4FH8A

Crystal structure of peroxiredoxin-1 from the human hookworm ancylostoma ceylanicum
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
171
structure length
171
Chain Sequence
HMSKAFIGKPAPDFATKAVFDGDFVDVKLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSDRFPEFKNLNVAVLACSTDSVFSHLAWINTPRKHGGLGDMKIPVLADTNHQIAKDYGVLKDDEGIAYRGLFIIDPKGILRQITINDLPVGRSVDETLRLVQAFQYTDKHGEVC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AcePrx-1
publication title Peroxiredoxin-1 from the Human Hookworm Ancylostoma ceylanicum Forms a Stable Oxidized Decamer and Is Covalently Inhibited by Conoidin A.
pubmed doi rcsb
source organism Ancylostoma ceylanicum
molecule tags Oxidoreductase
total genus 53
structure length 171
sequence length 171
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2012-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00578 AhpC-TSA AhpC/TSA family
A PF10417 1-cysPrx_C C-terminal domain of 1-Cys peroxiredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4fh8A00
3L9VA 1E6BA 3HYPA 4DSRA 1DBYA 1EGOA 5GSTA 2HRNA 1O85A 1K3YA 2KHPA 6GSVA 3TOTA 2H1AA 2F8AA 2YOIA 3PINA 1GL8A 5AIXA 4MH3A 1TK0B 1V57A 2XPEA 1YKCA 2OADA 1SKRB 1B8XA 1K0DA 1Z9HA 5B8BA 4H86A 4IHUA 3EINA 1GULA 2LJRA 4POLA 2VCZA 3MSZA 3FW2A 3VK9A 2E0QA 2K6VA 3DVXA 1NHYA 1FHEA 1MD4A 1ON4A 2NVLA 2H75A 3I43A 3FRCA 5D96A 1X9SB 1GTBA 5DJMA 3HY2A 3H79A 4NMUA 1EOHA 2IPAA 3G7JA 4N30A 4PXOA 3FR3A 1XPVA 3M8NA 2MYGA 5CAXA 5IOXA 4LLRA 20GSA 1PSQA 1EV9A 1N8JA 4GSSA 2EIRA 2ES7A 3TJFA 18GSA 5DJLA 4MMMA 5F05A 6GSYA 1G7EA 3S9FA 2V32A 1TK8B 4GRFA 2B5EA 4PX1A 3HXSA 2FNOA 3TKPA 3VWXA 2JZRA 2M80A 2C0DA 4BPYA 3EMXA 2VO4A 4L8EA 2R5GA 5KN3A 5ECHB 4XTSA 2X8HA 2WB9A 5CRHA 1FVKA 1TRVA 1QK8A 3ZREA 1FB0A 3IK7A 4PGTA 1A2MA 1GSEA 3QAVA 5B7CA 4BWSA 3QMXA 1K0AA 3LYKA 1THOA 2KUCA 1VGLA 1ERTA 1YDKA 4WETA 3TJJA 3ZMLA 1SYXA 3A2WA 3QOUA 5IMCA 3DMLA 4ISDA 3DVWA 2HSYA 1SJ6A 1A8YA 2FCHA 2B3SA 4ULXA 2WZ9A 1T4YA 2LEGA 2GQLA 5IPHA 4WR5A 2JADA 3SBCA 4EUYA 2ON5A 3O6TA 1K0NA 4XS6A 1PKWA 1XOAA 2XBQA 4J57E 2B7JA 2DJ0A 4HZ2A 4NV5A 3FYGA 3FHKA 5DAKB 2VM1A 4POMA 4NPBA 1TOFA 3KCMA 2IMEA 4GF0A 4PNGA 4PQIA 4JU5A 3BBYA 4AGSA 4IGJA 3Q74A 1Z5YE 5EVOA 3L9UA 2LRCA 5JWOB 2C8UA 2YPMA 4MJCA 3HDCA 1Z7PA 1ZZYA 2FY6A 2EC4A 1K0MA 17GSA 4WF5A 4IKHA 4LL1B 2OE1A 4MF7A 5LD0A 2HYXA 1ERVA 4LA1A 4CHSA 2ZNMA 2E7PA 5CP1A 2FWGA 3J7Yk 2WULA 1O81A 4GSNA 4KE3A 2R3XA 4DSQA 2YNXA 4O7HA 4KNDA 1OC3A 3UARA 4HS1A 2GS3A 4NAXA 1HYUA 3KMOA 4ZILA 3D6IA 3ZTLA 1SYRA 4DSSA 2H1GA 1GTAA 3GX0A 3IAM2 4TR1B 1JLWA 5D9VA 1NM3A 3GKMA 2HNLA 2AUVA 3ZMKA 3UOMA 1TU8A 3HZ4A 4TR4A 5IMDA 3CTFA 2QKEA 1C72A 1M99A 1K3LA 2LV3A 1RW1A 4AF2A 2I4AA 3GNJA 1QGVA 2P0GA 3GRXA 3ED3A 3DRNA 2DMLA 4L5LA 2M72A 2PUKC 2LJKA 3TJBA 1F3AA 2LQQA 2G0FA 2VL2A 1X5DA 1FVJA 5A5KA 5ECIB 5DVBA 1PD21 2RM5A 1KNGA 1T7PB 1XCCA 2H6ZA 4KSOA 1USBA 5AN1A 2LRTA 1XWGA 4L0UA 4XRDA 4BWQA 2PVQA 5CYYA 1CQGA 3GTUB 2H6YA 3TRPA 3KD0A 2VIMA 4RI6A 2VCWA 3E9JB 1U87A 2K8SA 1YKAA 4ECIA 1OE8A 4MZBA 2VL3A 2LNSA 2AHEA 2RLIA 2H73A 4X1UA 3FEUA 2R37A 3HZ8A 3F6FA 4KDUA 3IDVA 1GUHA 1DE2A 4ZB6A 1B4PA 1TU7A 4I5QA 1XVWA 13GSA 4F0CA 2IL3A 3H93A 2A4VA 2WDUA 4RQXA 4YQUA 1Y6EA 2CA8A 4IW9A 1GUMA 1WIKA 4OWYA 5HR0A 4HU7A 5F0GA 1GSQA 2C3NA 5C00A 3E3EA 5IO2A 5GAPD 5ABRA 1N2AA 4ZBAA 3WD6A 4DEJA 3DGQA 4ZBDA 4I2TA 5DBQA 3CSHA 2M46A 1TRSA 4IVFA 2F51A 2FWFA 3QAWA 5AGYA 4MDCA 3C71A 3D22A 4JEDA 4YH2A 2ZUPA 3F9UA 1SD8A 2FGXA 1J0FA 3IA1A 3ISOA 3VFIA 1MDJA 1PKZA 3KIJA 1SJZA 2LUSA 1X9MB 3KP9A 5H5QA 1EGRA 3HCZA 1NW2A 5DALA 2WGRA 2A2RA 4Q5NA 3ZVJA 2MMAA 1OC8A 1EZKA 3EURA 4Z7XA 2I81A 3GUSA 2IWTA 4E8HA 2E2MA 1TK5B 4KSMA 1T4ZA 2IMDA 4KUNA 1GLPA 2EIQA 1DSBA 4HZ4A 4IP1A 3F4SA 2JSZA 3NIVA 3UMAA 3HJPA 1Q98A 1XOBA 2GT6A 3GTUA 4KDYA 3F4TA 4GWRA 1VF1A 3C73A 4D73B 1S3DA 2YCDA 2I3YA 4NHZA 2H8LA 3JCML 4KAEA 3IK9A 1ZYEA 4JR4A 2LJAA 3EU3A 5FT3A 2GTUA 4L5OA 4ZIJA 1ZCPA 2DMMA 1B4QA 2B1KA 2KOKA 3CTGA 3ZL5A 3SWLA 2CVKA 4DVCA 1BYEA 2CAQA 5IOWA 1F37A 1B9YC 1VF3A 2KLXA 4TR3A 4POBA 5AISA 4Q5FA 2PMTA 3VI7A 5DDLA 4IJIA 4OCFA 2C3QA 1PQNA 2GZYA 3J7Yb 3O76A 1GSSA 2MMOA 3TGZA 2F3MA 3LWAA 3W8SA 2HXKA 4OO5A 3KGKA 1G6YA 2NTOA 4GQFA 2AV4A 5LNKe 4LL4B 4PUAA 1XWCA 1G7OA 3GV1A 1ILOA 1M2AA 1SK0A 2E2GA 5CRGA 4EDYA 3RBTA 2H19A 3ZIJA 2V1MA 1NSWA 4GTUA 4K0NA 4XS4A 1FB6A 3A2XA 1XW5A 3ERGA 1R5PA 4I2UA 5CNWA 2LKUA 3GA4A 1A0RP 1VF4A 2CZ2A 4IBPA 2V2GA 3IV4A 1J9BA 4O5RA 1DUGA 1TI3A 5EL8A 1WWJA 1K3OA 1BQ7A 1MEKA 4EL1A 3APQA 4ZL7A 1Z6MA 3LQ7A 3PH9A 3GN3A 4D73A 1Z7RA 2H71A 5HFGA 2G2QA 4CDOA 3LORA 1WRYA 5ECNB 3RHBA 2IMIA 9GSSA 1OKDA 5J9CA 1OC9A 3TCOA 1OAZA 4JE1A 2VLUA 1T1VA 3R2QA 3TKSC 1KEBA 2PU9C 3G7YA 4P3YB 4ZB9A 3Q18A 2H0IA 4L0WA 4ZB8A 2H1DA 2BTOT 4IELA 4MF5A 4FYBA 4KDXA 4HJ2A 4PQHA 3VWVA 4NWYA 3BOAA 4MJAA 1A24A 2C3TA 2K9FA 5ECQB 1GNEA 3LJRA 4MZCA 4YAPA 5IIZA 4IQ1A 1FAAA 3D21A 2RM6A 4GQCA 2GDRA 1SK2A 5D9XA 1LJRA 4DSSB 3A2VA 3I9V2 1T00A 1G0TA 5IO0A 3A5WA 2HI7A 3IC4A 5D9WA 3RDWA 2H30A 4BVYA 3G9BA 3QPMA 1X0RA 3TB2A 4ZXGA 5CRWA 2H0GA 3TDGA 2O85A 2WJUA 3QD9A 2H01A 3MWHA 1H75A 1V9WA 1UC7A 1RQMA 2B7KA 1YF0A 2YZHA 5G5EA 2DBCA 2C0GA 4F03A 3IPZA 3MDKA 1FOVA 4HUAA 1YY7A 4MJEA 1PRXA 3M9KA 1V98A 1X5CA 1UVZA 5KEJA 1V2AA 3C1RA 2TIRA 3NZNA 1BX9A 2O7KA 3EC3A 4AJ8A 2PVOC 3HVVA 4EC0A 2H76A 3U5RE 1SENA 1HQOA 2VCVA 1JHBA 5JCUA 3KMNA 3RPPA 2ALBA 1R5AA 2OE0A 4HJMA 1R7HA 1R4WA 5ECKB 3EVIA 1AXDA 2YV9A 3FR6A 4K1FA 3F6DA 3PR8A 3EU4A 2PGTA 3VPQA 4MK3A 2PWJA 3KH7A 3I6AA 2H70A 5A4VA 3OR5A 3FZ4A 2ON7A 2IIYA 2PBJA 4BL7A 2YWOA 3DWVA 5G31A 4F82A 2B5XA 2DIYA 5ECOB 4KX4A 3QR6A 1XWBA 4K7NA 3U6VA 2L6CA 5HFIA 1XW9A 3H8QA 2GSQA 5KN2A 4V2NA 5HFKA 2JU5A 5L71A 1TJDA 4IS0A 2OJLA 1WE0A 3TUEA 3EMPA 2AB6A 3D0ZA 4F2IA 2RIIA 3CXGA 5J3RA 1A0FA 2VCTA 1AQXA 1GTUA 5ECPB 5DALB 4N11A 3BJ5A 5D8IA 3QFAC 4HQZA 1QQ2A 1XZOA 2P5QA 3BD2A 4ML1A 3HJOA 3WT1A 3CRUA 2XBIA 3M1GA 1XFLA 4OMVA 2VLTA 5J41A 1XVQA 3EWLA 1EOGA 2DJJA 3TKQA 2YJ7A 1MDIA 3HJMA 3EE2A 2WFCA 5G2ZA 1HNBA 3GSSA 1PX7A 1Z3EA 4TR0A 2GZZA 2GSRA 2P5RA 4NXIA 4KH7A 1WJKA 4GXZA 3F8UA 4K7IA 1K0BA 1O7UA 1S3CA 2PERA 3K8NA 1M7TA 2IFQA 5IMZA 2YWMA 4XS1A 3UJ1A 4YAVA 3D4MA 3VWWA 3ZVJD 2HLSA 5ECMB 1GNWA 1S3AA 4I8BA 2OA7A 2YP6A 4K8MA 2L4CA 1KTEA 3KZQA 2L4QA 2WRTA 2V6OA 4WKWA 1ACVA 4BA7A 2VOCA 2CX4A 1SL0B 2NBSA 1W89A 3GFKA 4GSTA 3FKFA 4RUVA 4OFTA 3UBLA 1GSUA 1U3AA 4KA0A 1TDIA 3LXZA 4WBRD 2V6KA 4OFNA 3ZRDA 3KTBA 3V1WA 2GQKA 4EVMA 2O87A 3VPTA 1IYIA 1JZRA 5FWGA 1THXA 1PX6A 1SU9A 1M0UA 3IAS2 4N0ZA 3VWUA 3GSTA 5JWQB 1ABAA 4GLTA 2X99A 3LXTA 3M9JA 1GUKA 1ERUA 1JFUA 4I97A 19GSA 2O89A 1SKSB 3H4KA 1E2YA 3QFBC 2CV4A 3GX8A 4JRRA 5B6MA 2AYTA 3CSIA 1O73A 4XS4B 1GSYA 1SK1A 4AJ7A 3TRQA 1GH2A 1WPIA 5D73A 5ECLB 3LG6A 1AAZA 3CRTA 3GKKA 3GKNA 2OBIA 4X43A 3TJKA 2F9SA 2NPBA 3IHQA 1R26A 4QL9A 2JZTA 3BCIA 2JZSA 5H5RA 3GIXA 1F3BA 5COHA 1OYJA 3Q6OA 2J23A 4O92A 1M2DA 2CVDA 5IMFA 4MZWA 3IBHA 3GYKA 2H74A 3QCPA 3CSJA 3TKSE 3F3RA 3HVSA 6GSSA 5IMVA 4POKA 3RAZA 2GQMA 3AY8A 3ZIVA 4KB3A 3M0FA 1G6WA 1LBKA 2HFDA 2R2JA 4JZQA 1ZGNA 4J56E 4OD7A 1XW6A 3KTLA 1JZWA 1OC9B 4G19A 4K9ZA 3N5OA 5CRDA 2HT9A 1XWKA 3F0IA 4LMVA 4N0VA 4TXOA 2KP2A 1B48A 2YZUA 1NHOA 1TRWA 5DCHA 4XHMA 4KW6A 5JCGA 1M9BA 1MD3A 2H1BA 3C7MA 3NOFA 5GZZB 2RUEA 3QDNA 3GHAA 2B5YA 4N10A 2L57A 1EP7A 4V1Ap 1F9MA 1BEDA 2IMFA 1GSFA 1VF2A 4HOJA 3M3MA 3F63A 2L5LA 3DD3A 4LMWA 5G1KA 1RK4A 1QUWA 1AIUA 3Q19A 3ZFBA 3ZFLA 2LRNA 1H4OA 1YEPA 2VD1A 4WBJA 2J9HA 4G9HA 2HRFA 4V2LA 1ZOFA 4RI7A 6GSTA 6GSWA 3DIEA 2YANA 1IYHA 2DJ3A 5HR1A 4MCUA 5IM9A 1V58A 2CQ9A 1TRUA 1OKTA 3MAKA 3D5JA 4XRAA 1OE7A 4EO3A 1HNAA 3LSZA 2BJXA 3VI5A 2C80A 4TKYA 2QSIA 3L9SA 4WXTA 4JBBA 2AJQB 4MH2A 1VRSD 3L0HA 1XXUA 4V1Ag 5CO3A 2CZ3A 2YN1A 5ENUA 3LYPA 3P90A 2WCIA 1WOUA 2GVPA 5ECSA 1EEJA 2H66A 4MA9A 1ML6A 5J9BA 2MMZA 3HHVA 3W6GA 2V41A 4K7OA 1SKWB 4ZL9A 4TW5A 4PURA 4EDZA 3MNGA 4WR4A 2OBKA 2A2SA 1O6JA 4IN0A 4FYCA 4X0XA 3C1SA 4ZBBA 4MJBA 5J5NA 1QXHA 4PQ1A 1U88A 1CQHA 1AQWA 1WP0A 1ERWA 5HQPA 2K18A 2R6KA 1YJ6A 3ZLPA 5F06A 2LSTA 1PGTA 2FD3A 3EYTA 1URMA 4G10A 1UA5A 1XWAA 2VLVA 2H0HA 3BCKA 2YWNA 4MABA 2C0EA 2L5OA 14GSA 5KN0A 1AQVA 3US3A 1SJIA 3QAGA 1AUCA 2DC5A 1MDKA 5A4UA 3RHCA 1YF1A 2FA8A 5ID2A 2PPTA 2VCQA 1JZDA 4PNFA 3ME7A 4MPFA 2OACA 3UAPA 4IJ3A 1A23A 2B1LA 2GGTA 3W8JA 2NDOA 2FLSA 1K0CA 1YZXA 3G7IA 1JZOA 3IRAA 1SL2B 12GSA 2VUPA 2VL2C 2RUFA 1EV4A 2X64A 4ACSA 2X8CA 2JL4A 1ST9A 3KM6A 3GURA 1GWCA 4AJ6A 3GH9A 3CMIA 2C4JA 1ZMAA 4EE0A 5E59A 4Q5QA 3LFLA 4FO5A 3RPNA 3L4NA 8GSSA 1EP8A 2IFQB 3KH9A 4HU9A 2DJ2A 2N5BA 5IQYA 5INYA 5H5SA 1M2BA 1B9XC 1TTZA 3IE3A 1FG4A 3P2AA 5HR2A 2GSSA 1BAYA 1JLVA 1HNCA 1O8WA 3WGDA 3TKSA 3D4TA 4ECCA 4QL7A 3E0UA 1I9DA 1TXXA 2P31A 5CREA 4MLYA 2FWHA 1X9WB 1OVNA 3TJGA 3UBKA 2GZPA 2HSHA 5IPGA 5GAND 1FO5A 4EKZA 3GKXA 1XBSA 1F2EA 2AAWA 2CAIA 3IOSA 3VLNA 3GH6A 2GLRA 5E4WA 3TOUA 3FY7A 5KN1A 3GMFA 2B6MA 2LNTA 2JSYA 1MTCA 22GSA 1LU4A 2REMA 3UL3A 1J08A 3HD5A 3LGCA 1GTIA 2X8GA 4CW9A 4ECBA 2XC2A 4ILFA 1EEMA 1PN9A 5C04A 1TKDB 3FZ5A 4ZL8A 2I9HA 3ERWA 1M9AA 2K8VA 3UVHA 3ZITA 1W4VA 2EIOA 5G30A 3L78A 2CT6A 3WYWA 2XPDA 2YV7A 3VURA 3HKRA 2L59A 1Y25A 2HE3A 2LQOA 4ML6A 2HZEB 4EF0A 2TRXA 2ZCTA 4YQVA 4E8EA 5F8BA 5IMAA 3UEMA 5DQSA 6GSXA 2VCXA 2H6XA 2MMNA 5DAKA 4K6XA 4KCAA 1YQ1A 1WMJA 2CVBA 2GSTA 1PMTA 2DJKA 4NHWA 1Z6NA 1X5EA 4FYUA 1I5GA 2TRCP 3GL5A 3O3TA 1Q4JA 3IXRA 2PN8A 1A2LA 2WS2A 3F3QA 2DSAA 1U3IA 1BJXA 1TW9A 4GCIA 3UVTA 4Q5RA 2GT5A 2R4VA 1BG5A 1F6MC 2H72A 4V2MA 4TXOB 3FK8A 1ZYQB 6GSUA 4PUFC 5F07A 2L6DA 3UIWA 4HDEA 2N5AA 1HD2A 3APSA 2I1UA 2DLXA 1PL2A 3FR9A 3P7XA 4KGIA 2C1YA 2FUG2 1V40A 5DCGA 1A2JA 2LTKA 4MP4A 4FH8A 4TRXA 2XHFA 4JR6A 4QQ7A 4FIWA 1QMVA 5B8AA 5D9TA 4BVXA 3WGEA 3LEFA 3ZZXA 4TVEA 2CX3A 4TXVA 5LCZA 5ELGA 3ME8A 1UN2A 1KBNA 4HI7A 2YWIA 5A4WA 1EWXA 2FHEA 16GSA 4J2FA 4KCEA 4OO4A 1FW1A 4TR1A 4RQRA 5ECRB 1TP9A 4OFMA 2F8FA 3DYRA 3A3TA 3C8EA 3PGTA 4HEA2 2QGVA 2D2ZA 1AW9A 3GL3A 2Z9SA 1TI1A 4XIHA 2MZCA 7GSSA 2HZEA 5DQYA 2YJHA 4K2DA 10GSA 5J4UA 3P8WA 5G1LA 5EPFA 2BMXA 3CYNA 5B6NA 1QFNA 4XCSA 4ECJA 3DEXA 4ID0A 2JACA 3WGXA 3F4RA 4WEYA 1GP1A 2OE3A 2MBSA 5D93A 1A8LA 2VAFA 2IJYA 4IQAA 4TN8A 5AIVA 3FZ9A 3HVXA 3DXBA 1SD9A 3KJYA 2IN3A 1U6TA 4MPGA 4WF4A 3DKSA 2C0FA 2KP1A 3KP8A 4K0GA 4I6XA 2DJ1A 1O8XA 1PA3A 4YQMA 3IR4A 1T8EB 5FHIA 2IMKA 1SL1B 3CBUA 5JWRB 2HZFA 3HA9A 4HQSA 11GSA 1K0OA 4F0BA 2VL9A 3FZAA 1GLQA 1AC1A 2O8VB 3APOA 3N9JA 5EY6A 5GSSA 1YEXA 2VD0A 2OKAA 3H1NA 3I69A 3TKRA 1GSDA 2VM2A 1PL1A 2N5FA 3ERFA 3WT2A 1DE1A 4O32A 2QC7A 4NV2A 5G5FA 1ZL9A 4OCEA 4TOPA 5ID2B 5JCWA 2FA4A 5ELAA 3KEBA 3TRXA 1XIYA 3ZYWA 2DIZA 2FWEA 5HR3A 2MBTA 3KXOA 4IP6A 4EXJA 1GRXA 4G2EA 2LS5A 4F9ZA 4MF6A 1T3BA
