4FH8A

Crystal structure of peroxiredoxin-1 from the human hookworm ancylostoma ceylanicum
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
171
structure length
171
Chain Sequence
HMSKAFIGKPAPDFATKAVFDGDFVDVKLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSDRFPEFKNLNVAVLACSTDSVFSHLAWINTPRKHGGLGDMKIPVLADTNHQIAKDYGVLKDDEGIAYRGLFIIDPKGILRQITINDLPVGRSVDETLRLVQAFQYTDKHGEVC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords AcePrx-1
publication title Peroxiredoxin-1 from the Human Hookworm Ancylostoma ceylanicum Forms a Stable Oxidized Decamer and Is Covalently Inhibited by Conoidin A.
pubmed doi rcsb
source organism Ancylostoma ceylanicum
total genus 53
structure length 171
sequence length 171
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2012-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00578 AhpC-TSA AhpC/TSA family
A PF10417 1-cysPrx_C C-terminal domain of 1-Cys peroxiredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4fh8A00
4LMVA 1TW9A 1JZOA 4F0CA 4TN8A 5AISA 1GWCA 2LRCA 1TTZA 2H0IA 3F3RA 1XW9A 5HFIA 3J7Yk 2GLRA 5HR0A 3L4NA 3HKRA 4XS1A 4AGSA 2CZ2A 2VCZA 3EVIA 1X9WB 1NHYA 1DUGA 2R37A 4OO4A 2O85A 3HCZA 3LFLA 1ZZYA 1GSSA 3CSHA 4MP4A 1EP8A 2TRCP 2J9HA 3GRXA 1TOFA 2LJKA 1T8EB 3TOTA 3HJPA 2PPTA 4DSSB 3KEBA 4MCUA 2FA4A 2RUFA 3DWVA 1O8WA 3RPNA 1VF1A 4EXJA 5ECKB 4JEDA 1A24A 3C1SA 1GSFA 3F63A 1KNGA 3GSSA 2AUVA 1YY7A 2WZ9A 4HUAA 3IA1A 2JL4A 1BG5A 1JZWA 3CRUA 1T4YA 3VWUA 3TJFA 2L4QA 4YQVA 4NXIA 4BVYA 2B5YA 1K0AA 4O32A 3L9SA 2O89A 2JSZA 3CBUA 1AQVA 2LTKA 3IE3A 2P31A 1GSYA 1B8XA 3UVTA 1K0CA 4F0BA 3D5JA 5LD0A 5JWRB 2WB9A 2CAIA 2IFQB 2I81A 1WIKA 5INYA 1PA3A 1TK5B 3QAVA 3JCML 1YF0A 3H4KA 1WMJA 2C4JA 5HFKA 1GLPA 1XWCA 1HNCA 3LSZA 1BX9A 4EDZA 2IFQA 5DCGA 2LQQA 3VURA 2HZEB 2FGXA 4POKA 4MH2A 5F0GA 5GAND 1K3YA 5ECQB 1X9MB 1XWAA 3IOSA 2NTOA 5ELAA 4WXTA 4YH2A 2C0FA 2IPAA 5FWGA 2GGTA 2HZEA 1TKDB 3TRQA 5KN2A 3VLNA 1SYRA 2P5RA 2PUKC 4N0ZA 3EMXA 1MD4A 2K8SA 5EY6A 5DQYA 5LNKe 2HSYA 1TRWA 3RBTA 3TRXA 5ECNB 3FZAA 1GSDA 4LLRA 4D73B 3HDCA 1R26A 2B5EA 1SL0B 4TKYA 1M2AA 2HSHA 2HRFA 4WETA 1H75A 3DGQA 2H30A 5IMFA 2FHEA 2KP2A 2VL2A 4TR1A 5AIVA 4K9ZA 2CT6A 3LORA 2LJRA 1F6MC 1B4PA 3EINA 3US3A 1FB6A 5CO3A 4KE3A 3ZIVA 5F07A 5IO2A 2AB6A 4PUFC 3ZITA 4OCFA 2CVKA 1Z5YE 5G5EA 2DC5A 1F3BA 2VOCA 5CYYA 5IPGA 1TRVA 1X5EA 2QKEA 4JR6A 4L5OA 3KZQA 5IIZA 4GSNA 3DVXA 1RK4A 4J57E 4XS6A 3TKSE 3KH9A 3KCMA 3EC3A 2X99A 2LQOA 3DKSA 3HJMA 2OADA 2H73A 2JZRA 1BQ7A 2K9FA 1O7UA 2GSTA 1ZGNA 2L4CA 2MYGA 2VL2C 3DRNA 2LSTA 3FK8A 2G2QA 1G6YA 1ST9A 2GT5A 1KBNA 2NVLA 2KP1A 2IWTA 2XPEA 4ECCA 2QSIA 6GSYA 4PUAA 2YWOA 2L57A 14GSA 3L9UA 4BPYA 5H5SA 1AIUA 1SKWB 1A2LA 1WPIA 2JSYA 3D0ZA 3C7MA 5DJMA 3LGCA 4V2LA 2P0GA 4F9ZA 3EU4A 3HVSA 3HHVA 4ID0A 3S9FA 1G0TA 2HI7A 2WGRA 2H0GA 1OC9A 1A2JA 2VM2A 2FWFA 2VLVA 2R6KA 1WRYA 4FYBA 3KMNA 3U6VA 2LNTA 3KP9A 1TU8A 1I9DA 3P8WA 4YQMA 1X9SB 3ZREA 4GF0A 5GAPD 3E9JB 1V40A 3D21A 1XWKA 1U3IA 2GZZA 2I4AA 1U6TA 1XWGA 2F9SA 3QOUA 4IJ3A 5JWQB 5IPHA 1MEKA 5IMCA 1OVNA 4I5QA 4MZCA 2YN1A 2N5AA 3FR9A 19GSA 2VD1A 4PNGA 5IMVA 3F4RA 2VIMA 4HI7A 5J3RA 3A2WA 5A4VA 3ZYWA 4IQAA 2VD0A 4IJIA 1BAYA 1Z9HA 2VLTA 1M2BA 4N0VA 2DMMA 4ZXGA 2J23A 1CQGA 3QMXA 2X8HA 4JZQA 1OE8A 5ENUA 1GP1A 2V6OA 3G7YA 2DJKA 4WEYA 2M72A 4WR4A 2H8LA 1JLVA 1YF1A 2V2GA 5JCGA 5DAKB 2PERA 2M46A 3L78A 3BBYA 3DEXA 3N9JA 3DXBA 1M9BA 1K0OA 2I3YA 1AQWA 1THOA 4DSQA 3M0FA 4JBBA 1PL1A 3EURA 2I1UA 4TXOB 5C04A 1OC8A 4ZILA 3TJGA 4YAPA 3LXZA 2MMZA 5DAKA 2QGVA 2LEGA 4FYUA 2ZCTA 1QQ2A 1SD9A 2LNSA 3QCPA 3C8EA 3ZTLA 1WE0A 3HA9A 3CYNA 1ABAA 1GUMA 4FH8A 3O3TA 4MA9A 4G2EA 5EPFA 3QFAC 4I2UA 1T1VA 3E0UA 1K0BA 2Z9SA 3M9KA 1FVJA 3D4TA 3TDGA 1VGLA 3IC4A 2CQ9A 4NV5A 4ZL8A 2YNXA 1U88A 3ZRDA 4XTSA 2DSAA 2HYXA 12GSA 2PGTA 1JFUA 1MTCA 8GSSA 1BJXA 2NBSA 3F9UA 5HQPA 5CAXA 2KOKA 2ES7A 4ECIA 5ID2B 4TXVA 4HZ4A 2XBIA 1PMTA 2GZPA 4OO5A 4EO3A 1FB0A 4HDEA 1SL1B 3Q6OA 4MLYA 1VF3A 4I97A 3TRPA 1PX6A 3A5WA 5HR3A 2YWNA 1KEBA 1UN2A 2XHFA 1ML6A 2F3MA 1M2DA 1I5GA 4KCAA 3QAGA 22GSA 3IAS2 1LJRA 2A2SA 1SK0A 2B7JA 2PU9C 1XVWA 2FLSA 2V32A 2VCXA 1XIYA 3MSZA 3GX0A 5D73A 5ECSA 4GWRA 2H01A 2YOIA 1HNAA 4L0WA 5IMAA 3ERWA 4MJEA 4IBPA 4ZL9A 2YV7A 3I9V2 3D4MA 1SKRB 1THXA 5ECOB 5KN1A 5KN0A 2X8GA 4OWYA 1EV9A 4X1UA 4FO5A 5IMDA 3DMLA 5HR2A 1YZXA 2JZSA 4NPBA 2GQMA 3P7XA 4XHMA 1J08A 2H71A 2PBJA 4AF2A 2HFDA 4OFMA 5G1KA 3IXRA 1B9XC 5F06A 4EL1A 2JACA 3EYTA 2H1GA 2MBSA 1OAZA 3IK7A 4ZIJA 3BCKA 2DJ2A 2K18A 1Z7RA 4KCEA 4TW5A 2CAQA 2WFCA 2GT6A 4H86A 5E4WA 3Q74A 1V98A 4PXOA 6GSXA 2KHPA 1VRSD 3HXSA 3ZIJA 4GSSA 2AAWA 2C3NA 5CRGA 2NPBA 3FHKA 3IDVA 5D9XA 3GH6A 2YZHA 3UOMA 3CRTA 4KNDA 2VCVA 2L6CA 2N5BA 1GTBA 2WRTA 1PQNA 2EIQA 2PMTA 3KIJA 2IMEA 4RI7A 2A2RA 5F8BA 5FT3A 1B48A 1FAAA 4GSTA 1G7EA 1G7OA 1PL2A 4BA7A 3MAKA 1GUKA 1GTAA 2MMAA 2FD3A 3VK9A 1AAZA 5ABRA 3UJ1A 4PGTA 2NDOA 1ZYQB 4KAEA 5DDLA 2JU5A 4TOPA 2RIIA 1M7TA 1F9MA 3N5OA 4F03A 4MZBA 1Z3EA 5D9VA 4I2TA 3EE2A 4NAXA 3F0IA 4WR5A 1FVKA 1HD2A 5CNWA 6GSVA 3GH9A 5DBQA 4MJBA 2XBQA 2IL3A 4O7HA 1XOBA 3KXOA 4IN0A 3UBLA 4XS4B 1SJIA 1NSWA 5DALB 3WYWA 3GUSA 4IP6A 5D9TA 4N11A 1XBSA 4NV2A 2C80A 4MJCA 4PURA 3CSJA 1K0DA 4TR1B 1ZCPA 4IW9A 1N8JA 3VPQA 4Z7XA 1N2AA 4L8EA 3CSIA 4XS4A 5B8AA 1PGTA 5DALA 4ZB9A 1SU9A 3J7Yb 3C73A 3H8QA 3LYKA 1QMVA 4IKHA 2GTUA 2OJLA 3TJBA 13GSA 2LKUA 3TKSA 1ZYEA 1TRSA 2RLIA 4WBJA 5IOWA 1F37A 5ECLB 1UC7A 1AXDA 4BVXA 3ZFLA 3FW2A 2PWJA 4KB3A 1TI1A 5DVBA 1Z7PA 3GL5A 1SKSB 1A0FA 4WBRD 5AIXA 1TXXA 4MMMA 5H5QA 3ZMKA 1T4ZA 4KX4A 2TIRA 3VWXA 3UL3A 3FEUA 3L9VA 3GSTA 2E7PA 2CVBA 4IP1A 4POMA 3I6AA 3D6IA 5D9WA 3KMOA 2WS2A 3W8SA 1GSUA 3QAWA 5J5NA 2GSRA 4NWYA 2YANA 2EIRA 1A23A 3M1GA 4K8MA 1XFLA 3RAZA 4XRDA 3TKQA 4HS1A 1K0NA 5KN3A 2KUCA 3D22A 2K8VA 2YJHA 2PVOC 2JADA 3TKSC 1UVZA 3GURA 1A8YA 1SL2B 4OFNA 2JZTA 1XCCA 3CTGA 4RUVA 4K6XA 2WJUA 3KH7A 2HLSA 3E3EA 2AHEA 3LWAA 3APQA 3GTUB 1OC9B 4XIHA 2C3QA 2OKAA 2VM1A 2BJXA 2GVPA 3ZL5A 2RM5A 4KW6A 2CA8A 4GLTA 3GTUA 4TR3A 3P2AA 3KM6A 3GYKA 3DVWA 3H79A 4PX1A 2LS5A 2YPMA 3M3MA 5DCHA 2EIOA 1R7HA 4MF5A 1EGRA 4OMVA 4ZBDA 1DE2A 2GSQA 4MF6A 3RHCA 2GDRA 2L5LA 2PVQA 2KLXA 3ME7A 3BJ5A 4EF0A 3FZ5A 4KDYA 3RDWA 17GSA 2IN3A 4IS0A 1FG4A 3GV1A 3TJJA 4EC0A 3A2XA 4K0NA 2CV4A 1JHBA 3K8NA 4RQXA 2MMNA 3IRAA 3TKPA 5H5RA 1BEDA 1HQOA 3KP8A 5D93A 5CRHA 5GSTA 2C3TA 4V2NA 3I43A 3F3QA 2ZUPA 3M9JA 4EVMA 2YP6A 4AJ8A 5G5FA 1KTEA 1FHEA 4J56E 4ZB8A 3HVVA 4EDYA 3IAM2 5G1LA 1U3AA 4PQ1A 5G31A 3R2QA 2FUG2 2LRNA 2IMDA 2HRNA 2DIZA 1ERWA 3A2VA 3W6GA 4MK3A 3ME8A 4JR4A 4K7OA 3LYPA 4IQ1A 1TK8B 4OFTA 2CVDA 1OE7A 3WGEA 1S3AA 4IHUA 4XCSA 5B7CA 5EVOA 4N30A 2LV3A 4G9HA 2C8UA 4EE0A 3GA4A 18GSA 5C00A 3ERGA 1WP0A 1GULA 1C72A 3BCIA 4EKZA 4ML6A 1W4VA 1R4WA 1GTUA 1RQMA 1A8LA 4HEA2 1J0FA 4IELA 3FZ4A 2IMIA 1JLWA 6GSWA 3QDNA 3LG6A 1J9BA 4Q5QA 4LMWA 4MZWA 1OC3A 1XPVA 1T00A 3U5RE 4GCIA 1AQXA 2LRTA 4TVEA 2ON5A 1GSQA 4XRAA 1YEPA 3HY2A 3ISOA 5IOXA 3UMAA 1R5AA 1M99A 5J41A 5D8IA 1K0MA 4IVFA 2MZCA 4MH3A 4TRXA 5ECMB 1QGVA 3MNGA 1X5CA 2EC4A 3P90A 2YV9A 3IBHA 4KUNA 5B6NA 2B6MA 3LXTA 3NIVA 5A4UA 4WF4A 2H19A 3IR4A 2X64A 1GH2A 4F2IA 4QL9A 2D2ZA 4X43A 1X5DA 4V2MA 1TP9A 4I6XA 2G0FA 3TKRA 2IMFA 5JCUA 5J9CA 4ZL7A 4AJ6A 3NOFA 3GKMA 3ERFA 2RUEA 5A4WA 2DIYA 2XPDA 5JWOB 1AUCA 1FW1A 3DD3A 3F6FA 3Q19A 4DSRA 1XWBA 5GSSA 1NHOA 2HXKA 5DQSA 3FZ9A 4LA1A 3UAPA 3FYGA 5COHA 3VI5A 4ULXA 1WOUA 1ON4A 2VCTA 5HFGA 4TR4A 1V2AA 2H70A 2B7KA 3SBCA 1GNWA 4KA0A 3GNJA 2MMOA 2IMKA 3PH9A 10GSA 1SENA 3TJKA 4K1FA 5G2ZA 3BD2A 1R5PA 4POLA 2R5GA 3I69A 2DLXA 3ZVJD 2B1KA 2RM6A 3GN3A 3KTBA 4RQRA 3HVXA 5EL8A 1M9AA 1NW2A 1EV4A 1MDIA 3M8NA 3UVHA 1E2YA 3HD5A 1O73A 4CHSA 2VAFA 3UARA 4DVCA 3MDKA 3QD9A 2ZNMA 3CMIA 3EWLA 3W8JA 5E59A 1EGOA 2OACA 2H1BA 2FA8A 4HQZA 4DSSA 1FOVA 1OKTA 3F6DA 4X0XA 2FCHA 4EUYA 4NHZA 3TUEA 2V6KA 3WT1A 2DJJA 1YKAA 5ECRB 2R3XA 4N10A 2H1DA 1V58A 3VWWA 1IYIA 4ECJA 3ED3A 2VUPA 3WD6A 3F4TA 1GRXA 2VO4A 1SK2A 2R2JA 1EOGA 4MABA 3APOA 1F3AA 2H66A 1E6BA 3C71A 1K3LA 3PINA 4GQFA 4G10A 1ERTA 5ECHB 3IK9A 3ZVJA 1S3CA 1TJDA 1PRXA 7GSSA 3TGZA 3WGDA 3QPMA 3ZFBA 3IV4A 3UBKA 1T3BA 3IPZA 4ISDA 3UIWA 2L5OA 5CREA 4HJ2A 1GNEA 2H6ZA 1YQ1A 3GHAA 4F82A 3IHQA 3NZNA 4ZBBA 1DE1A 3GKNA 4JU5A 3H1NA 1MDJA 1TDIA 2GS3A 3LEFA 4J2FA 1IYHA 4GXZA 4PQIA 1HYUA 2AYTA 4O92A 2V41A 4MPGA 1A0RP 4WF5A 6GSSA 1OYJA 2PN8A 3GIXA 3GKXA 1SJZA 3G9BA 1K3OA 5ECIB 2MBTA 2E2GA 3QFBC 1LBKA 4HOJA 1LU4A 4L0UA 1XW5A 2BTOT 2H75A 2GZYA 2YCDA 2A4VA 2VL3A 5B8BA 3TB2A 2F51A 4WKWA 4TR0A 2QC7A 3HZ4A 1PSQA 2ALBA 2OBKA 4GTUA 5A5KA 1QXHA 2WDUA 2P5QA 1EWXA 2VLUA 1EP7A 4I8BA 4K2DA 1DSBA 3SWLA 4ZBAA 4ML1A 1JZRA 3F8UA 2B1LA 2M80A 3Q18A 2FWEA 20GSA 4Q5FA 1Y25A 5IM9A 4ECBA 2H1AA 1Z6MA 1GLQA 2L6DA 2C0EA 3FR6A 3TOUA 1QFNA 1ACVA 4HU7A 1RW1A 2FWHA 3VI7A 3KTLA 2HNLA 2GSSA 5AN1A 2I9HA 4JRRA 4KSOA 6GSTA 1GUHA 3GL3A 3ZZXA 4K7NA 3O76A 4GRFA 1SJ6A 3DIEA 1VF4A 2IJYA 4D73A 3EU3A 4ILFA 3RHBA 1VF2A 3HJOA 5JCWA 3ZMLA 2CX3A 3HZ8A 5J9BA 1XVQA 5AGYA 1TK0B 4BWSA 3APSA 4NMUA 2YWMA 2CX4A 4RI6A 3VFIA 4E8HA 2BMXA 4E8EA 2VCWA 2LJAA 3H93A 1GTIA 2OA7A 2HZFA 4CDOA 2R4VA 2OE0A 11GSA 2HE3A 3FY7A 4MDCA 1MD3A 4ACSA 1TU7A 1G6WA 2REMA 2V1MA 1Z6NA 4KGIA 16GSA 1X0RA 5ECPB 1YKCA 1AW9A 4QQ7A 5HR1A 1QK8A 1ILOA 4JE1A 2F8FA 2C0GA 2GQLA 3RPPA 4DEJA 4Q5NA 2DJ0A 3G7IA 2DJ3A 4LL1B 4IGJA 1U87A 3DYRA 4AJ7A 1ZOFA 3FR3A 1NM3A 4HU9A 1BYEA 4KSMA 3AY8A 2E0QA 1ERUA 3WGXA 1SYXA 1PN9A 3FKFA 9GSSA 1FO5A 1SD8A 5FHIA 2VL9A 2K6VA 4OCEA 1V9WA 1O6JA 5CRDA 2O87A 2H76A 3MWHA 2O8VB 1USBA 2OE3A 1T7PB 3GFKA 4KDXA 1WJKA 2B5XA 3QR6A 3BOAA 5GZZB 1Q4JA 2FY6A 1URMA 3ZLPA 2X8CA 3C1RA 1YJ6A 5ELGA 1AC1A 1OKDA 5G30A 2AV4A 4HZ2A 2DJ1A 1PX7A 1MDKA 2E2MA 2H6XA 4P3YB 2AJQB 4MJAA 1EEJA 4BWQA 1GL8A 3KGKA 2HT9A 2LUSA 1EOHA 3GMFA 1F2EA 3G7JA 5IMZA 5IO0A 2XC2A 2O7KA 1TI3A 5CRWA 2H72A 4FIWA 1TRUA 1O85A 3A3TA 1A2MA 3KJYA 3FRCA 3OR5A 3EMPA 2WCIA 5LCZA 2OE1A 1XW6A 4FYCA 4KH7A 1W89A 3PGTA 1PD21 4LL4B 2H6YA 2OBIA 3TCOA 2C1YA 3VWVA 3GKKA 1SK1A 2VCQA 5J4UA 1Q98A 1B4QA 4V1Ag 4V1Ap 2IIYA 2YZUA 1H4OA 2L59A 2YWIA 1UA5A 4HJMA 2CZ3A 1B9YC 2DMLA 1YEXA 2TRXA 1S3DA 4KDUA 5B6MA 2N5FA 4POBA 3UEMA 1GSEA 1O8XA 2GQKA 4GQCA 3CTFA 3HYPA 4BL7A 1EZKA 4TXOA 1O81A 2ON7A 1Y6EA 2B3SA 1V57A 4HQSA 1PKWA 4Q5RA 3CXGA 3LQ7A 1PKZA 2WULA 3PR8A 1HNBA 5F05A 3GX8A 4L5LA 2H74A 4PNFA 5CP1A 3LJRA 1ERVA 4CW9A 1ZL9A 4OD7A 3F4SA 4MPFA 2C0DA 4K0GA 3KD0A 4NHWA 4YQUA 2DBCA 1YDKA 5DJLA 6GSUA 1XXUA 3VPTA 4YAVA 3WT2A 5D96A 3L0HA 1JZDA 2FWGA 4PQHA 5KEJA 1ZMAA 5L71A 4MF7A 1QUWA 4QL7A 1XZOA 4G19A 1CQHA 2H0HA 2YJ7A 3V1WA 1DBYA 1M0UA 4ZB6A 1EEMA 5IQYA 1XOAA 4O5RA 5ID2A 1WWJA 2F8AA 4K7IA 3O6TA 2FNOA
