA 3KH7A 2L57A 1PA3A 2PN8A 1GH2A 4ZB8A 2IPAA 4EKZA 2YV7A 1RK4A 4MZWA 2KLXA 3F4RA 1QUWA 2ZUPA 4YQMA 2YJHA 1FO5A 1AQXA 3CXGA 2DMMA 1SYRA 1JFUA 4XRAA 4OD7A 5J9BA 2R2JA 3D4TA 1GNWA 4QL9A 20GSA 1TI3A 4OCEA 4HDEA 1WPIA 3I43A 3IR4A 1S3AA 2YZHA 2VLTA 3LYKA 4G2EA 4TW5A 4K8MA 2VM1A 3KEBA 5D8IA 3VLNA 1GP1A 1XOBA 5ID2B 2ZNMA 1EOHA 3ME7A 1DUGA 2WB9A 2REMA 1BQ7A 1DBYA 2H73A 3V1WA 1NW2A 1AUCA 4TOPA 5EVOA 1URMA 2FCHA 1B4PA 4MABA 3TKPA 3ZVJD 1YKAA 1OKTA 2FHEA 4QL7A 1TKDB 3UMAA 2R0GA 5ECSA 3EE2A 3LSZA 4J2FA 4KH7A 4JR6A 2IMFA 7GSSA 2B6MA 3Q6OA 1XW5A 2JU5A 4XRDA 1R4WA 2C0GA 4TXOB 4ZB6A 2CZ2A 4POMA 4MK3A 4K2DA 3WGXA 1SKWB 2G2QA 1CQGA 2HRNA 3F6DA 4EXJA 1ACVA 3NZNA 3QD9A 3M1GA 2YP6A 5KOWA 2M46A 1SYXA 4KDUA 3HZ8A 5ECPB 2CVKA 1G6WA 1A0FA 4TR1A 2XPDA 4ID0A 4OFMA 1XFLA 1T4ZA 3US3A 2H75A 3TJBA 1JHBA 2VCTA 4NV5A 1G7OA 1GL8A 6GSTA 4N0ZA 4TN8A 3L9UA 4X0XA 3HYPA 5JWRB 3LORA 5LCZA 2E0QA 3HA9A 17GSA 4XHMA 2F51A 5ECIB 5IQYA 4IJ3A 2H1DA 3GX0A 3H4KA 2MMZA 1HD2A 4TXOA 2X8HA 3FRCA 2IL3A 1SL1B 1VF4A 2KOKA 4FYBA 1ZMAA 4MJCA 3L78A 3F63A 3GL3A 3QDNA 2P5RA 2JZRA 5HR2A 4ZB9A 2IMEA 1XCCA 1VRSD 5F8BA 3F0IA 1T3BA 2C4JA 4MJEA 4BPYA 3GTUB 1ZYPA 2A2RA 4GSTA 2UZ8A 5DJLA 1PQNA 3UIWA 1WWJA 2FUG2 4MCUA 2WCIA 4KW6A 4L5OA 3G7YA 4FH8A 5C04A 3IAS2 1XWBA 3KD0A 1SKSB 1WIKA 1U88A 1XIYA 5BMUA 5IO2A 2XBIA 14GSA 4CY6A 1WMJA 4WR4A 1KBNA 2VUPA 2PBJA 1T1VA 4K9ZA 2HZEB 2ZCTA 1Z5YE 1VF2A 5ECRB 2F3MA 6GSSA 3WT1A 5EPFA 4BL7A 1OKDA 4LMVA 4NHWA 2GQLA 2MMOA 2XHFA 4KAEA 3IK9A 1DSBA 4V2MA 3L0HA 1TOFA 1ZL9A 2L6CA 2NTOA 4P3YB 1O8WA 3KIJA 1F3BA 2TIRA 2WGRA 2YV9A 2AUVA 3GHAA 4GSSA 1NSWA 3M9KA 2JL4A 2VCQA 2LKUA 3ZZXA 4GLTA 4DSRA 5B8BA 3D5JA 4J57E 4RUVA 1EV9A 3IBHA 3C1SA 4HQZA 2C1YA 2P31A 2VCWA 2B1KA 6GSWA 1Q98A 2FLSA 2KHPA 2V1MA 2C3NA 2VCZA 2V32A 4FIWA 4K5SA 3DMLA 1JLWA 3ERWA 4K7OA 2R3XA 3DD3A 1ERUA 3VURA 4O5UA 1FHEA 4NAXA 3UVTA 4GSNA 3RBTA 2C0FA 4ZL8A 3LYPA 3J7Yk 1W89A 1QMVA 4G19A 5CYYA 3IA1A 1RQMA 4OFTA 4O32A 3R2QA 5DBQA 4LLRA 1A2JA 4PQ1A 1T7PB 4WKWA 5H5QA 4EC0A 1V9WA 1XVQA 1SK0A 3GMFA 3F3RA 1SD9A 2C0EA 2HXKA 5H5RA 5LD0A 2HE3A 2MZCA 1B8XA 4USSA 3LWAA 1A8YA 3ZYWA 3VWXA 3UBKA 2JZSA 1FVKA 2GDRA 1ERTA 2H70A 3D22A 2YWMA 1GLPA 4WR5A 2I3YA 2DJ0A 5GSTA 3WGEA 3SWLA 1OE8A 1A24A 3EC3A 2YPMA 2H71A 3GN3A 3HVXA 4IGJA 1AC1A 5CP1A 4TKYA 2GGTA 4TRXA 1AAZA 4MF6A 5IMVA 1F3AA 1G6YA 5D73A 3UBLA 6GSVA 3F4TA 16GSA 2VCVA 5KN2A 3C73A 4F0BA 1B9XC 3ZIVA 3H93A 4NXIA 4PNGA 3Q18A 2TRXA 1X5CA 1SK2A 5E59A 3HY2A 2DIZA 1SL2B 3MAKA 4IVFA 1QQ2A 4PGTA 5FT3A 1ERVA 1CQHA 1F9MA 4KF9A 4TR4A 3E0UA 2LQOA 1O8XA 2L4CA 5JWQB 3OR5A 4L0WA 3FZAA 3FZ5A 2H1GA 1FAAA 3EMPA 4PUAA 5EL8A 2CVBA 2OJLA 1TJDA 5BRTA 3Q19A 3VFIA 1QXHA 1WE0A 1YKCA 4PNFA 1USBA 4ECJA 4X43A 5CAXA 4N11A 6GSXA 2LJKA 1OVNA 4CHSA 1O73A 2YWNA 4O92A 2EIRA 2FWGA 2R4VA 3TOTA 3TUEA 5ABRA 1BG5A 3F3QA 4BVYB 3D0ZA 1R5AA 2GT5A 2OBKA 3QCPA 5ELAA 3VWWA 3EVIA 1T4YA 2HRAA 13GSA 4GRFA 1G0TA 2N5AA 2WFCA 1F6MC 3FKFA 3A2XA 1GSFA 2HZFA 5J4UA 3BOAA 3PINA 2IMKA 4HZ4A 1GTUA 3HJPA 4Z2UA 2YOIA 3DWVA 4AF2A 1Z9HA 2IJYA 4IQAA 4OO5A 1M2BA 4NPBA 2J9HA 5D9WA 3DEXA 3IXRA 4ML1A 5DAKB 4BWSA 3ED3A 5F06A 1WRYA 2C3TA 5JCWA 2LRCA 4IS0A 4MH2A 1O81A 4A5PA 1B48A 3LEFA 1T8EB 1MD4A 1GSQA 3TJGA 4XCSA 3HJOA 2LEGA 2B1LA 1GSEA 1U6TA 4I6XA 3P90A 3IE3A 3KP8A 3O76A 2PGTA 3RAZA 2HYXA 2HRKA 5KOXA 2J23A 1MTCA 4TR3A 1BAYA 2O87A 2P0GA 2OKAA 2RM5A 3H79A 3NOFA 2H0IA 4ECCA 1S3CA 2Z9SA 2RIIA 4FYCA 4PTSA 5KN0A 4WETA 2OE0A 1R26A 3HKRA 1M99A 3EYTA 3L9SA 4PXOA 3FR3A 1K0MA 2FWFA 1WOUA 2CZ3A 5ELGA 3QAVA 5DAKA 1EZKA 4BWQA 2C0DA 4K0NA 3TB2A 1ERWA 3CTGA 4WBJA 2H76A 1HNAA 4HOJA 4XIHA 4XS1A 5IIZA 2QGVA 4GXZA 4X4JA 1UVZA 4RI6A 4KSOA 2LNSA 1JZRA 5EY6A 1ABAA 3CSHA 5IMAA 3APQA 1XWGA 4WXTA 4ZBAA 4RQRA 2H66A 2MMAA 4K1FA 3FZ9A 5F05A 5JCUA 1A2LA 4IKHA 1BYEA 1F37A 4OMVA 2X4AA 1K3OA 3ERFA 1ZYNA 5AISA 3GV1A 1YY7A 4KCEA 3IRAA 5HQPA 2OACA 1PX7A 2PMTA 2BJXA 3S9FA 4TR1B 5J3RA 2WRTA 2FA4A 2BMXA 2MBTA 4KA0A 3RHBA 1UA5A 4IJIA 1FW1A 4KUNA 2M72A 4G0KA 2AYTA 2HSHA 3D21A 2D2ZA 3MDKA 5DQYA 1B9YC 5CRGA 1FOVA 2MYGA 1KNGA 4GQCA 2VL3A 2WULA 4V1Ap 3F9UA 3EINA 9GSSA 3FYGA 4WEYA 1GTBA 1M7TA 4EVMA 4EF0A 3IHQA 2GS3A 3NIVA 4V2NA 1U3IA 3W8JA 4ZILA 1JZDA 5A4WA 1IYHA 3GKNA 3KXOA 2HRFA 3C8EA 2AHEA 1TRUA 2VD1A 3RDWA 22GSA 3FK8A 4KB3A 1RW1A 4ZL7A 5DJMA 4IP1A 3RPNA 1WP0A 2N5BA 2B7JA 2FNOA 4G10A 3TKQA 3TKSC 5HR1A 3FR6A 5DQSA 5IM9A 3TKRA 1VF1A 2DSAA 3GRXA 3A2WA 4LA1A 5GAPD 1MD3A 5IO0A 3HCZA 5G2ZA 5DDLA 5HFIA 3PGTA 1PD21 5L71A 3N9JA 4ECBA 1QGVA 2GSRA 2DJ1A 4BL7B 2E2GA 1X9SB 18GSA 4MDCA 5IMFA 2C80A 1GULA 5HR0A 3LW9A 3ZIJA 1GUHA 4HZ2A 3UVHA 2K8SA 4JZQA 4EE0A 4RQXA 1HYUA 1GLQA 2M80A 5C00A 3GSSA 2A2SA 4HJMA 1TK5B 2I81A 4F0CA 3HVSA 3DVWA 5E4WA 4TR0A 2AAWA 3UL3A 2BTOT 4BA7A 1WJKA 2X64A 2DJ2A 1PSQA 3IC4A 2YNXA 1GSUA 2HSMA 3BD2A 4ML6A 4HUAA 2ALBA 3TRPA 3GUSA 3GA4A 3DGQA 3A5WA 2DMLA 3ISOA 1A2MA 4MP4A 2X8GA 4K7IA 2V41A 4JBBA 3CRTA 1SL0B 1PN9A 4MLYA 4JR4A 4QQ7A 4AGSA 2ON7A 2VIMA 5AGYA 4WF5A 4EIPA 1V58A 1EWXA 4XTSA 2C8UA 1GSYA 4F2IA 2QC7A 2QKEA 2VCXA 4KX4A 2YN1A 1X9MB 2I1UA 1K0OA 3WT2A 3IOSA 5JWOB 3I9V2 2B5YA 1I5GA 1R7HA 1YDKA 4LMWA 2PWJA 3HHVA 1HNBA 2H19A 3QPMA 4Z2RA 4GF0A 3HDCA 5DVBA 3UOMA 3K8NA 3EPTA 2LS5A 3D6IA 2V6KA 3U5RE 1PKWA 4LL1B 4HU9A 3IK7A 4HEA2 1M2AA 2VO4A 6GSUA 3GNJA 2ES7A 3MSZA 4POKA 4KGIA 3M9JA 5A5KA 2MMNA 5B8AA 4FQUA 2AB6A 1PGTA 1YEXA 2OA7A 3DKSA 1E6BA 1H4OA 3TKSE 5ECKB 2N5FA 4YAVA 1K0AA 4Q5QA 3ZFLA 3GFKA 3A2VA 5FWGA 3ZITA 5H5SA 3KZQA 5CREA 1GNEA 1TDIA 1GWCA 1B4QA 3RHCA 5AN1A 2R0CA 3CRUA 1GTIA 2EIOA 3RPPA 4O5RA 1XOAA 4YKFA 2ON5A 3BCIA 4PQHA 1Z3EA 1GUMA 1XW6A 5D9VA 1O6JA 2E2MA 1TK8B 1TP9A 3TJFA 1YQ1A 4AJ8A 2TRCP 3KMNA 1N8JA 2I9HA 3FY7A 4JE1A 1TTZA 1ZYQB 1J9BA 4K5RA 3F6FA 2EC4A 4PUFC 1TK0B 5AIVA 5G31A 4N10A 3HVVA 5JCGA 2OE1A 2LUSA 3G7IA 4PX1A 1EV4A 2JSYA 1C72A 5IPHA 1GRXA 3GKKA 4MZBA 2LNTA 2CVDA 2R37A 2JZTA 3M8NA 2GSTA 2QA2A 1K0CA 4I2TA 4HJ2A 5B7CA 5G5EA 4ECIA 2CQ9A 3GURA 1QFNA 4K2XA 3IPZA 4PQIA 3ZMLA 4G0LA 2PVOC 3GX8A 5CNWA 1FVJA 1J08A 4POBA 5D9TA 4DSSB 2CAQA 1SJIA 2A4HA 2V2GA 1O7UA 2B7KA 2HFDA 1N2AA 1PN0A 4EL1A 1GSDA 2HSYA 3G7JA 1EP7A 1M2DA 2IFQA 4FYUA 3I6AA 3TRXA 1NHOA 2RLIA 2IMDA 3A5IA 5ECQB 3MWHA 1AW9A 2H1BA 1K0BA 2FA8A 1TXXA 4ZL9A 2LV3A 4Z7XA 5IOWA 4V1Ag 5ECNB 5COHA 1HNCA 2OE3A 4YQVA 1KTEA 2KP2A 3J7Yb 4CDOA 5CRHA 5B6NA 1PL1A 2GSSA 3PPUA 2DJJA 1PX6A 1MDKA 3E3EA 4GWRA 1FB0A 2NBSA 5ECHB 3H8QA 2GQMA 4OWYA 4BVXB 2H01A 4IP6A 5GSSA 1ZYEA 2EIQA 5HFKA 2F8FA 1XXUA 4IN0A 2X99A 1SD8A 