3UL3A

Structural insights into thioredoxin-2: a component of malaria parasite protein secretion machinery
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
103
structure length
103
Chain Sequence
RLQQNGSNIINGVNMKNTVIVLYFFAKWCQACTMQSTEMDKLQKYYGKRIYLLKVDLDKNESLARKFSVKSLPTIILLKNKTMLARKDHFVSSNDLIALIKKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thioredoxin
publication title Structural insights into thioredoxin-2: a component of malaria parasite protein secretion machinery
doi rcsb
source organism Plasmodium falciparum
molecule tags Oxidoreductase
total genus 29
structure length 103
sequence length 103
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3ul3A01
5IMAA 5D96A 5E59A 2NDOA 2WZ9A 1SENA 4NHWA 3HVXA 5D73A 2GSQA 2KLXA 2GGTA 2OE0A 1HNAA 2C4JA 4OO4A 2VCVA 1ZMAA 2X8CA 2VLVA 3CTGA 3EURA 2D2ZA 4F9ZA 2FWEA 4XCSA 1PGTA 4TXOB 1EP7A 2Z9SA 3M1GA 5D93A 2IJYA 1Y25A 3LFLA 5KN0A 3TKSC 4WF4A 3I69A 4PQIA 1OVNA 4KSMA 2OBKA 4KCEA 1GTAA 4PNFA 3D5JA 4KDYA 2DMMA 2A4VA 2LRCA 1T4YA 4O92A 1G6WA 5HR0A 3ZREA 4F2IA 1K0CA 2KHPA 3KP9A 5ELGA 1W4VA 3PH9A 1QFNA 4K7NA 2H70A 6GSSA 3F4RA 4XS4A 1T3BA 4MH2A 2L5LA 3QAVA 3CTFA 3KH9A 1U6TA 3GV1A 3NIVA 1F3AA 1W89A 1A0FA 3QAWA 1YY7A 5CNWA 5AGYA 5ENUA 1OE8A 1TI3A 2JADA 2FLSA 7GSSA 4JBBA 3LORA 3G7JA 3TDGA 3GTUB 4LLRA 2CQ9A 3FHKA 1XIYA 3HDCA 3ED3A 1ON4A 1TDIA 1A24A 2QSIA 1TK8B 3APQA 1H75A 1G6YA 1B4PA 1PL1A 4J2FA 2M80A 3BCKA 1XWAA 4L0WA 4K0GA 1XCCA 1O8WA 3IHQA 3WGEA 2I3YA 3MAKA 4FYCA 1B9XC 3WT1A 1V9WA 2H74A 2DSAA 3VWXA 1YDKA 1BYEA 4OD7A 5ECLB 4K7IA 2LJRA 1XZOA 1BG5A 3GX8A 3FYGA 2L59A 5IM9A 2YNXA 3VWVA 3DMLA 3F6FA 2H72A 3J7Yk 4DSQA 2P0GA 3G7IA 1GL8A 2IMEA 2OBIA 4TR1B 2HRNA 1Z7RA 1T1VA 1EOGA 4HQZA 2H01A 4RI6A 1TXXA 5G5EA 4TR3A 5GSSA 2IMKA 4OFMA 3ZYWA 2IMIA 4O5RA 3ERGA 3FKFA 4O7HA 5ECIB 3EWLA 4ULXA 3RHBA 1AXDA 4V2MA 4XRDA 2GSRA 3CSHA 1XPVA 5ECRB 3KJYA 2R2JA 3W8JA 4LL1B 1SK1A 4HU7A 2WRTA 3J7Yb 2YZUA 3VPTA 3CBUA 5IMVA 3FR3A 3Q18A 4GQCA 3A2XA 1ZCPA 4TR4A 1KNGA 2BJXA 1SU9A 1GSUA 2NVLA 4KGIA 3EMPA 3C8EA 4MJBA 3ZITA 1J0FA 2C8UA 2IPAA 3GUSA 4GQFA 1HD2A 5G30A 1G0TA 3GKNA 1NHYA 5GSTA 4Q5QA 2VL9A 2EC4A 4E8HA 5G1KA 4WF5A 2I4AA 1YEXA 4G10A 2G2QA 3ERWA 4MABA 2YJHA 1Z5YE 