chains in the Genus database with same CATH superfamily
4LMVA 1TW9A 1JZOA 4F0CA 4EIPA 4TN8A 5AISA 1GWCA 2LRCA 1TTZA 2H0IA 3F3RA 1XW9A 5HFIA 3J7Yk 2GLRA 5HR0A 3L4NA 3HKRA 4XS1A 4AGSA 4MNNA 2CZ2A 2VCZA 3EVIA 1X9WB 1NHYA 1DUGA 2R37A 1FOHA 4OO4A 2O85A 3HCZA 3LFLA 1ZZYA 1GSSA 3CSHA 4MP4A 1EP8A 2TRCP 2J9HA 3GRXA 1TOFA 2LJKA 1T8EB 3TOTA 3HJPA 2PPTA 4DSSB 3KEBA 4MCUA 2FA4A 2RUFA 3DWVA 1O8WA 3RPNA 1VF1A 4EXJA 5ECKB 4JEDA 1A24A 3C1SA 1GSFA 3F63A 1KNGA 3GSSA 2AUVA 1ZYPA 1YY7A 4BVYB 2WZ9A 4HUAA 3IA1A 2JL4A 1BG5A 2R0CA 2R0PA 1JZWA 3CRUA 1T4YA 3VWUA 3TJFA 2L4QA 4YQVA 4NXIA 4BVYA 2B5YA 1K0AA 4O32A 3L9SA 2O89A 2JSZA 3CBUA 1AQVA 2LTKA 3IE3A 2P31A 1GSYA 1B8XA 3UVTA 1K0CA 4F0BA 3D5JA 5LD0A 5JWRB 2WB9A 2CAIA 2IFQB 2I81A 1WIKA 5INYA 1PA3A 1TK5B 3QAVA 3JCML 1YF0A 3H4KA 1WMJA 2C4JA 5HFKA 1GLPA 1XWCA 1HNCA 3LSZA 4G0IA 1BX9A 4EDZA 2IFQA 5DCGA 2LQQA 3VURA 2HZEB 2FGXA 4POKA 4MH2A 5F0GA 5GAND 1K3YA 5ECQB 1X9MB 1XWAA 3IOSA 2NTOA 5ELAA 4WXTA 4YH2A 2C0FA 4K5SA 2IPAA 5FWGA 3IHGA 2GGTA 2HZEA 1TKDB 3TRQA 5KN2A 3VLNA 1SYRA 2P5RA 2PUKC 4N0ZA 3EMXA 1MD4A 4O5UA 2K8SA 5EY6A 5DQYA 5LNKe 2HSYA 1TRWA 3RBTA 3TRXA 5ECNB 3FZAA 1GSDA 4LLRA 4D73B 3HDCA 1R26A 2B5EA 1SL0B 4TKYA 1M2AA 2HSHA 4WETA 2HRFA 1H75A 3DGQA 2H30A 5IMFA 2FHEA 2KP2A 2VL2A 4TR1A 5AIVA 4K9ZA 2CT6A 3LORA 2LJRA 1F6MC 1B4PA 3EINA 3US3A 1ZYNA 1FB6A 5CO3A 4KE3A 3ZIVA 5F07A 5IO2A 2AB6A 4PUFC 3ZITA 4OCFA 2CVKA 1Z5YE 5G5EA 2DC5A 1F3BA 2VOCA 5CYYA 5IPGA 1TRVA 1X5EA 2QKEA 4JR6A 4L5OA 3KZQA 5IIZA 4GSNA 3DVXA 1RK4A 4J57E 4XS6A 3TKSE 3KH9A 3KCMA 3EC3A 4G0LA 2X99A 2LQOA 3DKSA 3HJMA 2OADA 2H73A 2JZRA 1BQ7A 2K9FA 1O7UA 2GSTA 1ZGNA 2L4CA 2MYGA 2VL2C 3DRNA 2LSTA 3FK8A 2G2QA 1G6YA 1ST9A 2GT5A 1KBNA 2NVLA 2KP1A 2IWTA 2XPEA 4ECCA 2QSIA 6GSYA 4PUAA 2HRKA 2YWOA 2L57A 14GSA 3L9UA 4BPYA 5H5SA 1AIUA 1SKWB 1A2LA 1WPIA 2JSYA 3D0ZA 3C7MA 5DJMA 3LGCA 2DKHA 4V2LA 2P0GA 4F9ZA 3EU4A 3HVSA 3HHVA 4ID0A 3S9FA 1G0TA 2HI7A 2WGRA 2H0GA 4Z2RA 1OC9A 1A2JA 2VM2A 2FWFA 2VLVA 3MIXA 2R6KA 1WRYA 4FYBA 3KMNA 3U6VA 2LNTA 3KP9A 1TU8A 1I9DA 3HVNA 3P8WA 4YQMA 1X9SB 3ZREA 4GF0A 5GAPD 3E9JB 4CY6A 1V40A 3D21A 1XWKA 1U3IA 2GZZA 2I4AA 1U6TA 1XWGA 2F9SA 3QOUA 4IJ3A 5JWQB 5IPHA 1MEKA 5IMCA 1OVNA 4I5QA 4MZCA 2QA1A 2YN1A 2N5AA 3FR9A 19GSA 2VD1A 4PNGA 5IMVA 3F4RA 2VIMA 4HI7A 5J3RA 3A2WA 5A4VA 3ZYWA 4IQAA 2VD0A 4IJIA 1BAYA 1Z9HA 2VLTA 1M2BA 3R3EA 4N0VA 2DMMA 4ZXGA 2J23A 1CQGA 3QMXA 2X8HA 4JZQA 1OE8A 5ENUA 1GP1A 2V6OA 3G7YA 2DJKA 4WEYA 2M72A 4WR4A 2H8LA 1JLVA 1YF1A 2V2GA 5JCGA 5DAKB 2PERA 2M46A 3L78A 3BBYA 3DEXA 3N9JA 3DXBA 1M9BA 1K0OA 2I3YA 1AQWA 1THOA 4DSQA 3M0FA 4JBBA 1PL1A 3EURA 2I1UA 4TXOB 5C04A 1OC8A 4ZILA 3TJGA 4YAPA 3LXZA 2MMZA 5DAKA 2QGVA 4YKFA 2LEGA 4FYUA 2ZCTA 1QQ2A 1SD9A 2LNSA 3QCPA 3C8EA 3ZTLA 1WE0A 3HA9A 3CYNA 1ABAA 1GUMA 4FH8A 3O3TA 4MA9A 4G2EA 5EPFA 3QFAC 4I2UA 1T1VA 3E0UA 1K0BA 2Z9SA 3M9KA 1FVJA 3D4TA 3TDGA 1VGLA 3IC4A 2CQ9A 4NV5A 4ZL8A 2YNXA 1U88A 3ZRDA 4XTSA 2DSAA 2HYXA 12GSA 2PGTA 1JFUA 1MTCA 8GSSA 1BJXA 2NBSA 3F9UA 5HQPA 5CAXA 2KOKA 2ES7A 4ECIA 5ID2B 4TXVA 4HZ4A 2XBIA 1PMTA 2GZPA 4OO5A 4EO3A 1FB0A 4HDEA 1SL1B 3Q6OA 4MLYA 1VF3A 4I97A 3TRPA 1PX6A 3A5WA 5HR3A 2YWNA 1KEBA 1UN2A 2XHFA 1ML6A 2F3MA 1M2DA 1I5GA 4KCAA 3QAGA 4EIQA 22GSA 3IAS2 1LJRA 2A2SA 1SK0A 2B7JA 2PU9C 1XVWA 2FLSA 2V32A 2VCXA 1XIYA 3MSZA 3GX0A 5D73A 5ECSA 4GWRA 2H01A 2YOIA 1HNAA 4L0WA 5IMAA 3ERWA 4MJEA 4IBPA 4ZL9A 2YV7A 3I9V2 3D4MA 1SKRB 1THXA 5ECOB 5KN1A 5KN0A 2X8GA 4OWYA 1EV9A 4X1UA 4FO5A 5IMDA 3DMLA 5HR2A 1YZXA 2JZSA 4NPBA 2GQMA 3P7XA 4XHMA 1J08A 2H71A 2PBJA 4AF2A 2HFDA 4OFMA 5G1KA 3IXRA 1B9XC 5F06A 4EL1A 2JACA 3EYTA 2H1GA 2MBSA 1OAZA 3IK7A 4ZIJA 3BCKA 2DJ2A 2K18A 1Z7RA 4KCEA 4TW5A 2CAQA 2WFCA 2GT6A 4H86A 5E4WA 3Q74A 1V98A 4PXOA 6GSXA 2KHPA 1VRSD 3HXSA 3IC8A 3ZIJA 4FQUA 4GSSA 2AAWA 2C3NA 5CRGA 2NPBA 3FHKA 3IDVA 5D9XA 3GH6A 2YZHA 3UOMA 3PPUA 3CRTA 4KNDA 2VCVA 2L6CA 2N5BA 1GTBA 2WRTA 1PQNA 2EIQA 2X4AA 2PMTA 3KIJA 5KOXA 2IMEA 4RI7A 2A2RA 5F8BA 5FT3A 1B48A 1FAAA 4GSTA 4YKGA 1G7EA 1G7OA 1PL2A 4BA7A 3MAKA 1GUKA 1GTAA 2MMAA 2FD3A 3VK9A 1AAZA 5ABRA 3UJ1A 4PGTA 2NDOA 1ZYQB 4KAEA 5DDLA 2JU5A 4TOPA 2RIIA 1M7TA 1F9MA 3N5OA 4Z2TA 4F03A 4MZBA 1Z3EA 5D9VA 4I2TA 3EE2A 4NAXA 3F0IA 4WR5A 1FVKA 1HD2A 5CNWA 6GSVA 3GH9A 5DBQA 4MJBA 2XBQA 2IL3A 4O7HA 1XOBA 3KXOA 4IN0A 3UBLA 4XS4B 1SJIA 1NSWA 5DALB 3WYWA 3GUSA 4IP6A 5D9TA 4N11A 1XBSA 4NV2A 2C80A 4MJCA 5KOWA 4PURA 3CSJA 1K0DA 4TR1B 1ZCPA 4IW9A 1N8JA 3VPQA 4Z7XA 1N2AA 4L8EA 3CSIA 4XS4A 5B8AA 1PGTA 5DALA 4ZB9A 1SU9A 3J7Yb 3C73A 3H8QA 3LYKA 1QMVA 4IKHA 2GTUA 2OJLA 3TJBA 13GSA 2LKUA 3TKSA 1ZYEA 1TRSA 2RLIA 4WBJA 5IOWA 1F37A 5ECLB 1UC7A 1AXDA 4BVXA 3ZFLA 3FW2A 2PWJA 4KB3A 1TI1A 5DVBA 1Z7PA 3GL5A 1SKSB 1A0FA 4WBRD 5AIXA 1TXXA 4MMMA 5H5QA 4HSCX 3ZMKA 1T4ZA 4KX4A 2TIRA 3VWXA 3UL3A 3FEUA 3L9VA 3GSTA 2E7PA 2CVBA 4IP1A 4POMA 3I6AA 3D6IA 5D9WA 1S3RA 1M3JA 3KMOA 2WS2A 3W8SA 1GSUA 3QAWA 5J5NA 2GSRA 4NWYA 2YANA 2EIRA 1A23A 3M1GA 4K8MA 1XFLA 3RAZA 1XG8A 4XRDA 3TKQA 4HS1A 1K0NA 5KN3A 2KUCA 3D22A 2K8VA 2YJHA 2PVOC 2JADA 3TKSC 1UVZA 3GURA 1A8YA 1SL2B 4OFNA 2JZTA 1XCCA 3CTGA 4RUVA 4K6XA 2WJUA 3KH7A 2HLSA 3E3EA 2AHEA 3LWAA 3APQA 3GTUB 2QA2A 1OC9B 4XIHA 2C3QA 2OKAA 2VM1A 2BJXA 2GVPA 3ZL5A 2RM5A 4KW6A 2CA8A 4GLTA 3GTUA 4TR3A 3P2AA 3KM6A 4ICYA 3GYKA 3DVWA 3H79A 4PX1A 2LS5A 2YPMA 3M3MA 5DCHA 4KF9A 2EIOA 1R7HA 4MF5A 1EGRA 4OMVA 4ZBDA 1DE2A 2GSQA 4MF6A 3RHCA 2GDRA 2L5LA 2PVQA 2KLXA 3ME7A 3BJ5A 4EF0A 3FZ5A 4KDYA 3RDWA 17GSA 2IN3A 4IS0A 1FG4A 3GV1A 3TJJA 4EC0A 3A2XA 4K0NA 2CV4A 1JHBA 3K8NA 4RQXA 2MMNA 3IRAA 3TKPA 5H5RA 1BEDA 1HQOA 3KP8A 5D93A 5CRHA 5GSTA 2C3TA 4V2NA 3FMWA 3I43A 3F3QA 2ZUPA 3M9JA 4EVMA 5BMUA 2YP6A 4AJ8A 5G5FA 1KTEA 1FHEA 4J56E 4ZB8A 3HVVA 4EDYA 3IAM2 5G1LA 1U3AA 4PQ1A 2HSMA 5G31A 3R2QA 2FUG2 2LRNA 2IMDA 2A4HA 2HRNA 2DIZA 1ERWA 3A2VA 3W6GA 4MK3A 3ME8A 4JR4A 4K7OA 3LYPA 4IQ1A 1TK8B 4OFTA 2CVDA 1OE7A 3WGEA 1S3AA 4IHUA 4XCSA 5B7CA 5EVOA 4N30A 2LV3A 4G9HA 2C8UA 4EE0A 3GA4A 18GSA 2X49A 5C00A 3ERGA 1WP0A 1GULA 1C72A 3BCIA 4EKZA 4ML6A 1W4VA 1R4WA 1GTUA 1RQMA 1A8LA 4HEA2 1J0FA 4IELA 3FZ4A 4A5PA 2IMIA 1JLWA 6GSWA 3QDNA 3LG6A 1J9BA 4Q5QA 4LMWA 4MZWA 1OC3A 1XPVA 1T00A 3U5RE 4GCIA 1AQXA 2LRTA 4TVEA 2ON5A 1GSQA 4XRAA 1YEPA 3HY2A 3ISOA 5IOXA 3UMAA 1R5AA 1M99A 5J41A 5D8IA 1K0MA 4IVFA 4K5RA 2MZCA 4MH3A 4TRXA 5ECMB 1QGVA 3MNGA 1X5CA 2EC4A 3P90A 2YV9A 3IBHA 4KUNA 5B6NA 4O5QA 2B6MA 3LXTA 3NIVA 5A4UA 4WF4A 2H19A 3IR4A 2X64A 1GH2A 4F2IA 4QL9A 2D2ZA 4X43A 1X5DA 4V2MA 1TP9A 4I6XA 2G0FA 3TKRA 2IMFA 5JCUA 5J9CA 4ZL7A 4AJ6A 3NOFA 3GKMA 4PTSA 3ERFA 2RUEA 5A4WA 2DIYA 2XPDA 5JWOB 1AUCA 4CY8A 1FW1A 3DD3A 3F6FA 3Q19A 4DSRA 1XWBA 5GSSA 1NHOA 2HXKA 5DQSA 3FZ9A 4LA1A 3UAPA 3FYGA 5COHA 3VI5A 4ULXA 1WOUA 1ON4A 2VCTA 5HFGA 4TR4A 1V2AA 2H70A 2B7KA 3SBCA 1GNWA 4KA0A 3GNJA 2MMOA 2IMKA 3PH9A 3EPTA 1SENA 10GSA 3TJKA 4K1FA 5G2ZA 3BD2A 1R5PA 4POLA 2R5GA 1M3IA 3I69A 2DLXA 3ZVJD 2B1KA 2RM6A 3GN3A 3KTBA 4RQRA 3HVXA 1M9AA 1NW2A 5EL8A 1EV4A 1MDIA 3M8NA 3UVHA 1E2YA 3HD5A 1O73A 4CHSA 2VAFA 3UARA 4DVCA 3MDKA 4G0KA 3QD9A 2ZNMA 3CMIA 3EWLA 3W8JA 5E59A 1EGOA 2OACA 2H1BA 2FA8A 4HQZA 4DSSA 1FOVA 1OKTA 3F6DA 4X0XA 2FCHA 4EUYA 4NHZA 3TUEA 2V6KA 3WT1A 2DJJA 1YKAA 5ECRB 2R3XA 4N10A 2H1DA 1V58A 3VWWA 1IYIA 4BIKA 4ECJA 3ED3A 4X4JA 2VUPA 3WD6A 3F4TA 1GRXA 2VO4A 1SK2A 2R2JA 1EOGA 4MABA 3LW9A 3APOA 1F3AA 3A5IA 2H66A 1E6BA 3C71A 1K3LA 3PINA 4GQFA 4G10A 1ERTA 5ECHB 3IK9A 3ZVJA 1S3CA 1TJDA 1PRXA 7GSSA 3TGZA 3WGDA 2A2PA 3QPMA 3ZFBA 3IV4A 3UBKA 1T3BA 3IPZA 4ISDA 3UIWA 2L5OA 5CREA 4HJ2A 1GNEA 2H6ZA 1YQ1A 3GHAA 4F82A 3IHQA 3NZNA 4ZBBA 1DE1A 3GKNA 4JU5A 3H1NA 1MDJA 1TDIA 2GS3A 3LEFA 4J2FA 1IYHA 4GXZA 4PQIA 1HYUA 2AYTA 4O92A 2V41A 4MPGA 1A0RP 4WF5A 6GSSA 1OYJA 2PN8A 2UZ8A 3GIXA 3GKXA 1SJZA 3G9BA 1K3OA 2R0GA 5ECIB 2MBTA 2E2GA 3QFBC 1LBKA 4HOJA 1LU4A 1PFOA 4L0UA 1XW5A 2BTOT 2H75A 2DKIA 2GZYA 2YCDA 2A4VA 2VL3A 5B8BA 3TB2A 2F51A 4WKWA 4TR0A 2QC7A 3HZ4A 1PSQA 2ALBA 2OBKA 4GTUA 5A5KA 1QXHA 2WDUA 2P5QA 1EWXA 2VLUA 1EP7A 4I8BA 4BVXB 4K2DA 1DSBA 3SWLA 4ZBAA 4ML1A 1JZRA 3F8UA 2B1LA 2M80A 3Q18A 2FWEA 20GSA 4Q5FA 1Y25A 5IM9A 4ECBA 2H1AA 1Z6MA 1GLQA 2L6DA 2C0EA 3FR6A 3TOUA 1QFNA 1ACVA 4HU7A 1RW1A 2FWHA 3VI7A 3KTLA 2HNLA 2GSSA 5AN1A 2I9HA 