1SL2B

Ternary 5' complex of t7 dna polymerase with a dna primer/template containing a cis-syn thymine dimer on the template and an incoming nucleotide
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
105
structure length
105
Chain Sequence
b'KIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*CP*GP*AP*AP*AP*AP*CP*GP*AP*CP*GP*GP*CP*CP*AP*GP*TP*GP*
publication title Nucleotide insertion opposite a cis-syn thymine dimer by a replicative DNA polymerase from bacteriophage T7.
pubmed doi rcsb
source organism Enterobacteria phage t7
molecule tags Transferase/electron transport/dna
total genus 28
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2004-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1sl2B00
2HT9A 1PSQA 3KCMA 1MDKA 2MMOA 4EE0A 1FHEA 1U88A 3FZ5A 4OWYA 16GSA 2PGTA 2EIRA 4MZWA 3BCIA 1B9YC 2FCHA 1PGTA 3QAWA 3WYWA 1EEMA 2FY6A 2GLRA 1OE8A 1EEJA 2X64A 4NHZA 2A2RA 4ML6A 5EL8A 3QFBC 2H6YA 3ME8A 1ON4A 4KDXA 4LMVA 2H73A 2R6KA 1FOVA 4L5OA 4TXOB 2GQMA 3GV1A 12GSA 4MK3A 3RHCA 2PWJA 2I4AA 2H66A 3IAS2 2V41A 2R2JA 3VWWA 2KLXA 1TXXA 4DEJA 3HKRA 2N5AA 1PN9A 1AAZA 5JWOB 3UVTA 3WGXA 1SJZA 2EIOA 3F9UA 4ECCA 3FW2A 8GSSA 1VGLA 2WFCA 2H75A 3J7Yk 3C1SA 4ZXGA 3TGZA 5J5NA 2E0QA 1SK0A 2B1LA 1Q98A 1TJDA 4OFNA 5ECQB 4MF5A 3M1GA 4ECJA 1JFUA 1T4YA 4V2LA 1GULA 4LLRA 2DSAA 2LRCA 2GTUA 5G1LA 1TRUA 1GUHA 2LNSA 3LORA 1O73A 3V1WA 1SKRB 1XW5A 1VF1A 2J9HA 2RIIA 1OE7A 1J9BA 2C0DA 1EOHA 3HVVA 3GA4A 3VFIA 2D2ZA 4F0CA 2N5FA 2X8CA 2LEGA 4MCUA 2JSYA 2ON5A 4F2IA 4ZL8A 3H4KA 2LSTA 3VWVA 5E59A 2H6XA 4OCEA 1XWBA 2PPTA 1PRXA 5IPGA 1X5DA 3ZREA 2O85A 5HFIA 5DJLA 2WDUA 1G0TA 2HSYA 1OKDA 1H75A 1A24A 5ECSA 3GSTA 2YNXA 2JZSA 4OFMA 1U3AA 1M2AA 4ILFA 1YF0A 3IK7A 3IDVA 4XHMA 2YWNA 5ID2B 2ON7A 3E3EA 1MEKA 2WS2A 3E9JB 5IOWA 2IFQA 4KA0A 22GSA 1SENA 1YF1A 4YAVA 4XS6A 1M9BA 1XIYA 1GNEA 2H76A 3SWLA 2EC4A 2X8GA 4V2NA 3G7YA 1XW6A 2JL4A 3KMOA 2CQ9A 4F82A 3H1NA 1LU4A 2I3YA 3IAM2 1JHBA 4MLYA 4N0ZA 5D9XA 3I43A 4FO5A 1UA5A 2JZTA 4OFTA 4PURA 2CX4A 1TI3A 4TR4A 1BQ7A 1XXUA 3L4NA 3LSZA 4HU7A 5F0GA 1F37A 1URMA 4NPBA 3A2WA 3O76A 11GSA 2CV4A 2L4QA 5GSTA 19GSA 1ZOFA 4V1Ap 5IMZA 3MWHA 1ZCPA 4PGTA 4JE1A 4CHSA 1KTEA 1A2MA 5AGYA 3KD0A 5B7CA 1O8XA 4ULXA 3QR6A 2KP1A 3M8NA 1JZDA 3BJ5A 5GSSA 3GFKA 1NM3A 2MBSA 3EU4A 1X5CA 4KUNA 1VF2A 1V40A 1QMVA 4EDZA 3GKXA 4Q5FA 3HVXA 2H6ZA 3DGQA 5DVBA 1B8XA 4TR3A 2CVKA 1EZKA 1ZL9A 2OE1A 3VWXA 5J41A 1TTZA 1RW1A 3GHAA 5J9BA 1XBSA 2DIZA 3RPPA 3W8JA 5ELGA 3RHBA 2GSTA 3F8UA 4FIWA 1NSWA 3TJBA 4FYUA 6GSWA 1ERTA 2C1YA 2NVLA 3ISOA 1YY7A 4K7NA 4ZBBA 2DJ0A 4WKWA 1QK8A 4EDYA 4IQAA 6GSUA 1U3IA 3CRUA 4JBBA 1Z6MA 3EURA 5L71A 2K18A 3IK9A 3ZITA 1HNCA 3IRAA 3HDCA 2GS3A 1ZYQB 5CP1A 4XCSA 2FWEA 4HOJA 5DAKB 3HD5A 4AJ7A 5DAKA 5G1KA 3Q74A 1XWAA 1TRSA 4I6XA 1NW2A 5IMVA 4X1UA 5EY6A 1X9WB 3Q6OA 2CT6A 3CXGA 3LYPA 3O6TA 3F3QA 1F3BA 2FLSA 1XVQA 2O8VB 1OC8A 2BMXA 3C73A 4PUAA 1GUMA 5DALA 1RK4A 5D73A 1SK2A 4I8BA 1KBNA 2HNLA 3QD9A 1A8LA 1N8JA 1K3LA 3CRTA 2YJHA 1SD8A 3F0IA 2LNTA 3HHVA 2C3QA 1X0RA 1GLPA 3A2VA 3DWVA 1X9SB 5ECRB 3F4RA 3ME7A 3L9UA 3TKQA 2IMIA 2KOKA 3WT2A 2C4JA 6GSSA 2H0GA 1HNAA 4DSRA 1G7OA 4MA9A 4TKYA 2RM5A 4NWYA 1MDIA 4AJ6A 6GSYA 3QFAC 3WD6A 2V6OA 2VOCA 3M3MA 2R37A 1MDJA 1UN2A 4Q5RA 4EF0A 1UC7A 3P2AA 1SJ6A 1GSUA 1GNWA 2V32A 1GWCA 4F9ZA 1XCCA 5KN0A 3UJ1A 3C1RA 3F63A 3KGKA 3QAGA 1M99A 2R5GA 1AC1A 3ZFLA 5F06A 2F8AA 4PQHA 4PQIA 5JCUA 1KEBA 1TDIA 1GUKA 4K6XA 4BVYA 3ZRDA 1Z5YE 4IP1A 1GRXA 4BWQA 4WR4A 1PD21 2H0IA 2OE0A 3TRXA 5CRGA 1SJIA 4BWSA 2QSIA 2VD1A 4RI7A 1T1VA 4ZB6A 2CAQA 3HJOA 1GSYA 3M9KA 4WXTA 4ML1A 3FYGA 4G9HA 2R3XA 1XWCA 3FR6A 4K2DA 3VK9A 1V58A 5D96A 3PH9A 4G19A 4GCIA 4MJBA 2REMA 2CZ2A 2LQQA 4X43A 2GZZA 5AISA 1FB6A 2VL9A 3UVHA 1Q4JA 4EXJA 4GSNA 4MDCA 2OBIA 4I2TA 3CSIA 1XWKA 1GTIA 3IA1A 1DBYA 5B6MA 3IHQA 4FH8A 4GQFA 3LGCA 3A2XA 2DMLA 1XZOA 4NAXA 4XS1A 2X99A 1O81A 2B3SA 1YDKA 3UIWA 2IJYA 3QDNA 1GSDA 4RUVA 2QKEA 4XS4B 4XS4A 4ISDA 2ZCTA 3D5JA 3FR9A 3IBHA 3L9SA 1X5EA 1SK1A 2AB6A 3D4TA 3I6AA 3NZNA 3TRPA 2VL2A 3GKMA 2NBSA 4Q5QA 3WGDA 2L4CA 3G7JA 5A4WA 2DIYA 1B48A 3DIEA 1EWXA 1QXHA 1Z9HA 3F6FA 2MMZA 2VCZA 3KTBA 3C7MA 1F9MA 1YZXA 6GSVA 2VD0A 1F6MC 2H74A 1WOUA 3CMIA 1PQNA 3VPTA 3LWAA 2PERA 4MMMA 3D4MA 2YV9A 2HI7A 5ECOB 3D6IA 4IS0A 3GKKA 2GSSA 3TUEA 4TVEA 2YANA 4HS1A 2VCXA 2VO4A 2F3MA 1R5PA 4OCFA 5F05A 4TXOA 3D22A 5KN1A 2HYXA 4IN0A 2C3TA 1FW1A 2NTOA 3BD2A 5IO2A 4IHUA 1ERWA 4MP4A 5FWGA 3BCKA 2X8HA 3EYTA 3UAPA 1M2BA 2CX3A 4NMUA 2H8LA 5G30A 2DBCA 3ZMLA 1TKDB 1Y25A 3TDGA 2LRTA 5H5SA 1ABAA 5H5RA 3UEMA 3SBCA 3ZFBA 1BG5A 1AXDA 5IMAA 2Z9SA 2LJKA 5IMFA 2GGTA 1WRYA 2B5YA 4J57E 2VLUA 1I9DA 3HYPA 1X9MB 2OKAA 1PKZA 3DD3A 2VM2A 4XRAA 3W6GA 1JZWA 4F03A 2RLIA 1K0NA 4GXZA 1AQWA 1WP0A 5CRHA 2HZEB 2HZFA 4KB3A 4KH7A 2P31A 3E0UA 4POBA 1THXA 3OR5A 3Q19A 4ZB8A 4NV2A 3CTGA 4K8MA 2DJ3A 2E2GA 2R4VA 3R2QA 3EINA 1FVKA 1HNBA 4EL1A 4YQMA 4DSSB 3EWLA 1F3AA 4DSSA 2LJRA 13GSA 1M7TA 2HLSA 3APSA 4O7HA 1ST9A 1XW9A 2XBQA 4IJIA 1A0FA 1F2EA 1DSBA 1GSQA 4WR5A 3UMAA 2B7JA 1K0CA 3C8EA 2RUFA 4IW9A 2B7KA 3N5OA 5IQYA 4P3YB 1FAAA 2IL3A 2WULA 5DCHA 2B6MA 3DVWA 3ZVJA 2IMEA 1B4QA 4NXIA 1GP1A 3TKRA 4AF2A 1G6YA 2IPAA 2HXKA 5ID2A 2MZCA 2I9HA 1LBKA 2E7PA 3KMNA 2H71A 4G2EA 3FRCA 3UL3A 2DMMA 2WCIA 4WEYA 5FT3A 1MD3A 4OMVA 1K0DA 3ERFA 1TU8A 3F4SA 5JWQB 4ZL7A 3ZIVA 3KP8A 2IMFA 4MF7A 1WPIA 4EC0A 5D93A 2TRCP 4HU9A 2HFDA 5JCGA 5DQYA 2K9FA 3F6DA 2H1DA 5HFKA 3MDKA 2V6KA 4EVMA 3KTLA 1A8YA 5ECNB 5B8BA 2K8VA 4I5QA 1HD2A 2FD3A 3A5WA 2JADA 4XIHA 3RAZA 3GYKA 2YCDA 4I2UA 4JR6A 2L59A 1CQHA 5ECLB 2GT6A 4ECIA 4JRRA 3GN3A 3GTUB 2L6CA 1HQOA 1VF3A 9GSSA 1A23A 3FKFA 3NIVA 2GQLA 2KUCA 1TK0B 3ERWA 2DC5A 1UVZA 4HJMA 2LV3A 3F4TA 5CNWA 3PGTA 1U87A 2GQKA 2C80A 3Q18A 4V2MA 4GRFA 3TJJA 7GSSA 1WMJA 1E2YA 3CBUA 1EP7A 4KW6A 2OACA 3FZ9A 4ZBAA 4EO3A 2K6VA 3IR4A 2YZUA 2VUPA 3KH7A 1SU9A 3GX8A 4L0UA 4IJ3A 1Z6NA 3TKSC 2VL3A 1TK5B 2OJLA 5A4VA 4O32A 4CDOA 3TJKA 1RQMA 3D21A 1OC3A 1EV9A 3NOFA 4KAEA 2AUVA 4WBRD 2JZRA 4TRXA 2F8FA 1TU7A 3FK8A 1GSEA 1VF4A 5F8BA 1WIKA 2HE3A 3BBYA 3RPNA 4HEA2 5G2ZA 5ECIB 2PVQA 3HVSA 3HA9A 1C72A 1YJ6A 4BA7A 2L5LA 4WETA 4ZB9A 1G6WA 1TOFA 3LFLA 4JEDA 3TRQA 2C0FA 1ERVA 3EU3A 5ECPB 5KN2A 1K0MA 3ZZXA 4IQ1A 3KEBA 5B6NA 1CQGA 4IKHA 3VLNA 2NPBA 5J9CA 1R5AA 2KHPA 3I9V2 4MH3A 3EMPA 4PNFA 4GSSA 1DE2A 4BL7A 5EVOA 3KZQA 1AQVA 1HYUA 2GDRA 4NHWA 5DCGA 4PQ1A 4ECBA 2FGXA 1YKAA 4O92A 20GSA 3O3TA 5KN3A 5H5QA 4V1Ag 2H72A 2C8UA 4EUYA 3VURA 3L0HA 1GSFA 2I81A 2P5RA 2YWOA 2B5XA 1Z3EA 1Y6EA 3MSZA 3TJGA 2DJ1A 3GH9A 3EC3A 3VPQA 3CYNA 1JZOA 2JU5A 5EPFA 1R7HA 4AGSA 1SYRA 2J23A 2CAIA 3MNGA 1T8EB 5INYA 4WF4A 5D8IA 5LD0A 4KCEA 2LS5A 4ID0A 4MJEA 2OBKA 4ZBDA 2EIQA 2OADA 2DJKA 2F51A 4TR0A 5IIZA 3DMLA 1BAYA 2GSRA 4TOPA 1M9AA 1JZRA 3ZMKA 5JWRB 2WJUA 2FWGA 1WE0A 1V98A 1BEDA 4L5LA 4FYBA 3K8NA 2MYGA 1GH2A 3ZLPA 1J08A 3DRNA 3QMXA 1XWGA 10GSA 1ILOA 2O89A 4YQUA 3L78A 3ERGA 1M0UA 3GL5A 3HZ8A 1ZMAA 3RDWA 1FVJA 4GWRA 3ZIJA 3TKSE 1S3CA 1V9WA 2YOIA 4QQ7A 3WGEA 2L57A 5IOXA 1YQ1A 4JZQA 1AQXA 1VRSD 2C3NA 3IPZA 2HRNA 1K0AA 2YZHA 1A2JA 3ZTLA 5ELAA 2JSZA 3TB2A 3AY8A 4YQVA 2ALBA 3GMFA 5D9VA 4MJCA 5KEJA 1AIUA 4LA1A 4KX4A 1R4WA 3KJYA 3P90A 4DSQA 2GT5A 2RUEA 6GSXA 4E8HA 1JLVA 2E2MA 2M46A 3GNJA 1T4ZA 1PKWA 3GSSA 4PX1A 3ZYWA 2VLTA 5DDLA 4MPFA 1QFNA 4CW9A 1SKWB 1DUGA 2XC2A 2C0EA 1EGOA 5ENUA 2V2GA 4BPYA 3LJRA 5DBQA 3ZL5A 1YEPA 4MZCA 3EMXA 4HJ2A 1XVWA 1T3BA 2P0GA 4IELA 3L9VA 3HCZA 1SL0B 1BJXA 2PN8A 3IC4A 2FA8A 3FY7A 4POMA 3H8QA 4K1FA 17GSA 3M9JA 2M80A 3IE3A 5AN1A 2ZUPA 3EE2A 1TRVA 3F3RA 2F9SA 1Z7RA 3GRXA 3HY2A 5IMDA 2O87A 4N10A 2YJ7A 3FHKA 4GTUA 2H1GA 4IBPA 2AV4A 5A5KA 2V1MA 2GSQA 1BX9A 2YN1A 4KDYA 2RM6A 5D9WA 3QOUA 3GUSA 1FO5A 1W89A 3KM6A 4KSMA 1G7EA 3GURA 2FA4A 4HQZA 5HR3A 3FZ4A 1K0OA 5IMCA 3KXOA 3KP9A 4PNGA 2PBJA 5CYYA 4YAPA 3IXRA 2IMDA 1OKTA 1SL2B 2YPMA 2VCVA 2GZPA 4ZL9A 5B8AA 2TIRA 3GL3A 3D0ZA 3APQA 3BOAA 3TJFA 1GLQA 2VCWA 3HJMA 4Q5NA 2HZEA 3ZVJD 4QL9A 4ZIJA 1PX7A 1XOBA 3QAVA 4WBJA 3TOUA 2LUSA 2YWMA 4OO5A 4POLA 4MF6A 2VCTA 1PL2A 4N11A 1B9XC 2GZYA 3A3TA 2QC7A 4XRDA 4PXOA 2H70A 1MTCA 4AJ8A 4ZILA 2G0FA 2AHEA 1USBA 2M72A 2VM1A 3DXBA 5C00A 2XHFA 1DE1A 5DQSA 1XOAA 3H79A 2LTKA 5CAXA 4TR1B 1PMTA 4TR1A 2FNOA 2P5QA 1R26A 14GSA 2CA8A 3MAKA 2FWFA 1XPVA 2HSHA 1JLWA 1W4VA 5GAPD 5HR2A 2ZNMA 1M2DA 3HJPA 1O6JA 1SL1B 4OO4A 2LQOA 2IFQB 4O5RA 4K0NA 1K3OA 2CVBA 3FZAA 5GZZB 4FYCA 2B1KA 1A2LA 2FWHA 2VLVA 3JCML 5G5FA 1FB0A 4ACSA 5AIXA 2MMNA 2YV7A 4QL7A 1S3AA 2DJJA 1SKSB 4D73B 4D73A 2IMKA 1TK8B 5CRWA 4E8EA 3EVIA 4N30A 3WT1A 2ES7A 3DVXA 5F07A 4K0GA 5LNKe 4IP6A 2YP6A 5FHIA 2H19A 4L8EA 2OA7A 4N0VA 1S3DA 2GVPA 3GTUA 3DYRA 1AUCA 4LL1B 4OD7A 4J56E 1BYEA 1T7PB 1TRWA 1NHOA 4K9ZA 1PX6A 1I5GA 5JCWA 4HQSA 4HZ4A 4KGIA 3LEFA 3PR8A 4JR4A 5DJMA 3UOMA 2H01A 3APOA 5CRDA 1YKCA 1QUWA 3I69A 2JACA 4L0WA 4WF5A 1V2AA 4TXVA 4YH2A 2NDOA 1SD9A 4Z7XA 4EKZA 5G31A 3GX0A 2AJQB 2DLXA 4TN8A 5A4UA 2FHEA 1U6TA 2VIMA 4MABA 4I97A 4K7IA 3W8SA 2AAWA 3TKPA 4PUFC 4KNDA 3US3A 1TP9A 1OAZA 3LG6A 4F0BA 1AW9A 3VWUA 3N9JA 3U6VA 4GSTA 4GQCA 1O7UA 2XPDA 5IO0A 4K7OA 4HDEA 3DKSA 3U5RE 3J7Yb 3GH6A 3UBLA 1MD4A 2A4VA 5ABRA 1QGVA 1O8WA 4KSOA 2LKUA 3C71A 5CO3A 1GTBA 1H4OA 5HQPA 4XTSA 3P8WA 2B5EA 2PU9C 2IWTA 2VL2C 3GIXA 1ZGNA 3RBTA 5ECKB 1ACVA 5G5EA 5J4UA 2QGVA 4LL4B 3LQ7A 1IYHA 4TW5A 3TOTA 1GL8A 5IPHA 4LMWA 3KH9A 3M0FA 4HUAA 2C0GA 5DALB 2DJ2A 3UARA 1XFLA 4H86A 4KCAA 5E4WA 5ECHB 1TW9A 3PINA 1K3YA 1LJRA 2AYTA 4RQXA 2HRFA 1ZZYA 1OC9B 2LJAA 3LXTA 1OC9A 1WWJA 3G7IA 1N2AA 3LYKA 4JU5A 1J0FA 1TI1A 3P7XA 2O7KA 4NV5A 3H93A 3G9BA 1GSSA 2IIYA 1T00A 1KNGA 4MH2A 1EGRA 3QPMA 1O85A 2PUKC 2OE3A 4IVFA 1B4PA 4BVXA 5HFGA 4J2FA 5LCZA 2WRTA 2CZ3A 2VCQA 4X0XA 3IOSA 3UBKA 1EOGA 1Z7PA 3CSHA 2H1AA 4HZ2A 1A0RP 2TRXA 4RI6A 5AIVA 3VI7A 5D9TA 5C04A 2BJXA 1FG4A 3HXSA 6GSTA 1PA3A 1SYXA 1ERUA 1ZYEA 2MBTA 1EP8A 2N5BA 3CTFA 1E6BA 3ED3A 2A2SA 2PVOC 5ECMB 3GKNA 2L6DA 4POKA 2FUG2 4RQRA 1ML6A 1OYJA 1K0BA 2YWIA 2VAFA 3TCOA 2MMAA 3S9FA 4G10A 5CREA 4GLTA 2I1UA 2L5OA 4GF0A 4MPGA 2G2QA 4DVCA 5COHA 18GSA 1PL1A 2KP2A 4MZBA 3QCPA 2K8SA 3HZ4A 4KDUA 3KIJA 1EV4A 3CSJA 1GTAA 2WGRA 1YEXA 2LRNA 2PMTA 5HR1A 1QQ2A 3TKSA 2IN3A 2H1BA 3VI5A 1THOA 1OVNA 2WB9A 2H0HA 3IV4A 2H30A 3FR3A 4HI7A 3DEXA 1NHYA 1WJKA 3FEUA 4KE3A 1IYIA 2XBIA 5GAND 1GTUA 3LXZA 2XPEA 5HR0A 4IGJA 5J3RA 2CVDA 2WZ9A 4MJAA 5IM9A 1V57A 2BTOT