1USBA 4NAXA 2R37A 2HLSA 2RUFA 1S3AA 1VF1A 2LNSA 4MF6A 19GSA 2PMTA 3CRTA 3ZIVA 2DJ3A 2YV9A 1C72A 3IV4A 2F51A 1JLVA 4FYBA 3E3EA 3L9VA 1EV9A 3FZ9A 4FIWA 4EVMA 3FRCA 4DSSA 1VRSD 3JCML 2DC5A 4TW5A 4ILFA 3M0FA 2EIRA 4MJAA 4ZILA 1FVJA 5G5FA 4ZIJA 2YN1A 4NMUA 3LXZA 3CRUA 5DCHA 2IIYA 2L5OA 2PERA 1SD8A 1WMJA 1U88A 3UBLA 3P7XA 1Z7PA 1AQWA 2R4VA 1OC9B 5DQYA 3D4TA 2B7KA 3UVHA 1XXUA 2WCIA 5EY6A 4CHSA 5J3RA 3D6IA 1ILOA 2C0DA 4GWRA 5DQSA 3E0UA 4MJCA 1M99A 1OC9A 4K0NA 3RAZA 4IN0A 5INYA 1XWKA 1ERVA 1O73A 3EMXA 3WGDA 2PPTA 5AN1A 5JWRB 5IPGA 2HXKA 1MEKA 1Q98A 2YWIA 4HZ4A 4G9HA 4HJMA 2GZZA 2C3NA 1F3BA 2I9HA 2AHEA 2GSSA 2ZCTA 1ACVA 1ZYEA 2M46A 5IMFA 3LG6A 2GVPA 4Q5NA 3KH7A 3A2VA 2H0IA 3MWHA 1J08A 3VWUA 4MMMA 2C0FA 3EU4A 2GSTA 3ZFLA 2RUEA 3V1WA 3TUEA 2C3TA 4ECBA 1BJXA 4MK3A 2CZ2A 1H4OA 1J9BA 5EPFA 3UMAA 2YP6A 4RI7A 1JZRA 2HI7A 2VM1A 5ECQB 1SJZA 4I6XA 1XW5A 2AUVA 2H0GA 2L4QA 4HDEA 5H5RA 4JU5A 4XS6A 2WDUA 1EEJA 1GUHA 1SYRA 1XOBA 3ERFA 3GHAA 1TW9A 2AV4A 3ZMKA 3LYKA 2JU5A 1DUGA 5DJLA 2GDRA 4AJ8A 5G31A 2FWHA 1SL2B 1YKCA 3UOMA 3M8NA 3WT2A 3IK9A 5JCGA 2JZRA 3NZNA 1YJ6A 5AISA 1HQOA 2H30A 3IR4A 3EYTA 3L9UA 3MSZA 3FEUA 1GTBA 16GSA 4ZBDA 1GH2A 1Q4JA 4IBPA 1TP9A 3F63A 2LUSA 5ECKB 2MBSA 3ZL5A 1QXHA 5J5NA 2DIYA 2IFQA 17GSA 3Q6OA 2IWTA 2REMA 1F9MA 3HJOA 1K3YA 4BVYA 2YJ7A 3Q19A 3M9KA 2K6VA 1ZGNA 2VCQA 4K9ZA 1SKRB 1CQGA 4TOPA 2ON7A 3CMIA 4ZL8A 2IMDA 2PBJA 3EU3A 4X1UA 1TTZA 3DIEA 5IOXA 3RHCA 5COHA 4NHZA 4ZL7A 3TKSE 1K0DA 3WGXA 12GSA 3C1RA 5DBQA 3HY2A 1YF1A 2B5EA 3IRAA 4XTSA 4BA7A 3ZIJA 3KGKA 2X8HA 4E8EA 2MBTA 2WGRA 3LXTA 1X9WB 3F9UA 6GSWA 1B9YC 4EUYA 1PKWA 1UVZA 2B1KA 1SL0B 3L4NA 4IJIA 5KN2A 5DAKA 3WD6A 3U5RE 1EGRA 1S3DA 5CRDA 3QAGA 5LD0A 3GNJA 1YF0A 1SD9A 2JZTA 3FR9A 3BOAA 3GYKA 3ZRDA 3ZLPA 2L57A 4BWSA 4L5OA 3KEBA 5IPHA 3IXRA 4OCEA 2ZNMA 4IVFA 2B1LA 1R5AA 2WULA 4LMVA 5CP1A 2H75A 2DJ1A 2J9HA 2HT9A 2O85A 1PA3A 4PXOA 4TRXA 2ES7A 5ABRA 2VM2A 3FK8A 1M2DA 2DJ2A 4N10A 4Z7XA 3HJPA 2CZ3A 2WJUA 4YQMA 3VI7A 5H5QA 1OKDA 2PUKC 5FT3A 5DCGA 5F05A 2MMOA 2VD0A 3KM6A 5IO2A 4WBRD 4HJ2A 2KOKA 1U87A 1O81A 5DALB 2LEGA 2NTOA 4XS4B 2M72A 2HFDA 4IKHA 2C1YA 1BAYA 4ECCA 2F3MA 4V2NA 2X8GA 5DALA 1RQMA 2C0GA 3O76A 3HXSA 3UEMA 4TR0A 2CX4A 2P5QA 