1SL2B

Ternary 5' complex of t7 dna polymerase with a dna primer/template containing a cis-syn thymine dimer on the template and an incoming nucleotide
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
105
structure length
105
Chain Sequence
KIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/electron transport/dna
molecule keywords 5'-D(*CP*GP*AP*AP*AP*AP*CP*GP*AP*CP*GP*GP*CP*CP*AP*GP*TP*GP*
publication title Nucleotide insertion opposite a cis-syn thymine dimer by a replicative DNA polymerase from bacteriophage T7.
pubmed doi rcsb
source organism Enterobacteria phage t7
total genus 28
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2004-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1sl2B00
4DSSA 4IP1A 2C0GA 4J56E 3P2AA 1T1VA 2B7JA 3EU4A 3HHVA 1ZCPA 3FW2A 4TVEA 1ACVA 1MDKA 2FA4A 3I69A 1Z7PA 1GSFA 1PL1A 2HSYA 2ZNMA 4TXVA 4MF7A 1SKRB 2YWMA 5IO2A 1YZXA 4HU7A 2RUFA 2CVBA 5F05A 4O32A 4OD7A 2VD0A 3TB2A 5IOXA 3G7YA 4TR4A 2XBQA 1ERWA 5IMZA 2X99A 1WIKA 2NDOA 3EU3A 2CVDA 4BPYA 3F8UA 5F8BA 4NV2A 1GL8A 4NWYA 1ERVA 3L78A 1UVZA 3TGZA 2L6DA 1WE0A 5A5KA 3UIWA 1PSQA 1T00A 1OAZA 2CAQA 3KM6A 1HNBA 4IJIA 3BCIA 5IO0A 1NHYA 5H5QA 5CRWA 2GSRA 4YAVA 2P5QA 4MPGA 2AAWA 3WD6A 1V2AA 1G7EA 2H70A 1UN2A 2KUCA 3EWLA 1MDIA 3BD2A 4MZCA 4N0ZA 4BWSA 1OC3A 3ZL5A 1GLPA 4KA0A 1XWKA 4CHSA 4LMVA 5F06A 1TXXA 3L9UA 2DJ3A 5HFKA 2FWGA 3GNJA 1U3AA 3UL3A 4YQUA 3IK7A 5INYA 2L6CA 4K8MA 3HJOA 1FVKA 5KN0A 4GQCA 3GHAA 1BX9A 4TR1A 4ECIA 3MDKA 2O7KA 2GGTA 5H5RA 2H8LA 5A4VA 1O73A 5G1KA 4V1Ap 3D6IA 2XC2A 3GMFA 3PGTA 5CRDA 5HR2A 5GAND 2AV4A 2H1AA 3HVSA 1GNEA 1T4ZA 4OMVA 2H6ZA 2ZUPA 4IW9A 1VF2A 4K6XA 3KZQA 2YZHA 5CRGA 16GSA 2VAFA 4DEJA 3W8JA 4GCIA 3J7Yk 2VCZA 3BCKA 3BOAA 4D73B 1W4VA 3G9BA 2R5GA 4XS1A 1AQWA 4PX1A 1SENA 4MP4A 1K0DA 2GT5A 2H6YA 5AISA 1A8LA 10GSA 1Z3EA 4HJ2A 2KP2A 4ULXA 1YQ1A 3KIJA 2H66A 2PBJA 2HT9A 1TOFA 5DQSA 4RQXA 1ZZYA 1XWAA 2GSSA 3F4RA 4HZ4A 1HQOA 2F51A 3LWAA 2C4JA 3EMXA 5ENUA 2H0GA 1GRXA 3S9FA 4I97A 1QQ2A 4NXIA 4WETA 2GT6A 4JBBA 1K0OA 4HS1A 3CRTA 4POMA 1B48A 1XVWA 3Q18A 4KDXA 2FD3A 4KCEA 1GSDA 1XXUA 1PGTA 4GSTA 1HNAA 1LBKA 1X0RA 4K7NA 5C04A 4PNGA 1M2BA 3DKSA 1YEPA 3TCOA 2J9HA 1C72A 5AIXA 4AJ7A 3ZMKA 3HVVA 4FYUA 4OO4A 4RQRA 4YAPA 2X8GA 2LJKA 4IJ3A 2QSIA 5ECKB 2JL4A 1SYXA 5F07A 1A24A 3GUSA 4ISDA 2VCTA 4XCSA 5A4UA 4KCAA 3SWLA 4BVYA 5J3RA 2PGTA 3IDVA 4ZILA 4BVXA 3UVTA 2PERA 3FY7A 1DE2A 2VCVA 1FVJA 4JE1A 5JCWA 5E59A 1EV9A 3GSTA 3KCMA 2IFQB 4ZB9A 4JRRA 1PA3A 3GTUB 14GSA 3IC4A 2GSQA 4OO5A 4ZL8A 1OKDA 5EL8A 5HR3A 3A3TA 2WDUA 3I9V2 3KTBA 3F9UA 2C3QA 5L71A 2RLIA 4J2FA 1FO5A 1CQHA 2VL9A 3EYTA 1PX7A 3ED3A 3GX0A 4F9ZA 4MZBA 4MABA 4I2UA 3IXRA 4TOPA 1SKSB 1QK8A 3QD9A 3J7Yb 4XS4A 5IPHA 7GSSA 5GZZB 1LU4A 1TI3A 3U5RE 5B7CA 1TRSA 4WBRD 3ERFA 3GIXA 4Q5FA 2JZRA 4PXOA 5KN2A 4CDOA 3VK9A 1XW5A 4GSNA 1PRXA 1Y25A 1TTZA 4KE3A 5IMVA 3JCML 3C73A 3ZLPA 1V9WA 1EGOA 4KDYA 1F37A 4NAXA 1JLVA 1BEDA 2K8SA 1SJIA 2DC5A 1XW6A 2VM2A 4HUAA 4WKWA 5GSTA 3H79A 1U3IA 2C0EA 2GS3A 5ECHB 2M46A 3MNGA 4K0NA 3TOUA 2KP1A 4RUVA 3D5JA 5IMDA 5DALB 4E8EA 1B4PA 4HQSA 1UC7A 3KGKA 3WGXA 2IMFA 1JLWA 4L0UA 3TUEA 3FK8A 1Z6NA 1RW1A 3RDWA 1B8XA 4GF0A 3QCPA 2C8UA 3TKPA 1TRVA 1ZOFA 4ZB8A 2MMZA 4IBPA 2FWEA 2B5XA 1ZYEA 3CTGA 2I81A 1IYHA 4DSSB 1GH2A 3CTFA 3GKKA 2HRFA 1OE7A 4IGJA 3LEFA 3ZIVA 3CRUA 2FY6A 5B8AA 3RBTA 3DD3A 2OKAA 3E9JB 5ID2A 4TR3A 1LJRA 3KH7A 3F6FA 3APQA 4L5LA 2IN3A 2IPAA 1OYJA 4F0CA 1SK2A 1SD8A 1USBA 4K1FA 1QUWA 2DIZA 2M80A 3GURA 3C8EA 2CZ2A 2DMMA 5AIVA 2GQMA 3F3QA 12GSA 4P3YB 1EEMA 1GWCA 2REMA 3DWVA 1EOHA 4AGSA 4I8BA 3C71A 2H75A 2R37A 3EURA 2H1GA 2O85A 3M1GA 1KNGA 3L9SA 2H73A 3DGQA 1SU9A 4MJBA 3FZ5A 1JZDA 4GRFA 3IAM2 3FHKA 4MA9A 4IHUA 5J9BA 1SL0B 4F03A 4IKHA 2Z9SA 4KGIA 1EGRA 4EDYA 2YN1A 1O7UA 1SKWB 4G2EA 3LYPA 2KLXA 2X8HA 2E2GA 3VWVA 2H01A 1AW9A 5F0GA 2YV7A 3TRQA 4WXTA 2HZEA 1A0RP 4J57E 3N9JA 1WPIA 5COHA 3D21A 4EF0A 3QFAC 1TJDA 1T8EB 6GSYA 3FZ4A 3M3MA 2VL3A 3O76A 5D9XA 4KX4A 2HI7A 5KN3A 1THXA 2LRNA 1ZGNA 2LRCA 3TKQA 2P5RA 3NIVA 2AB6A 4XHMA 4TR1B 1X5EA 19GSA 1R26A 1N2AA 2IMDA 3FR9A 1K3YA 1FHEA 2WRTA 3DIEA 3ZZXA 2E0QA 2PMTA 3FRCA 4HDEA 2JADA 4NPBA 3NZNA 1GUMA 1PKWA 2PPTA 1K0AA 4KAEA 1TRWA 4OCEA 3KH9A 3KTLA 3CSIA 5J5NA 1FAAA 1ZL9A 4MJCA 4IQ1A 1AAZA 2VLVA 5JWQB 4TR0A 2K8VA 3P90A 2OE3A 2PWJA 1XWGA 2H72A 3VWXA 3M0FA 2HSHA 4ILFA 1EP7A 3TDGA 4EVMA 3W8SA 2FWFA 2WCIA 1X5DA 5B8BA 4ZBBA 4OFNA 2VOCA 2O89A 2VL2C 2VD1A 4MH3A 1R5AA 3A5WA 2L57A 2AUVA 4Z7XA 1SD9A 4WF5A 2GLRA 3DEXA 4TN8A 4JR6A 2NPBA 2DJ1A 2XPDA 1ERUA 4BL7A 1AQXA 3CYNA 3UARA 4ECBA 2YWNA 3D22A 1GTIA 3Q74A 4ZXGA 1WRYA 2RM5A 1K3LA 4QQ7A 2WZ9A 1GULA 1ZMAA 3VWWA 2JZTA 1SJ6A 2LSTA 3GKNA 3L4NA 1XCCA 2C1YA 2MYGA 2EIQA 4NMUA 1MDJA 1BQ7A 1GSUA 2B5EA 2YJ7A 3QAVA 1NM3A 3QMXA 3TJGA 2YANA 3IBHA 3LORA 1BAYA 1PKZA 2WULA 1PD21 3VPTA 1B9YC 1GTUA 2FA8A 2LS5A 3KMNA 4EDZA 5DAKA 4YH2A 4WEYA 3TJKA 1Y6EA 1GSSA 22GSA 3P7XA 2IJYA 6GSVA 2K18A 1TRUA 3HD5A 2L4CA 1T3BA 1MD3A 1R7HA 1THOA 2GZZA 4LMWA 3MSZA 2O8VB 3P8WA 1S3CA 5IPGA 3CSJA 4XTSA 5DCHA 2QC7A 3G7JA 4N11A 3F63A 1TP9A 3DVXA 1OC8A 2BTOT 1F2EA 2DJ2A 2HRNA 4L5OA 1OKTA 4HJMA 2K6VA 2XPEA 1A2JA 2GVPA 5ECIB 1BJXA 1TK0B 1A23A 5G5EA 5JWOB 2J23A 4Q5NA 2JACA 3RAZA 5DVBA 6GSXA 1YKCA 5J9CA 4XS4B 5ECQB 2RM6A 5IOWA 3LQ7A 3IR4A 9GSSA 1YEXA 1HD2A 2PU9C 3IHQA 1GSEA 2L5LA 5D96A 3KP8A 3D4TA 1JZRA 4HQZA 5DJLA 2E7PA 2OE0A 2TRXA 1ST9A 3N5OA 2H19A 2DMLA 2NTOA 3VI5A 2OBKA 1ABAA 4XIHA 3E0UA 1T4YA 1AUCA 2B6MA 3ME8A 1QMVA 1KTEA 5B6MA 2PVOC 1O6JA 2V6KA 1SK1A 2LUSA 4ZBAA 4GSSA 3VPQA 5DBQA 4ECCA 3HDCA 1XIYA 4PUFC 1G0TA 2CQ9A 1YDKA 3PR8A 3US3A 1U88A 4LL1B 3F6DA 3ZVJD 3D4MA 2WGRA 1NW2A 3UMAA 1M0UA 3QOUA 3ZMLA 3MAKA 3ZFBA 2F8FA 4RI7A 2VCWA 2A4VA 3KP9A 2N5BA 2CX4A 3EINA 2A2RA 2WFCA 6GSUA 2AHEA 2VL2A 1XBSA 3BJ5A 5C00A 1K3OA 4JU5A 3FKFA 4V1Ag 4GLTA 2P31A 2OJLA 1OC9A 2GQLA 4ID0A 1V58A 1FG4A 2VO4A 13GSA 3FZAA 4BA7A 4FYBA 3WGDA 1WJKA 2MMOA 1MTCA 2LKUA 3IRAA 5ID2B 5A4WA 1AIUA 3I6AA 3VI7A 6GSWA 1Z7RA 2IWTA 1GSYA 1VF3A 3VLNA 3UBKA 3GKXA 4K7OA 4FYCA 3RPPA 2E2MA 2V32A 3IPZA 4HU9A 1M7TA 11GSA 1YF0A 2CT6A 2OADA 3ZIJA 2XHFA 2G2QA 5KN1A 3A2WA 4PQ1A 4PQIA 2X64A 3MWHA 1XWCA 3PINA 5FT3A 3V1WA 2DJKA 5CNWA 2DJJA 2ON5A 1S3DA 1SK0A 2YV9A 1DE1A 1W89A 1XVQA 1H4OA 4K0GA 5ECNB 2V1MA 2JSZA 2MBSA 3TKRA 2AYTA 1GLQA 3ZYWA 4DSQA 1V40A 1XW9A 3APSA 2WB9A 4DVCA 3CMIA 1M9BA 3TRPA 2HZFA 2LQQA 1URMA 4KB3A 3VFIA 4KNDA 2YPMA 2DJ0A 2LNSA 1R4WA 3HJPA 4GQFA 3M8NA 3A2XA 4MLYA 2IFQA 2NBSA 4N10A 1AXDA 2H1BA 3GTUA 5DCGA 5CYYA 3GX8A 4I2TA 2R6KA 2HZEB 1GUHA 3UBLA 3APOA 3GN3A 1B4QA 5D9TA 3CBUA 2I3YA 1E6BA 2B5YA 1YJ6A 1IYIA 2R3XA 2LJRA 3UJ1A 5ECLB 2H71A 2ALBA 2R2JA 2MMNA 4POBA 2L59A 4MMMA 4KUNA 1X5CA 2GSTA 4YQVA 5HR0A 5JCUA 5D9VA 5ECMB 3LYKA 3R2QA 2LRTA 4PURA 4ML1A 1O8XA 4X1UA 1I9DA 17GSA 1TKDB 2F9SA 1KEBA 2IMEA 5ECOB 2C3TA 3F4TA 3HY2A 4WR4A 2D2ZA 1O8WA 2ON7A 4G9HA 4TXOA 2HYXA 3GL3A 4ZL9A 5IMFA 4LL4B 1ILOA 3L0HA 1QFNA 2HNLA 4CW9A 1QGVA 3H1NA 4OCFA 5HR1A 3QPMA 3TKSE 3KMOA 3TJFA 1TK8B 1H75A 5G2ZA 1OE8A 3OR5A 3LGCA 4MCUA 3ERWA 3IK9A 4AF2A 5GAPD 4JEDA 1YF1A 2K9FA 4F0BA 2GDRA 3U6VA 3ERGA 4XRAA 3QR6A 5DJMA 2FGXA 2GZYA 3QAGA 4GWRA 3I43A 3LJRA 2OACA 5EPFA 1MD4A 3PH9A 5B6NA 4K2DA 1EP8A 4HI7A 1G7OA 3HJMA 3HZ4A 2I9HA 2VLUA 4IN0A 3GH9A 3LG6A 1WOUA 3CSHA 5D9WA 1PL2A 4ZB6A 1ZYQB 3GL5A 4K7IA 4IS0A 5ECRB 3ME7A 4MPFA 3H4KA 5DAKB 5JWRB 2FCHA 2YWIA 3HYPA 5EVOA 1G6YA 2O87A 4O7HA 1DSBA 3IA1A 1BYEA 4HOJA 2GZPA 2H6XA 2P0GA 3AY8A 1YY7A 1WP0A 2LNTA 3IV4A 1X9MB 3RHCA 4NHZA 3ZRDA 5J41A 5CP1A 2QKEA 1Z6MA 1U87A 1O85A 4G10A 4IVFA 5D8IA 1AQVA 3ZFLA 1MEKA 4IQAA 3NOFA 2F8AA 1N8JA 3WT2A 4V2LA 2B1LA 3QAWA 3UAPA 5IMAA 3L9VA 2VM1A 3GV1A 4L0WA 2RUEA 1EOGA 4N0VA 3TJJA 4PQHA 1K0BA 1OVNA 2VCXA 4WR5A 5FHIA 1XZOA 3K8NA 4I5QA 2C0DA 4FH8A 1V57A 3WYWA 4NHWA 1GTAA 2YP6A 1JFUA 2I4AA 4GXZA 2VLTA 4EKZA 3GFKA 1J0FA 1FB0A 1FW1A 4IP6A 3TJBA 2EIRA 1ML6A 4EUYA 3C7MA 2IMIA 3E3EA 3M9JA 4DSRA 1GNWA 4ZBDA 4MH2A 1XFLA 1M99A 1F6MC 4WBJA 4MZWA 1G6WA 3GKMA 1GSQA 4EXJA 1JHBA 1NSWA 3KJYA 2B7KA 5LNKe 1WWJA 4RI6A 2H30A 2XBIA 2FWHA 3A2VA 3TKSC 2H0IA 3M9KA 1GTBA 1B9XC 1A8YA 1TU8A 2VIMA 4MK3A 1UA5A 8GSSA 4X0XA 3EC3A 1T7PB 2ES7A 3KXOA 5CREA 2RIIA 2YWOA 1A2MA 5AGYA 2LJAA 2VCQA 3ZVJA 1PN9A 1PX6A 2N5AA 1VRSD 2YJHA 5HFGA 5H5SA 1TU7A 4JR4A 2FNOA 1GUKA 1O81A 1GP1A 1YKAA 2DLXA 2BMXA 2PN8A 5D73A 2YCDA 1VF4A 4PUAA 4OFMA 3ZTLA 4POKA 3HVXA 5ECPB 4GTUA 5LD0A 4LLRA 4EC0A 1OC9B 3GSSA 1V98A 3IAS2 4V2MA 3HCZA 2H76A 2H1DA 1JZOA 3LXZA 1PMTA 4KH7A 1AC1A 2X8CA 2HFDA 3IOSA 3UEMA 3CXGA 5EY6A 1PQNA 2LTKA 4X43A 2LQOA 3TOTA 1EZKA 5CRHA 3IE3A 18GSA 4PNFA 2DBCA 2NVLA 5HFIA 5FWGA 1X9WB 5IM9A 1DBYA 5ECSA 4QL7A 1SYRA 5G30A 2WS2A 3HZ8A 4MJEA 5ELGA 3O6TA 3GYKA 4TRXA 2KHPA 3WGEA 2YOIA 2EC4A 1J08A 3GRXA 2G0FA 4EE0A 1E2YA 4IELA 2B3SA 4HEA2 1CQGA 4L8EA 2H74A 2L4QA 3FEUA 2HXKA 1VF1A 3DYRA 2CAIA 3Q6OA 1I5GA 1K0MA 1Q98A 2LV3A 2YNXA 1TK5B 4D73A 5IQYA 1JZWA 1ON4A 1Z5YE 3EMPA 2WJUA 3C1RA 3F4SA 3DXBA 4LA1A 5DDLA 1SL1B 2PUKC 4NV5A 3H8QA 4MJAA 3EE2A 2DSAA 3UOMA 2N5FA 3DVWA 4HZ2A 4ACSA 5ABRA 3G7IA 4TW5A 4Q5RA 6GSTA 4XRDA 2IMKA 4K9ZA 3H93A 2VUPA 2PVQA 1M9AA 3DRNA 1XWBA 2IL3A 4KDUA 3HXSA 5D93A 1FOVA 1WMJA 3O3TA 4AJ6A 4V2NA 1QXHA 5IIZA 4WF4A 2TIRA 1XOBA 4EO3A 1Z9HA 3SBCA 5G5FA 2JU5A 2CA8A 1VGLA 2C3NA 2V2GA 2JSYA 5CO3A 4TKYA 4MF5A 3LSZA 3FYGA 5HQPA 4ML6A 4PGTA 2C0FA 4H86A 1RK4A 2MBTA 2YZUA 2MMAA 2QGVA 3F0IA 4ZL7A 2V41A 1J9BA 1BG5A 4TXOB 1SJZA 1TI1A 4O5RA 3TKSA 20GSA 1U6TA 2KOKA 5G1LA 1KBNA 4OWYA 4OFTA 4MF6A 2CV4A 3FR6A 2GTUA 3LFLA 4YQMA 2M72A 1FB6A 3QDNA 1F9MA 2DIYA 4AJ8A 5KEJA 4O92A 2ZCTA 1M2DA 1K0NA 3ZITA 2EIOA 2HE3A 1ERTA 3C1SA 3GH6A 3RHBA 3RPNA 3BBYA 2R4VA 4POLA 4Q5QA 2IIYA 5AN1A 4EL1A 2MZCA 3WT1A 1Q4JA 5ELAA 1F3BA 3VURA 1SL2B 3HKRA 4FIWA 1TW9A 1TDIA 3EVIA 2A2SA 1S3AA 1DUGA 2V6OA 2OA7A 1EWXA 5JCGA 2CZ3A 3Q19A 2I1UA 4BWQA 2L5OA 2OBIA 3GA4A 3UVHA 3FZ9A 1XOAA 4G19A 4XS6A 4QL9A 2HLSA 4E8HA 2CVKA 3KD0A 5IMCA 5GSSA 3D0ZA 1RQMA 1HYUA 3ISOA 4ECJA 3FR3A 4F2IA 4KW6A 3LXTA 2FUG2 1EV4A 1K0CA 4F82A 2H0HA 2BJXA 5J4UA 2OE1A 1M2AA 1R5PA 5DQYA 4JZQA 5E4WA 5DALA 3KEBA 4KSOA 5G31A 2FHEA 2CX3A 1F3AA 3F3RA 3W6GA 2B1KA 2C80A 5CAXA 3QFBC 4N30A 2F3MA 4I6XA 6GSSA 1HNCA 4MDCA 2GQKA 2TRCP 3DMLA 3VWUA 1NHOA 2LEGA 1X9SB 4ZIJA 1A2LA 4FO5A 2AJQB 2JZSA 3TRXA 1A0FA 5LCZA 2FLSA 1EEJA 1XPVA 3ZREA 3HA9A 4KSMA
chains in the Genus database with same CATH superfamily
4DSSA 4IP1A 2C0GA 4J56E 3P2AA 1T1VA 2B7JA 3EU4A 3HHVA 1ZCPA 3FW2A 4TVEA 1ACVA 1MDKA 2FA4A 3I69A 1Z7PA 1GSFA 4HSCX 1PL1A 2HSYA 2ZNMA 4TXVA 4MF7A 1SKRB 2YWMA 5IO2A 1YZXA 4HU7A 2RUFA 2CVBA 5F05A 4O32A 4OD7A 2VD0A 3TB2A 5IOXA 3G7YA 4TR4A 2XBQA 1ERWA 5IMZA 2X99A 1WIKA 2NDOA 3EU3A 2CVDA 4BPYA 3F8UA 5F8BA 4NV2A 1GL8A 4NWYA 1ERVA 3L78A 1UVZA 3TGZA 2L6DA 1WE0A 5A5KA 3UIWA 1PSQA 1T00A 1OAZA 2CAQA 3KM6A 1HNBA 4IJIA 3BCIA 5IO0A 1NHYA 5H5QA 4YKFA 5CRWA 2GSRA 4YAVA 2P5QA 4MPGA 2AAWA 3WD6A 1V2AA 1G7EA 2H70A 1UN2A 2KUCA 3EWLA 1MDIA 3BD2A 4MZCA 4N0ZA 4BWSA 1OC3A 3ZL5A 1GLPA 4KA0A 1XWKA 4CHSA 4LMVA 5F06A 4O5UA 1TXXA 3L9UA 2DJ3A 5HFKA 2FWGA 3GNJA 1U3AA 3UL3A 4YQUA 3IK7A 5INYA 2L6CA 4K8MA 3HJOA 3EPTA 1FVKA 5KN0A 4GQCA 3GHAA 1BX9A 4TR1A 4ECIA 3MDKA 2O7KA 2GGTA 5H5RA 2H8LA 5A4VA 1O73A 5G1KA 4V1Ap 3D6IA 2XC2A 3GMFA 3PGTA 5CRDA 5HR2A 5GAND 2AV4A 2H1AA 3HVSA 1GNEA 1T4ZA 4OMVA 2H6ZA 2ZUPA 4IW9A 1VF2A 4K6XA 3KZQA 2YZHA 5CRGA 16GSA 2VAFA 4DEJA 3W8JA 4GCIA 3J7Yk 2VCZA 3BCKA 3BOAA 4D73B 1W4VA 3G9BA 2R5GA 4XS1A 1AQWA 4PX1A 1SENA 4MP4A 1K0DA 2GT5A 2H6YA 5AISA 1M3IA 1A8LA 10GSA 1Z3EA 4HJ2A 2KP2A 4ULXA 1YQ1A 3KIJA 2H66A 2PBJA 2HT9A 1TOFA 5DQSA 4YKGA 4RQXA 1ZZYA 1XWAA 2GSSA 3F4RA 3PPUA 4HZ4A 1HQOA 2F51A 3LWAA 2C4JA 3EMXA 5ENUA 2H0GA 1GRXA 3S9FA 4I97A 1QQ2A 4NXIA 4WETA 2GT6A 4JBBA 1K0OA 4HS1A 3CRTA 4POMA 3FMWA 1B48A 1XVWA 3Q18A 4KDXA 2FD3A 4KCEA 1GSDA 1XXUA 1PGTA 4GSTA 1HNAA 1LBKA 1X0RA 4K7NA 5C04A 4PNGA 1M2BA 3DKSA 1YEPA 3TCOA 2J9HA 1C72A 5AIXA 4AJ7A 3ZMKA 3HVVA 4FYUA 4OO4A 4RQRA 4YAPA 2X8GA 2LJKA 4IJ3A 2QSIA 5ECKB 2JL4A 1SYXA 5F07A 1A24A 3GUSA 4ISDA 2VCTA 4XCSA 5A4UA 4KCAA 3SWLA 4BVYA 5J3RA 2PGTA 3IDVA 4ZILA 4BVXA 3UVTA 2PERA 3FY7A 1DE2A 2VCVA 4USSA 1FVJA 4JE1A 5JCWA 5E59A 1EV9A 3GSTA 3KCMA 2IFQB 4ZB9A 4JRRA 1PA3A 3GTUB 14GSA 3IC4A 2GSQA 4OO5A 4ZL8A 1OKDA 5EL8A 4Z2RA 5HR3A 3A3TA 2WDUA 4EIQA 3I9V2 3KTBA 3F9UA 2C3QA 5L71A 2RLIA 4J2FA 1FO5A 1CQHA 2VL9A 3EYTA 1PX7A 3ED3A 3GX0A 4F9ZA 4MZBA 3MIXA 4MABA 4I2UA 2R0PA 3IXRA 4TOPA 1SKSB 1QK8A 3QD9A 3J7Yb 4XS4A 5IPHA 7GSSA 5GZZB 1LU4A 1TI3A 3U5RE 5B7CA 1TRSA 4WBRD 3ERFA 3GIXA 4Q5FA 2JZRA 4PXOA 5BMUA 5KN2A 4CDOA 3VK9A 1XW5A 4GSNA 1PRXA 1Y25A 1TTZA 4KE3A 5IMVA 3JCML 3C73A 3ZLPA 1V9WA 1EGOA 4KDYA 1F37A 4NAXA 1JLVA 1BEDA 2K8SA 1SJIA 2DC5A 1XW6A 2VM2A 4HUAA 4WKWA 5GSTA 3H79A 1U3IA 2C0EA 2GS3A 2M46A 5ECHB 3MNGA 4K0NA 3TOUA 1FOHA 2KP1A 4RUVA 3D5JA 5IMDA 5DALB 4E8EA 1B4PA 4HQSA 1UC7A 3KGKA 3WGXA 2IMFA 1JLWA 4L0UA 3TUEA 3FK8A 1Z6NA 1RW1A 3RDWA 1B8XA 4GF0A 3QCPA 2C8UA 3TKPA 1TRVA 1ZOFA 4ZB8A 2MMZA 4IBPA 2FWEA 2B5XA 1ZYEA 3CTGA 2I81A 1IYHA 4DSSB 1GH2A 3CTFA 3GKKA 2HRFA 1OE7A 4IGJA 3LEFA 3ZIVA 3CRUA 2FY6A 5B8AA 3RBTA 3DD3A 2OKAA 3E9JB 5ID2A 4TR3A 1LJRA 3KH7A 3F6FA 3APQA 4L5LA 2IN3A 2IPAA 4CY6A 1OYJA 4F0CA 1SK2A 1SD8A 1USBA 4K1FA 1QUWA 2DIZA 2M80A 3GURA 3C8EA 2CZ2A 2DMMA 5AIVA 2GQMA 3F3QA 12GSA 4P3YB 1EEMA 1GWCA 2REMA 3DWVA 1EOHA 4AGSA 4I8BA 3C71A 2H75A 2R37A 3EURA 2H1GA 2O85A 3M1GA 1KNGA 3L9SA 2H73A 3DGQA 1SU9A 4MJBA 3FZ5A 1JZDA 4GRFA 3IAM2 3FHKA 5BRTA 4MA9A 4MNNA 4IHUA 5J9BA 1SL0B 4F03A 4IKHA 2Z9SA 4KGIA 1EGRA 4EDYA 2YN1A 1O7UA 1SKWB 4G2EA 3LYPA 2KLXA 2X8HA 2E2GA 4FQUA 2H01A 3VWVA 1AW9A 5F0GA 2YV7A 3TRQA 4WXTA 2HZEA 1A0RP 4J57E 3N9JA 1WPIA 5COHA 3D21A 4EF0A 3QFAC 1TJDA 1T8EB 6GSYA 3FZ4A 3M3MA 2VL3A 3O76A 5D9XA 4KX4A 2HI7A 5KN3A 1THXA 2LRNA 1ZGNA 2LRCA 3TKQA 2P5RA 3NIVA 2AB6A 4XHMA 4TR1B 1X5EA 19GSA 1R26A 1N2AA 2IMDA 3FR9A 1K3YA 1FHEA 2WRTA 3DIEA 3ZZXA 2E0QA 2PMTA 3FRCA 4HDEA 2JADA 4NPBA 3NZNA 1GUMA 1PKWA 2PPTA 1K0AA 4KAEA 1TRWA 4OCEA 3KH9A 4G0LA 3KTLA 4K5RA 3CSIA 5J5NA 1FAAA 1ZL9A 4MJCA 4IQ1A 1AAZA 2VLVA 5JWQB 4TR0A 2K8VA 3P90A 2OE3A 2PWJA 1XWGA 2H72A 3VWXA 3M0FA 2HSHA 4ILFA 1EP7A 3TDGA 4EVMA 3W8SA 2FWFA 2WCIA 1X5DA 5B8BA 3LW9A 4ZBBA 4OFNA 2VOCA 2O89A 2VL2C 2VD1A 4MH3A 1R5AA 3A5WA 2L57A 2AUVA 4Z7XA 1SD9A 4WF5A 1S3RA 2GLRA 3DEXA 4TN8A 4JR6A 2NPBA 2DJ1A 2XPDA 1ERUA 4BL7A 1AQXA 3CYNA 3UARA 4K5SA 4O5QA 4ECBA 2YWNA 3D22A 1GTIA 3Q74A 4ZXGA 1WRYA 2HSMA 2RM5A 1K3LA 4QQ7A 2WZ9A 1GULA 1M3JA 1ZMAA 3VWWA 2JZTA 1SJ6A 2LSTA 3GKNA 3L4NA 1XCCA 2C1YA 2MYGA 2EIQA 4NMUA 1MDJA 1BQ7A 1GSUA 2B5EA 2YJ7A 3QAVA 1NM3A 3QMXA 2A4HA 3TJGA 2YANA 3IBHA 3LORA 1BAYA 1PKZA 2WULA 1PD21 3VPTA 1B9YC 1GTUA 2FA8A 2LS5A 3KMNA 4EDZA 5DAKA 4YH2A 4WEYA 3TJKA 1Y6EA 1GSSA 22GSA 3P7XA 2IJYA 6GSVA 2K18A 1TRUA 2DKHA 3HD5A 4BIKA 2L4CA 4BVYB 1T3BA 4BVXB 1MD3A 1R7HA 1THOA 2GZZA 4LMWA 3MSZA 2O8VB 3P8WA 1S3CA 5IPGA 3CSJA 4XTSA 5DCHA 2QC7A 3G7JA 4N11A 3F63A 1TP9A 3DVXA 1OC8A 2BTOT 1F2EA 2DJ2A 2HRNA 4L5OA 1OKTA 4HJMA 2K6VA 2XPEA 1A2JA 2GVPA 5ECIB 1BJXA 1TK0B 1A23A 5G5EA 5JWOB 2J23A 4Q5NA 2JACA 3RAZA 5DVBA 6GSXA 1YKCA 1PFOA 5J9CA 4XS4B 5ECQB 2RM6A 5IOWA 3LQ7A 3IR4A 9GSSA 1YEXA 1HD2A 2PU9C 3IHQA 1GSEA 2L5LA 5D96A 3KP8A 3D4TA 1JZRA 4HQZA 2HRKA 5DJLA 2E7PA 2OE0A 2TRXA 1ST9A 3N5OA 2H19A 4G0KA 2DMLA 2NTOA 4PTSA 3VI5A 2OBKA 1ABAA 4XIHA 3E0UA 1T4YA 1AUCA 2B6MA 3ME8A 1QMVA 1KTEA 5B6MA 2PVOC 1O6JA 2V6KA 1SK1A 2LUSA 4ZBAA 2A2PA 4GSSA 3VPQA 5DBQA 4ECCA 3HDCA 1XIYA 4PUFC 1G0TA 2CQ9A 1YDKA 2X49A 3PR8A 3US3A 1U88A 4LL1B 3F6DA 3ZVJD 3D4MA 2WGRA 1NW2A 3UMAA 1M0UA 3QOUA 3ZMLA 3MAKA 3ZFBA 2F8FA 4RI7A 2VCWA 2A4VA 3KP9A 2N5BA 2CX4A 3EINA 2A2RA 2WFCA 6GSUA 2AHEA 2VL2A 1XBSA 3BJ5A 5C00A 1K3OA 4JU5A 3FKFA 4V1Ag 4GLTA 2P31A 2OJLA 1OC9A 2GQLA 4ID0A 1V58A 1FG4A 2VO4A 13GSA 3FZAA 4BA7A 4FYBA 3WGDA 1WJKA 2MMOA 4Z2UA 1MTCA 4CY8A 2LKUA 3IRAA 5ID2B 5A4WA 1AIUA 3I6AA 3VI7A 6GSWA 1Z7RA 2IWTA 1GSYA 1VF3A 3VLNA 3UBKA 3GKXA 4K7OA 4FYCA 3RPPA 2E2MA 2V32A 3IPZA 4HU9A 1M7TA 11GSA 1YF0A 2CT6A 2OADA 3ZIJA 2XHFA 2G2QA 5KN1A 3A2WA 4PQ1A 4PQIA 2X64A 3MWHA 1XWCA 3PINA 5FT3A 3V1WA 4G0IA 2DJKA 5CNWA 2DJJA 2ON5A 1S3DA 1SK0A 2YV9A 1DE1A 1W89A 1XVQA 1H4OA 4K0GA 5ECNB 2V1MA 2JSZA 2MBSA 3TKRA 2AYTA 1GLQA 3ZYWA 4DSQA 1V40A 1XW9A 3APSA 2WB9A 4DVCA 4KF9A 3CMIA 1M9BA 3TRPA 2HZFA 2LQQA 1URMA 4KB3A 3VFIA 4KNDA 2YPMA 2DJ0A 2LNSA 1R4WA 3HJPA 4GQFA 3M8NA 3A2XA 4MLYA 2IFQA 2NBSA 4N10A 1AXDA 2H1BA 3GTUA 5DCGA 5CYYA 3GX8A 4I2TA 2QA2A 2R6KA 2HZEB 1GUHA 3UBLA 1ZYPA 3APOA 3GN3A 1B4QA 5D9TA 3MYDA 3CBUA 2I3YA 1E6BA 2B5YA 1YJ6A 1IYIA 2R3XA 2LJRA 3UJ1A 5ECLB 2H71A 2ALBA 2R2JA 2MMNA 4POBA 2L59A 4MMMA 4KUNA 1X5CA 2GSTA 4YQVA 5HR0A 2HRAA 5JCUA 5D9VA 5ECMB 3LYKA 3R2QA 2LRTA 4PURA 4ML1A 1O8XA 4X1UA 1I9DA 17GSA 1TKDB 2F9SA 1KEBA 2IMEA 5ECOB 2C3TA 3F4TA 3HY2A 4WR4A 2D2ZA 1O8WA 2ON7A 4G9HA 4TXOA 2HYXA 3GL3A 4ZL9A 5IMFA 4A5PA 4LL4B 1ILOA 5KOWA 3L0HA 1QFNA 2HNLA 4CW9A 1QGVA 3H1NA 4OCFA 5HR1A 3QPMA 3TKSE 3KMOA 3TJFA 1TK8B 1H75A 5G2ZA 1OE8A 3OR5A 3LGCA 4MCUA 3ERWA 3IK9A 4AF2A 5GAPD 4JEDA 1YF1A 4BL7B 2K9FA 4F0BA 2GDRA 3U6VA 3ERGA 4XRAA 3QR6A 5DJMA 2FGXA 2GZYA 3QAGA 4GWRA 3I43A 3LJRA 2OACA 5EPFA 1MD4A 2X4AA 3PH9A 5B6NA 4K2DA 1EP8A 4HI7A 1G7OA 3HJMA 3HZ4A 2I9HA 2VLUA 4IN0A 3GH9A 3LG6A 1WOUA 3CSHA 5D9WA 1PL2A 4ZB6A 1ZYQB 3GL5A 4K7IA 4IS0A 5ECRB 1ZYNA 3ME7A 4MPFA 3H4KA 5DAKB 5JWRB 2FCHA 2YWIA 3HYPA 5EVOA 1G6YA 2O87A 4O7HA 1DSBA 3IA1A 1BYEA 4HOJA 2GZPA 2H6XA 2P0GA 3AY8A 1YY7A 1WP0A 2LNTA 3IV4A 1X9MB 3R3EA 3RHCA 4NHZA 3ZRDA 5J41A 5CP1A 2QKEA 1Z6MA 1U87A 1O85A 4G10A 4IVFA 5D8IA 1AQVA 3ZFLA 1MEKA 4IQAA 3NOFA 2F8AA 1N8JA 3IC8A 3WT2A 4V2LA 2B1LA 3QAWA 3UAPA 5IMAA 3L9VA 2VM1A 3GV1A 4L0WA 2RUEA 1EOGA 2UZ8A 4N0VA 3TJJA 4PQHA 1K0BA 1OVNA 2VCXA 4WR5A 5FHIA 1XZOA 3K8NA 4I5QA 2C0DA 4FH8A 1V57A 3WYWA 4NHWA 1GTAA 2YP6A 1JFUA 2I4AA 4GXZA 2VLTA 4EKZA 3GFKA 1J0FA 1FB0A 1FW1A 4IP6A 3TJBA 2EIRA 1ML6A 1PN0A 4EUYA 3C7MA 2IMIA 3E3EA 3M9JA 4DSRA 1GNWA 4ZBDA 4MH2A 1XFLA 1M99A 1F6MC 4WBJA 4MZWA 1G6WA 3GKMA 1GSQA 4EXJA 1JHBA 1NSWA 3KJYA 2B7KA 5LNKe 2R0CA 1WWJA 4RI6A 2H30A 2XBIA 2FWHA 3A2VA 3TKSC 2H0IA 3M9KA 1GTBA 1B9XC 1A8YA 1TU8A 2VIMA 4MK3A 1UA5A 8GSSA 2QA1A 4X0XA 3EC3A 1T7PB 2ES7A 3KXOA 5CREA 2RIIA 4K2XA 2YWOA 1A2MA 5AGYA 2DKIA 2LJAA 2VCQA 3ZVJA 1PN9A 1PX6A 2N5AA 1VRSD 2YJHA 5HFGA 5H5SA 1TU7A 4JR4A 3CQFA 2FNOA 2R0GA 1GUKA 1O81A 1GP1A 1YKAA 2DLXA 2BMXA 2PN8A 5D73A 2YCDA 1VF4A 4PUAA 4OFMA 3ZTLA 4POKA 3HVXA 5ECPB 4GTUA 5LD0A 4LLRA 4EC0A 1OC9B 3GSSA 1V98A 3IAS2 4V2MA 3HCZA 2H76A 2H1DA 1JZOA 3LXZA 1PMTA 4KH7A 1AC1A 2X8CA 2HFDA 3IOSA 3UEMA 3CXGA 5EY6A 1PQNA 2LTKA 4X43A 2LQOA 3TOTA 1EZKA 5CRHA 3IE3A 18GSA 4PNFA 2DBCA 2NVLA 5HFIA 5FWGA 1X9WB 5IM9A 1DBYA 5ECSA 4QL7A 1SYRA 5G30A 2WS2A 3HZ8A 4MJEA 5ELGA 3O6TA 3GYKA 4TRXA 