4JRRA 4KSOA 6GSTA 1GUHA 3GL3A 3ZZXA 4K7NA 3O76A 4GRFA 1SJ6A 3DIEA 1VF4A 2IJYA 4D73A 3EU3A 4ILFA 3RHBA 1VF2A 3HJOA 5JCWA 3ZMLA 2CX3A 3HZ8A 5J9BA 1XVQA 5AGYA 1TK0B 4BWSA 3APSA 4NMUA 2YWMA 2CX4A 4RI6A 3VFIA 4E8HA 2BMXA 4E8EA 2VCWA 2LJAA 3H93A 1GTIA 2OA7A 2HZFA 4CDOA 2R4VA 2OE0A 11GSA 2HE3A 3FY7A 4MDCA 1MD3A 4ACSA 1TU7A 1G6WA 2REMA 2V1MA 1Z6NA 4KGIA 16GSA 1X0RA 5ECPB 1YKCA 1AW9A 4QQ7A 5HR1A 1QK8A 1ILOA 4JE1A 2F8FA 2C0GA 2GQLA 3RPPA 4DEJA 4Q5NA 3MYDA 2DJ0A 3G7IA 2DJ3A 4LL1B 4IGJA 1U87A 3DYRA 4AJ7A 1ZOFA 3FR3A 1NM3A 4HU9A 1BYEA 4KSMA 3AY8A 2E0QA 1ERUA 3WGXA 1SYXA 1PN9A 3FKFA 9GSSA 1FO5A 1SD8A 5FHIA 2VL9A 2K6VA 4OCEA 1V9WA 1O6JA 5CRDA 2O87A 2H76A 3MWHA 2O8VB 1USBA 2OE3A 1T7PB 3GFKA 4KDXA 1WJKA 2B5XA 3QR6A 3BOAA 5GZZB 1Q4JA 2FY6A 1URMA 3ZLPA 2X8CA 3C1RA 1YJ6A 5ELGA 1AC1A 1OKDA 5G30A 2AV4A 4HZ2A 2DJ1A 1PX7A 1MDKA 2E2MA 2H6XA 4P3YB 4USSA 2AJQB 4MJAA 1EEJA 4BWQA 1GL8A 3KGKA 2HT9A 2LUSA 1EOHA 3GMFA 1F2EA 3G7JA 5IMZA 5IO0A 2XC2A 2O7KA 1TI3A 5CRWA 2H72A 4FIWA 1TRUA 1O85A 3A3TA 1A2MA 2HRAA 3KJYA 3FRCA 3OR5A 3EMPA 2WCIA 5LCZA 2OE1A 1XW6A 4FYCA 4KH7A 1W89A 3PGTA 1PD21 4LL4B 2H6YA 2OBIA 3TCOA 1PN0A 2C1YA 3VWVA 3GKKA 1SK1A 2VCQA 5J4UA 1Q98A 1B4QA 4V1Ag 4V1Ap 2IIYA 4Z2UA 2YZUA 4BL7B 1H4OA 2L59A 2YWIA 1UA5A 4HJMA 2CZ3A 1B9YC 2DMLA 4K2XA 1YEXA 2TRXA 1S3DA 4KDUA 5B6MA 2N5FA 4POBA 3UEMA 1GSEA 1O8XA 2GQKA 4GQCA 3CTFA 3HYPA 4BL7A 1EZKA 4TXOA 1O81A 2ON7A 1Y6EA 2B3SA 1V57A 4HQSA 1PKWA 4Q5RA 3CXGA 3LQ7A 1PKZA 2WULA 3PR8A 5BRTA 1HNBA 5F05A 3GX8A 4L5LA 2H74A 4PNFA 5CP1A 3LJRA 1ERVA 4CW9A 1ZL9A 4OD7A 3F4SA 4MPFA 2C0DA 4K0GA 3KD0A 4NHWA 4YQUA 2DBCA 1YDKA 5DJLA 6GSUA 3CQFA 1XXUA 3VPTA 4YAVA 3WT2A 5D96A 3L0HA 1JZDA 2FWGA 4PQHA 5KEJA 1ZMAA 5L71A 4MF7A 1QUWA 4QL7A 1XZOA 4G19A 1CQHA 2H0HA 2YJ7A 3V1WA 1DBYA 1M0UA 4ZB6A 1EEMA 5IQYA 1XOAA 4O5RA 5ID2A 1WWJA 2F8AA 4K7IA 3O6TA 2FNOA
chains in the Genus database with same CATH topology
4LMVA 1TW9A 1JZOA 4F0CA 4EIPA 4TN8A 5AISA 1GWCA 2LRCA 1TTZA 2H0IA 3F3RA 1XW9A 5HFIA 3J7Yk 2GLRA 5HR0A 3L4NA 3HKRA 4XS1A 4AGSA 4MNNA 2CZ2A 2VCZA 3EVIA 1X9WB 1NHYA 1DUGA 2R37A 1FOHA 4OO4A 2O85A 3HCZA 3LFLA 1ZZYA 1GSSA 3CSHA 4MP4A 1EP8A 2TRCP 2J9HA 3GRXA 1TOFA 2LJKA 1T8EB 3TOTA 3HJPA 2PPTA 4DSSB 3KEBA 4MCUA 2FA4A 2RUFA 3DWVA 1O8WA 3RPNA 1VF1A 4EXJA 5ECKB 4JEDA 1A24A 3C1SA 1GSFA 3F63A 1KNGA 3GSSA 2AUVA 1ZYPA 1YY7A 4BVYB 2WZ9A 4HUAA 3IA1A 2JL4A 1BG5A 2R0CA 2R0PA 1JZWA 3CRUA 1T4YA 3VWUA 3TJFA 2L4QA 4YQVA 4NXIA 4BVYA 2B5YA 1K0AA 4O32A 3L9SA 2O89A 2JSZA 3CBUA 1AQVA 2LTKA 3IE3A 2P31A 1GSYA 1B8XA 3UVTA 1K0CA 4F0BA 3D5JA 5LD0A 5JWRB 2WB9A 2CAIA 2IFQB 2I81A 1WIKA 5INYA 1PA3A 1TK5B 3QAVA 3JCML 1YF0A 3H4KA 1WMJA 2C4JA 5HFKA 1GLPA 1XWCA 1HNCA 3LSZA 4G0IA 1BX9A 4EDZA 2IFQA 5DCGA 2LQQA 3VURA 2HZEB 2FGXA 4POKA 4MH2A 5F0GA 5GAND 1K3YA 5ECQB 1X9MB 1XWAA 3IOSA 2NTOA 5ELAA 4WXTA 4YH2A 2C0FA 4K5SA 2IPAA 5FWGA 3IHGA 2GGTA 2HZEA 1TKDB 3TRQA 5KN2A 3VLNA 1SYRA 2P5RA 2PUKC 4N0ZA 3EMXA 1MD4A 4O5UA 2K8SA 5EY6A 5DQYA 5LNKe 2HSYA 1TRWA 3RBTA 3TRXA 5ECNB 3FZAA 1GSDA 4LLRA 4D73B 3HDCA 1R26A 2B5EA 1SL0B 4TKYA 1M2AA 2HSHA 4WETA 2HRFA 1H75A 3DGQA 2H30A 5IMFA 2FHEA 2KP2A 2VL2A 4TR1A 5AIVA 4K9ZA 2CT6A 3LORA 2LJRA 1F6MC 1B4PA 3EINA 3US3A 1ZYNA 1FB6A 5CO3A 4KE3A 3ZIVA 5F07A 5IO2A 2AB6A 4PUFC 3ZITA 4OCFA 2CVKA 1Z5YE 5G5EA 2DC5A 1F3BA 2VOCA 5CYYA 5IPGA 1TRVA 1X5EA 2QKEA 4JR6A 4L5OA 3KZQA 5IIZA 4GSNA 3DVXA 1RK4A 4J57E 4XS6A 3TKSE 3KH9A 3KCMA 3EC3A 4G0LA 2X99A 2LQOA 3DKSA 3HJMA 2OADA 2H73A 2JZRA 1BQ7A 2K9FA 1O7UA 2GSTA 1ZGNA 2L4CA 2MYGA 2VL2C 3DRNA 2LSTA 3FK8A 2G2QA 1G6YA 1ST9A 2GT5A 1KBNA 2NVLA 2KP1A 2IWTA 2XPEA 4ECCA 2QSIA 6GSYA 4PUAA 2HRKA 2YWOA 2L57A 14GSA 3L9UA 4BPYA 5H5SA 1AIUA 1SKWB 1A2LA 1WPIA 2JSYA 3D0ZA 3C7MA 5DJMA 3LGCA 2DKHA 4V2LA 2P0GA 4F9ZA 3EU4A 3HVSA 3HHVA 4ID0A 3S9FA 1G0TA 2HI7A 2WGRA 2H0GA 4Z2RA 1OC9A 1A2JA 2VM2A 2FWFA 2VLVA 3MIXA 2R6KA 1WRYA 4FYBA 3KMNA 3U6VA 2LNTA 3KP9A 1TU8A 1I9DA 3P8WA 4YQMA 1X9SB 3ZREA 4GF0A 5GAPD 3E9JB 4CY6A 1V40A 3D21A 1XWKA 1U3IA 2GZZA 2I4AA 1U6TA 1XWGA 2F9SA 3QOUA 4IJ3A 5JWQB 5IPHA 1MEKA 5IMCA 1OVNA 4I5QA 4MZCA 2QA1A 2YN1A 2N5AA 3FR9A 19GSA 2VD1A 4PNGA 5IMVA 3F4RA 2VIMA 4HI7A 5J3RA 3A2WA 5A4VA 3ZYWA 4IQAA 2VD0A 4IJIA 1BAYA 1Z9HA 2VLTA 1M2BA 3R3EA 4N0VA 2DMMA 4ZXGA 2J23A 1CQGA 3QMXA 2X8HA 4JZQA 1OE8A 5ENUA 1GP1A 2V6OA 3G7YA 2DJKA 4WEYA 2M72A 4WR4A 2H8LA 1JLVA 1YF1A 2V2GA 5JCGA 5DAKB 2PERA 2M46A 3L78A 3BBYA 3DEXA 3N9JA 3DXBA 1M9BA 1K0OA 2I3YA 1AQWA 1THOA 4DSQA 3M0FA 4JBBA 1PL1A 3EURA 2I1UA 4TXOB 5C04A 1OC8A 4ZILA 3TJGA 4YAPA 3LXZA 2MMZA 5DAKA 2QGVA 4YKFA 2LEGA 4FYUA 2ZCTA 1QQ2A 1SD9A 2LNSA 3QCPA 3C8EA 3ZTLA 1WE0A 3HA9A 3CYNA 1ABAA 1GUMA 4FH8A 3O3TA 4MA9A 4G2EA 5EPFA 3QFAC 4I2UA 1T1VA 3E0UA 1K0BA 2Z9SA 3M9KA 1FVJA 3D4TA 3TDGA 1VGLA 3IC4A 2CQ9A 4NV5A 4ZL8A 2YNXA 1U88A 3ZRDA 4XTSA 2DSAA 2HYXA 12GSA 2PGTA 1JFUA 1MTCA 8GSSA 1BJXA 2NBSA 3F9UA 5HQPA 5CAXA 2KOKA 2ES7A 4ECIA 5ID2B 4TXVA 4HZ4A 2XBIA 1PMTA 2GZPA 4OO5A 4EO3A 1FB0A 4HDEA 1SL1B 3Q6OA 4MLYA 1VF3A 4I97A 3TRPA 1PX6A 3A5WA 5HR3A 2YWNA 1KEBA 1UN2A 2XHFA 1ML6A 2F3MA 1M2DA 1I5GA 4KCAA 3QAGA 4EIQA 22GSA 3IAS2 1LJRA 2A2SA 1SK0A 2B7JA 2PU9C 1XVWA 2FLSA 2V32A 2VCXA 1XIYA 3MSZA 3GX0A 5D73A 5ECSA 4GWRA 2H01A 2YOIA 1HNAA 4L0WA 5IMAA 3ERWA 4MJEA 4IBPA 4ZL9A 2YV7A 3I9V2 3D4MA 1SKRB 1THXA 5ECOB 5KN1A 5KN0A 2X8GA 4OWYA 1EV9A 4X1UA 4FO5A 5IMDA 3DMLA 5HR2A 1YZXA 2JZSA 4NPBA 2GQMA 3P7XA 4XHMA 1J08A 2H71A 2PBJA 4AF2A 2HFDA 4OFMA 5G1KA 3IXRA 1B9XC 5F06A 4EL1A 2JACA 3EYTA 2H1GA 2MBSA 1OAZA 3IK7A 4ZIJA 3BCKA 2DJ2A 2K18A 1Z7RA 4KCEA 4TW5A 2CAQA 2WFCA 2GT6A 4H86A 5E4WA 3Q74A 1V98A 4PXOA 6GSXA 2KHPA 1VRSD 3HXSA 3IC8A 3ZIJA 4FQUA 4GSSA 2AAWA 2C3NA 5CRGA 2NPBA 3FHKA 3IDVA 5D9XA 3GH6A 2YZHA 3UOMA 3PPUA 3CRTA 4KNDA 2VCVA 2L6CA 2N5BA 1GTBA 2WRTA 1PQNA 2EIQA 2X4AA 2PMTA 3KIJA 5KOXA 2IMEA 4RI7A 2A2RA 5F8BA 5FT3A 1B48A 1FAAA 4GSTA 4YKGA 1G7EA 1G7OA 1PL2A 4BA7A 3MAKA 1GUKA 1GTAA 2MMAA 2FD3A 3VK9A 1AAZA 5ABRA 3UJ1A 4PGTA 2NDOA 1ZYQB 4KAEA 5DDLA 2JU5A 4TOPA 2RIIA 1M7TA 1F9MA 3N5OA 4Z2TA 4F03A 4MZBA 1Z3EA 5D9VA 4I2TA 3EE2A 4NAXA 3F0IA 4WR5A 1FVKA 1HD2A 5CNWA 6GSVA 3GH9A 5DBQA 4MJBA 2XBQA 2IL3A 4O7HA 1XOBA 3KXOA 4IN0A 3UBLA 4XS4B 1SJIA 1NSWA 5DALB 3WYWA 3GUSA 4IP6A 5D9TA 4N11A 1XBSA 4NV2A 2C80A 4MJCA 5KOWA 4PURA 3CSJA 1K0DA 4TR1B 1ZCPA 4IW9A 1N8JA 3VPQA 4Z7XA 1N2AA 4L8EA 3CSIA 4XS4A 5B8AA 1PGTA 5DALA 4ZB9A 1SU9A 3J7Yb 3C73A 3H8QA 3LYKA 1QMVA 4IKHA 2GTUA 2OJLA 3TJBA 13GSA 2LKUA 3TKSA 1ZYEA 1TRSA 2RLIA 4WBJA 5IOWA 1F37A 5ECLB 1UC7A 1AXDA 4BVXA 3ZFLA 3FW2A 2PWJA 4KB3A 1TI1A 5DVBA 1Z7PA 3GL5A 1SKSB 1A0FA 4WBRD 5AIXA 1TXXA 4MMMA 5H5QA 3ZMKA 1T4ZA 4KX4A 2TIRA 3VWXA 3UL3A 3FEUA 3L9VA 3GSTA 2E7PA 2CVBA 4IP1A 4POMA 3I6AA 3D6IA 5D9WA 3KMOA 2WS2A 3W8SA 1GSUA 3QAWA 5J5NA 2GSRA 4NWYA 2YANA 2EIRA 1A23A 3M1GA 4K8MA 1XFLA 3RAZA 4XRDA 3TKQA 4HS1A 1K0NA 5KN3A 2KUCA 3D22A 2K8VA 2YJHA 2PVOC 2JADA 3TKSC 1UVZA 3GURA 1A8YA 1SL2B 4OFNA 2JZTA 1XCCA 3CTGA 4RUVA 4K6XA 2WJUA 3KH7A 2HLSA 3E3EA 2AHEA 3LWAA 3APQA 3GTUB 2QA2A 1OC9B 4XIHA 2C3QA 2OKAA 2VM1A 2BJXA 2GVPA 3ZL5A 2RM5A 4KW6A 2CA8A 4GLTA 3GTUA 4TR3A 3P2AA 3KM6A 4ICYA 3GYKA 3DVWA 3H79A 4PX1A 2LS5A 2YPMA 3M3MA 5DCHA 4KF9A 2EIOA 1R7HA 4MF5A 1EGRA 4OMVA 4ZBDA 1DE2A 2GSQA 4MF6A 3RHCA 2GDRA 2L5LA 2PVQA 2KLXA 3ME7A 3BJ5A 4EF0A 3FZ5A 4KDYA 3RDWA 17GSA 2IN3A 4IS0A 1FG4A 3GV1A 3TJJA 4EC0A 3A2XA 4K0NA 2CV4A 1JHBA 3K8NA 4RQXA 2MMNA 3IRAA 3TKPA 5H5RA 1BEDA 1HQOA 3KP8A 5D93A 5CRHA 5GSTA 2C3TA 4V2NA 3FMWA 3I43A 3F3QA 2ZUPA 3M9JA 4EVMA 5BMUA 2YP6A 4AJ8A 5G5FA 1KTEA 1FHEA 4J56E 4ZB8A 3HVVA 4EDYA 3IAM2 5G1LA 1U3AA 4PQ1A 2HSMA 5G31A 3R2QA 2FUG2 2LRNA 2IMDA 2A4HA 2HRNA 2DIZA 1ERWA 3A2VA 3W6GA 4MK3A 3ME8A 4JR4A 4K7OA 3LYPA 4IQ1A 1TK8B 4OFTA 2CVDA 1OE7A 3WGEA 1S3AA 4IHUA 4XCSA 5B7CA 5EVOA 4N30A 2LV3A 4G9HA 2C8UA 4EE0A 3GA4A 18GSA 2X49A 5C00A 3ERGA 1WP0A 1GULA 1C72A 3BCIA 4EKZA 4ML6A 1W4VA 1R4WA 1GTUA 1RQMA 1A8LA 4HEA2 1J0FA 4IELA 3FZ4A 4A5PA 2IMIA 1JLWA 6GSWA 3QDNA 3LG6A 1J9BA 4Q5QA 4LMWA 4MZWA 1OC3A 1XPVA 1T00A 3U5RE 4GCIA 1AQXA 2LRTA 4TVEA 2ON5A 1GSQA 4XRAA 1YEPA 3HY2A 3ISOA 5IOXA 3UMAA 1R5AA 1M99A 5J41A 5D8IA 1K0MA 4IVFA 4K5RA 2MZCA 4MH3A 4TRXA 5ECMB 1QGVA 3MNGA 1X5CA 2EC4A 3P90A 2YV9A 3IBHA 4KUNA 5B6NA 4O5QA 2B6MA 3LXTA 3NIVA 5A4UA 4WF4A 2H19A 3IR4A 2X64A 1GH2A 4F2IA 4QL9A 2D2ZA 4X43A 1X5DA 4V2MA 1TP9A 4I6XA 2G0FA 3TKRA 2IMFA 5JCUA 5J9CA 4ZL7A 4AJ6A 3NOFA 3GKMA 4PTSA 3ERFA 2RUEA 5A4WA 2DIYA 2XPDA 5JWOB 1AUCA 4CY8A 1FW1A 3DD3A 3F6FA 3Q19A 4DSRA 1XWBA 5GSSA 1NHOA 2HXKA 5DQSA 3FZ9A 4LA1A 3UAPA 3FYGA 5COHA 3VI5A 4ULXA 1WOUA 1ON4A 2VCTA 5HFGA 4TR4A 1V2AA 2H70A 2B7KA 3SBCA 1GNWA 4KA0A 3GNJA 2MMOA 2IMKA 3PH9A 3EPTA 1SENA 10GSA 3TJKA 4K1FA 5G2ZA 3BD2A 1R5PA 4POLA 2R5GA 3I69A 2DLXA 3ZVJD 2B1KA 2RM6A 3GN3A 3KTBA 4RQRA 3HVXA 1M9AA 1NW2A 5EL8A 1EV4A 1MDIA 3M8NA 3UVHA 1E2YA 3HD5A 1O73A 4CHSA 2VAFA 3UARA 4DVCA 3MDKA 4G0KA 3QD9A 2ZNMA 3CMIA 3EWLA 3W8JA 5E59A 1EGOA 2OACA 2H1BA 2FA8A 4HQZA 4DSSA 1FOVA 1OKTA 3F6DA 4X0XA 2FCHA 4EUYA 4NHZA 3TUEA 2V6KA 3WT1A 2DJJA 1YKAA 5ECRB 2R3XA 4N10A 2H1DA 1V58A 3VWWA 1IYIA 4ECJA 3ED3A 4X4JA 2VUPA 3WD6A 3F4TA 1GRXA 2VO4A 1SK2A 2R2JA 1EOGA 4MABA 3LW9A 3APOA 1F3AA 3A5IA 2H66A 1E6BA 3C71A 1K3LA 3PINA 4GQFA 4G10A 1ERTA 5ECHB 3IK9A 3ZVJA 1S3CA 1TJDA 1PRXA 7GSSA 3TGZA 3WGDA 2A2PA 3QPMA 3ZFBA 3IV4A 3UBKA 1T3BA 3IPZA 4ISDA 3UIWA 2L5OA 5CREA 4HJ2A 1GNEA 2H6ZA 1YQ1A 3GHAA 4F82A 3IHQA 3NZNA 4ZBBA 1DE1A 3GKNA 