chains in the Genus database with same CATH superfamily
3L9VA 1E6BA 3HYPA 4DSRA 1DBYA 1EGOA 5GSTA 2HRNA 1O85A 1K3YA 2KHPA 6GSVA 3TOTA 2H1AA 2F8AA 2YOIA 3PINA 1GL8A 5AIXA 4MH3A 1TK0B 1V57A 2XPEA 1YKCA 2OADA 1SKRB 1B8XA 1K0DA 1Z9HA 5B8BA 4H86A 4IHUA 3EINA 1GULA 2LJRA 4POLA 2VCZA 3MSZA 3FW2A 3VK9A 2E0QA 2K6VA 3DVXA 1NHYA 1FHEA 1MD4A 1ON4A 2NVLA 2H75A 3I43A 3FRCA 5D96A 1X9SB 1GTBA 5DJMA 3HY2A 3H79A 4NMUA 1EOHA 2IPAA 3G7JA 4N30A 4PXOA 3FR3A 1XPVA 3M8NA 2MYGA 5CAXA 5IOXA 4LLRA 20GSA 1PSQA 1EV9A 1N8JA 4GSSA 2EIRA 2ES7A 2UZ8A 3TJFA 18GSA 5DJLA 4G0KA 4MMMA 5F05A 6GSYA 1G7EA 3S9FA 2V32A 1TK8B 4GRFA 2B5EA 4PX1A 3HXSA 2FNOA 3TKPA 3VWXA 2JZRA 2M80A 2C0DA 2HRKA 4BPYA 3EMXA 2VO4A 4L8EA 3FMWA 2R5GA 5KN3A 5ECHB 4XTSA 2X8HA 2WB9A 5CRHA 1FVKA 1TRVA 1QK8A 3ZREA 1FB0A 3IK7A 4PGTA 1A2MA 1GSEA 3QAVA 5B7CA 4BWSA 3QMXA 1K0AA 3LYKA 4G0IA 1THOA 2KUCA 1VGLA 1ERTA 1YDKA 4WETA 3TJJA 3ZMLA 1SYXA 3A2WA 3QOUA 5IMCA 3DMLA 4ISDA 2QA1A 3DVWA 2HSYA 1SJ6A 1A8YA 2FCHA 2B3SA 4ULXA 2WZ9A 1T4YA 2LEGA 2GQLA 5IPHA 4WR5A 2JADA 3SBCA 4EUYA 2ON5A 3O6TA 1K0NA 4XS6A 1PKWA 1XOAA 2XBQA 4J57E 2B7JA 2DJ0A 4HZ2A 4NV5A 3FYGA 3FHKA 5DAKB 2VM1A 4POMA 4NPBA 1TOFA 3KCMA 2IMEA 4GF0A 4PNGA 4PQIA 4JU5A 3BBYA 4AGSA 4IGJA 3Q74A 1Z5YE 5EVOA 3L9UA 4CY6A 2LRCA 5JWOB 2C8UA 2YPMA 4MJCA 3HDCA 1Z7PA 1ZZYA 2FY6A 2EC4A 1K0MA 17GSA 4WF5A 4IKHA 4LL1B 2OE1A 4MF7A 5LD0A 2HYXA 1ERVA 4LA1A 4CHSA 2ZNMA 2E7PA 5CP1A 2FWGA 3J7Yk 2WULA 1O81A 4GSNA 4KE3A 2R3XA 4DSQA 2YNXA 4O7HA 4KNDA 1OC3A 3UARA 4HS1A 4BVXB 2GS3A 4NAXA 1HYUA 3KMOA 4ZILA 3D6IA 3ZTLA 1SYRA 4DSSA 2H1GA 1GTAA 3GX0A 3IAM2 4TR1B 1JLWA 5D9VA 1NM3A 3GKMA 2HNLA 2AUVA 3ZMKA 3UOMA 1TU8A 3HZ4A 4TR4A 5IMDA 3CTFA 2QKEA 2R0CA 1C72A 1M99A 1K3LA 2LV3A 1RW1A 4AF2A 1FOHA 2I4AA 3GNJA 1QGVA 2P0GA 3GRXA 3ED3A 3DRNA 2DMLA 4L5LA 2M72A 2PUKC 2LJKA 3TJBA 1F3AA 2LQQA 2G0FA 2VL2A 1X5DA 1FVJA 5A5KA 5ECIB 5DVBA 1PD21 2RM5A 1KNGA 4K5RA 1T7PB 1XCCA 2H6ZA 4KSOA 1USBA 5AN1A 2LRTA 3CQFA 1XWGA 4L0UA 4XRDA 4BWQA 2PVQA 5CYYA 1CQGA 3GTUB 4K5SA 2H6YA 3TRPA 3KD0A 2VIMA 4RI6A 2VCWA 3E9JB 1U87A 2K8SA 1YKAA 4ECIA 1OE8A 4MZBA 2VL3A 2LNSA 2AHEA 2RLIA 2H73A 4X1UA 3FEUA 2R37A 3HZ8A 3F6FA 4KDUA 3IDVA 1GUHA 1DE2A 4ZB6A 1B4PA 1TU7A 4Z2RA 4I5QA 1XVWA 13GSA 4F0CA 2IL3A 3H93A 2A4VA 2WDUA 3A5IA 4RQXA 4YQUA 1Y6EA 2CA8A 4IW9A 1GUMA 1WIKA 4OWYA 5HR0A 4HU7A 5F0GA 1GSQA 2C3NA 5C00A 3E3EA 5IO2A 5GAPD 5ABRA 1N2AA 4ZBAA 3WD6A 4DEJA 3DGQA 4ZBDA 4HSCX 4I2TA 5DBQA 3CSHA 2M46A 1TRSA 4IVFA 2F51A 2FWFA 3QAWA 5AGYA 4MDCA 3C71A 3D22A 4JEDA 4YH2A 2ZUPA 3F9UA 1SD8A 2FGXA 1J0FA 3IA1A 3ISOA 3VFIA 1MDJA 1PKZA 3KIJA 1SJZA 2LUSA 1PFOA 1X9MB 3KP9A 5H5QA 1EGRA 3HCZA 1NW2A 5DALA 2WGRA 2A2RA 4Q5NA 3ZVJA 2MMAA 1OC8A 1EZKA 3EURA 4Z7XA 2I81A 3GUSA 2IWTA 4E8HA 2E2MA 1TK5B 4KSMA 1T4ZA 2IMDA 4KUNA 1GLPA 2EIQA 1DSBA 4HZ4A 4IP1A 3F4SA 2JSZA 3NIVA 3UMAA 3HJPA 1Q98A 1XOBA 2GT6A 3GTUA 4KDYA 3F4TA 4GWRA 1VF1A 3C73A 4D73B 1S3DA 2YCDA 2I3YA 4NHZA 2H8LA 4X4JA 3JCML 4KAEA 3IK9A 1ZYEA 4JR4A 2LJAA 3EU3A 5FT3A 2GTUA 4L5OA 4ZIJA 1ZCPA 2DMMA 1B4QA 2B1KA 2KOKA 3CTGA 3ZL5A 3SWLA 2CVKA 4DVCA 1BYEA 2CAQA 5IOWA 1F37A 1B9YC 1VF3A 2KLXA 4TR3A 4POBA 5AISA 4Q5FA 2PMTA 3VI7A 5DDLA 4IJIA 4OCFA 2C3QA 1PQNA 2GZYA 3J7Yb 3O76A 1GSSA 2MMOA 3TGZA 2F3MA 3LWAA 3W8SA 2HXKA 4OO5A 3KGKA 4ICYA 1G6YA 2NTOA 4GQFA 2AV4A 5LNKe 4LL4B 4PUAA 1XWCA 1G7OA 3GV1A 1ILOA 1M2AA 1SK0A 2E2GA 5CRGA 2DKIA 4EDYA 3RBTA 2H19A 3ZIJA 2V1MA 1NSWA 4GTUA 4K0NA 4XS4A 1FB6A 3A2XA 2R0PA 1XW5A 3ERGA 1R5PA 4I2UA 5CNWA 2LKUA 3GA4A 1A0RP 1VF4A 2CZ2A 2R0GA 4IBPA 2V2GA 3IV4A 1J9BA 4O5RA 1DUGA 1TI3A 5EL8A 1WWJA 1K3OA 1BQ7A 1MEKA 4EL1A 3APQA 4ZL7A 1Z6MA 3LQ7A 3PH9A 3GN3A 4D73A 1Z7RA 2DKHA 2H71A 5HFGA 2G2QA 4CDOA 2A4HA 3LORA 1WRYA 5ECNB 3RHBA 2IMIA 9GSSA 1OKDA 5J9CA 1OC9A 3TCOA 1OAZA 4JE1A 2VLUA 1T1VA 4CY8A 4EIQA 3R2QA 3TKSC 1KEBA 2PU9C 3G7YA 4P3YB 4ZB9A 3Q18A 2H0IA 4L0WA 4ZB8A 3MYDA 2H1DA 2BTOT 4IELA 4KF9A 4MF5A 4FYBA 3HVNA 4HJ2A 4KDXA 4PQHA 3VWVA 3IC8A 4NWYA 3BOAA 4MJAA 4PTSA 1A24A 2C3TA 2K9FA 5ECQB 4Z2TA 1GNEA 3LJRA 4MZCA 4YAPA 5IIZA 4IQ1A 1FAAA 3D21A 2RM6A 4GQCA 2GDRA 1SK2A 5D9XA 1LJRA 4DSSB 3A2VA 3I9V2 1T00A 1G0TA 5IO0A 1XG8A 3A5WA 2HI7A 3IC4A 5D9WA 3RDWA 2H30A 4BVYA 3G9BA 3QPMA 1X0RA 3TB2A 4ZXGA 5CRWA 2H0GA 3TDGA 4FQUA 2O85A 2WJUA 3QD9A 2H01A 3MWHA 5BMUA 1H75A 1V9WA 1UC7A 5BRTA 1RQMA 2B7KA 1YF0A 2YZHA 5G5EA 2DBCA 2C0GA 4F03A 3IPZA 3MDKA 1FOVA 4HUAA 1YY7A 4MJEA 1PRXA 3M9KA 1V98A 1X5CA 1UVZA 5KEJA 1V2AA 3C1RA 2TIRA 3NZNA 1BX9A 2O7KA 3EC3A 4AJ8A 2PVOC 3HVVA 4EC0A 2H76A 3U5RE 1SENA 1HQOA 2VCVA 1JHBA 5JCUA 3KMNA 3RPPA 2ALBA 1R5AA 2OE0A 4HJMA 1R7HA 1R4WA 5ECKB 3EVIA 1AXDA 2YV9A 1S3RA 3FR6A 4K1FA 3F6DA 3PR8A 3EU4A 2PGTA 3VPQA 4MK3A 2PWJA 3KH7A 3I6AA 2H70A 2QA2A 1M3JA 5A4VA 3OR5A 3FZ4A 2ON7A 2IIYA 2PBJA 4BL7A 2YWOA 3DWVA 5G31A 4F82A 2B5XA 2DIYA 5ECOB 4KX4A 3QR6A 1XWBA 4K7NA 3U6VA 2L6CA 5HFIA 1XW9A 3H8QA 2GSQA 5KN2A 4V2NA 5HFKA 2JU5A 5L71A 1TJDA 4IS0A 2OJLA 1WE0A 3TUEA 3EMPA 2AB6A 3D0ZA 4F2IA 4USSA 2RIIA 3CXGA 5J3RA 1A0FA 2VCTA 1AQXA 1GTUA 5ECPB 2HSMA 5DALB 4N11A 3BJ5A 5D8IA 3QFAC 4HQZA 1QQ2A 1XZOA 2P5QA 3BD2A 4ML1A 3HJOA 3WT1A 3CRUA 2XBIA 3M1GA 1XFLA 4OMVA 2VLTA 5J41A 1XVQA 3EWLA 1EOGA 2DJJA 3TKQA 4A5PA 2YJ7A 1MDIA 3HJMA 3EE2A 2WFCA 5G2ZA 1HNBA 3GSSA 1PX7A 1Z3EA 4TR0A 2GZZA 2GSRA 2P5RA 4NXIA 4KH7A 1WJKA 4GXZA 3F8UA 2X49A 4K7IA 1K0BA 1O7UA 1S3CA 2PERA 3K8NA 1M7TA 4Z2UA 2IFQA 5IMZA 2YWMA 4XS1A 3UJ1A 4YAVA 3D4MA 3VWWA 3ZVJD 2HLSA 5ECMB 1GNWA 1S3AA 4I8BA 2OA7A 2YP6A 4K8MA 2L4CA 1KTEA 3KZQA 2L4QA 2WRTA 2V6OA 4WKWA 1ACVA 4BA7A 2VOCA 2CX4A 1SL0B 2NBSA 1W89A 3GFKA 4GSTA 3FKFA 4MNNA 4RUVA 4OFTA 3UBLA 1GSUA 1U3AA 4KA0A 1TDIA 3LXZA 4WBRD 2V6KA 4OFNA 3ZRDA 3KTBA 3V1WA 2GQKA 4EVMA 2O87A 3VPTA 1IYIA 1JZRA 5FWGA 1THXA 1PX6A 1SU9A 1M0UA 3IAS2 4N0ZA 3VWUA 3GSTA 5JWQB 1ABAA 4GLTA 2X99A 3LXTA 3M9JA 1GUKA 1ERUA 1JFUA 4I97A 19GSA 2O89A 1SKSB 3H4KA 4BIKA 2HRAA 1E2YA 3QFBC 2CV4A 3GX8A 4JRRA 4O5UA 5B6MA 2AYTA 3CSIA 1O73A 4XS4B 1GSYA 1SK1A 4AJ7A 3TRQA 1GH2A 1WPIA 5D73A 5ECLB 3LG6A 1AAZA 3CRTA 3GKKA 3GKNA 2OBIA 4X43A 3TJKA 2F9SA 2NPBA 3IHQA 1R26A 4QL9A 2JZTA 3BCIA 2JZSA 5H5RA 3GIXA 1F3BA 5COHA 1OYJA 3Q6OA 2J23A 4O92A 1M2DA 2CVDA 5IMFA 4MZWA 3IBHA 3GYKA 2H74A 3QCPA 3CSJA 3TKSE 3F3RA 3HVSA 6GSSA 5IMVA 4POKA 3RAZA 2GQMA 3AY8A 4K2XA 3ZIVA 4KB3A 3M0FA 1G6WA 1LBKA 2HFDA 2R2JA 4JZQA 1ZGNA 4J56E 4OD7A 1XW6A 3KTLA 1JZWA 1OC9B 4G19A 4G0LA 4K9ZA 3N5OA 5CRDA 2HT9A 1XWKA 3F0IA 4LMVA 4N0VA 4TXOA 2KP2A 1B48A 2YZUA 1PN0A 1NHOA 1TRWA 5DCHA 4XHMA 4KW6A 5JCGA 1M9BA 1MD3A 2H1BA 3C7MA 3NOFA 5GZZB 2RUEA 3QDNA 3GHAA 2B5YA 4N10A 2L57A 1EP7A 4V1Ap 1F9MA 1BEDA 2IMFA 1GSFA 1VF2A 4HOJA 3M3MA 3F63A 2L5LA 3DD3A 4LMWA 5G1KA 1RK4A 1QUWA 1AIUA 5KOXA 3Q19A 4BVYB 3ZFBA 3ZFLA 2LRNA 1H4OA 1YEPA 2VD1A 4WBJA 2J9HA 4G9HA 2HRFA 4V2LA 1ZOFA 4RI7A 6GSTA 6GSWA 3DIEA 2YANA 1IYHA 2DJ3A 5HR1A 4MCUA 5IM9A 1V58A 2CQ9A 1TRUA 1OKTA 3MAKA 3D5JA 4XRAA 1OE7A 4EO3A 1HNAA 3LSZA 2BJXA 3VI5A 2C80A 4TKYA 2QSIA 3L9SA 4WXTA 4JBBA 2AJQB 4MH2A 1VRSD 3L0HA 1XXUA 4V1Ag 5CO3A 2CZ3A 2YN1A 5ENUA 3LYPA 3P90A 2WCIA 1WOUA 2GVPA 5ECSA 1EEJA 2H66A 4MA9A 1ML6A 5J9BA 2MMZA 3HHVA 3W6GA 2V41A 4K7OA 1SKWB 4ZL9A 4TW5A 4PURA 4EDZA 3MNGA 4WR4A 2OBKA 2A2SA 1O6JA 4IN0A 4FYCA 4X0XA 3C1SA 4ZBBA 4MJBA 5J5NA 3MIXA 1QXHA 4PQ1A 1U88A 1CQHA 1AQWA 1WP0A 1ERWA 5HQPA 2K18A 2R6KA 1YJ6A 4BL7B 3ZLPA 5F06A 2LSTA 1PGTA 2FD3A 3EYTA 1URMA 4G10A 1UA5A 1XWAA 2VLVA 2H0HA 3BCKA 2YWNA 4MABA 2C0EA 2L5OA 14GSA 5KN0A 1AQVA 3US3A 1SJIA 3QAGA 1AUCA 2DC5A 1MDKA 5A4UA 3RHCA 1YF1A 2FA8A 5ID2A 2PPTA 2VCQA 1JZDA 4PNFA 3ME7A 4MPFA 2OACA 3LW9A 3UAPA 4IJ3A 1A23A 2B1LA 2GGTA 3W8JA 2NDOA 2FLSA 1K0CA 1YZXA 3G7IA 1JZOA 3IRAA 1SL2B 12GSA 2VUPA 2VL2C 2RUFA 1EV4A 2X64A 4ACSA 2X8CA 2JL4A 1ST9A 3KM6A 3GURA 1GWCA 4AJ6A 3GH9A 3CMIA 2C4JA 1ZMAA 4EE0A 5E59A 4Q5QA 4O5QA 3LFLA 4FO5A 3RPNA 3L4NA 8GSSA 1EP8A 2IFQB 3KH9A 4HU9A 2DJ2A 2N5BA 5IQYA 5INYA 5H5SA 1M2BA 1B9XC 1TTZA 3IE3A 1FG4A 3P2AA 5HR2A 2GSSA 1BAYA 1JLVA 4YKGA 1HNCA 1O8WA 3WGDA 3TKSA 3D4TA 4ECCA 4QL7A 3E0UA 1I9DA 1TXXA 2P31A 5CREA 4YKFA 4MLYA 2FWHA 1X9WB 1M3IA 1OVNA 3TJGA 3UBKA 2GZPA 2HSHA 5IPGA 5GAND 1FO5A 4EKZA 3GKXA 1XBSA 1F2EA 2AAWA 2CAIA 3IOSA 3VLNA 3GH6A 2GLRA 