2KHPA 3WGEA 2YOIA 2EC4A 1J08A 3GRXA 2G0FA 4EE0A 1E2YA 4IELA 2B3SA 4HEA2 1CQGA 4L8EA 2H74A 2L4QA 3FEUA 2HXKA 1VF1A 3DYRA 2CAIA 4X4JA 3Q6OA 1I5GA 1K0MA 1Q98A 2LV3A 2YNXA 1TK5B 4D73A 5IQYA 1JZWA 1ON4A 1Z5YE 3EMPA 2WJUA 3C1RA 3F4SA 3DXBA 4LA1A 5DDLA 1SL1B 2PUKC 4NV5A 3H8QA 4MJAA 3EE2A 2DSAA 3UOMA 2N5FA 3DVWA 4HZ2A 4ACSA 5ABRA 3G7IA 4TW5A 4Q5RA 6GSTA 4XRDA 2IMKA 4K9ZA 3H93A 2VUPA 2PVQA 1M9AA 3DRNA 1XWBA 2IL3A 4KDUA 3HXSA 5D93A 1FOVA 1WMJA 3O3TA 4AJ6A 4V2NA 1QXHA 5IIZA 4WF4A 2TIRA 1XOBA 4EO3A 1Z9HA 3SBCA 5G5FA 2JU5A 2CA8A 1VGLA 2C3NA 2V2GA 2JSYA 5CO3A 4TKYA 4MF5A 3LSZA 3FYGA 5HQPA 4ML6A 4PGTA 2C0FA 4H86A 3IHGA 1RK4A 2MBTA 2YZUA 2MMAA 2QGVA 4Z2TA 3F0IA 4ZL7A 2V41A 1J9BA 1BG5A 4TXOB 1SJZA 1TI1A 4O5RA 3TKSA 20GSA 1U6TA 2KOKA 5G1LA 1KBNA 4OWYA 4OFTA 4MF6A 2CV4A 3FR6A 2GTUA 3LFLA 4YQMA 2M72A 1FB6A 3A5IA 3QDNA 1F9MA 2DIYA 4AJ8A 5KEJA 4O92A 2ZCTA 1M2DA 1K0NA 3ZITA 2EIOA 2HE3A 1ERTA 3C1SA 3GH6A 3RHBA 3RPNA 3BBYA 2R4VA 4POLA 4Q5QA 2IIYA 5AN1A 4EL1A 2MZCA 3WT1A 1Q4JA 5ELAA 1F3BA 3VURA 1XG8A 1SL2B 3HKRA 4FIWA 1TW9A 1TDIA 3EVIA 2A2SA 1S3AA 1DUGA 2V6OA 2OA7A 1EWXA 5JCGA 2CZ3A 3Q19A 2I1UA 4BWQA 2L5OA 2OBIA 4EIPA 3GA4A 3UVHA 3FZ9A 1XOAA 4G19A 4XS6A 4QL9A 2HLSA 4E8HA 2CVKA 3KD0A 5IMCA 5GSSA 3D0ZA 1RQMA 1HYUA 3ISOA 4ECJA 3FR3A 4F2IA 4KW6A 3LXTA 2FUG2 1EV4A 1K0CA 4F82A 2H0HA 2BJXA 5KOXA 5J4UA 3HVNA 2OE1A 1M2AA 1R5PA 5DQYA 4JZQA 5E4WA 5DALA 3KEBA 4KSOA 5G31A 2FHEA 2CX3A 1F3AA 3F3RA 3W6GA 2B1KA 2C80A 5CAXA 3QFBC 4N30A 2F3MA 4I6XA 6GSSA 1HNCA 4MDCA 2GQKA 2TRCP 3DMLA 3VWUA 4ICYA 1NHOA 2LEGA 1X9SB 4ZIJA 1A2LA 4FO5A 2AJQB 2JZSA 3TRXA 1A0FA 5LCZA 2FLSA 1EEJA 1XPVA 3ZREA 3HA9A 4KSMA
chains in the Genus database with same CATH topology
4DSSA 4IP1A 2C0GA 4J56E 3P2AA 1T1VA 2B7JA 3EU4A 3HHVA 1ZCPA 3FW2A 4TVEA 1ACVA 1MDKA 2FA4A 3I69A 1Z7PA 1GSFA 1PL1A 2HSYA 2ZNMA 4TXVA 4MF7A 1SKRB 2YWMA 5IO2A 1YZXA 4HU7A 2RUFA 2CVBA 5F05A 4O32A 4OD7A 2VD0A 3TB2A 5IOXA 3G7YA 4TR4A 2XBQA 1ERWA 5IMZA 2X99A 1WIKA 2NDOA 3EU3A 2CVDA 4BPYA 3F8UA 5F8BA 4NV2A 1GL8A 4NWYA 1ERVA 3L78A 1UVZA 3TGZA 2L6DA 1WE0A 5A5KA 3UIWA 1PSQA 1T00A 1OAZA 2CAQA 3KM6A 1HNBA 4IJIA 3BCIA 5IO0A 1NHYA 5H5QA 4YKFA 5CRWA 2GSRA 4YAVA 2P5QA 4MPGA 2AAWA 3WD6A 1V2AA 1G7EA 2H70A 1UN2A 2KUCA 3EWLA 1MDIA 3BD2A 4MZCA 4N0ZA 4BWSA 1OC3A 3ZL5A 1GLPA 4KA0A 1XWKA 4CHSA 4LMVA 5F06A 4O5UA 1TXXA 3L9UA 2DJ3A 5HFKA 2FWGA 3GNJA 1U3AA 3UL3A 4YQUA 3IK7A 5INYA 2L6CA 4K8MA 3HJOA 3EPTA 1FVKA 5KN0A 4GQCA 3GHAA 1BX9A 4TR1A 4ECIA 3MDKA 2O7KA 2GGTA 5H5RA 2H8LA 5A4VA 1O73A 5G1KA 4V1Ap 3D6IA 2XC2A 3GMFA 3PGTA 5CRDA 5HR2A 5GAND 2AV4A 2H1AA 3HVSA 1GNEA 1T4ZA 4OMVA 2H6ZA 2ZUPA 4IW9A 1VF2A 4K6XA 3KZQA 2YZHA 5CRGA 16GSA 2VAFA 4DEJA 3W8JA 4GCIA 3J7Yk 2VCZA 3BCKA 3BOAA 4D73B 1W4VA 3G9BA 2R5GA 4XS1A 1AQWA 4PX1A 1SENA 4MP4A 1K0DA 2GT5A 2H6YA 5AISA 1A8LA 10GSA 1Z3EA 4HJ2A 2KP2A 4ULXA 1YQ1A 3KIJA 2H66A 2PBJA 2HT9A 1TOFA 5DQSA 4YKGA 4RQXA 1ZZYA 1XWAA 2GSSA 3F4RA 3PPUA 4HZ4A 1HQOA 2F51A 3LWAA 2C4JA 3EMXA 5ENUA 2H0GA 1GRXA 3S9FA 4I97A 1QQ2A 4NXIA 4WETA 2GT6A 4JBBA 1K0OA 4HS1A 3CRTA 4POMA 3FMWA 1B48A 1XVWA 3Q18A 4KDXA 2FD3A 4KCEA 1GSDA 1XXUA 1PGTA 4GSTA 1HNAA 1LBKA 1X0RA 4K7NA 5C04A 4PNGA 1M2BA 3DKSA 1YEPA 3TCOA 2J9HA 1C72A 5AIXA 4AJ7A 3ZMKA 3HVVA 4FYUA 4OO4A 4RQRA 4YAPA 2X8GA 2LJKA 4IJ3A 2QSIA 5ECKB 2JL4A 1SYXA 5F07A 1A24A 3GUSA 4ISDA 2VCTA 4XCSA 5A4UA 4KCAA 3SWLA 4BVYA 5J3RA 2PGTA 3IDVA 4ZILA 4BVXA 3UVTA 2PERA 3FY7A 1DE2A 2VCVA 4USSA 1FVJA 4JE1A 5JCWA 5E59A 1EV9A 3GSTA 3KCMA 2IFQB 4ZB9A 4JRRA 1PA3A 3GTUB 14GSA 3IC4A 2GSQA 4OO5A 4ZL8A 1OKDA 5EL8A 4Z2RA 5HR3A 3A3TA 2WDUA 4EIQA 3I9V2 3KTBA 3F9UA 2C3QA 5L71A 2RLIA 4J2FA 1FO5A 1CQHA 2VL9A 3EYTA 1PX7A 3ED3A 3GX0A 4F9ZA 4MZBA 3MIXA 4MABA 4I2UA 2R0PA 3IXRA 4TOPA 1SKSB 1QK8A 3QD9A 3J7Yb 4XS4A 5IPHA 7GSSA 5GZZB 1LU4A 1TI3A 3U5RE 5B7CA 1TRSA 4WBRD 3ERFA 3GIXA 4Q5FA 2JZRA 4PXOA 5BMUA 5KN2A 4CDOA 3VK9A 1XW5A 4GSNA 1PRXA 1Y25A 1TTZA 4KE3A 5IMVA 3JCML 3C73A 3ZLPA 1V9WA 1EGOA 4KDYA 1F37A 4NAXA 1JLVA 1BEDA 2K8SA 1SJIA 2DC5A 1XW6A 2VM2A 4HUAA 4WKWA 5GSTA 3H79A 1U3IA 2C0EA 2GS3A 2M46A 5ECHB 3MNGA 4K0NA 3TOUA 1FOHA 2KP1A 4RUVA 3D5JA 5IMDA 5DALB 4E8EA 1B4PA 4HQSA 1UC7A 3KGKA 3WGXA 2IMFA 1JLWA 4L0UA 3TUEA 3FK8A 1Z6NA 1RW1A 3RDWA 1B8XA 4GF0A 3QCPA 2C8UA 3TKPA 1TRVA 1ZOFA 4ZB8A 2MMZA 4IBPA 2FWEA 2B5XA 1ZYEA 3CTGA 2I81A 1IYHA 4DSSB 1GH2A 3CTFA 3GKKA 2HRFA 1OE7A 4IGJA 3LEFA 3ZIVA 3CRUA 2FY6A 5B8AA 3RBTA 3DD3A 2OKAA 3E9JB 5ID2A 4TR3A 1LJRA 3KH7A 3F6FA 3APQA 4L5LA 2IN3A 2IPAA 4CY6A 1OYJA 4F0CA 1SK2A 1SD8A 1USBA 4K1FA 1QUWA 2DIZA 2M80A 3GURA 3C8EA 2CZ2A 2DMMA 5AIVA 2GQMA 3F3QA 12GSA 4P3YB 1EEMA 1GWCA 2REMA 3DWVA 1EOHA 4AGSA 4I8BA 3C71A 2H75A 2R37A 3EURA 2H1GA 2O85A 3M1GA 1KNGA 3L9SA 2H73A 3DGQA 1SU9A 4MJBA 3FZ5A 1JZDA 4GRFA 3IAM2 3FHKA 5BRTA 4MA9A 4MNNA 4IHUA 5J9BA 1SL0B 4F03A 4IKHA 2Z9SA 4KGIA 1EGRA 4EDYA 2YN1A 1O7UA 1SKWB 4G2EA 3LYPA 2KLXA 2X8HA 2E2GA 4FQUA 2H01A 3VWVA 1AW9A 5F0GA 2YV7A 3TRQA 4WXTA 2HZEA 1A0RP 4J57E 3N9JA 1WPIA 5COHA 3D21A 4EF0A 3QFAC 1TJDA 1T8EB 6GSYA 3FZ4A 3M3MA 2VL3A 3O76A 5D9XA 4KX4A 2HI7A 5KN3A 1THXA 2LRNA 1ZGNA 2LRCA 3TKQA 2P5RA 3NIVA 2AB6A 4XHMA 4TR1B 1X5EA 19GSA 1R26A 1N2AA 2IMDA 3FR9A 1K3YA 1FHEA 2WRTA 3DIEA 3ZZXA 2E0QA 2PMTA 3FRCA 4HDEA 2JADA 4NPBA 3NZNA 1GUMA 1PKWA 2PPTA 1K0AA 4KAEA 1TRWA 4OCEA 3KH9A 4G0LA 3KTLA 4K5RA 3CSIA 5J5NA 1FAAA 1ZL9A 4MJCA 4IQ1A 1AAZA 2VLVA 5JWQB 4TR0A 2K8VA 3P90A 2OE3A 2PWJA 1XWGA 2H72A 3VWXA 3M0FA 2HSHA 4ILFA 1EP7A 3TDGA 4EVMA 3W8SA 2FWFA 2WCIA 1X5DA 5B8BA 3LW9A 4ZBBA 4OFNA 2VOCA 2O89A 2VL2C 2VD1A 4MH3A 1R5AA 3A5WA 2L57A 2AUVA 4Z7XA 1SD9A 4WF5A 2GLRA 3DEXA 4TN8A 4JR6A 2NPBA 2DJ1A 2XPDA 1ERUA 4BL7A 1AQXA 3CYNA 3UARA 4K5SA 4O5QA 4ECBA 2YWNA 3D22A 1GTIA 3Q74A 4ZXGA 1WRYA 2HSMA 2RM5A 1K3LA 4QQ7A 2WZ9A 1GULA 1ZMAA 3VWWA 2JZTA 1SJ6A 2LSTA 3GKNA 3L4NA 1XCCA 2C1YA 2MYGA 2EIQA 4NMUA 1MDJA 1BQ7A 1GSUA 2B5EA 2YJ7A 3QAVA 1NM3A 3QMXA 2A4HA 3TJGA 2YANA 3IBHA 3LORA 1BAYA 1PKZA 2WULA 1PD21 3VPTA 1B9YC 1GTUA 2FA8A 2LS5A 3KMNA 4EDZA 5DAKA 4YH2A 4WEYA 3TJKA 1Y6EA 1GSSA 22GSA 3P7XA 2IJYA 6GSVA 2K18A 1TRUA 2DKHA 3HD5A 2L4CA 4BVYB 1T3BA 4BVXB 1MD3A 1R7HA 1THOA 2GZZA 4LMWA 3MSZA 2O8VB 3P8WA 1S3CA 5IPGA 3CSJA 4XTSA 5DCHA 2QC7A 3G7JA 4N11A 3F63A 1TP9A 3DVXA 1OC8A 2BTOT 1F2EA 2DJ2A 2HRNA 4L5OA 1OKTA 4HJMA 2K6VA 2XPEA 1A2JA 2GVPA 5ECIB 1BJXA 1TK0B 1A23A 5G5EA 5JWOB 2J23A 4Q5NA 2JACA 3RAZA 5DVBA 6GSXA 1YKCA 5J9CA 4XS4B 5ECQB 2RM6A 5IOWA 3LQ7A 3IR4A 9GSSA 1YEXA 1HD2A 2PU9C 3IHQA 1GSEA 2L5LA 5D96A 3KP8A 3D4TA 1JZRA 4HQZA 2HRKA 5DJLA 2E7PA 2OE0A 2TRXA 1ST9A 3N5OA 2H19A 4G0KA 2DMLA 2NTOA 4PTSA 3VI5A 2OBKA 1ABAA 4XIHA 3E0UA 1T4YA 1AUCA 2B6MA 3ME8A 1QMVA 1KTEA 5B6MA 2PVOC 1O6JA 2V6KA 1SK1A 2LUSA 4ZBAA 2A2PA 4GSSA 3VPQA 5DBQA 4ECCA 3HDCA 1XIYA 4PUFC 1G0TA 2CQ9A 1YDKA 2X49A 3PR8A 3US3A 1U88A 4LL1B 3F6DA 3ZVJD 3D4MA 2WGRA 1NW2A 3UMAA 1M0UA 3QOUA 3ZMLA 3MAKA 3ZFBA 2F8FA 4RI7A 2VCWA 2A4VA 3KP9A 2N5BA 2CX4A 3EINA 2A2RA 2WFCA 6GSUA 2AHEA 2VL2A 1XBSA 3BJ5A 5C00A 1K3OA 4JU5A 3FKFA 4V1Ag 4GLTA 2P31A 2OJLA 1OC9A 2GQLA 4ID0A 1V58A 1FG4A 2VO4A 13GSA 3FZAA 4BA7A 4FYBA 3WGDA 1WJKA 2MMOA 4Z2UA 1MTCA 4CY8A 2LKUA 3IRAA 5ID2B 5A4WA 1AIUA 3I6AA 3VI7A 6GSWA 1Z7RA 2IWTA 1GSYA 1VF3A 3VLNA 3UBKA 3GKXA 4K7OA 4FYCA 3RPPA 2E2MA 2V32A 3IPZA 4HU9A 1M7TA 11GSA 1YF0A 2CT6A 2OADA 3ZIJA 2XHFA 2G2QA 5KN1A 3A2WA 4PQ1A 4PQIA 2X64A 3MWHA 1XWCA 3PINA 5FT3A 3V1WA 4G0IA 2DJKA 5CNWA 2DJJA 2ON5A 1S3DA 1SK0A 2YV9A 1DE1A 1W89A 1XVQA 1H4OA 4K0GA 5ECNB 2V1MA 2JSZA 2MBSA 3TKRA 2AYTA 1GLQA 3ZYWA 4DSQA 1V40A 1XW9A 3APSA 2WB9A 4DVCA 4KF9A 3CMIA 1M9BA 3TRPA 2HZFA 2LQQA 1URMA 4KB3A 3VFIA 4KNDA 2YPMA 2DJ0A 2LNSA 1R4WA 3HJPA 4GQFA 3M8NA 3A2XA 4MLYA 2IFQA 2NBSA 4N10A 1AXDA 2H1BA 3GTUA 5DCGA 5CYYA 3GX8A 4I2TA 2QA2A 2R6KA 2HZEB 1GUHA 3UBLA 1ZYPA 3APOA 3GN3A 1B4QA 5D9TA 3MYDA 3CBUA 2I3YA 1E6BA 2B5YA 1YJ6A 1IYIA 2R3XA 2LJRA 3UJ1A 5ECLB 2H71A 2ALBA 2R2JA 2MMNA 4POBA 2L59A 4MMMA 4KUNA 1X5CA 2GSTA 4YQVA 5HR0A 2HRAA 5JCUA 5D9VA 5ECMB 3LYKA 3R2QA 2LRTA 4PURA 4ML1A 1O8XA 4X1UA 1I9DA 17GSA 1TKDB 2F9SA 1KEBA 2IMEA 5ECOB 2C3TA 3F4TA 3HY2A 4WR4A 2D2ZA 1O8WA 2ON7A 4G9HA 4TXOA 2HYXA 3GL3A 4ZL9A 5IMFA 4A5PA 4LL4B 1ILOA 5KOWA 3L0HA 1QFNA 2HNLA 4CW9A 1QGVA 3H1NA 4OCFA 5HR1A 3QPMA 3TKSE 3KMOA 3TJFA 1TK8B 1H75A 5G2ZA 1OE8A 3OR5A 3LGCA 4MCUA 3ERWA 3IK9A 4AF2A 5GAPD 4JEDA 1YF1A 4BL7B 2K9FA 4F0BA 2GDRA 3U6VA 3ERGA 4XRAA 3QR6A 5DJMA 2FGXA 2GZYA 3QAGA 4GWRA 3I43A 3LJRA 2OACA 5EPFA 1MD4A 2X4AA 3PH9A 5B6NA 4K2DA 1EP8A 4HI7A 1G7OA 3HJMA 3HZ4A 2I9HA 2VLUA 4IN0A 3GH9A 3LG6A 1WOUA 3CSHA 5D9WA 1PL2A 4ZB6A 1ZYQB 3GL5A 4K7IA 4IS0A 5ECRB 1ZYNA 3ME7A 4MPFA 3H4KA 5DAKB 5JWRB 2FCHA 2YWIA 3HYPA 5EVOA 1G6YA 2O87A 4O7HA 1DSBA 3IA1A 1BYEA 4HOJA 2GZPA 2H6XA 2P0GA 3AY8A 1YY7A 1WP0A 2LNTA 3IV4A 1X9MB 3R3EA 3RHCA 4NHZA 3ZRDA 5J41A 5CP1A 2QKEA 1Z6MA 1U87A 1O85A 4G10A 4IVFA 5D8IA 1AQVA 3ZFLA 1MEKA 4IQAA 3NOFA 2F8AA 1N8JA 3IC8A 3WT2A 4V2LA 2B1LA 3QAWA 3UAPA 5IMAA 3L9VA 2VM1A 3GV1A 4L0WA 2RUEA 1EOGA 2UZ8A 4N0VA 3TJJA 4PQHA 1K0BA 1OVNA 2VCXA 4WR5A 5FHIA 1XZOA 3K8NA 4I5QA 2C0DA 4FH8A 1V57A 3WYWA 4NHWA 1GTAA 2YP6A 1JFUA 2I4AA 4GXZA 2VLTA 4EKZA 3GFKA 1J0FA 1FB0A 1FW1A 4IP6A 3TJBA 2EIRA 1ML6A 1PN0A 4EUYA 3C7MA 2IMIA 3E3EA 3M9JA 4DSRA 1GNWA 4ZBDA 4MH2A 1XFLA 1M99A 1F6MC 4WBJA 4MZWA 1G6WA 3GKMA 1GSQA 4EXJA 1JHBA 1NSWA 3KJYA 2B7KA 5LNKe 2R0CA 1WWJA 4RI6A 2H30A 2XBIA 2FWHA 3A2VA 3TKSC 2H0IA 3M9KA 1GTBA 1B9XC 1A8YA 1TU8A 2VIMA 4MK3A 1UA5A 8GSSA 2QA1A 4X0XA 3EC3A 1T7PB 2ES7A 3KXOA 5CREA 2RIIA 4K2XA 2YWOA 1A2MA 5AGYA 2DKIA 2LJAA 2VCQA 3ZVJA 1PN9A 1PX6A 2N5AA 1VRSD 2YJHA 5HFGA 5H5SA 1TU7A 4JR4A 2FNOA 2R0GA 1GUKA 1O81A 1GP1A 1YKAA 2DLXA 2BMXA 2PN8A 5D73A 2YCDA 1VF4A 4PUAA 4OFMA 3ZTLA 4POKA 3HVXA 5ECPB 4GTUA 5LD0A 4LLRA 4EC0A 1OC9B 3GSSA 1V98A 3IAS2 4V2MA 3HCZA 2H76A 2H1DA 1JZOA 3LXZA 1PMTA 4KH7A 1AC1A 2X8CA 2HFDA 3IOSA 3UEMA 3CXGA 5EY6A 1PQNA 2LTKA 4X43A 2LQOA 3TOTA 1EZKA 5CRHA 3IE3A 18GSA 4PNFA 2DBCA 2NVLA 5HFIA 5FWGA 1X9WB 5IM9A 1DBYA 5ECSA 4QL7A 1SYRA 5G30A 2WS2A 3HZ8A 4MJEA 5ELGA 3O6TA 3GYKA 4TRXA 2KHPA 3WGEA 2YOIA 2EC4A 1J08A 3GRXA 2G0FA 4EE0A 1E2YA 4IELA 2B3SA 4HEA2 1CQGA 4L8EA 2H74A 2L4QA 3FEUA 2HXKA 1VF1A 3DYRA 2CAIA 4X4JA 3Q6OA 1I5GA 1K0MA 1Q98A 2LV3A 2YNXA 1TK5B 4D73A 5IQYA 1JZWA 1ON4A 1Z5YE 3EMPA 2WJUA 3C1RA 3F4SA 3DXBA 4LA1A 5DDLA 1SL1B 2PUKC 4NV5A 3H8QA 4MJAA 3EE2A 2DSAA 3UOMA 2N5FA 3DVWA 4HZ2A 4ACSA 5ABRA 3G7IA 4TW5A 4Q5RA 6GSTA 4XRDA 2IMKA 4K9ZA 3H93A 2VUPA 2PVQA 1M9AA 3DRNA 1XWBA 2IL3A 4KDUA 3HXSA 5D93A 1FOVA 1WMJA 3O3TA 4AJ6A 4V2NA 1QXHA 5IIZA 4WF4A 2TIRA 1XOBA 4EO3A 1Z9HA 3SBCA 5G5FA 2JU5A 2CA8A 1VGLA 2C3NA 2V2GA 2JSYA 5CO3A 4TKYA 4MF5A 3LSZA 3FYGA 5HQPA 4ML6A 4PGTA 2C0FA 4H86A 3IHGA 1RK4A 2MBTA 2YZUA 2MMAA 2QGVA 4Z2TA 3F0IA 4ZL7A 2V41A 1J9BA 1BG5A 4TXOB 1SJZA 1TI1A 4O5RA 3TKSA 20GSA 1U6TA 2KOKA 5G1LA 1KBNA 4OWYA 4OFTA 4MF6A 2CV4A 3FR6A 2GTUA 3LFLA 4YQMA 2M72A 1FB6A 3A5IA 3QDNA 1F9MA 2DIYA 4AJ8A 5KEJA 4O92A 2ZCTA 1M2DA 1K0NA 3ZITA 2EIOA 2HE3A 1ERTA 3C1SA 3GH6A 3RHBA 3RPNA 3BBYA 2R4VA 4POLA 4Q5QA 2IIYA 5AN1A 4EL1A 2MZCA 3WT1A 1Q4JA 5ELAA 1F3BA 3VURA 1SL2B 3HKRA 4FIWA 1TW9A 1TDIA 3EVIA 2A2SA 1S3AA 1DUGA 2V6OA 2OA7A 1EWXA 5JCGA 2CZ3A 3Q19A 2I1UA 4BWQA 2L5OA 2OBIA 4EIPA 3GA4A 3UVHA 3FZ9A 1XOAA 4G19A 4XS6A 4QL9A 2HLSA 4E8HA 2CVKA 3KD0A 5IMCA 5GSSA 3D0ZA 1RQMA 1HYUA 3ISOA 4ECJA 3FR3A 4F2IA 4KW6A 3LXTA 2FUG2 1EV4A 1K0CA 4F82A 2H0HA 2BJXA 5KOXA 5J4UA 2OE1A 1M2AA 1R5PA 5DQYA 4JZQA 5E4WA 5DALA 3KEBA 4KSOA 5G31A 2FHEA 2CX3A 1F3AA 3F3RA 3W6GA 2B1KA 2C80A 5CAXA 3QFBC 4N30A 2F3MA 4I6XA 6GSSA 1HNCA 4MDCA 2GQKA 2TRCP 3DMLA 3VWUA 4ICYA 1NHOA 2LEGA 1X9SB 4ZIJA 1A2LA 4FO5A 2AJQB 2JZSA 3TRXA 1A0FA 5LCZA 2FLSA 1EEJA 1XPVA 3ZREA 3HA9A 4KSMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DSS A;  4IP1 A;  2C0G A;  4J56 E;  3P2A A;  1T1V A;  2B7J A;  3EU4 A;  3HHV A;  1ZCP A;  3FW2 A;  4TVE A;  1ACV A;  1MDK A;  2FA4 A;  3I69 A;  1Z7P A;  1GSF A;  1PL1 A;  2HSY A;  2ZNM A;  4TXV A;  4MF7 A;  1SKR B;  2YWM A;  5IO2 A;  1YZX A;  4HU7 A;  2RUF A;  2CVB A;  5F05 A;  4O32 A;  4OD7 A;  2VD0 A;  3TB2 A;  5IOX A;  3G7Y A;  4TR4 A;  2XBQ A;  1ERW A;  5IMZ A;  2X99 A;  1WIK A;  2NDO A;  3EU3 A;  2CVD A;  4BPY A;  3F8U A;  5F8B A;  4NV2 A;  1GL8 A;  4NWY A;  1ERV A;  3L78 A;  1UVZ A;  3TGZ A;  2L6D A;  1WE0 A;  5A5K A;  3UIW A;  1PSQ A;  1T00 A;  1OAZ A;  2CAQ A;  3KM6 A;  1HNB A;  4IJI A;  3BCI A;  5IO0 A;  1NHY A;  5H5Q A;  5CRW A;  2GSR A;  4YAV A;  2P5Q A;  4MPG A;  2AAW A;  3WD6 A;  1V2A A;  1G7E A;  2H70 A;  1UN2 A;  2KUC A;  3EWL A;  1MDI A;  3BD2 A;  4MZC A;  4N0Z A;  4BWS A;  1OC3 A;  3ZL5 A;  1GLP A;  4KA0 A;  1XWK A;  4CHS A;  4LMV A;  5F06 A;  1TXX A;  3L9U A;  2DJ3 A;  5HFK A;  2FWG A;  3GNJ A;  1U3A A;  3UL3 A;  4YQU A;  3IK7 A;  5INY A;  2L6C A;  4K8M A;  3HJO A;  1FVK A;  5KN0 A;  4GQC A;  3GHA A;  1BX9 A;  4TR1 A;  4ECI A;  3MDK A;  2O7K A;  2GGT A;  5H5R A;  2H8L A;  5A4V A;  1O73 A;  5G1K A;  4V1A p;  3D6I A;  2XC2 A;  3GMF A;  3PGT A;  5CRD A;  5HR2 A;  5GAN D;  2AV4 A;  2H1A A;  3HVS A;  1GNE A;  1T4Z A;  4OMV A;  2H6Z A;  2ZUP A;  4IW9 A;  1VF2 A;  4K6X A;  3KZQ A;  2YZH A;  5CRG A;  16GS A;  2VAF A;  4DEJ A;  3W8J A;  4GCI A;  3J7Y k;  2VCZ A;  3BCK A;  3BOA A;  4D73 B;  1W4V A;  3G9B A;  2R5G A;  4XS1 A;  1AQW A;  4PX1 A;  1SEN A;  4MP4 A;  1K0D A;  2GT5 A;  2H6Y A;  5AIS A;  1A8L A;  10GS A;  1Z3E A;  4HJ2 A;  2KP2 A;  4ULX A;  1YQ1 A;  3KIJ A;  2H66 A;  2PBJ A;  2HT9 A;  1TOF A;  5DQS A;  4RQX A;  1ZZY A;  1XWA A;  2GSS A;  3F4R A;  4HZ4 A;  1HQO A;  2F51 A;  3LWA A;  2C4J A;  3EMX A;  5ENU A;  2H0G A;  1GRX A;  3S9F A;  4I97 A;  1QQ2 A;  4NXI A;  4WET A;  2GT6 A;  4JBB A;  1K0O A;  4HS1 A;  3CRT A;  4POM A;  1B48 A;  1XVW A;  3Q18 A;  4KDX A;  2FD3 A;  4KCE A;  1GSD A;  1XXU A;  1PGT A;  4GST A;  1HNA A;  1LBK A;  1X0R A;  4K7N A;  5C04 A;  4PNG A;  1M2B A;  3DKS A;  1YEP A;  3TCO A;  2J9H A;  1C72 A;  5AIX A;  4AJ7 A;  3ZMK A;  3HVV A;  4FYU A;  4OO4 A;  4RQR A;  4YAP A;  2X8G A;  2LJK A;  4IJ3 A;  2QSI A;  5ECK B;  2JL4 A;  1SYX A;  5F07 A;  1A24 A;  3GUS A;  4ISD A;  2VCT A;  4XCS A;  5A4U A;  4KCA A;  3SWL A;  4BVY A;  5J3R A;  2PGT A;  3IDV A;  4ZIL A;  4BVX A;  3UVT A;  2PER A;  3FY7 A;  1DE2 A;  2VCV A;  1FVJ A;  4JE1 A;  5JCW A;  5E59 A;  1EV9 A;  3GST A;  3KCM A;  2IFQ B;  4ZB9 A;  4JRR A;  1PA3 A;  3GTU B;  14GS A;  3IC4 A;  2GSQ A;  4OO5 A;  4ZL8 A;  1OKD A;  5EL8 A;  5HR3 A;  3A3T A;  2WDU A;  3I9V 2;  3KTB A;  3F9U A;  2C3Q A;  5L71 A;  2RLI A;  4J2F A;  1FO5 A;  1CQH A;  2VL9 A;  3EYT A;  1PX7 A;  3ED3 A;  3GX0 A;  4F9Z A;  4MZB A;  4MAB A;  4I2U A;  3IXR A;  4TOP A;  1SKS B;  1QK8 A;  3QD9 A;  3J7Y b;  4XS4 A;  5IPH A;  7GSS A;  5GZZ B;  1LU4 A;  1TI3 A;  3U5R E;  5B7C A;  1TRS A;  4WBR D;  3ERF A;  3GIX A;  4Q5F A;  2JZR A;  4PXO A;  5KN2 A;  4CDO A;  3VK9 A;  1XW5 A;  4GSN A;  1PRX A;  1Y25 A;  1TTZ A;  4KE3 A;  5IMV A;  3JCM L;  3C73 A;  3ZLP A;  1V9W A;  1EGO A;  4KDY A;  1F37 A;  4NAX A;  1JLV A;  1BED A;  2K8S A;  1SJI A;  2DC5 A;  1XW6 A;  2VM2 A;  4HUA A;  4WKW A;  5GST A;  3H79 A;  1U3I A;  2C0E A;  2GS3 A;  5ECH B;  2M46 A;  3MNG A;  4K0N A;  3TOU A;  2KP1 A;  4RUV A;  3D5J A;  5IMD A;  5DAL B;  4E8E A;  1B4P A;  4HQS A;  1UC7 A;  3KGK A;  3WGX A;  2IMF A;  1JLW A;  4L0U A;  3TUE A;  3FK8 A;  1Z6N A;  1RW1 A;  3RDW A;  1B8X A;  4GF0 A;  3QCP A;  2C8U A;  3TKP A;  1TRV A;  1ZOF A;  4ZB8 A;  2MMZ A;  4IBP A;  2FWE A;  2B5X A;  1ZYE A;  3CTG A;  2I81 A;  1IYH A;  4DSS B;  1GH2 A;  3CTF A;  3GKK A;  2HRF A;  1OE7 A;  4IGJ A;  3LEF A;  3ZIV A;  3CRU A;  2FY6 A;  5B8A A;  3RBT A;  3DD3 A;  2OKA A;  3E9J B;  5ID2 A;  4TR3 A;  1LJR A;  3KH7 A;  3F6F A;  3APQ A;  4L5L A;  2IN3 A;  2IPA A;  1OYJ A;  4F0C A;  1SK2 A;  1SD8 A;  1USB A;  4K1F A;  1QUW A;  2DIZ A;  2M80 A;  3GUR A;  3C8E A;  2CZ2 A;  2DMM A;  5AIV A;  2GQM A;  3F3Q A;  12GS A;  4P3Y B;  1EEM A;  1GWC A;  2REM A;  3DWV A;  1EOH A;  4AGS A;  4I8B A;  3C71 A;  2H75 A;  2R37 A;  3EUR A;  2H1G A;  2O85 A;  3M1G A;  1KNG A;  3L9S A;  2H73 A;  3DGQ A;  1SU9 A;  4MJB A;  3FZ5 A;  1JZD A;  4GRF A;  3IAM 2;  3FHK A;  4MA9 A;  4IHU A;  5J9B A;  1SL0 B;  4F03 A;  4IKH A;  2Z9S A;  4KGI A;  1EGR A;  4EDY A;  2YN1 A;  1O7U A;  1SKW B;  4G2E A;  3LYP A;  2KLX A;  2X8H A;  2E2G A;  3VWV A;  2H01 A;  1AW9 A;  5F0G A;  2YV7 A;  3TRQ A;  4WXT A;  2HZE A;  1A0R P;  4J57 E;  3N9J A;  1WPI A;  5COH A;  3D21 A;  4EF0 A;  3QFA C;  1TJD A;  1T8E B;  6GSY A;  3FZ4 A;  3M3M A;  2VL3 A;  3O76 A;  5D9X A;  4KX4 A;  2HI7 A;  5KN3 A;  1THX A;  2LRN A;  1ZGN A;  2LRC A;  3TKQ A;  2P5R A;  3NIV A;  2AB6 A;  4XHM A;  4TR1 B;  1X5E A;  19GS A;  1R26 A;  1N2A A;  2IMD A;  3FR9 A;  1K3Y A;  1FHE A;  2WRT A;  3DIE A;  3ZZX A;  2E0Q A;  2PMT A;  3FRC A;  4HDE A;  2JAD A;  4NPB A;  3NZN A;  1GUM A;  1PKW A;  2PPT A;  1K0A A;  4KAE A;  1TRW A;  4OCE A;  3KH9 A;  3KTL A;  3CSI A;  5J5N A;  1FAA A;  1ZL9 A;  4MJC A;  4IQ1 A;  1AAZ A;  2VLV A;  5JWQ B;  4TR0 A;  2K8V A;  3P90 A;  2OE3 A;  2PWJ A;  1XWG A;  2H72 A;  3VWX A;  3M0F A;  2HSH A;  4ILF A;  1EP7 A;  3TDG A;  4EVM A;  3W8S A;  2FWF A;  2WCI A;  1X5D A;  5B8B A;  4ZBB A;  4OFN A;  2VOC A;  2O89 A;  2VL2 C;  2VD1 A;  4MH3 A;  1R5A A;  3A5W A;  2L57 A;  2AUV A;  4Z7X A;  1SD9 A;  4WF5 A;  2GLR A;  3DEX A;  4TN8 A;  4JR6 A;  2NPB A;  2DJ1 A;  2XPD A;  1ERU A;  4BL7 A;  1AQX A;  3CYN A;  3UAR A;  4ECB A;  2YWN A;  3D22 A;  1GTI A;  3Q74 A;  4ZXG A;  1WRY A;  2RM5 A;  1K3L A;  4QQ7 A;  2WZ9 A;  1GUL A;  1ZMA A;  3VWW A;  2JZT A;  1SJ6 A;  2LST A;  3GKN A;  3L4N A;  1XCC A;  2C1Y A;  2MYG A;  2EIQ A;  4NMU A;  1MDJ A;  1BQ7 A;  1GSU A;  2B5E A;  2YJ7 A;  3QAV A;  1NM3 A;  3QMX A;  3TJG A;  2YAN A;  3IBH A;  3LOR A;  1BAY A;  1PKZ A;  2WUL A;  1PD2 1;  3VPT A;  1B9Y C;  1GTU A;  2FA8 A;  2LS5 A;  3KMN A;  4EDZ A;  5DAK A;  4YH2 A;  4WEY A;  3TJK A;  1Y6E A;  1GSS A;  22GS A;  3P7X A;  2IJY A;  6GSV A;  2K18 A;  1TRU A;  3HD5 A;  2L4C A;  1T3B A;  1MD3 A;  1R7H A;  1THO A;  2GZZ A;  4LMW A;  3MSZ A;  2O8V B;  3P8W A;  1S3C A;  5IPG A;  3CSJ A;  4XTS A;  5DCH A;  2QC7 A;  3G7J A;  4N11 A;  3F63 A;  1TP9 A;  3DVX A;  1OC8 A;  2BTO T;  1F2E A;  2DJ2 A;  2HRN A;  4L5O A;  1OKT A;  4HJM A;  2K6V A;  2XPE A;  1A2J A;  2GVP A;  5ECI B;  1BJX A;  1TK0 B;  1A23 A;  5G5E A;  5JWO B;  2J23 A;  4Q5N A;  2JAC A;  3RAZ A;  5DVB A;  6GSX A;  1YKC A;  5J9C A;  4XS4 B;  5ECQ B;  2RM6 A;  5IOW A;  3LQ7 A;  3IR4 A;  9GSS A;  1YEX A;  1HD2 A;  2PU9 C;  3IHQ A;  1GSE A;  2L5L A;  5D96 A;  3KP8 A;  3D4T A;  1JZR A;  4HQZ A;  5DJL A;  2E7P A;  2OE0 A;  2TRX A;  1ST9 A;  3N5O A;  2H19 A;  2DML A;  2NTO A;  