1GP1A 1X0RA 3GA4A 1BEDA 3I9V2 3I6AA 1FO5A 4LA1A 1FB6A 3LGCA 2PVOC 2VLUA 1FG4A 4EE0A 1TJDA 4EF0A 2DJ0A 2K8SA 1DSBA 3L78A 2QKEA 4BWQA 4GCIA 3H8QA 2R6KA 1EP8A 5LNKe 4P3YB 6GSUA 1M9BA 4POKA 3GH9A 2VCZA 4EXJA 1PQNA 3EINA 2QGVA 4MP4A 3RDWA 3UIWA 2XBIA 1GUKA 4DVCA 2X99A 1KTEA 5F8BA 1SKWB 4AF2A 2E7PA 3HD5A 4RQXA 5ID2A 2RIIA 18GSA 1VF3A 1ZOFA 3QOUA 1MDJA 4KE3A 2YZHA 2YV7A 2V1MA 3TB2A 2LJAA 1AC1A 2HSHA 1X9MB 4OFTA 4KNDA 4QL9A 2AAWA 4EDZA 3IA1A 2N5AA 4MZCA 3FZ4A 3DD3A 3IE3A 1ZL9A 1V57A 3N5OA 4EKZA 3ME7A 3BJ5A 3FZ5A 1K3OA 3GSSA 4MJEA 1K0BA 5A4WA 1XWGA 3EE2A 3VPQA 3VLNA 8GSSA 4HZ2A 4WEYA 4WR4A 3VK9A 3LYPA 1PN9A 2GS3A 5D9XA 1JZOA 1G7OA 4NPBA 22GSA 3P90A 5DVBA 1WPIA 3DYRA 1QMVA 5H5SA 3W8SA 3IC4A 4MH3A 1F2EA 1PX7A 5D8IA 4ZL9A 4D73A 4IHUA 4V1Ag 4IP6A 3KTLA 5J4UA 4WR5A 1K0OA 1IYIA 1BX9A 3W6GA 3C71A 1JLWA 1WWJA 5A5KA 5HR1A 4L8EA 5KN1A 1TOFA 5D9TA 1I9DA 4GF0A 3H93A 4LMWA 2YWNA 3HYPA 1X5DA 3BCIA 1EV4A 1O8XA 3WYWA 1YEPA 2H1GA 1A2MA 3MNGA 4LL4B 2VL3A 5CRWA 1O6JA 2H76A 3UAPA 4Q5RA 2TRXA 3ISOA 2CX3A 1GTIA 1EOHA 4HQSA 3F4TA 1GSSA 1BQ7A 1MD4A 3EC3A 3D21A 2RM6A 3GL5A 3GX0A 3TJFA 3D0ZA 4JR6A 4I2UA 4DSSB 2MMZA 4JRRA 3GH6A 1A8LA 5KEJA 4KH7A 3DEXA 1GSQA 4MPGA 3BD2A 3G7YA 2V6KA 4IQAA 3KD0A 5IMDA 2BMXA 4MLYA 4NWYA 4GTUA 1MDIA 1FB0A 4IS0A 3PGTA 1HNCA 4GRFA 2AB6A 2B5XA 3GFKA 5J41A 1GUMA 1V2AA 1N2AA 3GIXA 2GLRA 2J23A 3QDNA 2YOIA 4RUVA 3TJGA 1T7PB 3L9SA 2FGXA 2DJJA 3HCZA 1TU8A 1K0NA 2VO4A 3TKRA 4J57E 3LEFA 1JZDA 5ECMB 2JSZA 4I2TA 1S3CA 4XS1A 5ECNB 3QFAC 1PKZA 5F07A 2XHFA 3GN3A 2H6XA 2IL3A 2KUCA 1TRUA 3GL3A 4F82A 3IBHA 4JE1A 2MZCA 1Z9HA 4GXZA 3HJMA 1GRXA 2CAIA 1GTUA 4MF7A 5A4VA 1I5GA 11GSA 4X43A 3LSZA 2HZFA 1OC3A 3G9BA 4G2EA 4OCFA 4KSOA 5D9WA 4YAPA 2B3SA 3ME8A 1ST9A 1XVWA 3TKQA 3VI5A 3H79A 5AIXA 4OFNA 3FR6A 4WXTA 2R3XA 3HVSA 1LBKA 2DIZA 5ELAA 1B4QA 2GQMA 4H86A 4I97A 6GSYA 2H8LA 3P2AA 2E0QA 1Y6EA 3GRXA 2ON5A 2HNLA 3TRQA 1A0RP 3F3RA 2XPDA 1U3IA 3APSA 1T00A 3DVXA 1PRXA 3NOFA 4ZB9A 4TVEA 2ALBA 3PINA 2V41A 5FWGA 3BBYA 4OO5A 1F6MC 4MA9A 1AW9A 1KBNA 6GSTA 1EEMA 3H4KA 1SJ6A 3QR6A 3KMNA 4FO5A 3IAM2 13GSA 2F8FA 4F03A 3IDVA 2GZPA 1VF2A 3ZZXA 3QCPA 5JWOB 5B7CA 3UL3A 1QUWA 3A2WA 1UA5A 3MDKA 5A4UA 1DE2A 4IP1A 4FH8A 2IFQB 2JACA 