5E4WA 3TOUA 3FY7A 5KN1A 3GMFA 2B6MA 2LNTA 2JSYA 1MTCA 22GSA 1LU4A 2REMA 3UL3A 1J08A 2X4AA 3HD5A 3LGCA 1GTIA 2X8GA 4CW9A 4ECBA 2XC2A 4ILFA 1EEMA 1PN9A 5C04A 1TKDB 3FZ5A 4ZL8A 2I9HA 3ERWA 1M9AA 2K8VA 3UVHA 3ZITA 1W4VA 2EIOA 5G30A 3L78A 2CT6A 3WYWA 2XPDA 2YV7A 3VURA 3HKRA 2L59A 1Y25A 2HE3A 2LQOA 4ML6A 2HZEB 4EF0A 2TRXA 2ZCTA 4YQVA 4E8EA 5F8BA 5IMAA 3UEMA 5DQSA 6GSXA 2VCXA 2H6XA 2MMNA 4EIPA 5DAKA 4K6XA 4KCAA 1YQ1A 1WMJA 2CVBA 2GSTA 1PMTA 2DJKA 4NHWA 1Z6NA 1X5EA 4FYUA 1I5GA 2TRCP 3GL5A 3O3TA 1Q4JA 3IXRA 2PN8A 1A2LA 2WS2A 3F3QA 2DSAA 1U3IA 1BJXA 1TW9A 4GCIA 3UVTA 4Q5RA 2GT5A 2R4VA 1BG5A 1F6MC 2H72A 4V2MA 4TXOB 3FK8A 1ZYQB 6GSUA 4PUFC 5F07A 2L6DA 3UIWA 4HDEA 2N5AA 1HD2A 3APSA 2I1UA 2DLXA 1PL2A 3FR9A 3P7XA 4KGIA 2C1YA 2FUG2 1V40A 5DCGA 1A2JA 2LTKA 4MP4A 4FH8A 4TRXA 2XHFA 4JR6A 3EPTA 4QQ7A 4FIWA 1QMVA 5B8AA 5D9TA 4BVXA 3WGEA 3LEFA 3ZZXA 4TVEA 2CX3A 4TXVA 5LCZA 5ELGA 3ME8A 1UN2A 1KBNA 4HI7A 2YWIA 5A4WA 1EWXA 2FHEA 16GSA 4J2FA 4KCEA 4OO4A 1FW1A 4TR1A 4RQRA 5ECRB 1TP9A 4OFMA 2F8FA 3DYRA 3R3EA 3A3TA 3C8EA 3PGTA 4HEA2 2QGVA 2D2ZA 1AW9A 3GL3A 2Z9SA 1TI1A 4XIHA 2MZCA 7GSSA 2HZEA 5DQYA 2YJHA 3IHGA 4K2DA 10GSA 5J4UA 3P8WA 3PPUA 5G1LA 5EPFA 2BMXA 3CYNA 5B6NA 1QFNA 4XCSA 4ECJA 3DEXA 4ID0A 2JACA 3WGXA 3F4RA 4WEYA 1GP1A 2OE3A 2MBSA 5D93A 1A8LA 2VAFA 2IJYA 4IQAA 4TN8A 5AIVA 3FZ9A 3HVXA 3DXBA 1SD9A 3KJYA 2IN3A 1U6TA 4MPGA 4WF4A 1ZYPA 2C0FA 3DKSA 2KP1A 3KP8A 4K0GA 4I6XA 2DJ1A 1O8XA 1PA3A 4YQMA 3IR4A 1T8EB 1ZYNA 5FHIA 2IMKA 1SL1B 3CBUA 5JWRB 5KOWA 2HZFA 3HA9A 4HQSA 11GSA 1K0OA 4F0BA 2VL9A 3FZAA 1GLQA 1AC1A 2A2PA 2O8VB 3APOA 3N9JA 5EY6A 5GSSA 1YEXA 2VD0A 2OKAA 3H1NA 3I69A 3TKRA 1GSDA 2VM2A 1PL1A 2N5FA 3ERFA 3WT2A 1DE1A 4O32A 2QC7A 4NV2A 5G5FA 1ZL9A 4OCEA 4TOPA 5ID2B 5JCWA 2FA4A 5ELAA 3KEBA 3TRXA 1XIYA 3ZYWA 2DIZA 2FWEA 5HR3A 2MBTA 3KXOA 4IP6A 4EXJA 1GRXA 4G2EA 2LS5A 4F9ZA 4MF6A 1T3BA
chains in the Genus database with same CATH topology
3L9VA 1E6BA 3HYPA 4DSRA 1DBYA 1EGOA 5GSTA 2HRNA 1O85A 1K3YA 2KHPA 6GSVA 3TOTA 2H1AA 2F8AA 2YOIA 3PINA 1GL8A 5AIXA 4MH3A 1TK0B 1V57A 2XPEA 1YKCA 2OADA 1SKRB 1B8XA 1K0DA 1Z9HA 5B8BA 4H86A 4IHUA 3EINA 1GULA 2LJRA 4POLA 2VCZA 3MSZA 3FW2A 3VK9A 2E0QA 2K6VA 3DVXA 1NHYA 1FHEA 1MD4A 1ON4A 2NVLA 2H75A 3I43A 3FRCA 5D96A 1X9SB 1GTBA 5DJMA 3HY2A 3H79A 4NMUA 1EOHA 2IPAA 3G7JA 4N30A 4PXOA 3FR3A 1XPVA 3M8NA 2MYGA 5CAXA 5IOXA 4LLRA 20GSA 1PSQA 1EV9A 1N8JA 4GSSA 2EIRA 2ES7A 2UZ8A 3TJFA 18GSA 5DJLA 4G0KA 4MMMA 5F05A 6GSYA 1G7EA 3S9FA 2V32A 1TK8B 4GRFA 2B5EA 4PX1A 3HXSA 2FNOA 3TKPA 3VWXA 2JZRA 2M80A 2C0DA 2HRKA 4BPYA 3EMXA 2VO4A 4L8EA 3FMWA 2R5GA 5KN3A 5ECHB 4XTSA 2X8HA 2WB9A 5CRHA 1FVKA 1TRVA 1QK8A 3ZREA 1FB0A 3IK7A 4PGTA 1A2MA 1GSEA 3QAVA 5B7CA 4BWSA 3QMXA 1K0AA 3LYKA 4G0IA 1THOA 2KUCA 1VGLA 1ERTA 1YDKA 4WETA 3TJJA 3ZMLA 1SYXA 3A2WA 3QOUA 5IMCA 3DMLA 4ISDA 2QA1A 3DVWA 2HSYA 1SJ6A 1A8YA 2FCHA 2B3SA 4ULXA 2WZ9A 1T4YA 2LEGA 2GQLA 5IPHA 4WR5A 2JADA 3SBCA 4EUYA 2ON5A 3O6TA 1K0NA 4XS6A 1PKWA 1XOAA 2XBQA 4J57E 2B7JA 2DJ0A 4HZ2A 4NV5A 3FYGA 3FHKA 5DAKB 2VM1A 4POMA 4NPBA 1TOFA 3KCMA 2IMEA 4GF0A 4PNGA 4PQIA 4JU5A 3BBYA 4AGSA 4IGJA 3Q74A 1Z5YE 5EVOA 3L9UA 4CY6A 2LRCA 5JWOB 2C8UA 2YPMA 4MJCA 3HDCA 1Z7PA 1ZZYA 2FY6A 2EC4A 1K0MA 17GSA 4WF5A 4IKHA 4LL1B 2OE1A 4MF7A 5LD0A 2HYXA 1ERVA 4LA1A 4CHSA 2ZNMA 2E7PA 5CP1A 2FWGA 3J7Yk 2WULA 1O81A 4GSNA 4KE3A 2R3XA 4DSQA 2YNXA 4O7HA 4KNDA 1OC3A 3UARA 4HS1A 4BVXB 2GS3A 4NAXA 1HYUA 3KMOA 4ZILA 3D6IA 3ZTLA 1SYRA 4DSSA 2H1GA 1GTAA 3GX0A 3IAM2 4TR1B 1JLWA 5D9VA 1NM3A 3GKMA 2HNLA 2AUVA 3ZMKA 3UOMA 1TU8A 3HZ4A 4TR4A 5IMDA 3CTFA 2QKEA 2R0CA 1C72A 1M99A 1K3LA 2LV3A 1RW1A 4AF2A 1FOHA 2I4AA 3GNJA 1QGVA 2P0GA 3GRXA 3ED3A 3DRNA 2DMLA 4L5LA 2M72A 2PUKC 2LJKA 3TJBA 1F3AA 2LQQA 2G0FA 2VL2A 1X5DA 1FVJA 5A5KA 5ECIB 5DVBA 1PD21 2RM5A 1KNGA 4K5RA 1T7PB 1XCCA 2H6ZA 4KSOA 1USBA 5AN1A 2LRTA 1XWGA 4L0UA 4XRDA 4BWQA 2PVQA 5CYYA 1CQGA 3GTUB 4K5SA 2H6YA 3TRPA 3KD0A 2VIMA 4RI6A 2VCWA 3E9JB 1U87A 2K8SA 1YKAA 4ECIA 1OE8A 4MZBA 2VL3A 2LNSA 2AHEA 2RLIA 2H73A 4X1UA 3FEUA 2R37A 3HZ8A 3F6FA 4KDUA 3IDVA 1GUHA 1DE2A 4ZB6A 1B4PA 1TU7A 4Z2RA 4I5QA 1XVWA 13GSA 4F0CA 2IL3A 3H93A 2A4VA 2WDUA 3A5IA 4RQXA 4YQUA 1Y6EA 2CA8A 4IW9A 1GUMA 1WIKA 4OWYA 5HR0A 4HU7A 5F0GA 1GSQA 2C3NA 5C00A 3E3EA 5IO2A 5GAPD 5ABRA 1N2AA 4ZBAA 3WD6A 4DEJA 3DGQA 4ZBDA 4I2TA 5DBQA 3CSHA 2M46A 1TRSA 4IVFA 2F51A 2FWFA 3QAWA 5AGYA 4MDCA 3C71A 3D22A 4JEDA 4YH2A 2ZUPA 3F9UA 1SD8A 2FGXA 1J0FA 3IA1A 3ISOA 3VFIA 1MDJA 1PKZA 3KIJA 1SJZA 2LUSA 1X9MB 3KP9A 5H5QA 1EGRA 3HCZA 1NW2A 5DALA 2WGRA 2A2RA 4Q5NA 3ZVJA 2MMAA 1OC8A 1EZKA 3EURA 4Z7XA 2I81A 3GUSA 2IWTA 4E8HA 2E2MA 1TK5B 4KSMA 1T4ZA 2IMDA 4KUNA 1GLPA 2EIQA 1DSBA 4HZ4A 4IP1A 3F4SA 2JSZA 3NIVA 3UMAA 3HJPA 1Q98A 1XOBA 2GT6A 3GTUA 4KDYA 3F4TA 4GWRA 1VF1A 3C73A 4D73B 1S3DA 2YCDA 2I3YA 4NHZA 2H8LA 4X4JA 3JCML 4KAEA 3IK9A 1ZYEA 4JR4A 2LJAA 3EU3A 5FT3A 2GTUA 4L5OA 4ZIJA 1ZCPA 2DMMA 1B4QA 2B1KA 2KOKA 3CTGA 3ZL5A 3SWLA 2CVKA 4DVCA 1BYEA 2CAQA 5IOWA 1F37A 1B9YC 1VF3A 2KLXA 4TR3A 4POBA 5AISA 4Q5FA 2PMTA 3VI7A 5DDLA 4IJIA 4OCFA 2C3QA 1PQNA 2GZYA 3J7Yb 3O76A 1GSSA 2MMOA 3TGZA 2F3MA 3LWAA 3W8SA 2HXKA 4OO5A 3KGKA 4ICYA 1G6YA 2NTOA 4GQFA 2AV4A 5LNKe 4LL4B 4PUAA 1XWCA 1G7OA 3GV1A 1ILOA 1M2AA 1SK0A 2E2GA 5CRGA 2DKIA 4EDYA 3RBTA 2H19A 3ZIJA 2V1MA 1NSWA 4GTUA 4K0NA 4XS4A 1FB6A 3A2XA 2R0PA 1XW5A 3ERGA 1R5PA 4I2UA 5CNWA 2LKUA 3GA4A 1A0RP 1VF4A 2CZ2A 2R0GA 4IBPA 2V2GA 3IV4A 1J9BA 4O5RA 1DUGA 1TI3A 5EL8A 1WWJA 1K3OA 1BQ7A 1MEKA 4EL1A 3APQA 4ZL7A 1Z6MA 3LQ7A 3PH9A 3GN3A 4D73A 1Z7RA 2DKHA 2H71A 5HFGA 2G2QA 4CDOA 2A4HA 3LORA 1WRYA 5ECNB 3RHBA 2IMIA 9GSSA 1OKDA 5J9CA 1OC9A 3TCOA 1OAZA 4JE1A 2VLUA 1T1VA 4CY8A 4EIQA 3R2QA 3TKSC 1KEBA 2PU9C 3G7YA 4P3YB 4ZB9A 3Q18A 2H0IA 4L0WA 4ZB8A 3MYDA 2H1DA 2BTOT 4IELA 4KF9A 4MF5A 4FYBA 4KDXA 4HJ2A 4PQHA 3VWVA 3IC8A 4NWYA 3BOAA 4MJAA 4PTSA 1A24A 2C3TA 2K9FA 5ECQB 4Z2TA 1GNEA 3LJRA 4MZCA 4YAPA 5IIZA 4IQ1A 1FAAA 3D21A 2RM6A 4GQCA 2GDRA 1SK2A 5D9XA 1LJRA 4DSSB 3A2VA 3I9V2 1T00A 1G0TA 5IO0A 3A5WA 2HI7A 3IC4A 5D9WA 3RDWA 2H30A 4BVYA 3G9BA 3QPMA 1X0RA 3TB2A 4ZXGA 5CRWA 2H0GA 3TDGA 4FQUA 2O85A 2WJUA 3QD9A 2H01A 3MWHA 5BMUA 1H75A 1V9WA 1UC7A 5BRTA 1RQMA 2B7KA 1YF0A 2YZHA 5G5EA 2DBCA 2C0GA 4F03A 3IPZA 3MDKA 1FOVA 4HUAA 1YY7A 4MJEA 1PRXA 3M9KA 1V98A 1X5CA 1UVZA 5KEJA 1V2AA 3C1RA 2TIRA 3NZNA 1BX9A 2O7KA 3EC3A 4AJ8A 2PVOC 3HVVA 4EC0A 2H76A 3U5RE 1SENA 1HQOA 2VCVA 1JHBA 5JCUA 3KMNA 3RPPA 2ALBA 1R5AA 2OE0A 4HJMA 1R7HA 1R4WA 5ECKB 3EVIA 1AXDA 2YV9A 3FR6A 4K1FA 3F6DA 3PR8A 3EU4A 2PGTA 3VPQA 4MK3A 2PWJA 3KH7A 3I6AA 2H70A 2QA2A 5A4VA 3OR5A 3FZ4A 2ON7A 2IIYA 2PBJA 4BL7A 2YWOA 3DWVA 5G31A 4F82A 2B5XA 2DIYA 5ECOB 4KX4A 3QR6A 1XWBA 4K7NA 3U6VA 2L6CA 5HFIA 1XW9A 3H8QA 2GSQA 5KN2A 4V2NA 5HFKA 2JU5A 5L71A 1TJDA 4IS0A 2OJLA 1WE0A 3TUEA 3EMPA 2AB6A 3D0ZA 4F2IA 4USSA 2RIIA 3CXGA 5J3RA 1A0FA 2VCTA 1AQXA 1GTUA 5ECPB 2HSMA 5DALB 4N11A 3BJ5A 5D8IA 3QFAC 4HQZA 1QQ2A 1XZOA 2P5QA 3BD2A 4ML1A 3HJOA 3WT1A 3CRUA 2XBIA 3M1GA 1XFLA 4OMVA 2VLTA 5J41A 1XVQA 3EWLA 1EOGA 2DJJA 3TKQA 4A5PA 2YJ7A 1MDIA 3HJMA 3EE2A 2WFCA 5G2ZA 1HNBA 3GSSA 1PX7A 1Z3EA 4TR0A 2GZZA 2GSRA 2P5RA 4NXIA 4KH7A 1WJKA 4GXZA 3F8UA 2X49A 4K7IA 1K0BA 1O7UA 1S3CA 2PERA 3K8NA 1M7TA 4Z2UA 2IFQA 5IMZA 2YWMA 4XS1A 3UJ1A 4YAVA 3D4MA 3VWWA 3ZVJD 2HLSA 5ECMB 1GNWA 1S3AA 4I8BA 2OA7A 2YP6A 4K8MA 2L4CA 1KTEA 3KZQA 2L4QA 2WRTA 2V6OA 4WKWA 1ACVA 4BA7A 2VOCA 2CX4A 1SL0B 2NBSA 1W89A 3GFKA 4GSTA 3FKFA 4MNNA 4RUVA 4OFTA 3UBLA 1GSUA 1U3AA 4KA0A 1TDIA 3LXZA 4WBRD 2V6KA 4OFNA 3ZRDA 3KTBA 3V1WA 2GQKA 4EVMA 2O87A 3VPTA 1IYIA 1JZRA 5FWGA 1THXA 1PX6A 1SU9A 1M0UA 3IAS2 4N0ZA 3VWUA 3GSTA 5JWQB 1ABAA 4GLTA 2X99A 3LXTA 3M9JA 1GUKA 1ERUA 1JFUA 4I97A 19GSA 2O89A 1SKSB 3H4KA 2HRAA 1E2YA 3QFBC 2CV4A 3GX8A 4JRRA 4O5UA 5B6MA 2AYTA 3CSIA 1O73A 4XS4B 1GSYA 1SK1A 4AJ7A 3TRQA 1GH2A 1WPIA 5D73A 5ECLB 3LG6A 1AAZA 3CRTA 3GKKA 3GKNA 2OBIA 4X43A 3TJKA 2F9SA 2NPBA 3IHQA 1R26A 4QL9A 2JZTA 3BCIA 2JZSA 5H5RA 3GIXA 1F3BA 5COHA 1OYJA 3Q6OA 2J23A 4O92A 1M2DA 2CVDA 5IMFA 4MZWA 3IBHA 3GYKA 2H74A 3QCPA 3CSJA 3TKSE 3F3RA 3HVSA 6GSSA 5IMVA 4POKA 3RAZA 2GQMA 3AY8A 4K2XA 3ZIVA 4KB3A 3M0FA 1G6WA 1LBKA 2HFDA 2R2JA 4JZQA 1ZGNA 4J56E 4OD7A 1XW6A 3KTLA 1JZWA 1OC9B 4G19A 4G0LA 4K9ZA 3N5OA 5CRDA 2HT9A 1XWKA 3F0IA 4LMVA 4N0VA 4TXOA 2KP2A 1B48A 2YZUA 1PN0A 1NHOA 1TRWA 5DCHA 4XHMA 4KW6A 5JCGA 1M9BA 1MD3A 2H1BA 3C7MA 3NOFA 5GZZB 2RUEA 3QDNA 3GHAA 2B5YA 4N10A 2L57A 1EP7A 4V1Ap 1F9MA 1BEDA 2IMFA 1GSFA 1VF2A 4HOJA 3M3MA 3F63A 2L5LA 3DD3A 4LMWA 5G1KA 1RK4A 1QUWA 1AIUA 5KOXA 3Q19A 4BVYB 3ZFBA 3ZFLA 2LRNA 1H4OA 1YEPA 2VD1A 4WBJA 2J9HA 4G9HA 2HRFA 4V2LA 1ZOFA 4RI7A 6GSTA 6GSWA 3DIEA 2YANA 1IYHA 2DJ3A 5HR1A 4MCUA 5IM9A 1V58A 2CQ9A 1TRUA 1OKTA 3MAKA 3D5JA 4XRAA 1OE7A 4EO3A 1HNAA 3LSZA 2BJXA 3VI5A 2C80A 4TKYA 2QSIA 3L9SA 4WXTA 4JBBA 2AJQB 4MH2A 1VRSD 3L0HA 1XXUA 4V1Ag 5CO3A 2CZ3A 2YN1A 5ENUA 3LYPA 3P90A 2WCIA 1WOUA 2GVPA 5ECSA 1EEJA 2H66A 4MA9A 1ML6A 5J9BA 2MMZA 3HHVA 3W6GA 2V41A 4K7OA 1SKWB 4ZL9A 4TW5A 4PURA 4EDZA 3MNGA 4WR4A 2OBKA 2A2SA 1O6JA 4IN0A 4FYCA 4X0XA 3C1SA 4ZBBA 4MJBA 5J5NA 3MIXA 1QXHA 4PQ1A 1U88A 1CQHA 1AQWA 1WP0A 1ERWA 5HQPA 2K18A 2R6KA 1YJ6A 4BL7B 3ZLPA 5F06A 2LSTA 1PGTA 2FD3A 3EYTA 1URMA 4G10A 1UA5A 1XWAA 2VLVA 2H0HA 3BCKA 2YWNA 4MABA 2C0EA 2L5OA 14GSA 5KN0A 1AQVA 3US3A 1SJIA 3QAGA 1AUCA 2DC5A 1MDKA 5A4UA 3RHCA 1YF1A 2FA8A 5ID2A 2PPTA 2VCQA 1JZDA 4PNFA 3ME7A 4MPFA 2OACA 3LW9A 