chains in the Genus database with same CATH superfamily
2HT9A 1PSQA 3KCMA 1MDKA 2MMOA 4O5UA 4EE0A 1FHEA 1U88A 3FZ5A 4OWYA 16GSA 2PGTA 2EIRA 4MZWA 3BCIA 1B9YC 2FCHA 1PGTA 3QAWA 3WYWA 1EEMA 2FY6A 2GLRA 1OE8A 1EEJA 2X64A 4NHZA 2A2RA 4ML6A 5EL8A 3QFBC 2H6YA 3ME8A 1ON4A 4KDXA 4LMVA 2H73A 2R6KA 1FOVA 4USSA 4L5OA 4TXOB 2GQMA 3GV1A 12GSA 4MK3A 3RHCA 2PWJA 2I4AA 2H66A 3IAS2 2V41A 2R2JA 3VWWA 2KLXA 1TXXA 4G0KA 4DEJA 3HKRA 2N5AA 1PN9A 1AAZA 5JWOB 3UVTA 3WGXA 1SJZA 2EIOA 3F9UA 3MIXA 4ECCA 3FW2A 8GSSA 1VGLA 2WFCA 2H75A 3J7Yk 3C1SA 4ZXGA 3TGZA 5J5NA 2E0QA 1SK0A 2B1LA 1Q98A 1TJDA 4OFNA 5ECQB 4MF5A 3M1GA 4ECJA 1JFUA 1T4YA 4V2LA 1GULA 4LLRA 2DSAA 2LRCA 2GTUA 5G1LA 2A4HA 1TRUA 1GUHA 2DKIA 2LNSA 3LORA 1O73A 3V1WA 1SKRB 1XW5A 1VF1A 2J9HA 2RIIA 1OE7A 1J9BA 2C0DA 1EOHA 3HVVA 3GA4A 3VFIA 2D2ZA 4F0CA 2N5FA 2X8CA 2LEGA 4MCUA 4X4JA 2JSYA 2ON5A 4F2IA 4ZL8A 3H4KA 2LSTA 3VWVA 5E59A 2H6XA 4OCEA 1XWBA 2PPTA 1PRXA 5IPGA 1X5DA 3ZREA 2O85A 5HFIA 5DJLA 2WDUA 1G0TA 2HSYA 1OKDA 1H75A 1A24A 5ECSA 3GSTA 2YNXA 2JZSA 4OFMA 1U3AA 1M2AA 4ILFA 1YF0A 3IK7A 3IDVA 4XHMA 2YWNA 5ID2B 2ON7A 3E3EA 1MEKA 2WS2A 3E9JB 5IOWA 2IFQA 4KA0A 22GSA 1SENA 1YF1A 4YAVA 4XS6A 1M9BA 1XIYA 1GNEA 2H76A 3SWLA 2EC4A 2X8GA 4V2NA 3G7YA 1XW6A 2JL4A 3KMOA 2CQ9A 4F82A 3H1NA 1LU4A 2I3YA 3IAM2 1JHBA 4MLYA 4N0ZA 5D9XA 3I43A 3A5IA 4FO5A 1UA5A 2JZTA 4OFTA 4PURA 2CX4A 1TI3A 4TR4A 1BQ7A 1XXUA 3L4NA 3LSZA 4HU7A 2HRAA 5F0GA 1F37A 1URMA 4NPBA 3A2WA 3O76A 11GSA 2CV4A 2L4QA 5GSTA 19GSA 1ZOFA 1PFOA 4V1Ap 5IMZA 3MWHA 1ZCPA 4PGTA 4JE1A 4CHSA 1KTEA 1A2MA 5AGYA 3KD0A 5B7CA 1O8XA 4ULXA 3QR6A 2KP1A 3M8NA 1JZDA 3BJ5A 5GSSA 3GFKA 1NM3A 2MBSA 3EU4A 1X5CA 4KUNA 1VF2A 1V40A 1QMVA 4EDZA 3GKXA 4Q5FA 3HVXA 2H6ZA 3DGQA 5DVBA 1B8XA 4TR3A 2CVKA 1EZKA 1ZL9A 2OE1A 3VWXA 5J41A 1TTZA 1RW1A 3GHAA 5J9BA 1XBSA 2DIZA 3RPPA 3W8JA 5ELGA 3RHBA 2GSTA 3F8UA 4FIWA 1NSWA 3TJBA 4FYUA 6GSWA 1ERTA 2C1YA 2NVLA 3ISOA 1YY7A 4K7NA 4ZBBA 2DJ0A 4WKWA 1QK8A 4EDYA 4IQAA 6GSUA 1U3IA 2R0GA 3CRUA 4JBBA 1Z6MA 3EURA 5L71A 2K18A 3IK9A 3ZITA 1HNCA 3IRAA 3HDCA 2GS3A 1ZYQB 5CP1A 4XCSA 5BMUA 2FWEA 4HOJA 5DAKB 3HD5A 4AJ7A 5DAKA 5G1KA 3Q74A 1XWAA 1TRSA 3IHGA 4I6XA 1NW2A 5IMVA 4X1UA 5EY6A 1X9WB 3Q6OA 2CT6A 3CXGA 3LYPA 3O6TA 3F3QA 1F3BA 2FLSA 1XVQA 2O8VB 1OC8A 2BMXA 3C73A 4PUAA 1GUMA 5DALA 1RK4A 5D73A 1SK2A 4I8BA 1KBNA 2HNLA 3QD9A 1A8LA 1N8JA 1K3LA 3CRTA 2YJHA 1SD8A 3F0IA 2LNTA 3HHVA 2C3QA 1X0RA 1GLPA 3A2VA 3DWVA 1X9SB 3IC8A 5ECRB 3F4RA 3ME7A 3L9UA 3TKQA 4BL7B 2IMIA 2KOKA 3WT2A 2C4JA 4ICYA 6GSSA 2H0GA 1HNAA 4DSRA 1G7OA 4MA9A 4TKYA 2RM5A 4NWYA 1MDIA 4AJ6A 6GSYA 3QFAC 3WD6A 2V6OA 2VOCA 3M3MA 2R37A 1MDJA 1UN2A 4Q5RA 4EF0A 1UC7A 3P2AA 1SJ6A 1GSUA 1GNWA 2V32A 1GWCA 4F9ZA 1XCCA 5KN0A 3UJ1A 3C1RA 3F63A 3KGKA 3QAGA 1M99A 2R5GA 1AC1A 3ZFLA 5F06A 2F8AA 4PQHA 4PQIA 5JCUA 1KEBA 1TDIA 1GUKA 4BVYB 4K6XA 4BVYA 3ZRDA 1Z5YE 4IP1A 1GRXA 4BWQA 4WR4A 1PD21 2H0IA 2OE0A 3TRXA 5CRGA 1SJIA 4BWSA 2QSIA 2VD1A 4RI7A 1T1VA 4ZB6A 2CAQA 3HJOA 1GSYA 3M9KA 4WXTA 4ML1A 3FYGA 4G9HA 2R3XA 1XWCA 3FR6A 4K2DA 3VK9A 1V58A 2UZ8A 1M3IA 5D96A 3PH9A 4G19A 4GCIA 4MJBA 2REMA 2CZ2A 2LQQA 4X43A 1FOHA 2GZZA 5AISA 1FB6A 2VL9A 3UVHA 1Q4JA 4K5SA 4EXJA 4GSNA 4MDCA 2OBIA 4I2TA 3CSIA 1XWKA 1GTIA 3IA1A 1DBYA 5B6MA 3IHQA 4FH8A 4KF9A 4GQFA 3LGCA 3A2XA 2DMLA 1XZOA 2R0CA 4NAXA 4XS1A 2X99A 1O81A 2B3SA 1YDKA 3UIWA 2IJYA 3QDNA 1GSDA 4RUVA 2QKEA 4XS4B 4XS4A 4ISDA 2ZCTA 3D5JA 3FR9A 3IBHA 3L9SA 1X5EA 1SK1A 2AB6A 3D4TA 3I6AA 3NZNA 3TRPA 2VL2A 3GKMA 2NBSA 4Q5QA 3WGDA 2L4CA 3G7JA 5A4WA 2DIYA 1B48A 3DIEA 1EWXA 1QXHA 1Z9HA 3F6FA 2MMZA 2VCZA 3KTBA 3C7MA 1F9MA 1YZXA 6GSVA 2VD0A 1F6MC 2H74A 1WOUA 3CMIA 1PQNA 3VPTA 3LWAA 1PN0A 2PERA 4MMMA 3D4MA 2YV9A 2HI7A 5ECOB 3D6IA 4IS0A 3GKKA 2GSSA 3TUEA 4TVEA 2YANA 4HS1A 2VCXA 2VO4A 2F3MA 1R5PA 4OCFA 5F05A 4TXOA 3D22A 5KN1A 2HYXA 4IN0A 2C3TA 1FW1A 2NTOA 3BD2A 5IO2A 4IHUA 1ERWA 4MP4A 5FWGA 3BCKA 2X8HA 3EYTA 3UAPA 1M2BA 4BIKA 2CX3A 4NMUA 1XG8A 2H8LA 5G30A 2DBCA 3ZMLA 1TKDB 1Y25A 3TDGA 2LRTA 5H5SA 5KOWA 1ABAA 5H5RA 3UEMA 3SBCA 3ZFBA 1BG5A 1AXDA 5IMAA 2Z9SA 2LJKA 5IMFA 2GGTA 4J57E 1WRYA 2B5YA 2VLUA 3PPUA 1I9DA 3HYPA 1X9MB 2OKAA 1PKZA 3DD3A 2VM2A 4XRAA 3W6GA 1JZWA 4F03A 2RLIA 1K0NA 4GXZA 1AQWA 1WP0A 5CRHA 2HZEB 2HZFA 4KB3A 4KH7A 2P31A 3E0UA 4POBA 1THXA 3OR5A 3Q19A 4ZB8A 2X49A 4NV2A 3CTGA 4K8MA 2DJ3A 2E2GA 2R4VA 3R2QA 3EINA 1FVKA 1HNBA 4EL1A 4YQMA 4DSSB 3EWLA 1F3AA 4DSSA 2LJRA 13GSA 1M7TA 2HLSA 3APSA 4O7HA 1ST9A 1XW9A 2XBQA 4IJIA 1A0FA 1F2EA 1DSBA 1GSQA 4WR5A 3UMAA 4Z2RA 2B7JA 1K0CA 3C8EA 4FQUA 4MNNA 2RUFA 4IW9A 2B7KA 3N5OA 5IQYA 4P3YB 1FAAA 2IL3A 2WULA 5DCHA 2B6MA 3DVWA 3ZVJA 2IMEA 1B4QA 4NXIA 1GP1A 3TKRA 4AF2A 1G6YA 2IPAA 2HXKA 5ID2A 2MZCA 2I9HA 1LBKA 2E7PA 3KMNA 2H71A 4G2EA 3FRCA 3UL3A 2DMMA 2WCIA 4WEYA 5FT3A 1MD3A 4OMVA 1K0DA 3ERFA 1TU8A 3F4SA 2DKHA 5JWQB 4ZL7A 3ZIVA 3KP8A 2IMFA 4MF7A 1WPIA 4EC0A 5D93A 2TRCP 4HU9A 2HFDA 5JCGA 5DQYA 2K9FA 3F6DA 2X4AA 2H1DA 5HFKA 3MDKA 2V6KA 4EVMA 3KTLA 1A8YA 5ECNB 5B8BA 2K8VA 4I5QA 1HD2A 2FD3A 3A5WA 2JADA 4XIHA 3RAZA 3GYKA 2YCDA 4I2UA 4JR6A 2L59A 1CQHA 5ECLB 2GT6A 4ECIA 4JRRA 3GN3A 3GTUB 2L6CA 1HQOA 1VF3A 9GSSA 1A23A 3FKFA 3NIVA 2GQLA 2KUCA 1TK0B 3ERWA 2DC5A 1UVZA 4HJMA 2LV3A 3F4TA 5CNWA 3PGTA 1U87A 2GQKA 2C80A 3Q18A 4V2MA 4GRFA 3TJJA 7GSSA 4YKGA 1WMJA 1E2YA 3CBUA 1EP7A 4KW6A 2OACA 3R3EA 3FZ9A 4ZBAA 4EO3A 2K6VA 3IR4A 2YZUA 2VUPA 3KH7A 1SU9A 3GX8A 4L0UA 4IJ3A 1Z6NA 3TKSC 2VL3A 1TK5B 2OJLA 5A4VA 4O32A 4CDOA 3TJKA 1RQMA 3D21A 1OC3A 1EV9A 3NOFA 4KAEA 2AUVA 4WBRD 2JZRA 4TRXA 2F8FA 1TU7A 3FK8A 1GSEA 1VF4A 5F8BA 1WIKA 2HE3A 3BBYA 3RPNA 4HEA2 5G2ZA 5ECIB 5BRTA 2PVQA 3HVSA 3HA9A 1C72A 1YJ6A 4BA7A 2L5LA 4WETA 4ZB9A 1G6WA 1TOFA 3LFLA 4JEDA 3TRQA 2C0FA 1ERVA 3EU3A 5ECPB 5KN2A 1K0MA 4K2XA 3ZZXA 4IQ1A 3KEBA 5B6NA 1CQGA 4IKHA 3VLNA 2NPBA 5J9CA 5KOXA 1R5AA 2KHPA 3I9V2 4MH3A 3EMPA 4PNFA 4GSSA 1S3RA 1DE2A 4A5PA 4BL7A 5EVOA 3KZQA 1AQVA 1HYUA 2GDRA 4NHWA 5DCGA 4PQ1A 4ECBA 2FGXA 1YKAA 4O92A 20GSA 3O3TA 5KN3A 5H5QA 4V1Ag 2H72A 2C8UA 4EUYA 3VURA 3L0HA 4O5QA 1GSFA 2I81A 2P5RA 2YWOA 2B5XA 1Z3EA 1Y6EA 3MSZA 3TJGA 2DJ1A 3GH9A 3EC3A 3VPQA 3CYNA 1JZOA 2JU5A 5EPFA 1R7HA 4AGSA 1SYRA 2J23A 2CAIA 3MNGA 1T8EB 5INYA 4WF4A 4G0IA 5D8IA 5LD0A 4KCEA 2LS5A 4ID0A 4MJEA 2OBKA 4ZBDA 2EIQA 2OADA 2DJKA 2F51A 4TR0A 5IIZA 3DMLA 1BAYA 2GSRA 4TOPA 1M9AA 1JZRA 3ZMKA 5JWRB 2WJUA 2FWGA 1WE0A 1V98A 1BEDA 4L5LA 4FYBA 3K8NA 2MYGA 1GH2A 3ZLPA 1J08A 3DRNA 3QMXA 1XWGA 10GSA 1ILOA 2O89A 4YQUA 3L78A 3ERGA 1M0UA 3GL5A 3HZ8A 1ZMAA 3RDWA 1FVJA 4GWRA 3ZIJA 3TKSE 1S3CA 1V9WA 2YOIA 4QQ7A 3WGEA 2L57A 5IOXA 1YQ1A 4JZQA 1AQXA 1VRSD 2C3NA 4EIQA 3IPZA 2HRNA 1K0AA 2YZHA 1A2JA 3ZTLA 5ELAA 2JSZA 3TB2A 3AY8A 4YQVA 2ALBA 3GMFA 5D9VA 4MJCA 5KEJA 1AIUA 4LA1A 4KX4A 1R4WA 3KJYA 3P90A 4DSQA 2GT5A 2RUEA 6GSXA 4E8HA 1JLVA 2E2MA 2M46A 3GNJA 1T4ZA 1PKWA 3GSSA 4PX1A 3ZYWA 2VLTA 5DDLA 3HVNA 4MPFA 1QFNA 4CW9A 1SKWB 1DUGA 2XC2A 2C0EA 1EGOA 5ENUA 2V2GA 4BPYA 3LJRA 5DBQA 3ZL5A 1YEPA 4MZCA 3EMXA 4HJ2A 1XVWA 1T3BA 2P0GA 3EPTA 4IELA 3L9VA 3HCZA 1SL0B 1BJXA 2PN8A 3IC4A 2FA8A 3FY7A 4POMA 3H8QA 4K1FA 17GSA 3M9JA 2M80A 3IE3A 5AN1A 1ZYPA 2ZUPA 3EE2A 4K5RA 1TRVA 3F3RA 2F9SA 1Z7RA 3GRXA 3HY2A 5IMDA 2O87A 4N10A 2YJ7A 3FHKA 4GTUA 2H1GA 4IBPA 2AV4A 5A5KA 2V1MA 2GSQA 1BX9A 2YN1A 4KDYA 2RM6A 5D9WA 3QOUA 3GUSA 1FO5A 1W89A 3KM6A 4KSMA 1G7EA 3GURA 2FA4A 4HQZA 5HR3A 3FZ4A 4Z2TA 1K0OA 5IMCA 3KXOA 3KP9A 4PNGA 1M3JA 2PBJA 5CYYA 4YAPA 3IXRA 2IMDA 1OKTA 1SL2B 2YPMA 2VCVA 2GZPA 4ZL9A 5B8AA 2TIRA 3GL3A 3D0ZA 3APQA 3BOAA 3TJFA 1GLQA 2VCWA 3HJMA 4Q5NA 2HZEA 3ZVJD 4QL9A 4ZIJA 1PX7A 1XOBA 3QAVA 4WBJA 3TOUA 4YKFA 2LUSA 2YWMA 4OO5A 4POLA 4MF6A 2VCTA 1PL2A 4N11A 1B9XC 2GZYA 3A3TA 2QC7A 4XRDA 4PXOA 2H70A 4CY8A 1MTCA 4AJ8A 4ZILA 2G0FA 2AHEA 1USBA 2M72A 2VM1A 3DXBA 5C00A 2XHFA 1DE1A 5DQSA 1XOAA 3H79A 2LTKA 5CAXA 4TR1B 1PMTA 4TR1A 2FNOA 2P5QA 1R26A 14GSA 2CA8A 3MAKA 2FWFA 1XPVA 2HSHA 1JLWA 1W4VA 5GAPD 5HR2A 2ZNMA 1M2DA 3HJPA 1O6JA 1SL1B 4OO4A 2LQOA 2IFQB 4O5RA 4K0NA 1K3OA 2CVBA 3FZAA 5GZZB 4FYCA 2B1KA 1A2LA 2FWHA 2VLVA 3JCML 5G5FA 1FB0A 4ACSA 5AIXA 2MMNA 2YV7A 4QL7A 1S3AA 2DJJA 1SKSB 4D73B 4D73A 2IMKA 1TK8B 5CRWA 4E8EA 3EVIA 4N30A 3WT1A 2ES7A 2QA1A 3DVXA 5F07A 4K0GA 5LNKe 4IP6A 2YP6A 5FHIA 2H19A 4L8EA 2OA7A 4N0VA 1S3DA 2GVPA 3GTUA 3DYRA 1AUCA 4LL1B 4OD7A 4J56E 1BYEA 1T7PB 1TRWA 1NHOA 4K9ZA 1PX6A 1I5GA 5JCWA 4HQSA 3LW9A 4HZ4A 4KGIA 3LEFA 3PR8A 4JR4A 5DJMA 3UOMA 2H01A 