4JU5A 3H1NA 1MDJA 1TDIA 2GS3A 3LEFA 4J2FA 1IYHA 4GXZA 4PQIA 1HYUA 2AYTA 4O92A 2V41A 4MPGA 1A0RP 4WF5A 6GSSA 1OYJA 2PN8A 2UZ8A 3GIXA 3GKXA 1SJZA 3G9BA 1K3OA 2R0GA 5ECIB 2MBTA 2E2GA 3QFBC 1LBKA 4HOJA 1LU4A 4L0UA 1XW5A 2BTOT 2H75A 2DKIA 2GZYA 2YCDA 2A4VA 2VL3A 5B8BA 3TB2A 2F51A 4WKWA 4TR0A 2QC7A 3HZ4A 1PSQA 2ALBA 2OBKA 4GTUA 5A5KA 1QXHA 2WDUA 2P5QA 1EWXA 2VLUA 1EP7A 4I8BA 4BVXB 4K2DA 1DSBA 3SWLA 4ZBAA 4ML1A 1JZRA 3F8UA 2B1LA 2M80A 3Q18A 2FWEA 20GSA 4Q5FA 1Y25A 5IM9A 4ECBA 2H1AA 1Z6MA 1GLQA 2L6DA 2C0EA 3FR6A 3TOUA 1QFNA 1ACVA 4HU7A 1RW1A 2FWHA 3VI7A 3KTLA 2HNLA 2GSSA 5AN1A 2I9HA 4JRRA 4KSOA 6GSTA 1GUHA 3GL3A 3ZZXA 4K7NA 3O76A 4GRFA 1SJ6A 3DIEA 1VF4A 2IJYA 4D73A 3EU3A 4ILFA 3RHBA 1VF2A 3HJOA 5JCWA 3ZMLA 2CX3A 3HZ8A 5J9BA 1XVQA 5AGYA 1TK0B 4BWSA 3APSA 4NMUA 2YWMA 2CX4A 4RI6A 3VFIA 4E8HA 2BMXA 4E8EA 2VCWA 2LJAA 3H93A 1GTIA 2OA7A 2HZFA 4CDOA 2R4VA 2OE0A 11GSA 2HE3A 3FY7A 4MDCA 1MD3A 4ACSA 1TU7A 1G6WA 2REMA 2V1MA 1Z6NA 4KGIA 16GSA 1X0RA 5ECPB 1YKCA 1AW9A 4QQ7A 5HR1A 1QK8A 1ILOA 4JE1A 2F8FA 2C0GA 2GQLA 3RPPA 4DEJA 4Q5NA 3MYDA 2DJ0A 3G7IA 2DJ3A 4LL1B 4IGJA 1U87A 3DYRA 4AJ7A 1ZOFA 3FR3A 1NM3A 4HU9A 1BYEA 4KSMA 3AY8A 2E0QA 1ERUA 3WGXA 1SYXA 1PN9A 3FKFA 9GSSA 1FO5A 1SD8A 5FHIA 2VL9A 2K6VA 4OCEA 1V9WA 1O6JA 5CRDA 2O87A 2H76A 3MWHA 2O8VB 1USBA 2OE3A 1T7PB 3GFKA 4KDXA 1WJKA 2B5XA 3QR6A 3BOAA 5GZZB 1Q4JA 2FY6A 1URMA 3ZLPA 2X8CA 3C1RA 1YJ6A 5ELGA 1AC1A 1OKDA 5G30A 2AV4A 4HZ2A 2DJ1A 1PX7A 1MDKA 2E2MA 2H6XA 4P3YB 4USSA 2AJQB 4MJAA 1EEJA 4BWQA 1GL8A 3KGKA 2HT9A 2LUSA 1EOHA 3GMFA 1F2EA 3G7JA 5IMZA 5IO0A 2XC2A 2O7KA 1TI3A 5CRWA 2H72A 4FIWA 1TRUA 1O85A 3A3TA 1A2MA 2HRAA 3KJYA 3FRCA 3OR5A 3EMPA 2WCIA 5LCZA 2OE1A 1XW6A 4FYCA 4KH7A 1W89A 3PGTA 1PD21 4LL4B 2H6YA 2OBIA 3TCOA 1PN0A 2C1YA 3VWVA 3GKKA 1SK1A 2VCQA 5J4UA 1Q98A 1B4QA 4V1Ag 4V1Ap 2IIYA 4Z2UA 2YZUA 4BL7B 1H4OA 2L59A 2YWIA 1UA5A 4HJMA 2CZ3A 1B9YC 2DMLA 4K2XA 1YEXA 2TRXA 1S3DA 4KDUA 5B6MA 2N5FA 4POBA 3UEMA 1GSEA 1O8XA 2GQKA 4GQCA 3CTFA 3HYPA 4BL7A 1EZKA 4TXOA 1O81A 2ON7A 1Y6EA 2B3SA 1V57A 4HQSA 1PKWA 4Q5RA 3CXGA 3LQ7A 1PKZA 2WULA 3PR8A 5BRTA 1HNBA 5F05A 3GX8A 4L5LA 2H74A 4PNFA 5CP1A 3LJRA 1ERVA 4CW9A 1ZL9A 4OD7A 3F4SA 4MPFA 2C0DA 4K0GA 3KD0A 4NHWA 4YQUA 2DBCA 1YDKA 5DJLA 6GSUA 1XXUA 3VPTA 4YAVA 3WT2A 5D96A 3L0HA 1JZDA 2FWGA 4PQHA 5KEJA 1ZMAA 5L71A 4MF7A 1QUWA 4QL7A 1XZOA 4G19A 1CQHA 2H0HA 2YJ7A 3V1WA 1DBYA 1M0UA 4ZB6A 1EEMA 5IQYA 1XOAA 4O5RA 5ID2A 1WWJA 2F8AA 4K7IA 3O6TA 2FNOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LMV A;  1TW9 A;  1JZO A;  4F0C A;  4TN8 A;  5AIS A;  1GWC A;  2LRC A;  1TTZ A;  2H0I A;  3F3R A;  1XW9 A;  5HFI A;  3J7Y k;  2GLR A;  5HR0 A;  3L4N A;  3HKR A;  4XS1 A;  4AGS A;  2CZ2 A;  2VCZ A;  3EVI A;  1X9W B;  1NHY A;  1DUG A;  2R37 A;  4OO4 A;  2O85 A;  3HCZ A;  3LFL A;  1ZZY A;  1GSS A;  3CSH A;  4MP4 A;  1EP8 A;  2TRC P;  2J9H A;  3GRX A;  1TOF A;  2LJK A;  1T8E B;  3TOT A;  3HJP A;  2PPT A;  4DSS B;  3KEB A;  4MCU A;  2FA4 A;  2RUF A;  3DWV A;  1O8W A;  3RPN A;  1VF1 A;  4EXJ A;  5ECK B;  4JED A;  1A24 A;  3C1S A;  1GSF A;  3F63 A;  1KNG A;  3GSS A;  2AUV A;  1YY7 A;  2WZ9 A;  4HUA A;  3IA1 A;  2JL4 A;  1BG5 A;  1JZW A;  3CRU A;  1T4Y A;  3VWU A;  3TJF A;  2L4Q A;  4YQV A;  4NXI A;  4BVY A;  2B5Y A;  1K0A A;  4O32 A;  3L9S A;  2O89 A;  2JSZ A;  3CBU A;  1AQV A;  2LTK A;  3IE3 A;  2P31 A;  1GSY A;  1B8X A;  3UVT A;  1K0C A;  4F0B A;  3D5J A;  5LD0 A;  5JWR B;  2WB9 A;  2CAI A;  2IFQ B;  2I81 A;  1WIK A;  5INY A;  1PA3 A;  1TK5 B;  3QAV A;  3JCM L;  1YF0 A;  3H4K A;  1WMJ A;  2C4J A;  5HFK A;  1GLP A;  1XWC A;  1HNC A;  3LSZ A;  1BX9 A;  4EDZ A;  2IFQ A;  5DCG A;  2LQQ A;  3VUR A;  2HZE B;  2FGX A;  4POK A;  4MH2 A;  5F0G A;  5GAN D;  1K3Y A;  5ECQ B;  1X9M B;  1XWA A;  3IOS A;  2NTO A;  5ELA A;  4WXT A;  4YH2 A;  2C0F A;  2IPA A;  5FWG A;  2GGT A;  2HZE A;  1TKD B;  3TRQ A;  5KN2 A;  3VLN A;  1SYR A;  2P5R A;  2PUK C;  4N0Z A;  3EMX A;  1MD4 A;  2K8S A;  5EY6 A;  5DQY A;  5LNK e;  2HSY A;  1TRW A;  3RBT A;  3TRX A;  5ECN B;  3FZA A;  1GSD A;  4LLR A;  4D73 B;  3HDC A;  1R26 A;  2B5E A;  1SL0 B;  4TKY A;  1M2A A;  2HSH A;  2HRF A;  4WET A;  1H75 A;  3DGQ A;  2H30 A;  5IMF A;  2FHE A;  2KP2 A;  2VL2 A;  4TR1 A;  5AIV A;  4K9Z A;  2CT6 A;  3LOR A;  2LJR A;  1F6M C;  1B4P A;  3EIN A;  3US3 A;  1FB6 A;  5CO3 A;  4KE3 A;  3ZIV A;  5F07 A;  5IO2 A;  2AB6 A;  4PUF C;  3ZIT A;  4OCF A;  2CVK A;  1Z5Y E;  5G5E A;  2DC5 A;  1F3B A;  2VOC A;  5CYY A;  5IPG A;  1TRV A;  1X5E A;  2QKE A;  4JR6 A;  4L5O A;  3KZQ A;  5IIZ A;  4GSN A;  3DVX A;  1RK4 A;  4J57 E;  4XS6 A;  3TKS E;  3KH9 A;  3KCM A;  3EC3 A;  2X99 A;  2LQO A;  3DKS A;  3HJM A;  2OAD A;  2H73 A;  2JZR A;  1BQ7 A;  2K9F A;  1O7U A;  2GST A;  1ZGN A;  2L4C A;  2MYG A;  2VL2 C;  3DRN A;  2LST A;  3FK8 A;  2G2Q A;  1G6Y A;  1ST9 A;  2GT5 A;  1KBN A;  2NVL A;  2KP1 A;  2IWT A;  2XPE A;  4ECC A;  2QSI A;  6GSY A;  4PUA A;  2YWO A;  2L57 A;  14GS A;  3L9U A;  4BPY A;  5H5S A;  1AIU A;  1SKW B;  1A2L A;  1WPI A;  2JSY A;  3D0Z A;  3C7M A;  5DJM A;  3LGC A;  4V2L A;  2P0G A;  4F9Z A;  3EU4 A;  3HVS A;  3HHV A;  4ID0 A;  3S9F A;  1G0T A;  2HI7 A;  2WGR A;  2H0G A;  1OC9 A;  1A2J A;  2VM2 A;  2FWF A;  2VLV A;  2R6K A;  1WRY A;  4FYB A;  3KMN A;  3U6V A;  2LNT A;  3KP9 A;  1TU8 A;  1I9D A;  3P8W A;  4YQM A;  1X9S B;  3ZRE A;  4GF0 A;  5GAP D;  3E9J B;  1V40 A;  3D21 A;  1XWK A;  1U3I A;  2GZZ A;  2I4A A;  1U6T A;  1XWG A;  2F9S A;  3QOU A;  4IJ3 A;  5JWQ B;  5IPH A;  1MEK A;  5IMC A;  1OVN A;  4I5Q A;  4MZC A;  2YN1 A;  2N5A A;  3FR9 A;  19GS A;  2VD1 A;  4PNG A;  5IMV A;  3F4R A;  2VIM A;  4HI7 A;  5J3R A;  3A2W A;  5A4V A;  3ZYW A;  4IQA A;  2VD0 A;  4IJI A;  1BAY A;  1Z9H A;  2VLT A;  1M2B A;  4N0V A;  2DMM A;  4ZXG A;  2J23 A;  1CQG A;  3QMX A;  2X8H A;  4JZQ A;  1OE8 A;  5ENU A;  1GP1 A;  2V6O A;  3G7Y A;  2DJK A;  4WEY A;  2M72 A;  4WR4 A;  2H8L A;  1JLV A;  1YF1 A;  2V2G A;  5JCG A;  5DAK B;  2PER A;  2M46 A;  3L78 A;  3BBY A;  3DEX A;  3N9J A;  3DXB A;  1M9B A;  1K0O A;  2I3Y A;  1AQW A;  1THO A;  4DSQ A;  3M0F A;  4JBB A;  1PL1 A;  3EUR A;  2I1U A;  4TXO B;  5C04 A;  1OC8 A;  4ZIL A;  3TJG A;  4YAP A;  3LXZ A;  2MMZ A;  5DAK A;  2QGV A;  2LEG A;  4FYU A;  2ZCT A;  1QQ2 A;  1SD9 A;  2LNS A;  3QCP A;  3C8E A;  3ZTL A;  1WE0 A;  3HA9 A;  3CYN A;  1ABA A;  1GUM A;  4FH8 A;  3O3T A;  4MA9 A;  4G2E A;  5EPF A;  3QFA C;  4I2U A;  1T1V A;  3E0U A;  1K0B A;  2Z9S A;  3M9K A;  1FVJ A;  3D4T A;  3TDG A;  1VGL A;  3IC4 A;  2CQ9 A;  4NV5 A;  4ZL8 A;  2YNX A;  1U88 A;  3ZRD A;  4XTS A;  2DSA A;  2HYX A;  12GS A;  2PGT A;  1JFU A;  1MTC A;  8GSS A;  1BJX A;  2NBS A;  3F9U A;  5HQP A;  5CAX A;  2KOK A;  2ES7 A;  4ECI A;  5ID2 B;  4TXV A;  4HZ4 A;  2XBI A;  1PMT A;  2GZP A;  4OO5 A;  4EO3 A;  1FB0 A;  4HDE A;  1SL1 B;  3Q6O A;  4MLY A;  1VF3 A;  4I97 A;  3TRP A;  1PX6 A;  3A5W A;  5HR3 A;  2YWN A;  1KEB A;  1UN2 A;  2XHF A;  1ML6 A;  2F3M A;  1M2D A;  1I5G A;  4KCA A;  3QAG A;  22GS A;  3IAS 2;  1LJR A;  2A2S A;  1SK0 A;  2B7J A;  2PU9 C;  1XVW A;  2FLS A;  2V32 A;  2VCX A;  1XIY A;  3MSZ A;  3GX0 A;  5D73 A;  5ECS A;  4GWR A;  2H01 A;  2YOI A;  1HNA A;  4L0W A;  5IMA A;  3ERW A;  4MJE A;  4IBP A;  4ZL9 A;  2YV7 A;  3I9V 2;  3D4M A;  1SKR B;  1THX A;  5ECO B;  5KN1 A;  5KN0 A;  2X8G A;  4OWY A;  1EV9 A;  4X1U A;  4FO5 A;  5IMD A;  3DML A;  5HR2 A;  1YZX A;  2JZS A;  4NPB A;  2GQM A;  3P7X A;  4XHM A;  1J08 A;  2H71 A;  2PBJ A;  4AF2 A;  2HFD A;  4OFM A;  5G1K A;  3IXR A;  1B9X C;  5F06 A;  4EL1 A;  2JAC A;  3EYT A;  2H1G A;  2MBS A;  1OAZ A;  3IK7 A;  4ZIJ A;  3BCK A;  2DJ2 A;  2K18 A;  1Z7R A;  4KCE A;  4TW5 A;  2CAQ A;  2WFC A;  2GT6 A;  4H86 A;  5E4W A;  3Q74 A;  1V98 A;  4PXO A;  6GSX A;  2KHP A;  1VRS D;  3HXS A;  3ZIJ A;  4GSS A;  2AAW A;  2C3N A;  5CRG A;  2NPB A;  3FHK A;  3IDV A;  5D9X A;  3GH6 A;  2YZH A;  3UOM A;  3CRT A;  4KND A;  2VCV A;  2L6C A;  2N5B A;  1GTB A;  2WRT A;  1PQN A;  2EIQ A;  2PMT A;  3KIJ A;  2IME A;  4RI7 A;  2A2R A;  5F8B A;  5FT3 A;  1B48 A;  1FAA A;  4GST A;  1G7E A;  1G7O A;  1PL2 A;  4BA7 A;  3MAK A;  1GUK A;  1GTA A;  2MMA A;  2FD3 A;  3VK9 A;  1AAZ A;  5ABR A;  3UJ1 A;  4PGT A;  2NDO A;  1ZYQ B;  4KAE A;  5DDL A;  2JU5 A;  4TOP A;  2RII A;  1M7T A;  1F9M A;  3N5O A;  4F03 A;  4MZB A;  1Z3E A;  5D9V A;  4I2T A;  3EE2 A;  4NAX A;  3F0I A;  4WR5 A;  1FVK A;  1HD2 A;  5CNW A;  6GSV A;  3GH9 A;  5DBQ A;  4MJB A;  2XBQ A;  2IL3 A;  4O7H A;  1XOB A;  3KXO A;  4IN0 A;  3UBL A;  4XS4 B;  1SJI A;  1NSW A;  5DAL B;  3WYW A;  3GUS A;  4IP6 A;  5D9T A;  4N11 A;  1XBS A;  4NV2 A;  2C80 A;  4MJC A;  4PUR A;  3CSJ A;  1K0D A;  4TR1 B;  1ZCP A;  4IW9 A;  1N8J A;  3VPQ A;  4Z7X A;  1N2A A;  4L8E A;  3CSI A;  4XS4 A;  5B8A A;  1PGT A;  5DAL A;  4ZB9 A;  1SU9 A;  3J7Y b;  3C73 A;  3H8Q A;  3LYK A;  1QMV A;  4IKH A;  2GTU A;  2OJL A;  3TJB A;  13GS A;  2LKU A;  3TKS A;  1ZYE A;  1TRS A;  2RLI A;  4WBJ A;  5IOW A;  1F37 A;  5ECL B;  1UC7 A;  1AXD A;  4BVX A;  3ZFL A;  3FW2 A;  2PWJ A;  4KB3 A;  1TI1 A;  5DVB A;  1Z7P A;  3GL5 A;  1SKS B;  1A0F A;  4WBR D;  5AIX A;  1TXX A;  4MMM A;  5H5Q A;  3ZMK A;  1T4Z A;  4KX4 A;  2TIR A;  3VWX A;  3UL3 A;  3FEU A;  3L9V A;  3GST A;  2E7P A;  2CVB A;  4IP1 A;  4POM A;  3I6A A;  3D6I