3UAPA 4IJ3A 1A23A 2B1LA 2GGTA 3W8JA 2NDOA 2FLSA 1K0CA 1YZXA 3G7IA 1JZOA 3IRAA 1SL2B 12GSA 2VUPA 2VL2C 2RUFA 1EV4A 2X64A 4ACSA 2X8CA 2JL4A 1ST9A 3KM6A 3GURA 1GWCA 4AJ6A 3GH9A 3CMIA 2C4JA 1ZMAA 4EE0A 5E59A 4Q5QA 4O5QA 3LFLA 4FO5A 3RPNA 3L4NA 8GSSA 1EP8A 2IFQB 3KH9A 4HU9A 2DJ2A 2N5BA 5IQYA 5INYA 5H5SA 1M2BA 1B9XC 1TTZA 3IE3A 1FG4A 3P2AA 5HR2A 2GSSA 1BAYA 1JLVA 4YKGA 1HNCA 1O8WA 3WGDA 3TKSA 3D4TA 4ECCA 4QL7A 3E0UA 1I9DA 1TXXA 2P31A 5CREA 4YKFA 4MLYA 2FWHA 1X9WB 1OVNA 3TJGA 3UBKA 2GZPA 2HSHA 5IPGA 5GAND 1FO5A 4EKZA 3GKXA 1XBSA 1F2EA 2AAWA 2CAIA 3IOSA 3VLNA 3GH6A 2GLRA 5E4WA 3TOUA 3FY7A 5KN1A 3GMFA 2B6MA 2LNTA 2JSYA 1MTCA 22GSA 1LU4A 2REMA 3UL3A 1J08A 2X4AA 3HD5A 3LGCA 1GTIA 2X8GA 4CW9A 4ECBA 2XC2A 4ILFA 1EEMA 1PN9A 5C04A 1TKDB 3FZ5A 4ZL8A 2I9HA 3ERWA 1M9AA 2K8VA 3UVHA 3ZITA 1W4VA 2EIOA 5G30A 3L78A 2CT6A 3WYWA 2XPDA 2YV7A 3VURA 3HKRA 2L59A 1Y25A 2HE3A 2LQOA 4ML6A 2HZEB 4EF0A 2TRXA 2ZCTA 4YQVA 4E8EA 5F8BA 5IMAA 3UEMA 5DQSA 6GSXA 2VCXA 2H6XA 2MMNA 4EIPA 5DAKA 4K6XA 4KCAA 1YQ1A 1WMJA 2CVBA 2GSTA 1PMTA 2DJKA 4NHWA 1Z6NA 1X5EA 4FYUA 1I5GA 2TRCP 3GL5A 3O3TA 1Q4JA 3IXRA 2PN8A 1A2LA 2WS2A 3F3QA 2DSAA 1U3IA 1BJXA 1TW9A 4GCIA 3UVTA 4Q5RA 2GT5A 2R4VA 1BG5A 1F6MC 2H72A 4V2MA 4TXOB 3FK8A 1ZYQB 6GSUA 4PUFC 5F07A 2L6DA 3UIWA 4HDEA 2N5AA 1HD2A 3APSA 2I1UA 2DLXA 1PL2A 3FR9A 3P7XA 4KGIA 2C1YA 2FUG2 1V40A 5DCGA 1A2JA 2LTKA 4MP4A 4FH8A 4TRXA 2XHFA 4JR6A 3EPTA 4QQ7A 4FIWA 1QMVA 5B8AA 5D9TA 4BVXA 3WGEA 3LEFA 3ZZXA 4TVEA 2CX3A 4TXVA 5LCZA 5ELGA 3ME8A 1UN2A 1KBNA 4HI7A 2YWIA 5A4WA 1EWXA 2FHEA 16GSA 4J2FA 4KCEA 4OO4A 1FW1A 4TR1A 4RQRA 5ECRB 1TP9A 4OFMA 2F8FA 3DYRA 3R3EA 3A3TA 3C8EA 3PGTA 4HEA2 2QGVA 2D2ZA 1AW9A 3GL3A 2Z9SA 1TI1A 4XIHA 2MZCA 7GSSA 2HZEA 5DQYA 2YJHA 3IHGA 4K2DA 10GSA 5J4UA 3P8WA 3PPUA 5G1LA 5EPFA 2BMXA 3CYNA 5B6NA 1QFNA 4XCSA 4ECJA 3DEXA 4ID0A 2JACA 3WGXA 3F4RA 4WEYA 1GP1A 2OE3A 2MBSA 5D93A 1A8LA 2VAFA 2IJYA 4IQAA 4TN8A 5AIVA 3FZ9A 3HVXA 3DXBA 1SD9A 3KJYA 2IN3A 1U6TA 4MPGA 4WF4A 1ZYPA 2C0FA 3DKSA 2KP1A 3KP8A 4K0GA 4I6XA 2DJ1A 1O8XA 1PA3A 4YQMA 3IR4A 1T8EB 1ZYNA 5FHIA 2IMKA 1SL1B 3CBUA 5JWRB 5KOWA 2HZFA 3HA9A 4HQSA 11GSA 1K0OA 4F0BA 2VL9A 3FZAA 1GLQA 1AC1A 2A2PA 2O8VB 3APOA 3N9JA 5EY6A 5GSSA 1YEXA 2VD0A 2OKAA 3H1NA 3I69A 3TKRA 1GSDA 2VM2A 1PL1A 2N5FA 3ERFA 3WT2A 1DE1A 4O32A 2QC7A 4NV2A 5G5FA 1ZL9A 4OCEA 4TOPA 5ID2B 5JCWA 2FA4A 5ELAA 3KEBA 3TRXA 1XIYA 3ZYWA 2DIZA 2FWEA 5HR3A 2MBTA 3KXOA 4IP6A 4EXJA 1GRXA 4G2EA 2LS5A 4F9ZA 4MF6A 1T3BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L9V A;  1E6B A;  3HYP A;  4DSR A;  1DBY A;  1EGO A;  5GST A;  2HRN A;  1O85 A;  1K3Y A;  2KHP A;  6GSV A;  3TOT A;  2H1A A;  2F8A A;  2YOI A;  3PIN A;  1GL8 A;  5AIX A;  4MH3 A;  1TK0 B;  1V57 A;  2XPE A;  1YKC A;  2OAD A;  1SKR B;  1B8X A;  1K0D A;  1Z9H A;  5B8B A;  4H86 A;  4IHU A;  3EIN A;  1GUL A;  2LJR A;  4POL A;  2VCZ A;  3MSZ A;  3FW2 A;  3VK9 A;  2E0Q A;  2K6V A;  3DVX A;  1NHY A;  1FHE A;  1MD4 A;  1ON4 A;  2NVL A;  2H75 A;  3I43 A;  3FRC A;  5D96 A;  1X9S B;  1GTB A;  5DJM A;  3HY2 A;  3H79 A;  4NMU A;  1EOH A;  2IPA A;  3G7J A;  4N30 A;  4PXO A;  3FR3 A;  1XPV A;  3M8N A;  2MYG A;  5CAX A;  5IOX A;  4LLR A;  20GS A;  1PSQ A;  1EV9 A;  1N8J A;  4GSS A;  2EIR A;  2ES7 A;  3TJF A;  18GS A;  5DJL A;  4MMM A;  5F05 A;  6GSY A;  1G7E A;  3S9F A;  2V32 A;  1TK8 B;  4GRF A;  2B5E A;  4PX1 A;  3HXS A;  2FNO A;  3TKP A;  3VWX A;  2JZR A;  2M80 A;  2C0D A;  4BPY A;  3EMX A;  2VO4 A;  4L8E A;  2R5G A;  5KN3 A;  5ECH B;  4XTS A;  2X8H A;  2WB9 A;  5CRH A;  1FVK A;  1TRV A;  1QK8 A;  3ZRE A;  1FB0 A;  3IK7 A;  4PGT A;  1A2M A;  1GSE A;  3QAV A;  5B7C A;  4BWS A;  3QMX A;  1K0A A;  3LYK A;  1THO A;  2KUC A;  1VGL A;  1ERT A;  1YDK A;  4WET A;  3TJJ A;  3ZML A;  1SYX A;  3A2W A;  3QOU A;  5IMC A;  3DML A;  4ISD A;  3DVW A;  2HSY A;  1SJ6 A;  1A8Y A;  2FCH A;  2B3S A;  4ULX A;  2WZ9 A;  1T4Y A;  2LEG A;  2GQL A;  5IPH A;  4WR5 A;  2JAD A;  3SBC A;  4EUY A;  2ON5 A;  3O6T A;  1K0N A;  4XS6 A;  1PKW A;  1XOA A;  2XBQ A;  4J57 E;  2B7J A;  2DJ0 A;  4HZ2 A;  4NV5 A;  3FYG A;  3FHK A;  5DAK B;  2VM1 A;  4POM A;  4NPB A;  1TOF A;  3KCM A;  2IME A;  4GF0 A;  4PNG A;  4PQI A;  4JU5 A;  3BBY A;  4AGS A;  4IGJ A;  3Q74 A;  1Z5Y E;  5EVO A;  3L9U A;  2LRC A;  5JWO B;  2C8U A;  2YPM A;  4MJC A;  3HDC A;  1Z7P A;  1ZZY A;  2FY6 A;  2EC4 A;  1K0M A;  17GS A;  4WF5 A;  4IKH A;  4LL1 B;  2OE1 A;  4MF7 A;  5LD0 A;  2HYX A;  1ERV A;  4LA1 A;  4CHS A;  2ZNM A;  2E7P A;  5CP1 A;  2FWG A;  3J7Y k;  2WUL A;  1O81 A;  4GSN A;  4KE3 A;  2R3X A;  4DSQ A;  2YNX A;  4O7H A;  4KND A;  1OC3 A;  3UAR A;  4HS1 A;  2GS3 A;  4NAX A;  1HYU A;  3KMO A;  4ZIL A;  3D6I A;  3ZTL A;  1SYR A;  4DSS A;  2H1G A;  1GTA A;  3GX0 A;  3IAM 2;  4TR1 B;  1JLW A;  5D9V A;  1NM3 A;  3GKM A;  2HNL A;  2AUV A;  3ZMK A;  3UOM A;  1TU8 A;  3HZ4 A;  4TR4 A;  5IMD A;  3CTF A;  2QKE A;  1C72 A;  1M99 A;  1K3L A;  2LV3 A;  1RW1 A;  4AF2 A;  2I4A A;  3GNJ A;  1QGV A;  2P0G A;  3GRX A;  3ED3 A;  3DRN A;  2DML A;  4L5L A;  2M72 A;  2PUK C;  2LJK A;  3TJB A;  1F3A A;  2LQQ A;  2G0F A;  2VL2 A;  1X5D A;  1FVJ A;  5A5K A;  5ECI B;  5DVB A;  1PD2 1;  2RM5 A;  1KNG A;  1T7P B;  1XCC A;  2H6Z A;  4KSO A;  1USB A;  5AN1 A;  2LRT A;  1XWG A;  4L0U A;  4XRD A;  4BWQ A;  2PVQ A;  5CYY A;  1CQG A;  3GTU B;  2H6Y A;  3TRP A;  3KD0 A;  2VIM A;  4RI6 A;  2VCW A;  3E9J B;  1U87 A;  2K8S A;  1YKA A;  4ECI A;  1OE8 A;  4MZB A;  2VL3 A;  2LNS A;  2AHE A;  2RLI A;  2H73 A;  4X1U A;  3FEU A;  2R37 A;  3HZ8 A;  3F6F A;  4KDU A;  3IDV A;  1GUH A;  1DE2 A;  4ZB6 A;  1B4P A;  1TU7 A;  4I5Q A;  1XVW A;  13GS A;  4F0C A;  2IL3 A;  3H93 A;  2A4V A;  2WDU A;  4RQX A;  4YQU A;  1Y6E A;  2CA8 A;  4IW9 A;  1GUM A;  1WIK A;  4OWY A;  5HR0 A;  4HU7 A;  5F0G A;  1GSQ A;  2C3N A;  5C00 A;  3E3E A;  5IO2 A;  5GAP D;  5ABR A;  1N2A A;  4ZBA A;  3WD6 A;  4DEJ A;  3DGQ A;  4ZBD A;  4I2T A;  5DBQ A;  3CSH A;  2M46 A;  1TRS A;  4IVF A;  2F51 A;  2FWF A;  3QAW A;  5AGY A;  4MDC A;  3C71 A;  3D22 A;  4JED A;  4YH2 A;  2ZUP A;  3F9U A;  1SD8 A;  2FGX A;  1J0F A;  3IA1 A;  3ISO A;  3VFI A;  1MDJ A;  1PKZ A;  3KIJ A;  1SJZ A;  2LUS A;  1X9M B;  3KP9 A;  5H5Q A;  1EGR A;  3HCZ A;  1NW2 A;  5DAL A;  2WGR A;  2A2R A;  4Q5N A;  3ZVJ A;  2MMA A;  1OC8 A;  1EZK A;  3EUR A;  4Z7X A;  2I81 A;  3GUS A;  2IWT A;  4E8H A;  2E2M A;  1TK5 B;  4KSM A;  1T4Z A;  2IMD A;  4KUN A;  1GLP A;  2EIQ A;  1DSB A;  4HZ4 A;  4IP1 A;  3F4S A;  2JSZ A;  3NIV A;  3UMA A;  3HJP A;  1Q98 A;  1XOB A;  2GT6 A;  3GTU A;  4KDY A;  3F4T A;  4GWR A;  1VF1 A;  3C73 A;  4D73 B;  1S3D A;  2YCD A;  2I3Y A;  4NHZ A;  2H8L A;  3JCM L;  4KAE A;  3IK9 A;  1ZYE A;  4JR4 A;  2LJA A;  3EU3 A;  5FT3 A;  2GTU A;  4L5O A;  4ZIJ A;  1ZCP A;  2DMM A;  1B4Q A;  2B1K A;  2KOK A;  3CTG A;  3ZL5 A;  3SWL A;  2CVK A;  4DVC A;  1BYE A;  2CAQ A;  5IOW A;  1F37 A;  1B9Y C;  1VF3 A;  2KLX A;  4TR3 A;  4POB A;  5AIS A;  4Q5F A;  2PMT A;  3VI7 A;  5DDL A;  4IJI A;  4OCF A;  2C3Q A;  1PQN A;  2GZY A;  3J7Y b;  3O76 A;  1GSS A;  2MMO A;  3TGZ A;  2F3M A;  3LWA A;  3W8S A;  2HXK A;  4OO5 A;  3KGK A;  1G6Y A;  2NTO A;  4GQF A;  2AV4 A;  5LNK e;  4LL4 B;  4PUA A;  1XWC A;  1G7O A;  3GV1 A;  1ILO A;  1M2A A;  1SK0 A;  2E2G A;  5CRG A;  4EDY A;  3RBT A;  2H19 A;  3ZIJ A;  2V1M A;  1NSW A;  4GTU A;  4K0N A;  4XS4 A;  1FB6 A;  3A2X A;  1XW5 A;  3ERG A;  1R5P A;  4I2U A;  5CNW A;  2LKU A;  3GA4 A;  1A0R P;  1VF4 A;  2CZ2 A;  4IBP A;  2V2G A;  3IV4 A;  1J9B A;  4O5R A;  1DUG A;  1TI3 A;  5EL8 A;  1WWJ A;  1K3O A;  1BQ7 A;  1MEK A;  4EL1 A;  3APQ A;  4ZL7 A;  1Z6M A;  3LQ7 A;  3PH9 A;  3GN3 A;  4D73 A;  1Z7R A;  2H71 A;  5HFG A;  2G2Q A;  4CDO A;  3LOR A;  1WRY A;  5ECN B;  3RHB A;  2IMI A;  9GSS A;  1OKD A;  5J9C A;  1OC9 A;  3TCO A;  1OAZ A;  4JE1 A;  2VLU A;  1T1V A;  3R2Q A;  3TKS C;  1KEB A;  2PU9 C;  3G7Y A;  4P3Y B;  4ZB9 A;  3Q18 A;  2H0I A;  4L0W A;  4ZB8 A;  2H1D A;  2BTO T;  4IEL A;  4MF5 A;  4FYB A;  4KDX A;  4HJ2 A;  4PQH A;  3VWV A;  4NWY A;  3BOA A;  4MJA A;  1A24 A;  2C3T A;  2K9F A;  5ECQ B;  1GNE A;  3LJR A;  4MZC A;  4YAP A;  5IIZ A;  4IQ1 A;  1FAA A;  3D21 A;  2RM6 A;  4GQC A;  2GDR A;  1SK2 A;  5D9X A;  1LJR A;  4DSS B;  3A2V A;  3I9V 2;  1T00 A;  1G0T A;  5IO0 A;  3A5W A;  2HI7 A;  3IC4 A;  5D9W A;  3RDW A;  2H30 A;  4BVY A;  3G9B A;  3QPM A;  1X0R A;  3TB2 A;  4ZXG A;  5CRW A;  2H0G A;  3TDG A;  2O85 A;  2WJU A;  3QD9 A;  2H01 A;  3MWH A;  1H75 A;  1V9W A;  1UC7 A;  1RQM A;  2B7K A;  1YF0 A;  2YZH A;  5G5E A;  2DBC A;  2C0G A;  4F03 A;  3IPZ A;  3MDK A;  1FOV A;  4HUA A;  1YY7 A;  4MJE A;  1PRX A;  3M9K A;  1V98 A;  1X5C A;  1UVZ A;  5KEJ A;  1V2A A;  3C1R A;  2TIR A;  3NZN A;  1BX9 A;  2O7K A;  3EC3 A;  4AJ8 A;  2PVO C;  3HVV A;  4EC0 A;  2H76 A;  3U5R E;  1SEN A;  1HQO A;  2VCV A;  1JHB A;  5JCU A;  3KMN A;  3RPP A;  2ALB A;  1R5A A;  2OE0 A;  4HJM A;  1R7H A;  1R4W A;  5ECK B;  3EVI A;  1AXD A;  2YV9 A;  3FR6 A;  4K1F A;  3F6D A;  3PR8 A;  3EU4 A;  2PGT A;  3VPQ A;  4MK3 A;  2PWJ A;  3KH7 A;  3I6A A;  2H70 A;  5A4V A;  3OR5 A;  3FZ4 A;  2ON7 A;  2IIY A;  2PBJ A;  4BL7 A;  2YWO A;  3DWV A;  5G31 A;  4F82 A;  2B5X A;  2DIY A;  5ECO B;  4KX4 A;  3QR6 A;  1XWB A;  4K7N A;  3U6V A;  2L6C A;  5HFI A;  1XW9 A;  3H8Q A;  2GSQ A;  5KN2 A;  4V2N A;  5HFK A;  2JU5 A;  5L71 A;  1TJD A;  4IS0 A;  2OJL A;  1WE0 A;  3TUE A;  3EMP A;  2AB6 A;  3D0Z A;  4F2I A;  2RII A;  3CXG A;  5J3R A;  1A0F A;  2VCT A;  1AQX A;  1GTU A;  5ECP B;  5DAL B;  4N11 A;  3BJ5 A;  5D8I A;  3QFA C;  4HQZ A;  1QQ2 A;  1XZO A;  2P5Q A;  3BD2 A;  4ML1 A;  3HJO A;  3WT1 A;  3CRU A;  2XBI A;  3M1G A;  1XFL A;  4OMV A;  2VLT A;  5J41 A;  1XVQ A;  3EWL A;  1EOG A;  2DJJ A;  3TKQ A;  2YJ7 A;  1MDI A;  3HJM A;  3EE2 A;  2WFC A;  5G2Z A;  1HNB A;  3GSS A;  1PX7 A;  1Z3E A;  4TR0 A;  2GZZ A;  2GSR A;  2P5R A;  4NXI A;  4KH7 A;  1WJK A;  4GXZ A;  3F8U A;  4K7I A;  1K0B A;  1O7U A;  1S3C A;  2PER A;  3K8N A;  1M7T A;  2IFQ A;  5IMZ A;  2YWM A;  4XS1 A;  3UJ1 A;  4YAV A;  3D4M A;  3VWW A;  3ZVJ D;  2HLS A;  5ECM B;  1GNW A;  1S3A A;  4I8B A;  2OA7 A;  2YP6 A;  4K8M A;  2L4C A;  1KTE A;  3KZQ A;  2L4Q A;  2WRT A;  2V6O A;  4WKW A;  1ACV A;  4BA7 A;  2VOC A;  2CX4 A;  1SL0 B;  2NBS A;  1W89 A;  3GFK A;  4GST A;  3FKF A;  4RUV A;  4OFT A;  3UBL A;  1GSU A;  1U3A A;  4KA0 A;  1TDI A;  3LXZ A;  4WBR D;  2V6K A;  4OFN A;  3ZRD A;  3KTB A;  3V1W A;  2GQK A;  4EVM A;  2O87 A;  3VPT A;  1IYI A;  1JZR A;  5FWG A;  1THX A;  1PX6 A;  1SU9 A;  1M0U A;  3IAS 2;  4N0Z A;  3VWU A;  3GST A;  5JWQ B;  1ABA A;  4GLT A;  2X99 A;  3LXT A;  3M9J A;  1GUK A;  1ERU A;  1JFU A;  4I97 A;  19GS A;  2O89 A;  1SKS B;  3H4K A;  1E2Y A;  3QFB C;  2CV4 A;  3GX8 A;  4JRR A;  5B6M A;  2AYT A;  3CSI A;  1O73 A;  4XS4 B;  1GSY A;  1SK1 A;  4AJ7 A;  3TRQ A;  1GH2 A;  1WPI A;  5D73 A;  5ECL B;  3LG6 A;  1AAZ A;  3CRT A;  3GKK A;  3GKN A;  2OBI A;  4X43 A;  3TJK A;  2F9S A;  2NPB A;  3IHQ A;  1R26 A;  4QL9 A;  2JZT A;  3BCI A;  2JZS A;  5H5R A;  3GIX A;  1F3B A;  5COH A;  1OYJ A;  3Q6O A;  2J23 A;  4O92 A;  1M2D A;  2CVD A;  5IMF A;  4MZW A;  3IBH A;  3GYK A;  2H74 A;  3QCP A;  3CSJ A;  3TKS E;  3F3R A;  3HVS A;  6GSS A;  5IMV A;  4POK A;  3RAZ A;  2GQM A;  3AY8 A;  3ZIV A;  4KB3 A;  3M0F A;  1G6W A;  1LBK A;  2HFD A;  2R2J A;  4JZQ A;  1ZGN A;  4J56 E;  4OD7 A;  1XW6 A;  3KTL A;  1JZW A;  1OC9 B;  4G19 A;  4K9Z A;  3N5O A;  5CRD A;  2HT9 A;  1XWK A;  3F0I A;  4LMV A;  4N0V A;  4TXO A;  2KP2 A;  1B48 A;  2YZU A;  1NHO A;  1TRW A;  5DCH A;  4XHM A;  4KW6 A;  5JCG A;  1M9B A;  1MD3 A;  2H1B A;  3C7M A;  3NOF A;  5GZZ B;  2RUE A;  3QDN A;  3GHA A;  2B5Y A;  4N10 A;  2L57 A;  1EP7 A;  4V1A p;  1F9M A;  1BED A;  2IMF A;  1GSF A;  1VF2 A;  4HOJ A;  3M3M A;  3F63 A;  2L5L A;  3DD3 A;  4LMW A;  5G1K A;  1RK4 A;  1QUW A;  1AIU A;  3Q19 A;  3ZFB A;  3ZFL A;  2LRN A;  1H4O A;  1YEP A;  2VD1 A;  4WBJ A;  2J9H A;  4G9H A;  2HRF A;  4V2L A;  1ZOF A;  4RI7 A;  6GST A;  6GSW A;  3DIE A;  2YAN A;  1IYH A;  2DJ3 A;  5HR1 A;  4MCU A;  5IM9 A;  1V58 A;  2CQ9 A;  1TRU A;  1OKT A;  3MAK A;  3D5J A;  4XRA A;  1OE7 A;  4EO3 A;  1HNA A;  3LSZ A;  2BJX A;  3VI5 A;  2C80 A;  4TKY A;  2QSI A;  3L9S A;  4WXT A;  4JBB A;  2AJQ B;  4MH2 A;  1VRS D;  3L0H A;  1XXU A;  4V1A g;  5CO3 A;  2CZ3 A;  2YN1 A;  5ENU A;  3LYP A;  3P90 A;  2WCI A;  1WOU A;  2GVP A;  5ECS A;  1EEJ A;  2H66 A;  4MA9 A;  1ML6 A;  5J9B A;  2MMZ A;  3HHV A;  3W6G A;  2V41 A;  4K7O A;  1SKW B;  4ZL9 A;  4TW5 A;  4PUR A;  4EDZ A;  3MNG A;  4WR4 A;  2OBK A;  2A2S A;  1O6J A;  4IN0 A;  4FYC A;  4X0X A;  3C1S A;  4ZBB A;  4MJB A;  5J5N A;  1QXH A;  4PQ1 A;  1U88 A;  1CQH A;  1AQW A;  1WP0 A;  1ERW A;  5HQP A;  2K18 A;  2R6K A;  1YJ6 A;  3ZLP A;  5F06 A;  2LST A;  1PGT A;  2FD3 A;  3EYT A;  1URM A;  4G10 A;  1UA5 A;  1XWA A;  2VLV A;  2H0H A;  3BCK A;  2YWN A;  4MAB A;  2C0E A;  2L5O A;  14GS A;  5KN0 A;  1AQV A;  3US3 A;  1SJI A;  3QAG A;  1AUC A;  2DC5 A;  1MDK A;  5A4U A;  3RHC A;  1YF1 A;  2FA8 A;  5ID2 A;  2PPT A;  2VCQ A;  1JZD A;  4PNF A;  3ME7 A;  4MPF A;  2OAC A;  3UAP A;  4IJ3 A;  1A23 A;  2B1L A;  2GGT A;  3W8J A;  2NDO A;  2FLS A;  1K0C A;  1YZX A;  3G7I A;  1JZO A;  3IRA A;  1SL2 B;  12GS A;  2VUP A;  2VL2 C;  2RUF A;  1EV4 A;  2X64 A;  4ACS A;  2X8C A;  2JL4 A;  1ST9 A;  3KM6 A;  3GUR A;  1GWC A;  4AJ6 A;  3GH9 A;  3CMI A;  2C4J A;  1ZMA A;  4EE0 A;  5E59 A;  4Q5Q A;  3LFL A;  4FO5 A;  3RPN A;  3L4N A;  8GSS A;  1EP8 A;  2IFQ B;  3KH9 A;  4HU9 A;  2DJ2 A;  2N5B A;  5IQY A;  5INY A;  5H5S A;  1M2B A;  1B9X C;  1TTZ A;  3IE3 A;  1FG4 A;  3P2A A;  5HR2 A;  2GSS A;  1BAY A;  1JLV A;  1HNC A;  1O8W A;  3WGD A;  3TKS A;  3D4T A;  4ECC A;  4QL7 A;  3E0U A;  1I9D A;  1TXX A;  2P31 A;  5CRE A;  4MLY A;  2FWH A;  1X9W B;  1OVN A;  3TJG A;  3UBK A;  2GZP A;  2HSH A;  5IPG A;  5GAN D;  1FO5 A;  4EKZ A;  3GKX A;  1XBS A;  1F2E A;  2AAW A;  2CAI A;  3IOS A;  3VLN A;  3GH6 A;  2GLR A;  5E4W A;  3TOU A;  3FY7 A;  5KN1 A;  3GMF A;  2B6M A;  2LNT A;  2JSY A;  1MTC A;  22GS A;  1LU4 A;  2REM A;  3UL3 A;  1J08 A;  3HD5 A;  3LGC A;  1GTI A;  2X8G A;  4CW9 A;  4ECB A;  2XC2 A;  4ILF A;  1EEM A;  1PN9 A;  5C04 A;  1TKD B;  3FZ5 A;  4ZL8 A;  2I9H A;  3ERW A;  1M9A A;  2K8V A;  3UVH A;  3ZIT A;  1W4V A;  2EIO A;  5G30 A;  3L78 A;  2CT6 A;  3WYW A;  2XPD A;  2YV7 A;  3VUR A;  3HKR A;  2L59 A;  1Y25 A;  2HE3 A;  2LQO A;  4ML6 A;  2HZE B;  4EF0 A;  2TRX A;  2ZCT A;  4YQV A;  4E8E A;  5F8B A;  5IMA A;  3UEM A;  5DQS A;  6GSX A;  2VCX A;  2H6X A;  2MMN A;  5DAK A;  4K6X A;  4KCA A;  1YQ1 A;  1WMJ A;  2CVB A;  2GST A;  1PMT A;  2DJK A;  4NHW A;  1Z6N A;  1X5E A;  4FYU A;  1I5G A;  2TRC P;  3GL5 A;  3O3T A;  1Q4J A;  3IXR A;  2PN8 A;  1A2L A;  2WS2 A;  3F3Q A;  2DSA A;  1U3I A;  1BJX A;  1TW9 A;  4GCI A;  3UVT A;  4Q5R A;  2GT5 A;  2R4V A;  1BG5 A;  1F6M C;  2H72 A;  4V2M A;  4TXO B;  3FK8 A;  1ZYQ B;  6GSU A;  4PUF C;  5F07 A;  2L6D A;  3UIW A;  4HDE A;  2N5A A;  1HD2 A;  3APS A;  2I1U A;  2DLX A;  1PL2 A;  3FR9 A;  3P7X A;  4KGI A;  2C1Y A;  2FUG 2;  1V40 A;  5DCG A;  1A2J A;  2LTK A;  4MP4 A;  4FH8 A;  4TRX A;  2XHF A;  4JR6 A;  4QQ7 A;  4FIW A;  1QMV A;  5B8A A;  5D9T A;  4BVX A;  3WGE A;  3LEF A;  3ZZX A;  4TVE A;  2CX3 A;  4TXV A;  5LCZ A;  5ELG A;  3ME8 A;  1UN2 A;  1KBN A;  4HI7 A;  2YWI A;  5A4W A;  1EWX A;  2FHE A;  16GS A;  4J2F A;  4KCE A;  4OO4 A;  1FW1 A;  4TR1 A;  4RQR A;  5ECR B;  1TP9 A;  4OFM A;  2F8F A;  3DYR A;  3A3T A;  3C8E A;  3PGT A;  4HEA 2;  2QGV A;  2D2Z A;  1AW9 A;  3GL3 A;  2Z9S A;  1TI1 A;  4XIH A;  2MZC A;  7GSS A;  2HZE A;  5DQY A;  2YJH A;  4K2D A;  10GS A;  5J4U A;  3P8W A;  5G1L A;  5EPF A;  2BMX A;  3CYN A;  5B6N A;  1QFN A;  4XCS A;  4ECJ A;  3DEX A;  4ID0 A;  2JAC A;  3WGX A;  3F4R A;  4WEY A;  1GP1 A;  2OE3 A;  2MBS A;  5D93 A;  1A8L A;  2VAF A;  2IJY A;  4IQA A;  4TN8 A;  5AIV A;  3FZ9 A;  3HVX A;  3DXB A;  1SD9 A;  3KJY A;  2IN3 A;  1U6T A;  4MPG A;  4WF4 A;  3DKS A;  2C0F A;  2KP1 A;  3KP8 A;  4K0G A;  4I6X A;  2DJ1 A;  1O8X A;  1PA3 A;  4YQM A;  3IR4 A;  1T8E B;  5FHI A;  2IMK A;  1SL1 B;  3CBU A;  5JWR B;  2HZF A;  3HA9 A;  4HQS A;  11GS A;  1K0O A;  4F0B A;  2VL9 A;  3FZA A;  1GLQ A;  1AC1 A;  2O8V B;  3APO A;  3N9J A;  5EY6 A;  5GSS A;  1YEX A;  2VD0 A;  2OKA A;  3H1N A;  3I69 A;  3TKR A;  1GSD A;  2VM2 A;  1PL1 A;  2N5F A;  3ERF A;  3WT2 A;  1DE1 A;  4O32 A;  2QC7 A;  4NV2 A;  5G5F A;  1ZL9 A;  4OCE A;  4TOP A;  5ID2 B;  5JCW A;  2FA4 A;  5ELA A;  3KEB A;  3TRX A;  1XIY A;  3ZYW A;  2DIZ A;  2FWE A;  5HR3 A;  2MBT A;  3KXO A;  4IP6 A;  4EXJ A;  1GRX A;  4G2E A;  2LS5 A;  4F9Z A;  4MF6 A;  1T3B A; 
#chains in the Genus database with same CATH topology
 3L9V A;  1E6B A;  3HYP A;  4DSR A;  1DBY A;  1EGO A;  5GST A;  2HRN A;  1O85 A;  1K3Y A;  2KHP A;  6GSV A;  3TOT A;  2H1A A;  2F8A A;  2YOI A;  3PIN A;  1GL8 A;  5AIX A;  4MH3 A;  1TK0 B;  1V57 A;  2XPE A;  1YKC A;  2OAD A;  1SKR B;  1B8X A;  1K0D A;  1Z9H A;  5B8B A;  4H86 A;  4IHU A;  3EIN A;  1GUL A;  2LJR A;  4POL A;  2VCZ A;  3MSZ A;  3FW2 A;  3VK9 A;  2E0Q A;  2K6V A;  3DVX A;  1NHY A;  1FHE A;  1MD4 A;  1ON4 A;  2NVL A;  2H75 A;  3I43 A;  3FRC A;  5D96 A;  1X9S B;  1GTB A;  5DJM A;  3HY2 A;  3H79 A;  4NMU A;  1EOH A;  2IPA A;  3G7J A;  4N30 A;  4PXO A;  3FR3 A;  1XPV A;  3M8N A;  2MYG A;  5CAX A;  5IOX A;  4LLR A;  20GS A;  1PSQ A;  1EV9 A;  1N8J A;  4GSS A;  2EIR A;  2ES7 A;  2UZ8 A;  3TJF A;  18GS A;  5DJL A;  4G0K A;  4MMM A;  5F05 A;  6GSY A;  1G7E A;  3S9F A;  2V32 A;  1TK8 B;  4GRF A;  2B5E A;  4PX1 A;  3HXS A;  2FNO A;  3TKP A;  3VWX A;  2JZR A;  2M80 A;  2C0D A;  2HRK A;  4BPY A;  3EMX A;  2VO4 A;  4L8E A;  3FMW A;  2R5G A;  5KN3 A;  5ECH B;  4XTS A;  2X8H A;  2WB9 A;  5CRH A;  1FVK A;  1TRV A;  1QK8 A;  3ZRE A;  1FB0 A;  3IK7 A;  4PGT A;  1A2M A;  1GSE A;  3QAV A;  5B7C A;  4BWS A;  3QMX A;  1K0A A;  3LYK A;  4G0I A;  1THO A;  2KUC A;  1VGL A;  1ERT A;  1YDK A;  4WET A;  3TJJ A;  3ZML A;  1SYX A;  3A2W A;  3QOU A;  5IMC A;  3DML A;  4ISD A;  2QA1 A;  3DVW A;  2HSY A;  1SJ6 A;  1A8Y A;  2FCH A;  2B3S A;  4ULX A;  2WZ9 A;  1T4Y A;  2LEG A;  2GQL A;  5IPH A;  4WR5 A;  2JAD A;  3SBC A;  4EUY A;  2ON5 A;  3O6T A;  1K0N A;  4XS6 A;  1PKW A;  1XOA A;  2XBQ A;  4J57 E;  2B7J A;  2DJ0 A;  4HZ2 A;  4NV5 A;  3FYG A;  3FHK A;  5DAK B;  2VM1 A;  4POM A;  4NPB A;  1TOF A;  3KCM A;  2IME A;  4GF0 A;  4PNG A;  4PQI A;  4JU5 A;  3BBY A;  4AGS A;  4IGJ A;  3Q74 A;  1Z5Y E;  5EVO A;  3L9U A;  4CY6 A;  2LRC A;  5JWO B;  2C8U