3APOA 5CRDA 1YKCA 1QUWA 3I69A 2JACA 4L0WA 4WF5A 3CQFA 1V2AA 4TXVA 4YH2A 2NDOA 1SD9A 4Z7XA 4EKZA 5G31A 3GX0A 2AJQB 2DLXA 4TN8A 5A4UA 2FHEA 1U6TA 2VIMA 4MABA 4I97A 4K7IA 3W8SA 2AAWA 3TKPA 4PUFC 4KNDA 3US3A 1TP9A 1OAZA 3LG6A 4F0BA 1AW9A 3VWUA 3N9JA 3U6VA 4GSTA 4GQCA 1O7UA 2XPDA 5IO0A 4K7OA 4HDEA 2HRKA 3DKSA 3U5RE 3J7Yb 3GH6A 3UBLA 1MD4A 2A4VA 5ABRA 1QGVA 1O8WA 4KSOA 2LKUA 3C71A 5CO3A 1GTBA 1H4OA 2R0PA 5HQPA 3MYDA 4XTSA 3P8WA 2B5EA 2PU9C 2IWTA 2VL2C 3GIXA 1ZGNA 3RBTA 5ECKB 2QA2A 1ACVA 4HSCX 5G5EA 5J4UA 2QGVA 4LL4B 3LQ7A 1IYHA 4TW5A 3TOTA 1GL8A 5IPHA 4LMWA 3KH9A 3FMWA 3M0FA 4HUAA 2C0GA 5DALB 2DJ2A 3UARA 1XFLA 4H86A 4KCAA 5E4WA 5ECHB 1TW9A 3PINA 1K3YA 1LJRA 2AYTA 4RQXA 2HRFA 1ZZYA 1OC9B 2LJAA 3LXTA 1OC9A 1WWJA 3G7IA 1N2AA 3LYKA 4JU5A 1J0FA 1TI1A 3P7XA 2O7KA 4NV5A 3H93A 3G9BA 1GSSA 2IIYA 4G0LA 1T00A 1KNGA 4MH2A 1EGRA 3QPMA 1O85A 2PUKC 2OE3A 4IVFA 1B4PA 4BVXB 4BVXA 5HFGA 4J2FA 5LCZA 2WRTA 2CZ3A 2VCQA 4X0XA 3IOSA 3UBKA 1EOGA 1Z7PA 3CSHA 2H1AA 4HZ2A 1A0RP 2TRXA 4RI6A 5AIVA 3VI7A 2A2PA 5D9TA 5C04A 2BJXA 1FG4A 3HXSA 4Z2UA 6GSTA 1PA3A 1SYXA 1ERUA 1ZYEA 2MBTA 1EP8A 2N5BA 3CTFA 1E6BA 3ED3A 2A2SA 2PVOC 5ECMB 3GKNA 2L6DA 4POKA 2FUG2 4RQRA 1ML6A 1OYJA 1K0BA 2YWIA 2VAFA 3TCOA 2MMAA 3S9FA 4G10A 5CREA 4GLTA 2I1UA 2L5OA 4CY6A 4GF0A 4MPGA 2G2QA 4DVCA 5COHA 18GSA 1PL1A 2KP2A 4MZBA 3QCPA 2K8SA 3HZ4A 4KDUA 3KIJA 1EV4A 4EIPA 3CSJA 1GTAA 2WGRA 1YEXA 2LRNA 2PMTA 5HR1A 1QQ2A 3TKSA 2IN3A 2H1BA 3VI5A 1THOA 1OVNA 2WB9A 2H0HA 3IV4A 2H30A 3FR3A 4HI7A 3DEXA 1NHYA 1WJKA 3FEUA 2HSMA 4KE3A 1ZYNA 1IYIA 2XBIA 4PTSA 5GAND 1GTUA 3LXZA 2XPEA 5HR0A 4IGJA 5J3RA 2CVDA 2WZ9A 4MJAA 5IM9A 1V57A 2BTOT
chains in the Genus database with same CATH topology
2HT9A 1PSQA 3KCMA 1MDKA 2MMOA 4O5UA 4EE0A 1FHEA 1U88A 3FZ5A 4OWYA 16GSA 2PGTA 2EIRA 4MZWA 3BCIA 1B9YC 2FCHA 1PGTA 3QAWA 3WYWA 1EEMA 2FY6A 2GLRA 1OE8A 1EEJA 2X64A 4NHZA 2A2RA 4ML6A 5EL8A 3QFBC 2H6YA 3ME8A 1ON4A 4KDXA 4LMVA 2H73A 2R6KA 1FOVA 4USSA 4L5OA 4TXOB 2GQMA 3GV1A 12GSA 4MK3A 3RHCA 2PWJA 2I4AA 2H66A 3IAS2 2V41A 2R2JA 3VWWA 2KLXA 1TXXA 4G0KA 4DEJA 3HKRA 2N5AA 1PN9A 1AAZA 5JWOB 3UVTA 3WGXA 1SJZA 2EIOA 3F9UA 3MIXA 4ECCA 3FW2A 8GSSA 1VGLA 2WFCA 2H75A 3J7Yk 3C1SA 4ZXGA 3TGZA 5J5NA 2E0QA 1SK0A 2B1LA 1Q98A 1TJDA 4OFNA 5ECQB 4MF5A 3M1GA 4ECJA 1JFUA 1T4YA 4V2LA 1GULA 4LLRA 2DSAA 2LRCA 2GTUA 5G1LA 2A4HA 1TRUA 1GUHA 2DKIA 2LNSA 3LORA 1O73A 3V1WA 1SKRB 1XW5A 1VF1A 2J9HA 2RIIA 1OE7A 1J9BA 2C0DA 1EOHA 3HVVA 3GA4A 3VFIA 2D2ZA 4F0CA 2N5FA 2X8CA 2LEGA 4MCUA 4X4JA 2JSYA 2ON5A 4F2IA 4ZL8A 3H4KA 2LSTA 3VWVA 5E59A 2H6XA 4OCEA 1XWBA 2PPTA 1PRXA 5IPGA 1X5DA 3ZREA 2O85A 5HFIA 5DJLA 2WDUA 1G0TA 2HSYA 1OKDA 1H75A 1A24A 5ECSA 3GSTA 2YNXA 2JZSA 4OFMA 1U3AA 1M2AA 4ILFA 1YF0A 3IK7A 3IDVA 4XHMA 2YWNA 5ID2B 2ON7A 3E3EA 1MEKA 2WS2A 3E9JB 5IOWA 2IFQA 4KA0A 22GSA 1SENA 1YF1A 4YAVA 4XS6A 1M9BA 1XIYA 1GNEA 2H76A 3SWLA 2EC4A 2X8GA 4V2NA 3G7YA 1XW6A 2JL4A 3KMOA 2CQ9A 4F82A 3H1NA 1LU4A 2I3YA 3IAM2 1JHBA 4MLYA 4N0ZA 5D9XA 3I43A 3A5IA 4FO5A 1UA5A 2JZTA 4OFTA 4PURA 2CX4A 1TI3A 4TR4A 1BQ7A 1XXUA 3L4NA 3LSZA 4HU7A 2HRAA 5F0GA 1F37A 1URMA 4NPBA 3A2WA 3O76A 11GSA 2CV4A 2L4QA 5GSTA 19GSA 1ZOFA 4V1Ap 5IMZA 3MWHA 1ZCPA 4PGTA 4JE1A 4CHSA 1KTEA 1A2MA 5AGYA 3KD0A 5B7CA 1O8XA 4ULXA 3QR6A 2KP1A 3M8NA 1JZDA 3BJ5A 5GSSA 3GFKA 1NM3A 2MBSA 3EU4A 1X5CA 4KUNA 1VF2A 1V40A 1QMVA 4EDZA 3GKXA 4Q5FA 3HVXA 2H6ZA 3DGQA 5DVBA 1B8XA 4TR3A 2CVKA 1EZKA 1ZL9A 2OE1A 3VWXA 5J41A 1TTZA 1RW1A 3GHAA 5J9BA 1XBSA 2DIZA 3RPPA 3W8JA 5ELGA 3RHBA 2GSTA 3F8UA 4FIWA 1NSWA 3TJBA 4FYUA 6GSWA 1ERTA 2C1YA 2NVLA 3ISOA 1YY7A 4K7NA 4ZBBA 2DJ0A 4WKWA 1QK8A 4EDYA 4IQAA 6GSUA 1U3IA 2R0GA 3CRUA 4JBBA 1Z6MA 3EURA 5L71A 2K18A 3IK9A 3ZITA 1HNCA 3IRAA 3HDCA 2GS3A 1ZYQB 5CP1A 4XCSA 5BMUA 2FWEA 4HOJA 5DAKB 3HD5A 4AJ7A 5DAKA 5G1KA 3Q74A 1XWAA 1TRSA 3IHGA 4I6XA 1NW2A 5IMVA 4X1UA 5EY6A 1X9WB 3Q6OA 2CT6A 3CXGA 3LYPA 3O6TA 3F3QA 1F3BA 2FLSA 1XVQA 2O8VB 1OC8A 2BMXA 3C73A 4PUAA 1GUMA 5DALA 1RK4A 5D73A 1SK2A 4I8BA 1KBNA 2HNLA 3QD9A 1A8LA 1N8JA 1K3LA 3CRTA 2YJHA 1SD8A 3F0IA 2LNTA 3HHVA 2C3QA 1X0RA 1GLPA 3A2VA 3DWVA 1X9SB 3IC8A 5ECRB 3F4RA 3ME7A 3L9UA 3TKQA 4BL7B 2IMIA 2KOKA 3WT2A 2C4JA 4ICYA 6GSSA 2H0GA 1HNAA 4DSRA 1G7OA 4MA9A 4TKYA 2RM5A 4NWYA 1MDIA 4AJ6A 6GSYA 3QFAC 3WD6A 2V6OA 2VOCA 3M3MA 2R37A 1MDJA 1UN2A 4Q5RA 4EF0A 1UC7A 3P2AA 1SJ6A 1GSUA 1GNWA 2V32A 1GWCA 4F9ZA 1XCCA 5KN0A 3UJ1A 3C1RA 3F63A 3KGKA 3QAGA 1M99A 2R5GA 1AC1A 3ZFLA 5F06A 2F8AA 4PQHA 4PQIA 5JCUA 1KEBA 1TDIA 1GUKA 4BVYB 4K6XA 4BVYA 3ZRDA 1Z5YE 4IP1A 1GRXA 4BWQA 4WR4A 1PD21 2H0IA 2OE0A 3TRXA 5CRGA 1SJIA 4BWSA 2QSIA 2VD1A 4RI7A 1T1VA 4ZB6A 2CAQA 3HJOA 1GSYA 3M9KA 4WXTA 4ML1A 3FYGA 4G9HA 2R3XA 1XWCA 3FR6A 4K2DA 3VK9A 1V58A 2UZ8A 5D96A 3PH9A 4G19A 4GCIA 4MJBA 2REMA 2CZ2A 2LQQA 4X43A 1FOHA 2GZZA 5AISA 1FB6A 2VL9A 3UVHA 1Q4JA 4K5SA 4EXJA 4GSNA 4MDCA 2OBIA 4I2TA 3CSIA 1XWKA 1GTIA 3IA1A 1DBYA 5B6MA 3IHQA 4FH8A 4KF9A 4GQFA 3LGCA 3A2XA 2DMLA 1XZOA 2R0CA 4NAXA 4XS1A 2X99A 1O81A 2B3SA 1YDKA 3UIWA 2IJYA 3QDNA 1GSDA 4RUVA 2QKEA 4XS4B 4XS4A 4ISDA 2ZCTA 3D5JA 3FR9A 3IBHA 3L9SA 1X5EA 1SK1A 2AB6A 3D4TA 3I6AA 3NZNA 3TRPA 2VL2A 3GKMA 2NBSA 4Q5QA 3WGDA 2L4CA 3G7JA 5A4WA 2DIYA 1B48A 3DIEA 1EWXA 1QXHA 1Z9HA 3F6FA 2MMZA 2VCZA 3KTBA 3C7MA 1F9MA 1YZXA 6GSVA 2VD0A 1F6MC 2H74A 1WOUA 3CMIA 1PQNA 3VPTA 3LWAA 1PN0A 2PERA 4MMMA 3D4MA 2YV9A 2HI7A 5ECOB 3D6IA 4IS0A 3GKKA 2GSSA 3TUEA 4TVEA 2YANA 4HS1A 2VCXA 2VO4A 2F3MA 1R5PA 4OCFA 5F05A 4TXOA 3D22A 5KN1A 2HYXA 4IN0A 2C3TA 1FW1A 2NTOA 3BD2A 5IO2A 4IHUA 1ERWA 4MP4A 5FWGA 3BCKA 2X8HA 3EYTA 3UAPA 1M2BA 2CX3A 4NMUA 2H8LA 5G30A 2DBCA 3ZMLA 1TKDB 1Y25A 3TDGA 2LRTA 5H5SA 5KOWA 1ABAA 5H5RA 3UEMA 3SBCA 3ZFBA 1BG5A 1AXDA 5IMAA 2Z9SA 2LJKA 5IMFA 2GGTA 4J57E 1WRYA 2B5YA 2VLUA 3PPUA 1I9DA 3HYPA 1X9MB 2OKAA 1PKZA 3DD3A 2VM2A 4XRAA 3W6GA 1JZWA 4F03A 2RLIA 1K0NA 4GXZA 1AQWA 1WP0A 5CRHA 2HZEB 2HZFA 4KB3A 4KH7A 2P31A 3E0UA 4POBA 1THXA 3OR5A 3Q19A 4ZB8A 2X49A 4NV2A 3CTGA 4K8MA 2DJ3A 2E2GA 2R4VA 3R2QA 3EINA 1FVKA 1HNBA 4EL1A 4YQMA 4DSSB 3EWLA 1F3AA 4DSSA 2LJRA 13GSA 1M7TA 2HLSA 3APSA 4O7HA 1ST9A 1XW9A 2XBQA 4IJIA 1A0FA 1F2EA 1DSBA 1GSQA 4WR5A 3UMAA 4Z2RA 2B7JA 1K0CA 3C8EA 4FQUA 4MNNA 2RUFA 4IW9A 2B7KA 3N5OA 5IQYA 4P3YB 1FAAA 2IL3A 2WULA 5DCHA 2B6MA 3DVWA 3ZVJA 2IMEA 1B4QA 4NXIA 1GP1A 3TKRA 4AF2A 1G6YA 2IPAA 2HXKA 5ID2A 2MZCA 2I9HA 1LBKA 2E7PA 3KMNA 2H71A 4G2EA 3FRCA 3UL3A 2DMMA 2WCIA 4WEYA 5FT3A 1MD3A 4OMVA 1K0DA 3ERFA 1TU8A 3F4SA 2DKHA 5JWQB 4ZL7A 3ZIVA 3KP8A 2IMFA 4MF7A 1WPIA 4EC0A 5D93A 2TRCP 4HU9A 2HFDA 5JCGA 5DQYA 2K9FA 3F6DA 2X4AA 2H1DA 5HFKA 3MDKA 2V6KA 4EVMA 3KTLA 1A8YA 5ECNB 5B8BA 2K8VA 4I5QA 1HD2A 2FD3A 3A5WA 2JADA 4XIHA 3RAZA 3GYKA 2YCDA 4I2UA 4JR6A 2L59A 1CQHA 5ECLB 2GT6A 4ECIA 4JRRA 3GN3A 3GTUB 2L6CA 1HQOA 1VF3A 9GSSA 1A23A 3FKFA 3NIVA 2GQLA 2KUCA 1TK0B 3ERWA 2DC5A 1UVZA 4HJMA 2LV3A 3F4TA 5CNWA 3PGTA 1U87A 2GQKA 2C80A 3Q18A 4V2MA 4GRFA 3TJJA 7GSSA 4YKGA 1WMJA 1E2YA 3CBUA 1EP7A 4KW6A 2OACA 3R3EA 3FZ9A 4ZBAA 4EO3A 2K6VA 3IR4A 2YZUA 2VUPA 3KH7A 1SU9A 3GX8A 4L0UA 4IJ3A 1Z6NA 3TKSC 2VL3A 1TK5B 2OJLA 5A4VA 4O32A 4CDOA 3TJKA 1RQMA 3D21A 1OC3A 1EV9A 3NOFA 4KAEA 2AUVA 4WBRD 2JZRA 4TRXA 2F8FA 1TU7A 3FK8A 1GSEA 1VF4A 5F8BA 1WIKA 2HE3A 3BBYA 3RPNA 4HEA2 5G2ZA 5ECIB 5BRTA 2PVQA 3HVSA 3HA9A 1C72A 1YJ6A 4BA7A 2L5LA 4WETA 4ZB9A 1G6WA 1TOFA 3LFLA 4JEDA 3TRQA 2C0FA 1ERVA 3EU3A 5ECPB 5KN2A 1K0MA 4K2XA 3ZZXA 4IQ1A 3KEBA 5B6NA 1CQGA 4IKHA 3VLNA 2NPBA 5J9CA 5KOXA 1R5AA 2KHPA 3I9V2 4MH3A 3EMPA 4PNFA 4GSSA 1DE2A 4A5PA 4BL7A 5EVOA 3KZQA 1AQVA 1HYUA 2GDRA 4NHWA 5DCGA 4PQ1A 4ECBA 2FGXA 1YKAA 4O92A 20GSA 3O3TA 5KN3A 5H5QA 4V1Ag 2H72A 2C8UA 4EUYA 3VURA 3L0HA 4O5QA 1GSFA 2I81A 2P5RA 2YWOA 2B5XA 1Z3EA 1Y6EA 3MSZA 3TJGA 2DJ1A 3GH9A 3EC3A 3VPQA 3CYNA 1JZOA 2JU5A 5EPFA 1R7HA 4AGSA 1SYRA 2J23A 2CAIA 3MNGA 1T8EB 5INYA 4WF4A 4G0IA 5D8IA 5LD0A 4KCEA 2LS5A 4ID0A 4MJEA 2OBKA 4ZBDA 2EIQA 2OADA 2DJKA 2F51A 4TR0A 5IIZA 3DMLA 1BAYA 2GSRA 4TOPA 1M9AA 1JZRA 3ZMKA 5JWRB 2WJUA 2FWGA 1WE0A 1V98A 1BEDA 4L5LA 4FYBA 3K8NA 2MYGA 1GH2A 3ZLPA 1J08A 3DRNA 3QMXA 1XWGA 10GSA 1ILOA 2O89A 4YQUA 3L78A 3ERGA 1M0UA 3GL5A 3HZ8A 1ZMAA 3RDWA 1FVJA 4GWRA 3ZIJA 3TKSE 1S3CA 1V9WA 2YOIA 4QQ7A 3WGEA 2L57A 5IOXA 1YQ1A 4JZQA 1AQXA 1VRSD 2C3NA 4EIQA 3IPZA 2HRNA 1K0AA 2YZHA 1A2JA 3ZTLA 5ELAA 2JSZA 3TB2A 3AY8A 4YQVA 2ALBA 3GMFA 5D9VA 4MJCA 5KEJA 1AIUA 4LA1A 4KX4A 1R4WA 3KJYA 3P90A 4DSQA 2GT5A 2RUEA 6GSXA 4E8HA 1JLVA 2E2MA 2M46A 3GNJA 1T4ZA 1PKWA 3GSSA 4PX1A 3ZYWA 2VLTA 5DDLA 4MPFA 1QFNA 4CW9A 1SKWB 1DUGA 2XC2A 2C0EA 1EGOA 5ENUA 2V2GA 4BPYA 3LJRA 5DBQA 3ZL5A 1YEPA 4MZCA 3EMXA 4HJ2A 1XVWA 1T3BA 2P0GA 3EPTA 4IELA 3L9VA 3HCZA 1SL0B 1BJXA 2PN8A 3IC4A 2FA8A 3FY7A 4POMA 3H8QA 4K1FA 17GSA 3M9JA 2M80A 3IE3A 5AN1A 1ZYPA 2ZUPA 3EE2A 4K5RA 1TRVA 3F3RA 2F9SA 1Z7RA 3GRXA 3HY2A 5IMDA 2O87A 4N10A 2YJ7A 3FHKA 4GTUA 2H1GA 4IBPA 2AV4A 5A5KA 2V1MA 2GSQA 1BX9A 2YN1A 4KDYA 2RM6A 5D9WA 3QOUA 3GUSA 1FO5A 1W89A 3KM6A 4KSMA 1G7EA 3GURA 2FA4A 4HQZA 5HR3A 3FZ4A 4Z2TA 1K0OA 5IMCA 3KXOA 3KP9A 4PNGA 2PBJA 5CYYA 4YAPA 3IXRA 2IMDA 1OKTA 1SL2B 2YPMA 2VCVA 2GZPA 4ZL9A 5B8AA 2TIRA 3GL3A 3D0ZA 3APQA 3BOAA 3TJFA 1GLQA 2VCWA 3HJMA 4Q5NA 2HZEA 3ZVJD 4QL9A 4ZIJA 1PX7A 1XOBA 3QAVA 4WBJA 3TOUA 4YKFA 2LUSA 2YWMA 4OO5A 4POLA 4MF6A 2VCTA 1PL2A 4N11A 1B9XC 2GZYA 3A3TA 2QC7A 4XRDA 4PXOA 2H70A 4CY8A 1MTCA 4AJ8A 4ZILA 2G0FA 2AHEA 1USBA 2M72A 2VM1A 