3VI5 A;  2OBK A;  1ABA A;  4XIH A;  3E0U A;  1T4Y A;  1AUC A;  2B6M A;  3ME8 A;  1QMV A;  1KTE A;  5B6M A;  2PVO C;  1O6J A;  2V6K A;  1SK1 A;  2LUS A;  4ZBA A;  4GSS A;  3VPQ A;  5DBQ A;  4ECC A;  3HDC A;  1XIY A;  4PUF C;  1G0T A;  2CQ9 A;  1YDK A;  3PR8 A;  3US3 A;  1U88 A;  4LL1 B;  3F6D A;  3ZVJ D;  3D4M A;  2WGR A;  1NW2 A;  3UMA A;  1M0U A;  3QOU A;  3ZML A;  3MAK A;  3ZFB A;  2F8F A;  4RI7 A;  2VCW A;  2A4V A;  3KP9 A;  2N5B A;  2CX4 A;  3EIN A;  2A2R A;  2WFC A;  6GSU A;  2AHE A;  2VL2 A;  1XBS A;  3BJ5 A;  5C00 A;  1K3O A;  4JU5 A;  3FKF A;  4V1A g;  4GLT A;  2P31 A;  2OJL A;  1OC9 A;  2GQL A;  4ID0 A;  1V58 A;  1FG4 A;  2VO4 A;  13GS A;  3FZA A;  4BA7 A;  4FYB A;  3WGD A;  1WJK A;  2MMO A;  1MTC A;  2LKU A;  3IRA A;  5ID2 B;  5A4W A;  1AIU A;  3I6A A;  3VI7 A;  6GSW A;  1Z7R A;  2IWT A;  1GSY A;  1VF3 A;  3VLN A;  3UBK A;  3GKX A;  4K7O A;  4FYC A;  3RPP A;  2E2M A;  2V32 A;  3IPZ A;  4HU9 A;  1M7T A;  11GS A;  1YF0 A;  2CT6 A;  2OAD A;  3ZIJ A;  2XHF A;  2G2Q A;  5KN1 A;  3A2W A;  4PQ1 A;  4PQI A;  2X64 A;  3MWH A;  1XWC A;  3PIN A;  5FT3 A;  3V1W A;  2DJK A;  5CNW A;  2DJJ A;  2ON5 A;  1S3D A;  1SK0 A;  2YV9 A;  1DE1 A;  1W89 A;  1XVQ A;  1H4O A;  4K0G A;  5ECN B;  2V1M A;  2JSZ A;  2MBS A;  3TKR A;  2AYT A;  1GLQ A;  3ZYW A;  4DSQ A;  1V40 A;  1XW9 A;  3APS A;  2WB9 A;  4DVC A;  3CMI A;  1M9B A;  3TRP A;  2HZF A;  2LQQ A;  1URM A;  4KB3 A;  3VFI A;  4KND A;  2YPM A;  2DJ0 A;  2LNS A;  1R4W A;  3HJP A;  4GQF A;  3M8N A;  3A2X A;  4MLY A;  2IFQ A;  2NBS A;  4N10 A;  1AXD A;  2H1B A;  3GTU A;  5DCG A;  5CYY A;  3GX8 A;  4I2T A;  2R6K A;  2HZE B;  1GUH A;  3UBL A;  3APO A;  3GN3 A;  1B4Q A;  5D9T A;  3CBU A;  2I3Y A;  1E6B A;  2B5Y A;  1YJ6 A;  1IYI A;  2R3X A;  2LJR A;  3UJ1 A;  5ECL B;  2H71 A;  2ALB A;  2R2J A;  2MMN A;  4POB A;  2L59 A;  4MMM A;  4KUN A;  1X5C A;  2GST A;  4YQV A;  5HR0 A;  5JCU A;  5D9V A;  5ECM B;  3LYK A;  3R2Q A;  2LRT A;  4PUR A;  4ML1 A;  1O8X A;  4X1U A;  1I9D A;  17GS A;  1TKD B;  2F9S A;  1KEB A;  2IME A;  5ECO B;  2C3T A;  3F4T A;  3HY2 A;  4WR4 A;  2D2Z A;  1O8W A;  2ON7 A;  4G9H A;  4TXO A;  2HYX A;  3GL3 A;  4ZL9 A;  5IMF A;  4LL4 B;  1ILO A;  3L0H A;  1QFN A;  2HNL A;  4CW9 A;  1QGV A;  3H1N A;  4OCF A;  5HR1 A;  3QPM A;  3TKS E;  3KMO A;  3TJF A;  1TK8 B;  1H75 A;  5G2Z A;  1OE8 A;  3OR5 A;  3LGC A;  4MCU A;  3ERW A;  3IK9 A;  4AF2 A;  5GAP D;  4JED A;  1YF1 A;  2K9F A;  4F0B A;  2GDR A;  3U6V A;  3ERG A;  4XRA A;  3QR6 A;  5DJM A;  2FGX A;  2GZY A;  3QAG A;  4GWR A;  3I43 A;  3LJR A;  2OAC A;  5EPF A;  1MD4 A;  3PH9 A;  5B6N A;  4K2D A;  1EP8 A;  4HI7 A;  1G7O A;  3HJM A;  3HZ4 A;  2I9H A;  2VLU A;  4IN0 A;  3GH9 A;  3LG6 A;  1WOU A;  3CSH A;  5D9W A;  1PL2 A;  4ZB6 A;  1ZYQ B;  3GL5 A;  4K7I A;  4IS0 A;  5ECR B;  3ME7 A;  4MPF A;  3H4K A;  5DAK B;  5JWR B;  2FCH A;  2YWI A;  3HYP A;  5EVO A;  1G6Y A;  2O87 A;  4O7H A;  1DSB A;  3IA1 A;  1BYE A;  4HOJ A;  2GZP A;  2H6X A;  2P0G A;  3AY8 A;  1YY7 A;  1WP0 A;  2LNT A;  3IV4 A;  1X9M B;  3RHC A;  4NHZ A;  3ZRD A;  5J41 A;  5CP1 A;  2QKE A;  1Z6M A;  1U87 A;  1O85 A;  4G10 A;  4IVF A;  5D8I A;  1AQV A;  3ZFL A;  1MEK A;  4IQA A;  3NOF A;  2F8A A;  1N8J A;  3WT2 A;  4V2L A;  2B1L A;  3QAW A;  3UAP A;  5IMA A;  3L9V A;  2VM1 A;  3GV1 A;  4L0W A;  2RUE A;  1EOG A;  4N0V A;  3TJJ A;  4PQH A;  1K0B A;  1OVN A;  2VCX A;  4WR5 A;  5FHI A;  1XZO A;  3K8N A;  4I5Q A;  2C0D A;  4FH8 A;  1V57 A;  3WYW A;  4NHW A;  1GTA A;  2YP6 A;  1JFU A;  2I4A A;  4GXZ A;  2VLT A;  4EKZ A;  3GFK A;  1J0F A;  1FB0 A;  1FW1 A;  4IP6 A;  3TJB A;  2EIR A;  1ML6 A;  4EUY A;  3C7M A;  2IMI A;  3E3E A;  3M9J A;  4DSR A;  1GNW A;  4ZBD A;  4MH2 A;  1XFL A;  1M99 A;  1F6M C;  4WBJ A;  4MZW A;  1G6W A;  3GKM A;  1GSQ A;  4EXJ A;  1JHB A;  1NSW A;  3KJY A;  2B7K A;  5LNK e;  1WWJ A;  4RI6 A;  2H30 A;  2XBI A;  2FWH A;  3A2V A;  3TKS C;  2H0I A;  3M9K A;  1GTB A;  1B9X C;  1A8Y A;  1TU8 A;  2VIM A;  4MK3 A;  1UA5 A;  8GSS A;  4X0X A;  3EC3 A;  1T7P B;  2ES7 A;  3KXO A;  5CRE A;  2RII A;  2YWO A;  1A2M A;  5AGY A;  2LJA A;  2VCQ A;  3ZVJ A;  1PN9 A;  1PX6 A;  2N5A A;  1VRS D;  2YJH A;  5HFG A;  5H5S A;  1TU7 A;  4JR4 A;  2FNO A;  1GUK A;  1O81 A;  1GP1 A;  1YKA A;  2DLX A;  2BMX A;  2PN8 A;  5D73 A;  2YCD A;  1VF4 A;  4PUA A;  4OFM A;  3ZTL A;  4POK A;  3HVX A;  5ECP B;  4GTU A;  5LD0 A;  4LLR A;  4EC0 A;  1OC9 B;  3GSS A;  1V98 A;  3IAS 2;  4V2M A;  3HCZ A;  2H76 A;  2H1D A;  1JZO A;  3LXZ A;  1PMT A;  4KH7 A;  1AC1 A;  2X8C A;  2HFD A;  3IOS A;  3UEM A;  3CXG A;  5EY6 A;  1PQN A;  2LTK A;  4X43 A;  2LQO A;  3TOT A;  1EZK A;  5CRH A;  3IE3 A;  18GS A;  4PNF A;  2DBC A;  2NVL A;  5HFI A;  5FWG A;  1X9W B;  5IM9 A;  1DBY A;  5ECS A;  4QL7 A;  1SYR A;  5G30 A;  2WS2 A;  3HZ8 A;  4MJE A;  5ELG A;  3O6T A;  3GYK A;  4TRX A;  2KHP A;  3WGE A;  2YOI A;  2EC4 A;  1J08 A;  3GRX A;  2G0F A;  4EE0 A;  1E2Y A;  4IEL A;  2B3S A;  4HEA 2;  1CQG A;  4L8E A;  2H74 A;  2L4Q A;  3FEU A;  2HXK A;  1VF1 A;  3DYR A;  2CAI A;  3Q6O A;  1I5G A;  1K0M A;  1Q98 A;  2LV3 A;  2YNX A;  1TK5 B;  4D73 A;  5IQY A;  1JZW A;  1ON4 A;  1Z5Y E;  3EMP A;  2WJU A;  3C1R A;  3F4S A;  3DXB A;  4LA1 A;  5DDL A;  1SL1 B;  2PUK C;  4NV5 A;  3H8Q A;  4MJA A;  3EE2 A;  2DSA A;  3UOM A;  2N5F A;  3DVW A;  4HZ2 A;  4ACS A;  5ABR A;  3G7I A;  4TW5 A;  4Q5R A;  6GST A;  4XRD A;  2IMK A;  4K9Z A;  3H93 A;  2VUP A;  2PVQ A;  1M9A A;  3DRN A;  1XWB A;  2IL3 A;  4KDU A;  3HXS A;  5D93 A;  1FOV A;  1WMJ A;  3O3T A;  4AJ6 A;  4V2N A;  1QXH A;  5IIZ A;  4WF4 A;  2TIR A;  1XOB A;  4EO3 A;  1Z9H A;  3SBC A;  5G5F A;  2JU5 A;  2CA8 A;  1VGL A;  2C3N A;  2V2G A;  2JSY A;  5CO3 A;  4TKY A;  4MF5 A;  3LSZ A;  3FYG A;  5HQP A;  4ML6 A;  4PGT A;  2C0F A;  4H86 A;  1RK4 A;  2MBT A;  2YZU A;  2MMA A;  2QGV A;  3F0I A;  4ZL7 A;  2V41 A;  1J9B A;  1BG5 A;  4TXO B;  1SJZ A;  1TI1 A;  4O5R A;  3TKS A;  20GS A;  1U6T A;  2KOK A;  5G1L A;  1KBN A;  4OWY A;  4OFT A;  4MF6 A;  2CV4 A;  3FR6 A;  2GTU A;  3LFL A;  4YQM A;  2M72 A;  1FB6 A;  3QDN A;  1F9M A;  2DIY A;  4AJ8 A;  5KEJ A;  4O92 A;  2ZCT A;  1M2D A;  1K0N A;  3ZIT A;  2EIO A;  2HE3 A;  1ERT A;  3C1S A;  3GH6 A;  3RHB A;  3RPN A;  3BBY A;  2R4V A;  4POL A;  4Q5Q A;  2IIY A;  5AN1 A;  4EL1 A;  2MZC A;  3WT1 A;  1Q4J A;  5ELA A;  1F3B A;  3VUR A;  1SL2 B;  3HKR A;  4FIW A;  1TW9 A;  1TDI A;  3EVI A;  2A2S A;  1S3A A;  1DUG A;  2V6O A;  2OA7 A;  1EWX A;  5JCG A;  2CZ3 A;  3Q19 A;  2I1U A;  4BWQ A;  2L5O A;  2OBI A;  3GA4 A;  3UVH A;  3FZ9 A;  1XOA A;  4G19 A;  4XS6 A;  4QL9 A;  2HLS A;  4E8H A;  2CVK A;  3KD0 A;  5IMC A;  5GSS A;  3D0Z A;  1RQM A;  1HYU A;  3ISO A;  4ECJ A;  3FR3 A;  4F2I A;  4KW6 A;  3LXT A;  2FUG 2;  1EV4 A;  1K0C A;  4F82 A;  2H0H A;  2BJX A;  5J4U A;  2OE1 A;  1M2A A;  1R5P A;  5DQY A;  4JZQ A;  5E4W A;  5DAL A;  3KEB A;  4KSO A;  5G31 A;  2FHE A;  2CX3 A;  1F3A A;  3F3R A;  3W6G A;  2B1K A;  2C80 A;  5CAX A;  3QFB C;  4N30 A;  2F3M A;  4I6X A;  6GSS A;  1HNC A;  4MDC A;  2GQK A;  2TRC P;  3DML A;  3VWU A;  1NHO A;  2LEG A;  1X9S B;  4ZIJ A;  1A2L A;  4FO5 A;  2AJQ B;  2JZS A;  3TRX A;  1A0F A;  5LCZ A;  2FLS A;  1EEJ A;  1XPV A;  3ZRE A;  3HA9 A;  4KSM A; 
#chains in the Genus database with same CATH topology
 4DSS A;  4IP1 A;  2C0G A;  4J56 E;  3P2A A;  1T1V A;  2B7J A;  3EU4 A;  3HHV A;  1ZCP A;  3FW2 A;  4TVE A;  1ACV A;  1MDK A;  2FA4 A;  3I69 A;  1Z7P A;  1GSF A;  4HSC X;  1PL1 A;  2HSY A;  2ZNM A;  4TXV A;  4MF7 A;  1SKR B;  2YWM A;  5IO2 A;  1YZX A;  4HU7 A;  2RUF A;  2CVB A;  5F05 A;  4O32 A;  4OD7 A;  2VD0 A;  3TB2 A;  5IOX A;  3G7Y A;  4TR4 A;  2XBQ A;  1ERW A;  5IMZ A;  2X99 A;  1WIK A;  2NDO A;  3EU3 A;  2CVD A;  4BPY A;  3F8U A;  5F8B A;  4NV2 A;  1GL8 A;  4NWY A;  1ERV A;  3L78 A;  1UVZ A;  3TGZ A;  2L6D A;  1WE0 A;  5A5K A;  3UIW A;  1PSQ A;  1T00 A;  1OAZ A;  2CAQ A;  3KM6 A;  1HNB A;  4IJI A;  3BCI A;  5IO0 A;  1NHY A;  5H5Q A;  4YKF A;  5CRW A;  2GSR A;  4YAV A;  2P5Q A;  4MPG A;  2AAW A;  3WD6 A;  1V2A A;  1G7E A;  2H70 A;  1UN2 A;  2KUC A;  3EWL A;  1MDI A;  3BD2 A;  4MZC A;  4N0Z A;  4BWS A;  1OC3 A;  3ZL5 A;  1GLP A;  4KA0 A;  1XWK A;  4CHS A;  4LMV A;  5F06 A;  4O5U A;  1TXX A;  3L9U A;  2DJ3 A;  5HFK A;  2FWG A;  3GNJ A;  1U3A A;  3UL3 A;  4YQU A;  3IK7 A;  5INY A;  2L6C A;  4K8M A;  3HJO A;  3EPT A;  1FVK A;  5KN0 A;  4GQC A;  3GHA A;  1BX9 A;  4TR1 A;  4ECI A;  3MDK A;  2O7K A;  2GGT A;  5H5R A;  2H8L A;  5A4V A;  1O73 A;  5G1K A;  4V1A p;  3D6I A;  2XC2 A;  3GMF A;  3PGT A;  5CRD A;  5HR2 A;  5GAN D;  2AV4 A;  2H1A A;  3HVS A;  1GNE A;  1T4Z A;  4OMV A;  2H6Z A;  2ZUP A;  4IW9 A;  1VF2 A;  4K6X A;  3KZQ A;  2YZH A;  5CRG A;  16GS A;  2VAF A;  4DEJ A;  3W8J A;  4GCI A;  3J7Y k;  2VCZ A;  3BCK A;  3BOA A;  4D73 B;  1W4V A;  3G9B A;  2R5G A;  4XS1 A;  1AQW A;  4PX1 A;  1SEN A;  4MP4 A;  1K0D A;  2GT5 A;  2H6Y A;  5AIS A;  1M3I A;  1A8L A;  10GS A;  1Z3E A;  4HJ2 A;  2KP2 A;  4ULX A;  1YQ1 A;  3KIJ A;  2H66 A;  2PBJ A;  2HT9 A;  1TOF A;  5DQS A;  4YKG A;  4RQX A;  1ZZY A;  1XWA A;  2GSS A;  3F4R A;  3PPU A;  4HZ4 A;  1HQO A;  2F51 A;  3LWA A;  2C4J A;  3EMX A;  5ENU A;  2H0G A;  1GRX A;  3S9F A;  4I97 A;  