1OYJA 3LFLA 3W6GA 4DSSA 3DVXA 4KDXA 4FO5A 1Y25A 2IWTA 2CA8A 3ZLPA 2VOCA 2YCDA 3UARA 2O89A 2VL9A 2PPTA 4GQFA 4K6XA 4Z2TA 3WGDA 2VL2A 3U6VA 2RM6A 3HZ4A 2NVLA 4IQ1A 8GSSA 2H0GA 3DRNA 1FOHA 3CSJA 1T00A 4ZBDA 4WBRD 3QR6A 2RUFA 2JADA 1PMTA 3TJKA 2PU9C 4TXVA 5HFGA 4MF7A 1SU9A 2PUKC 5F07A 1AIUA 1ZCPA 3GKMA 3TDGA 3BJ5A 4NWYA 2PERA 4XS4B 1EGOA 2B5XA 2AV4A 2C3QA 3EU4A 4MA9A 1Z6NA 4IBPA 1X5EA 4WF4A 6GSYA 1VF3A 4MMMA 3TOUA 4BVXA 4HI7A 3PR8A 2R0PA 4I97A 1TU8A 3VPTA 3MNGA 3QAWA 2IIYA 3ZFBA 3BBYA 2VLVA 5A4VA 2LTKA 4IW9A 4E8EA 4F9ZA 1TRVA 3GH9A 4NHZA 4G0IA 3HD5A 1V57A 4NV2A 1EGRA 1SK1A 1GSSA 4Q5FA 3IAM2 2K8VA 3L4NA 5G30A 2VD0A 4HQSA 5G1LA 3F8UA 2H6ZA 1U3AA 3Q74A 4ILFA 4ZXGA 3FZ4A 3CSIA 4H86A 4POLA 3ZL5A 1BX9A 2P5QA 3UEMA 2H6YA 1XWAA 2GZYA 2CX4A 4ZIJA 2OADA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XS4 A;  3AY8 A;  3GST A;  3ZMK A;  1JZO A;  5ECM B;  2YJ7 A;  4AJ6 A;  1SJZ A;  2H0H A;  4MH3 A;  2H1A A;  3IDV A;  5DCH A;  3JCM L;  3PH9 A;  2R5G A;  2DJK A;  5FHI A;  3H1N A;  2NPB A;  3C71 A;  1S3D A;  4XS6 A;  3FR9 A;  2E7P A;  2B3S A;  1K3Y A;  2YZU A;  2R6K A;  4ACS A;  3CMI A;  4X1U A;  3VI5 A;  5ID2 A;  5KEJ A;  1YJ6 A;  1ZOF A;  3ERG A;  5D96 A;  2MBS A;  4K7N A;  4F03 A;  1X0R A;  3GYK A;  4L5L A;  1OC8 A;  4MPG A;  5J41 A;  1EP8 A;  5ECL B;  3N5O A;  2X8C A;  3GIX A;  1PKZ A;  2WDU A;  4JED A;  3TKS A;  5ECO B;  3GH6 A;  1EEJ A;  1U87 A;  1A23 A;  1KEB A;  1ILO A;  2CV4 A;  2DBC A;  2VM2 A;  1A0R P;  4GCI A;  2H74 A;  4ULX A;  2FWE A;  1Y6E A;  2RUE A;  4KE3 A;  5IMD A;  3KM6 A;  4MF5 A;  1MDI A;  1M9B A;  1TI1 A;  5LNK e;  1EOG A;  4IHU A;  1XWK A;  1LU4 A;  4GTU A;  5DAL B;  4ISD A;  3TCO A;  4YAP A;  5HR3 A;  2HNL A;  3KGK A;  1GTA A;  2K18 A;  4HU7 A;  4OO4 A;  4YH2 A;  2HLS A;  1XPV A;  1SJ6 A;  4O7H A;  1THX A;  1SKR B;  3IV4 A;  4NMU A;  4JU5 A;  2GTU A;  4D73 B;  3ZRD A;  4MPF A;  2CAI A;  1X5D A;  2JAC A;  2GZP A;  1LBK A;  3UJ1 A;  1ON4 A;  1A8L A;  2A4V A;  5INY A;  1FG4 A;  1YZX A;  2V6O A;  3QFB C;  4Q5R A;  2L59 A;  4ZBB A;  4I2U A;  2LRT A;  2QSI A;  2XC2 A;  3VI7 A;  1AQV A;  1Z6M A;  3APS A;  5ENU A;  2GLR A;  1YEP A;  4KCA A;  1AQW A;  1PRX A;  5KN1 A;  5DAL A;  4G9H A;  1R5P A;  3O3T A;  2LST A;  3TGZ A;  3GTU A;  3L9V A;  1G7E A;  1NHY A;  2K6V A;  10GS A;  1TU7 A;  4I5Q A;  4MJB A;  3P7X A;  5D93 A;  2FGX A;  1AXD A;  2WJU A;  3EMX A;  5CRW A;  1XVW A;  5D9X A;  4D73 A;  1H75 A;  2LJR A;  3F4S A;  1UN2 A;  4PUR A;  3HJM A;  4IEL A;  3M0F A;  1ST9 A;  1TW9 A;  2HZE A;  1V2A A;  3WD6 A;  12GS A;  5IOX A;  2L6D A;  3GKX A;  2H8L A;  5G5F A;  4EUY A;  4I8B A;  5A4U A;  5J9C A;  2H6X A;  4CW9 A;  19GS A;  2LJA A;  1K3L A;  3HXS A;  2LQQ A;  1UC7 A;  1OC9 B;  1TRW A;  3DYR A;  1X9W B;  2GQK A;  3A3T A;  2IN3 A;  1XW9 A;  3LJR A;  4J56 E;  4N0V A;  4DSQ A;  3FHK A;  4MZC A;  1FB6 A;  2L5O A;  2CT6 A;  2HI7 A;  5GZZ B;  2WS2 A;  1QK8 A;  2DLX A;  2YAN A;  3LG6 A;  4LL4 B;  4DVC A;  3SBC A;  1M0U A;  4EO3 A;  2YWO A;  5KN3 A;  3W8S A;  1F2E A;  2GZZ A;  4RI7 A;  1NM3 A;  4EDZ A;  4KND A;  1SEN A;  2O85 A;  1V98 A;  2DIY A;  3FW2 A;  2KP1 A;  4Q5N A;  4K0G A;  5IMC A;  3KCM A;  1GUK A;  1K0D A;  3UAP A;  4EDY A;  4V2L A;  2XBQ A;  3CBU A;  2GVP A;  2YWI A;  5DCG A;  5B6M A;  3KJY A;  2GT6 A;  2FY6 A;  3APO A;  3WYW A;  3ZTL A;  1OC9 A;  2O7K A;  3TJJ A;  2VAF A;  2I4A A;  3VWU A;  2IMI A;  5AIX A;  5CRD A;  4OFN A;  3LXZ A;  2GSQ A;  3VWV A;  2IFQ B;  1DE2 A;  2B5E A;  3KMO A;  1BJX A;  1OAZ A;  1ZZY A;  2AJQ B;  5IPG A;  4KSM A;  2DC5 A;  1YF0 A;  2JSZ A;  1XWC A;  3M3M A;  1Z7P A;  1V40 A;  2XPE A;  3VPQ A;  1EEM A;  3LQ7 A;  3BCK A;  3CTF A;  2WZ9 A;  3KTL A;  1XBS A;  3G9B A;  1MDJ A;  1E2Y A;  1JZW A;  2H30 A;  3I69 A;  2LRN A;  11GS A;  5F0G A;  5IMZ A;  1IYI A;  1ML6 A;  4OCF A;  3DXB A;  1W4V A;  2L4Q A;  2DJ3 A;  1LJR A;  4MJA A;  3C1R A;  3EUR A;  2FWH A;  1JLV A;  1HQO A;  1OC3 A;  5J5N A;  2O8V B;  3KTB A;  1BED A;  1ZGN A;  5CO3 A;  1THO A;  4KDY A;  1Z7R A;  3D4M A;  3DIE A;  4AJ7 A;  4N30 A;  3FEU A;  4YQU A;  1DE1 A;  5GAN D;  3P8W A;  1YF1 A;  3LGC A;  2G0F A;  2L5L A;  1XZO A;  3E9J B;  3QMX A;  3CYN A;  1TRS A;  3GL5 A;  2NDO A;  1PL2 A;  4L0U A;  4E8H A;  5G1K A;  1OE7 A;  3ZRE A;  3QOU A;  3QAG A;  2CX3 A;  1K0N A;  1O85 A;  3VK9 A;  2F9S A;  3KH9 A;  2FD3 A;  3LXT A;  4DEJ A;  4JRR A;  2HT9 A;  2K9F A;  3EU3 A;  2VL2 C;  1M9A A;  3QFA C;  2KUC A;  2H72 A;  2F8A A;  3P2A A;  3ZVJ A;  4TVE A;  1VGL A;  3TRQ A;  3O6T A;  3KP9 A;  4F82 A;  1Q4J A;  3EWL A;  3ME8 A;  3C7M A;  4HS1 A;  1MEK A;  4L8E A;  2VLU A;  2OBI A;  1J0F A;  1I9D A;  2PVQ A;  4BVY A;  3KH7 A;  2L57 A;  1PA3 A;  2PN8 A;  1GH2 A;  4ZB8 A;  2IPA A;  4EKZ A;  2YV7 A;  1RK4 A;  4MZW A;  2KLX A;  3F4R A;  1QUW A;  2ZUP A;  4YQM A;  2YJH A;  1FO5 A;  1AQX A;  3CXG A;  2DMM A;  1SYR A;  1JFU A;  4XRA A;  4OD7 A;  5J9B A;  2R2J A;  3D4T A;  1GNW A;  4QL9 A;  20GS A;  1TI3 A;  4OCE A;  4HDE A;  1WPI A;  3I43 A;  3IR4 A;  1S3A A;  2YZH A;  2VLT A;  3LYK A;  4G2E A;  4TW5 A;  4K8M A;  2VM1 A;  3KEB A;  5D8I A;  3VLN A;  1GP1 A;  1XOB A;  5ID2 B;  2ZNM A;  1EOH A;  3ME7 A;  1DUG A;  2WB9 A;  2REM A;  1BQ7 A;  1DBY A;  2H73 A;  3V1W A;  1NW2 A;  1AUC A;  4TOP A;  5EVO A;  1URM A;  2FCH A;  1B4P A;  4MAB A;  3TKP A;  3ZVJ D;  1YKA A;  1OKT A;  2FHE A;  4QL7 A;  1TKD B;  3UMA A;  5ECS A;  3EE2 A;  3LSZ A;  4J2F A;  4KH7 A;  4JR6 A;  2IMF A;  7GSS A;  2B6M A;  3Q6O A;  1XW5 A;  2JU5 A;  4XRD A;  1R4W A;  2C0G A;  4TXO B;  4ZB6 A;  2CZ2 A;  4POM A;  4MK3 A;  4K2D A;  3WGX A;  1SKW B;  2G2Q A;  1CQG A;  2HRN A;  3F6D A;  4EXJ A;  1ACV A;  3NZN A;  3QD9 A;  3M1G A;  2YP6 A;  2M46 A;  1SYX A;  4KDU A;  3HZ8 A;  5ECP B;  2CVK A;  1G6W A;  1A0F A;  4TR1 A;  2XPD A;  4ID0 A;  4OFM A;  1XFL A;  1T4Z A;  3US3 A;  2H75 A;  3TJB A;  1JHB A;  2VCT A;  4NV5 A;  1G7O A;  1GL8 A;  6GST A;  4N0Z A;  4TN8 A;  3L9U A;  4X0X A;  3HYP A;  5JWR B;  3LOR A;  5LCZ A;  2E0Q A;  3HA9 A;  17GS A;  4XHM A;  2F51 A;  5ECI B;  5IQY A;  4IJ3 A;  2H1D A;  3GX0 A;  3H4K A;  2MMZ A;  1HD2 A;  4TXO A;  2X8H A;  3FRC A;  2IL3 A;  1SL1 B;  1VF4 A;  2KOK A;  4FYB A;  1ZMA A;  4MJC A;  3L78 A;  3F63 A;  3GL3 A;  3QDN A;  2P5R A;  2JZR A;  5HR2 A;  4ZB9 A;  2IME A;  1XCC A;  1VRS D;  5F8B A;  3F0I A;  1T3B A;  2C4J A;  4MJE A;  4BPY A;  3GTU B;  4GST A;  2A2R A;  5DJL