3DXBA 5C00A 2XHFA 1DE1A 5DQSA 1XOAA 3H79A 2LTKA 5CAXA 4TR1B 1PMTA 4TR1A 2FNOA 2P5QA 1R26A 14GSA 2CA8A 3MAKA 2FWFA 1XPVA 2HSHA 1JLWA 1W4VA 5GAPD 5HR2A 2ZNMA 1M2DA 3HJPA 1O6JA 1SL1B 4OO4A 2LQOA 2IFQB 4O5RA 4K0NA 1K3OA 2CVBA 3FZAA 5GZZB 4FYCA 2B1KA 1A2LA 2FWHA 2VLVA 3JCML 5G5FA 1FB0A 4ACSA 5AIXA 2MMNA 2YV7A 4QL7A 1S3AA 2DJJA 1SKSB 4D73B 4D73A 2IMKA 1TK8B 5CRWA 4E8EA 3EVIA 4N30A 3WT1A 2ES7A 2QA1A 3DVXA 5F07A 4K0GA 5LNKe 4IP6A 2YP6A 5FHIA 2H19A 4L8EA 2OA7A 4N0VA 1S3DA 2GVPA 3GTUA 3DYRA 1AUCA 4LL1B 4OD7A 4J56E 1BYEA 1T7PB 1TRWA 1NHOA 4K9ZA 1PX6A 1I5GA 5JCWA 4HQSA 3LW9A 4HZ4A 4KGIA 3LEFA 3PR8A 4JR4A 5DJMA 3UOMA 2H01A 3APOA 5CRDA 1YKCA 1QUWA 3I69A 2JACA 4L0WA 4WF5A 1V2AA 4TXVA 4YH2A 2NDOA 1SD9A 4Z7XA 4EKZA 5G31A 3GX0A 2AJQB 2DLXA 4TN8A 5A4UA 2FHEA 1U6TA 2VIMA 4MABA 4I97A 4K7IA 3W8SA 2AAWA 3TKPA 4PUFC 4KNDA 3US3A 1TP9A 1OAZA 3LG6A 4F0BA 1AW9A 3VWUA 3N9JA 3U6VA 4GSTA 4GQCA 1O7UA 2XPDA 5IO0A 4K7OA 4HDEA 2HRKA 3DKSA 3U5RE 3J7Yb 3GH6A 3UBLA 1MD4A 2A4VA 5ABRA 1QGVA 1O8WA 4KSOA 2LKUA 3C71A 5CO3A 1GTBA 1H4OA 2R0PA 5HQPA 3MYDA 4XTSA 3P8WA 2B5EA 2PU9C 2IWTA 2VL2C 3GIXA 1ZGNA 3RBTA 5ECKB 2QA2A 1ACVA 5G5EA 5J4UA 2QGVA 4LL4B 3LQ7A 1IYHA 4TW5A 3TOTA 1GL8A 5IPHA 4LMWA 3KH9A 3FMWA 3M0FA 4HUAA 2C0GA 5DALB 2DJ2A 3UARA 1XFLA 4H86A 4KCAA 5E4WA 5ECHB 1TW9A 3PINA 1K3YA 1LJRA 2AYTA 4RQXA 2HRFA 1ZZYA 1OC9B 2LJAA 3LXTA 1OC9A 1WWJA 3G7IA 1N2AA 3LYKA 4JU5A 1J0FA 1TI1A 3P7XA 2O7KA 4NV5A 3H93A 3G9BA 1GSSA 2IIYA 4G0LA 1T00A 1KNGA 4MH2A 1EGRA 3QPMA 1O85A 2PUKC 2OE3A 4IVFA 1B4PA 4BVXB 4BVXA 5HFGA 4J2FA 5LCZA 2WRTA 2CZ3A 2VCQA 4X0XA 3IOSA 3UBKA 1EOGA 1Z7PA 3CSHA 2H1AA 4HZ2A 1A0RP 2TRXA 4RI6A 5AIVA 3VI7A 2A2PA 5D9TA 5C04A 2BJXA 1FG4A 3HXSA 4Z2UA 6GSTA 1PA3A 1SYXA 1ERUA 1ZYEA 2MBTA 1EP8A 2N5BA 3CTFA 1E6BA 3ED3A 2A2SA 2PVOC 5ECMB 3GKNA 2L6DA 4POKA 2FUG2 4RQRA 1ML6A 1OYJA 1K0BA 2YWIA 2VAFA 3TCOA 2MMAA 3S9FA 4G10A 5CREA 4GLTA 2I1UA 2L5OA 4CY6A 4GF0A 4MPGA 2G2QA 4DVCA 5COHA 18GSA 1PL1A 2KP2A 4MZBA 3QCPA 2K8SA 3HZ4A 4KDUA 3KIJA 1EV4A 4EIPA 3CSJA 1GTAA 2WGRA 1YEXA 2LRNA 2PMTA 5HR1A 1QQ2A 3TKSA 2IN3A 2H1BA 3VI5A 1THOA 1OVNA 2WB9A 2H0HA 3IV4A 2H30A 3FR3A 4HI7A 3DEXA 1NHYA 1WJKA 3FEUA 2HSMA 4KE3A 1ZYNA 1IYIA 2XBIA 4PTSA 5GAND 1GTUA 3LXZA 2XPEA 5HR0A 4IGJA 5J3RA 2CVDA 2WZ9A 4MJAA 5IM9A 1V57A 2BTOT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HT9 A;  1PSQ A;  3KCM A;  1MDK A;  2MMO A;  4EE0 A;  1FHE A;  1U88 A;  3FZ5 A;  4OWY A;  16GS A;  2PGT A;  2EIR A;  4MZW A;  3BCI A;  1B9Y C;  2FCH A;  1PGT A;  3QAW A;  3WYW A;  1EEM A;  2FY6 A;  2GLR A;  1OE8 A;  1EEJ A;  2X64 A;  4NHZ A;  2A2R A;  4ML6 A;  5EL8 A;  3QFB C;  2H6Y A;  3ME8 A;  1ON4 A;  4KDX A;  4LMV A;  2H73 A;  2R6K A;  1FOV A;  4L5O A;  4TXO B;  2GQM A;  3GV1 A;  12GS A;  4MK3 A;  3RHC A;  2PWJ A;  2I4A A;  2H66 A;  3IAS 2;  2V41 A;  2R2J A;  3VWW A;  2KLX A;  1TXX A;  4DEJ A;  3HKR A;  2N5A A;  1PN9 A;  1AAZ A;  5JWO B;  3UVT A;  3WGX A;  1SJZ A;  2EIO A;  3F9U A;  4ECC A;  3FW2 A;  8GSS A;  1VGL A;  2WFC A;  2H75 A;  3J7Y k;  3C1S A;  4ZXG A;  3TGZ A;  5J5N A;  2E0Q A;  1SK0 A;  2B1L A;  1Q98 A;  1TJD A;  4OFN A;  5ECQ B;  4MF5 A;  3M1G A;  4ECJ A;  1JFU A;  1T4Y A;  4V2L A;  1GUL A;  4LLR A;  2DSA A;  2LRC A;  2GTU A;  5G1L A;  1TRU A;  1GUH A;  2LNS A;  3LOR A;  1O73 A;  3V1W A;  1SKR B;  1XW5 A;  1VF1 A;  2J9H A;  2RII A;  1OE7 A;  1J9B A;  2C0D A;  1EOH A;  3HVV A;  3GA4 A;  3VFI A;  2D2Z A;  4F0C A;  2N5F A;  2X8C A;  2LEG A;  4MCU A;  2JSY A;  2ON5 A;  4F2I A;  4ZL8 A;  3H4K A;  2LST A;  3VWV A;  5E59 A;  2H6X A;  4OCE A;  1XWB A;  2PPT A;  1PRX A;  5IPG A;  1X5D A;  3ZRE A;  2O85 A;  5HFI A;  5DJL A;  2WDU A;  1G0T A;  2HSY A;  1OKD A;  1H75 A;  1A24 A;  5ECS A;  3GST A;  2YNX A;  2JZS A;  4OFM A;  1U3A A;  1M2A A;  4ILF A;  1YF0 A;  3IK7 A;  3IDV A;  4XHM A;  2YWN A;  5ID2 B;  2ON7 A;  3E3E A;  1MEK A;  2WS2 A;  3E9J B;  5IOW A;  2IFQ A;  4KA0 A;  22GS A;  1SEN A;  1YF1 A;  4YAV A;  4XS6 A;  1M9B A;  1XIY A;  1GNE A;  2H76 A;  3SWL A;  2EC4 A;  2X8G A;  4V2N A;  3G7Y A;  1XW6 A;  2JL4 A;  3KMO A;  2CQ9 A;  4F82 A;  3H1N A;  1LU4 A;  2I3Y A;  3IAM 2;  1JHB A;  4MLY A;  4N0Z A;  5D9X A;  3I43 A;  4FO5 A;  1UA5 A;  2JZT A;  4OFT A;  4PUR A;  2CX4 A;  1TI3 A;  4TR4 A;  1BQ7 A;  1XXU A;  3L4N A;  3LSZ A;  4HU7 A;  5F0G A;  1F37 A;  1URM A;  4NPB A;  3A2W A;  3O76 A;  11GS A;  2CV4 A;  2L4Q A;  5GST A;  19GS A;  1ZOF A;  4V1A p;  5IMZ A;  3MWH A;  1ZCP A;  4PGT A;  4JE1 A;  4CHS A;  1KTE A;  1A2M A;  5AGY A;  3KD0 A;  5B7C A;  1O8X A;  4ULX A;  3QR6 A;  2KP1 A;  3M8N A;  1JZD A;  3BJ5 A;  5GSS A;  3GFK A;  1NM3 A;  2MBS A;  3EU4 A;  1X5C A;  4KUN A;  1VF2 A;  1V40 A;  1QMV A;  4EDZ A;  3GKX A;  4Q5F A;  3HVX A;  2H6Z A;  3DGQ A;  5DVB A;  1B8X A;  4TR3 A;  2CVK A;  1EZK A;  1ZL9 A;  2OE1 A;  3VWX A;  5J41 A;  1TTZ A;  1RW1 A;  3GHA A;  5J9B A;  1XBS A;  2DIZ A;  3RPP A;  3W8J A;  5ELG A;  3RHB A;  2GST A;  3F8U A;  4FIW A;  1NSW A;  3TJB A;  4FYU A;  6GSW A;  1ERT A;  2C1Y A;  2NVL A;  3ISO A;  1YY7 A;  4K7N A;  4ZBB A;  2DJ0 A;  4WKW A;  1QK8 A;  4EDY A;  4IQA A;  6GSU A;  1U3I A;  3CRU A;  4JBB A;  1Z6M A;  3EUR A;  5L71 A;  2K18 A;  3IK9 A;  3ZIT A;  1HNC A;  3IRA A;  3HDC A;  2GS3 A;  1ZYQ B;  5CP1 A;  4XCS A;  2FWE A;  4HOJ A;  5DAK B;  3HD5 A;  4AJ7 A;  5DAK A;  5G1K A;  3Q74 A;  1XWA A;  1TRS A;  4I6X A;  1NW2 A;  5IMV A;  4X1U A;  5EY6 A;  1X9W B;  3Q6O A;  2CT6 A;  3CXG A;  3LYP A;  3O6T A;  3F3Q A;  1F3B A;  2FLS A;  1XVQ A;  2O8V B;  1OC8 A;  2BMX A;  3C73 A;  4PUA A;  1GUM A;  5DAL A;  1RK4 A;  5D73 A;  1SK2 A;  4I8B A;  1KBN A;  2HNL A;  3QD9 A;  1A8L A;  1N8J A;  1K3L A;  3CRT A;  2YJH A;  1SD8 A;  3F0I A;  2LNT A;  3HHV A;  2C3Q A;  1X0R A;  1GLP A;  3A2V A;  3DWV A;  1X9S B;  5ECR B;  3F4R A;  3ME7 A;  3L9U A;  3TKQ A;  2IMI A;  2KOK A;  3WT2 A;  2C4J A;  6GSS A;  2H0G A;  1HNA A;  4DSR A;  1G7O A;  4MA9 A;  4TKY A;  2RM5 A;  4NWY A;  1MDI A;  4AJ6 A;  6GSY A;  3QFA C;  3WD6 A;  2V6O A;  2VOC A;  3M3M A;  2R37 A;  1MDJ A;  1UN2 A;  4Q5R A;  4EF0 A;  1UC7 A;  3P2A A;  1SJ6 A;  1GSU A;  1GNW A;  2V32 A;  1GWC A;  4F9Z A;  1XCC A;  5KN0 A;  3UJ1 A;  3C1R A;  3F63 A;  3KGK A;  3QAG A;  1M99 A;  2R5G A;  1AC1 A;  3ZFL A;  5F06 A;  2F8A A;  4PQH A;  4PQI A;  5JCU A;  1KEB A;  1TDI A;  1GUK A;  4K6X A;  4BVY A;  3ZRD A;  1Z5Y E;  4IP1 A;  1GRX A;  4BWQ A;  4WR4 A;  1PD2 1;  2H0I A;  2OE0 A;  3TRX A;  5CRG A;  1SJI A;  4BWS A;  2QSI A;  2VD1 A;  4RI7 A;  1T1V A;  4ZB6 A;  2CAQ A;  3HJO A;  1GSY A;  3M9K A;  4WXT A;  4ML1 A;  3FYG A;  4G9H A;  2R3X A;  1XWC A;  3FR6 A;  4K2D A;  3VK9 A;  1V58 A;  5D96 A;  3PH9 A;  4G19 A;  4GCI A;  4MJB A;  2REM A;  2CZ2 A;  2LQQ A;  4X43 A;  2GZZ A;  5AIS A;  1FB6 A;  2VL9 A;  3UVH A;  1Q4J A;  4EXJ A;  4GSN A;  4MDC A;  2OBI A;  4I2T A;  3CSI A;  1XWK A;  1GTI A;  3IA1 A;  1DBY A;  5B6M A;  3IHQ A;  4FH8 A;  4GQF A;  3LGC A;  3A2X A;  2DML A;  1XZO A;  4NAX A;  4XS1 A;  2X99 A;  1O81 A;  2B3S A;  1YDK A;  3UIW A;  2IJY A;  3QDN A;  1GSD A;  4RUV A;  2QKE A;  4XS4 B;  4XS4 A;  4ISD A;  2ZCT A;  3D5J A;  3FR9 A;  3IBH A;  3L9S A;  1X5E A;  1SK1 A;  2AB6 A;  3D4T A;  3I6A A;  3NZN A;  3TRP A;  2VL2 A;  3GKM A;  2NBS A;  4Q5Q A;  3WGD A;  2L4C A;  3G7J A;  5A4W A;  2DIY A;  1B48 A;  3DIE A;  1EWX A;  1QXH A;  1Z9H A;  3F6F A;  2MMZ A;  2VCZ A;  3KTB A;  3C7M A;  1F9M A;  1YZX A;  6GSV A;  2VD0 A;  1F6M C;  2H74 A;  1WOU A;  3CMI A;  1PQN A;  3VPT A;  3LWA A;  2PER A;  4MMM A;  3D4M A;  2YV9 A;  2HI7 A;  5ECO B;  3D6I A;  4IS0 A;  3GKK A;  2GSS A;  3TUE A;  4TVE A;  2YAN A;  4HS1 A;  2VCX A;  2VO4 A;  2F3M A;  1R5P A;  4OCF A;  5F05 A;  4TXO A;  3D22 A;  5KN1 A;  2HYX A;  4IN0 A;  2C3T A;  1FW1 A;  2NTO A;  3BD2 A;  5IO2 A;  4IHU A;  1ERW A;  4MP4 A;  5FWG A;  3BCK A;  2X8H A;  3EYT A;  3UAP A;  1M2B A;  2CX3 A;  4NMU A;  2H8L A;  5G30 A;  2DBC A;  3ZML A;  1TKD B;  1Y25 A;  3TDG A;  2LRT A;  5H5S A;  1ABA A;  5H5R A;  3UEM A;  3SBC A;  3ZFB A;  1BG5 A;  1AXD A;  5IMA A;  2Z9S A;  2LJK A;  5IMF A;  2GGT A;  1WRY A;  2B5Y A;  4J57 E;  2VLU A;  1I9D A;  3HYP A;  1X9M B;  2OKA A;  1PKZ A;  3DD3 A;  2VM2 A;  4XRA A;  3W6G A;  1JZW A;  4F03 A;  2RLI A;  1K0N A;  4GXZ A;  1AQW A;  1WP0 A;  5CRH A;  2HZE B;  2HZF A;  4KB3 A;  4KH7 A;  2P31 A;  3E0U A;  4POB A;  1THX A;  3OR5 A;  3Q19 A;  4ZB8 A;  4NV2 A;  3CTG A;  4K8M A;  2DJ3 A;  2E2G A;  2R4V A;  3R2Q A;  3EIN A;  1FVK A;  1HNB A;  4EL1 A;  4YQM A;  4DSS B;  3EWL A;  1F3A A;  4DSS A;  2LJR A;  13GS A;  1M7T A;  2HLS A;  3APS A;  4O7H A;  1ST9 A;  1XW9 A;  2XBQ A;  4IJI A;  1A0F A;  1F2E A;  1DSB A;  1GSQ A;  4WR5 A;  3UMA A;  2B7J A;  1K0C A;  3C8E A;  2RUF A;  4IW9 A;  2B7K A;  3N5O A;  5IQY A;  4P3Y B;  1FAA A;  2IL3 A;  2WUL A;  5DCH A;  2B6M A;  3DVW A;  3ZVJ A;  2IME A;  1B4Q A;  4NXI A;  1GP1 A;  3TKR A;  4AF2 A;  1G6Y A;  2IPA A;  2HXK A;  5ID2 A;  2MZC A;  2I9H A;  1LBK A;  2E7P A;  3KMN A;  2H71 A;  4G2E A;  3FRC A;  3UL3 A;  2DMM A;  2WCI A;  4WEY A;  5FT3 A;  1MD3 A;  4OMV A;  1K0D A;  3ERF A;  1TU8 A;  3F4S A;  5JWQ B;  4ZL7 A;  3ZIV A;  3KP8 A;  2IMF A;  4MF7 A;  1WPI A;  4EC0 A;  5D93 A;  2TRC P;  4HU9 A;  2HFD A;  5JCG A;  5DQY A;  2K9F A;  3F6D A;  2H1D A;  5HFK A;  3MDK