A;  2YPM A;  4MJC A;  3HDC A;  1Z7P A;  1ZZY A;  2FY6 A;  2EC4 A;  1K0M A;  17GS A;  4WF5 A;  4IKH A;  4LL1 B;  2OE1 A;  4MF7 A;  5LD0 A;  2HYX A;  1ERV A;  4LA1 A;  4CHS A;  2ZNM A;  2E7P A;  5CP1 A;  2FWG A;  3J7Y k;  2WUL A;  1O81 A;  4GSN A;  4KE3 A;  2R3X A;  4DSQ A;  2YNX A;  4O7H A;  4KND A;  1OC3 A;  3UAR A;  4HS1 A;  4BVX B;  2GS3 A;  4NAX A;  1HYU A;  3KMO A;  4ZIL A;  3D6I A;  3ZTL A;  1SYR A;  4DSS A;  2H1G A;  1GTA A;  3GX0 A;  3IAM 2;  4TR1 B;  1JLW A;  5D9V A;  1NM3 A;  3GKM A;  2HNL A;  2AUV A;  3ZMK A;  3UOM A;  1TU8 A;  3HZ4 A;  4TR4 A;  5IMD A;  3CTF A;  2QKE A;  2R0C A;  1C72 A;  1M99 A;  1K3L A;  2LV3 A;  1RW1 A;  4AF2 A;  1FOH A;  2I4A A;  3GNJ A;  1QGV A;  2P0G A;  3GRX A;  3ED3 A;  3DRN A;  2DML A;  4L5L A;  2M72 A;  2PUK C;  2LJK A;  3TJB A;  1F3A A;  2LQQ A;  2G0F A;  2VL2 A;  1X5D A;  1FVJ A;  5A5K A;  5ECI B;  5DVB A;  1PD2 1;  2RM5 A;  1KNG A;  4K5R A;  1T7P B;  1XCC A;  2H6Z A;  4KSO A;  1USB A;  5AN1 A;  2LRT A;  3CQF A;  1XWG A;  4L0U A;  4XRD A;  4BWQ A;  2PVQ A;  5CYY A;  1CQG A;  3GTU B;  4K5S A;  2H6Y A;  3TRP A;  3KD0 A;  2VIM A;  4RI6 A;  2VCW A;  3E9J B;  1U87 A;  2K8S A;  1YKA A;  4ECI A;  1OE8 A;  4MZB A;  2VL3 A;  2LNS A;  2AHE A;  2RLI A;  2H73 A;  4X1U A;  3FEU A;  2R37 A;  3HZ8 A;  3F6F A;  4KDU A;  3IDV A;  1GUH A;  1DE2 A;  4ZB6 A;  1B4P A;  1TU7 A;  4Z2R A;  4I5Q A;  1XVW A;  13GS A;  4F0C A;  2IL3 A;  3H93 A;  2A4V A;  2WDU A;  3A5I A;  4RQX A;  4YQU A;  1Y6E A;  2CA8 A;  4IW9 A;  1GUM A;  1WIK A;  4OWY A;  5HR0 A;  4HU7 A;  5F0G A;  1GSQ A;  2C3N A;  5C00 A;  3E3E A;  5IO2 A;  5GAP D;  5ABR A;  1N2A A;  4ZBA A;  3WD6 A;  4DEJ A;  3DGQ A;  4ZBD A;  4HSC X;  4I2T A;  5DBQ A;  3CSH A;  2M46 A;  1TRS A;  4IVF A;  2F51 A;  2FWF A;  3QAW A;  5AGY A;  4MDC A;  3C71 A;  3D22 A;  4JED A;  4YH2 A;  2ZUP A;  3F9U A;  1SD8 A;  2FGX A;  1J0F A;  3IA1 A;  3ISO A;  3VFI A;  1MDJ A;  1PKZ A;  3KIJ A;  1SJZ A;  2LUS A;  1PFO A;  1X9M B;  3KP9 A;  5H5Q A;  1EGR A;  3HCZ A;  1NW2 A;  5DAL A;  2WGR A;  2A2R A;  4Q5N A;  3ZVJ A;  2MMA A;  1OC8 A;  1EZK A;  3EUR A;  4Z7X A;  2I81 A;  3GUS A;  2IWT A;  4E8H A;  2E2M A;  1TK5 B;  4KSM A;  1T4Z A;  2IMD A;  4KUN A;  1GLP A;  2EIQ A;  1DSB A;  4HZ4 A;  4IP1 A;  3F4S A;  2JSZ A;  3NIV A;  3UMA A;  3HJP A;  1Q98 A;  1XOB A;  2GT6 A;  3GTU A;  4KDY A;  3F4T A;  4GWR A;  1VF1 A;  3C73 A;  4D73 B;  1S3D A;  2YCD A;  2I3Y A;  4NHZ A;  2H8L A;  4X4J A;  3JCM L;  4KAE A;  3IK9 A;  1ZYE A;  4JR4 A;  2LJA A;  3EU3 A;  5FT3 A;  2GTU A;  4L5O A;  4ZIJ A;  1ZCP A;  2DMM A;  1B4Q A;  2B1K A;  2KOK A;  3CTG A;  3ZL5 A;  3SWL A;  2CVK A;  4DVC A;  1BYE A;  2CAQ A;  5IOW A;  1F37 A;  1B9Y C;  1VF3 A;  2KLX A;  4TR3 A;  4POB A;  5AIS A;  4Q5F A;  2PMT A;  3VI7 A;  5DDL A;  4IJI A;  4OCF A;  2C3Q A;  1PQN A;  2GZY A;  3J7Y b;  3O76 A;  1GSS A;  2MMO A;  3TGZ A;  2F3M A;  3LWA A;  3W8S A;  2HXK A;  4OO5 A;  3KGK A;  4ICY A;  1G6Y A;  2NTO A;  4GQF A;  2AV4 A;  5LNK e;  4LL4 B;  4PUA A;  1XWC A;  1G7O A;  3GV1 A;  1ILO A;  1M2A A;  1SK0 A;  2E2G A;  5CRG A;  2DKI A;  4EDY A;  3RBT A;  2H19 A;  3ZIJ A;  2V1M A;  1NSW A;  4GTU A;  4K0N A;  4XS4 A;  1FB6 A;  3A2X A;  2R0P A;  1XW5 A;  3ERG A;  1R5P A;  4I2U A;  5CNW A;  2LKU A;  3GA4 A;  1A0R P;  1VF4 A;  2CZ2 A;  2R0G A;  4IBP A;  2V2G A;  3IV4 A;  1J9B A;  4O5R A;  1DUG A;  1TI3 A;  5EL8 A;  1WWJ A;  1K3O A;  1BQ7 A;  1MEK A;  4EL1 A;  3APQ A;  4ZL7 A;  1Z6M A;  3LQ7 A;  3PH9 A;  3GN3 A;  4D73 A;  1Z7R A;  2DKH A;  2H71 A;  5HFG A;  2G2Q A;  4CDO A;  2A4H A;  3LOR A;  1WRY A;  5ECN B;  3RHB A;  2IMI A;  9GSS A;  1OKD A;  5J9C A;  1OC9 A;  3TCO A;  1OAZ A;  4JE1 A;  2VLU A;  1T1V A;  4CY8 A;  4EIQ A;  3R2Q A;  3TKS C;  1KEB A;  2PU9 C;  3G7Y A;  4P3Y B;  4ZB9 A;  3Q18 A;  2H0I A;  4L0W A;  4ZB8 A;  3MYD A;  2H1D A;  2BTO T;  4IEL A;  4KF9 A;  4MF5 A;  4FYB A;  3HVN A;  4HJ2 A;  4KDX A;  4PQH A;  3VWV A;  3IC8 A;  4NWY A;  3BOA A;  4MJA A;  4PTS A;  1A24 A;  2C3T A;  2K9F A;  5ECQ B;  4Z2T A;  1GNE A;  3LJR A;  4MZC A;  4YAP A;  5IIZ A;  4IQ1 A;  1FAA A;  3D21 A;  2RM6 A;  4GQC A;  2GDR A;  1SK2 A;  5D9X A;  1LJR A;  4DSS B;  3A2V A;  3I9V 2;  1T00 A;  1G0T A;  5IO0 A;  1XG8 A;  3A5W A;  2HI7 A;  3IC4 A;  5D9W A;  3RDW A;  2H30 A;  4BVY A;  3G9B A;  3QPM A;  1X0R A;  3TB2 A;  4ZXG A;  5CRW A;  2H0G A;  3TDG A;  4FQU A;  2O85 A;  2WJU A;  3QD9 A;  2H01 A;  3MWH A;  5BMU A;  1H75 A;  1V9W A;  1UC7 A;  5BRT A;  1RQM A;  2B7K A;  1YF0 A;  2YZH A;  5G5E A;  2DBC A;  2C0G A;  4F03 A;  3IPZ A;  3MDK A;  1FOV A;  4HUA A;  1YY7 A;  4MJE A;  1PRX A;  3M9K A;  1V98 A;  1X5C A;  1UVZ A;  5KEJ A;  1V2A A;  3C1R A;  2TIR A;  3NZN A;  1BX9 A;  2O7K A;  3EC3 A;  4AJ8 A;  2PVO C;  3HVV A;  4EC0 A;  2H76 A;  3U5R E;  1SEN A;  1HQO A;  2VCV A;  1JHB A;  5JCU A;  3KMN A;  3RPP A;  2ALB A;  1R5A A;  2OE0 A;  4HJM A;  1R7H A;  1R4W A;  5ECK B;  3EVI A;  1AXD A;  2YV9 A;  1S3R A;  3FR6 A;  4K1F A;  3F6D A;  3PR8 A;  3EU4 A;  2PGT A;  3VPQ A;  4MK3 A;  2PWJ A;  3KH7 A;  3I6A A;  2H70 A;  2QA2 A;  1M3J A;  5A4V A;  3OR5 A;  3FZ4 A;  2ON7 A;  2IIY A;  2PBJ A;  4BL7 A;  2YWO A;  3DWV A;  5G31 A;  4F82 A;  2B5X A;  2DIY A;  5ECO B;  4KX4 A;  3QR6 A;  1XWB A;  4K7N A;  3U6V A;  2L6C A;  5HFI A;  1XW9 A;  3H8Q A;  2GSQ A;  5KN2 A;  4V2N A;  5HFK A;  2JU5 A;  5L71 A;  1TJD A;  4IS0 A;  2OJL A;  1WE0 A;  3TUE A;  3EMP A;  2AB6 A;  3D0Z A;  4F2I A;  4USS A;  2RII A;  3CXG A;  5J3R A;  1A0F A;  2VCT A;  1AQX A;  1GTU A;  5ECP B;  2HSM A;  5DAL B;  4N11 A;  3BJ5 A;  5D8I A;  3QFA C;  4HQZ A;  1QQ2 A;  1XZO A;  2P5Q A;  3BD2 A;  4ML1 A;  3HJO A;  3WT1 A;  3CRU A;  2XBI A;  3M1G A;  1XFL A;  4OMV A;  2VLT A;  5J41 A;  1XVQ A;  3EWL A;  1EOG A;  2DJJ A;  3TKQ A;  4A5P A;  2YJ7 A;  1MDI A;  3HJM A;  3EE2 A;  2WFC A;  5G2Z A;  1HNB A;  3GSS A;  1PX7 A;  1Z3E A;  4TR0 A;  2GZZ A;  2GSR A;  2P5R A;  4NXI A;  4KH7 A;  1WJK A;  4GXZ A;  3F8U A;  2X49 A;  4K7I A;  1K0B A;  1O7U A;  1S3C A;  2PER A;  3K8N A;  1M7T A;  4Z2U A;  2IFQ A;  5IMZ A;  2YWM A;  4XS1 A;  3UJ1 A;  4YAV A;  3D4M A;  3VWW A;  3ZVJ D;  2HLS A;  5ECM B;  1GNW A;  1S3A A;  4I8B A;  2OA7 A;  2YP6 A;  4K8M A;  2L4C A;  1KTE A;  3KZQ A;  2L4Q A;  2WRT A;  2V6O A;  4WKW A;  1ACV A;  4BA7 A;  2VOC A;  2CX4 A;  1SL0 B;  2NBS A;  1W89 A;  3GFK A;  4GST A;  3FKF A;  4MNN A;  4RUV A;  4OFT A;  3UBL A;  1GSU A;  1U3A A;  4KA0 A;  1TDI A;  3LXZ A;  4WBR D;  2V6K A;  4OFN A;  3ZRD A;  3KTB A;  3V1W A;  2GQK A;  4EVM A;  2O87 A;  3VPT A;  1IYI A;  1JZR A;  5FWG A;  1THX A;  1PX6 A;  1SU9 A;  1M0U A;  3IAS 2;  4N0Z A;  3VWU A;  3GST A;  5JWQ B;  1ABA A;  4GLT A;  2X99 A;  3LXT A;  3M9J A;  1GUK A;  1ERU A;  1JFU A;  4I97 A;  19GS A;  2O89 A;  1SKS B;  3H4K A;  4BIK A;  2HRA A;  1E2Y A;  3QFB C;  2CV4 A;  3GX8 A;  4JRR A;  4O5U A;  5B6M A;  2AYT A;  3CSI A;  1O73 A;  4XS4 B;  1GSY A;  1SK1 A;  4AJ7 A;  3TRQ A;  1GH2 A;  1WPI A;  5D73 A;  5ECL B;  3LG6 A;  1AAZ A;  3CRT A;  3GKK A;  3GKN A;  2OBI A;  4X43 A;  3TJK A;  2F9S A;  2NPB A;  3IHQ A;  1R26 A;  4QL9 A;  2JZT A;  3BCI A;  2JZS A;  5H5R A;  3GIX A;  1F3B A;  5COH A;  1OYJ A;  3Q6O A;  2J23 A;  4O92 A;  1M2D A;  2CVD A;  5IMF A;  4MZW A;  3IBH A;  3GYK A;  2H74 A;  3QCP A;  3CSJ A;  3TKS E;  3F3R A;  3HVS A;  6GSS A;  5IMV A;  4POK A;  3RAZ A;  2GQM A;  3AY8 A;  4K2X A;  3ZIV A;  4KB3 A;  3M0F A;  1G6W A;  1LBK A;  2HFD A;  2R2J A;  4JZQ A;  1ZGN A;  4J56 E;  4OD7 A;  1XW6 A;  3KTL A;  1JZW A;  1OC9 B;  4G19 A;  4G0L A;  4K9Z A;  3N5O A;  5CRD A;  2HT9 A;  1XWK A;  3F0I A;  4LMV A;  4N0V A;  4TXO A;  2KP2 A;  1B48 A;  2YZU A;  1PN0 A;  1NHO A;  1TRW A;  5DCH A;  4XHM A;  4KW6 A;  5JCG A;  1M9B A;  1MD3 A;  2H1B A;  3C7M A;  3NOF A;  5GZZ B;  2RUE A;  3QDN A;  3GHA A;  2B5Y A;  4N10 A;  2L57 A;  1EP7 A;  4V1A p;  1F9M A;  1BED A;  2IMF A;  1GSF A;  1VF2 A;  4HOJ A;  3M3M A;  3F63 A;  2L5L A;  3DD3 A;  4LMW A;  5G1K A;  1RK4 A;  1QUW A;  1AIU A;  5KOX A;  3Q19 A;  4BVY B;  3ZFB A;  3ZFL A;  2LRN A;  1H4O A;  1YEP A;  2VD1 A;  4WBJ A;  2J9H A;  4G9H A;  2HRF A;  4V2L A;  1ZOF A;  4RI7 A;  6GST A;  6GSW A;  3DIE A;  2YAN A;  1IYH A;  2DJ3 A;  5HR1 A;  4MCU A;  5IM9 A;  1V58 A;  2CQ9 A;  1TRU A;  1OKT A;  3MAK A;  3D5J A;  4XRA A;  1OE7 A;  4EO3 A;  1HNA A;  3LSZ A;  2BJX A;  3VI5 A;  2C80 A;  4TKY A;  2QSI A;  3L9S A;  4WXT A;  4JBB A;  2AJQ B;  4MH2 A;  1VRS D;  3L0H A;  1XXU A;  4V1A g;  5CO3 A;  2CZ3 A;  2YN1 A;  5ENU A;  3LYP A;  3P90 A;  2WCI A;  1WOU A;  2GVP A;  5ECS A;  1EEJ A;  2H66 A;  4MA9 A;  1ML6 A;  5J9B A;  2MMZ A;  3HHV A;  3W6G A;  2V41 A;  4K7O A;  1SKW B;  4ZL9 A;  4TW5 A;  4PUR A;  4EDZ A;  3MNG A;  4WR4 A;  2OBK A;  2A2S A;  1O6J A;  4IN0 A;  4FYC A;  4X0X A;  3C1S A;  4ZBB A;  4MJB A;  5J5N A;  3MIX A;  1QXH A;  4PQ1 A;  1U88 A;  1CQH A;  1AQW A;  1WP0 A;  1ERW A;  5HQP A;  2K18 A;  2R6K A;  1YJ6 A;  4BL7 B;  3ZLP A;  5F06 A;  2LST A;  1PGT A;  2FD3 A;  3EYT A;  1URM A;  4G10 A;  1UA5 A;  1XWA A;  2VLV A;  2H0H A;  3BCK A;  2YWN A;  4MAB A;  2C0E A;  2L5O A;  14GS A;  5KN0 A;  1AQV A;  3US3 A;  1SJI A;  3QAG A;  1AUC A;  2DC5 A;  1MDK A;  5A4U A;  3RHC A;  1YF1 A;  2FA8 A;  5ID2 A;  2PPT A;  2VCQ A;  1JZD A;  4PNF A;  3ME7 A;  4MPF A;  2OAC