A;  1PQN A;  3UIW A;  1WWJ A;  2FUG 2;  4MCU A;  2WCI A;  4KW6 A;  4L5O A;  3G7Y A;  4FH8 A;  5C04 A;  3IAS 2;  1XWB A;  3KD0 A;  1SKS B;  1WIK A;  1U88 A;  1XIY A;  5IO2 A;  2XBI A;  14GS A;  1WMJ A;  4WR4 A;  1KBN A;  2VUP A;  2PBJ A;  1T1V A;  4K9Z A;  2HZE B;  2ZCT A;  1Z5Y E;  1VF2 A;  5ECR B;  2F3M A;  6GSS A;  3WT1 A;  5EPF A;  4BL7 A;  1OKD A;  4LMV A;  4NHW A;  2GQL A;  2MMO A;  2XHF A;  4KAE A;  3IK9 A;  1DSB A;  4V2M A;  3L0H A;  1TOF A;  1ZL9 A;  2L6C A;  2NTO A;  4P3Y B;  1O8W A;  3KIJ A;  1F3B A;  2TIR A;  2WGR A;  2YV9 A;  2AUV A;  3GHA A;  4GSS A;  1NSW A;  3M9K A;  2JL4 A;  2VCQ A;  2LKU A;  3ZZX A;  4GLT A;  4DSR A;  5B8B A;  3D5J A;  4J57 E;  4RUV A;  1EV9 A;  3IBH A;  3C1S A;  4HQZ A;  2C1Y A;  2P31 A;  2VCW A;  2B1K A;  6GSW A;  1Q98 A;  2FLS A;  2KHP A;  2V1M A;  2C3N A;  2VCZ A;  2V32 A;  4FIW A;  3DML A;  1JLW A;  3ERW A;  4K7O A;  2R3X A;  3DD3 A;  1ERU A;  3VUR A;  1FHE A;  4NAX A;  3UVT A;  4GSN A;  3RBT A;  2C0F A;  4ZL8 A;  3LYP A;  3J7Y k;  1W89 A;  1QMV A;  4G19 A;  5CYY A;  3IA1 A;  1RQM A;  4OFT A;  4O32 A;  3R2Q A;  5DBQ A;  4LLR A;  1A2J A;  4PQ1 A;  1T7P B;  4WKW A;  5H5Q A;  4EC0 A;  1V9W A;  1XVQ A;  1SK0 A;  3GMF A;  3F3R A;  1SD9 A;  2C0E A;  2HXK A;  5H5R A;  5LD0 A;  2HE3 A;  2MZC A;  1B8X A;  3LWA A;  1A8Y A;  3ZYW A;  3VWX A;  3UBK A;  2JZS A;  1FVK A;  2GDR A;  1ERT A;  2H70 A;  3D22 A;  2YWM A;  1GLP A;  4WR5 A;  2I3Y A;  2DJ0 A;  5GST A;  3WGE A;  3SWL A;  1OE8 A;  1A24 A;  3EC3 A;  2YPM A;  2H71 A;  3GN3 A;  3HVX A;  4IGJ A;  1AC1 A;  5CP1 A;  4TKY A;  2GGT A;  4TRX A;  1AAZ A;  4MF6 A;  5IMV A;  1F3A A;  1G6Y A;  5D73 A;  3UBL A;  6GSV A;  3F4T A;  16GS A;  2VCV A;  5KN2 A;  3C73 A;  4F0B A;  1B9X C;  3ZIV A;  3H93 A;  4NXI A;  4PNG A;  3Q18 A;  2TRX A;  1X5C A;  1SK2 A;  5E59 A;  3HY2 A;  2DIZ A;  1SL2 B;  3MAK A;  4IVF A;  1QQ2 A;  4PGT A;  5FT3 A;  1ERV A;  1CQH A;  1F9M A;  4TR4 A;  3E0U A;  2LQO A;  1O8X A;  2L4C A;  5JWQ B;  3OR5 A;  4L0W A;  3FZA A;  3FZ5 A;  2H1G A;  1FAA A;  3EMP A;  4PUA A;  5EL8 A;  2CVB A;  2OJL A;  1TJD A;  3Q19 A;  3VFI A;  1QXH A;  1WE0 A;  1YKC A;  4PNF A;  1USB A;  4ECJ A;  4X43 A;  5CAX A;  4N11 A;  6GSX A;  2LJK A;  1OVN A;  4CHS A;  1O73 A;  2YWN A;  4O92 A;  2EIR A;  2FWG A;  2R4V A;  3TOT A;  3TUE A;  5ABR A;  1BG5 A;  3F3Q A;  3D0Z A;  1R5A A;  2GT5 A;  2OBK A;  3QCP A;  5ELA A;  3VWW A;  3EVI A;  1T4Y A;  13GS A;  4GRF A;  1G0T A;  2N5A A;  2WFC A;  1F6M C;  3FKF A;  3A2X A;  1GSF A;  2HZF A;  5J4U A;  3BOA A;  3PIN A;  2IMK A;  4HZ4 A;  1GTU A;  3HJP A;  2YOI A;  3DWV A;  4AF2 A;  1Z9H A;  2IJY A;  4IQA A;  4OO5 A;  1M2B A;  4NPB A;  2J9H A;  5D9W A;  3DEX A;  3IXR A;  4ML1 A;  5DAK B;  4BWS A;  3ED3 A;  5F06 A;  1WRY A;  2C3T A;  5JCW A;  2LRC A;  4IS0 A;  4MH2 A;  1O81 A;  1B48 A;  3LEF A;  1T8E B;  1MD4 A;  1GSQ A;  3TJG A;  4XCS A;  3HJO A;  2LEG A;  2B1L A;  1GSE A;  1U6T A;  4I6X A;  3P90 A;  3IE3 A;  3KP8 A;  3O76 A;  2PGT A;  3RAZ A;  2HYX A;  2J23 A;  1MTC A;  4TR3 A;  1BAY A;  2O87 A;  2P0G A;  2OKA A;  2RM5 A;  3H79 A;  3NOF A;  2H0I A;  4ECC A;  1S3C A;  2Z9S A;  2RII A;  4FYC A;  5KN0 A;  4WET A;  2OE0 A;  1R26 A;  3HKR A;  1M99 A;  3EYT A;  3L9S A;  4PXO A;  3FR3 A;  1K0M A;  2FWF A;  1WOU A;  2CZ3 A;  5ELG A;  3QAV A;  5DAK A;  1EZK A;  4BWQ A;  2C0D A;  4K0N A;  3TB2 A;  1ERW A;  3CTG A;  4WBJ A;  2H76 A;  1HNA A;  4HOJ A;  4XIH A;  4XS1 A;  5IIZ A;  2QGV A;  4GXZ A;  1UVZ A;  4RI6 A;  4KSO A;  2LNS A;  1JZR A;  5EY6 A;  1ABA A;  3CSH A;  5IMA A;  3APQ A;  1XWG A;  4WXT A;  4ZBA A;  4RQR A;  2H66 A;  2MMA A;  4K1F A;  3FZ9 A;  5F05 A;  5JCU A;  1A2L A;  4IKH A;  1BYE A;  1F37 A;  4OMV A;  1K3O A;  3ERF A;  5AIS A;  3GV1 A;  1YY7 A;  4KCE A;  3IRA A;  5HQP A;  2OAC A;  1PX7 A;  2PMT A;  2BJX A;  3S9F A;  4TR1 B;  5J3R A;  2WRT A;  2FA4 A;  2BMX A;  2MBT A;  4KA0 A;  3RHB A;  1UA5 A;  4IJI A;  1FW1 A;  4KUN A;  2M72 A;  2AYT A;  2HSH A;  3D21 A;  2D2Z A;  5DQY A;  3MDK A;  1B9Y C;  5CRG A;  1FOV A;  2MYG A;  1KNG A;  4GQC A;  2VL3 A;  2WUL A;  4V1A p;  3F9U A;  3EIN A;  9GSS A;  3FYG A;  4WEY A;  1GTB A;  1M7T A;  4EVM A;  4EF0 A;  3IHQ A;  2GS3 A;  3NIV A;  4V2N A;  1U3I A;  3W8J A;  4ZIL A;  1JZD A;  5A4W A;  1IYH A;  3GKN A;  3KXO A;  2HRF A;  3C8E A;  2AHE A;  1TRU A;  2VD1 A;  3RDW A;  22GS A;  3FK8 A;  4KB3 A;  1RW1 A;  4ZL7 A;  5DJM A;  4IP1 A;  3RPN A;  1WP0 A;  2N5B A;  2B7J A;  2FNO A;  4G10 A;  3TKQ A;  3TKS C;  5HR1 A;  3FR6 A;  5DQS A;  5IM9 A;  3TKR A;  1VF1 A;  2DSA A;  3GRX A;  3A2W A;  4LA1 A;  5GAP D;  1MD3 A;  5IO0 A;  3HCZ A;  5G2Z A;  5DDL A;  5HFI A;  3PGT A;  1PD2 1;  5L71 A;  3N9J A;  4ECB A;  1QGV A;  2GSR A;  2DJ1 A;  2E2G A;  1X9S B;  18GS A;  4MDC A;  5IMF A;  2C80 A;  1GUL A;  5HR0 A;  3ZIJ A;  1GUH A;  4HZ2 A;  3UVH A;  2K8S A;  4JZQ A;  4EE0 A;  4RQX A;  1HYU A;  1GLQ A;  2M80 A;  5C00 A;  3GSS A;  2A2S A;  4HJM A;  1TK5 B;  2I81 A;  4F0C A;  3HVS A;  3DVW A;  5E4W A;  4TR0 A;  2AAW A;  3UL3 A;  2BTO T;  4BA7 A;  1WJK A;  2X64 A;  2DJ2 A;  1PSQ A;  3IC4 A;  2YNX A;  1GSU A;  3BD2 A;  4ML6 A;  4HUA A;  2ALB A;  3TRP A;  3GUS A;  3GA4 A;  3DGQ A;  3A5W A;  2DML A;  3ISO A;  1A2M A;  4MP4 A;  2X8G A;  4K7I A;  2V41 A;  4JBB A;  3CRT A;  1SL0 B;  1PN9 A;  4MLY A;  4JR4 A;  4QQ7 A;  4AGS A;  2ON7 A;  2VIM A;  5AGY A;  4WF5 A;  1V58 A;  1EWX A;  4XTS A;  2C8U A;  1GSY A;  4F2I A;  2QC7 A;  2QKE A;  2VCX A;  4KX4 A;  2YN1 A;  1X9M B;  2I1U A;  1K0O A;  3WT2 A;  3IOS A;  5JWO B;  3I9V 2;  2B5Y A;  1I5G A;  1R7H A;  1YDK A;  4LMW A;  2PWJ A;  3HHV A;  1HNB A;  2H19 A;  3QPM A;  4GF0 A;  3HDC A;  5DVB A;  3UOM A;  3K8N A;  2LS5 A;  3D6I A;  2V6K A;  3U5R E;  1PKW A;  4LL1 B;  4HU9 A;  3IK7 A;  4HEA 2;  1M2A A;  2VO4 A;  6GSU A;  3GNJ A;  2ES7 A;  3MSZ A;  4POK A;  4KGI A;  3M9J A;  5A5K A;  2MMN A;  5B8A A;  2AB6 A;  1PGT A;  1YEX A;  2OA7 A;  3DKS A;  1E6B A;  1H4O A;  3TKS E;  5ECK B;  2N5F A;  4YAV A;  1K0A A;  4Q5Q A;  3ZFL A;  3GFK A;  3A2V A;  5FWG A;  3ZIT A;  5H5S A;  3KZQ A;  5CRE A;  1GNE A;  1TDI A;  1GWC A;  1B4Q A;  3RHC A;  5AN1 A;  3CRU A;  1GTI A;  2EIO A;  3RPP A;  4O5R A;  1XOA A;  2ON5 A;  3BCI A;  4PQH A;  1Z3E A;  1GUM A;  1XW6 A;  5D9V A;  1O6J A;  2E2M A;  1TK8 B;  1TP9 A;  3TJF A;  1YQ1 A;  4AJ8 A;  2TRC P;  3KMN A;  1N8J A;  2I9H A;  3FY7 A;  4JE1 A;  1TTZ A;  1ZYQ B;  1J9B A;  3F6F A;  2EC4 A;  4PUF C;  1TK0 B;  5AIV A;  5G31 A;  4N10 A;  3HVV A;  5JCG A;  2OE1 A;  2LUS A;  3G7I A;  4PX1 A;  1EV4 A;  2JSY A;  1C72 A;  5IPH A;  1GRX A;  3GKK A;  4MZB A;  2LNT A;  2CVD A;  2R37 A;  2JZT A;  3M8N A;  2GST A;  1K0C A;  4I2T A;  4HJ2 A;  5B7C A;  5G5E A;  4ECI A;  2CQ9 A;  3GUR A;  1QFN A;  3IPZ A;  4PQI A;  3ZML A;  2PVO C;  3GX8 A;  5CNW A;  1FVJ A;  1J08 A;  4POB A;  5D9T A;  4DSS B;  2CAQ A;  1SJI A;  2V2G A;  1O7U A;  2B7K A;  2HFD A;  1N2A A;  4EL1 A;  1GSD A;  2HSY A;  3G7J A;  1EP7 A;  1M2D A;  2IFQ A;  4FYU A;  3I6A A;  3TRX A;  1NHO A;  2RLI A;  2IMD A;  5ECQ B;  3MWH A;  1AW9 A;  2H1B A;  1K0B A;  2FA8 A;  1TXX A;  4ZL9 A;  2LV3 A;  4Z7X A;  5IOW A;  4V1A g;  5ECN B;  5COH A;  1HNC A;  2OE3 A;  4YQV A;  1KTE A;  2KP2 A;  3J7Y b;  4CDO A;  5CRH A;  5B6N A;  1PL1 A;  2GSS A;  2DJJ A;  1PX6 A;  1MDK A;  3E3E A;  4GWR A;  1FB0 A;  2NBS A;  5ECH B;  3H8Q A;  2GQM A;  4OWY A;  2H01 A;  4IP6 A;  5GSS A;  1ZYE A;  2EIQ A;  5HFK A;  2F8F A;  1XXU A;  4IN0 A;  2X99 A;  1SD8 A;  1OYJ A;  3LFL A;  3W6G A;  4DSS A;  3DVX A;  4KDX A;  4FO5 A;  1Y25 A;  2IWT A;  2CA8 A;  3ZLP A;  2VOC A;  2YCD A;  3UAR A;  2O89 A;  2VL9 A;  2PPT A;  4GQF A;  4K6X A;  3WGD A;  2VL2 A;  3U6V A;  2RM6 A;  3HZ4 A;  2NVL A;  4IQ1 A;  8GSS A;  2H0G A;  3DRN A;  3CSJ A;  1T00 A;  4ZBD A;  4WBR D;  3QR6 A;  2RUF A;  2JAD A;  1PMT A;  3TJK A;  2PU9 C;  4TXV A;  5HFG A;  4MF7 A;  1SU9 A;  2PUK C;  5F07 A;  1AIU A;  1ZCP A;  3GKM A;  3TDG A;  3BJ5 A;  4NWY A;  2PER A;  4XS4 B;  1EGO A;  2B5X A;  2AV4 A;  2C3Q A;  3EU4 A;  4MA9 A;  1Z6N A;  4IBP A;  1X5E A;  4WF4 A;  6GSY A;  1VF3 A;  4MMM A;  3TOU A;  4BVX A;  4HI7 A;  3PR8 A;  4I97 A;  1TU8 A;  3VPT A;  3MNG A;  3QAW A;  2IIY A;  3ZFB A;  3BBY A;  2VLV A;  5A4V A;  2LTK A;  4IW9 A;  4E8E A;  4F9Z A;  1TRV A;  3GH9 A;  4NHZ A;  3HD5 A;  1V57 A;  4NV2 A;  1EGR A;  1SK1 A;  1GSS A;  4Q5F A;  3IAM 2;  2K8V A;  3L4N A;  5G30 A;  2VD0 A;  4HQS A;  5G1L A;  3F8U A;  2H6Z A;  1U3A A;  3Q74 A;  4ILF A;  4ZXG A;  3FZ4 A;  3CSI A;  4H86 A;  4POL A;  3ZL5 A;  1BX9 A;  2P5Q A;  3UEM A;  2H6Y A;  1XWA A;  2GZY A;  2CX4 A;  4ZIJ A;  2OAD A; 
#chains in the Genus database with same CATH topology
 4XS4 A;  3AY8 A;  3GST A;  3ZMK A;  1JZO A;  5ECM B;  2YJ7 A;  4AJ6 A;  1SJZ A;  2H0H A;  4MH3 A;  2H1A A;  3IDV A;  5DCH A;  3JCM L;  3PH9 A;  3FMW A;  2R5G A;  2DJK A;  5FHI A;  3H1N A;  2NPB A;  3C71 A;  1S3D A;  4XS6 A;  4MNN A;  3FR9 A;  2E7P A;  2B3S A;  1K3Y A;  2YZU A;  2R6K A;  4ACS A;  3CMI A;  4X1U A;  3VI5 A;  5ID2 A;  5KEJ A;  1YJ6 A;  1ZOF A;  3ERG A;  5D96 A;  2MBS A;  4K7N A;  4F03 A;  1X0R A;  3GYK A;  4L5L A;  1OC8 A;  4MPG A;  5J41 A;  1EP8 A;  2A2P A;  5ECL B;  3N5O A;  2X8C A;  4O5Q A;  3GIX A;  1PKZ A;  2X49 A;  2WDU A;  4JED A;  3TKS A;  5ECO B;  3GH6 A;  1EEJ A;  1U87 A;  1A23 A;  1KEB A;  1ILO A;  2CV4 A;  2DBC A;  2VM2 A;  1A0R P;  3MYD A;  4GCI A;  2H74 A;  4ULX A;  2FWE A;  1Y6E A;  2RUE A;  4KE3 A;  5IMD A;  3KM6 A;  4MF5 A;  1PFO A;  1MDI A;  1M9B A;  1TI1 A;  5LNK e;  1EOG A;  4IHU A;  1XWK A;  1LU4 A;  4GTU A;  5DAL B;  4ISD A;  4CY8 A;  3TCO A;  4YAP A;  5HR3 A;  2HNL A;  3KGK A;  1GTA A;  2K18 A;  4HU7 A;  4OO4 A;  3MIX A;  4YH2 A;  2HLS A;  1XPV A;  1SJ6 A;  4O7H A;  1THX A;  1SKR B;  3IV4 A;  4NMU A;  4JU5 A;  2GTU A;  4D73 B;  3ZRD A;  4MPF A;  2CAI A;  1X5D A;  2JAC A;  2GZP A;  1LBK A;  3IC8 A;  3UJ1 A;  1ON4 A;  1A8L A;  2A4V A;  5INY A;  1FG4 A;  1YZX A;  2V6O A;  3QFB C;  4Q5R A;  2L59 A;  4ZBB A;  4I2U A;  2LRT A;  2QSI A;  2XC2 A;  3VI7 A;  1AQV A;  1Z6M A;  3APS A;  5ENU A;  2GLR A;  1YEP A;  4KCA A;  1AQW A;  1PRX A;  5KN1 A;  5DAL A;  4G9H A;  1R5P A;  3O3T A;  2LST A;  3TGZ A;  3GTU A;  3L9V A;  1G7E A;  1NHY A;  2K6V A;  10GS A;  1TU7 A;  4I5Q A;  4MJB A;  3P7X A;  5D93 A;  2FGX A;  1AXD A;  2WJU A;  3EMX A;  5CRW A;  1XVW A;  5D9X A;  4D73 A;  1H75 A;  2LJR A;  3F4S A;  1UN2 A;  4PUR A;  3HJM A;  4IEL A;  3M0F A;  1ST9 A;  1TW9 A;  2HZE A;  1V2A A;  3WD6 A;  12GS A;  5IOX A;  2L6D A;  3GKX A;  2H8L A;  5G5F A;  4EUY A;  4I8B A;  5A4U A;  5J9C A;  2H6X A;  4YKG A;  4CW9 A;  19GS A;  2LJA A;  1K3L A;  3HXS A;  2LQQ A;  1UC7 A;  2DKI A;  1OC9 B;  1TRW A;  3DYR A;  1X9W B;  2GQK A;  3A3T A;  2IN3 A;  1XW9 A;  3LJR A;  4J56 E;  4N0V A;  4DSQ A;  3FHK A;  4MZC A;  1FB6 A;  2L5O A;  2CT6 A;  2HI7 A;  5GZZ B;  2WS2 A;  1QK8 A;  2DLX A;  2QA1 A;  4ICY A;  2YAN A;  3LG6 A;  4LL4 B;  4DVC A;  2DKH A;  3SBC A;  1M0U A;  4EO3 A;  2YWO A;  5KN3 A;  3W8S A;  1F2E A;  2GZZ A;  4RI7 A;  1NM3 A;  4EDZ A;  4KND A;  1SEN A;  2O85 A;  1V98 A;  2DIY A;  3FW2 A;  2KP1 A;  4Q5N A;  4K0G A;  5IMC A;  3KCM A;  1GUK A;  1K0D A;  3UAP A;  4EDY A;  4V2L A;  2XBQ A;  3CBU A;  2GVP A;  2YWI A;  5DCG A;  5B6M A;  3KJY A;  2GT6 A;  2FY6 A;  3APO A;  3WYW A;  3ZTL A;  1OC9 A;  2O7K A;  3R3E A;  3TJJ A;  2VAF A;  2I4A A;  4EIQ A;  3VWU A;  2IMI A;  5AIX A;  5CRD A;  4OFN A;  3LXZ A;  2GSQ A;  3VWV A;  2IFQ B;  1DE2 A;  2B5E A;  3KMO A;  1BJX A;  1OAZ A;  1ZZY A;  2AJQ B;  5IPG A;  4KSM A;  2DC5 A;  1YF0 A;  2JSZ A;  1XWC A;  3M3M A;  1Z7P A;  1V40 A;  2XPE A;  3VPQ A;  1EEM A;  3LQ7 A;  3BCK A;  3CTF A;  2WZ9 A;  3KTL A;  1XBS A;  3G9B A;  1MDJ A;  1E2Y A;  1JZW A;  2H30 A;  3I69 A;  2LRN A;  11GS A;  5F0G A;  5IMZ A;  1IYI A;  1ML6 A;  4OCF A;  3DXB A;  1W4V A;  2L4Q A;  2DJ3 A;  1LJR A;  4MJA A;  3C1R A;  3EUR A;  2FWH A;  1JLV A;  1HQO A;  1OC3 A;  5J5N A;  2O8V B;  3KTB A;  1BED A;  1ZGN A;  5CO3 A;  1THO A;  4KDY A;  1Z7R A;  3D4M A;  3DIE A;  4AJ7 A;  4N30 A;  3FEU A;  4YQU A;  1DE1 A;  5GAN D;  3P8W A;  1YF1 A;  3LGC A;  2G0F A;  2L5L A;  1XZO A;  3E9J B;  3QMX A;  3CYN A;  1TRS A;  3GL5 A;  2NDO A;  1PL2 A;  4L0U A;  4E8H A;  5G1K A;  1OE7 A;  3ZRE A;  3IHG A;  3QOU A;  3QAG A;  2CX3 A;  1K0N A;  1O85 A;  3VK9 A;  2F9S A;  3KH9 A;  2FD3 A;  3LXT A;  4DEJ A;  4JRR A;  2HT9 A;  2K9F A;  3EU3 A;  2VL2 C;  1M9A A;  3QFA C;  2KUC A;  2H72 A;  2F8A A;  3P2A A;  3ZVJ A;  4TVE A;  1VGL A;  3TRQ A;  3O6T A;  3KP9 A;  4F82 A;  1Q4J A;  3EWL A;  3ME8 A;  3C7M A;  4HS1 A;  1MEK A;  4L8E A;  2VLU A;  2OBI A;  1J0F A;  1I9D A;  4BIK A;  2PVQ A;  4BVY A;  3KH7 A;  2L57 A;  1PA3 A;  2PN8 A;  1GH2 A;  4ZB8 A;  2IPA A;  4EKZ A;  2YV7 A;  1RK4 A;  4MZW A;  2KLX