1QQ2 A;  4NXI A;  4WET A;  2GT6 A;  4JBB A;  1K0O A;  4HS1 A;  3CRT A;  4POM A;  3FMW A;  1B48 A;  1XVW A;  3Q18 A;  4KDX A;  2FD3 A;  4KCE A;  1GSD A;  1XXU A;  1PGT A;  4GST A;  1HNA A;  1LBK A;  1X0R A;  4K7N A;  5C04 A;  4PNG A;  1M2B A;  3DKS A;  1YEP A;  3TCO A;  2J9H A;  1C72 A;  5AIX A;  4AJ7 A;  3ZMK A;  3HVV A;  4FYU A;  4OO4 A;  4RQR A;  4YAP A;  2X8G A;  2LJK A;  4IJ3 A;  2QSI A;  5ECK B;  2JL4 A;  1SYX A;  5F07 A;  1A24 A;  3GUS A;  4ISD A;  2VCT A;  4XCS A;  5A4U A;  4KCA A;  3SWL A;  4BVY A;  5J3R A;  2PGT A;  3IDV A;  4ZIL A;  4BVX A;  3UVT A;  2PER A;  3FY7 A;  1DE2 A;  2VCV A;  4USS A;  1FVJ A;  4JE1 A;  5JCW A;  5E59 A;  1EV9 A;  3GST A;  3KCM A;  2IFQ B;  4ZB9 A;  4JRR A;  1PA3 A;  3GTU B;  14GS A;  3IC4 A;  2GSQ A;  4OO5 A;  4ZL8 A;  1OKD A;  5EL8 A;  4Z2R A;  5HR3 A;  3A3T A;  2WDU A;  4EIQ A;  3I9V 2;  3KTB A;  3F9U A;  2C3Q A;  5L71 A;  2RLI A;  4J2F A;  1FO5 A;  1CQH A;  2VL9 A;  3EYT A;  1PX7 A;  3ED3 A;  3GX0 A;  4F9Z A;  4MZB A;  3MIX A;  4MAB A;  4I2U A;  2R0P A;  3IXR A;  4TOP A;  1SKS B;  1QK8 A;  3QD9 A;  3J7Y b;  4XS4 A;  5IPH A;  7GSS A;  5GZZ B;  1LU4 A;  1TI3 A;  3U5R E;  5B7C A;  1TRS A;  4WBR D;  3ERF A;  3GIX A;  4Q5F A;  2JZR A;  4PXO A;  5BMU A;  5KN2 A;  4CDO A;  3VK9 A;  1XW5 A;  4GSN A;  1PRX A;  1Y25 A;  1TTZ A;  4KE3 A;  5IMV A;  3JCM L;  3C73 A;  3ZLP A;  1V9W A;  1EGO A;  4KDY A;  1F37 A;  4NAX A;  1JLV A;  1BED A;  2K8S A;  1SJI A;  2DC5 A;  1XW6 A;  2VM2 A;  4HUA A;  4WKW A;  5GST A;  3H79 A;  1U3I A;  2C0E A;  2GS3 A;  2M46 A;  5ECH B;  3MNG A;  4K0N A;  3TOU A;  1FOH A;  2KP1 A;  4RUV A;  3D5J A;  5IMD A;  5DAL B;  4E8E A;  1B4P A;  4HQS A;  1UC7 A;  3KGK A;  3WGX A;  2IMF A;  1JLW A;  4L0U A;  3TUE A;  3FK8 A;  1Z6N A;  1RW1 A;  3RDW A;  1B8X A;  4GF0 A;  3QCP A;  2C8U A;  3TKP A;  1TRV A;  1ZOF A;  4ZB8 A;  2MMZ A;  4IBP A;  2FWE A;  2B5X A;  1ZYE A;  3CTG A;  2I81 A;  1IYH A;  4DSS B;  1GH2 A;  3CTF A;  3GKK A;  2HRF A;  1OE7 A;  4IGJ A;  3LEF A;  3ZIV A;  3CRU A;  2FY6 A;  5B8A A;  3RBT A;  3DD3 A;  2OKA A;  3E9J B;  5ID2 A;  4TR3 A;  1LJR A;  3KH7 A;  3F6F A;  3APQ A;  4L5L A;  2IN3 A;  2IPA A;  4CY6 A;  1OYJ A;  4F0C A;  1SK2 A;  1SD8 A;  1USB A;  4K1F A;  1QUW A;  2DIZ A;  2M80 A;  3GUR A;  3C8E A;  2CZ2 A;  2DMM A;  5AIV A;  2GQM A;  3F3Q A;  12GS A;  4P3Y B;  1EEM A;  1GWC A;  2REM A;  3DWV A;  1EOH A;  4AGS A;  4I8B A;  3C71 A;  2H75 A;  2R37 A;  3EUR A;  2H1G A;  2O85 A;  3M1G A;  1KNG A;  3L9S A;  2H73 A;  3DGQ A;  1SU9 A;  4MJB A;  3FZ5 A;  1JZD A;  4GRF A;  3IAM 2;  3FHK A;  5BRT A;  4MA9 A;  4MNN A;  4IHU A;  5J9B A;  1SL0 B;  4F03 A;  4IKH A;  2Z9S A;  4KGI A;  1EGR A;  4EDY A;  2YN1 A;  1O7U A;  1SKW B;  4G2E A;  3LYP A;  2KLX A;  2X8H A;  2E2G A;  4FQU A;  2H01 A;  3VWV A;  1AW9 A;  5F0G A;  2YV7 A;  3TRQ A;  4WXT A;  2HZE A;  1A0R P;  4J57 E;  3N9J A;  1WPI A;  5COH A;  3D21 A;  4EF0 A;  3QFA C;  1TJD A;  1T8E B;  6GSY A;  3FZ4 A;  3M3M A;  2VL3 A;  3O76 A;  5D9X A;  4KX4 A;  2HI7 A;  5KN3 A;  1THX A;  2LRN A;  1ZGN A;  2LRC A;  3TKQ A;  2P5R A;  3NIV A;  2AB6 A;  4XHM A;  4TR1 B;  1X5E A;  19GS A;  1R26 A;  1N2A A;  2IMD A;  3FR9 A;  1K3Y A;  1FHE A;  2WRT A;  3DIE A;  3ZZX A;  2E0Q A;  2PMT A;  3FRC A;  4HDE A;  2JAD A;  4NPB A;  3NZN A;  1GUM A;  1PKW A;  2PPT A;  1K0A A;  4KAE A;  1TRW A;  4OCE A;  3KH9 A;  4G0L A;  3KTL A;  4K5R A;  3CSI A;  5J5N A;  1FAA A;  1ZL9 A;  4MJC A;  4IQ1 A;  1AAZ A;  2VLV A;  5JWQ B;  4TR0 A;  2K8V A;  3P90 A;  2OE3 A;  2PWJ A;  1XWG A;  2H72 A;  3VWX A;  3M0F A;  2HSH A;  4ILF A;  1EP7 A;  3TDG A;  4EVM A;  3W8S A;  2FWF A;  2WCI A;  1X5D A;  5B8B A;  3LW9 A;  4ZBB A;  4OFN A;  2VOC A;  2O89 A;  2VL2 C;  2VD1 A;  4MH3 A;  1R5A A;  3A5W A;  2L57 A;  2AUV A;  4Z7X A;  1SD9 A;  4WF5 A;  1S3R A;  2GLR A;  3DEX A;  4TN8 A;  4JR6 A;  2NPB A;  2DJ1 A;  2XPD A;  1ERU A;  4BL7 A;  1AQX A;  3CYN A;  3UAR A;  4K5S A;  4O5Q A;  4ECB A;  2YWN A;  3D22 A;  1GTI A;  3Q74 A;  4ZXG A;  1WRY A;  2HSM A;  2RM5 A;  1K3L A;  4QQ7 A;  2WZ9 A;  1GUL A;  1M3J A;  1ZMA A;  3VWW A;  2JZT A;  1SJ6 A;  2LST A;  3GKN A;  3L4N A;  1XCC A;  2C1Y A;  2MYG A;  2EIQ A;  4NMU A;  1MDJ A;  1BQ7 A;  1GSU A;  2B5E A;  2YJ7 A;  3QAV A;  1NM3 A;  3QMX A;  2A4H A;  3TJG A;  2YAN A;  3IBH A;  3LOR A;  1BAY A;  1PKZ A;  2WUL A;  1PD2 1;  3VPT A;  1B9Y C;  1GTU A;  2FA8 A;  2LS5 A;  3KMN A;  4EDZ A;  5DAK A;  4YH2 A;  4WEY A;  3TJK A;  1Y6E A;  1GSS A;  22GS A;  3P7X A;  2IJY A;  6GSV A;  2K18 A;  1TRU A;  2DKH A;  3HD5 A;  4BIK A;  2L4C A;  4BVY B;  1T3B A;  4BVX B;  1MD3 A;  1R7H A;  1THO A;  2GZZ A;  4LMW A;  3MSZ A;  2O8V B;  3P8W A;  1S3C A;  5IPG A;  3CSJ A;  4XTS A;  5DCH A;  2QC7 A;  3G7J A;  4N11 A;  3F63 A;  1TP9 A;  3DVX A;  1OC8 A;  2BTO T;  1F2E A;  2DJ2 A;  2HRN A;  4L5O A;  1OKT A;  4HJM A;  2K6V A;  2XPE A;  1A2J A;  2GVP A;  5ECI B;  1BJX A;  1TK0 B;  1A23 A;  5G5E A;  5JWO B;  2J23 A;  4Q5N A;  2JAC A;  3RAZ A;  5DVB A;  6GSX A;  1YKC A;  1PFO A;  5J9C A;  4XS4 B;  5ECQ B;  2RM6 A;  5IOW A;  3LQ7 A;  3IR4 A;  9GSS A;  1YEX A;  1HD2 A;  2PU9 C;  3IHQ A;  1GSE A;  2L5L A;  5D96 A;  3KP8 A;  3D4T A;  1JZR A;  4HQZ A;  2HRK A;  5DJL A;  2E7P A;  2OE0 A;  2TRX A;  1ST9 A;  3N5O A;  2H19 A;  4G0K A;  2DML A;  2NTO A;  4PTS A;  3VI5 A;  2OBK A;  1ABA A;  4XIH A;  3E0U A;  1T4Y A;  1AUC A;  2B6M A;  3ME8 A;  1QMV A;  1KTE A;  5B6M A;  2PVO C;  1O6J A;  2V6K A;  1SK1 A;  2LUS A;  4ZBA A;  2A2P A;  4GSS A;  3VPQ A;  5DBQ A;  4ECC A;  3HDC A;  1XIY A;  4PUF C;  1G0T A;  2CQ9 A;  1YDK A;  2X49 A;  3PR8 A;  3US3 A;  1U88 A;  4LL1 B;  3F6D A;  3ZVJ D;  3D4M A;  2WGR A;  1NW2 A;  3UMA A;  1M0U A;  3QOU A;  3ZML A;  3MAK A;  3ZFB A;  2F8F A;  4RI7 A;  2VCW A;  2A4V A;  3KP9 A;  2N5B A;  2CX4 A;  3EIN A;  2A2R A;  2WFC A;  6GSU A;  2AHE A;  2VL2 A;  1XBS A;  3BJ5 A;  5C00 A;  1K3O A;  4JU5 A;  3FKF A;  4V1A g;  4GLT A;  2P31 A;  2OJL A;  1OC9 A;  2GQL A;  4ID0 A;  1V58 A;  1FG4 A;  2VO4 A;  13GS A;  3FZA A;  4BA7 A;  4FYB A;  3WGD A;  1WJK A;  2MMO A;  4Z2U A;  1MTC A;  4CY8 A;  2LKU A;  3IRA A;  5ID2 B;  5A4W A;  1AIU A;  3I6A A;  3VI7 A;  6GSW A;  1Z7R A;  2IWT A;  1GSY A;  1VF3 A;  3VLN A;  3UBK A;  3GKX A;  4K7O A;  4FYC A;  3RPP A;  2E2M A;  2V32 A;  3IPZ A;  4HU9 A;  1M7T A;  11GS A;  1YF0 A;  2CT6 A;  2OAD A;  3ZIJ A;  2XHF A;  2G2Q A;  5KN1 A;  3A2W A;  4PQ1 A;  4PQI A;  2X64 A;  3MWH A;  1XWC A;  3PIN A;  5FT3 A;  3V1W A;  4G0I A;  2DJK A;  5CNW A;  2DJJ A;  2ON5 A;  1S3D A;  1SK0 A;  2YV9 A;  1DE1 A;  1W89 A;  1XVQ A;  1H4O A;  4K0G A;  5ECN B;  2V1M A;  2JSZ A;  2MBS A;  3TKR A;  2AYT A;  1GLQ A;  3ZYW A;  4DSQ A;  1V40 A;  1XW9 A;  3APS A;  2WB9 A;  4DVC A;  4KF9 A;  3CMI A;  1M9B A;  3TRP A;  2HZF A;  2LQQ A;  1URM A;  4KB3 A;  3VFI A;  4KND A;  2YPM A;  2DJ0 A;  2LNS A;  1R4W A;  3HJP A;  4GQF A;  3M8N A;  3A2X A;  4MLY A;  2IFQ A;  2NBS A;  4N10 A;  1AXD A;  2H1B A;  3GTU A;  5DCG A;  5CYY A;  3GX8 A;  4I2T A;  2QA2 A;  2R6K A;  2HZE B;  1GUH A;  3UBL A;  1ZYP A;  3APO A;  3GN3 A;  1B4Q A;  5D9T A;  3MYD A;  3CBU A;  2I3Y A;  1E6B A;  2B5Y A;  1YJ6 A;  1IYI A;  2R3X A;  2LJR A;  3UJ1 A;  5ECL B;  2H71 A;  2ALB A;  2R2J A;  2MMN A;  4POB A;  2L59 A;  4MMM A;  4KUN A;  1X5C A;  2GST A;  4YQV A;  5HR0 A;  2HRA A;  5JCU A;  5D9V A;  5ECM B;  3LYK A;  3R2Q A;  2LRT A;  4PUR A;  4ML1 A;  1O8X A;  4X1U A;  1I9D A;  17GS A;  1TKD B;  2F9S A;  1KEB A;  2IME A;  5ECO B;  2C3T A;  3F4T A;  3HY2 A;  4WR4 A;  2D2Z A;  1O8W A;  2ON7 A;  4G9H A;  4TXO A;  2HYX A;  3GL3 A;  4ZL9 A;  5IMF A;  4A5P A;  4LL4 B;  1ILO A;  5KOW A;  3L0H A;  1QFN A;  2HNL A;  4CW9 A;  1QGV A;  3H1N A;  4OCF A;  5HR1 A;  3QPM A;  3TKS E;  3KMO A;  3TJF A;  1TK8 B;  1H75 A;  5G2Z A;  1OE8 A;  3OR5 A;  3LGC A;  4MCU A;  3ERW A;  3IK9 A;  4AF2 A;  5GAP D;  4JED A;  1YF1 A;  4BL7 B;  2K9F A;  4F0B A;  2GDR A;  3U6V A;  3ERG A;  4XRA A;  3QR6 A;  5DJM A;  2FGX A;  2GZY A;  3QAG A;  4GWR A;  3I43 A;  3LJR A;  2OAC A;  5EPF A;  1MD4 A;  2X4A A;  3PH9 A;  5B6N A;  4K2D A;  1EP8 A;  4HI7 A;  1G7O A;  3HJM A;  3HZ4 A;  2I9H A;  2VLU A;  4IN0 A;  3GH9 A;  3LG6 A;  1WOU A;  3CSH A;  5D9W A;  1PL2 A;  4ZB6 A;  1ZYQ B;  3GL5 A;  4K7I A;  4IS0 A;  5ECR B;  1ZYN A;  3ME7 A;  4MPF A;  3H4K A;  5DAK B;  5JWR B;  2FCH A;  2YWI A;  3HYP A;  5EVO A;  1G6Y A;  2O87 A;  4O7H A;  1DSB A;  3IA1 A;  1BYE A;  4HOJ A;  2GZP A;  2H6X A;  2P0G A;  3AY8 A;  1YY7 A;  1WP0 A;  2LNT A;  3IV4 A;  1X9M B;  3R3E A;  3RHC A;  4NHZ A;  3ZRD A;  5J41 A;  5CP1 A;  2QKE A;  1Z6M A;  1U87 A;  1O85 A;  4G10 A;  4IVF A;  5D8I A;  1AQV A;  3ZFL A;  1MEK A;  4IQA A;  3NOF A;  2F8A A;  1N8J A;  3IC8 A;  3WT2 A;  4V2L A;  2B1L A;  3QAW A;  3UAP A;  5IMA A;  3L9V A;  2VM1 A;  3GV1 A;  4L0W A;  2RUE A;  1EOG A;  2UZ8 A;  4N0V A;  3TJJ A;  4PQH A;  1K0B A;  1OVN A;  2VCX A;  4WR5 A;  5FHI A;  1XZO A;  3K8N A;  4I5Q A;  2C0D A;  4FH8 A;  1V57 A;  3WYW A;  4NHW A;  1GTA A;  2YP6 A;  1JFU A;  2I4A A;  4GXZ A;  2VLT A;  4EKZ A;  3GFK A;  1J0F A;  1FB0 A;  1FW1 A;  4IP6 A;  3TJB A;  2EIR A;  1ML6 A;  1PN0 A;  4EUY A;  3C7M A;  2IMI A;  3E3E A;  3M9J A;  4DSR A;  1GNW A;  4ZBD A;  4MH2 A;  1XFL A;  1M99 A;  