A;  5D9W A;  3KMO A;  2WS2 A;  3W8S A;  1GSU A;  3QAW A;  5J5N A;  2GSR A;  4NWY A;  2YAN A;  2EIR A;  1A23 A;  3M1G A;  4K8M A;  1XFL A;  3RAZ A;  4XRD A;  3TKQ A;  4HS1 A;  1K0N A;  5KN3 A;  2KUC A;  3D22 A;  2K8V A;  2YJH A;  2PVO C;  2JAD A;  3TKS C;  1UVZ A;  3GUR A;  1A8Y A;  1SL2 B;  4OFN A;  2JZT A;  1XCC A;  3CTG A;  4RUV A;  4K6X A;  2WJU A;  3KH7 A;  2HLS A;  3E3E A;  2AHE A;  3LWA A;  3APQ A;  3GTU B;  1OC9 B;  4XIH A;  2C3Q A;  2OKA A;  2VM1 A;  2BJX A;  2GVP A;  3ZL5 A;  2RM5 A;  4KW6 A;  2CA8 A;  4GLT A;  3GTU A;  4TR3 A;  3P2A A;  3KM6 A;  3GYK A;  3DVW A;  3H79 A;  4PX1 A;  2LS5 A;  2YPM A;  3M3M A;  5DCH A;  2EIO A;  1R7H A;  4MF5 A;  1EGR A;  4OMV A;  4ZBD A;  1DE2 A;  2GSQ A;  4MF6 A;  3RHC A;  2GDR A;  2L5L A;  2PVQ A;  2KLX A;  3ME7 A;  3BJ5 A;  4EF0 A;  3FZ5 A;  4KDY A;  3RDW A;  17GS A;  2IN3 A;  4IS0 A;  1FG4 A;  3GV1 A;  3TJJ A;  4EC0 A;  3A2X A;  4K0N A;  2CV4 A;  1JHB A;  3K8N A;  4RQX A;  2MMN A;  3IRA A;  3TKP A;  5H5R A;  1BED A;  1HQO A;  3KP8 A;  5D93 A;  5CRH A;  5GST A;  2C3T A;  4V2N A;  3I43 A;  3F3Q A;  2ZUP A;  3M9J A;  4EVM A;  2YP6 A;  4AJ8 A;  5G5F A;  1KTE A;  1FHE A;  4J56 E;  4ZB8 A;  3HVV A;  4EDY A;  3IAM 2;  5G1L A;  1U3A A;  4PQ1 A;  5G31 A;  3R2Q A;  2FUG 2;  2LRN A;  2IMD A;  2HRN A;  2DIZ A;  1ERW A;  3A2V A;  3W6G A;  4MK3 A;  3ME8 A;  4JR4 A;  4K7O A;  3LYP A;  4IQ1 A;  1TK8 B;  4OFT A;  2CVD A;  1OE7 A;  3WGE A;  1S3A A;  4IHU A;  4XCS A;  5B7C A;  5EVO A;  4N30 A;  2LV3 A;  4G9H A;  2C8U A;  4EE0 A;  3GA4 A;  18GS A;  5C00 A;  3ERG A;  1WP0 A;  1GUL A;  1C72 A;  3BCI A;  4EKZ A;  4ML6 A;  1W4V A;  1R4W A;  1GTU A;  1RQM A;  1A8L A;  4HEA 2;  1J0F A;  4IEL A;  3FZ4 A;  2IMI A;  1JLW A;  6GSW A;  3QDN A;  3LG6 A;  1J9B A;  4Q5Q A;  4LMW A;  4MZW A;  1OC3 A;  1XPV A;  1T00 A;  3U5R E;  4GCI A;  1AQX A;  2LRT A;  4TVE A;  2ON5 A;  1GSQ A;  4XRA A;  1YEP A;  3HY2 A;  3ISO A;  5IOX A;  3UMA A;  1R5A A;  1M99 A;  5J41 A;  5D8I A;  1K0M A;  4IVF A;  2MZC A;  4MH3 A;  4TRX A;  5ECM B;  1QGV A;  3MNG A;  1X5C A;  2EC4 A;  3P90 A;  2YV9 A;  3IBH A;  4KUN A;  5B6N A;  2B6M A;  3LXT A;  3NIV A;  5A4U A;  4WF4 A;  2H19 A;  3IR4 A;  2X64 A;  1GH2 A;  4F2I A;  4QL9 A;  2D2Z A;  4X43 A;  1X5D A;  4V2M A;  1TP9 A;  4I6X A;  2G0F A;  3TKR A;  2IMF A;  5JCU A;  5J9C A;  4ZL7 A;  4AJ6 A;  3NOF A;  3GKM A;  3ERF A;  2RUE A;  5A4W A;  2DIY A;  2XPD A;  5JWO B;  1AUC A;  1FW1 A;  3DD3 A;  3F6F A;  3Q19 A;  4DSR A;  1XWB A;  5GSS A;  1NHO A;  2HXK A;  5DQS A;  3FZ9 A;  4LA1 A;  3UAP A;  3FYG A;  5COH A;  3VI5 A;  4ULX A;  1WOU A;  1ON4 A;  2VCT A;  5HFG A;  4TR4 A;  1V2A A;  2H70 A;  2B7K A;  3SBC A;  1GNW A;  4KA0 A;  3GNJ A;  2MMO A;  2IMK A;  3PH9 A;  10GS A;  1SEN A;  3TJK A;  4K1F A;  5G2Z A;  3BD2 A;  1R5P A;  4POL A;  2R5G A;  3I69 A;  2DLX A;  3ZVJ D;  2B1K A;  2RM6 A;  3GN3 A;  3KTB A;  4RQR A;  3HVX A;  5EL8 A;  1M9A A;  1NW2 A;  1EV4 A;  1MDI A;  3M8N A;  3UVH A;  1E2Y A;  3HD5 A;  1O73 A;  4CHS A;  2VAF A;  3UAR A;  4DVC A;  3MDK A;  3QD9 A;  2ZNM A;  3CMI A;  3EWL A;  3W8J A;  5E59 A;  1EGO A;  2OAC A;  2H1B A;  2FA8 A;  4HQZ A;  4DSS A;  1FOV A;  1OKT A;  3F6D A;  4X0X A;  2FCH A;  4EUY A;  4NHZ A;  3TUE A;  2V6K A;  3WT1 A;  2DJJ A;  1YKA A;  5ECR B;  2R3X A;  4N10 A;  2H1D A;  1V58 A;  3VWW A;  1IYI A;  4ECJ A;  3ED3 A;  2VUP A;  3WD6 A;  3F4T A;  1GRX A;  2VO4 A;  1SK2 A;  2R2J A;  1EOG A;  4MAB A;  3APO A;  1F3A A;  2H66 A;  1E6B A;  3C71 A;  1K3L A;  3PIN A;  4GQF A;  4G10 A;  1ERT A;  5ECH B;  3IK9 A;  3ZVJ A;  1S3C A;  1TJD A;  1PRX A;  7GSS A;  3TGZ A;  3WGD A;  3QPM A;  3ZFB A;  3IV4 A;  3UBK A;  1T3B A;  3IPZ A;  4ISD A;  3UIW A;  2L5O A;  5CRE A;  4HJ2 A;  1GNE A;  2H6Z A;  1YQ1 A;  3GHA A;  4F82 A;  3IHQ A;  3NZN A;  4ZBB A;  1DE1 A;  3GKN A;  4JU5 A;  3H1N A;  1MDJ A;  1TDI A;  2GS3 A;  3LEF A;  4J2F A;  1IYH A;  4GXZ A;  4PQI A;  1HYU A;  2AYT A;  4O92 A;  2V41 A;  4MPG A;  1A0R P;  4WF5 A;  6GSS A;  1OYJ A;  2PN8 A;  3GIX A;  3GKX A;  1SJZ A;  3G9B A;  1K3O A;  5ECI B;  2MBT A;  2E2G A;  3QFB C;  1LBK A;  4HOJ A;  1LU4 A;  4L0U A;  1XW5 A;  2BTO T;  2H75 A;  2GZY A;  2YCD A;  2A4V A;  2VL3 A;  5B8B A;  3TB2 A;  2F51 A;  4WKW A;  4TR0 A;  2QC7 A;  3HZ4 A;  1PSQ A;  2ALB A;  2OBK A;  4GTU A;  5A5K A;  1QXH A;  2WDU A;  2P5Q A;  1EWX A;  2VLU A;  1EP7 A;  4I8B A;  4K2D A;  1DSB A;  3SWL A;  4ZBA A;  4ML1 A;  1JZR A;  3F8U A;  2B1L A;  2M80 A;  3Q18 A;  2FWE A;  20GS A;  4Q5F A;  1Y25 A;  5IM9 A;  4ECB A;  2H1A A;  1Z6M A;  1GLQ A;  2L6D A;  2C0E A;  3FR6 A;  3TOU A;  1QFN A;  1ACV A;  4HU7 A;  1RW1 A;  2FWH A;  3VI7 A;  3KTL A;  2HNL A;  2GSS A;  5AN1 A;  2I9H A;  4JRR A;  4KSO A;  6GST A;  1GUH A;  3GL3 A;  3ZZX A;  4K7N A;  3O76 A;  4GRF A;  1SJ6 A;  3DIE A;  1VF4 A;  2IJY A;  4D73 A;  3EU3 A;  4ILF A;  3RHB A;  1VF2 A;  3HJO A;  5JCW A;  3ZML A;  2CX3 A;  3HZ8 A;  5J9B A;  1XVQ A;  5AGY A;  1TK0 B;  4BWS A;  3APS A;  4NMU A;  2YWM A;  2CX4 A;  4RI6 A;  3VFI A;  4E8H A;  2BMX A;  4E8E A;  2VCW A;  2LJA A;  3H93 A;  1GTI A;  2OA7 A;  2HZF A;  4CDO A;  2R4V A;  2OE0 A;  11GS A;  2HE3 A;  3FY7 A;  4MDC A;  1MD3 A;  4ACS A;  1TU7 A;  1G6W A;  2REM A;  2V1M A;  1Z6N A;  4KGI A;  16GS A;  1X0R A;  5ECP B;  1YKC A;  1AW9 A;  4QQ7 A;  5HR1 A;  1QK8 A;  1ILO A;  4JE1 A;  2F8F A;  2C0G A;  2GQL A;  3RPP A;  4DEJ A;  4Q5N A;  2DJ0 A;  3G7I A;  2DJ3 A;  4LL1 B;  4IGJ A;  1U87 A;  3DYR A;  4AJ7 A;  1ZOF A;  3FR3 A;  1NM3 A;  4HU9 A;  1BYE A;  4KSM A;  3AY8 A;  2E0Q A;  1ERU A;  3WGX A;  1SYX A;  1PN9 A;  3FKF A;  9GSS A;  1FO5 A;  1SD8 A;  5FHI A;  2VL9 A;  2K6V A;  4OCE A;  1V9W A;  1O6J A;  5CRD A;  2O87 A;  2H76 A;  3MWH A;  2O8V B;  1USB A;  2OE3 A;  1T7P B;  3GFK A;  4KDX A;  1WJK A;  2B5X A;  3QR6 A;  3BOA A;  5GZZ B;  1Q4J A;  2FY6 A;  1URM A;  3ZLP A;  2X8C A;  3C1R A;  1YJ6 A;  5ELG A;  1AC1 A;  1OKD A;  5G30 A;  2AV4 A;  4HZ2 A;  2DJ1 A;  1PX7 A;  1MDK A;  2E2M A;  2H6X A;  4P3Y B;  2AJQ B;  4MJA A;  1EEJ A;  4BWQ A;  1GL8 A;  3KGK A;  2HT9 A;  2LUS A;  1EOH A;  3GMF A;  1F2E A;  3G7J A;  5IMZ A;  5IO0 A;  2XC2 A;  2O7K A;  1TI3 A;  5CRW A;  2H72 A;  4FIW A;  1TRU A;  1O85 A;  3A3T A;  1A2M A;  3KJY A;  3FRC A;  3OR5 A;  3EMP A;  2WCI A;  5LCZ A;  2OE1 A;  1XW6 A;  4FYC A;  4KH7 A;  1W89 A;  3PGT A;  1PD2 1;  4LL4 B;  2H6Y A;  2OBI A;  3TCO A;  2C1Y A;  3VWV A;  3GKK A;  1SK1 A;  2VCQ A;  5J4U A;  1Q98 A;  1B4Q A;  4V1A g;  4V1A p;  2IIY A;  2YZU A;  1H4O A;  2L59 A;  2YWI A;  1UA5 A;  4HJM A;  2CZ3 A;  1B9Y C;  2DML A;  1YEX A;  2TRX A;  1S3D A;  4KDU A;  5B6M A;  2N5F A;  4POB A;  3UEM A;  1GSE A;  1O8X A;  2GQK A;  4GQC A;  3CTF A;  3HYP A;  4BL7 A;  1EZK A;  4TXO A;  1O81 A;  2ON7 A;  1Y6E A;  2B3S A;  1V57 A;  4HQS A;  1PKW A;  4Q5R A;  3CXG A;  3LQ7 A;  1PKZ A;  2WUL A;  3PR8 A;  1HNB A;  5F05 A;  3GX8 A;  4L5L A;  2H74 A;  4PNF A;  5CP1 A;  3LJR A;  1ERV A;  4CW9 A;  1ZL9 A;  4OD7 A;  3F4S A;  4MPF A;  2C0D A;  4K0G A;  3KD0 A;  4NHW A;  4YQU A;  2DBC A;  1YDK A;  5DJL A;  6GSU A;  1XXU A;  3VPT A;  4YAV A;  3WT2 A;  5D96 A;  3L0H A;  1JZD A;  2FWG A;  4PQH A;  5KEJ A;  1ZMA A;  5L71 A;  4MF7 A;  1QUW A;  4QL7 A;  1XZO A;  4G19 A;  1CQH A;  2H0H A;  2YJ7 A;  3V1W A;  1DBY A;  1M0U A;  4ZB6 A;  1EEM A;  5IQY A;  1XOA A;  4O5R A;  5ID2 A;  1WWJ A;  2F8A A;  4K7I A;  3O6T A;  2FNO A; 
#chains in the Genus database with same CATH topology
 4LMV A;  1TW9 A;  1JZO A;  4F0C A;  4EIP A;  4TN8 A;  5AIS A;  1GWC A;  2LRC A;  1TTZ A;  2H0I A;  3F3R A;  1XW9 A;  5HFI A;  3J7Y k;  2GLR A;  5HR0 A;  3L4N A;  3HKR A;  4XS1 A;  4AGS A;  4MNN A;  2CZ2 A;  2VCZ A;  3EVI A;  1X9W B;  1NHY A;  1DUG A;  2R37 A;  1FOH A;  4OO4 A;  2O85 A;  3HCZ A;  3LFL A;  1ZZY A;  1GSS A;  3CSH A;  4MP4 A;  1EP8 A;  2TRC P;  2J9H A;  3GRX A;  1TOF A;  2LJK A;  1T8E B;  3TOT A;  3HJP A;  2PPT A;  4DSS B;  3KEB A;  4MCU A;  2FA4 A;  2RUF A;  3DWV A;  1O8W A;  3RPN A;  1VF1 A;  4EXJ A;  5ECK B;  4JED A;  1A24 A;  3C1S A;  1GSF A;  3F63 A;  1KNG A;  3GSS A;  2AUV A;  1ZYP A;  1YY7 A;  4BVY B;  2WZ9 A;  4HUA A;  3IA1 A;  2JL4 A;  1BG5 A;  2R0C A;  2R0P A;  1JZW A;  3CRU A;  1T4Y A;  3VWU A;  3TJF A;  2L4Q A;  4YQV A;  4NXI A;  4BVY A;  2B5Y A;  1K0A A;  4O32 A;  3L9S A;  2O89 A;  2JSZ A;  3CBU A;  1AQV A;  2LTK A;  3IE3 A;  2P31 A;  1GSY A;  1B8X A;  3UVT A;  1K0C A;  4F0B A;  3D5J A;  5LD0 A;  5JWR B;  2WB9 A;  2CAI A;  2IFQ B;  2I81 A;  1WIK A;  5INY A;  1PA3 A;  1TK5 B;  3QAV A;  3JCM L;  1YF0 A;  3H4K A;  1WMJ A;  2C4J A;  5HFK A;  1GLP A;  1XWC A;  1HNC A;  3LSZ A;  4G0I A;  1BX9 A;  4EDZ A;  2IFQ A;  5DCG A;  2LQQ A;  3VUR A;  2HZE B;  2FGX A;  4POK A;  4MH2 A;  5F0G A;  5GAN D;  1K3Y A;  5ECQ B;  1X9M B;  1XWA A;  3IOS A;  2NTO A;  5ELA A;  4WXT A;  4YH2 A;  2C0F A;  4K5S A;  2IPA A;  5FWG A;  3IHG A;  2GGT A;  2HZE A;  1TKD B;  3TRQ A;  5KN2 A;  3VLN A;  1SYR A;  2P5R A;  2PUK C;  4N0Z A;  3EMX A;  1MD4 A;  4O5U A;  2K8S A;  5EY6 A;  5DQY A;  5LNK e;  2HSY A;  1TRW A;  3RBT A;  3TRX A;  5ECN B;  3FZA A;  1GSD A;  4LLR A;  4D73 B;  3HDC A;  1R26 A;  2B5E A;  1SL0 B;  4TKY A;  1M2A A;  2HSH A;  4WET A;  2HRF A;  1H75 A;  3DGQ A;  2H30 A;  5IMF A;  2FHE A;  2KP2 A;  2VL2 A;  4TR1 A;  5AIV A;  4K9Z