A;  3F4R A;  1QUW A;  2ZUP A;  4YQM A;  2YJH A;  1FO5 A;  1AQX A;  3CXG A;  2DMM A;  1SYR A;  1JFU A;  4XRA A;  4OD7 A;  5J9B A;  2R2J A;  3D4T A;  1GNW A;  4QL9 A;  20GS A;  1TI3 A;  4OCE A;  4HDE A;  1WPI A;  3I43 A;  3IR4 A;  1S3A A;  2YZH A;  2VLT A;  3LYK A;  4G2E A;  4TW5 A;  4K8M A;  2VM1 A;  3KEB A;  5D8I A;  3VLN A;  1GP1 A;  1XOB A;  5ID2 B;  2ZNM A;  1EOH A;  3ME7 A;  1DUG A;  2WB9 A;  2REM A;  1BQ7 A;  1DBY A;  2H73 A;  4HSC X;  3V1W A;  1NW2 A;  1AUC A;  4TOP A;  5EVO A;  1URM A;  2FCH A;  1B4P A;  4MAB A;  3TKP A;  3ZVJ D;  1YKA A;  1OKT A;  2FHE A;  4QL7 A;  1TKD B;  3UMA A;  2R0G A;  5ECS A;  3EE2 A;  3LSZ A;  4J2F A;  4KH7 A;  4JR6 A;  2IMF A;  3HVN A;  7GSS A;  2B6M A;  3Q6O A;  1XW5 A;  2JU5 A;  4XRD A;  1R4W A;  2C0G A;  4TXO B;  4ZB6 A;  2CZ2 A;  4POM A;  4MK3 A;  4K2D A;  3WGX A;  1SKW B;  2G2Q A;  1CQG A;  2HRN A;  3F6D A;  4EXJ A;  1ACV A;  3NZN A;  3QD9 A;  3M1G A;  2YP6 A;  5KOW A;  2M46 A;  1SYX A;  4KDU A;  3HZ8 A;  5ECP B;  2CVK A;  1G6W A;  1A0F A;  4TR1 A;  2XPD A;  4ID0 A;  4OFM A;  1XFL A;  1T4Z A;  3US3 A;  2H75 A;  3TJB A;  1JHB A;  2VCT A;  4NV5 A;  1G7O A;  1GL8 A;  6GST A;  4N0Z A;  4TN8 A;  3L9U A;  4X0X A;  3HYP A;  5JWR B;  3LOR A;  5LCZ A;  2E0Q A;  3HA9 A;  17GS A;  4XHM A;  2F51 A;  5ECI B;  5IQY A;  4IJ3 A;  2H1D A;  3GX0 A;  3H4K A;  2MMZ A;  1HD2 A;  4TXO A;  2X8H A;  3FRC A;  2IL3 A;  1SL1 B;  1VF4 A;  2KOK A;  4FYB A;  1ZMA A;  4MJC A;  3L78 A;  3F63 A;  3GL3 A;  3QDN A;  2P5R A;  2JZR A;  5HR2 A;  4ZB9 A;  2IME A;  1XCC A;  1VRS D;  5F8B A;  3F0I A;  1T3B A;  2C4J A;  4MJE A;  4BPY A;  3GTU B;  1ZYP A;  2A2R A;  4GST A;  2UZ8 A;  5DJL A;  1PQN A;  3UIW A;  1WWJ A;  2FUG 2;  4MCU A;  2WCI A;  4KW6 A;  4L5O A;  3G7Y A;  4FH8 A;  5C04 A;  3IAS 2;  1XWB A;  3KD0 A;  1SKS B;  1WIK A;  1U88 A;  1XIY A;  5BMU A;  5IO2 A;  2XBI A;  14GS A;  4CY6 A;  1WMJ A;  4WR4 A;  1KBN A;  2VUP A;  2PBJ A;  1T1V A;  4K9Z A;  2HZE B;  2ZCT A;  1Z5Y E;  1VF2 A;  5ECR B;  2F3M A;  6GSS A;  3WT1 A;  5EPF A;  4BL7 A;  1OKD A;  4LMV A;  4NHW A;  2GQL A;  2MMO A;  2XHF A;  4KAE A;  3IK9 A;  1DSB A;  4V2M A;  3L0H A;  1TOF A;  1ZL9 A;  2L6C A;  2NTO A;  4P3Y B;  1O8W A;  3KIJ A;  1F3B A;  2TIR A;  2WGR A;  2YV9 A;  2AUV A;  3GHA A;  4GSS A;  1NSW A;  3M9K A;  2JL4 A;  2VCQ A;  2LKU A;  3ZZX A;  4GLT A;  4DSR A;  5B8B A;  3D5J A;  4J57 E;  4RUV A;  1EV9 A;  3IBH A;  3C1S A;  4HQZ A;  2C1Y A;  2P31 A;  2VCW A;  2B1K A;  6GSW A;  1Q98 A;  2FLS A;  2KHP A;  2V1M A;  2C3N A;  2VCZ A;  2V32 A;  4FIW A;  4K5S A;  3DML A;  1JLW A;  3ERW A;  4K7O A;  2R3X A;  3DD3 A;  1ERU A;  3VUR A;  4O5U A;  1FHE A;  4NAX A;  3UVT A;  4GSN A;  3RBT A;  2C0F A;  4ZL8 A;  3LYP A;  3J7Y k;  1W89 A;  1QMV A;  4G19 A;  5CYY A;  3IA1 A;  1RQM A;  4OFT A;  4O32 A;  3R2Q A;  5DBQ A;  4LLR A;  1A2J A;  4PQ1 A;  1T7P B;  4WKW A;  5H5Q A;  4EC0 A;  1V9W A;  1XVQ A;  1SK0 A;  3GMF A;  3F3R A;  1SD9 A;  2C0E A;  2HXK A;  5H5R A;  5LD0 A;  2HE3 A;  2MZC A;  1B8X A;  4USS A;  3LWA A;  1A8Y A;  3ZYW A;  3VWX A;  3UBK A;  2JZS A;  1FVK A;  2GDR A;  1ERT A;  2H70 A;  3D22 A;  2YWM A;  1GLP A;  4WR5 A;  2I3Y A;  2DJ0 A;  5GST A;  3WGE A;  3SWL A;  1OE8 A;  1A24 A;  3EC3 A;  2YPM A;  2H71 A;  3GN3 A;  3HVX A;  4IGJ A;  1AC1 A;  5CP1 A;  4TKY A;  2GGT A;  4TRX A;  1AAZ A;  4MF6 A;  5IMV A;  1F3A A;  1G6Y A;  5D73 A;  1M3J A;  3UBL A;  6GSV A;  3F4T A;  16GS A;  2VCV A;  5KN2 A;  3C73 A;  4F0B A;  1B9X C;  3ZIV A;  3H93 A;  4NXI A;  4PNG A;  3Q18 A;  2TRX A;  1X5C A;  1SK2 A;  5E59 A;  3HY2 A;  2DIZ A;  1SL2 B;  3MAK A;  4IVF A;  1QQ2 A;  4PGT A;  5FT3 A;  1ERV A;  1CQH A;  1F9M A;  4KF9 A;  4TR4 A;  3E0U A;  2LQO A;  1O8X A;  2L4C A;  5JWQ B;  3OR5 A;  4L0W A;  3FZA A;  3FZ5 A;  2H1G A;  1FAA A;  3EMP A;  4PUA A;  5EL8 A;  2CVB A;  2OJL A;  1TJD A;  5BRT A;  3Q19 A;  3VFI A;  1QXH A;  1WE0 A;  1YKC A;  4PNF A;  1USB A;  4ECJ A;  4X43 A;  5CAX A;  4N11 A;  6GSX A;  2LJK A;  1OVN A;  4CHS A;  1O73 A;  2YWN A;  4O92 A;  2EIR A;  2FWG A;  2R4V A;  3TOT A;  3TUE A;  5ABR A;  1BG5 A;  3F3Q A;  4BVY B;  3D0Z A;  1R5A A;  2GT5 A;  2OBK A;  3QCP A;  5ELA A;  3VWW A;  3EVI A;  1T4Y A;  2HRA A;  13GS A;  4GRF A;  1G0T A;  2N5A A;  2WFC A;  1F6M C;  3FKF A;  3A2X A;  1GSF A;  2HZF A;  5J4U A;  3BOA A;  3PIN A;  2IMK A;  4HZ4 A;  1GTU A;  3HJP A;  4Z2U A;  2YOI A;  3DWV A;  4AF2 A;  1Z9H A;  2IJY A;  4IQA A;  4OO5 A;  1M2B A;  4NPB A;  2J9H A;  5D9W A;  3DEX A;  3IXR A;  4ML1 A;  5DAK B;  4BWS A;  3ED3 A;  5F06 A;  1WRY A;  2C3T A;  5JCW A;  2LRC A;  4IS0 A;  4MH2 A;  1O81 A;  4A5P A;  1B48 A;  3LEF A;  1T8E B;  1MD4 A;  1XG8 A;  1GSQ A;  3TJG A;  4XCS A;  3HJO A;  2LEG A;  2B1L A;  1GSE A;  1U6T A;  4I6X A;  3P90 A;  3IE3 A;  3KP8 A;  3O76 A;  2PGT A;  3RAZ A;  2HYX A;  2HRK A;  5KOX A;  2J23 A;  1MTC A;  4TR3 A;  1BAY A;  2O87 A;  2P0G A;  2OKA A;  2RM5 A;  3H79 A;  3NOF A;  2H0I A;  4ECC A;  1S3C A;  2Z9S A;  2RII A;  4FYC A;  4PTS A;  5KN0 A;  4WET A;  2OE0 A;  1R26 A;  3HKR A;  1M99 A;  3EYT A;  3L9S A;  4PXO A;  3FR3 A;  1K0M A;  2FWF A;  1WOU A;  2CZ3 A;  5ELG A;  3QAV A;  5DAK A;  1EZK A;  4BWQ A;  2C0D A;  4K0N A;  3TB2 A;  1ERW A;  3CTG A;  4WBJ A;  2H76 A;  1HNA A;  4HOJ A;  4XIH A;  4XS1 A;  5IIZ A;  2QGV A;  4GXZ A;  4X4J A;  1UVZ A;  4RI6 A;  4KSO A;  2LNS A;  1JZR A;  5EY6 A;  1ABA A;  3CSH A;  5IMA A;  3APQ A;  1XWG A;  4WXT A;  4ZBA A;  4RQR A;  2H66 A;  2MMA A;  4K1F A;  3FZ9 A;  5F05 A;  5JCU A;  1A2L A;  4IKH A;  1BYE A;  1F37 A;  4OMV A;  2X4A A;  1K3O A;  3ERF A;  1ZYN A;  5AIS A;  3GV1 A;  1YY7 A;  4KCE A;  3IRA A;  5HQP A;  2OAC A;  1PX7 A;  2PMT A;  2BJX A;  3S9F A;  4TR1 B;  5J3R A;  2WRT A;  2FA4 A;  2BMX A;  2MBT A;  4KA0 A;  3RHB A;  1UA5 A;  4IJI A;  1FW1 A;  4KUN A;  2M72 A;  4G0K A;  2AYT A;  2HSH A;  3D21 A;  2D2Z A;  3MDK A;  5DQY A;  1B9Y C;  5CRG A;  1FOV A;  2MYG A;  1KNG A;  4GQC A;  2VL3 A;  2WUL A;  4V1A p;  3F9U A;  3EIN A;  9GSS A;  3FYG A;  4WEY A;  1GTB A;  1M7T A;  4EVM A;  4EF0 A;  3IHQ A;  2GS3 A;  3NIV A;  4V2N A;  1U3I A;  3W8J A;  4ZIL A;  1JZD A;  5A4W A;  1IYH A;  3GKN A;  3KXO A;  2HRF A;  3C8E A;  2AHE A;  1TRU A;  2VD1 A;  3RDW A;  22GS A;  3FK8 A;  4KB3 A;  1RW1 A;  4ZL7 A;  5DJM A;  4IP1 A;  3RPN A;  1WP0 A;  2N5B A;  2B7J A;  2FNO A;  4G10 A;  3TKQ A;  3TKS C;  5HR1 A;  3FR6 A;  5DQS A;  