5G2ZA 2E2GA 2IMFA 4I5QA 3FY7A 2DJKA 3HZ4A 4PQ1A 2BTOT 4IW9A 5HR3A 4ML1A 2NPBA 1R5PA 3GKKA 4EC0A 2N5FA 2RLIA 2LRNA 4ISDA 1ERUA 5J9CA 1IYHA 2P5RA 1QGVA 3VWWA 1GSFA 2OACA 5B8BA 4YQUA 4Q5FA 1AIUA 2EIOA 4WETA 3TCOA 3D22A 4KUNA 2HZEA 1WIKA 1SL1B 1X9SB 3RBTA 1M9AA 2PVQA 4X0XA 4AJ6A 1MD3A 4OWYA 1M2AA 3HZ8A 1DE1A 4IGJA 4HS1A 1TRSA 1THOA 5DAKB 2TRCP 4QQ7A 1V40A 1Z3EA 3IK7A 1SK2A 3DWVA 2N5BA 2FWFA 4IELA 3HKRA 3TJJA 4K8MA 1O85A 1HYUA 1NSWA 1HNBA 3M9JA 3F3QA 4AGSA 2YWMA 5GZZB 2K9FA 2XC2A 3KP8A 2L6DA 2CVKA 5HFKA 4ID0A 4EO3A 2H66A 1GWCA 2CV4A 1YZXA 2FY6A 4K6XA 2HSYA 2WS2A 2AYTA 5IO0A 4K2DA 3TOTA 4TN8A 5E4WA 4GSTA 1PX6A 1ABAA 2KP2A 2LNTA 4CDOA 1A8YA 3ZTLA 5CO3A 3TKSA 3TRXA 1PL2A 1URMA 1WE0A 2RM5A 3VFIA 2PU9C 3SWLA 4IJ3A 2MMAA 5ECHB 1RW1A 4CW9A 2R5GA 2VD1A 1TU7A 4N0ZA 1NW2A 1XWBA 4JR4A 5JCUA 1FHEA 4HOJA 4PGTA 4PURA 5IQYA 4TXOA 1E2YA 2CA8A 1FAAA 2GZYA 4PUFC 2B7JA 5CAXA 2H1AA 1T8EB 1XWCA 2HYXA 3DVWA 1ML6A 1ERTA 3RPPA 1FOVA 2VL2A 2O87A 3C7MA 3QFBC 3APOA 5C04A 1TRVA 3DXBA 1UC7A 4BVXA 5GAND 2LQQA 14GSA 5CYYA 4BPYA 4JZQA 1K0AA 3A3TA 4GSNA 3SBCA 2H73A 4BL7A 2FA4A 4HI7A 5HFIA 2VL2C 1XW6A 4MZBA 1SKSB 1LJRA 2DBCA 1XVQA 1U3AA 2EIQA 2DLXA 2VLTA 1SJIA 3EVIA 3Q74A 4K7OA 5ID2B 1T4ZA 2OJLA 2JZSA 1OKTA 1GNEA 4G19A 2GTUA 4K1FA 5HR2A 4KCAA 5DDLA 2HRFA 2L4CA 4HU9A 4IQ1A 1ZYQB 3KMOA 2A2SA 3GSTA 3F4SA 2V2GA 4PUAA 1YKAA 1N8JA 3GTUA 2FHEA 4PQHA 2G0FA 1SYXA 2FWGA 2VAFA 2KP1A 5IMCA 5B6NA 4WKWA 2C3QA 1WOUA 1M0UA 4ML6A 1RK4A 4HEA2 2O7KA 3C1SA 2GT6A 4MCUA 3KTBA 1GLPA 3ZVJD 2XBQA 1OE7A 1OAZA 5CRGA 3VURA 5IIZA 1A2LA 4YQVA 1XW9A 3KXOA 2K8VA 5GAPD 3UVTA 3US3A 3UARA 3DRNA 4D73B 1GSDA 1F37A 4MZWA 1AUCA 1K0MA 4ECIA 5FHIA 1O7UA 2O8VB 2VCXA 3GURA 1PD21 1MDKA 3F8UA 3U6VA 4TR1A 4N0VA 3LQ7A 1JHBA 3ZMLA 1X5CA 1THXA 1EWXA 5JWQB 3R2QA 5AIVA 2AJQB 4PX1A 1G7EA 1PSQA 3H1NA 1WP0A 1B8XA 2LKUA 4QL7A 4DSRA 1FW1A 2JL4A 1XOAA 5JCWA 1V98A 2LJKA 5F0GA 5HFGA 2CAQA 1X5EA 2YANA 2LSTA 2LRTA 3ZVJA 4RQRA 1GLQA 4NV5A 5D9VA 5LCZA 3I43A 3UJ1A 1V58A 4L5LA 2I81A 3IAS2 1JZWA 2K18A 1UN2A 2I1UA 4AJ7A 3F6DA 20GSA 3CSJA 1TI1A 4NV2A 4EL1A 1NM3A 2PWJA 2OE1A 1JFUA 1E6BA 5IOWA 1GNWA 1GSEA 1A2JA 2GT5A 2VIMA 2O89A 3KCMA 3TKPA 3FW2A 5L71A 2FD3A 1AQVA 4NXIA 3UBKA 4GSSA 