A;  2CT6 A;  3LOR A;  2LJR A;  1F6M C;  1B4P A;  3EIN A;  3US3 A;  1ZYN A;  1FB6 A;  5CO3 A;  4KE3 A;  3ZIV A;  5F07 A;  5IO2 A;  2AB6 A;  4PUF C;  3ZIT A;  4OCF A;  2CVK A;  1Z5Y E;  5G5E A;  2DC5 A;  1F3B A;  2VOC A;  5CYY A;  5IPG A;  1TRV A;  1X5E A;  2QKE A;  4JR6 A;  4L5O A;  3KZQ A;  5IIZ A;  4GSN A;  3DVX A;  1RK4 A;  4J57 E;  4XS6 A;  3TKS E;  3KH9 A;  3KCM A;  3EC3 A;  4G0L A;  2X99 A;  2LQO A;  3DKS A;  3HJM A;  2OAD A;  2H73 A;  2JZR A;  1BQ7 A;  2K9F A;  1O7U A;  2GST A;  1ZGN A;  2L4C A;  2MYG A;  2VL2 C;  3DRN A;  2LST A;  3FK8 A;  2G2Q A;  1G6Y A;  1ST9 A;  2GT5 A;  1KBN A;  2NVL A;  2KP1 A;  2IWT A;  2XPE A;  4ECC A;  2QSI A;  6GSY A;  4PUA A;  2HRK A;  2YWO A;  2L57 A;  14GS A;  3L9U A;  4BPY A;  5H5S A;  1AIU A;  1SKW B;  1A2L A;  1WPI A;  2JSY A;  3D0Z A;  3C7M A;  5DJM A;  3LGC A;  2DKH A;  4V2L A;  2P0G A;  4F9Z A;  3EU4 A;  3HVS A;  3HHV A;  4ID0 A;  3S9F A;  1G0T A;  2HI7 A;  2WGR A;  2H0G A;  4Z2R A;  1OC9 A;  1A2J A;  2VM2 A;  2FWF A;  2VLV A;  3MIX A;  2R6K A;  1WRY A;  4FYB A;  3KMN A;  3U6V A;  2LNT A;  3KP9 A;  1TU8 A;  1I9D A;  3HVN A;  3P8W A;  4YQM A;  1X9S B;  3ZRE A;  4GF0 A;  5GAP D;  3E9J B;  4CY6 A;  1V40 A;  3D21 A;  1XWK A;  1U3I A;  2GZZ A;  2I4A A;  1U6T A;  1XWG A;  2F9S A;  3QOU A;  4IJ3 A;  5JWQ B;  5IPH A;  1MEK A;  5IMC A;  1OVN A;  4I5Q A;  4MZC A;  2QA1 A;  2YN1 A;  2N5A A;  3FR9 A;  19GS A;  2VD1 A;  4PNG A;  5IMV A;  3F4R A;  2VIM A;  4HI7 A;  5J3R A;  3A2W A;  5A4V A;  3ZYW A;  4IQA A;  2VD0 A;  4IJI A;  1BAY A;  1Z9H A;  2VLT A;  1M2B A;  3R3E A;  4N0V A;  2DMM A;  4ZXG A;  2J23 A;  1CQG A;  3QMX A;  2X8H A;  4JZQ A;  1OE8 A;  5ENU A;  1GP1 A;  2V6O A;  3G7Y A;  2DJK A;  4WEY A;  2M72 A;  4WR4 A;  2H8L A;  1JLV A;  1YF1 A;  2V2G A;  5JCG A;  5DAK B;  2PER A;  2M46 A;  3L78 A;  3BBY A;  3DEX A;  3N9J A;  3DXB A;  1M9B A;  1K0O A;  2I3Y A;  1AQW A;  1THO A;  4DSQ A;  3M0F A;  4JBB A;  1PL1 A;  3EUR A;  2I1U A;  4TXO B;  5C04 A;  1OC8 A;  4ZIL A;  3TJG A;  4YAP A;  3LXZ A;  2MMZ A;  5DAK A;  2QGV A;  4YKF A;  2LEG A;  4FYU A;  2ZCT A;  1QQ2 A;  1SD9 A;  2LNS A;  3QCP A;  3C8E A;  3ZTL A;  1WE0 A;  3HA9 A;  3CYN A;  1ABA A;  1GUM A;  4FH8 A;  3O3T A;  4MA9 A;  4G2E A;  5EPF A;  3QFA C;  4I2U A;  1T1V A;  3E0U A;  1K0B A;  2Z9S A;  3M9K A;  1FVJ A;  3D4T A;  3TDG A;  1VGL A;  3IC4 A;  2CQ9 A;  4NV5 A;  4ZL8 A;  2YNX A;  1U88 A;  3ZRD A;  4XTS A;  2DSA A;  2HYX A;  12GS A;  2PGT A;  1JFU A;  1MTC A;  8GSS A;  1BJX A;  2NBS A;  3F9U A;  5HQP A;  5CAX A;  2KOK A;  2ES7 A;  4ECI A;  5ID2 B;  4TXV A;  4HZ4 A;  2XBI A;  1PMT A;  2GZP A;  4OO5 A;  4EO3 A;  1FB0 A;  4HDE A;  1SL1 B;  3Q6O A;  4MLY A;  1VF3 A;  4I97 A;  3TRP A;  1PX6 A;  3A5W A;  5HR3 A;  2YWN A;  1KEB A;  1UN2 A;  2XHF A;  1ML6 A;  2F3M A;  1M2D A;  1I5G A;  4KCA A;  3QAG A;  4EIQ A;  22GS A;  3IAS 2;  1LJR A;  2A2S A;  1SK0 A;  2B7J A;  2PU9 C;  1XVW A;  2FLS A;  2V32 A;  2VCX A;  1XIY A;  3MSZ A;  3GX0 A;  5D73 A;  5ECS A;  4GWR A;  2H01 A;  2YOI A;  1HNA A;  4L0W A;  5IMA A;  3ERW A;  4MJE A;  4IBP A;  4ZL9 A;  2YV7 A;  3I9V 2;  3D4M A;  1SKR B;  1THX A;  5ECO B;  5KN1 A;  5KN0 A;  2X8G A;  4OWY A;  1EV9 A;  4X1U A;  4FO5 A;  5IMD A;  3DML A;  5HR2 A;  1YZX A;  2JZS A;  4NPB A;  2GQM A;  3P7X A;  4XHM A;  1J08 A;  2H71 A;  2PBJ A;  4AF2 A;  2HFD A;  4OFM A;  5G1K A;  3IXR A;  1B9X C;  5F06 A;  4EL1 A;  2JAC A;  3EYT A;  2H1G A;  2MBS A;  1OAZ A;  3IK7 A;  4ZIJ A;  3BCK A;  2DJ2 A;  2K18 A;  1Z7R A;  4KCE A;  4TW5 A;  2CAQ A;  2WFC A;  2GT6 A;  4H86 A;  5E4W A;  3Q74 A;  1V98 A;  4PXO A;  6GSX A;  2KHP A;  1VRS D;  3HXS A;  3IC8 A;  3ZIJ A;  4FQU A;  4GSS A;  2AAW A;  2C3N A;  5CRG A;  2NPB A;  3FHK A;  3IDV A;  5D9X A;  3GH6 A;  2YZH A;  3UOM A;  3PPU A;  3CRT A;  4KND A;  2VCV A;  2L6C A;  2N5B A;  1GTB A;  2WRT A;  1PQN A;  2EIQ A;  2X4A A;  2PMT A;  3KIJ A;  5KOX A;  2IME A;  4RI7 A;  2A2R A;  5F8B A;  5FT3 A;  1B48 A;  1FAA A;  4GST A;  4YKG A;  1G7E A;  1G7O A;  1PL2 A;  4BA7 A;  3MAK A;  1GUK A;  1GTA A;  2MMA A;  2FD3 A;  3VK9 A;  1AAZ A;  5ABR A;  3UJ1 A;  4PGT A;  2NDO A;  1ZYQ B;  4KAE A;  5DDL A;  2JU5 A;  4TOP A;  2RII A;  1M7T A;  1F9M A;  3N5O A;  4Z2T A;  4F03 A;  4MZB A;  1Z3E A;  5D9V A;  4I2T A;  3EE2 A;  4NAX A;  3F0I A;  4WR5 A;  1FVK A;  1HD2 A;  5CNW A;  6GSV A;  3GH9 A;  5DBQ A;  4MJB A;  2XBQ A;  2IL3 A;  4O7H A;  1XOB A;  3KXO A;  4IN0 A;  3UBL A;  4XS4 B;  1SJI A;  1NSW A;  5DAL B;  3WYW A;  3GUS A;  4IP6 A;  5D9T A;  4N11 A;  1XBS A;  4NV2 A;  2C80 A;  4MJC A;  5KOW A;  4PUR A;  3CSJ A;  1K0D A;  4TR1 B;  1ZCP A;  4IW9 A;  1N8J A;  3VPQ A;  4Z7X A;  1N2A A;  4L8E A;  3CSI A;  4XS4 A;  5B8A A;  1PGT A;  5DAL A;  4ZB9 A;  1SU9 A;  3J7Y b;  3C73 A;  3H8Q A;  3LYK A;  1QMV A;  4IKH A;  2GTU A;  2OJL A;  3TJB A;  13GS A;  2LKU A;  3TKS A;  1ZYE A;  1TRS A;  2RLI A;  4WBJ A;  5IOW A;  1F37 A;  5ECL B;  1UC7 A;  1AXD A;  4BVX A;  3ZFL A;  3FW2 A;  2PWJ A;  4KB3 A;  1TI1 A;  5DVB A;  1Z7P A;  3GL5 A;  1SKS B;  1A0F A;  4WBR D;  5AIX A;  1TXX A;  4MMM A;  5H5Q A;  4HSC X;  3ZMK A;  1T4Z A;  4KX4 A;  2TIR A;  3VWX A;  3UL3 A;  3FEU A;  3L9V A;  3GST A;  2E7P A;  2CVB A;  4IP1 A;  4POM A;  3I6A A;  3D6I A;  5D9W A;  1S3R A;  1M3J A;  3KMO A;  2WS2 A;  3W8S A;  1GSU A;  3QAW A;  5J5N A;  2GSR A;  4NWY A;  2YAN A;  2EIR A;  1A23 A;  3M1G A;  4K8M A;  1XFL A;  3RAZ A;  1XG8 A;  4XRD A;  3TKQ A;  4HS1 A;  1K0N A;  5KN3 A;  2KUC A;  3D22 A;  2K8V A;  2YJH A;  2PVO C;  2JAD A;  3TKS C;  1UVZ A;  3GUR A;  1A8Y A;  1SL2 B;  4OFN A;  2JZT A;  1XCC A;  3CTG A;  4RUV A;  4K6X A;  2WJU A;  3KH7 A;  2HLS A;  3E3E A;  2AHE A;  3LWA A;  3APQ A;  3GTU B;  2QA2 A;  1OC9 B;  4XIH A;  2C3Q A;  2OKA A;  2VM1 A;  2BJX A;  2GVP A;  3ZL5 A;  2RM5 A;  4KW6 A;  2CA8 A;  4GLT A;  3GTU A;  4TR3 A;  3P2A A;  3KM6 A;  4ICY A;  3GYK A;  3DVW A;  3H79 A;  4PX1 A;  2LS5 A;  2YPM A;  3M3M A;  5DCH A;  4KF9 A;  2EIO A;  1R7H A;  4MF5 A;  1EGR A;  4OMV A;  4ZBD A;  1DE2 A;  2GSQ A;  4MF6 A;  3RHC A;  2GDR A;  2L5L A;  2PVQ A;  2KLX A;  3ME7 A;  3BJ5 A;  4EF0 A;  3FZ5 A;  4KDY A;  3RDW A;  17GS A;  2IN3 A;  4IS0 A;  1FG4 A;  3GV1 A;  3TJJ A;  4EC0 A;  3A2X A;  4K0N A;  2CV4 A;  1JHB A;  3K8N A;  4RQX A;  2MMN A;  3IRA A;  3TKP A;  5H5R A;  1BED A;  1HQO A;  3KP8 A;  5D93 A;  5CRH A;  5GST A;  2C3T A;  4V2N A;  3FMW A;  3I43 A;  3F3Q A;  2ZUP A;  3M9J A;  4EVM A;  5BMU A;  2YP6 A;  4AJ8 A;  5G5F A;  1KTE A;  1FHE A;  4J56 E;  4ZB8 A;  3HVV A;  4EDY A;  3IAM 2;  5G1L A;  1U3A A;  4PQ1 A;  2HSM A;  5G31 A;  3R2Q A;  2FUG 2;  2LRN A;  2IMD A;  2A4H A;  2HRN A;  2DIZ A;  1ERW A;  3A2V A;  3W6G A;  4MK3 A;  3ME8 A;  4JR4 A;  4K7O A;  3LYP A;  4IQ1 A;  1TK8 B;  4OFT A;  2CVD A;  1OE7 A;  3WGE A;  1S3A A;  4IHU A;  4XCS A;  5B7C A;  5EVO A;  4N30 A;  2LV3 A;  4G9H A;  2C8U A;  4EE0 A;  3GA4 A;  18GS A;  2X49 A;  5C00 A;  3ERG A;  1WP0 A;  1GUL A;  1C72 A;  3BCI A;  4EKZ A;  4ML6 A;  1W4V A;  1R4W A;  1GTU A;  1RQM A;  1A8L A;  4HEA 2;  1J0F A;  4IEL A;  3FZ4 A;  4A5P A;  2IMI A;  1JLW A;  6GSW A;  3QDN A;  3LG6 A;  1J9B A;  4Q5Q A;  4LMW A;  4MZW A;  1OC3 A;  1XPV A;  1T00 A;  3U5R E;  4GCI A;  1AQX A;  2LRT A;  4TVE A;  2ON5 A;  1GSQ A;  4XRA A;  1YEP A;  3HY2 A;  3ISO A;  5IOX A;  3UMA A;  1R5A A;  1M99 A;  5J41 A;  5D8I A;  1K0M A;  4IVF A;  4K5R A;  2MZC A;  4MH3 A;  4TRX A;  5ECM B;  1QGV A;  3MNG A;  1X5C A;  2EC4 A;  3P90 A;  2YV9 A;  3IBH A;  4KUN A;  5B6N A;  4O5Q A;  2B6M A;  3LXT A;  3NIV A;  5A4U A;  4WF4 A;  2H19 A;  3IR4 A;  2X64 A;  1GH2 A;  4F2I A;  4QL9 A;  2D2Z A;  4X43 A;  1X5D A;  4V2M A;  1TP9 A;  4I6X A;  2G0F A;  3TKR A;  2IMF A;  5JCU A;  5J9C A;  4ZL7 A;  4AJ6 A;  3NOF A;  3GKM A;  4PTS A;  3ERF A;  2RUE A;  5A4W A;  2DIY A;  2XPD A;  5JWO B;  1AUC A;  4CY8 A;  1FW1 A;  3DD3 A;  3F6F A;  3Q19 A;  4DSR A;  1XWB A;  5GSS A;  1NHO A;  2HXK A;  5DQS A;  3FZ9 A;  4LA1 A;  3UAP A;  3FYG A;  5COH A;  3VI5 A;  4ULX A;  1WOU A;  1ON4 A;  2VCT A;  5HFG A;  4TR4 A;  1V2A A;  2H70 A;  2B7K A;  3SBC A;  1GNW A;  4KA0 A;  3GNJ A;  2MMO A;  2IMK A;  3PH9 A;  3EPT A;  1SEN A;  10GS A;  3TJK A;  4K1F A;  5G2Z A;  3BD2 A;  1R5P A;  4POL A;  2R5G A;  1M3I A;  3I69 A;  2DLX A;  3ZVJ D;  2B1K A;  2RM6 A;  3GN3 A;  3KTB A;  4RQR A;  3HVX A;  1M9A A;  1NW2 A;  5EL8 A;  1EV4 A;  1MDI A;  3M8N A;  3UVH A;  1E2Y A;  3HD5 A;  1O73 A;  4CHS A;  2VAF A;  3UAR A;  4DVC A;  3MDK A;  4G0K A;  3QD9 A;  2ZNM A;  3CMI A;  3EWL A;  3W8J A;  5E59 A;  1EGO A;  2OAC A;  2H1B A;  2FA8 A;  4HQZ A;  4DSS A;  1FOV A;  1OKT A;  3F6D A;  4X0X A;  2FCH A;  4EUY A;  4NHZ A;  3TUE A;  2V6K A;  3WT1 A;  2DJJ A;  1YKA A;  5ECR B;  2R3X A;  4N10 A;  2H1D A;  1V58 A;  3VWW A;  1IYI A;  4BIK A;  4ECJ A;  3ED3 A;  4X4J A;  2VUP A;  3WD6 A;  3F4T A;  1GRX A;  2VO4 A;  1SK2 A;  2R2J A;  1EOG A;  4MAB A;  3LW9 A;  3APO A;  1F3A A;  3A5I A;  2H66 A;  1E6B A;  3C71 A;  1K3L A;  3PIN A;  4GQF A;  4G10 A;  1ERT A;  5ECH B;  3IK9 A;  3ZVJ A;  1S3C A;  1TJD A;  1PRX A;  7GSS A;  3TGZ A;  3WGD A;  2A2P A;  3QPM A;  3ZFB A;  3IV4 A;  3UBK A;  1T3B A;  3IPZ A;  4ISD A;  3UIW A;  2L5O A;  5CRE A;  4HJ2 A;  1GNE A;  2H6Z A;  1YQ1 A;  3GHA A;  4F82 A;  3IHQ A;  3NZN A;  4ZBB A;  