1F6M C;  4WBJ A;  4MZW A;  1G6W A;  3GKM A;  1GSQ A;  4EXJ A;  1JHB A;  1NSW A;  3KJY A;  2B7K A;  5LNK e;  2R0C A;  1WWJ A;  4RI6 A;  2H30 A;  2XBI A;  2FWH A;  3A2V A;  3TKS C;  2H0I A;  3M9K A;  1GTB A;  1B9X C;  1A8Y A;  1TU8 A;  2VIM A;  4MK3 A;  1UA5 A;  8GSS A;  2QA1 A;  4X0X A;  3EC3 A;  1T7P B;  2ES7 A;  3KXO A;  5CRE A;  2RII A;  4K2X A;  2YWO A;  1A2M A;  5AGY A;  2DKI A;  2LJA A;  2VCQ A;  3ZVJ A;  1PN9 A;  1PX6 A;  2N5A A;  1VRS D;  2YJH A;  5HFG A;  5H5S A;  1TU7 A;  4JR4 A;  3CQF A;  2FNO A;  2R0G A;  1GUK A;  1O81 A;  1GP1 A;  1YKA A;  2DLX A;  2BMX A;  2PN8 A;  5D73 A;  2YCD A;  1VF4 A;  4PUA A;  4OFM A;  3ZTL A;  4POK A;  3HVX A;  5ECP B;  4GTU A;  5LD0 A;  4LLR A;  4EC0 A;  1OC9 B;  3GSS A;  1V98 A;  3IAS 2;  4V2M A;  3HCZ A;  2H76 A;  2H1D A;  1JZO A;  3LXZ A;  1PMT A;  4KH7 A;  1AC1 A;  2X8C A;  2HFD A;  3IOS A;  3UEM A;  3CXG A;  5EY6 A;  1PQN A;  2LTK A;  4X43 A;  2LQO A;  3TOT A;  1EZK A;  5CRH A;  3IE3 A;  18GS A;  4PNF A;  2DBC A;  2NVL A;  5HFI A;  5FWG A;  1X9W B;  5IM9 A;  1DBY A;  5ECS A;  4QL7 A;  1SYR A;  5G30 A;  2WS2 A;  3HZ8 A;  4MJE A;  5ELG A;  3O6T A;  3GYK A;  4TRX A;  2KHP A;  3WGE A;  2YOI A;  2EC4 A;  1J08 A;  3GRX A;  2G0F A;  4EE0 A;  1E2Y A;  4IEL A;  2B3S A;  4HEA 2;  1CQG A;  4L8E A;  2H74 A;  2L4Q A;  3FEU A;  2HXK A;  1VF1 A;  3DYR A;  2CAI A;  4X4J A;  3Q6O A;  1I5G A;  1K0M A;  1Q98 A;  2LV3 A;  2YNX A;  1TK5 B;  4D73 A;  5IQY A;  1JZW A;  1ON4 A;  1Z5Y E;  3EMP A;  2WJU A;  3C1R A;  3F4S A;  3DXB A;  4LA1 A;  5DDL A;  1SL1 B;  2PUK C;  4NV5 A;  3H8Q A;  4MJA A;  3EE2 A;  2DSA A;  3UOM A;  2N5F A;  3DVW A;  4HZ2 A;  4ACS A;  5ABR A;  3G7I A;  4TW5 A;  4Q5R A;  6GST A;  4XRD A;  2IMK A;  4K9Z A;  3H93 A;  2VUP A;  2PVQ A;  1M9A A;  3DRN A;  1XWB A;  2IL3 A;  4KDU A;  3HXS A;  5D93 A;  1FOV A;  1WMJ A;  3O3T A;  4AJ6 A;  4V2N A;  1QXH A;  5IIZ A;  4WF4 A;  2TIR A;  1XOB A;  4EO3 A;  1Z9H A;  3SBC A;  5G5F A;  2JU5 A;  2CA8 A;  1VGL A;  2C3N A;  2V2G A;  2JSY A;  5CO3 A;  4TKY A;  4MF5 A;  3LSZ A;  3FYG A;  5HQP A;  4ML6 A;  4PGT A;  2C0F A;  4H86 A;  3IHG A;  1RK4 A;  2MBT A;  2YZU A;  2MMA A;  2QGV A;  4Z2T A;  3F0I A;  4ZL7 A;  2V41 A;  1J9B A;  1BG5 A;  4TXO B;  1SJZ A;  1TI1 A;  4O5R A;  3TKS A;  20GS A;  1U6T A;  2KOK A;  5G1L A;  1KBN A;  4OWY A;  4OFT A;  4MF6 A;  2CV4 A;  3FR6 A;  2GTU A;  3LFL A;  4YQM A;  2M72 A;  1FB6 A;  3A5I A;  3QDN A;  1F9M A;  2DIY A;  4AJ8 A;  5KEJ A;  4O92 A;  2ZCT A;  1M2D A;  1K0N A;  3ZIT A;  2EIO A;  2HE3 A;  1ERT A;  3C1S A;  3GH6 A;  3RHB A;  3RPN A;  3BBY A;  2R4V A;  4POL A;  4Q5Q A;  2IIY A;  5AN1 A;  4EL1 A;  2MZC A;  3WT1 A;  1Q4J A;  5ELA A;  1F3B A;  3VUR A;  1XG8 A;  1SL2 B;  3HKR A;  4FIW A;  1TW9 A;  1TDI A;  3EVI A;  2A2S A;  1S3A A;  1DUG A;  2V6O A;  2OA7 A;  1EWX A;  5JCG A;  2CZ3 A;  3Q19 A;  2I1U A;  4BWQ A;  2L5O A;  2OBI A;  4EIP A;  3GA4 A;  3UVH A;  3FZ9 A;  1XOA A;  4G19 A;  4XS6 A;  4QL9 A;  2HLS A;  4E8H A;  2CVK A;  3KD0 A;  5IMC A;  5GSS A;  3D0Z A;  1RQM A;  1HYU A;  3ISO A;  4ECJ A;  3FR3 A;  4F2I A;  4KW6 A;  3LXT A;  2FUG 2;  1EV4 A;  1K0C A;  4F82 A;  2H0H A;  2BJX A;  5KOX A;  5J4U A;  3HVN A;  2OE1 A;  1M2A A;  1R5P A;  5DQY A;  4JZQ A;  5E4W A;  5DAL A;  3KEB A;  4KSO A;  5G31 A;  2FHE A;  2CX3 A;  1F3A A;  3F3R A;  3W6G A;  2B1K A;  2C80 A;  5CAX A;  3QFB C;  4N30 A;  2F3M A;  4I6X A;  6GSS A;  1HNC A;  4MDC A;  2GQK A;  2TRC P;  3DML A;  3VWU A;  4ICY A;  1NHO A;  2LEG A;  1X9S B;  4ZIJ A;  1A2L A;  4FO5 A;  2AJQ B;  2JZS A;  3TRX A;  1A0F A;  5LCZ A;  2FLS A;  1EEJ A;  1XPV A;  3ZRE A;  3HA9 A;  4KSM A; 
#chains in the Genus database with same CATH homology
 4DSS A;  4IP1 A;  2C0G A;  4J56 E;  3P2A A;  1T1V A;  2B7J A;  3EU4 A;  3HHV A;  1ZCP A;  3FW2 A;  4TVE A;  1ACV A;  1MDK A;  2FA4 A;  3I69 A;  1Z7P A;  1GSF A;  1PL1 A;  2HSY A;  2ZNM A;  4TXV A;  4MF7 A;  1SKR B;  2YWM A;  5IO2 A;  1YZX A;  4HU7 A;  2RUF A;  2CVB A;  5F05 A;  4O32 A;  4OD7 A;  2VD0 A;  3TB2 A;  5IOX A;  3G7Y A;  4TR4 A;  2XBQ A;  1ERW A;  5IMZ A;  2X99 A;  1WIK A;  2NDO A;  3EU3 A;  2CVD A;  4BPY A;  3F8U A;  5F8B A;  4NV2 A;  1GL8 A;  4NWY A;  1ERV A;  3L78 A;  1UVZ A;  3TGZ A;  2L6D A;  1WE0 A;  5A5K A;  3UIW A;  1PSQ A;  1T00 A;  1OAZ A;  2CAQ A;  3KM6 A;  1HNB A;  4IJI A;  3BCI A;  5IO0 A;  1NHY A;  5H5Q A;  4YKF A;  5CRW A;  2GSR A;  4YAV A;  2P5Q A;  4MPG A;  2AAW A;  3WD6 A;  1V2A A;  1G7E A;  2H70 A;  1UN2 A;  2KUC A;  3EWL A;  1MDI A;  3BD2 A;  4MZC A;  4N0Z A;  4BWS A;  1OC3 A;  3ZL5 A;  1GLP A;  4KA0 A;  1XWK A;  4CHS A;  4LMV A;  5F06 A;  4O5U A;  1TXX A;  3L9U A;  2DJ3 A;  5HFK A;  2FWG A;  3GNJ A;  1U3A A;  3UL3 A;  4YQU A;  3IK7 A;  5INY A;  2L6C A;  4K8M A;  3HJO A;  3EPT A;  1FVK A;  5KN0 A;  4GQC A;  3GHA A;  1BX9 A;  4TR1 A;  4ECI A;  3MDK A;  2O7K A;  2GGT A;  5H5R A;  2H8L A;  5A4V A;  1O73 A;  5G1K A;  4V1A p;  3D6I A;  2XC2 A;  3GMF A;  3PGT A;  5CRD A;  5HR2 A;  5GAN D;  2AV4 A;  2H1A A;  3HVS A;  1GNE A;  1T4Z A;  4OMV A;  2H6Z A;  2ZUP A;  4IW9 A;  1VF2 A;  4K6X A;  3KZQ A;  2YZH A;  5CRG A;  16GS A;  2VAF A;  4DEJ A;  3W8J A;  4GCI A;  3J7Y k;  2VCZ A;  3BCK A;  3BOA A;  4D73 B;  1W4V A;  3G9B A;  2R5G A;  4XS1 A;  1AQW A;  4PX1 A;  1SEN A;  4MP4 A;  1K0D A;  2GT5 A;  2H6Y A;  5AIS A;  1A8L A;  10GS A;  1Z3E A;  4HJ2 A;  2KP2 A;  4ULX A;  1YQ1 A;  3KIJ A;  2H66 A;  2PBJ A;  2HT9 A;  1TOF A;  5DQS A;  4YKG A;  4RQX A;  1ZZY A;  1XWA A;  2GSS A;  3F4R A;  3PPU A;  4HZ4 A;  1HQO A;  2F51 A;  3LWA A;  2C4J A;  3EMX A;  5ENU A;  2H0G A;  1GRX A;  3S9F A;  4I97 A;  1QQ2 A;  4NXI A;  4WET A;  2GT6 A;  4JBB A;  1K0O A;  4HS1 A;  3CRT A;  4POM A;  3FMW A;  1B48 A;  1XVW A;  3Q18 A;  4KDX A;  2FD3 A;  4KCE A;  1GSD A;  1XXU A;  1PGT A;  4GST A;  1HNA A;  1LBK A;  1X0R A;  4K7N A;  5C04 A;  4PNG A;  1M2B A;  3DKS A;  1YEP A;  3TCO A;  2J9H A;  1C72 A;  5AIX A;  4AJ7 A;  3ZMK A;  3HVV A;  4FYU A;  4OO4 A;  4RQR A;  4YAP A;  2X8G A;  2LJK A;  4IJ3 A;  2QSI A;  5ECK B;  2JL4 A;  1SYX A;  5F07 A;  1A24 A;  3GUS A;  4ISD A;  2VCT A;  4XCS A;  5A4U A;  4KCA A;  3SWL A;  4BVY A;  5J3R A;  2PGT A;  3IDV A;  4ZIL A;  4BVX A;  3UVT A;  2PER A;  3FY7 A;  1DE2 A;  2VCV A;  4USS A;  1FVJ A;  4JE1 A;  5JCW A;  5E59 A;  1EV9 A;  3GST A;  3KCM A;  2IFQ B;  4ZB9 A;  4JRR A;  1PA3 A;  3GTU B;  14GS A;  3IC4 A;  2GSQ A;  4OO5 A;  4ZL8 A;  1OKD A;  5EL8 A;  4Z2R A;  5HR3 A;  3A3T A;  2WDU A;  4EIQ A;  3I9V 2;  3KTB A;  3F9U A;  2C3Q A;  5L71 A;  2RLI A;  4J2F A;  1FO5 A;  1CQH A;  2VL9 A;  3EYT A;  1PX7 A;  3ED3 A;  3GX0 A;  4F9Z A;  4MZB A;  3MIX A;  4MAB A;  4I2U A;  2R0P A;  3IXR A;  4TOP A;  1SKS B;  1QK8 A;  3QD9 A;  3J7Y b;  4XS4 A;  5IPH A;  7GSS A;  5GZZ B;  1LU4 A;  1TI3 A;  3U5R E;  5B7C A;  1TRS A;  4WBR D;  3ERF A;  3GIX A;  4Q5F A;  2JZR A;  4PXO A;  5BMU A;  5KN2 A;  4CDO A;  3VK9 A;  1XW5 A;  4GSN A;  1PRX A;  1Y25 A;  1TTZ A;  4KE3 A;  5IMV A;  3JCM L;  3C73 A;  3ZLP A;  1V9W A;  1EGO A;  4KDY A;  1F37 A;  4NAX A;  1JLV A;  1BED A;  2K8S A;  1SJI A;  2DC5 A;  1XW6 A;  2VM2 A;  4HUA A;  4WKW A;  5GST A;  3H79 A;  1U3I A;  2C0E A;  2GS3 A;  2M46 A;  5ECH B;  3MNG A;  4K0N A;  3TOU A;  1FOH A;  2KP1 A;  4RUV A;  3D5J A;  5IMD A;  5DAL B;  4E8E A;  1B4P A;  4HQS A;  1UC7 A;  3KGK A;  3WGX A;  2IMF A;  1JLW A;  4L0U A;  3TUE A;  3FK8 A;  1Z6N A;  1RW1 A;  3RDW A;  1B8X A;  4GF0 A;  3QCP A;  2C8U A;  3TKP A;  1TRV A;  1ZOF A;  4ZB8 A;  2MMZ A;  4IBP A;  2FWE A;  2B5X A;  1ZYE A;  3CTG A;  2I81 A;  1IYH A;  4DSS B;  1GH2 A;  3CTF A;  3GKK A;  2HRF A;  1OE7 A;  4IGJ A;  3LEF A;  3ZIV A;  3CRU A;  2FY6 A;  5B8A A;  3RBT A;  3DD3 A;  2OKA A;  3E9J B;  5ID2 A;  4TR3 A;  1LJR A;  3KH7 A;  3F6F A;  3APQ A;  4L5L A;  2IN3 A;  2IPA A;  4CY6 A;  1OYJ A;  4F0C A;  1SK2 A;  1SD8 A;  1USB A;  4K1F A;  1QUW A;  2DIZ A;  2M80 A;  3GUR A;  3C8E A;  2CZ2 A;  2DMM A;  5AIV A;  2GQM A;  3F3Q A;  12GS A;  4P3Y B;  1EEM A;  1GWC A;  2REM A;  3DWV A;  1EOH A;  4AGS A;  4I8B A;  3C71 A;  2H75 A;  2R37 A;  3EUR A;  2H1G A;  2O85 A;  3M1G A;  1KNG A;  3L9S A;  2H73 A;  3DGQ A;  1SU9 A;  4MJB A;  3FZ5 A;  1JZD A;  4GRF A;  3IAM 2;  3FHK A;  5BRT A;  4MA9 A;  4MNN A;  4IHU A;  5J9B A;  1SL0 B;  4F03 A;  4IKH A;  2Z9S A;  4KGI A;  1EGR A;  4EDY A;  2YN1 A;  1O7U A;  1SKW B;  4G2E A;  3LYP A;  2KLX A;  2X8H A;  2E2G A;  4FQU A;  2H01 A;  3VWV A;  1AW9 A;  5F0G A;  2YV7 A;  3TRQ A;  4WXT A;  2HZE A;  1A0R P;  4J57 E;  3N9J A;  1WPI A;  5COH A;  3D21 A;  4EF0 A;  3QFA C;  1TJD A;  1T8E B;  6GSY A;  3FZ4 A;  3M3M A;  2VL3 A;  3O76 A;  5D9X A;  4KX4 A;  2HI7 A;  5KN3 A;  1THX A;  2LRN A;  1ZGN A;  2LRC A;  3TKQ A;  2P5R A;  3NIV A;  2AB6 A;  4XHM A;  4TR1 B;  1X5E A;  19GS A;  1R26 A;  1N2A A;  2IMD A;  3FR9 A;  1K3Y A;  1FHE A;  2WRT A;  3DIE A;  3ZZX A;  2E0Q A;  2PMT A;  3FRC A;  4HDE A;  2JAD A;  4NPB A;  3NZN A;  1GUM A;  1PKW A;  2PPT A;  1K0A A;  4KAE A;  1TRW A;  4OCE A;  3KH9 A;  4G0L A;  3KTL A;  4K5R A;  3CSI A;  5J5N A;  1FAA A;  1ZL9 A;  4MJC A;  4IQ1 A;  1AAZ A;  2VLV A;  5JWQ B;  4TR0 A;  2K8V A;  3P90 A;  2OE3 A;  2PWJ A;  1XWG A;  2H72 A;  3VWX A;  3M0F A;  2HSH A;  4ILF A;  1EP7 A;  3TDG A;  4EVM A;  3W8S