4KDXA 4FYUA 5HQPA 4TXVA 3GKXA 4O32A 2H6YA 5ECSA 1FVKA 3L0HA 4KA0A 1AQXA 4V1Ap 2JSYA 4PNGA 2H6ZA 1Z6MA 1ZZYA 1ERWA 2PGTA 1Z6NA 2PN8A 1A23A 2HE3A 2OE3A 3A5WA 3KZQA 5ECPB 2F9SA 1K3LA 4XIHA 2V6OA 1OC8A 3N9JA 3TOUA 4POMA 5C00A 3CSIA 1OYJA 3HVVA 2H1BA 4EDYA 3GMFA 1EZKA 2LS5A 5ECOB 2FCHA 4F0BA 2LTKA 2A2RA 2CVDA 3CXGA 3DGQA 4MDCA 2IN3A 3KIJA 4MPFA 2ZUPA 4KW6A 3OR5A 1QQ2A 6GSVA 5KN3A 3QD9A 4KB3A 2DMLA 2H19A 1WRYA 3TJBA 1DBYA 3TRPA 6GSXA 3RPNA 1VF4A 1EGOA 2CT6A 3HA9A 2C80A 2OADA 1QK8A 1PMTA 2VCTA 4ZXGA 3IOSA 4I8BA 4N11A 4V2LA 2MYGA 3IPZA 3TJKA 2VOCA 1B48A 2TIRA 5DJMA 4GLTA 4XHMA 3QMXA 4DEJA 2H0HA 2MMNA 4KDUA 3O6TA 1R4WA 2FNOA 1MTCA 1KEBA 4ECJA 4KX4A 1M2BA 1TK5B 5F06A 2GQKA 4ZBBA 4OMVA 2LQOA 2FA8A 4ACSA 2YCDA 1GSYA 1M7TA 2F8AA 2YPMA 2L6CA 1TRWA 2P31A 1TK0B 3M3MA 1YQ1A 2YWOA 3ZFBA 3PR8A 4XRAA 4F0CA 2WB9A 9GSSA 5EL8A 2H1DA 1NHOA 3E9JB 1TKDB 2B5YA 4KAEA 1GULA 5J9BA 2QC7A 3FZAA 5B6MA 3AY8A 2HZEB 3LWAA 5CRHA 4ZBAA 2VCWA 1SK0A 2H71A 3GKMA 1CQHA 4L0UA 10GSA 3TGZA 5CREA 4ZB8A 1R7HA 3DKSA 1LU4A 2WFCA 5B8AA 3D4MA 3LJRA 2V32A 1XBSA 4N30A 2XPEA 4JEDA 5IMZA 4YH2A 2OA7A 3O3TA 2FUG2 2GQLA 2C0EA 1XFLA 2OKAA 1AAZA 4POBA 1WJKA 2VUPA 2LV3A 4TKYA 4POLA 4HUAA 3HHVA 2NBSA 2CVBA 1VGLA 4MF5A 3F0IA 2X64A 4WBJA 4J56E 4ZB6A 2B6MA 3K8NA 3QPMA 3C73A 4YAVA 2E2MA 1R26A 3S9FA 5G1LA 3P8WA 3CYNA 5EVOA
chains in the Genus database with same CATH superfamily
5IMAA 5D96A 5E59A 4Z2UA 2NDOA 4Z2RA 2WZ9A 1SENA 4NHWA 3HVXA 5D73A 2GSQA 2KLXA 2GGTA 2OE0A 1HNAA 2C4JA 4OO4A 2VCVA 1ZMAA 2X8CA 2VLVA 3CTGA 3EURA 2D2ZA 4F9ZA 2FWEA 4XCSA 1PGTA 4TXOB 1EP7A 2Z9SA 3M1GA 5D93A 2IJYA 1Y25A 3LFLA 5KN0A 3TKSC 4WF4A 1FOHA 3I69A 4PQIA 1OVNA 4KSMA 2OBKA 4KCEA 4K5SA 1GTAA 4PNFA 3D5JA 4KDYA 2DMMA 2A4VA 2LRCA 1T4YA 4O92A 1G6WA 5HR0A 3ZREA 4F2IA 1K0CA 4BL7B 2KHPA 3KP9A 5ELGA 1W4VA 3PH9A 1QFNA 4K7NA 2H70A 6GSSA 3F4RA 4XS4A 1T3BA 4MH2A 2L5LA 3QAVA 3CTFA 3KH9A 3PPUA 1U6TA 3GV1A 3NIVA 1F3AA 1W89A 1A0FA 3QAWA 1YY7A 2R0GA 5CNWA 5AGYA 5ENUA 1OE8A 1TI3A 2JADA 2FLSA 7GSSA 4JBBA 3LORA 3G7JA 3TDGA 3GTUB 4LLRA 2CQ9A 3FHKA 1XIYA 3HDCA 3ED3A 1ON4A 1TDIA 1A24A 2QSIA 1TK8B 1M3IA 3APQA 1H75A 1G6YA 1B4PA 1PL1A 4J2FA 2M80A 3BCKA 1XWAA 4L0WA 4K0GA 1XCCA 1O8WA 3IHQA 3WGEA 