1DE1 A;  3GKN A;  4JU5 A;  3H1N A;  1MDJ A;  1TDI A;  2GS3 A;  3LEF A;  4J2F A;  1IYH A;  4GXZ A;  4PQI A;  1HYU A;  2AYT A;  4O92 A;  2V41 A;  4MPG A;  1A0R P;  4WF5 A;  6GSS A;  1OYJ A;  2PN8 A;  2UZ8 A;  3GIX A;  3GKX A;  1SJZ A;  3G9B A;  1K3O A;  2R0G A;  5ECI B;  2MBT A;  2E2G A;  3QFB C;  1LBK A;  4HOJ A;  1LU4 A;  1PFO A;  4L0U A;  1XW5 A;  2BTO T;  2H75 A;  2DKI A;  2GZY A;  2YCD A;  2A4V A;  2VL3 A;  5B8B A;  3TB2 A;  2F51 A;  4WKW A;  4TR0 A;  2QC7 A;  3HZ4 A;  1PSQ A;  2ALB A;  2OBK A;  4GTU A;  5A5K A;  1QXH A;  2WDU A;  2P5Q A;  1EWX A;  2VLU A;  1EP7 A;  4I8B A;  4BVX B;  4K2D A;  1DSB A;  3SWL A;  4ZBA A;  4ML1 A;  1JZR A;  3F8U A;  2B1L A;  2M80 A;  3Q18 A;  2FWE A;  20GS A;  4Q5F A;  1Y25 A;  5IM9 A;  4ECB A;  2H1A A;  1Z6M A;  1GLQ A;  2L6D A;  2C0E A;  3FR6 A;  3TOU A;  1QFN A;  1ACV A;  4HU7 A;  1RW1 A;  2FWH A;  3VI7 A;  3KTL A;  2HNL A;  2GSS A;  5AN1 A;  2I9H A;  4JRR A;  4KSO A;  6GST A;  1GUH A;  3GL3 A;  3ZZX A;  4K7N A;  3O76 A;  4GRF A;  1SJ6 A;  3DIE A;  1VF4 A;  2IJY A;  4D73 A;  3EU3 A;  4ILF A;  3RHB A;  1VF2 A;  3HJO A;  5JCW A;  3ZML A;  2CX3 A;  3HZ8 A;  5J9B A;  1XVQ A;  5AGY A;  1TK0 B;  4BWS A;  3APS A;  4NMU A;  2YWM A;  2CX4 A;  4RI6 A;  3VFI A;  4E8H A;  2BMX A;  4E8E A;  2VCW A;  2LJA A;  3H93 A;  1GTI A;  2OA7 A;  2HZF A;  4CDO A;  2R4V A;  2OE0 A;  11GS A;  2HE3 A;  3FY7 A;  4MDC A;  1MD3 A;  4ACS A;  1TU7 A;  1G6W A;  2REM A;  2V1M A;  1Z6N A;  4KGI A;  16GS A;  1X0R A;  5ECP B;  1YKC A;  1AW9 A;  4QQ7 A;  5HR1 A;  1QK8 A;  1ILO A;  4JE1 A;  2F8F A;  2C0G A;  2GQL A;  3RPP A;  4DEJ A;  4Q5N A;  3MYD A;  2DJ0 A;  3G7I A;  2DJ3 A;  4LL1 B;  4IGJ A;  1U87 A;  3DYR A;  4AJ7 A;  1ZOF A;  3FR3 A;  1NM3 A;  4HU9 A;  1BYE A;  4KSM A;  3AY8 A;  2E0Q A;  1ERU A;  3WGX A;  1SYX A;  1PN9 A;  3FKF A;  9GSS A;  1FO5 A;  1SD8 A;  5FHI A;  2VL9 A;  2K6V A;  4OCE A;  1V9W A;  1O6J A;  5CRD A;  2O87 A;  2H76 A;  3MWH A;  2O8V B;  1USB A;  2OE3 A;  1T7P B;  3GFK A;  4KDX A;  1WJK A;  2B5X A;  3QR6 A;  3BOA A;  5GZZ B;  1Q4J A;  2FY6 A;  1URM A;  3ZLP A;  2X8C A;  3C1R A;  1YJ6 A;  5ELG A;  1AC1 A;  1OKD A;  5G30 A;  2AV4 A;  4HZ2 A;  2DJ1 A;  1PX7 A;  1MDK A;  2E2M A;  2H6X A;  4P3Y B;  4USS A;  2AJQ B;  4MJA A;  1EEJ A;  4BWQ A;  1GL8 A;  3KGK A;  2HT9 A;  2LUS A;  1EOH A;  3GMF A;  1F2E A;  3G7J A;  5IMZ A;  5IO0 A;  2XC2 A;  2O7K A;  1TI3 A;  5CRW A;  2H72 A;  4FIW A;  1TRU A;  1O85 A;  3A3T A;  1A2M A;  2HRA A;  3KJY A;  3FRC A;  3OR5 A;  3EMP A;  2WCI A;  5LCZ A;  2OE1 A;  1XW6 A;  4FYC A;  4KH7 A;  1W89 A;  3PGT A;  1PD2 1;  4LL4 B;  2H6Y A;  2OBI A;  3TCO A;  1PN0 A;  2C1Y A;  3VWV A;  3GKK A;  1SK1 A;  2VCQ A;  5J4U A;  1Q98 A;  1B4Q A;  4V1A g;  4V1A p;  2IIY A;  4Z2U A;  2YZU A;  4BL7 B;  1H4O A;  2L59 A;  2YWI A;  1UA5 A;  4HJM A;  2CZ3 A;  1B9Y C;  2DML A;  4K2X A;  1YEX A;  2TRX A;  1S3D A;  4KDU A;  5B6M A;  2N5F A;  4POB A;  3UEM A;  1GSE A;  1O8X A;  2GQK A;  4GQC A;  3CTF A;  3HYP A;  4BL7 A;  1EZK A;  4TXO A;  1O81 A;  2ON7 A;  1Y6E A;  2B3S A;  1V57 A;  4HQS A;  1PKW A;  4Q5R A;  3CXG A;  3LQ7 A;  1PKZ A;  2WUL A;  3PR8 A;  5BRT A;  1HNB A;  5F05 A;  3GX8 A;  4L5L A;  2H74 A;  4PNF A;  5CP1 A;  3LJR A;  1ERV A;  4CW9 A;  1ZL9 A;  4OD7 A;  3F4S A;  4MPF A;  2C0D A;  4K0G A;  3KD0 A;  4NHW A;  4YQU A;  2DBC A;  1YDK A;  5DJL A;  6GSU A;  3CQF A;  1XXU A;  3VPT A;  4YAV A;  3WT2 A;  5D96 A;  3L0H A;  1JZD A;  2FWG A;  4PQH A;  5KEJ A;  1ZMA A;  5L71 A;  4MF7 A;  1QUW A;  4QL7 A;  1XZO A;  4G19 A;  1CQH A;  2H0H A;  2YJ7 A;  3V1W A;  1DBY A;  1M0U A;  4ZB6 A;  1EEM A;  5IQY A;  1XOA A;  4O5R A;  5ID2 A;  1WWJ A;  2F8A A;  4K7I A;  3O6T A;  2FNO A; 
#chains in the Genus database with same CATH homology
 4LMV A;  1TW9 A;  1JZO A;  4F0C A;  4EIP A;  4TN8 A;  5AIS A;  1GWC A;  2LRC A;  1TTZ A;  2H0I A;  3F3R A;  1XW9 A;  5HFI A;  3J7Y k;  2GLR A;  5HR0 A;  3L4N A;  3HKR A;  4XS1 A;  4AGS A;  4MNN A;  2CZ2 A;  2VCZ A;  3EVI A;  1X9W B;  1NHY A;  1DUG A;  2R37 A;  1FOH A;  4OO4 A;  2O85 A;  3HCZ A;  3LFL A;  1ZZY A;  1GSS A;  3CSH A;  4MP4 A;  1EP8 A;  2TRC P;  2J9H A;  3GRX A;  1TOF A;  2LJK A;  1T8E B;  3TOT A;  3HJP A;  2PPT A;  4DSS B;  3KEB A;  4MCU A;  2FA4 A;  2RUF A;  3DWV A;  1O8W A;  3RPN A;  1VF1 A;  4EXJ A;  5ECK B;  4JED A;  1A24 A;  3C1S A;  1GSF A;  3F63 A;  1KNG A;  3GSS A;  2AUV A;  1ZYP A;  1YY7 A;  4BVY B;  2WZ9 A;  4HUA A;  3IA1 A;  2JL4 A;  1BG5 A;  2R0C A;  2R0P A;  1JZW A;  3CRU A;  1T4Y A;  3VWU A;  3TJF A;  2L4Q A;  4YQV A;  4NXI A;  4BVY A;  2B5Y A;  1K0A A;  4O32 A;  3L9S A;  2O89 A;  2JSZ A;  3CBU A;  1AQV A;  2LTK A;  3IE3 A;  2P31 A;  1GSY A;  1B8X A;  3UVT A;  1K0C A;  4F0B A;  3D5J A;  5LD0 A;  5JWR B;  2WB9 A;  2CAI A;  2IFQ B;  2I81 A;  1WIK A;  5INY A;  1PA3 A;  1TK5 B;  3QAV A;  3JCM L;  1YF0 A;  3H4K A;  1WMJ A;  2C4J A;  5HFK A;  1GLP A;  1XWC A;  1HNC A;  3LSZ A;  4G0I A;  1BX9 A;  4EDZ A;  2IFQ A;  5DCG A;  2LQQ A;  3VUR A;  2HZE B;  2FGX A;  4POK A;  4MH2 A;  5F0G A;  5GAN D;  1K3Y A;  5ECQ B;  1X9M B;  1XWA A;  3IOS A;  2NTO A;  5ELA A;  4WXT A;  4YH2 A;  2C0F A;  4K5S A;  2IPA A;  5FWG A;  3IHG A;  2GGT A;  2HZE A;  1TKD B;  3TRQ A;  5KN2 A;  3VLN A;  1SYR A;  2P5R A;  2PUK C;  4N0Z A;  3EMX A;  1MD4 A;  4O5U A;  2K8S A;  5EY6 A;  5DQY A;  5LNK e;  2HSY A;  1TRW A;  3RBT A;  3TRX A;  5ECN B;  3FZA A;  1GSD A;  4LLR A;  4D73 B;  3HDC A;  1R26 A;  2B5E A;  1SL0 B;  4TKY A;  1M2A A;  2HSH A;  4WET A;  2HRF A;  1H75 A;  3DGQ A;  2H30 A;  5IMF A;  2FHE A;  2KP2 A;  2VL2 A;  4TR1 A;  5AIV A;  4K9Z A;  2CT6 A;  3LOR A;  2LJR A;  1F6M C;  1B4P A;  3EIN A;  3US3 A;  1ZYN A;  1FB6 A;  5CO3 A;  4KE3 A;  3ZIV A;  5F07 A;  5IO2 A;  2AB6 A;  4PUF C;  3ZIT A;  4OCF A;  2CVK A;  1Z5Y E;  5G5E A;  2DC5 A;  1F3B A;  2VOC A;  5CYY A;  5IPG A;  1TRV A;  1X5E A;  2QKE A;  4JR6 A;  4L5O A;  3KZQ A;  5IIZ A;  4GSN A;  3DVX A;  1RK4 A;  4J57 E;  4XS6 A;  3TKS E;  3KH9 A;  3KCM A;  3EC3 A;  4G0L A;  2X99 A;  2LQO A;  3DKS A;  3HJM A;  2OAD A;  2H73 A;  2JZR A;  1BQ7 A;  2K9F A;  1O7U A;  2GST A;  1ZGN A;  2L4C A;  2MYG A;  2VL2 C;  3DRN A;  2LST A;  3FK8 A;  2G2Q A;  1G6Y A;  1ST9 A;  2GT5 A;  1KBN A;  2NVL A;  2KP1 A;  2IWT A;  2XPE A;  4ECC A;  2QSI A;  6GSY A;  4PUA A;  2HRK A;  2YWO A;  2L57 A;  14GS A;  3L9U A;  4BPY A;  5H5S A;  1AIU A;  1SKW B;  1A2L A;  1WPI A;  2JSY A;  3D0Z A;  3C7M A;  5DJM A;  3LGC A;  2DKH A;  4V2L A;  2P0G A;  4F9Z A;  3EU4 A;  3HVS A;  3HHV A;  4ID0 A;  3S9F A;  1G0T A;  2HI7 A;  2WGR A;  2H0G A;  4Z2R A;  1OC9 A;  1A2J A;  2VM2 A;  2FWF A;  2VLV A;  3MIX A;  2R6K A;  1WRY A;  4FYB A;  3KMN A;  3U6V A;  2LNT A;  3KP9 A;  1TU8 A;  1I9D A;  3P8W A;  4YQM A;  1X9S B;  3ZRE A;  4GF0 A;  5GAP D;  3E9J B;  4CY6 A;  1V40 A;  3D21 A;  1XWK A;  1U3I A;  2GZZ A;  2I4A A;  1U6T A;  1XWG A;  2F9S A;  3QOU A;  4IJ3 A;  5JWQ B;  5IPH A;  1MEK A;  5IMC A;  1OVN A;  4I5Q A;  4MZC A;  2QA1 A;  2YN1 A;  2N5A A;  3FR9 A;  19GS A;  2VD1 A;  4PNG A;  5IMV A;  3F4R A;  2VIM A;  4HI7 A;  5J3R A;  3A2W A;  5A4V A;  3ZYW A;  4IQA A;  2VD0 A;  4IJI A;  1BAY A;  1Z9H A;  2VLT A;  1M2B A;  3R3E A;  4N0V A;  2DMM A;  4ZXG A;  2J23 A;  1CQG A;  3QMX A;  2X8H A;  4JZQ A;  1OE8 A;  5ENU A;  1GP1 A;  2V6O A;  3G7Y A;  2DJK A;  4WEY A;  2M72 A;  4WR4 A;  2H8L A;  1JLV A;  1YF1 A;  2V2G A;  5JCG A;  5DAK B;  2PER A;  2M46 A;  3L78 A;  3BBY A;  3DEX A;  3N9J A;  3DXB A;  1M9B A;  1K0O A;  2I3Y A;  1AQW A;  1THO A;  4DSQ A;  3M0F A;  4JBB A;  1PL1 A;  3EUR A;  2I1U A;  4TXO B;  5C04 A;  1OC8 A;  4ZIL A;  3TJG A;  4YAP A;  3LXZ A;  2MMZ A;  5DAK A;  2QGV A;  4YKF A;  2LEG A;  4FYU A;  2ZCT A;  1QQ2 A;  1SD9 A;  2LNS A;  3QCP A;  3C8E A;  3ZTL A;  1WE0 A;  3HA9 A;  3CYN A;  1ABA A;  1GUM A;  4FH8 A;  3O3T A;  4MA9 A;  4G2E A;  5EPF A;  3QFA C;  4I2U A;  1T1V A;  3E0U A;  1K0B A;  2Z9S A;  3M9K A;  1FVJ A;  3D4T A;  3TDG A;  1VGL A;  3IC4 A;  2CQ9 A;  4NV5 A;  4ZL8 A;  2YNX A;  1U88 A;  3ZRD A;  4XTS A;  2DSA A;  2HYX A;  12GS A;  2PGT A;  1JFU A;  1MTC A;  8GSS A;  1BJX A;  2NBS A;  3F9U A;  5HQP A;  5CAX A;  2KOK A;  2ES7 A;  4ECI A;  5ID2 B;  4TXV A;  4HZ4 A;  2XBI A;  1PMT A;  2GZP A;  4OO5 A;  4EO3 A;  1FB0 A;  4HDE A;  1SL1 B;  3Q6O A;  4MLY A;  1VF3 A;  4I97 A;  3TRP A;  1PX6 A;  3A5W A;  5HR3 A;  2YWN A;  1KEB A;  1UN2 A;  2XHF A;  1ML6 A;  2F3M A;  1M2D A;  1I5G A;  4KCA A;  3QAG A;  4EIQ A;  22GS A;  3IAS 2;  1LJR A;  2A2S A;  1SK0 A;  2B7J A;  2PU9 C;  1XVW A;  2FLS A;  2V32 A;  2VCX A;  1XIY A;  3MSZ A;  3GX0 A;  5D73 A;  5ECS A;  4GWR A;  2H01 A;  2YOI A;  1HNA A;  4L0W A;  5IMA A;  3ERW A;  4MJE A;  4IBP A;  4ZL9 A;  2YV7 A;  3I9V 2;  3D4M A;  1SKR B;  1THX A;  5ECO B;  5KN1 A;  5KN0 A;  2X8G A;  4OWY A;  1EV9 A;  4X1U A;  4FO5 A;  5IMD A;  3DML A;  5HR2 A;  1YZX A;  2JZS A;  4NPB A;  2GQM A;  3P7X A;  4XHM A;  1J08 A;  2H71 A;  2PBJ A;  4AF2 A;  2HFD A;  4OFM A;  5G1K A;  3IXR A;  1B9X C;  5F06 A;  4EL1 A;  2JAC A;  3EYT A;  2H1G A;  2MBS A;  1OAZ A;  3IK7 A;  4ZIJ A;  3BCK A;  2DJ2 A;  2K18 A;  1Z7R A;  4KCE A;  4TW5 A;  2CAQ A;  2WFC A;  2GT6 A;  4H86 A;  5E4W A;  3Q74 A;  1V98 A;  4PXO A;  6GSX A;  2KHP A;  1VRS D;  3HXS A;  3IC8 A;  3ZIJ A;  4FQU A;  4GSS A;  