A;  2V6K A;  4EVM A;  3KTL A;  1A8Y A;  5ECN B;  5B8B A;  2K8V A;  4I5Q A;  1HD2 A;  2FD3 A;  3A5W A;  2JAD A;  4XIH A;  3RAZ A;  3GYK A;  2YCD A;  4I2U A;  4JR6 A;  2L59 A;  1CQH A;  5ECL B;  2GT6 A;  4ECI A;  4JRR A;  3GN3 A;  3GTU B;  2L6C A;  1HQO A;  1VF3 A;  9GSS A;  1A23 A;  3FKF A;  3NIV A;  2GQL A;  2KUC A;  1TK0 B;  3ERW A;  2DC5 A;  1UVZ A;  4HJM A;  2LV3 A;  3F4T A;  5CNW A;  3PGT A;  1U87 A;  2GQK A;  2C80 A;  3Q18 A;  4V2M A;  4GRF A;  3TJJ A;  7GSS A;  1WMJ A;  1E2Y A;  3CBU A;  1EP7 A;  4KW6 A;  2OAC A;  3FZ9 A;  4ZBA A;  4EO3 A;  2K6V A;  3IR4 A;  2YZU A;  2VUP A;  3KH7 A;  1SU9 A;  3GX8 A;  4L0U A;  4IJ3 A;  1Z6N A;  3TKS C;  2VL3 A;  1TK5 B;  2OJL A;  5A4V A;  4O32 A;  4CDO A;  3TJK A;  1RQM A;  3D21 A;  1OC3 A;  1EV9 A;  3NOF A;  4KAE A;  2AUV A;  4WBR D;  2JZR A;  4TRX A;  2F8F A;  1TU7 A;  3FK8 A;  1GSE A;  1VF4 A;  5F8B A;  1WIK A;  2HE3 A;  3BBY A;  3RPN A;  4HEA 2;  5G2Z A;  5ECI B;  2PVQ A;  3HVS A;  3HA9 A;  1C72 A;  1YJ6 A;  4BA7 A;  2L5L A;  4WET A;  4ZB9 A;  1G6W A;  1TOF A;  3LFL A;  4JED A;  3TRQ A;  2C0F A;  1ERV A;  3EU3 A;  5ECP B;  5KN2 A;  1K0M A;  3ZZX A;  4IQ1 A;  3KEB A;  5B6N A;  1CQG A;  4IKH A;  3VLN A;  2NPB A;  5J9C A;  1R5A A;  2KHP A;  3I9V 2;  4MH3 A;  3EMP A;  4PNF A;  4GSS A;  1DE2 A;  4BL7 A;  5EVO A;  3KZQ A;  1AQV A;  1HYU A;  2GDR A;  4NHW A;  5DCG A;  4PQ1 A;  4ECB A;  2FGX A;  1YKA A;  4O92 A;  20GS A;  3O3T A;  5KN3 A;  5H5Q A;  4V1A g;  2H72 A;  2C8U A;  4EUY A;  3VUR A;  3L0H A;  1GSF A;  2I81 A;  2P5R A;  2YWO A;  2B5X A;  1Z3E A;  1Y6E A;  3MSZ A;  3TJG A;  2DJ1 A;  3GH9 A;  3EC3 A;  3VPQ A;  3CYN A;  1JZO A;  2JU5 A;  5EPF A;  1R7H A;  4AGS A;  1SYR A;  2J23 A;  2CAI A;  3MNG A;  1T8E B;  5INY A;  4WF4 A;  5D8I A;  5LD0 A;  4KCE A;  2LS5 A;  4ID0 A;  4MJE A;  2OBK A;  4ZBD A;  2EIQ A;  2OAD A;  2DJK A;  2F51 A;  4TR0 A;  5IIZ A;  3DML A;  1BAY A;  2GSR A;  4TOP A;  1M9A A;  1JZR A;  3ZMK A;  5JWR B;  2WJU A;  2FWG A;  1WE0 A;  1V98 A;  1BED A;  4L5L A;  4FYB A;  3K8N A;  2MYG A;  1GH2 A;  3ZLP A;  1J08 A;  3DRN A;  3QMX A;  1XWG A;  10GS A;  1ILO A;  2O89 A;  4YQU A;  3L78 A;  3ERG A;  1M0U A;  3GL5 A;  3HZ8 A;  1ZMA A;  3RDW A;  1FVJ A;  4GWR A;  3ZIJ A;  3TKS E;  1S3C A;  1V9W A;  2YOI A;  4QQ7 A;  3WGE A;  2L57 A;  5IOX A;  1YQ1 A;  4JZQ A;  1AQX A;  1VRS D;  2C3N A;  3IPZ A;  2HRN A;  1K0A A;  2YZH A;  1A2J A;  3ZTL A;  5ELA A;  2JSZ A;  3TB2 A;  3AY8 A;  4YQV A;  2ALB A;  3GMF A;  5D9V A;  4MJC A;  5KEJ A;  1AIU A;  4LA1 A;  4KX4 A;  1R4W A;  3KJY A;  3P90 A;  4DSQ A;  2GT5 A;  2RUE A;  6GSX A;  4E8H A;  1JLV A;  2E2M A;  2M46 A;  3GNJ A;  1T4Z A;  1PKW A;  3GSS A;  4PX1 A;  3ZYW A;  2VLT A;  5DDL A;  4MPF A;  1QFN A;  4CW9 A;  1SKW B;  1DUG A;  2XC2 A;  2C0E A;  1EGO A;  5ENU A;  2V2G A;  4BPY A;  3LJR A;  5DBQ A;  3ZL5 A;  1YEP A;  4MZC A;  3EMX A;  4HJ2 A;  1XVW A;  1T3B A;  2P0G A;  4IEL A;  3L9V A;  3HCZ A;  1SL0 B;  1BJX A;  2PN8 A;  3IC4 A;  2FA8 A;  3FY7 A;  4POM A;  3H8Q A;  4K1F A;  17GS A;  3M9J A;  2M80 A;  3IE3 A;  5AN1 A;  2ZUP A;  3EE2 A;  1TRV A;  3F3R A;  2F9S A;  1Z7R A;  3GRX A;  3HY2 A;  5IMD A;  2O87 A;  4N10 A;  2YJ7 A;  3FHK A;  4GTU A;  2H1G A;  4IBP A;  2AV4 A;  5A5K A;  2V1M A;  2GSQ A;  1BX9 A;  2YN1 A;  4KDY A;  2RM6 A;  5D9W A;  3QOU A;  3GUS A;  1FO5 A;  1W89 A;  3KM6 A;  4KSM A;  1G7E A;  3GUR A;  2FA4 A;  4HQZ A;  5HR3 A;  3FZ4 A;  1K0O A;  5IMC A;  3KXO A;  3KP9 A;  4PNG A;  2PBJ A;  5CYY A;  4YAP A;  3IXR A;  2IMD A;  1OKT A;  1SL2 B;  2YPM A;  2VCV A;  2GZP A;  4ZL9 A;  5B8A A;  2TIR A;  3GL3 A;  3D0Z A;  3APQ A;  3BOA A;  3TJF A;  1GLQ A;  2VCW A;  3HJM A;  4Q5N A;  2HZE A;  3ZVJ D;  4QL9 A;  4ZIJ A;  1PX7 A;  1XOB A;  3QAV A;  4WBJ A;  3TOU A;  2LUS A;  2YWM A;  4OO5 A;  4POL A;  4MF6 A;  2VCT A;  1PL2 A;  4N11 A;  1B9X C;  2GZY A;  3A3T A;  2QC7 A;  4XRD A;  4PXO A;  2H70 A;  1MTC A;  4AJ8 A;  4ZIL A;  2G0F A;  2AHE A;  1USB A;  2M72 A;  2VM1 A;  3DXB A;  5C00 A;  2XHF A;  1DE1 A;  5DQS A;  1XOA A;  3H79 A;  2LTK A;  5CAX A;  4TR1 B;  1PMT A;  4TR1 A;  2FNO A;  2P5Q A;  1R26 A;  14GS A;  2CA8 A;  3MAK A;  2FWF A;  1XPV A;  2HSH A;  1JLW A;  1W4V A;  5GAP D;  5HR2 A;  2ZNM A;  1M2D A;  3HJP A;  1O6J A;  1SL1 B;  4OO4 A;  2LQO A;  2IFQ B;  4O5R A;  4K0N A;  1K3O A;  2CVB A;  3FZA A;  5GZZ B;  4FYC A;  2B1K A;  1A2L A;  2FWH A;  2VLV A;  3JCM L;  5G5F A;  1FB0 A;  4ACS A;  5AIX A;  2MMN A;  2YV7 A;  4QL7 A;  1S3A A;  2DJJ A;  1SKS B;  4D73 B;  4D73 A;  2IMK A;  1TK8 B;  5CRW A;  4E8E A;  3EVI A;  4N30 A;  3WT1 A;  2ES7 A;  3DVX A;  5F07 A;  4K0G A;  5LNK e;  4IP6 A;  2YP6 A;  5FHI A;  2H19 A;  4L8E A;  2OA7 A;  4N0V A;  1S3D A;  2GVP A;  3GTU A;  3DYR A;  1AUC A;  4LL1 B;  4OD7 A;  4J56 E;  1BYE A;  1T7P B;  1TRW A;  1NHO A;  4K9Z A;  1PX6 A;  1I5G A;  5JCW A;  4HQS A;  4HZ4 A;  4KGI A;  3LEF A;  3PR8 A;  4JR4 A;  5DJM A;  3UOM A;  2H01 A;  3APO A;  5CRD A;  1YKC A;  1QUW A;  3I69 A;  2JAC A;  4L0W A;  4WF5 A;  1V2A A;  4TXV A;  4YH2 A;  2NDO A;  1SD9 A;  4Z7X A;  4EKZ A;  5G31 A;  3GX0 A;  2AJQ B;  2DLX A;  4TN8 A;  5A4U A;  2FHE A;  1U6T A;  2VIM A;  4MAB A;  4I97 A;  4K7I A;  3W8S A;  2AAW A;  3TKP A;  4PUF C;  4KND A;  3US3 A;  1TP9 A;  1OAZ A;  3LG6 A;  4F0B A;  1AW9 A;  3VWU A;  3N9J A;  3U6V A;  4GST A;  4GQC A;  1O7U A;  2XPD A;  5IO0 A;  4K7O A;  4HDE A;  3DKS A;  3U5R E;  3J7Y b;  3GH6 A;  3UBL A;  1MD4 A;  2A4V A;  5ABR A;  1QGV A;  1O8W A;  4KSO A;  2LKU A;  3C71 A;  5CO3 A;  1GTB A;  1H4O A;  5HQP A;  4XTS A;  3P8W A;  2B5E A;  2PU9 C;  2IWT A;  2VL2 C;  3GIX A;  1ZGN A;  3RBT A;  5ECK B;  1ACV A;  5G5E A;  5J4U A;  2QGV A;  4LL4 B;  3LQ7 A;  1IYH A;  4TW5 A;  3TOT A;  1GL8 A;  5IPH A;  4LMW A;  3KH9 A;  3M0F A;  4HUA A;  2C0G A;  5DAL B;  2DJ2 A;  3UAR A;  1XFL A;  4H86 A;  4KCA A;  5E4W A;  5ECH B;  1TW9 A;  3PIN A;  1K3Y A;  1LJR A;  2AYT A;  4RQX A;  2HRF A;  1ZZY A;  1OC9 B;  2LJA A;  3LXT A;  1OC9 A;  1WWJ A;  3G7I A;  1N2A A;  3LYK A;  4JU5 A;  1J0F A;  1TI1 A;  3P7X A;  2O7K A;  4NV5 A;  3H93 A;  3G9B A;  1GSS A;  2IIY A;  1T00 A;  1KNG A;  4MH2 A;  1EGR A;  3QPM A;  1O85 A;  2PUK C;  2OE3 A;  4IVF A;  1B4P A;  4BVX A;  5HFG A;  4J2F A;  5LCZ A;  2WRT A;  2CZ3 A;  2VCQ A;  4X0X A;  3IOS A;  3UBK A;  1EOG A;  1Z7P A;  3CSH A;  2H1A A;  4HZ2 A;  1A0R P;  2TRX A;  4RI6 A;  5AIV A;  3VI7 A;  5D9T A;  5C04 A;  2BJX A;  1FG4 A;  3HXS A;  6GST A;  1PA3 A;  1SYX A;  1ERU A;  1ZYE A;  2MBT A;  1EP8 A;  2N5B A;  3CTF A;  1E6B A;  3ED3 A;  2A2S A;  2PVO C;  5ECM B;  3GKN A;  2L6D A;  4POK A;  2FUG 2;  4RQR A;  1ML6 A;  1OYJ A;  1K0B A;  2YWI A;  2VAF A;  3TCO A;  2MMA A;  3S9F A;  4G10 A;  5CRE A;  4GLT A;  2I1U A;  2L5O A;  4GF0 A;  4MPG A;  2G2Q A;  4DVC A;  5COH A;  18GS A;  1PL1 A;  2KP2 A;  4MZB A;  3QCP A;  2K8S A;  3HZ4 A;  4KDU A;  3KIJ A;  1EV4 A;  3CSJ A;  1GTA A;  2WGR A;  1YEX A;  2LRN A;  2PMT A;  5HR1 A;  1QQ2 A;  3TKS A;  2IN3 A;  2H1B A;  3VI5 A;  1THO A;  1OVN A;  2WB9 A;  2H0H A;  3IV4 A;  2H30 A;  3FR3 A;  4HI7 A;  3DEX A;  1NHY A;  1WJK A;  3FEU A;  4KE3 A;  1IYI A;  2XBI A;  5GAN D;  1GTU A;  3LXZ A;  2XPE A;  5HR0 A;  4IGJ A;  5J3R A;  2CVD A;  2WZ9 A;  4MJA A;  5IM9 A;  1V57 A;  2BTO T; 
#chains in the Genus database with same CATH topology
 2HT9 A;  1PSQ A;  3KCM A;  1MDK A;  2MMO A;  4O5U A;  4EE0 A;  1FHE A;  1U88 A;  3FZ5 A;  4OWY A;  16GS A;  2PGT A;  2EIR A;  4MZW A;  3BCI A;  1B9Y C;  2FCH A;  1PGT A;  3QAW A;  3WYW A;  1EEM A;  2FY6 A;  2GLR A;  1OE8 A;  1EEJ A;  2X64 A;  4NHZ A;  2A2R A;  4ML6 A;  5EL8 A;  3QFB C;  2H6Y A;  3ME8 A;  1ON4 A;  4KDX A;  4LMV A;  2H73 A;  2R6K A;  1FOV A;  4USS A;  4L5O A;  4TXO B;  2GQM A;  3GV1 A;  12GS A;  4MK3 A;  3RHC A;  2PWJ A;  2I4A A;  2H66 A;  3IAS 2;  2V41 A;  2R2J A;  3VWW A;  2KLX A;  1TXX A;  4G0K A;  4DEJ A;  3HKR A;  2N5A A;  1PN9 A;  1AAZ A;  5JWO B;  3UVT A;  3WGX A;  1SJZ A;  2EIO A;  3F9U A;  3MIX A;  4ECC A;  3FW2 A;  8GSS A;  1VGL A;  2WFC A;  2H75 A;  3J7Y k;  3C1S A;  4ZXG A;  3TGZ A;  5J5N A;  2E0Q A;  1SK0 A;  2B1L A;  1Q98 A;  1TJD A;  4OFN A;  5ECQ B;  4MF5 A;  3M1G A;  4ECJ A;  1JFU A;  1T4Y A;  4V2L A;  1GUL A;  4LLR A;  2DSA A;  2LRC A;  2GTU A;  5G1L A;  2A4H A;  1TRU A;  1GUH A;  2DKI A;  2LNS A;  3LOR A;  1O73 A;  3V1W A;  1SKR B;  1XW5 A;  1VF1 A;  2J9H A;  2RII A;  1OE7 A;  1J9B A;  2C0D A;  1EOH A;  3HVV A;  3GA4 A;  3VFI A;  2D2Z A;  4F0C A;  2N5F A;  2X8C A;  2LEG A;  4MCU A;  4X4J A;  2JSY A;  2ON5 A;  4F2I A;  4ZL8 A;  3H4K A;  2LST A;  3VWV A;  5E59 A;  2H6X A;  4OCE A;  1XWB A;  2PPT A;  1PRX A;  5IPG A;  1X5D A;  3ZRE A;  2O85 A;  5HFI A;  5DJL A;  2WDU A;  1G0T A;  2HSY A;  1OKD A;  1H75 A;  1A24 A;  5ECS A;  3GST A;  2YNX A;  2JZS A;  4OFM A;  1U3A A;  1M2A A;  4ILF A;  1YF0 A;  3IK7 A;  3IDV A;  4XHM A;  2YWN A;  5ID2 B;  2ON7 A;  3E3E A;  1MEK A;  2WS2 A;  3E9J B;  5IOW A;  2IFQ A;  4KA0 A;  22GS A;  1SEN A;  1YF1 A;  4YAV A;  4XS6 A;  1M9B A;  1XIY A;  1GNE A;  2H76 A;  3SWL A;  2EC4 A;  2X8G A;  4V2N A;  3G7Y A;  1XW6 A;  2JL4 A;  3KMO A;  2CQ9 A;  4F82 A;  3H1N A;  1LU4 A;  2I3Y A;  3IAM 2;  1JHB A;  4MLY A;  4N0Z A;  5D9X A;  3I43 A;  3A5I A;  4FO5 A;  1UA5 A;  2JZT A;  