5IM9 A;  3TKR A;  1VF1 A;  2DSA A;  3GRX A;  3A2W A;  4LA1 A;  5GAP D;  1MD3 A;  5IO0 A;  3HCZ A;  5G2Z A;  5DDL A;  5HFI A;  3PGT A;  1PD2 1;  5L71 A;  3N9J A;  4ECB A;  1QGV A;  2GSR A;  2DJ1 A;  4BL7 B;  2E2G A;  1S3R A;  1X9S B;  18GS A;  4MDC A;  5IMF A;  2C80 A;  1GUL A;  5HR0 A;  3LW9 A;  3ZIJ A;  1GUH A;  4HZ2 A;  3UVH A;  2K8S A;  4JZQ A;  4EE0 A;  4RQX A;  1HYU A;  1GLQ A;  2M80 A;  5C00 A;  3GSS A;  2A2S A;  4HJM A;  1TK5 B;  2I81 A;  4F0C A;  3HVS A;  3DVW A;  5E4W A;  4TR0 A;  2AAW A;  3UL3 A;  2BTO T;  4BA7 A;  1WJK A;  2X64 A;  2DJ2 A;  1PSQ A;  3IC4 A;  2YNX A;  1GSU A;  2HSM A;  3BD2 A;  4ML6 A;  4HUA A;  2ALB A;  3TRP A;  3GUS A;  3GA4 A;  3DGQ A;  3A5W A;  2DML A;  3ISO A;  1A2M A;  4MP4 A;  2X8G A;  4K7I A;  2V41 A;  4JBB A;  3CRT A;  1SL0 B;  1PN9 A;  4MLY A;  4JR4 A;  4QQ7 A;  4AGS A;  2ON7 A;  2VIM A;  5AGY A;  4WF5 A;  4EIP A;  1V58 A;  1EWX A;  4XTS A;  2C8U A;  1GSY A;  4F2I A;  2QC7 A;  2QKE A;  2VCX A;  4KX4 A;  2YN1 A;  1X9M B;  2I1U A;  1K0O A;  3WT2 A;  3IOS A;  5JWO B;  3I9V 2;  2B5Y A;  1I5G A;  1R7H A;  1YDK A;  4LMW A;  2PWJ A;  3HHV A;  1HNB A;  2H19 A;  3QPM A;  4Z2R A;  4GF0 A;  3HDC A;  5DVB A;  3UOM A;  3K8N A;  3EPT A;  2LS5 A;  3CQF A;  3D6I A;  2V6K A;  3U5R E;  1PKW A;  4LL1 B;  4HU9 A;  3IK7 A;  4HEA 2;  1M2A A;  2VO4 A;  6GSU A;  3GNJ A;  2ES7 A;  3MSZ A;  4POK A;  4KGI A;  3M9J A;  5A5K A;  2MMN A;  5B8A A;  4FQU A;  2AB6 A;  1PGT A;  1YEX A;  2OA7 A;  3DKS A;  1E6B A;  1H4O A;  3TKS E;  5ECK B;  2N5F A;  4YAV A;  1K0A A;  4Q5Q A;  3ZFL A;  3GFK A;  3A2V A;  5FWG A;  3ZIT A;  5H5S A;  3KZQ A;  5CRE A;  1GNE A;  1TDI A;  1GWC A;  1B4Q A;  3RHC A;  5AN1 A;  2R0C A;  3CRU A;  1GTI A;  2EIO A;  3RPP A;  4O5R A;  1XOA A;  4YKF A;  2ON5 A;  3BCI A;  4PQH A;  1Z3E A;  1GUM A;  1XW6 A;  5D9V A;  1O6J A;  2E2M A;  1TK8 B;  1TP9 A;  3TJF A;  1YQ1 A;  4AJ8 A;  2TRC P;  3KMN A;  1N8J A;  2I9H A;  3FY7 A;  4JE1 A;  1TTZ A;  1ZYQ B;  1J9B A;  4K5R A;  3F6F A;  2EC4 A;  4PUF C;  1TK0 B;  5AIV A;  5G31 A;  4N10 A;  3HVV A;  5JCG A;  2OE1 A;  2LUS A;  3G7I A;  4PX1 A;  1EV4 A;  2JSY A;  1C72 A;  5IPH A;  1GRX A;  3GKK A;  4MZB A;  2LNT A;  2CVD A;  2R37 A;  2JZT A;  3M8N A;  2GST A;  2QA2 A;  1K0C A;  4I2T A;  4HJ2 A;  5B7C A;  5G5E A;  4ECI A;  2CQ9 A;  3GUR A;  1QFN A;  4K2X A;  3IPZ A;  4PQI A;  3ZML A;  4G0L A;  2PVO C;  3GX8 A;  5CNW A;  1FVJ A;  1J08 A;  4POB A;  5D9T A;  4DSS B;  2CAQ A;  1SJI A;  2A4H A;  2V2G A;  1O7U A;  2B7K A;  2HFD A;  1N2A A;  1PN0 A;  4EL1 A;  1GSD A;  2HSY A;  3G7J A;  1EP7 A;  1M2D A;  2IFQ A;  4FYU A;  3I6A A;  3TRX A;  1NHO A;  2RLI A;  2IMD A;  3A5I A;  5ECQ B;  3MWH A;  1AW9 A;  2H1B A;  1K0B A;  2FA8 A;  1TXX A;  4ZL9 A;  2LV3 A;  4Z7X A;  5IOW A;  4V1A g;  5ECN B;  5COH A;  1HNC A;  2OE3 A;  4YQV A;  1KTE A;  2KP2 A;  3J7Y b;  4CDO A;  5CRH A;  5B6N A;  1PL1 A;  2GSS A;  3PPU A;  2DJJ A;  1PX6 A;  1MDK A;  3E3E A;  4GWR A;  1FB0 A;  2NBS A;  5ECH B;  3H8Q A;  2GQM A;  4OWY A;  4BVX B;  2H01 A;  4IP6 A;  5GSS A;  1ZYE A;  2EIQ A;  5HFK A;  2F8F A;  1XXU A;  4IN0 A;  2X99 A;  1SD8 A;  1OYJ A;  3LFL A;  3W6G A;  4DSS A;  3DVX A;  4KDX A;  4FO5 A;  1Y25 A;  2IWT A;  2CA8 A;  3ZLP A;  2VOC A;  2YCD A;  3UAR A;  2O89 A;  2VL9 A;  2PPT A;  4GQF A;  4K6X A;  4Z2T A;  3WGD A;  2VL2 A;  3U6V A;  2RM6 A;  1M3I A;  3HZ4 A;  2NVL A;  4IQ1 A;  8GSS A;  2H0G A;  3DRN A;  1FOH A;  3CSJ A;  1T00 A;  4ZBD A;  4WBR D;  3QR6 A;  2RUF A;  2JAD A;  1PMT A;  3TJK A;  2PU9 C;  4TXV A;  5HFG A;  4MF7 A;  1SU9 A;  2PUK C;  5F07 A;  1AIU A;  1ZCP A;  3GKM A;  3TDG A;  3BJ5 A;  4NWY A;  2PER A;  4XS4 B;  1EGO A;  2B5X A;  2AV4 A;  2C3Q A;  3EU4 A;  4MA9 A;  1Z6N A;  4IBP A;  1X5E A;  4WF4 A;  6GSY A;  1VF3 A;  4MMM A;  3TOU A;  4BVX A;  4HI7 A;  3PR8 A;  2R0P A;  4I97 A;  1TU8 A;  3VPT A;  3MNG A;  3QAW A;  2IIY A;  3ZFB A;  3BBY A;  2VLV A;  5A4V A;  2LTK A;  4IW9 A;  4E8E A;  4F9Z A;  1TRV A;  3GH9 A;  4NHZ A;  4G0I A;  3HD5 A;  1V57 A;  4NV2 A;  1EGR A;  1SK1 A;  1GSS A;  4Q5F A;  3IAM 2;  2K8V A;  3L4N A;  5G30 A;  2VD0 A;  4HQS A;  5G1L A;  3F8U A;  2H6Z A;  1U3A A;  3Q74 A;  4ILF A;  4ZXG A;  3FZ4 A;  3CSI A;  4H86 A;  4POL A;  3ZL5 A;  1BX9 A;  2P5Q A;  3UEM A;  2H6Y A;  1XWA A;  2GZY A;  2CX4 A;  4ZIJ A;  2OAD A; 
#chains in the Genus database with same CATH homology
 4XS4 A;  3AY8 A;  3GST A;  3ZMK A;  1JZO A;  5ECM B;  2YJ7 A;  4AJ6 A;  1SJZ A;  2H0H A;  4MH3 A;  2H1A A;  3IDV A;  5DCH A;  3JCM L;  3PH9 A;  3FMW A;  2R5G A;  2DJK A;  5FHI A;  3H1N A;  2NPB A;  3C71 A;  1S3D A;  4XS6 A;  4MNN A;  3FR9 A;  2E7P A;  2B3S A;  1K3Y A;  2YZU A;  2R6K A;  4ACS A;  3CMI A;  4X1U A;  3VI5 A;  5ID2 A;  5KEJ A;  1YJ6 A;  1ZOF A;  3ERG A;  5D96 A;  2MBS A;  4K7N A;  4F03 A;  1X0R A;  3GYK A;  4L5L A;  1OC8 A;  4MPG A;  5J41 A;  1EP8 A;  2A2P A;  5ECL B;  3N5O A;  2X8C A;  4O5Q A;  3GIX A;  1PKZ A;  2X49 A;  2WDU A;  4JED A;  3TKS A;  5ECO B;  3GH6 A;  1EEJ A;  1U87 A;  1A23 A;  1KEB A;  1ILO A;  2CV4 A;  2DBC A;  2VM2 A;  1A0R P;  3MYD A;  4GCI A;  2H74 A;  4ULX A;  2FWE A;  1Y6E A;  2RUE A;  4KE3 A;  5IMD A;  3KM6 A;  4MF5 A;  1MDI A;  1M9B A;  1TI1 A;  5LNK e;  1EOG A;  4IHU A;  1XWK A;  1LU4 A;  4GTU A;  5DAL B;  4ISD A;  4CY8 A;  3TCO A;  4YAP A;  5HR3 A;  2HNL A;  3KGK A;  1GTA A;  2K18 A;  4HU7 A;  4OO4 A;  3MIX A;  4YH2 A;  2HLS A;  1XPV A;  1SJ6 A;  4O7H A;  1THX A;  1SKR B;  3IV4 A;  4NMU A;  4JU5 A;  2GTU A;  4D73 B;  3ZRD A;  4MPF A;  2CAI A;  1X5D A;  2JAC A;  2GZP A;  1LBK A;  3IC8 A;  3UJ1 A;  1ON4 A;  1A8L A;  2A4V A;  5INY A;  1FG4 A;  1YZX A;  2V6O A;  3QFB C;  4Q5R A;  2L59 A;  4ZBB A;  4I2U A;  2LRT A;  2QSI A;  2XC2 A;  3VI7 A;  1AQV A;  1Z6M A;  3APS A;  5ENU A;  2GLR A;  1YEP A;  4KCA A;  1AQW A;  1PRX A;  5KN1 A;  5DAL A;  4G9H A;  1R5P A;  3O3T A;  2LST A;  3TGZ A;  3GTU A;  3L9V A;  1G7E A;  1NHY A;  2K6V A;  10GS A;  1TU7 A;  4I5Q A;  4MJB A;  3P7X A;  5D93 A;  2FGX A;  1AXD A;  2WJU A;  3EMX A;  5CRW A;  1XVW A;  5D9X A;  4D73 A;  1H75 A;  2LJR A;  3F4S A;  1UN2 A;  4PUR A;  3HJM A;  4IEL A;  3M0F A;  1ST9 A;  1TW9 A;  2HZE A;  1V2A A;  3WD6 A;  12GS A;  5IOX A;  2L6D A;  3GKX A;  2H8L A;  5G5F A;  4EUY A;  4I8B A;  5A4U A;  5J9C A;  2H6X A;  4YKG A;  4CW9 A;  19GS A;  2LJA A;  1K3L A;  3HXS A;  2LQQ A;  1UC7 A;  2DKI A;  1OC9 B;  1TRW A;  