2I3YA 3MAKA 4FYCA 1B9XC 3WT1A 1V9WA 2QA1A 2H74A 2DSAA 3VWXA 1YDKA 1BYEA 4OD7A 5ECLB 4K7IA 2LJRA 1XZOA 1BG5A 3GX8A 1S3RA 3FYGA 2L59A 3EPTA 4MNNA 5IM9A 2YNXA 3VWVA 3DMLA 3F6FA 2H72A 3J7Yk 4DSQA 2P0GA 3G7IA 1GL8A 2IMEA 2OBIA 4TR1B 2HRNA 1Z7RA 1T1VA 1EOGA 4HQZA 2H01A 4RI6A 1TXXA 5G5EA 4TR3A 5GSSA 2IMKA 4OFMA 3ZYWA 2DKHA 2IMIA 4O5RA 3ERGA 3FKFA 4O7HA 5ECIB 3EWLA 4ULXA 3RHBA 1AXDA 4V2MA 4XRDA 1XG8A 2GSRA 3CSHA 1XPVA 5ECRB 3KJYA 2R2JA 3W8JA 4LL1B 1SK1A 4HU7A 2WRTA 3J7Yb 2YZUA 3VPTA 3CBUA 5IMVA 3FR3A 3Q18A 4GQCA 3A2XA 1ZCPA 4TR4A 1KNGA 2BJXA 1SU9A 1GSUA 2NVLA 4KGIA 3EMPA 3C8EA 4MJBA 3ZITA 1J0FA 2C8UA 2IPAA 3GUSA 4GQFA 1HD2A 5G30A 1G0TA 3CQFA 3GKNA 1NHYA 5GSTA 4Q5QA 2VL9A 2EC4A 4E8HA 5G1KA 4WF5A 2I4AA 1YEXA 4G10A 2G2QA 3ERWA 4MABA 2YJHA 1Z5YE 1USBA 4NAXA 2R37A 2HLSA 2RUFA 1S3AA 1VF1A 2LNSA 4MF6A 19GSA 2PMTA 3CRTA 4K5RA 3ZIVA 2DJ3A 2YV9A 1C72A 3IV4A 2F51A 1JLVA 4FYBA 3E3EA 3L9VA 1EV9A 3FZ9A 4FIWA 4EVMA 3FRCA 4DSSA 1VRSD 3JCML 2DC5A 3LW9A 4TW5A 4ILFA 3M0FA 2X49A 2EIRA 4MJAA 4ZILA 1FVJA 5G5FA 4ZIJA 2YN1A 4NMUA 3LXZA 3CRUA 5DCHA 2IIYA 2L5OA 2PERA 1SD8A 1WMJA 1U88A 3UBLA 3P7XA 1Z7PA 1AQWA 2R4VA 1OC9B 4K2XA 5DQYA 3D4TA 2B7KA 3UVHA 1XXUA 2WCIA 5EY6A 4CHSA 5J3RA 3D6IA 1ILOA 2C0DA 4GWRA 5DQSA 3E0UA 4MJCA 1M99A 1OC9A 4K0NA 3RAZA 3FMWA 4IN0A 5INYA 1XWKA 1ERVA 1O73A 3EMXA 3WGDA 2PPTA 5AN1A 5JWRB 5IPGA 2HXKA 1MEKA 1Q98A 2YWIA 4HZ4A 4G9HA 4HJMA 2GZZA 2C3NA 1F3BA 2I9HA 2AHEA 2GSSA 2ZCTA 1ACVA 1ZYEA 2M46A 5IMFA 3LG6A 2GVPA 4Q5NA 3KH7A 3A2VA 2H0IA 3MWHA 1J08A 3VWUA 4MMMA 2C0FA 3EU4A 2GSTA 3ZFLA 2RUEA 3V1WA 3TUEA 2C3TA 4ECBA 1BJXA 4MK3A 2CZ2A 1H4OA 1J9BA 5EPFA 3UMAA 2YP6A 4RI7A 1JZRA 2HI7A 2VM1A 5ECQB 1SJZA 4I6XA 1XW5A 2AUVA 2H0GA 2L4QA 4HDEA 5H5RA 4JU5A 4XS6A 2WDUA 1EEJA 1GUHA 1SYRA 3HVNA 4G0LA 1XOBA 2X4AA 3ERFA 3GHAA 1TW9A 2AV4A 3ZMKA 3LYKA 2JU5A 1DUGA 5DJLA 2GDRA 4AJ8A 5G31A 2FWHA 1SL2B 1YKCA 3UOMA 3M8NA 3WT2A 3IK9A 5JCGA 2JZRA 3NZNA 5KOWA 1YJ6A 5AISA 1HQOA 2H30A 3IR4A 3EYTA 3L9UA 4BVYB 3MSZA 3FEUA 1GTBA 16GSA 4ZBDA 1GH2A 1Q4JA 4IBPA 1TP9A 3F63A 2LUSA 5ECKB 2MBSA 3ZL5A 1QXHA 5J5NA 2DIYA 2IFQA 17GSA 3Q6OA 2IWTA 2REMA 1F9MA 3HJOA 1K3YA 4BVYA 2YJ7A 3Q19A 3M9KA 2K6VA 1ZGNA 2VCQA 4K9ZA 1SKRB 4FQUA 1CQGA 