4OFT A;  4PUR A;  2CX4 A;  1TI3 A;  4TR4 A;  1BQ7 A;  1XXU A;  3L4N A;  3LSZ A;  4HU7 A;  2HRA A;  5F0G A;  1F37 A;  1URM A;  4NPB A;  3A2W A;  3O76 A;  11GS A;  2CV4 A;  2L4Q A;  5GST A;  19GS A;  1ZOF A;  1PFO A;  4V1A p;  5IMZ A;  3MWH A;  1ZCP A;  4PGT A;  4JE1 A;  4CHS A;  1KTE A;  1A2M A;  5AGY A;  3KD0 A;  5B7C A;  1O8X A;  4ULX A;  3QR6 A;  2KP1 A;  3M8N A;  1JZD A;  3BJ5 A;  5GSS A;  3GFK A;  1NM3 A;  2MBS A;  3EU4 A;  1X5C A;  4KUN A;  1VF2 A;  1V40 A;  1QMV A;  4EDZ A;  3GKX A;  4Q5F A;  3HVX A;  2H6Z A;  3DGQ A;  5DVB A;  1B8X A;  4TR3 A;  2CVK A;  1EZK A;  1ZL9 A;  2OE1 A;  3VWX A;  5J41 A;  1TTZ A;  1RW1 A;  3GHA A;  5J9B A;  1XBS A;  2DIZ A;  3RPP A;  3W8J A;  5ELG A;  3RHB A;  2GST A;  3F8U A;  4FIW A;  1NSW A;  3TJB A;  4FYU A;  6GSW A;  1ERT A;  2C1Y A;  2NVL A;  3ISO A;  1YY7 A;  4K7N A;  4ZBB A;  2DJ0 A;  4WKW A;  1QK8 A;  4EDY A;  4IQA A;  6GSU A;  1U3I A;  2R0G A;  3CRU A;  4JBB A;  1Z6M A;  3EUR A;  5L71 A;  2K18 A;  3IK9 A;  3ZIT A;  1HNC A;  3IRA A;  3HDC A;  2GS3 A;  1ZYQ B;  5CP1 A;  4XCS A;  5BMU A;  2FWE A;  4HOJ A;  5DAK B;  3HD5 A;  4AJ7 A;  5DAK A;  5G1K A;  3Q74 A;  1XWA A;  1TRS A;  3IHG A;  4I6X A;  1NW2 A;  5IMV A;  4X1U A;  5EY6 A;  1X9W B;  3Q6O A;  2CT6 A;  3CXG A;  3LYP A;  3O6T A;  3F3Q A;  1F3B A;  2FLS A;  1XVQ A;  2O8V B;  1OC8 A;  2BMX A;  3C73 A;  4PUA A;  1GUM A;  5DAL A;  1RK4 A;  5D73 A;  1SK2 A;  4I8B A;  1KBN A;  2HNL A;  3QD9 A;  1A8L A;  1N8J A;  1K3L A;  3CRT A;  2YJH A;  1SD8 A;  3F0I A;  2LNT A;  3HHV A;  2C3Q A;  1X0R A;  1GLP A;  3A2V A;  3DWV A;  1X9S B;  3IC8 A;  5ECR B;  3F4R A;  3ME7 A;  3L9U A;  3TKQ A;  4BL7 B;  2IMI A;  2KOK A;  3WT2 A;  2C4J A;  4ICY A;  6GSS A;  2H0G A;  1HNA A;  4DSR A;  1G7O A;  4MA9 A;  4TKY A;  2RM5 A;  4NWY A;  1MDI A;  4AJ6 A;  6GSY A;  3QFA C;  3WD6 A;  2V6O A;  2VOC A;  3M3M A;  2R37 A;  1MDJ A;  1UN2 A;  4Q5R A;  4EF0 A;  1UC7 A;  3P2A A;  1SJ6 A;  1GSU A;  1GNW A;  2V32 A;  1GWC A;  4F9Z A;  1XCC A;  5KN0 A;  3UJ1 A;  3C1R A;  3F63 A;  3KGK A;  3QAG A;  1M99 A;  2R5G A;  1AC1 A;  3ZFL A;  5F06 A;  2F8A A;  4PQH A;  4PQI A;  5JCU A;  1KEB A;  1TDI A;  1GUK A;  4BVY B;  4K6X A;  4BVY A;  3ZRD A;  1Z5Y E;  4IP1 A;  1GRX A;  4BWQ A;  4WR4 A;  1PD2 1;  2H0I A;  2OE0 A;  3TRX A;  5CRG A;  1SJI A;  4BWS A;  2QSI A;  2VD1 A;  4RI7 A;  1T1V A;  4ZB6 A;  2CAQ A;  3HJO A;  1GSY A;  3M9K A;  4WXT A;  4ML1 A;  3FYG A;  4G9H A;  2R3X A;  1XWC A;  3FR6 A;  4K2D A;  3VK9 A;  1V58 A;  2UZ8 A;  1M3I A;  5D96 A;  3PH9 A;  4G19 A;  4GCI A;  4MJB A;  2REM A;  2CZ2 A;  2LQQ A;  4X43 A;  1FOH A;  2GZZ A;  5AIS A;  1FB6 A;  2VL9 A;  3UVH A;  1Q4J A;  4K5S A;  4EXJ A;  4GSN A;  4MDC A;  2OBI A;  4I2T A;  3CSI A;  1XWK A;  1GTI A;  3IA1 A;  1DBY A;  5B6M A;  3IHQ A;  4FH8 A;  4KF9 A;  4GQF A;  3LGC A;  3A2X A;  2DML A;  1XZO A;  2R0C A;  4NAX A;  4XS1 A;  2X99 A;  1O81 A;  2B3S A;  1YDK A;  3UIW A;  2IJY A;  3QDN A;  1GSD A;  4RUV A;  2QKE A;  4XS4 B;  4XS4 A;  4ISD A;  2ZCT A;  3D5J A;  3FR9 A;  3IBH A;  3L9S A;  1X5E A;  1SK1 A;  2AB6 A;  3D4T A;  3I6A A;  3NZN A;  3TRP A;  2VL2 A;  3GKM A;  2NBS A;  4Q5Q A;  3WGD A;  2L4C A;  3G7J A;  5A4W A;  2DIY A;  1B48 A;  3DIE A;  1EWX A;  1QXH A;  1Z9H A;  3F6F A;  2MMZ A;  2VCZ A;  3KTB A;  3C7M A;  1F9M A;  1YZX A;  6GSV A;  2VD0 A;  1F6M C;  2H74 A;  1WOU A;  3CMI A;  1PQN A;  3VPT A;  3LWA A;  1PN0 A;  2PER A;  4MMM A;  3D4M A;  2YV9 A;  2HI7 A;  5ECO B;  3D6I A;  4IS0 A;  3GKK A;  2GSS A;  3TUE A;  4TVE A;  2YAN A;  4HS1 A;  2VCX A;  2VO4 A;  2F3M A;  1R5P A;  4OCF A;  5F05 A;  4TXO A;  3D22 A;  5KN1 A;  2HYX A;  4IN0 A;  2C3T A;  1FW1 A;  2NTO A;  3BD2 A;  5IO2 A;  4IHU A;  1ERW A;  4MP4 A;  5FWG A;  3BCK A;  2X8H A;  3EYT A;  3UAP A;  1M2B A;  4BIK A;  2CX3 A;  4NMU A;  1XG8 A;  2H8L A;  5G30 A;  2DBC A;  3ZML A;  1TKD B;  1Y25 A;  3TDG A;  2LRT A;  5H5S A;  5KOW A;  1ABA A;  5H5R A;  3UEM A;  3SBC A;  3ZFB A;  1BG5 A;  1AXD A;  5IMA A;  2Z9S A;  2LJK A;  5IMF A;  2GGT A;  4J57 E;  1WRY A;  2B5Y A;  2VLU A;  3PPU A;  1I9D A;  3HYP A;  1X9M B;  2OKA A;  1PKZ A;  3DD3 A;  2VM2 A;  4XRA A;  3W6G A;  1JZW A;  4F03 A;  2RLI A;  1K0N A;  4GXZ A;  1AQW A;  1WP0 A;  5CRH A;  2HZE B;  2HZF A;  4KB3 A;  4KH7 A;  2P31 A;  3E0U A;  4POB A;  1THX A;  3OR5 A;  3Q19 A;  4ZB8 A;  2X49 A;  4NV2 A;  3CTG A;  4K8M A;  2DJ3 A;  2E2G A;  2R4V A;  3R2Q A;  3EIN A;  1FVK A;  1HNB A;  4EL1 A;  4YQM A;  4DSS B;  3EWL A;  1F3A A;  4DSS A;  2LJR A;  13GS A;  1M7T A;  2HLS A;  3APS A;  4O7H A;  1ST9 A;  1XW9 A;  2XBQ A;  4IJI A;  1A0F A;  1F2E A;  1DSB A;  1GSQ A;  4WR5 A;  3UMA A;  4Z2R A;  2B7J A;  1K0C A;  3C8E A;  4FQU A;  4MNN A;  2RUF A;  4IW9 A;  2B7K A;  3N5O A;  5IQY A;  4P3Y B;  1FAA A;  2IL3 A;  2WUL A;  5DCH A;  2B6M A;  3DVW A;  3ZVJ A;  2IME A;  1B4Q A;  4NXI A;  1GP1 A;  3TKR A;  4AF2 A;  1G6Y A;  2IPA A;  2HXK A;  5ID2 A;  2MZC A;  2I9H A;  1LBK A;  2E7P A;  3KMN A;  2H71 A;  4G2E A;  3FRC A;  3UL3 A;  2DMM A;  2WCI A;  4WEY A;  5FT3 A;  1MD3 A;  4OMV A;  1K0D A;  3ERF A;  1TU8 A;  3F4S A;  2DKH A;  5JWQ B;  4ZL7 A;  3ZIV A;  3KP8 A;  2IMF A;  4MF7 A;  1WPI A;  4EC0 A;  5D93 A;  2TRC P;  4HU9 A;  2HFD A;  5JCG A;  5DQY A;  2K9F A;  3F6D A;  2X4A A;  2H1D A;  5HFK A;  3MDK A;  2V6K A;  4EVM A;  3KTL A;  1A8Y A;  5ECN B;  5B8B A;  2K8V A;  4I5Q A;  1HD2 A;  2FD3 A;  3A5W A;  2JAD A;  4XIH A;  3RAZ A;  3GYK A;  2YCD A;  4I2U A;  4JR6 A;  2L59 A;  1CQH A;  5ECL B;  2GT6 A;  4ECI A;  4JRR A;  3GN3 A;  3GTU B;  2L6C A;  1HQO A;  1VF3 A;  9GSS A;  1A23 A;  3FKF A;  3NIV A;  2GQL A;  2KUC A;  1TK0 B;  3ERW A;  2DC5 A;  1UVZ A;  4HJM A;  2LV3 A;  3F4T A;  5CNW A;  3PGT A;  1U87 A;  2GQK A;  2C80 A;  3Q18 A;  4V2M A;  4GRF A;  3TJJ A;  7GSS A;  4YKG A;  1WMJ A;  1E2Y A;  3CBU A;  1EP7 A;  4KW6 A;  2OAC A;  3R3E A;  3FZ9 A;  4ZBA A;  4EO3 A;  2K6V A;  3IR4 A;  2YZU A;  2VUP A;  3KH7 A;  1SU9 A;  3GX8 A;  4L0U A;  4IJ3 A;  1Z6N A;  3TKS C;  2VL3 A;  1TK5 B;  2OJL A;  5A4V A;  4O32 A;  4CDO A;  3TJK A;  1RQM A;  3D21 A;  1OC3 A;  1EV9 A;  3NOF A;  4KAE A;  2AUV A;  4WBR D;  2JZR A;  4TRX A;  2F8F A;  1TU7 A;  3FK8 A;  1GSE A;  1VF4 A;  5F8B A;  1WIK A;  2HE3 A;  3BBY A;  3RPN A;  4HEA 2;  5G2Z A;  5ECI B;  5BRT A;  2PVQ A;  3HVS A;  3HA9 A;  1C72 A;  1YJ6 A;  4BA7 A;  2L5L A;  4WET A;  4ZB9 A;  1G6W A;  1TOF A;  3LFL A;  4JED A;  3TRQ A;  2C0F A;  1ERV A;  3EU3 A;  5ECP B;  5KN2 A;  1K0M A;  4K2X A;  3ZZX A;  4IQ1 A;  3KEB A;  5B6N A;  1CQG A;  4IKH A;  3VLN A;  2NPB A;  5J9C A;  5KOX A;  1R5A A;  2KHP A;  3I9V 2;  4MH3 A;  3EMP A;  4PNF A;  4GSS A;  1S3R A;  1DE2 A;  4A5P A;  4BL7 A;  5EVO A;  3KZQ A;  1AQV A;  1HYU A;  2GDR A;  4NHW A;  5DCG A;  4PQ1 A;  4ECB A;  2FGX A;  1YKA A;  4O92 A;  20GS A;  3O3T A;  5KN3 A;  5H5Q A;  4V1A g;  2H72 A;  2C8U A;  4EUY A;  3VUR A;  3L0H A;  4O5Q A;  1GSF A;  2I81 A;  2P5R A;  2YWO A;  2B5X A;  1Z3E A;  1Y6E A;  3MSZ A;  3TJG A;  2DJ1 A;  3GH9 A;  3EC3 A;  3VPQ A;  3CYN A;  1JZO A;  2JU5 A;  5EPF A;  1R7H A;  4AGS A;  1SYR A;  2J23 A;  2CAI A;  3MNG A;  1T8E B;  5INY A;  4WF4 A;  4G0I A;  5D8I A;  5LD0 A;  4KCE A;  2LS5 A;  4ID0 A;  4MJE A;  2OBK A;  4ZBD A;  2EIQ A;  2OAD A;  2DJK A;  2F51 A;  4TR0 A;  5IIZ A;  3DML A;  1BAY A;  2GSR A;  4TOP A;  1M9A A;  1JZR A;  3ZMK A;  5JWR B;  2WJU A;  2FWG A;  1WE0 A;  1V98 A;  1BED A;  4L5L A;  4FYB A;  3K8N A;  2MYG A;  1GH2 A;  3ZLP A;  1J08 A;  3DRN A;  3QMX A;  1XWG A;  10GS A;  1ILO A;  2O89 A;  4YQU A;  3L78 A;  3ERG A;  1M0U A;  3GL5 A;  3HZ8 A;  1ZMA A;  3RDW A;  1FVJ A;  4GWR A;  3ZIJ A;  3TKS E;  1S3C A;  1V9W A;  2YOI A;  4QQ7 A;  3WGE A;  2L57 A;  5IOX A;  1YQ1 A;  4JZQ A;  1AQX A;  1VRS D;  2C3N A;  4EIQ A;  3IPZ A;  2HRN A;  1K0A A;  2YZH A;  1A2J A;  3ZTL A;  5ELA A;  2JSZ A;  3TB2 A;  3AY8 A;  4YQV A;  2ALB A;  3GMF A;  5D9V A;  4MJC A;  5KEJ A;  1AIU A;  4LA1 A;  4KX4 A;  1R4W A;  3KJY A;  3P90 A;  4DSQ A;  2GT5 A;  2RUE A;  6GSX A;  4E8H A;  1JLV A;  2E2M A;  2M46 A;  3GNJ A;  1T4Z A;  1PKW A;  3GSS A;  4PX1 A;  3ZYW A;  2VLT A;  5DDL A;  3HVN A;  4MPF A;  1QFN A;  4CW9 A;  1SKW B;  1DUG A;  2XC2 A;  2C0E A;  1EGO A;  5ENU A;  2V2G A;  4BPY A;  3LJR A;  5DBQ A;  3ZL5 A;  1YEP A;  4MZC A;  3EMX A;  4HJ2 A;  1XVW A;  1T3B A;  2P0G A;  3EPT A;  4IEL A;  3L9V A;  3HCZ A;  1SL0 B;  1BJX A;  2PN8 A;  3IC4 A;  2FA8 A;  3FY7 A;  4POM A;  3H8Q A;  4K1F A;  17GS A;  3M9J A;  2M80 A;  3IE3 A;  5AN1 A;  1ZYP A;  2ZUP A;  3EE2 A;  4K5R A;  1TRV A;  3F3R A;  2F9S A;  1Z7R A;  3GRX A;  3HY2 A;  5IMD A;  2O87 A;  4N10 A;  2YJ7 A;  3FHK A;  4GTU A;  2H1G A;  4IBP A;  2AV4 A;  5A5K A;  2V1M A;  2GSQ A;  1BX9 A;  2YN1 A;  4KDY A;  2RM6 A;  5D9W A;  3QOU A;  3GUS A;  1FO5 A;  1W89 A;  3KM6 A;  4KSM A;  1G7E A;  3GUR A;  2FA4 A;  4HQZ A;  5HR3 A;  3FZ4 A;  4Z2T A;  1K0O A;  5IMC A;  3KXO A;  3KP9 A;  4PNG A;  1M3J A;  2PBJ A;  5CYY A;  4YAP A;  3IXR A;  2IMD A;  1OKT A;  1SL2 B;  2YPM A;  2VCV A;  2GZP A;  4ZL9 A;  5B8A A;  2TIR A;  3GL3 A;  3D0Z A;  3APQ A;  3BOA A;  3TJF A;  1GLQ A;  2VCW A;  3HJM A;  4Q5N A;  2HZE A;  3ZVJ D;  4QL9 A;  4ZIJ A;  1PX7 A;  1XOB A;  3QAV A;  4WBJ A;  3TOU A;  4YKF A;  2LUS A;  2YWM A;  4OO5 