A;  3LW9 A;  3UAP A;  4IJ3 A;  1A23 A;  2B1L A;  2GGT A;  3W8J A;  2NDO A;  2FLS A;  1K0C A;  1YZX A;  3G7I A;  1JZO A;  3IRA A;  1SL2 B;  12GS A;  2VUP A;  2VL2 C;  2RUF A;  1EV4 A;  2X64 A;  4ACS A;  2X8C A;  2JL4 A;  1ST9 A;  3KM6 A;  3GUR A;  1GWC A;  4AJ6 A;  3GH9 A;  3CMI A;  2C4J A;  1ZMA A;  4EE0 A;  5E59 A;  4Q5Q A;  4O5Q A;  3LFL A;  4FO5 A;  3RPN A;  3L4N A;  8GSS A;  1EP8 A;  2IFQ B;  3KH9 A;  4HU9 A;  2DJ2 A;  2N5B A;  5IQY A;  5INY A;  5H5S A;  1M2B A;  1B9X C;  1TTZ A;  3IE3 A;  1FG4 A;  3P2A A;  5HR2 A;  2GSS A;  1BAY A;  1JLV A;  4YKG A;  1HNC A;  1O8W A;  3WGD A;  3TKS A;  3D4T A;  4ECC A;  4QL7 A;  3E0U A;  1I9D A;  1TXX A;  2P31 A;  5CRE A;  4YKF A;  4MLY A;  2FWH A;  1X9W B;  1M3I A;  1OVN A;  3TJG A;  3UBK A;  2GZP A;  2HSH A;  5IPG A;  5GAN D;  1FO5 A;  4EKZ A;  3GKX A;  1XBS A;  1F2E A;  2AAW A;  2CAI A;  3IOS A;  3VLN A;  3GH6 A;  2GLR A;  5E4W A;  3TOU A;  3FY7 A;  5KN1 A;  3GMF A;  2B6M A;  2LNT A;  2JSY A;  1MTC A;  22GS A;  1LU4 A;  2REM A;  3UL3 A;  1J08 A;  2X4A A;  3HD5 A;  3LGC A;  1GTI A;  2X8G A;  4CW9 A;  4ECB A;  2XC2 A;  4ILF A;  1EEM A;  1PN9 A;  5C04 A;  1TKD B;  3FZ5 A;  4ZL8 A;  2I9H A;  3ERW A;  1M9A A;  2K8V A;  3UVH A;  3ZIT A;  1W4V A;  2EIO A;  5G30 A;  3L78 A;  2CT6 A;  3WYW A;  2XPD A;  2YV7 A;  3VUR A;  3HKR A;  2L59 A;  1Y25 A;  2HE3 A;  2LQO A;  4ML6 A;  2HZE B;  4EF0 A;  2TRX A;  2ZCT A;  4YQV A;  4E8E A;  5F8B A;  5IMA A;  3UEM A;  5DQS A;  6GSX A;  2VCX A;  2H6X A;  2MMN A;  4EIP A;  5DAK A;  4K6X A;  4KCA A;  1YQ1 A;  1WMJ A;  2CVB A;  2GST A;  1PMT A;  2DJK A;  4NHW A;  1Z6N A;  1X5E A;  4FYU A;  1I5G A;  2TRC P;  3GL5 A;  3O3T A;  1Q4J A;  3IXR A;  2PN8 A;  1A2L A;  2WS2 A;  3F3Q A;  2DSA A;  1U3I A;  1BJX A;  1TW9 A;  4GCI A;  3UVT A;  4Q5R A;  2GT5 A;  2R4V A;  1BG5 A;  1F6M C;  2H72 A;  4V2M A;  4TXO B;  3FK8 A;  1ZYQ B;  6GSU A;  4PUF C;  5F07 A;  2L6D A;  3UIW A;  4HDE A;  2N5A A;  1HD2 A;  3APS A;  2I1U A;  2DLX A;  1PL2 A;  3FR9 A;  3P7X A;  4KGI A;  2C1Y A;  2FUG 2;  1V40 A;  5DCG A;  1A2J A;  2LTK A;  4MP4 A;  4FH8 A;  4TRX A;  2XHF A;  4JR6 A;  3EPT A;  4QQ7 A;  4FIW A;  1QMV A;  5B8A A;  5D9T A;  4BVX A;  3WGE A;  3LEF A;  3ZZX A;  4TVE A;  2CX3 A;  4TXV A;  5LCZ A;  5ELG A;  3ME8 A;  1UN2 A;  1KBN A;  4HI7 A;  2YWI A;  5A4W A;  1EWX A;  2FHE A;  16GS A;  4J2F A;  4KCE A;  4OO4 A;  1FW1 A;  4TR1 A;  4RQR A;  5ECR B;  1TP9 A;  4OFM A;  2F8F A;  3DYR A;  3R3E A;  3A3T A;  3C8E A;  3PGT A;  4HEA 2;  2QGV A;  2D2Z A;  1AW9 A;  3GL3 A;  2Z9S A;  1TI1 A;  4XIH A;  2MZC A;  7GSS A;  2HZE A;  5DQY A;  2YJH A;  3IHG A;  4K2D A;  10GS A;  5J4U A;  3P8W A;  3PPU A;  5G1L A;  5EPF A;  2BMX A;  3CYN A;  5B6N A;  1QFN A;  4XCS A;  4ECJ A;  3DEX A;  4ID0 A;  2JAC A;  3WGX A;  3F4R A;  4WEY A;  1GP1 A;  2OE3 A;  2MBS A;  5D93 A;  1A8L A;  2VAF A;  2IJY A;  4IQA A;  4TN8 A;  5AIV A;  3FZ9 A;  3HVX A;  3DXB A;  1SD9 A;  3KJY A;  2IN3 A;  1U6T A;  4MPG A;  4WF4 A;  1ZYP A;  2C0F A;  3DKS A;  2KP1 A;  3KP8 A;  4K0G A;  4I6X A;  2DJ1 A;  1O8X A;  1PA3 A;  4YQM A;  3IR4 A;  1T8E B;  1ZYN A;  5FHI A;  2IMK A;  1SL1 B;  3CBU A;  5JWR B;  5KOW A;  2HZF A;  3HA9 A;  4HQS A;  11GS A;  1K0O A;  4F0B A;  2VL9 A;  3FZA A;  1GLQ A;  1AC1 A;  2A2P A;  2O8V B;  3APO A;  3N9J A;  5EY6 A;  5GSS A;  1YEX A;  2VD0 A;  2OKA A;  3H1N A;  3I69 A;  3TKR A;  1GSD A;  2VM2 A;  1PL1 A;  2N5F A;  3ERF A;  3WT2 A;  1DE1 A;  4O32 A;  2QC7 A;  4NV2 A;  5G5F A;  1ZL9 A;  4OCE A;  4TOP A;  5ID2 B;  5JCW A;  2FA4 A;  5ELA A;  3KEB A;  3TRX A;  1XIY A;  3ZYW A;  2DIZ A;  2FWE A;  5HR3 A;  2MBT A;  3KXO A;  4IP6 A;  4EXJ A;  1GRX A;  4G2E A;  2LS5 A;  4F9Z A;  4MF6 A;  1T3B A; 
#chains in the Genus database with same CATH homology
 3L9V A;  1E6B A;  3HYP A;  4DSR A;  1DBY A;  1EGO A;  5GST A;  2HRN A;  1O85 A;  1K3Y A;  2KHP A;  6GSV A;  3TOT A;  2H1A A;  2F8A A;  2YOI A;  3PIN A;  1GL8 A;  5AIX A;  4MH3 A;  1TK0 B;  1V57 A;  2XPE A;  1YKC A;  2OAD A;  1SKR B;  1B8X A;  1K0D A;  1Z9H A;  5B8B A;  4H86 A;  4IHU A;  3EIN A;  1GUL A;  2LJR A;  4POL A;  2VCZ A;  3MSZ A;  3FW2 A;  3VK9 A;  2E0Q A;  2K6V A;  3DVX A;  1NHY A;  1FHE A;  1MD4 A;  1ON4 A;  2NVL A;  2H75 A;  3I43 A;  3FRC A;  5D96 A;  1X9S B;  1GTB A;  5DJM A;  3HY2 A;  3H79 A;  4NMU A;  1EOH A;  2IPA A;  3G7J A;  4N30 A;  4PXO A;  3FR3 A;  1XPV A;  3M8N A;  2MYG A;  5CAX A;  5IOX A;  4LLR A;  20GS A;  1PSQ A;  1EV9 A;  1N8J A;  4GSS A;  2EIR A;  2ES7 A;  2UZ8 A;  3TJF A;  18GS A;  5DJL A;  4G0K A;  4MMM A;  5F05 A;  6GSY A;  1G7E A;  3S9F A;  2V32 A;  1TK8 B;  4GRF A;  2B5E A;  4PX1 A;  3HXS A;  2FNO A;  3TKP A;  3VWX A;  2JZR A;  2M80 A;  2C0D A;  2HRK A;  4BPY A;  3EMX A;  2VO4 A;  4L8E A;  3FMW A;  2R5G A;  5KN3 A;  5ECH B;  4XTS A;  2X8H A;  2WB9 A;  5CRH A;  1FVK A;  1TRV A;  1QK8 A;  3ZRE A;  1FB0 A;  3IK7 A;  4PGT A;  1A2M A;  1GSE A;  3QAV A;  5B7C A;  4BWS A;  3QMX A;  1K0A A;  3LYK A;  4G0I A;  1THO A;  2KUC A;  1VGL A;  1ERT A;  1YDK A;  4WET A;  3TJJ A;  3ZML A;  1SYX A;  3A2W A;  3QOU A;  5IMC A;  3DML A;  4ISD A;  2QA1 A;  3DVW A;  2HSY A;  1SJ6 A;  1A8Y A;  2FCH A;  2B3S A;  4ULX A;  2WZ9 A;  1T4Y A;  2LEG A;  2GQL A;  5IPH A;  4WR5 A;  2JAD A;  3SBC A;  4EUY A;  2ON5 A;  3O6T A;  1K0N A;  4XS6 A;  1PKW A;  1XOA A;  2XBQ A;  4J57 E;  2B7J A;  2DJ0 A;  4HZ2 A;  4NV5 A;  3FYG A;  3FHK A;  5DAK B;  2VM1 A;  4POM A;  4NPB A;  1TOF A;  3KCM A;  2IME A;  4GF0 A;  4PNG A;  4PQI A;  4JU5 A;  3BBY A;  4AGS A;  4IGJ A;  3Q74 A;  1Z5Y E;  5EVO A;  3L9U A;  4CY6 A;  2LRC A;  5JWO B;  2C8U A;  2YPM A;  4MJC A;  3HDC A;  1Z7P A;  1ZZY A;  2FY6 A;  2EC4 A;  1K0M A;  17GS A;  4WF5 A;  4IKH A;  4LL1 B;  2OE1 A;  4MF7 A;  5LD0 A;  2HYX A;  1ERV A;  4LA1 A;  4CHS A;  2ZNM A;  2E7P A;  5CP1 A;  2FWG A;  3J7Y k;  2WUL A;  1O81 A;  4GSN A;  4KE3 A;  2R3X A;  4DSQ A;  2YNX A;  4O7H A;  4KND A;  1OC3 A;  3UAR A;  4HS1 A;  4BVX B;  2GS3 A;  4NAX A;  1HYU A;  3KMO A;  4ZIL A;  3D6I A;  3ZTL A;  1SYR A;  4DSS A;  2H1G A;  1GTA A;  3GX0 A;  3IAM 2;  4TR1 B;  1JLW A;  5D9V A;  1NM3 A;  3GKM A;  2HNL A;  2AUV A;  3ZMK A;  3UOM A;  1TU8 A;  3HZ4 A;  4TR4 A;  5IMD A;  3CTF A;  2QKE A;  2R0C A;  1C72 A;  1M99 A;  1K3L A;  2LV3 A;  1RW1 A;  4AF2 A;  1FOH A;  2I4A A;  3GNJ A;  1QGV A;  2P0G A;  3GRX A;  3ED3 A;  3DRN A;  2DML A;  4L5L A;  2M72 A;  2PUK C;  2LJK A;  3TJB A;  1F3A A;  2LQQ A;  2G0F A;  2VL2 A;  1X5D A;  1FVJ A;  5A5K A;  5ECI B;  5DVB A;  1PD2 1;  2RM5 A;  1KNG A;  4K5R A;  1T7P B;  1XCC A;  2H6Z A;  4KSO A;  1USB A;  5AN1 A;  2LRT A;  1XWG A;  4L0U A;  4XRD A;  4BWQ A;  2PVQ A;  5CYY A;  1CQG A;  3GTU B;  4K5S A;  2H6Y A;  3TRP A;  3KD0 A;  2VIM A;  4RI6 A;  2VCW A;  3E9J B;  1U87 A;  2K8S A;  1YKA A;  4ECI A;  1OE8 A;  4MZB A;  2VL3 A;  2LNS A;  2AHE A;  2RLI A;  2H73 A;  4X1U A;  3FEU A;  2R37 A;  3HZ8 A;  3F6F A;  4KDU A;  3IDV A;  1GUH A;  1DE2 A;  4ZB6 A;  1B4P A;  1TU7 A;  4Z2R A;  4I5Q A;  1XVW A;  13GS A;  4F0C A;  2IL3 A;  3H93 A;  2A4V A;  2WDU A;  3A5I A;  4RQX A;  4YQU A;  1Y6E A;  2CA8 A;  4IW9 A;  1GUM A;  1WIK A;  4OWY A;  5HR0 A;  4HU7 A;  5F0G A;  1GSQ A;  2C3N A;  5C00 A;  3E3E A;  5IO2 A;  5GAP D;  5ABR A;  1N2A A;  4ZBA A;  3WD6 A;  4DEJ A;  3DGQ A;  4ZBD A;  4I2T A;  5DBQ A;  3CSH A;  2M46 A;  1TRS A;  4IVF A;  2F51 A;  2FWF A;  3QAW A;  5AGY A;  4MDC A;  3C71 A;  3D22 A;  4JED A;  4YH2 A;  2ZUP A;  3F9U A;  1SD8 A;  2FGX A;  1J0F A;  3IA1 A;  3ISO A;  3VFI A;  1MDJ A;  1PKZ A;  3KIJ A;  1SJZ A;  2LUS A;  1X9M B;  3KP9 A;  5H5Q A;  1EGR A;  3HCZ A;  1NW2 A;  5DAL A;  2WGR A;  2A2R A;  4Q5N A;  3ZVJ A;  2MMA A;  1OC8 A;  1EZK A;  3EUR A;  4Z7X A;  2I81 A;  3GUS A;  2IWT A;  4E8H A;  2E2M A;  1TK5 B;  4KSM A;  1T4Z A;  2IMD A;  4KUN A;  1GLP A;  2EIQ A;  1DSB A;  4HZ4 A;  4IP1 A;  3F4S A;  2JSZ A;  3NIV A;  3UMA A;  3HJP A;  1Q98 A;  1XOB A;  2GT6 A;  3GTU A;  4KDY A;  3F4T A;  4GWR A;  1VF1 A;  3C73 A;  4D73 B;  1S3D A;  2YCD A;  2I3Y A;  4NHZ A;  2H8L A;  4X4J A;  3JCM L;  4KAE A;  3IK9 A;  1ZYE A;  4JR4 A;  2LJA A;  3EU3 A;  5FT3 A;  2GTU A;  4L5O A;  4ZIJ A;  1ZCP A;  2DMM A;  1B4Q A;  2B1K A;  2KOK A;  3CTG A;  3ZL5 A;  3SWL A;  2CVK A;  4DVC A;  1BYE A;  2CAQ A;  5IOW A;  1F37 A;  1B9Y C;  1VF3 A;  2KLX A;  4TR3 A;  4POB A;  5AIS A;  4Q5F A;  2PMT A;  3VI7 A;  5DDL A;  4IJI A;  4OCF A;  2C3Q A;  1PQN A;  2GZY A;  3J7Y b;  3O76 A;  1GSS A;  2MMO A;  3TGZ A;  2F3M A;  3LWA A;  3W8S A;  2HXK A;  4OO5 A;  3KGK A;  4ICY A;  1G6Y A;  2NTO A;  4GQF A;  2AV4 A;  5LNK e;  4LL4 B;  4PUA A;  1XWC A;  1G7O A;  3GV1 A;  1ILO A;  1M2A A;  1SK0 A;  2E2G A;  5CRG A;  2DKI A;  4EDY A;  3RBT A;  2H19 A;  3ZIJ A;  2V1M A;  1NSW A;  4GTU A;  4K0N A;  4XS4 A;  1FB6 A;  3A2X A;  2R0P A;  1XW5 A;  3ERG A;  1R5P A;  4I2U A;  5CNW A;  2LKU A;  3GA4 A;  1A0R P;  1VF4 A;  2CZ2 A;  2R0G A;  4IBP A;  2V2G A;  3IV4 A;  1J9B A;  4O5R A;  1DUG A;  1TI3 A;  5EL8 A;  1WWJ A;  1K3O A;  1BQ7 A;  1MEK A;  4EL1 A;  3APQ A;  4ZL7 A;  1Z6M A;  3LQ7 A;  3PH9 A;  3GN3 A;  4D73 A;  1Z7R A;  2DKH A;  2H71 A;  5HFG A;  2G2Q A;  4CDO A;  2A4H A;  3LOR A;  1WRY A;  5ECN B;  3RHB A;  2IMI A;  9GSS A;  1OKD A;  5J9C A;  1OC9 A;  3TCO A;  1OAZ A;  4JE1 A;  2VLU A;  1T1V A;  4CY8 