4TOPA 2ON7A 4HSCX 3CMIA 4ZL8A 2IMDA 2PBJA 3EU3A 4X1UA 1TTZA 2UZ8A 3DIEA 5IOXA 3RHCA 5COHA 4NHZA 4ZL7A 3TKSE 1K0DA 3WGXA 12GSA 3C1RA 5DBQA 3HY2A 1YF1A 2B5EA 3IRAA 4XTSA 4BA7A 3ZIJA 3KGKA 4YKFA 2X8HA 4E8EA 2MBTA 2WGRA 3LXTA 1X9WB 3F9UA 6GSWA 2R0PA 1B9YC 4EUYA 1PKWA 1UVZA 2B1KA 1SL0B 3L4NA 4IJIA 5KN2A 5DAKA 3WD6A 3U5RE 1EGRA 1S3DA 5CRDA 3QAGA 5LD0A 3GNJA 1YF0A 1SD9A 2JZTA 3FR9A 3BOAA 3GYKA 3ZRDA 3ZLPA 2L57A 4BWSA 4L5OA 4X4JA 3KEBA 5IPHA 3IXRA 4OCEA 2ZNMA 4IVFA 2B1LA 1R5AA 2WULA 4LMVA 5CP1A 2H75A 2DJ1A 2J9HA 2HT9A 2O85A 1PA3A 4PXOA 4TRXA 2ES7A 5ABRA 2VM2A 3FK8A 1M2DA 2DJ2A 4N10A 4Z7XA 3HJPA 2CZ3A 2WJUA 2QA2A 4YQMA 3VI7A 5H5QA 1OKDA 2PUKC 5FT3A 5DCGA 5F05A 2MMOA 2VD0A 3KM6A 5IO2A 4WBRD 4HJ2A 2KOKA 1U87A 1O81A 5DALB 2LEGA 2NTOA 4XS4B 2M72A 2HFDA 4IKHA 2C1YA 1ZYNA 1BAYA 2A2PA 4ECCA 2F3MA 4V2NA 2X8GA 5DALA 1RQMA 2C0GA 3O76A 3HXSA 3UEMA 4TR0A 2CX4A 3IC8A 2P5QA 1GP1A 1X0RA 3GA4A 1BEDA 3I9V2 3I6AA 1FO5A 4LA1A 1FB6A 3LGCA 2PVOC 2VLUA 1FG4A 4EE0A 1TJDA 4EF0A 2DJ0A 2K8SA 1DSBA 3L78A 2QKEA 4BWQA 4GCIA 3H8QA 2R6KA 1EP8A 5LNKe 4P3YB 6GSUA 4USSA 1M9BA 4CY8A 4POKA 3GH9A 2VCZA 4EXJA 1PQNA 3EINA 2QGVA 4MP4A 3RDWA 3UIWA 2XBIA 1GUKA 4DVCA 2X99A 1KTEA 5F8BA 1SKWB 4AF2A 2E7PA 3HD5A 4RQXA 5ID2A 2RIIA 18GSA 1VF3A 1ZOFA 3QOUA 1MDJA 4KE3A 2YZHA 2YV7A 2V1MA 3TB2A 2LJAA 1AC1A 2HSHA 1X9MB 4OFTA 4KNDA 4QL9A 2AAWA 4EDZA 3IA1A 2N5AA 4MZCA 3FZ4A 3DD3A 3IE3A 1ZL9A 1V57A 3N5OA 4EKZA 3ME7A 3BJ5A 2R0CA 3FZ5A 1K3OA 3GSSA 4MJEA 1K0BA 5A4WA 1XWGA 3EE2A 3VPQA 1M3JA 3VLNA 8GSSA 4HZ2A 4WEYA 4WR4A 3VK9A 3LYPA 1PN9A 2GS3A 5D9XA 1JZOA 1G7OA 4NPBA 22GSA 3P90A 5DVBA 1WPIA 3DYRA 1QMVA 5H5SA 3W8SA 3IC4A 4MH3A 1F2EA 1PX7A 5D8IA 4ZL9A 4D73A 4IHUA 4V1Ag 4IP6A 3KTLA 5J4UA 4KF9A 4WR5A 1K0OA 1IYIA 1BX9A 3W6GA 3C71A 1JLWA 1WWJA 5A5KA 5HR1A 4L8EA 5KN1A 1TOFA 5D9TA 1I9DA 4GF0A 3H93A 4LMWA 2YWNA 3HYPA 1X5DA 3BCIA 1EV4A 1O8XA 3WYWA 1YEPA 2H1GA 1A2MA 3MNGA 4LL4B 2VL3A 5CRWA 1O6JA 4BIKA 2H76A 3UAPA 4Q5RA 2TRXA 3ISOA 2CX3A 1GTIA 1EOHA 4HQSA 3F4TA 1GSSA 1BQ7A 1MD4A 4ICYA 3EC3A 3D21A 2RM6A 3GL5A 3GX0A 3TJFA 3D0ZA 4JR6A 4I2UA 4DSSB 2MMZA 4JRRA 3GH6A 1A8LA 5KEJA 4KH7A 3DEXA 1GSQA 4MPGA 3BD2A 3G7YA 2V6KA 4IQAA 3KD0A 5IMDA 2BMXA 4MLYA 4NWYA 4GTUA 1MDIA 