A;  4POL A;  4MF6 A;  2VCT A;  1PL2 A;  4N11 A;  1B9X C;  2GZY A;  3A3T A;  2QC7 A;  4XRD A;  4PXO A;  2H70 A;  4CY8 A;  1MTC A;  4AJ8 A;  4ZIL A;  2G0F A;  2AHE A;  1USB A;  2M72 A;  2VM1 A;  3DXB A;  5C00 A;  2XHF A;  1DE1 A;  5DQS A;  1XOA A;  3H79 A;  2LTK A;  5CAX A;  4TR1 B;  1PMT A;  4TR1 A;  2FNO A;  2P5Q A;  1R26 A;  14GS A;  2CA8 A;  3MAK A;  2FWF A;  1XPV A;  2HSH A;  1JLW A;  1W4V A;  5GAP D;  5HR2 A;  2ZNM A;  1M2D A;  3HJP A;  1O6J A;  1SL1 B;  4OO4 A;  2LQO A;  2IFQ B;  4O5R A;  4K0N A;  1K3O A;  2CVB A;  3FZA A;  5GZZ B;  4FYC A;  2B1K A;  1A2L A;  2FWH A;  2VLV A;  3JCM L;  5G5F A;  1FB0 A;  4ACS A;  5AIX A;  2MMN A;  2YV7 A;  4QL7 A;  1S3A A;  2DJJ A;  1SKS B;  4D73 B;  4D73 A;  2IMK A;  1TK8 B;  5CRW A;  4E8E A;  3EVI A;  4N30 A;  3WT1 A;  2ES7 A;  2QA1 A;  3DVX A;  5F07 A;  4K0G A;  5LNK e;  4IP6 A;  2YP6 A;  5FHI A;  2H19 A;  4L8E A;  2OA7 A;  4N0V A;  1S3D A;  2GVP A;  3GTU A;  3DYR A;  1AUC A;  4LL1 B;  4OD7 A;  4J56 E;  1BYE A;  1T7P B;  1TRW A;  1NHO A;  4K9Z A;  1PX6 A;  1I5G A;  5JCW A;  4HQS A;  3LW9 A;  4HZ4 A;  4KGI A;  3LEF A;  3PR8 A;  4JR4 A;  5DJM A;  3UOM A;  2H01 A;  3APO A;  5CRD A;  1YKC A;  1QUW A;  3I69 A;  2JAC A;  4L0W A;  4WF5 A;  3CQF A;  1V2A A;  4TXV A;  4YH2 A;  2NDO A;  1SD9 A;  4Z7X A;  4EKZ A;  5G31 A;  3GX0 A;  2AJQ B;  2DLX A;  4TN8 A;  5A4U A;  2FHE A;  1U6T A;  2VIM A;  4MAB A;  4I97 A;  4K7I A;  3W8S A;  2AAW A;  3TKP A;  4PUF C;  4KND A;  3US3 A;  1TP9 A;  1OAZ A;  3LG6 A;  4F0B A;  1AW9 A;  3VWU A;  3N9J A;  3U6V A;  4GST A;  4GQC A;  1O7U A;  2XPD A;  5IO0 A;  4K7O A;  4HDE A;  2HRK A;  3DKS A;  3U5R E;  3J7Y b;  3GH6 A;  3UBL A;  1MD4 A;  2A4V A;  5ABR A;  1QGV A;  1O8W A;  4KSO A;  2LKU A;  3C71 A;  5CO3 A;  1GTB A;  1H4O A;  2R0P A;  5HQP A;  3MYD A;  4XTS A;  3P8W A;  2B5E A;  2PU9 C;  2IWT A;  2VL2 C;  3GIX A;  1ZGN A;  3RBT A;  5ECK B;  2QA2 A;  1ACV A;  4HSC X;  5G5E A;  5J4U A;  2QGV A;  4LL4 B;  3LQ7 A;  1IYH A;  4TW5 A;  3TOT A;  1GL8 A;  5IPH A;  4LMW A;  3KH9 A;  3FMW A;  3M0F A;  4HUA A;  2C0G A;  5DAL B;  2DJ2 A;  3UAR A;  1XFL A;  4H86 A;  4KCA A;  5E4W A;  5ECH B;  1TW9 A;  3PIN A;  1K3Y A;  1LJR A;  2AYT A;  4RQX A;  2HRF A;  1ZZY A;  1OC9 B;  2LJA A;  3LXT A;  1OC9 A;  1WWJ A;  3G7I A;  1N2A A;  3LYK A;  4JU5 A;  1J0F A;  1TI1 A;  3P7X A;  2O7K A;  4NV5 A;  3H93 A;  3G9B A;  1GSS A;  2IIY A;  4G0L A;  1T00 A;  1KNG A;  4MH2 A;  1EGR A;  3QPM A;  1O85 A;  2PUK C;  2OE3 A;  4IVF A;  1B4P A;  4BVX B;  4BVX A;  5HFG A;  4J2F A;  5LCZ A;  2WRT A;  2CZ3 A;  2VCQ A;  4X0X A;  3IOS A;  3UBK A;  1EOG A;  1Z7P A;  3CSH A;  2H1A A;  4HZ2 A;  1A0R P;  2TRX A;  4RI6 A;  5AIV A;  3VI7 A;  2A2P A;  5D9T A;  5C04 A;  2BJX A;  1FG4 A;  3HXS A;  4Z2U A;  6GST A;  1PA3 A;  1SYX A;  1ERU A;  1ZYE A;  2MBT A;  1EP8 A;  2N5B A;  3CTF A;  1E6B A;  3ED3 A;  2A2S A;  2PVO C;  5ECM B;  3GKN A;  2L6D A;  4POK A;  2FUG 2;  4RQR A;  1ML6 A;  1OYJ A;  1K0B A;  2YWI A;  2VAF A;  3TCO A;  2MMA A;  3S9F A;  4G10 A;  5CRE A;  4GLT A;  2I1U A;  2L5O A;  4CY6 A;  4GF0 A;  4MPG A;  2G2Q A;  4DVC A;  5COH A;  18GS A;  1PL1 A;  2KP2 A;  4MZB A;  3QCP A;  2K8S A;  3HZ4 A;  4KDU A;  3KIJ A;  1EV4 A;  4EIP A;  3CSJ A;  1GTA A;  2WGR A;  1YEX A;  2LRN A;  2PMT A;  5HR1 A;  1QQ2 A;  3TKS A;  2IN3 A;  2H1B A;  3VI5 A;  1THO A;  1OVN A;  2WB9 A;  2H0H A;  3IV4 A;  2H30 A;  3FR3 A;  4HI7 A;  3DEX A;  1NHY A;  1WJK A;  3FEU A;  2HSM A;  4KE3 A;  1ZYN A;  1IYI A;  2XBI A;  4PTS A;  5GAN D;  1GTU A;  3LXZ A;  2XPE A;  5HR0 A;  4IGJ A;  5J3R A;  2CVD A;  2WZ9 A;  4MJA A;  5IM9 A;  1V57 A;  2BTO T; 
#chains in the Genus database with same CATH homology
 2HT9 A;  1PSQ A;  3KCM A;  1MDK A;  2MMO A;  4O5U A;  4EE0 A;  1FHE A;  1U88 A;  3FZ5 A;  4OWY A;  16GS A;  2PGT A;  2EIR A;  4MZW A;  3BCI A;  1B9Y C;  2FCH A;  1PGT A;  3QAW A;  3WYW A;  1EEM A;  2FY6 A;  2GLR A;  1OE8 A;  1EEJ A;  2X64 A;  4NHZ A;  2A2R A;  4ML6 A;  5EL8 A;  3QFB C;  2H6Y A;  3ME8 A;  1ON4 A;  4KDX A;  4LMV A;  2H73 A;  2R6K A;  1FOV A;  4USS A;  4L5O A;  4TXO B;  2GQM A;  3GV1 A;  12GS A;  4MK3 A;  3RHC A;  2PWJ A;  2I4A A;  2H66 A;  3IAS 2;  2V41 A;  2R2J A;  3VWW A;  2KLX A;  1TXX A;  4G0K A;  4DEJ A;  3HKR A;  2N5A A;  1PN9 A;  1AAZ A;  5JWO B;  3UVT A;  3WGX A;  1SJZ A;  2EIO A;  3F9U A;  3MIX A;  4ECC A;  3FW2 A;  8GSS A;  1VGL A;  2WFC A;  2H75 A;  3J7Y k;  3C1S A;  4ZXG A;  3TGZ A;  5J5N A;  2E0Q A;  1SK0 A;  2B1L A;  1Q98 A;  1TJD A;  4OFN A;  5ECQ B;  4MF5 A;  3M1G A;  4ECJ A;  1JFU A;  1T4Y A;  4V2L A;  1GUL A;  4LLR A;  2DSA A;  2LRC A;  2GTU A;  5G1L A;  2A4H A;  1TRU A;  1GUH A;  2DKI A;  2LNS A;  3LOR A;  1O73 A;  3V1W A;  1SKR B;  1XW5 A;  1VF1 A;  2J9H A;  2RII A;  1OE7 A;  1J9B A;  2C0D A;  1EOH A;  3HVV A;  3GA4 A;  3VFI A;  2D2Z A;  4F0C A;  2N5F A;  2X8C A;  2LEG A;  4MCU A;  4X4J A;  2JSY A;  2ON5 A;  4F2I A;  4ZL8 A;  3H4K A;  2LST A;  3VWV A;  5E59 A;  2H6X A;  4OCE A;  1XWB A;  2PPT A;  1PRX A;  5IPG A;  1X5D A;  3ZRE A;  2O85 A;  5HFI A;  5DJL A;  2WDU A;  1G0T A;  2HSY A;  1OKD A;  1H75 A;  1A24 A;  5ECS A;  3GST A;  2YNX A;  2JZS A;  4OFM A;  1U3A A;  1M2A A;  4ILF A;  1YF0 A;  3IK7 A;  3IDV A;  4XHM A;  2YWN A;  5ID2 B;  2ON7 A;  3E3E A;  1MEK A;  2WS2 A;  3E9J B;  5IOW A;  2IFQ A;  4KA0 A;  22GS A;  1SEN A;  1YF1 A;  4YAV A;  4XS6 A;  1M9B A;  1XIY A;  1GNE A;  2H76 A;  3SWL A;  2EC4 A;  2X8G A;  4V2N A;  3G7Y A;  1XW6 A;  2JL4 A;  3KMO A;  2CQ9 A;  4F82 A;  3H1N A;  1LU4 A;  2I3Y A;  3IAM 2;  1JHB A;  4MLY A;  4N0Z A;  5D9X A;  3I43 A;  3A5I A;  4FO5 A;  1UA5 A;  2JZT A;  4OFT A;  4PUR A;  2CX4 A;  1TI3 A;  4TR4 A;  1BQ7 A;  1XXU A;  3L4N A;  3LSZ A;  4HU7 A;  2HRA A;  5F0G A;  1F37 A;  1URM A;  4NPB A;  3A2W A;  3O76 A;  11GS A;  2CV4 A;  2L4Q A;  5GST A;  19GS A;  1ZOF A;  4V1A p;  5IMZ A;  3MWH A;  1ZCP A;  4PGT A;  4JE1 A;  4CHS A;  1KTE A;  1A2M A;  5AGY A;  3KD0 A;  5B7C A;  1O8X A;  4ULX A;  3QR6 A;  2KP1 A;  3M8N A;  1JZD A;  3BJ5 A;  5GSS A;  3GFK A;  1NM3 A;  2MBS A;  3EU4 A;  1X5C A;  4KUN A;  1VF2 A;  1V40 A;  1QMV A;  4EDZ A;  3GKX A;  4Q5F A;  3HVX A;  2H6Z A;  3DGQ A;  5DVB A;  1B8X A;  4TR3 A;  2CVK A;  1EZK A;  1ZL9 A;  2OE1 A;  3VWX A;  5J41 A;  1TTZ A;  1RW1 A;  3GHA A;  5J9B A;  1XBS A;  2DIZ A;  3RPP A;  3W8J A;  5ELG A;  3RHB A;  2GST A;  3F8U A;  4FIW A;  1NSW A;  3TJB A;  4FYU A;  6GSW A;  1ERT A;  2C1Y A;  2NVL A;  3ISO A;  1YY7 A;  4K7N A;  4ZBB A;  2DJ0 A;  4WKW A;  1QK8 A;  4EDY A;  4IQA A;  6GSU A;  1U3I A;  2R0G A;  3CRU A;  4JBB A;  1Z6M A;  3EUR A;  5L71 A;  2K18 A;  3IK9 A;  3ZIT A;  1HNC A;  3IRA A;  3HDC A;  2GS3 A;  1ZYQ B;  5CP1 A;  4XCS A;  5BMU A;  2FWE A;  4HOJ A;  5DAK B;  3HD5 A;  4AJ7 A;  5DAK A;  5G1K A;  3Q74 A;  1XWA A;  1TRS A;  3IHG A;  4I6X A;  1NW2 A;  5IMV A;  4X1U A;  5EY6 A;  1X9W B;  3Q6O A;  2CT6 A;  3CXG A;  3LYP A;  3O6T A;  3F3Q A;  1F3B A;  2FLS A;  1XVQ A;  2O8V B;  1OC8 A;  2BMX A;  3C73 A;  4PUA A;  1GUM A;  5DAL A;  1RK4 A;  5D73 A;  1SK2 A;  4I8B A;  1KBN A;  2HNL A;  3QD9 A;  1A8L A;  1N8J A;  1K3L A;  3CRT A;  2YJH A;  1SD8 A;  3F0I A;  2LNT A;  3HHV A;  2C3Q A;  1X0R A;  1GLP A;  3A2V A;  3DWV A;  1X9S B;  3IC8 A;  5ECR B;  3F4R A;  3ME7 A;  3L9U A;  3TKQ A;  4BL7 B;  2IMI A;  2KOK A;  3WT2 A;  2C4J A;  4ICY A;  6GSS A;  2H0G A;  1HNA A;  4DSR A;  1G7O A;  4MA9 A;  4TKY A;  2RM5 A;  4NWY A;  1MDI A;  4AJ6 A;  6GSY A;  3QFA C;  3WD6 A;  2V6O A;  2VOC A;  3M3M A;  2R37 A;  1MDJ A;  1UN2 A;  4Q5R A;  4EF0 A;  1UC7 A;  3P2A A;  1SJ6 A;  1GSU A;  1GNW A;  2V32 A;  1GWC A;  4F9Z A;  1XCC A;  5KN0 A;  3UJ1 A;  3C1R A;  3F63 A;  3KGK A;  3QAG A;  1M99 A;  2R5G A;  1AC1 A;  3ZFL A;  5F06 A;  2F8A A;  4PQH A;  4PQI A;  5JCU A;  1KEB A;  1TDI A;  1GUK A;  4BVY B;  4K6X A;  4BVY A;  3ZRD A;  1Z5Y E;  4IP1 A;  1GRX A;  4BWQ A;  4WR4 A;  1PD2 1;  2H0I A;  2OE0 A;  3TRX A;  5CRG A;  1SJI A;  4BWS A;  2QSI A;  2VD1 A;  4RI7 A;  1T1V A;  4ZB6 A;  2CAQ A;  3HJO A;  1GSY A;  3M9K A;  4WXT A;  4ML1 A;  3FYG A;  4G9H A;  2R3X A;  1XWC A;  3FR6 A;  4K2D A;  3VK9 A;  1V58 A;  2UZ8 A;  5D96 A;  3PH9 A;  4G19 A;  4GCI A;  4MJB A;  2REM A;  2CZ2 A;  2LQQ A;  4X43 A;  1FOH A;  2GZZ A;  5AIS A;  1FB6 A;  2VL9 A;  3UVH A;  1Q4J A;  4K5S A;  4EXJ A;  4GSN A;  4MDC A;  2OBI A;  4I2T A;  3CSI A;  1XWK A;  1GTI A;  3IA1 A;  1DBY A;  5B6M A;  3IHQ A;  4FH8 A;  4KF9 A;  4GQF A;  3LGC A;  3A2X A;  2DML A;  1XZO A;  2R0C A;  4NAX A;  4XS1 A;  2X99 A;  1O81 A;  2B3S A;  1YDK A;  3UIW A;  2IJY A;  3QDN A;  1GSD A;  4RUV A;  2QKE A;  4XS4 B;  4XS4 A;  4ISD A;  2ZCT A;  3D5J A;  3FR9 A;  3IBH A;  3L9S A;  1X5E A;  1SK1 A;  2AB6 A;  3D4T A;  3I6A A;  3NZN A;  3TRP A;  2VL2 A;  3GKM A;  2NBS A;  4Q5Q A;  3WGD A;  2L4C A;  3G7J A;  5A4W A;  2DIY A;  1B48 A;  3DIE A;  1EWX A;  1QXH A;  1Z9H A;  3F6F A;  2MMZ A;  2VCZ A;  3KTB A;  3C7M A;  1F9M A;  1YZX A;  6GSV A;  2VD0 A;  1F6M C;  2H74 A;  1WOU A;  3CMI A;  1PQN A;  3VPT A;  3LWA A;  1PN0 A;  2PER A;  4MMM A;  3D4M A;  2YV9 A;  2HI7 A;  5ECO B;  3D6I A;  4IS0 A;  3GKK A;  2GSS A;  3TUE A;  4TVE A;  2YAN A;  4HS1 A;  2VCX A;  2VO4 A;  2F3M A;  1R5P A;  4OCF A;  5F05 A;  4TXO A;  3D22 A;  5KN1 