A;  4EIQ A;  3R2Q A;  3TKS C;  1KEB A;  2PU9 C;  3G7Y A;  4P3Y B;  4ZB9 A;  3Q18 A;  2H0I A;  4L0W A;  4ZB8 A;  3MYD A;  2H1D A;  2BTO T;  4IEL A;  4KF9 A;  4MF5 A;  4FYB A;  4KDX A;  4HJ2 A;  4PQH A;  3VWV A;  3IC8 A;  4NWY A;  3BOA A;  4MJA A;  4PTS A;  1A24 A;  2C3T A;  2K9F A;  5ECQ B;  4Z2T A;  1GNE A;  3LJR A;  4MZC A;  4YAP A;  5IIZ A;  4IQ1 A;  1FAA A;  3D21 A;  2RM6 A;  4GQC A;  2GDR A;  1SK2 A;  5D9X A;  1LJR A;  4DSS B;  3A2V A;  3I9V 2;  1T00 A;  1G0T A;  5IO0 A;  3A5W A;  2HI7 A;  3IC4 A;  5D9W A;  3RDW A;  2H30 A;  4BVY A;  3G9B A;  3QPM A;  1X0R A;  3TB2 A;  4ZXG A;  5CRW A;  2H0G A;  3TDG A;  4FQU A;  2O85 A;  2WJU A;  3QD9 A;  2H01 A;  3MWH A;  5BMU A;  1H75 A;  1V9W A;  1UC7 A;  5BRT A;  1RQM A;  2B7K A;  1YF0 A;  2YZH A;  5G5E A;  2DBC A;  2C0G A;  4F03 A;  3IPZ A;  3MDK A;  1FOV A;  4HUA A;  1YY7 A;  4MJE A;  1PRX A;  3M9K A;  1V98 A;  1X5C A;  1UVZ A;  5KEJ A;  1V2A A;  3C1R A;  2TIR A;  3NZN A;  1BX9 A;  2O7K A;  3EC3 A;  4AJ8 A;  2PVO C;  3HVV A;  4EC0 A;  2H76 A;  3U5R E;  1SEN A;  1HQO A;  2VCV A;  1JHB A;  5JCU A;  3KMN A;  3RPP A;  2ALB A;  1R5A A;  2OE0 A;  4HJM A;  1R7H A;  1R4W A;  5ECK B;  3EVI A;  1AXD A;  2YV9 A;  3FR6 A;  4K1F A;  3F6D A;  3PR8 A;  3EU4 A;  2PGT A;  3VPQ A;  4MK3 A;  2PWJ A;  3KH7 A;  3I6A A;  2H70 A;  2QA2 A;  5A4V A;  3OR5 A;  3FZ4 A;  2ON7 A;  2IIY A;  2PBJ A;  4BL7 A;  2YWO A;  3DWV A;  5G31 A;  4F82 A;  2B5X A;  2DIY A;  5ECO B;  4KX4 A;  3QR6 A;  1XWB A;  4K7N A;  3U6V A;  2L6C A;  5HFI A;  1XW9 A;  3H8Q A;  2GSQ A;  5KN2 A;  4V2N A;  5HFK A;  2JU5 A;  5L71 A;  1TJD A;  4IS0 A;  2OJL A;  1WE0 A;  3TUE A;  3EMP A;  2AB6 A;  3D0Z A;  4F2I A;  4USS A;  2RII A;  3CXG A;  5J3R A;  1A0F A;  2VCT A;  1AQX A;  1GTU A;  5ECP B;  2HSM A;  5DAL B;  4N11 A;  3BJ5 A;  5D8I A;  3QFA C;  4HQZ A;  1QQ2 A;  1XZO A;  2P5Q A;  3BD2 A;  4ML1 A;  3HJO A;  3WT1 A;  3CRU A;  2XBI A;  3M1G A;  1XFL A;  4OMV A;  2VLT A;  5J41 A;  1XVQ A;  3EWL A;  1EOG A;  2DJJ A;  3TKQ A;  4A5P A;  2YJ7 A;  1MDI A;  3HJM A;  3EE2 A;  2WFC A;  5G2Z A;  1HNB A;  3GSS A;  1PX7 A;  1Z3E A;  4TR0 A;  2GZZ A;  2GSR A;  2P5R A;  4NXI A;  4KH7 A;  1WJK A;  4GXZ A;  3F8U A;  2X49 A;  4K7I A;  1K0B A;  1O7U A;  1S3C A;  2PER A;  3K8N A;  1M7T A;  4Z2U A;  2IFQ A;  5IMZ A;  2YWM A;  4XS1 A;  3UJ1 A;  4YAV A;  3D4M A;  3VWW A;  3ZVJ D;  2HLS A;  5ECM B;  1GNW A;  1S3A A;  4I8B A;  2OA7 A;  2YP6 A;  4K8M A;  2L4C A;  1KTE A;  3KZQ A;  2L4Q A;  2WRT A;  2V6O A;  4WKW A;  1ACV A;  4BA7 A;  2VOC A;  2CX4 A;  1SL0 B;  2NBS A;  1W89 A;  3GFK A;  4GST A;  3FKF A;  4MNN A;  4RUV A;  4OFT A;  3UBL A;  1GSU A;  1U3A A;  4KA0 A;  1TDI A;  3LXZ A;  4WBR D;  2V6K A;  4OFN A;  3ZRD A;  3KTB A;  3V1W A;  2GQK A;  4EVM A;  2O87 A;  3VPT A;  1IYI A;  1JZR A;  5FWG A;  1THX A;  1PX6 A;  1SU9 A;  1M0U A;  3IAS 2;  4N0Z A;  3VWU A;  3GST A;  5JWQ B;  1ABA A;  4GLT A;  2X99 A;  3LXT A;  3M9J A;  1GUK A;  1ERU A;  1JFU A;  4I97 A;  19GS A;  2O89 A;  1SKS B;  3H4K A;  2HRA A;  1E2Y A;  3QFB C;  2CV4 A;  3GX8 A;  4JRR A;  4O5U A;  5B6M A;  2AYT A;  3CSI A;  1O73 A;  4XS4 B;  1GSY A;  1SK1 A;  4AJ7 A;  3TRQ A;  1GH2 A;  1WPI A;  5D73 A;  5ECL B;  3LG6 A;  1AAZ A;  3CRT A;  3GKK A;  3GKN A;  2OBI A;  4X43 A;  3TJK A;  2F9S A;  2NPB A;  3IHQ A;  1R26 A;  4QL9 A;  2JZT A;  3BCI A;  2JZS A;  5H5R A;  3GIX A;  1F3B A;  5COH A;  1OYJ A;  3Q6O A;  2J23 A;  4O92 A;  1M2D A;  2CVD A;  5IMF A;  4MZW A;  3IBH A;  3GYK A;  2H74 A;  3QCP A;  3CSJ A;  3TKS E;  3F3R A;  3HVS A;  6GSS A;  5IMV A;  4POK A;  3RAZ A;  2GQM A;  3AY8 A;  4K2X A;  3ZIV A;  4KB3 A;  3M0F A;  1G6W A;  1LBK A;  2HFD A;  2R2J A;  4JZQ A;  1ZGN A;  4J56 E;  4OD7 A;  1XW6 A;  3KTL A;  1JZW A;  1OC9 B;  4G19 A;  4G0L A;  4K9Z A;  3N5O A;  5CRD A;  2HT9 A;  1XWK A;  3F0I A;  4LMV A;  4N0V A;  4TXO A;  2KP2 A;  1B48 A;  2YZU A;  1PN0 A;  1NHO A;  1TRW A;  5DCH A;  4XHM A;  4KW6 A;  5JCG A;  1M9B A;  1MD3 A;  2H1B A;  3C7M A;  3NOF A;  5GZZ B;  2RUE A;  3QDN A;  3GHA A;  2B5Y A;  4N10 A;  2L57 A;  1EP7 A;  4V1A p;  1F9M A;  1BED A;  2IMF A;  1GSF A;  1VF2 A;  4HOJ A;  3M3M A;  3F63 A;  2L5L A;  3DD3 A;  4LMW A;  5G1K A;  1RK4 A;  1QUW A;  1AIU A;  5KOX A;  3Q19 A;  4BVY B;  3ZFB A;  3ZFL A;  2LRN A;  1H4O A;  1YEP A;  2VD1 A;  4WBJ A;  2J9H A;  4G9H A;  2HRF A;  4V2L A;  1ZOF A;  4RI7 A;  6GST A;  6GSW A;  3DIE A;  2YAN A;  1IYH A;  2DJ3 A;  5HR1 A;  4MCU A;  5IM9 A;  1V58 A;  2CQ9 A;  1TRU A;  1OKT A;  3MAK A;  3D5J A;  4XRA A;  1OE7 A;  4EO3 A;  1HNA A;  3LSZ A;  2BJX A;  3VI5 A;  2C80 A;  4TKY A;  2QSI A;  3L9S A;  4WXT A;  4JBB A;  2AJQ B;  4MH2 A;  1VRS D;  3L0H A;  1XXU A;  4V1A g;  5CO3 A;  2CZ3 A;  2YN1 A;  5ENU A;  3LYP A;  3P90 A;  2WCI A;  1WOU A;  2GVP A;  5ECS A;  1EEJ A;  2H66 A;  4MA9 A;  1ML6 A;  5J9B A;  2MMZ A;  3HHV A;  3W6G A;  2V41 A;  4K7O A;  1SKW B;  4ZL9 A;  4TW5 A;  4PUR A;  4EDZ A;  3MNG A;  4WR4 A;  2OBK A;  2A2S A;  1O6J A;  4IN0 A;  4FYC A;  4X0X A;  3C1S A;  4ZBB A;  4MJB A;  5J5N A;  3MIX A;  1QXH A;  4PQ1 A;  1U88 A;  1CQH A;  1AQW A;  1WP0 A;  1ERW A;  5HQP A;  2K18 A;  2R6K A;  1YJ6 A;  4BL7 B;  3ZLP A;  5F06 A;  2LST A;  1PGT A;  2FD3 A;  3EYT A;  1URM A;  4G10 A;  1UA5 A;  1XWA A;  2VLV A;  2H0H A;  3BCK A;  2YWN A;  4MAB A;  2C0E A;  2L5O A;  14GS A;  5KN0 A;  1AQV A;  3US3 A;  1SJI A;  3QAG A;  1AUC A;  2DC5 A;  1MDK A;  5A4U A;  3RHC A;  1YF1 A;  2FA8 A;  5ID2 A;  2PPT A;  2VCQ A;  1JZD A;  4PNF A;  3ME7 A;  4MPF A;  2OAC A;  3LW9 A;  3UAP A;  4IJ3 A;  1A23 A;  2B1L A;  2GGT A;  3W8J A;  2NDO A;  2FLS A;  1K0C A;  1YZX A;  3G7I A;  1JZO A;  3IRA A;  1SL2 B;  12GS A;  2VUP A;  2VL2 C;  2RUF A;  1EV4 A;  2X64 A;  4ACS A;  2X8C A;  2JL4 A;  1ST9 A;  3KM6 A;  3GUR A;  1GWC A;  4AJ6 A;  3GH9 A;  3CMI A;  2C4J A;  1ZMA A;  4EE0 A;  5E59 A;  4Q5Q A;  4O5Q A;  3LFL A;  4FO5 A;  3RPN A;  3L4N A;  8GSS A;  1EP8 A;  2IFQ B;  3KH9 A;  4HU9 A;  2DJ2 A;  2N5B A;  5IQY A;  5INY A;  5H5S A;  1M2B A;  1B9X C;  1TTZ A;  3IE3 A;  1FG4 A;  3P2A A;  5HR2 A;  2GSS A;  1BAY A;  1JLV A;  4YKG A;  1HNC A;  1O8W A;  3WGD A;  3TKS A;  3D4T A;  4ECC A;  4QL7 A;  3E0U A;  1I9D A;  1TXX A;  2P31 A;  5CRE A;  4YKF A;  4MLY A;  2FWH A;  1X9W B;  1OVN A;  3TJG A;  3UBK A;  2GZP A;  2HSH A;  5IPG A;  5GAN D;  1FO5 A;  4EKZ A;  3GKX A;  1XBS A;  1F2E A;  2AAW A;  2CAI A;  3IOS A;  3VLN A;  3GH6 A;  2GLR A;  5E4W A;  3TOU A;  3FY7 A;  5KN1 A;  3GMF A;  2B6M A;  2LNT A;  2JSY A;  1MTC A;  22GS A;  1LU4 A;  2REM A;  3UL3 A;  1J08 A;  2X4A A;  3HD5 A;  3LGC A;  1GTI A;  2X8G A;  4CW9 A;  4ECB A;  2XC2 A;  4ILF A;  1EEM A;  1PN9 A;  5C04 A;  1TKD B;  3FZ5 A;  4ZL8 A;  2I9H A;  3ERW A;  1M9A A;  2K8V A;  3UVH A;  3ZIT A;  1W4V A;  2EIO A;  5G30 A;  3L78 A;  2CT6 A;  3WYW A;  2XPD A;  2YV7 A;  3VUR A;  3HKR A;  2L59 A;  1Y25 A;  2HE3 A;  2LQO A;  4ML6 A;  2HZE B;  4EF0 A;  2TRX A;  2ZCT A;  4YQV A;  4E8E A;  5F8B A;  5IMA A;  3UEM A;  5DQS A;  6GSX A;  2VCX A;  2H6X A;  2MMN A;  4EIP A;  5DAK A;  4K6X A;  4KCA A;  1YQ1 A;  1WMJ A;  2CVB A;  2GST A;  1PMT A;  2DJK A;  4NHW A;  1Z6N A;  1X5E A;  4FYU A;  1I5G A;  2TRC P;  3GL5 A;  3O3T A;  1Q4J A;  3IXR A;  2PN8 A;  1A2L A;  2WS2 A;  3F3Q A;  2DSA A;  1U3I A;  1BJX A;  1TW9 A;  4GCI A;  3UVT A;  4Q5R A;  2GT5 A;  2R4V A;  1BG5 A;  1F6M C;  2H72 A;  4V2M A;  4TXO B;  3FK8 A;  1ZYQ B;  6GSU A;  4PUF C;  5F07 A;  2L6D A;  3UIW A;  4HDE A;  2N5A A;  1HD2 A;  3APS A;  2I1U A;  2DLX A;  1PL2 A;  3FR9 A;  3P7X A;  4KGI A;  2C1Y A;  2FUG 2;  1V40 A;  5DCG A;  1A2J A;  2LTK A;  4MP4 A;  4FH8 A;  4TRX A;  2XHF A;  4JR6 A;  3EPT A;  4QQ7 A;  4FIW A;  1QMV A;  5B8A A;  5D9T A;  4BVX A;  3WGE A;  3LEF A;  3ZZX A;  4TVE A;  2CX3 A;  4TXV A;  5LCZ A;  5ELG A;  3ME8 A;  1UN2 A;  1KBN A;  4HI7 A;  2YWI A;  5A4W A;  1EWX A;  2FHE A;  16GS A;  4J2F A;  4KCE A;  4OO4 A;  1FW1 A;  4TR1 A;  4RQR A;  5ECR B;  1TP9 A;  4OFM A;  2F8F A;  3DYR A;  3R3E A;  3A3T A;  3C8E A;  3PGT A;  4HEA 2;  2QGV A;  2D2Z A;  1AW9 A;  3GL3 A;  2Z9S A;  1TI1 A;  4XIH A;  2MZC A;  7GSS A;  2HZE A;  5DQY A;  2YJH A;  3IHG A;  4K2D A;  10GS A;  5J4U A;  3P8W A;  3PPU A;  5G1L A;  5EPF A;  2BMX A;  3CYN A;  5B6N A;  1QFN A;  4XCS A;  4ECJ A;  3DEX A;  4ID0 A;  2JAC A;  3WGX A;  3F4R A;  4WEY A;  1GP1 A;  2OE3 A;  2MBS A;  5D93 A;  1A8L A;  2VAF A;  2IJY A;  4IQA A;  4TN8 A;  5AIV A;  3FZ9 A;  3HVX A;  3DXB A;  1SD9 A;  3KJY A;  2IN3 A;  1U6T A;  4MPG A;  4WF4 A;  1ZYP A;  2C0F A;  3DKS A;  2KP1 A;  3KP8 A;  4K0G A;  4I6X A;  2DJ1 A;  1O8X A;  1PA3 A;  4YQM A;  3IR4 A;  1T8E B;  1ZYN A;  5FHI A;  2IMK A;  1SL1 B;  3CBU A;  5JWR B;  5KOW A;  2HZF A;  3HA9 A;  4HQS A;  11GS A;  1K0O A;  4F0B A;  2VL9 A;  3FZA A;  1GLQ A;  1AC1 A;  2A2P A;  2O8V B;  3APO A;  3N9J A;  5EY6 A;  5GSS A;  1YEX A;  2VD0 A;  2OKA A;  3H1N A;  3I69 A;  3TKR A;  1GSD A;  2VM2 A;  1PL1 A;  2N5F A;  3ERF A;  3WT2 A;  1DE1 A;  4O32 A;  2QC7 A;  4NV2 A;  5G5F A;  1ZL9 A;  4OCE A;  4TOP A;  5ID2 B;  5JCW A;  2FA4 A;  5ELA A;  3KEB A;  3TRX A;  1XIY A;  3ZYW A;  2DIZ A;  2FWE A;  5HR3 A;  2MBT A;  3KXO A;  4IP6 A;  4EXJ A;  1GRX A;  4G2E A;  2LS5 A;  4F9Z A;  4MF6 A;  1T3B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...