A;  2FWF A;  2WCI A;  1X5D A;  5B8B A;  3LW9 A;  4ZBB A;  4OFN A;  2VOC A;  2O89 A;  2VL2 C;  2VD1 A;  4MH3 A;  1R5A A;  3A5W A;  2L57 A;  2AUV A;  4Z7X A;  1SD9 A;  4WF5 A;  2GLR A;  3DEX A;  4TN8 A;  4JR6 A;  2NPB A;  2DJ1 A;  2XPD A;  1ERU A;  4BL7 A;  1AQX A;  3CYN A;  3UAR A;  4K5S A;  4O5Q A;  4ECB A;  2YWN A;  3D22 A;  1GTI A;  3Q74 A;  4ZXG A;  1WRY A;  2HSM A;  2RM5 A;  1K3L A;  4QQ7 A;  2WZ9 A;  1GUL A;  1ZMA A;  3VWW A;  2JZT A;  1SJ6 A;  2LST A;  3GKN A;  3L4N A;  1XCC A;  2C1Y A;  2MYG A;  2EIQ A;  4NMU A;  1MDJ A;  1BQ7 A;  1GSU A;  2B5E A;  2YJ7 A;  3QAV A;  1NM3 A;  3QMX A;  2A4H A;  3TJG A;  2YAN A;  3IBH A;  3LOR A;  1BAY A;  1PKZ A;  2WUL A;  1PD2 1;  3VPT A;  1B9Y C;  1GTU A;  2FA8 A;  2LS5 A;  3KMN A;  4EDZ A;  5DAK A;  4YH2 A;  4WEY A;  3TJK A;  1Y6E A;  1GSS A;  22GS A;  3P7X A;  2IJY A;  6GSV A;  2K18 A;  1TRU A;  2DKH A;  3HD5 A;  2L4C A;  4BVY B;  1T3B A;  4BVX B;  1MD3 A;  1R7H A;  1THO A;  2GZZ A;  4LMW A;  3MSZ A;  2O8V B;  3P8W A;  1S3C A;  5IPG A;  3CSJ A;  4XTS A;  5DCH A;  2QC7 A;  3G7J A;  4N11 A;  3F63 A;  1TP9 A;  3DVX A;  1OC8 A;  2BTO T;  1F2E A;  2DJ2 A;  2HRN A;  4L5O A;  1OKT A;  4HJM A;  2K6V A;  2XPE A;  1A2J A;  2GVP A;  5ECI B;  1BJX A;  1TK0 B;  1A23 A;  5G5E A;  5JWO B;  2J23 A;  4Q5N A;  2JAC A;  3RAZ A;  5DVB A;  6GSX A;  1YKC A;  5J9C A;  4XS4 B;  5ECQ B;  2RM6 A;  5IOW A;  3LQ7 A;  3IR4 A;  9GSS A;  1YEX A;  1HD2 A;  2PU9 C;  3IHQ A;  1GSE A;  2L5L A;  5D96 A;  3KP8 A;  3D4T A;  1JZR A;  4HQZ A;  2HRK A;  5DJL A;  2E7P A;  2OE0 A;  2TRX A;  1ST9 A;  3N5O A;  2H19 A;  4G0K A;  2DML A;  2NTO A;  4PTS A;  3VI5 A;  2OBK A;  1ABA A;  4XIH A;  3E0U A;  1T4Y A;  1AUC A;  2B6M A;  3ME8 A;  1QMV A;  1KTE A;  5B6M A;  2PVO C;  1O6J A;  2V6K A;  1SK1 A;  2LUS A;  4ZBA A;  2A2P A;  4GSS A;  3VPQ A;  5DBQ A;  4ECC A;  3HDC A;  1XIY A;  4PUF C;  1G0T A;  2CQ9 A;  1YDK A;  2X49 A;  3PR8 A;  3US3 A;  1U88 A;  4LL1 B;  3F6D A;  3ZVJ D;  3D4M A;  2WGR A;  1NW2 A;  3UMA A;  1M0U A;  3QOU A;  3ZML A;  3MAK A;  3ZFB A;  2F8F A;  4RI7 A;  2VCW A;  2A4V A;  3KP9 A;  2N5B A;  2CX4 A;  3EIN A;  2A2R A;  2WFC A;  6GSU A;  2AHE A;  2VL2 A;  1XBS A;  3BJ5 A;  5C00 A;  1K3O A;  4JU5 A;  3FKF A;  4V1A g;  4GLT A;  2P31 A;  2OJL A;  1OC9 A;  2GQL A;  4ID0 A;  1V58 A;  1FG4 A;  2VO4 A;  13GS A;  3FZA A;  4BA7 A;  4FYB A;  3WGD A;  1WJK A;  2MMO A;  4Z2U A;  1MTC A;  4CY8 A;  2LKU A;  3IRA A;  5ID2 B;  5A4W A;  1AIU A;  3I6A A;  3VI7 A;  6GSW A;  1Z7R A;  2IWT A;  1GSY A;  1VF3 A;  3VLN A;  3UBK A;  3GKX A;  4K7O A;  4FYC A;  3RPP A;  2E2M A;  2V32 A;  3IPZ A;  4HU9 A;  1M7T A;  11GS A;  1YF0 A;  2CT6 A;  2OAD A;  3ZIJ A;  2XHF A;  2G2Q A;  5KN1 A;  3A2W A;  4PQ1 A;  4PQI A;  2X64 A;  3MWH A;  1XWC A;  3PIN A;  5FT3 A;  3V1W A;  4G0I A;  2DJK A;  5CNW A;  2DJJ A;  2ON5 A;  1S3D A;  1SK0 A;  2YV9 A;  1DE1 A;  1W89 A;  1XVQ A;  1H4O A;  4K0G A;  5ECN B;  2V1M A;  2JSZ A;  2MBS A;  3TKR A;  2AYT A;  1GLQ A;  3ZYW A;  4DSQ A;  1V40 A;  1XW9 A;  3APS A;  2WB9 A;  4DVC A;  4KF9 A;  3CMI A;  1M9B A;  3TRP A;  2HZF A;  2LQQ A;  1URM A;  4KB3 A;  3VFI A;  4KND A;  2YPM A;  2DJ0 A;  2LNS A;  1R4W A;  3HJP A;  4GQF A;  3M8N A;  3A2X A;  4MLY A;  2IFQ A;  2NBS A;  4N10 A;  1AXD A;  2H1B A;  3GTU A;  5DCG A;  5CYY A;  3GX8 A;  4I2T A;  2QA2 A;  2R6K A;  2HZE B;  1GUH A;  3UBL A;  1ZYP A;  3APO A;  3GN3 A;  1B4Q A;  5D9T A;  3MYD A;  3CBU A;  2I3Y A;  1E6B A;  2B5Y A;  1YJ6 A;  1IYI A;  2R3X A;  2LJR A;  3UJ1 A;  5ECL B;  2H71 A;  2ALB A;  2R2J A;  2MMN A;  4POB A;  2L59 A;  4MMM A;  4KUN A;  1X5C A;  2GST A;  4YQV A;  5HR0 A;  2HRA A;  5JCU A;  5D9V A;  5ECM B;  3LYK A;  3R2Q A;  2LRT A;  4PUR A;  4ML1 A;  1O8X A;  4X1U A;  1I9D A;  17GS A;  1TKD B;  2F9S A;  1KEB A;  2IME A;  5ECO B;  2C3T A;  3F4T A;  3HY2 A;  4WR4 A;  2D2Z A;  1O8W A;  2ON7 A;  4G9H A;  4TXO A;  2HYX A;  3GL3 A;  4ZL9 A;  5IMF A;  4A5P A;  4LL4 B;  1ILO A;  5KOW A;  3L0H A;  1QFN A;  2HNL A;  4CW9 A;  1QGV A;  3H1N A;  4OCF A;  5HR1 A;  3QPM A;  3TKS E;  3KMO A;  3TJF A;  1TK8 B;  1H75 A;  5G2Z A;  1OE8 A;  3OR5 A;  3LGC A;  4MCU A;  3ERW A;  3IK9 A;  4AF2 A;  5GAP D;  4JED A;  1YF1 A;  4BL7 B;  2K9F A;  4F0B A;  2GDR A;  3U6V A;  3ERG A;  4XRA A;  3QR6 A;  5DJM A;  2FGX A;  2GZY A;  3QAG A;  4GWR A;  3I43 A;  3LJR A;  2OAC A;  5EPF A;  1MD4 A;  2X4A A;  3PH9 A;  5B6N A;  4K2D A;  1EP8 A;  4HI7 A;  1G7O A;  3HJM A;  3HZ4 A;  2I9H A;  2VLU A;  4IN0 A;  3GH9 A;  3LG6 A;  1WOU A;  3CSH A;  5D9W A;  1PL2 A;  4ZB6 A;  1ZYQ B;  3GL5 A;  4K7I A;  4IS0 A;  5ECR B;  1ZYN A;  3ME7 A;  4MPF A;  3H4K A;  5DAK B;  5JWR B;  2FCH A;  2YWI A;  3HYP A;  5EVO A;  1G6Y A;  2O87 A;  4O7H A;  1DSB A;  3IA1 A;  1BYE A;  4HOJ A;  2GZP A;  2H6X A;  2P0G A;  3AY8 A;  1YY7 A;  1WP0 A;  2LNT A;  3IV4 A;  1X9M B;  3R3E A;  3RHC A;  4NHZ A;  3ZRD A;  5J41 A;  5CP1 A;  2QKE A;  1Z6M A;  1U87 A;  1O85 A;  4G10 A;  4IVF A;  5D8I A;  1AQV A;  3ZFL A;  1MEK A;  4IQA A;  3NOF A;  2F8A A;  1N8J A;  3IC8 A;  3WT2 A;  4V2L A;  2B1L A;  3QAW A;  3UAP A;  5IMA A;  3L9V A;  2VM1 A;  3GV1 A;  4L0W A;  2RUE A;  1EOG A;  2UZ8 A;  4N0V A;  3TJJ A;  4PQH A;  1K0B A;  1OVN A;  2VCX A;  4WR5 A;  5FHI A;  1XZO A;  3K8N A;  4I5Q A;  2C0D A;  4FH8 A;  1V57 A;  3WYW A;  4NHW A;  1GTA A;  2YP6 A;  1JFU A;  2I4A A;  4GXZ A;  2VLT A;  4EKZ A;  3GFK A;  1J0F A;  1FB0 A;  1FW1 A;  4IP6 A;  3TJB A;  2EIR A;  1ML6 A;  1PN0 A;  4EUY A;  3C7M A;  2IMI A;  3E3E A;  3M9J A;  4DSR A;  1GNW A;  4ZBD A;  4MH2 A;  1XFL A;  1M99 A;  1F6M C;  4WBJ A;  4MZW A;  1G6W A;  3GKM A;  1GSQ A;  4EXJ A;  1JHB A;  1NSW A;  3KJY A;  2B7K A;  5LNK e;  2R0C A;  1WWJ A;  4RI6 A;  2H30 A;  2XBI A;  2FWH A;  3A2V A;  3TKS C;  2H0I A;  3M9K A;  1GTB A;  1B9X C;  1A8Y A;  1TU8 A;  2VIM A;  4MK3 A;  1UA5 A;  8GSS A;  2QA1 A;  4X0X A;  3EC3 A;  1T7P B;  2ES7 A;  3KXO A;  5CRE A;  2RII A;  4K2X A;  2YWO A;  1A2M A;  5AGY A;  2DKI A;  2LJA A;  2VCQ A;  3ZVJ A;  1PN9 A;  1PX6 A;  2N5A A;  1VRS D;  2YJH A;  5HFG A;  5H5S A;  1TU7 A;  4JR4 A;  2FNO A;  2R0G A;  1GUK A;  1O81 A;  1GP1 A;  1YKA A;  2DLX A;  2BMX A;  2PN8 A;  5D73 A;  2YCD A;  1VF4 A;  4PUA A;  4OFM A;  3ZTL A;  4POK A;  3HVX A;  5ECP B;  4GTU A;  5LD0 A;  4LLR A;  4EC0 A;  1OC9 B;  3GSS A;  1V98 A;  3IAS 2;  4V2M A;  3HCZ A;  2H76 A;  2H1D A;  1JZO A;  3LXZ A;  1PMT A;  4KH7 A;  1AC1 A;  2X8C A;  2HFD A;  3IOS A;  3UEM A;  3CXG A;  5EY6 A;  1PQN A;  2LTK A;  4X43 A;  2LQO A;  3TOT A;  1EZK A;  5CRH A;  3IE3 A;  18GS A;  4PNF A;  2DBC A;  2NVL A;  5HFI A;  5FWG A;  1X9W B;  5IM9 A;  1DBY A;  5ECS A;  4QL7 A;  1SYR A;  5G30 A;  2WS2 A;  3HZ8 A;  4MJE A;  5ELG A;  3O6T A;  3GYK A;  4TRX A;  2KHP A;  3WGE A;  2YOI A;  2EC4 A;  1J08 A;  3GRX A;  2G0F A;  4EE0 A;  1E2Y A;  4IEL A;  2B3S A;  4HEA 2;  1CQG A;  4L8E A;  2H74 A;  2L4Q A;  3FEU A;  2HXK A;  1VF1 A;  3DYR A;  2CAI A;  4X4J A;  3Q6O A;  1I5G A;  1K0M A;  1Q98 A;  2LV3 A;  2YNX A;  1TK5 B;  4D73 A;  5IQY A;  1JZW A;  1ON4 A;  1Z5Y E;  3EMP A;  2WJU A;  3C1R A;  3F4S A;  3DXB A;  4LA1 A;  5DDL A;  1SL1 B;  2PUK C;  4NV5 A;  3H8Q A;  4MJA A;  3EE2 A;  2DSA A;  3UOM A;  2N5F A;  3DVW A;  4HZ2 A;  4ACS A;  5ABR A;  3G7I A;  4TW5 A;  4Q5R A;  6GST A;  4XRD A;  2IMK A;  4K9Z A;  3H93 A;  2VUP A;  2PVQ A;  1M9A A;  3DRN A;  1XWB A;  2IL3 A;  4KDU A;  3HXS A;  5D93 A;  1FOV A;  1WMJ A;  3O3T A;  4AJ6 A;  4V2N A;  1QXH A;  5IIZ A;  4WF4 A;  2TIR A;  1XOB A;  4EO3 A;  1Z9H A;  3SBC A;  5G5F A;  2JU5 A;  2CA8 A;  1VGL A;  2C3N A;  2V2G A;  2JSY A;  5CO3 A;  4TKY A;  4MF5 A;  3LSZ A;  3FYG A;  5HQP A;  4ML6 A;  4PGT A;  2C0F A;  4H86 A;  3IHG A;  1RK4 A;  2MBT A;  2YZU A;  2MMA A;  2QGV A;  4Z2T A;  3F0I A;  4ZL7 A;  2V41 A;  1J9B A;  1BG5 A;  4TXO B;  1SJZ A;  1TI1 A;  4O5R A;  3TKS A;  20GS A;  1U6T A;  2KOK A;  5G1L A;  1KBN A;  4OWY A;  4OFT A;  4MF6 A;  2CV4 A;  3FR6 A;  2GTU A;  3LFL A;  4YQM A;  2M72 A;  1FB6 A;  3A5I A;  3QDN A;  1F9M A;  2DIY A;  4AJ8 A;  5KEJ A;  4O92 A;  2ZCT A;  1M2D A;  1K0N A;  3ZIT A;  2EIO A;  2HE3 A;  1ERT A;  3C1S A;  3GH6 A;  3RHB A;  3RPN A;  3BBY A;  2R4V A;  4POL A;  4Q5Q A;  2IIY A;  5AN1 A;  4EL1 A;  2MZC A;  3WT1 A;  1Q4J A;  5ELA A;  1F3B A;  3VUR A;  1SL2 B;  3HKR A;  4FIW A;  1TW9 A;  1TDI A;  3EVI A;  2A2S A;  1S3A A;  1DUG A;  2V6O A;  2OA7 A;  1EWX A;  5JCG A;  2CZ3 A;  3Q19 A;  2I1U A;  4BWQ A;  2L5O A;  2OBI A;  4EIP A;  3GA4 A;  3UVH A;  3FZ9 A;  1XOA A;  4G19 A;  4XS6 A;  4QL9 A;  2HLS A;  4E8H A;  2CVK A;  3KD0 A;  5IMC A;  5GSS A;  3D0Z A;  1RQM A;  1HYU A;  3ISO A;  4ECJ A;  3FR3 A;  4F2I A;  4KW6 A;  3LXT A;  2FUG 2;  1EV4 A;  1K0C A;  4F82 A;  2H0H A;  2BJX A;  5KOX A;  5J4U A;  2OE1 A;  1M2A A;  1R5P A;  5DQY A;  4JZQ A;  5E4W A;  5DAL A;  3KEB A;  4KSO A;  5G31 A;  2FHE A;  2CX3 A;  1F3A A;  3F3R A;  3W6G A;  2B1K A;  2C80 A;  5CAX A;  3QFB C;  4N30 A;  2F3M A;  4I6X A;  6GSS A;  1HNC A;  4MDC A;  2GQK A;  2TRC P;  3DML A;  3VWU A;  4ICY A;  1NHO A;  2LEG A;  1X9S B;  4ZIJ A;  1A2L A;  4FO5 A;  2AJQ B;  2JZS A;  3TRX A;  1A0F A;  5LCZ A;  2FLS A;  1EEJ A;  1XPV A;  3ZRE A;  3HA9 A;  4KSM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...