3DYR A;  1X9W B;  2GQK A;  3A3T A;  2IN3 A;  1XW9 A;  3LJR A;  4J56 E;  4N0V A;  4DSQ A;  3FHK A;  4MZC A;  1FB6 A;  2L5O A;  2CT6 A;  2HI7 A;  5GZZ B;  2WS2 A;  1QK8 A;  2DLX A;  2QA1 A;  4ICY A;  2YAN A;  3LG6 A;  4LL4 B;  4DVC A;  2DKH A;  3SBC A;  1M0U A;  4EO3 A;  2YWO A;  5KN3 A;  3W8S A;  1F2E A;  2GZZ A;  4RI7 A;  1NM3 A;  4EDZ A;  4KND A;  1SEN A;  2O85 A;  1V98 A;  2DIY A;  3FW2 A;  2KP1 A;  4Q5N A;  4K0G A;  5IMC A;  3KCM A;  1GUK A;  1K0D A;  3UAP A;  4EDY A;  4V2L A;  2XBQ A;  3CBU A;  2GVP A;  2YWI A;  5DCG A;  5B6M A;  3KJY A;  2GT6 A;  2FY6 A;  3APO A;  3WYW A;  3ZTL A;  1OC9 A;  2O7K A;  3R3E A;  3TJJ A;  2VAF A;  2I4A A;  4EIQ A;  3VWU A;  2IMI A;  5AIX A;  5CRD A;  4OFN A;  3LXZ A;  2GSQ A;  3VWV A;  2IFQ B;  1DE2 A;  2B5E A;  3KMO A;  1BJX A;  1OAZ A;  1ZZY A;  2AJQ B;  5IPG A;  4KSM A;  2DC5 A;  1YF0 A;  2JSZ A;  1XWC A;  3M3M A;  1Z7P A;  1V40 A;  2XPE A;  3VPQ A;  1EEM A;  3LQ7 A;  3BCK A;  3CTF A;  2WZ9 A;  3KTL A;  1XBS A;  3G9B A;  1MDJ A;  1E2Y A;  1JZW A;  2H30 A;  3I69 A;  2LRN A;  11GS A;  5F0G A;  5IMZ A;  1IYI A;  1ML6 A;  4OCF A;  3DXB A;  1W4V A;  2L4Q A;  2DJ3 A;  1LJR A;  4MJA A;  3C1R A;  3EUR A;  2FWH A;  1JLV A;  1HQO A;  1OC3 A;  5J5N A;  2O8V B;  3KTB A;  1BED A;  1ZGN A;  5CO3 A;  1THO A;  4KDY A;  1Z7R A;  3D4M A;  3DIE A;  4AJ7 A;  4N30 A;  3FEU A;  4YQU A;  1DE1 A;  5GAN D;  3P8W A;  1YF1 A;  3LGC A;  2G0F A;  2L5L A;  1XZO A;  3E9J B;  3QMX A;  3CYN A;  1TRS A;  3GL5 A;  2NDO A;  1PL2 A;  4L0U A;  4E8H A;  5G1K A;  1OE7 A;  3ZRE A;  3IHG A;  3QOU A;  3QAG A;  2CX3 A;  1K0N A;  1O85 A;  3VK9 A;  2F9S A;  3KH9 A;  2FD3 A;  3LXT A;  4DEJ A;  4JRR A;  2HT9 A;  2K9F A;  3EU3 A;  2VL2 C;  1M9A A;  3QFA C;  2KUC A;  2H72 A;  2F8A A;  3P2A A;  3ZVJ A;  4TVE A;  1VGL A;  3TRQ A;  3O6T A;  3KP9 A;  4F82 A;  1Q4J A;  3EWL A;  3ME8 A;  3C7M A;  4HS1 A;  1MEK A;  4L8E A;  2VLU A;  2OBI A;  1J0F A;  1I9D A;  2PVQ A;  4BVY A;  3KH7 A;  2L57 A;  1PA3 A;  2PN8 A;  1GH2 A;  4ZB8 A;  2IPA A;  4EKZ A;  2YV7 A;  1RK4 A;  4MZW A;  2KLX A;  3F4R A;  1QUW A;  2ZUP A;  4YQM A;  2YJH A;  1FO5 A;  1AQX A;  3CXG A;  2DMM A;  1SYR A;  1JFU A;  4XRA A;  4OD7 A;  5J9B A;  2R2J A;  3D4T A;  1GNW A;  4QL9 A;  20GS A;  1TI3 A;  4OCE A;  4HDE A;  1WPI A;  3I43 A;  3IR4 A;  1S3A A;  2YZH A;  2VLT A;  3LYK A;  4G2E A;  4TW5 A;  4K8M A;  2VM1 A;  3KEB A;  5D8I A;  3VLN A;  1GP1 A;  1XOB A;  5ID2 B;  2ZNM A;  1EOH A;  3ME7 A;  1DUG A;  2WB9 A;  2REM A;  1BQ7 A;  1DBY A;  2H73 A;  3V1W A;  1NW2 A;  1AUC A;  4TOP A;  5EVO A;  1URM A;  2FCH A;  1B4P A;  4MAB A;  3TKP A;  3ZVJ D;  1YKA A;  1OKT A;  2FHE A;  4QL7 A;  1TKD B;  3UMA A;  2R0G A;  5ECS A;  3EE2 A;  3LSZ A;  4J2F A;  4KH7 A;  4JR6 A;  2IMF A;  7GSS A;  2B6M A;  3Q6O A;  1XW5 A;  2JU5 A;  4XRD A;  1R4W A;  2C0G A;  4TXO B;  4ZB6 A;  2CZ2 A;  4POM A;  4MK3 A;  4K2D A;  3WGX A;  1SKW B;  2G2Q A;  1CQG A;  2HRN A;  3F6D A;  4EXJ A;  1ACV A;  3NZN A;  3QD9 A;  3M1G A;  2YP6 A;  5KOW A;  2M46 A;  1SYX A;  4KDU A;  3HZ8 A;  5ECP B;  2CVK A;  1G6W A;  1A0F A;  4TR1 A;  2XPD A;  4ID0 A;  4OFM A;  1XFL A;  1T4Z A;  3US3 A;  2H75 A;  3TJB A;  1JHB A;  2VCT A;  4NV5 A;  1G7O A;  1GL8 A;  6GST A;  4N0Z A;  4TN8 A;  3L9U A;  4X0X A;  3HYP A;  5JWR B;  3LOR A;  5LCZ A;  2E0Q A;  3HA9 A;  17GS A;  4XHM A;  2F51 A;  5ECI B;  5IQY A;  4IJ3 A;  2H1D A;  3GX0 A;  3H4K A;  2MMZ A;  1HD2 A;  4TXO A;  2X8H A;  3FRC A;  2IL3 A;  1SL1 B;  1VF4 A;  2KOK A;  4FYB A;  1ZMA A;  4MJC A;  3L78 A;  3F63 A;  3GL3 A;  3QDN A;  2P5R A;  2JZR A;  5HR2 A;  4ZB9 A;  2IME A;  1XCC A;  1VRS D;  5F8B A;  3F0I A;  1T3B A;  2C4J A;  4MJE A;  4BPY A;  3GTU B;  1ZYP A;  2A2R A;  4GST A;  2UZ8 A;  5DJL A;  1PQN A;  3UIW A;  1WWJ A;  2FUG 2;  4MCU A;  2WCI A;  4KW6 A;  4L5O A;  3G7Y A;  4FH8 A;  5C04 A;  3IAS 2;  1XWB A;  3KD0 A;  1SKS B;  1WIK A;  1U88 A;  1XIY A;  5BMU A;  5IO2 A;  2XBI A;  14GS A;  4CY6 A;  1WMJ A;  4WR4 A;  1KBN A;  2VUP A;  2PBJ A;  1T1V A;  4K9Z A;  2HZE B;  2ZCT A;  1Z5Y E;  1VF2 A;  5ECR B;  2F3M A;  6GSS A;  3WT1 A;  5EPF A;  4BL7 A;  1OKD A;  4LMV A;  4NHW A;  2GQL A;  2MMO A;  2XHF A;  4KAE A;  3IK9 A;  1DSB A;  4V2M A;  3L0H A;  1TOF A;  1ZL9 A;  2L6C A;  2NTO A;  4P3Y B;  1O8W A;  3KIJ A;  1F3B A;  2TIR A;  2WGR A;  2YV9 A;  2AUV A;  3GHA A;  4GSS A;  1NSW A;  3M9K A;  2JL4 A;  2VCQ A;  2LKU A;  3ZZX A;  4GLT A;  4DSR A;  5B8B A;  3D5J A;  4J57 E;  4RUV A;  1EV9 A;  3IBH A;  3C1S A;  4HQZ A;  2C1Y A;  2P31 A;  2VCW A;  2B1K A;  6GSW A;  1Q98 A;  2FLS A;  2KHP A;  2V1M A;  2C3N A;  2VCZ A;  2V32 A;  4FIW A;  4K5S A;  3DML A;  1JLW A;  3ERW A;  4K7O A;  2R3X A;  3DD3 A;  1ERU A;  3VUR A;  4O5U A;  1FHE A;  4NAX A;  3UVT A;  4GSN A;  3RBT A;  2C0F A;  4ZL8 A;  3LYP A;  3J7Y k;  1W89 A;  1QMV A;  4G19 A;  5CYY A;  3IA1 A;  1RQM A;  4OFT A;  4O32 A;  3R2Q A;  5DBQ A;  4LLR A;  1A2J A;  4PQ1 A;  1T7P B;  4WKW A;  5H5Q A;  4EC0 A;  1V9W A;  1XVQ A;  1SK0 A;  3GMF A;  3F3R A;  1SD9 A;  2C0E A;  2HXK A;  5H5R A;  5LD0 A;  2HE3 A;  2MZC A;  1B8X A;  4USS A;  3LWA A;  1A8Y A;  3ZYW A;  3VWX A;  3UBK A;  2JZS A;  1FVK A;  2GDR A;  1ERT A;  2H70 A;  3D22 A;  2YWM A;  1GLP A;  4WR5 A;  2I3Y A;  2DJ0 A;  5GST A;  3WGE A;  3SWL A;  1OE8 A;  1A24 A;  3EC3 A;  2YPM A;  2H71 A;  3GN3 A;  3HVX A;  4IGJ A;  1AC1 A;  5CP1 A;  4TKY A;  2GGT A;  4TRX A;  1AAZ A;  4MF6 A;  5IMV A;  1F3A A;  1G6Y A;  5D73 A;  3UBL A;  6GSV A;  3F4T A;  16GS A;  2VCV A;  5KN2 A;  3C73 A;  4F0B A;  1B9X C;  3ZIV A;  3H93 A;  4NXI A;  4PNG A;  3Q18 A;  2TRX A;  1X5C A;  1SK2 A;  5E59 A;  3HY2 A;  2DIZ A;  1SL2 B;  3MAK A;  4IVF A;  1QQ2 A;  4PGT A;  5FT3 A;  1ERV A;  1CQH A;  1F9M A;  4KF9 A;  4TR4 A;  3E0U A;  2LQO A;  1O8X A;  2L4C A;  5JWQ B;  3OR5 A;  4L0W A;  3FZA A;  3FZ5 A;  2H1G A;  1FAA A;  3EMP A;  4PUA A;  5EL8 A;  2CVB A;  2OJL A;  1TJD A;  5BRT A;  3Q19 A;  3VFI A;  1QXH A;  1WE0 A;  1YKC A;  4PNF A;  1USB A;  4ECJ A;  4X43 A;  5CAX A;  4N11 A;  6GSX A;  2LJK A;  1OVN A;  4CHS A;  1O73 A;  2YWN A;  4O92 A;  2EIR A;  2FWG A;  2R4V A;  3TOT A;  3TUE A;  5ABR A;  1BG5 A;  3F3Q A;  4BVY B;  3D0Z A;  1R5A A;  2GT5 A;  2OBK A;  3QCP A;  5ELA A;  3VWW A;  3EVI A;  1T4Y A;  2HRA A;  13GS A;  4GRF A;  1G0T A;  2N5A A;  2WFC A;  1F6M C;  3FKF A;  3A2X A;  1GSF A;  2HZF A;  5J4U A;  3BOA A;  3PIN A;  2IMK