A;  2HYX A;  4IN0 A;  2C3T A;  1FW1 A;  2NTO A;  3BD2 A;  5IO2 A;  4IHU A;  1ERW A;  4MP4 A;  5FWG A;  3BCK A;  2X8H A;  3EYT A;  3UAP A;  1M2B A;  2CX3 A;  4NMU A;  2H8L A;  5G30 A;  2DBC A;  3ZML A;  1TKD B;  1Y25 A;  3TDG A;  2LRT A;  5H5S A;  5KOW A;  1ABA A;  5H5R A;  3UEM A;  3SBC A;  3ZFB A;  1BG5 A;  1AXD A;  5IMA A;  2Z9S A;  2LJK A;  5IMF A;  2GGT A;  4J57 E;  1WRY A;  2B5Y A;  2VLU A;  3PPU A;  1I9D A;  3HYP A;  1X9M B;  2OKA A;  1PKZ A;  3DD3 A;  2VM2 A;  4XRA A;  3W6G A;  1JZW A;  4F03 A;  2RLI A;  1K0N A;  4GXZ A;  1AQW A;  1WP0 A;  5CRH A;  2HZE B;  2HZF A;  4KB3 A;  4KH7 A;  2P31 A;  3E0U A;  4POB A;  1THX A;  3OR5 A;  3Q19 A;  4ZB8 A;  2X49 A;  4NV2 A;  3CTG A;  4K8M A;  2DJ3 A;  2E2G A;  2R4V A;  3R2Q A;  3EIN A;  1FVK A;  1HNB A;  4EL1 A;  4YQM A;  4DSS B;  3EWL A;  1F3A A;  4DSS A;  2LJR A;  13GS A;  1M7T A;  2HLS A;  3APS A;  4O7H A;  1ST9 A;  1XW9 A;  2XBQ A;  4IJI A;  1A0F A;  1F2E A;  1DSB A;  1GSQ A;  4WR5 A;  3UMA A;  4Z2R A;  2B7J A;  1K0C A;  3C8E A;  4FQU A;  4MNN A;  2RUF A;  4IW9 A;  2B7K A;  3N5O A;  5IQY A;  4P3Y B;  1FAA A;  2IL3 A;  2WUL A;  5DCH A;  2B6M A;  3DVW A;  3ZVJ A;  2IME A;  1B4Q A;  4NXI A;  1GP1 A;  3TKR A;  4AF2 A;  1G6Y A;  2IPA A;  2HXK A;  5ID2 A;  2MZC A;  2I9H A;  1LBK A;  2E7P A;  3KMN A;  2H71 A;  4G2E A;  3FRC A;  3UL3 A;  2DMM A;  2WCI A;  4WEY A;  5FT3 A;  1MD3 A;  4OMV A;  1K0D A;  3ERF A;  1TU8 A;  3F4S A;  2DKH A;  5JWQ B;  4ZL7 A;  3ZIV A;  3KP8 A;  2IMF A;  4MF7 A;  1WPI A;  4EC0 A;  5D93 A;  2TRC P;  4HU9 A;  2HFD A;  5JCG A;  5DQY A;  2K9F A;  3F6D A;  2X4A A;  2H1D A;  5HFK A;  3MDK A;  2V6K A;  4EVM A;  3KTL A;  1A8Y A;  5ECN B;  5B8B A;  2K8V A;  4I5Q A;  1HD2 A;  2FD3 A;  3A5W A;  2JAD A;  4XIH A;  3RAZ A;  3GYK A;  2YCD A;  4I2U A;  4JR6 A;  2L59 A;  1CQH A;  5ECL B;  2GT6 A;  4ECI A;  4JRR A;  3GN3 A;  3GTU B;  2L6C A;  1HQO A;  1VF3 A;  9GSS A;  1A23 A;  3FKF A;  3NIV A;  2GQL A;  2KUC A;  1TK0 B;  3ERW A;  2DC5 A;  1UVZ A;  4HJM A;  2LV3 A;  3F4T A;  5CNW A;  3PGT A;  1U87 A;  2GQK A;  2C80 A;  3Q18 A;  4V2M A;  4GRF A;  3TJJ A;  7GSS A;  4YKG A;  1WMJ A;  1E2Y A;  3CBU A;  1EP7 A;  4KW6 A;  2OAC A;  3R3E A;  3FZ9 A;  4ZBA A;  4EO3 A;  2K6V A;  3IR4 A;  2YZU A;  2VUP A;  3KH7 A;  1SU9 A;  3GX8 A;  4L0U A;  4IJ3 A;  1Z6N A;  3TKS C;  2VL3 A;  1TK5 B;  2OJL A;  5A4V A;  4O32 A;  4CDO A;  3TJK A;  1RQM A;  3D21 A;  1OC3 A;  1EV9 A;  3NOF A;  4KAE A;  2AUV A;  4WBR D;  2JZR A;  4TRX A;  2F8F A;  1TU7 A;  3FK8 A;  1GSE A;  1VF4 A;  5F8B A;  1WIK A;  2HE3 A;  3BBY A;  3RPN A;  4HEA 2;  5G2Z A;  5ECI B;  5BRT A;  2PVQ A;  3HVS A;  3HA9 A;  1C72 A;  1YJ6 A;  4BA7 A;  2L5L A;  4WET A;  4ZB9 A;  1G6W A;  1TOF A;  3LFL A;  4JED A;  3TRQ A;  2C0F A;  1ERV A;  3EU3 A;  5ECP B;  5KN2 A;  1K0M A;  4K2X A;  3ZZX A;  4IQ1 A;  3KEB A;  5B6N A;  1CQG A;  4IKH A;  3VLN A;  2NPB A;  5J9C A;  5KOX A;  1R5A A;  2KHP A;  3I9V 2;  4MH3 A;  3EMP A;  4PNF A;  4GSS A;  1DE2 A;  4A5P A;  4BL7 A;  5EVO A;  3KZQ A;  1AQV A;  1HYU A;  2GDR A;  4NHW A;  5DCG A;  4PQ1 A;  4ECB A;  2FGX A;  1YKA A;  4O92 A;  20GS A;  3O3T A;  5KN3 A;  5H5Q A;  4V1A g;  2H72 A;  2C8U A;  4EUY A;  3VUR A;  3L0H A;  4O5Q A;  1GSF A;  2I81 A;  2P5R A;  2YWO A;  2B5X A;  1Z3E A;  1Y6E A;  3MSZ A;  3TJG A;  2DJ1 A;  3GH9 A;  3EC3 A;  3VPQ A;  3CYN A;  1JZO A;  2JU5 A;  5EPF A;  1R7H A;  4AGS A;  1SYR A;  2J23 A;  2CAI A;  3MNG A;  1T8E B;  5INY A;  4WF4 A;  4G0I A;  5D8I A;  5LD0 A;  4KCE A;  2LS5 A;  4ID0 A;  4MJE A;  2OBK A;  4ZBD A;  2EIQ A;  2OAD A;  2DJK A;  2F51 A;  4TR0 A;  5IIZ A;  3DML A;  1BAY A;  2GSR A;  4TOP A;  1M9A A;  1JZR A;  3ZMK A;  5JWR B;  2WJU A;  2FWG A;  1WE0 A;  1V98 A;  1BED A;  4L5L A;  4FYB A;  3K8N A;  2MYG A;  1GH2 A;  3ZLP A;  1J08 A;  3DRN A;  3QMX A;  1XWG A;  10GS A;  1ILO A;  2O89 A;  4YQU A;  3L78 A;  3ERG A;  1M0U A;  3GL5 A;  3HZ8 A;  1ZMA A;  3RDW A;  1FVJ A;  4GWR A;  3ZIJ A;  3TKS E;  1S3C A;  1V9W A;  2YOI A;  4QQ7 A;  3WGE A;  2L57 A;  5IOX A;  1YQ1 A;  4JZQ A;  1AQX A;  1VRS D;  2C3N A;  4EIQ A;  3IPZ A;  2HRN A;  1K0A A;  2YZH A;  1A2J A;  3ZTL A;  5ELA A;  2JSZ A;  3TB2 A;  3AY8 A;  4YQV A;  2ALB A;  3GMF A;  5D9V A;  4MJC A;  5KEJ A;  1AIU A;  4LA1 A;  4KX4 A;  1R4W A;  3KJY A;  3P90 A;  4DSQ A;  2GT5 A;  2RUE A;  6GSX A;  4E8H A;  1JLV A;  2E2M A;  2M46 A;  3GNJ A;  1T4Z A;  1PKW A;  3GSS A;  4PX1 A;  3ZYW A;  2VLT A;  5DDL A;  4MPF A;  1QFN A;  4CW9 A;  1SKW B;  1DUG A;  2XC2 A;  2C0E A;  1EGO A;  5ENU A;  2V2G A;  4BPY A;  3LJR A;  5DBQ A;  3ZL5 A;  1YEP A;  4MZC A;  3EMX A;  4HJ2 A;  1XVW A;  1T3B A;  2P0G A;  3EPT A;  4IEL A;  3L9V A;  3HCZ A;  1SL0 B;  1BJX A;  2PN8 A;  3IC4 A;  2FA8 A;  3FY7 A;  4POM A;  3H8Q A;  4K1F A;  17GS A;  3M9J A;  2M80 A;  3IE3 A;  5AN1 A;  1ZYP A;  2ZUP A;  3EE2 A;  4K5R A;  1TRV A;  3F3R A;  2F9S A;  1Z7R A;  3GRX A;  3HY2 A;  5IMD A;  2O87 A;  4N10 A;  2YJ7 A;  3FHK A;  4GTU A;  2H1G A;  4IBP A;  2AV4 A;  5A5K A;  2V1M A;  2GSQ A;  1BX9 A;  2YN1 A;  4KDY A;  2RM6 A;  5D9W A;  3QOU A;  3GUS A;  1FO5 A;  1W89 A;  3KM6 A;  4KSM A;  1G7E A;  3GUR A;  2FA4 A;  4HQZ A;  5HR3 A;  3FZ4 A;  4Z2T A;  1K0O A;  5IMC A;  3KXO A;  3KP9 A;  4PNG A;  2PBJ A;  5CYY A;  4YAP A;  3IXR A;  2IMD A;  1OKT A;  1SL2 B;  2YPM A;  2VCV A;  2GZP A;  4ZL9 A;  5B8A A;  2TIR A;  3GL3 A;  3D0Z A;  3APQ A;  3BOA A;  3TJF A;  1GLQ A;  2VCW A;  3HJM A;  4Q5N A;  2HZE A;  3ZVJ D;  4QL9 A;  4ZIJ A;  1PX7 A;  1XOB A;  3QAV A;  4WBJ A;  3TOU A;  4YKF A;  2LUS A;  2YWM A;  4OO5 A;  4POL A;  4MF6 A;  2VCT A;  1PL2 A;  4N11 A;  1B9X C;  2GZY A;  3A3T A;  2QC7 A;  4XRD A;  4PXO A;  2H70 A;  4CY8 A;  1MTC A;  4AJ8 A;  4ZIL A;  2G0F A;  2AHE A;  1USB A;  2M72 A;  2VM1 A;  3DXB A;  5C00 A;  2XHF A;  1DE1 A;  5DQS A;  1XOA A;  3H79 A;  2LTK A;  5CAX A;  4TR1 B;  1PMT A;  4TR1 A;  2FNO A;  2P5Q A;  1R26 A;  14GS A;  2CA8 A;  3MAK A;  2FWF A;  1XPV A;  2HSH A;  1JLW A;  1W4V A;  5GAP D;  5HR2 A;  2ZNM A;  1M2D A;  3HJP A;  1O6J A;  1SL1 B;  4OO4 A;  2LQO A;  2IFQ B;  4O5R A;  4K0N A;  1K3O A;  2CVB A;  3FZA A;  5GZZ B;  4FYC A;  2B1K A;  1A2L A;  2FWH A;  2VLV A;  3JCM L;  5G5F A;  1FB0 A;  4ACS A;  5AIX A;  2MMN A;  2YV7 A;  4QL7 A;  1S3A A;  2DJJ A;  1SKS B;  4D73 B;  4D73 A;  2IMK A;  1TK8 B;  5CRW A;  4E8E A;  3EVI A;  4N30 A;  3WT1 A;  2ES7 A;  2QA1 A;  3DVX A;  5F07 A;  4K0G A;  5LNK e;  4IP6 A;  2YP6 A;  5FHI A;  2H19 A;  4L8E A;  2OA7 A;  4N0V A;  1S3D A;  2GVP A;  3GTU A;  3DYR A;  1AUC A;  4LL1 B;  4OD7 A;  4J56 E;  1BYE A;  1T7P B;  1TRW A;  1NHO A;  4K9Z A;  1PX6 A;  1I5G A;  5JCW A;  4HQS A;  3LW9 A;  4HZ4 A;  4KGI A;  3LEF A;  3PR8 A;  4JR4 A;  5DJM A;  3UOM A;  2H01 A;  3APO A;  5CRD A;  1YKC A;  1QUW A;  3I69 A;  2JAC A;  4L0W A;  4WF5 A;  1V2A A;  4TXV A;  4YH2 A;  2NDO A;  1SD9 A;  4Z7X A;  4EKZ A;  5G31 A;  3GX0 A;  2AJQ B;  2DLX A;  4TN8 A;  5A4U A;  2FHE A;  1U6T A;  2VIM A;  4MAB A;  4I97 A;  4K7I A;  3W8S A;  2AAW A;  3TKP A;  4PUF C;  4KND A;  3US3 A;  1TP9 A;  1OAZ A;  3LG6 A;  4F0B A;  1AW9 A;  3VWU A;  3N9J A;  3U6V A;  4GST A;  4GQC A;  1O7U A;  2XPD A;  5IO0 A;  4K7O A;  4HDE A;  2HRK A;  3DKS A;  3U5R E;  3J7Y b;  3GH6 A;  3UBL A;  1MD4 A;  2A4V A;  5ABR A;  1QGV A;  1O8W A;  4KSO A;  2LKU A;  3C71 A;  5CO3 A;  1GTB A;  1H4O A;  2R0P A;  5HQP A;  3MYD A;  4XTS A;  3P8W A;  2B5E A;  2PU9 C;  2IWT A;  2VL2 C;  3GIX A;  1ZGN A;  3RBT A;  5ECK B;  2QA2 A;  1ACV A;  5G5E A;  5J4U A;  2QGV A;  4LL4 B;  3LQ7 A;  1IYH A;  4TW5 A;  3TOT A;  1GL8 A;  5IPH A;  4LMW A;  3KH9 A;  3FMW A;  3M0F A;  4HUA A;  2C0G A;  5DAL B;  2DJ2 A;  3UAR A;  1XFL A;  4H86 A;  4KCA A;  5E4W A;  5ECH B;  1TW9 A;  3PIN A;  1K3Y A;  1LJR A;  2AYT A;  4RQX A;  2HRF A;  1ZZY A;  1OC9 B;  2LJA A;  3LXT A;  1OC9 A;  1WWJ A;  3G7I A;  1N2A A;  3LYK A;  4JU5 A;  1J0F A;  1TI1 A;  3P7X A;  2O7K A;  4NV5 A;  3H93 A;  3G9B A;  1GSS A;  2IIY A;  4G0L A;  1T00 A;  1KNG A;  4MH2 A;  1EGR A;  3QPM A;  1O85 A;  2PUK C;  2OE3 A;  4IVF A;  1B4P A;  4BVX B;  4BVX A;  5HFG A;  4J2F A;  5LCZ A;  2WRT A;  2CZ3 A;  2VCQ A;  4X0X A;  3IOS A;  3UBK A;  1EOG A;  1Z7P A;  3CSH A;  2H1A A;  4HZ2 A;  1A0R P;  2TRX A;  4RI6 A;  5AIV A;  3VI7 A;  2A2P A;  5D9T A;  5C04 A;  2BJX A;  1FG4 A;  3HXS A;  4Z2U A;  6GST A;  1PA3 A;  1SYX A;  1ERU A;  1ZYE A;  2MBT A;  1EP8 A;  2N5B A;  3CTF A;  1E6B A;  3ED3 A;  2A2S A;  2PVO C;  5ECM B;  3GKN A;  2L6D A;  4POK A;  2FUG 2;  4RQR A;  1ML6 A;  1OYJ A;  1K0B A;  2YWI A;  2VAF A;  3TCO A;  2MMA A;  3S9F A;  4G10 A;  5CRE A;  4GLT A;  2I1U A;  2L5O A;  4CY6 A;  4GF0 A;  4MPG A;  2G2Q A;  4DVC A;  5COH A;  18GS A;  1PL1 A;  2KP2 A;  4MZB A;  3QCP A;  2K8S A;  3HZ4 A;  4KDU A;  3KIJ A;  1EV4 A;  4EIP A;  3CSJ A;  1GTA A;  2WGR A;  1YEX A;  2LRN A;  2PMT A;  5HR1 A;  1QQ2 A;  3TKS A;  2IN3 A;  2H1B A;  3VI5 A;  1THO A;  1OVN A;  2WB9 A;  2H0H A;  3IV4 A;  2H30 A;  3FR3 A;  4HI7 A;  3DEX A;  1NHY A;  1WJK A;  3FEU A;  2HSM A;  4KE3 A;  1ZYN A;  1IYI A;  2XBI A;  4PTS A;  5GAN D;  1GTU A;  3LXZ A;  2XPE A;  5HR0 A;  4IGJ A;  5J3R A;  2CVD A;  2WZ9 A;  4MJA A;  5IM9 A;  1V57 A;  2BTO T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...