2AAW A;  2C3N A;  5CRG A;  2NPB A;  3FHK A;  3IDV A;  5D9X A;  3GH6 A;  2YZH A;  3UOM A;  3PPU A;  3CRT A;  4KND A;  2VCV A;  2L6C A;  2N5B A;  1GTB A;  2WRT A;  1PQN A;  2EIQ A;  2X4A A;  2PMT A;  3KIJ A;  5KOX A;  2IME A;  4RI7 A;  2A2R A;  5F8B A;  5FT3 A;  1B48 A;  1FAA A;  4GST A;  4YKG A;  1G7E A;  1G7O A;  1PL2 A;  4BA7 A;  3MAK A;  1GUK A;  1GTA A;  2MMA A;  2FD3 A;  3VK9 A;  1AAZ A;  5ABR A;  3UJ1 A;  4PGT A;  2NDO A;  1ZYQ B;  4KAE A;  5DDL A;  2JU5 A;  4TOP A;  2RII A;  1M7T A;  1F9M A;  3N5O A;  4Z2T A;  4F03 A;  4MZB A;  1Z3E A;  5D9V A;  4I2T A;  3EE2 A;  4NAX A;  3F0I A;  4WR5 A;  1FVK A;  1HD2 A;  5CNW A;  6GSV A;  3GH9 A;  5DBQ A;  4MJB A;  2XBQ A;  2IL3 A;  4O7H A;  1XOB A;  3KXO A;  4IN0 A;  3UBL A;  4XS4 B;  1SJI A;  1NSW A;  5DAL B;  3WYW A;  3GUS A;  4IP6 A;  5D9T A;  4N11 A;  1XBS A;  4NV2 A;  2C80 A;  4MJC A;  5KOW A;  4PUR A;  3CSJ A;  1K0D A;  4TR1 B;  1ZCP A;  4IW9 A;  1N8J A;  3VPQ A;  4Z7X A;  1N2A A;  4L8E A;  3CSI A;  4XS4 A;  5B8A A;  1PGT A;  5DAL A;  4ZB9 A;  1SU9 A;  3J7Y b;  3C73 A;  3H8Q A;  3LYK A;  1QMV A;  4IKH A;  2GTU A;  2OJL A;  3TJB A;  13GS A;  2LKU A;  3TKS A;  1ZYE A;  1TRS A;  2RLI A;  4WBJ A;  5IOW A;  1F37 A;  5ECL B;  1UC7 A;  1AXD A;  4BVX A;  3ZFL A;  3FW2 A;  2PWJ A;  4KB3 A;  1TI1 A;  5DVB A;  1Z7P A;  3GL5 A;  1SKS B;  1A0F A;  4WBR D;  5AIX A;  1TXX A;  4MMM A;  5H5Q A;  3ZMK A;  1T4Z A;  4KX4 A;  2TIR A;  3VWX A;  3UL3 A;  3FEU A;  3L9V A;  3GST A;  2E7P A;  2CVB A;  4IP1 A;  4POM A;  3I6A A;  3D6I A;  5D9W A;  3KMO A;  2WS2 A;  3W8S A;  1GSU A;  3QAW A;  5J5N A;  2GSR A;  4NWY A;  2YAN A;  2EIR A;  1A23 A;  3M1G A;  4K8M A;  1XFL A;  3RAZ A;  4XRD A;  3TKQ A;  4HS1 A;  1K0N A;  5KN3 A;  2KUC A;  3D22 A;  2K8V A;  2YJH A;  2PVO C;  2JAD A;  3TKS C;  1UVZ A;  3GUR A;  1A8Y A;  1SL2 B;  4OFN A;  2JZT A;  1XCC A;  3CTG A;  4RUV A;  4K6X A;  2WJU A;  3KH7 A;  2HLS A;  3E3E A;  2AHE A;  3LWA A;  3APQ A;  3GTU B;  2QA2 A;  1OC9 B;  4XIH A;  2C3Q A;  2OKA A;  2VM1 A;  2BJX A;  2GVP A;  3ZL5 A;  2RM5 A;  4KW6 A;  2CA8 A;  4GLT A;  3GTU A;  4TR3 A;  3P2A A;  3KM6 A;  4ICY A;  3GYK A;  3DVW A;  3H79 A;  4PX1 A;  2LS5 A;  2YPM A;  3M3M A;  5DCH A;  4KF9 A;  2EIO A;  1R7H A;  4MF5 A;  1EGR A;  4OMV A;  4ZBD A;  1DE2 A;  2GSQ A;  4MF6 A;  3RHC A;  2GDR A;  2L5L A;  2PVQ A;  2KLX A;  3ME7 A;  3BJ5 A;  4EF0 A;  3FZ5 A;  4KDY A;  3RDW A;  17GS A;  2IN3 A;  4IS0 A;  1FG4 A;  3GV1 A;  3TJJ A;  4EC0 A;  3A2X A;  4K0N A;  2CV4 A;  1JHB A;  3K8N A;  4RQX A;  2MMN A;  3IRA A;  3TKP A;  5H5R A;  1BED A;  1HQO A;  3KP8 A;  5D93 A;  5CRH A;  5GST A;  2C3T A;  4V2N A;  3FMW A;  3I43 A;  3F3Q A;  2ZUP A;  3M9J A;  4EVM A;  5BMU A;  2YP6 A;  4AJ8 A;  5G5F A;  1KTE A;  1FHE A;  4J56 E;  4ZB8 A;  3HVV A;  4EDY A;  3IAM 2;  5G1L A;  1U3A A;  4PQ1 A;  2HSM A;  5G31 A;  3R2Q A;  2FUG 2;  2LRN A;  2IMD A;  2A4H A;  2HRN A;  2DIZ A;  1ERW A;  3A2V A;  3W6G A;  4MK3 A;  3ME8 A;  4JR4 A;  4K7O A;  3LYP A;  4IQ1 A;  1TK8 B;  4OFT A;  2CVD A;  1OE7 A;  3WGE A;  1S3A A;  4IHU A;  4XCS A;  5B7C A;  5EVO A;  4N30 A;  2LV3 A;  4G9H A;  2C8U A;  4EE0 A;  3GA4 A;  18GS A;  2X49 A;  5C00 A;  3ERG A;  1WP0 A;  1GUL A;  1C72 A;  3BCI A;  4EKZ A;  4ML6 A;  1W4V A;  1R4W A;  1GTU A;  1RQM A;  1A8L A;  4HEA 2;  1J0F A;  4IEL A;  3FZ4 A;  4A5P A;  2IMI A;  1JLW A;  6GSW A;  3QDN A;  3LG6 A;  1J9B A;  4Q5Q A;  4LMW A;  4MZW A;  1OC3 A;  1XPV A;  1T00 A;  3U5R E;  4GCI A;  1AQX A;  2LRT A;  4TVE A;  2ON5 A;  1GSQ A;  4XRA A;  1YEP A;  3HY2 A;  3ISO A;  5IOX A;  3UMA A;  1R5A A;  1M99 A;  5J41 A;  5D8I A;  1K0M A;  4IVF A;  4K5R A;  2MZC A;  4MH3 A;  4TRX A;  5ECM B;  1QGV A;  3MNG A;  1X5C A;  2EC4 A;  3P90 A;  2YV9 A;  3IBH A;  4KUN A;  5B6N A;  4O5Q A;  2B6M A;  3LXT A;  3NIV A;  5A4U A;  4WF4 A;  2H19 A;  3IR4 A;  2X64 A;  1GH2 A;  4F2I A;  4QL9 A;  2D2Z A;  4X43 A;  1X5D A;  4V2M A;  1TP9 A;  4I6X A;  2G0F A;  3TKR A;  2IMF A;  5JCU A;  5J9C A;  4ZL7 A;  4AJ6 A;  3NOF A;  3GKM A;  4PTS A;  3ERF A;  2RUE A;  5A4W A;  2DIY A;  2XPD A;  5JWO B;  1AUC A;  4CY8 A;  1FW1 A;  3DD3 A;  3F6F A;  3Q19 A;  4DSR A;  1XWB A;  5GSS A;  1NHO A;  2HXK A;  5DQS A;  3FZ9 A;  4LA1 A;  3UAP A;  3FYG A;  5COH A;  3VI5 A;  4ULX A;  1WOU A;  1ON4 A;  2VCT A;  5HFG A;  4TR4 A;  1V2A A;  2H70 A;  2B7K A;  3SBC A;  1GNW A;  4KA0 A;  3GNJ A;  2MMO A;  2IMK A;  3PH9 A;  3EPT A;  1SEN A;  10GS A;  3TJK A;  4K1F A;  5G2Z A;  3BD2 A;  1R5P A;  4POL A;  2R5G A;  3I69 A;  2DLX A;  3ZVJ D;  2B1K A;  2RM6 A;  3GN3 A;  3KTB A;  4RQR A;  3HVX A;  1M9A A;  1NW2 A;  5EL8 A;  1EV4 A;  1MDI A;  3M8N A;  3UVH A;  1E2Y A;  3HD5 A;  1O73 A;  4CHS A;  2VAF A;  3UAR A;  4DVC A;  3MDK A;  4G0K A;  3QD9 A;  2ZNM A;  3CMI A;  3EWL A;  3W8J A;  5E59 A;  1EGO A;  2OAC A;  2H1B A;  2FA8 A;  4HQZ A;  4DSS A;  1FOV A;  1OKT A;  3F6D A;  4X0X A;  2FCH A;  4EUY A;  4NHZ A;  3TUE A;  2V6K A;  3WT1 A;  2DJJ A;  1YKA A;  5ECR B;  2R3X A;  4N10 A;  2H1D A;  1V58 A;  3VWW A;  1IYI A;  4ECJ A;  3ED3 A;  4X4J A;  2VUP A;  3WD6 A;  3F4T A;  1GRX A;  2VO4 A;  1SK2 A;  2R2J A;  1EOG A;  4MAB A;  3LW9 A;  3APO A;  1F3A A;  3A5I A;  2H66 A;  1E6B A;  3C71 A;  1K3L A;  3PIN A;  4GQF A;  4G10 A;  1ERT A;  5ECH B;  3IK9 A;  3ZVJ A;  1S3C A;  1TJD A;  1PRX A;  7GSS A;  3TGZ A;  3WGD A;  2A2P A;  3QPM A;  3ZFB A;  3IV4 A;  3UBK A;  1T3B A;  3IPZ A;  4ISD A;  3UIW A;  2L5O A;  5CRE A;  4HJ2 A;  1GNE A;  2H6Z A;  1YQ1 A;  3GHA A;  4F82 A;  3IHQ A;  3NZN A;  4ZBB A;  1DE1 A;  3GKN A;  4JU5 A;  3H1N A;  1MDJ A;  1TDI A;  2GS3 A;  3LEF A;  4J2F A;  1IYH A;  4GXZ A;  4PQI A;  1HYU A;  2AYT A;  4O92 A;  2V41 A;  4MPG A;  1A0R P;  4WF5 A;  6GSS A;  1OYJ A;  2PN8 A;  2UZ8 A;  3GIX A;  3GKX A;  1SJZ A;  3G9B A;  1K3O A;  2R0G A;  5ECI B;  2MBT A;  2E2G A;  3QFB C;  1LBK A;  4HOJ A;  1LU4 A;  4L0U A;  1XW5 A;  2BTO T;  2H75 A;  2DKI A;  2GZY A;  2YCD A;  2A4V A;  2VL3 A;  5B8B A;  3TB2 A;  2F51 A;  4WKW A;  4TR0 A;  2QC7 A;  3HZ4 A;  1PSQ A;  2ALB A;  2OBK A;  4GTU A;  5A5K A;  1QXH A;  2WDU A;  2P5Q A;  1EWX A;  2VLU A;  1EP7 A;  4I8B A;  4BVX B;  4K2D A;  1DSB A;  3SWL A;  4ZBA A;  4ML1 A;  1JZR A;  3F8U A;  2B1L A;  2M80 A;  3Q18 A;  2FWE A;  20GS A;  4Q5F A;  1Y25 A;  5IM9 A;  4ECB A;  2H1A A;  1Z6M A;  1GLQ A;  2L6D A;  2C0E A;  3FR6 A;  3TOU A;  1QFN A;  1ACV A;  4HU7 A;  1RW1 A;  2FWH A;  3VI7 A;  3KTL A;  2HNL A;  2GSS A;  5AN1 A;  2I9H A;  4JRR A;  4KSO A;  6GST A;  1GUH A;  3GL3 A;  3ZZX A;  4K7N A;  3O76 A;  4GRF A;  1SJ6 A;  3DIE A;  1VF4 A;  2IJY A;  4D73 A;  3EU3 A;  4ILF A;  3RHB A;  1VF2 A;  3HJO A;  5JCW A;  3ZML A;  2CX3 A;  3HZ8 A;  5J9B A;  1XVQ A;  5AGY A;  1TK0 B;  4BWS A;  3APS A;  4NMU A;  2YWM A;  2CX4 A;  4RI6 A;  3VFI A;  4E8H A;  2BMX A;  4E8E A;  2VCW A;  2LJA A;  3H93 A;  1GTI A;  2OA7 A;  2HZF A;  4CDO A;  2R4V A;  2OE0 A;  11GS A;  2HE3 A;  3FY7 A;  4MDC A;  1MD3 A;  4ACS A;  1TU7 A;  1G6W A;  2REM A;  2V1M A;  1Z6N A;  4KGI A;  16GS A;  1X0R A;  5ECP B;  1YKC A;  1AW9 A;  4QQ7 A;  5HR1 A;  1QK8 A;  1ILO A;  4JE1 A;  2F8F A;  2C0G A;  2GQL A;  3RPP A;  4DEJ A;  4Q5N A;  3MYD A;  2DJ0 A;  3G7I A;  2DJ3 A;  4LL1 B;  4IGJ A;  1U87 A;  3DYR A;  4AJ7 A;  1ZOF A;  3FR3 A;  1NM3 A;  4HU9 A;  1BYE A;  4KSM A;  3AY8 A;  2E0Q A;  1ERU A;  3WGX A;  1SYX A;  1PN9 A;  3FKF A;  9GSS A;  1FO5 A;  1SD8 A;  5FHI A;  2VL9 A;  2K6V A;  4OCE A;  1V9W A;  1O6J A;  5CRD A;  2O87 A;  2H76 A;  3MWH A;  2O8V B;  1USB A;  2OE3 A;  1T7P B;  3GFK A;  4KDX A;  1WJK A;  2B5X A;  3QR6 A;  3BOA A;  5GZZ B;  1Q4J A;  2FY6 A;  1URM A;  3ZLP A;  2X8C A;  3C1R A;  1YJ6 A;  5ELG A;  1AC1 A;  1OKD A;  5G30 A;  2AV4 A;  4HZ2 A;  2DJ1 A;  1PX7 A;  1MDK A;  2E2M A;  2H6X A;  4P3Y B;  4USS A;  2AJQ B;  4MJA A;  1EEJ A;  4BWQ A;  1GL8 A;  3KGK A;  2HT9 A;  2LUS A;  1EOH A;  3GMF A;  1F2E A;  3G7J A;  5IMZ A;  5IO0 A;  2XC2 A;  2O7K A;  1TI3 A;  5CRW A;  2H72 A;  4FIW A;  1TRU A;  1O85 A;  3A3T A;  1A2M A;  2HRA A;  3KJY A;  3FRC A;  3OR5 A;  3EMP A;  2WCI A;  5LCZ A;  2OE1 A;  1XW6 A;  4FYC A;  4KH7 A;  1W89 A;  3PGT A;  1PD2 1;  4LL4 B;  2H6Y A;  2OBI A;  3TCO A;  1PN0 A;  2C1Y A;  3VWV A;  3GKK A;  1SK1 A;  2VCQ A;  5J4U A;  1Q98 A;  1B4Q A;  4V1A g;  4V1A p;  2IIY A;  4Z2U A;  2YZU A;  4BL7 B;  1H4O A;  2L59 A;  2YWI A;  1UA5 A;  4HJM A;  2CZ3 A;  1B9Y C;  2DML A;  4K2X A;  1YEX A;  2TRX A;  1S3D A;  4KDU A;  5B6M A;  2N5F A;  4POB A;  3UEM A;  1GSE A;  1O8X A;  2GQK A;  4GQC A;  3CTF A;  3HYP A;  4BL7 A;  1EZK A;  4TXO A;  1O81 A;  2ON7 A;  1Y6E A;  2B3S A;  1V57 A;  4HQS A;  1PKW A;  4Q5R A;  3CXG A;  3LQ7 A;  1PKZ A;  2WUL A;  3PR8 A;  5BRT A;  1HNB A;  5F05 A;  3GX8 A;  4L5L A;  2H74 A;  4PNF A;  5CP1 A;  3LJR A;  1ERV A;  4CW9 A;  1ZL9 A;  4OD7 A;  3F4S A;  4MPF A;  2C0D A;  4K0G A;  3KD0 A;  4NHW A;  4YQU A;  2DBC A;  1YDK A;  5DJL A;  6GSU A;  1XXU A;  3VPT A;  4YAV A;  3WT2 A;  5D96 A;  3L0H A;  1JZD A;  2FWG A;  4PQH A;  5KEJ A;  1ZMA A;  5L71 A;  4MF7 A;  1QUW A;  4QL7 A;  1XZO A;  4G19 A;  1CQH A;  2H0H A;  2YJ7 A;  3V1W A;  1DBY A;  1M0U A;  4ZB6 A;  1EEM A;  5IQY A;  1XOA A;  4O5R A;  5ID2 A;  1WWJ A;  2F8A A;  4K7I A;  3O6T A;  2FNO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...