A;  4HZ4 A;  1GTU A;  3HJP A;  4Z2U A;  2YOI A;  3DWV A;  4AF2 A;  1Z9H A;  2IJY A;  4IQA A;  4OO5 A;  1M2B A;  4NPB A;  2J9H A;  5D9W A;  3DEX A;  3IXR A;  4ML1 A;  5DAK B;  4BWS A;  3ED3 A;  5F06 A;  1WRY A;  2C3T A;  5JCW A;  2LRC A;  4IS0 A;  4MH2 A;  1O81 A;  4A5P A;  1B48 A;  3LEF A;  1T8E B;  1MD4 A;  1GSQ A;  3TJG A;  4XCS A;  3HJO A;  2LEG A;  2B1L A;  1GSE A;  1U6T A;  4I6X A;  3P90 A;  3IE3 A;  3KP8 A;  3O76 A;  2PGT A;  3RAZ A;  2HYX A;  2HRK A;  5KOX A;  2J23 A;  1MTC A;  4TR3 A;  1BAY A;  2O87 A;  2P0G A;  2OKA A;  2RM5 A;  3H79 A;  3NOF A;  2H0I A;  4ECC A;  1S3C A;  2Z9S A;  2RII A;  4FYC A;  4PTS A;  5KN0 A;  4WET A;  2OE0 A;  1R26 A;  3HKR A;  1M99 A;  3EYT A;  3L9S A;  4PXO A;  3FR3 A;  1K0M A;  2FWF A;  1WOU A;  2CZ3 A;  5ELG A;  3QAV A;  5DAK A;  1EZK A;  4BWQ A;  2C0D A;  4K0N A;  3TB2 A;  1ERW A;  3CTG A;  4WBJ A;  2H76 A;  1HNA A;  4HOJ A;  4XIH A;  4XS1 A;  5IIZ A;  2QGV A;  4GXZ A;  4X4J A;  1UVZ A;  4RI6 A;  4KSO A;  2LNS A;  1JZR A;  5EY6 A;  1ABA A;  3CSH A;  5IMA A;  3APQ A;  1XWG A;  4WXT A;  4ZBA A;  4RQR A;  2H66 A;  2MMA A;  4K1F A;  3FZ9 A;  5F05 A;  5JCU A;  1A2L A;  4IKH A;  1BYE A;  1F37 A;  4OMV A;  2X4A A;  1K3O A;  3ERF A;  1ZYN A;  5AIS A;  3GV1 A;  1YY7 A;  4KCE A;  3IRA A;  5HQP A;  2OAC A;  1PX7 A;  2PMT A;  2BJX A;  3S9F A;  4TR1 B;  5J3R A;  2WRT A;  2FA4 A;  2BMX A;  2MBT A;  4KA0 A;  3RHB A;  1UA5 A;  4IJI A;  1FW1 A;  4KUN A;  2M72 A;  4G0K A;  2AYT A;  2HSH A;  3D21 A;  2D2Z A;  3MDK A;  5DQY A;  1B9Y C;  5CRG A;  1FOV A;  2MYG A;  1KNG A;  4GQC A;  2VL3 A;  2WUL A;  4V1A p;  3F9U A;  3EIN A;  9GSS A;  3FYG A;  4WEY A;  1GTB A;  1M7T A;  4EVM A;  4EF0 A;  3IHQ A;  2GS3 A;  3NIV A;  4V2N A;  1U3I A;  3W8J A;  4ZIL A;  1JZD A;  5A4W A;  1IYH A;  3GKN A;  3KXO A;  2HRF A;  3C8E A;  2AHE A;  1TRU A;  2VD1 A;  3RDW A;  22GS A;  3FK8 A;  4KB3 A;  1RW1 A;  4ZL7 A;  5DJM A;  4IP1 A;  3RPN A;  1WP0 A;  2N5B A;  2B7J A;  2FNO A;  4G10 A;  3TKQ A;  3TKS C;  5HR1 A;  3FR6 A;  5DQS A;  5IM9 A;  3TKR A;  1VF1 A;  2DSA A;  3GRX A;  3A2W A;  4LA1 A;  5GAP D;  1MD3 A;  5IO0 A;  3HCZ A;  5G2Z A;  5DDL A;  5HFI A;  3PGT A;  1PD2 1;  5L71 A;  3N9J A;  4ECB A;  1QGV A;  2GSR A;  2DJ1 A;  4BL7 B;  2E2G A;  1X9S B;  18GS A;  4MDC A;  5IMF A;  2C80 A;  1GUL A;  5HR0 A;  3LW9 A;  3ZIJ A;  1GUH A;  4HZ2 A;  3UVH A;  2K8S A;  4JZQ A;  4EE0 A;  4RQX A;  1HYU A;  1GLQ A;  2M80 A;  5C00 A;  3GSS A;  2A2S A;  4HJM A;  1TK5 B;  2I81 A;  4F0C A;  3HVS A;  3DVW A;  5E4W A;  4TR0 A;  2AAW A;  3UL3 A;  2BTO T;  4BA7 A;  1WJK A;  2X64 A;  2DJ2 A;  1PSQ A;  3IC4 A;  2YNX A;  1GSU A;  2HSM A;  3BD2 A;  4ML6 A;  4HUA A;  2ALB A;  3TRP A;  3GUS A;  3GA4 A;  3DGQ A;  3A5W A;  2DML A;  3ISO A;  1A2M A;  4MP4 A;  2X8G A;  4K7I A;  2V41 A;  4JBB A;  3CRT A;  1SL0 B;  1PN9 A;  4MLY A;  4JR4 A;  4QQ7 A;  4AGS A;  2ON7 A;  2VIM A;  5AGY A;  4WF5 A;  4EIP A;  1V58 A;  1EWX A;  4XTS A;  2C8U A;  1GSY A;  4F2I A;  2QC7 A;  2QKE A;  2VCX A;  4KX4 A;  2YN1 A;  1X9M B;  2I1U A;  1K0O A;  3WT2 A;  3IOS A;  5JWO B;  3I9V 2;  2B5Y A;  1I5G A;  1R7H A;  1YDK A;  4LMW A;  2PWJ A;  3HHV A;  1HNB A;  2H19 A;  3QPM A;  4Z2R A;  4GF0 A;  3HDC A;  5DVB A;  3UOM A;  3K8N A;  3EPT A;  2LS5 A;  3D6I A;  2V6K A;  3U5R E;  1PKW A;  4LL1 B;  4HU9 A;  3IK7 A;  4HEA 2;  1M2A A;  2VO4 A;  6GSU A;  3GNJ A;  2ES7 A;  3MSZ A;  4POK A;  4KGI A;  3M9J A;  5A5K A;  2MMN A;  5B8A A;  4FQU A;  2AB6 A;  1PGT A;  1YEX A;  2OA7 A;  3DKS A;  1E6B A;  1H4O A;  3TKS E;  5ECK B;  2N5F A;  4YAV A;  1K0A A;  4Q5Q A;  3ZFL A;  3GFK A;  3A2V A;  5FWG A;  3ZIT A;  5H5S A;  3KZQ A;  5CRE A;  1GNE A;  1TDI A;  1GWC A;  1B4Q A;  3RHC A;  5AN1 A;  2R0C A;  3CRU A;  1GTI A;  2EIO A;  3RPP A;  4O5R A;  1XOA A;  4YKF A;  2ON5 A;  3BCI A;  4PQH A;  1Z3E A;  1GUM A;  1XW6 A;  5D9V A;  1O6J A;  2E2M A;  1TK8 B;  1TP9 A;  3TJF A;  1YQ1 A;  4AJ8 A;  2TRC P;  3KMN A;  1N8J A;  2I9H A;  3FY7 A;  4JE1 A;  1TTZ A;  1ZYQ B;  1J9B A;  4K5R A;  3F6F A;  2EC4 A;  4PUF C;  1TK0 B;  5AIV A;  5G31 A;  4N10 A;  3HVV A;  5JCG A;  2OE1 A;  2LUS A;  3G7I A;  4PX1 A;  1EV4 A;  2JSY A;  1C72 A;  5IPH A;  1GRX A;  3GKK A;  4MZB A;  2LNT A;  2CVD A;  2R37 A;  2JZT A;  3M8N A;  2GST A;  2QA2 A;  1K0C A;  4I2T A;  4HJ2 A;  5B7C A;  5G5E A;  4ECI A;  2CQ9 A;  3GUR A;  1QFN A;  4K2X A;  3IPZ A;  4PQI A;  3ZML A;  4G0L A;  2PVO C;  3GX8 A;  5CNW A;  1FVJ A;  1J08 A;  4POB A;  5D9T A;  4DSS B;  2CAQ A;  1SJI A;  2A4H A;  2V2G A;  1O7U A;  2B7K A;  2HFD A;  1N2A A;  1PN0 A;  4EL1 A;  1GSD A;  2HSY A;  3G7J A;  1EP7 A;  1M2D A;  2IFQ A;  4FYU A;  3I6A A;  3TRX A;  1NHO A;  2RLI A;  2IMD A;  3A5I A;  5ECQ B;  3MWH A;  1AW9 A;  2H1B A;  1K0B A;  2FA8 A;  1TXX A;  4ZL9 A;  2LV3 A;  4Z7X A;  5IOW A;  4V1A g;  5ECN B;  5COH A;  1HNC A;  2OE3 A;  4YQV A;  1KTE A;  2KP2 A;  3J7Y b;  4CDO A;  5CRH A;  5B6N A;  1PL1 A;  2GSS A;  3PPU A;  2DJJ A;  1PX6 A;  1MDK A;  3E3E A;  4GWR A;  1FB0 A;  2NBS A;  5ECH B;  3H8Q A;  2GQM A;  4OWY A;  4BVX B;  2H01 A;  4IP6 A;  5GSS A;  1ZYE A;  2EIQ A;  5HFK A;  2F8F A;  1XXU A;  4IN0 A;  2X99 A;  1SD8 A;  1OYJ A;  3LFL A;  3W6G A;  4DSS A;  3DVX A;  4KDX A;  4FO5 A;  1Y25 A;  2IWT A;  2CA8 A;  3ZLP A;  2VOC A;  2YCD A;  3UAR A;  2O89 A;  2VL9 A;  2PPT A;  4GQF A;  4K6X A;  4Z2T A;  3WGD A;  2VL2 A;  3U6V A;  2RM6 A;  3HZ4 A;  2NVL A;  4IQ1 A;  8GSS A;  2H0G A;  3DRN A;  1FOH A;  3CSJ A;  1T00 A;  4ZBD A;  4WBR D;  3QR6 A;  2RUF A;  2JAD A;  1PMT A;  3TJK A;  2PU9 C;  4TXV A;  5HFG A;  4MF7 A;  1SU9 A;  2PUK C;  5F07 A;  1AIU A;  1ZCP A;  3GKM A;  3TDG A;  3BJ5 A;  4NWY A;  2PER A;  4XS4 B;  1EGO A;  2B5X A;  2AV4 A;  2C3Q A;  3EU4 A;  4MA9 A;  1Z6N A;  4IBP A;  1X5E A;  4WF4 A;  6GSY A;  1VF3 A;  4MMM A;  3TOU A;  4BVX A;  4HI7 A;  3PR8 A;  2R0P A;  4I97 A;  1TU8 A;  3VPT A;  3MNG A;  3QAW A;  2IIY A;  3ZFB A;  3BBY A;  2VLV A;  5A4V A;  2LTK A;  4IW9 A;  4E8E A;  4F9Z A;  1TRV A;  3GH9 A;  4NHZ A;  4G0I A;  3HD5 A;  1V57 A;  4NV2 A;  1EGR A;  1SK1 A;  1GSS A;  4Q5F A;  3IAM 2;  2K8V A;  3L4N A;  5G30 A;  2VD0 A;  4HQS A;  5G1L A;  3F8U A;  2H6Z A;  1U3A A;  3Q74 A;  4ILF A;  4ZXG A;  3FZ4 A;  3CSI A;  4H86 A;  4POL A;  3ZL5 A;  1BX9 A;  2P5Q A;  3UEM A;  2H6Y A;  1XWA A;  2GZY A;  2CX4 A;  4ZIJ A;  2OAD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...