1FB0A 4IS0A 3PGTA 1HNCA 4GRFA 2AB6A 2B5XA 3GFKA 5J41A 1GUMA 1V2AA 5KOXA 1N2AA 3GIXA 2GLRA 2J23A 3QDNA 2YOIA 4G0KA 4RUVA 3TJGA 1T7PB 3L9SA 2FGXA 2DJJA 3HCZA 1TU8A 1K0NA 2VO4A 3TKRA 4J57E 3LEFA 1JZDA 5ECMB 2JSZA 4I2TA 1S3CA 4XS1A 5ECNB 3QFAC 1PKZA 5F07A 2XHFA 3GN3A 2H6XA 2IL3A 2KUCA 1TRUA 3GL3A 4F82A 3IBHA 4JE1A 2MZCA 1Z9HA 4GXZA 3HJMA 1GRXA 2CAIA 1GTUA 4MF7A 5A4VA 1I5GA 11GSA 4X43A 5BRTA 3LSZA 2HZFA 1OC3A 3G9BA 4EIQA 4G2EA 4OCFA 4KSOA 5D9WA 4YAPA 2B3SA 3ME8A 1ST9A 1XVWA 3TKQA 3VI5A 3H79A 5AIXA 4OFNA 3FR6A 4WXTA 2R3XA 3HVSA 1LBKA 2DIZA 5ELAA 1B4QA 2GQMA 4H86A 4I97A 6GSYA 2H8LA 3P2AA 2E0QA 1Y6EA 3GRXA 2ON5A 2HNLA 3TRQA 1A0RP 3F3RA 2XPDA 1U3IA 3APSA 1T00A 3DVXA 1PRXA 3NOFA 4ZB9A 4TVEA 2ALBA 3PINA 2V41A 5FWGA 3BBYA 4OO5A 1F6MC 4MA9A 1AW9A 1KBNA 6GSTA 1EEMA 3H4KA 1SJ6A 3QR6A 3KMNA 4FO5A 3IAM2 13GSA 2F8FA 4F03A 3IDVA 2GZPA 1VF2A 3ZZXA 3QCPA 5JWOB 5B7CA 3UL3A 4Z2TA 4EIPA 1QUWA 3A2WA 1UA5A 3MDKA 5A4UA 1DE2A 4IP1A 4FH8A 2IFQB 2JACA 5G2ZA 2E2GA 2IMFA 4I5QA 3FY7A 2DJKA 3HZ4A 4PQ1A 2BTOT 4IW9A 5HR3A 4ML1A 2NPBA 1R5PA 3GKKA 4EC0A 2N5FA 2RLIA 2LRNA 4ISDA 1ERUA 5J9CA 1IYHA 2P5RA 1QGVA 3VWWA 1GSFA 2OACA 5B8BA 4YQUA 4Q5FA 1AIUA 2EIOA 4WETA 3TCOA 3D22A 4KUNA 2HZEA 4A5PA 1WIKA 1SL1B 1X9SB 3RBTA 1M9AA 2PVQA 4X0XA 4AJ6A 1MD3A 4OWYA 1M2AA 3HZ8A 1DE1A 4IGJA 4HS1A 1TRSA 1THOA 5DAKB 2TRCP 4QQ7A 1V40A 1Z3EA 3IK7A 1SK2A 3DWVA 2N5BA 2FWFA 4IELA 3HKRA 3TJJA 4K8MA 1O85A 1HYUA 1NSWA 1HNBA 3M9JA 3F3QA 4AGSA 2YWMA 5GZZB 2K9FA 2XC2A 3KP8A 2L6DA 2CVKA 5HFKA 4ID0A 4EO3A 2H66A 1GWCA 2CV4A 1YZXA 2FY6A 4K6XA 2HSYA 2WS2A 2AYTA 5IO0A 4K2DA 3TOTA 4TN8A 2HRAA 5E4WA 4GSTA 1PX6A 1ABAA 2KP2A 2LNTA 4CDOA 1A8YA 3ZTLA 5CO3A 3TKSA 4CY6A 3TRXA 1PL2A 1URMA 1WE0A 2RM5A 3VFIA 2PU9C 3SWLA 4IJ3A 2MMAA 5ECHB 1RW1A 4CW9A 2R5GA 2VD1A 4PTSA 1TU7A 4N0ZA 1NW2A 1XWBA 4JR4A 5JCUA 1FHEA 4HOJA 4PGTA 4PURA 5IQYA 4TXOA 1E2YA 2CA8A 1FAAA 2GZYA 4PUFC 4BVXB 2B7JA 5CAXA 2H1AA 1T8EB 5BMUA 1XWCA 2HYXA 3DVWA 1ML6A 1ERTA 3RPPA 1FOVA 2VL2A 2O87A 3C7MA 3QFBC 3APOA 5C04A 1TRVA 3DXBA 1UC7A 4BVXA 5GAND 2LQQA 14GSA 5CYYA 4BPYA 4JZQA 1K0AA 3A3TA 4GSNA 3SBCA 2H73A 4BL7A 2FA4A 4HI7A 5HFIA 2VL2C 1XW6A 4MZBA 1SKSB 1LJRA 2DBCA 1XVQA 1U3AA 2EIQA 2DLXA 2VLTA 1SJIA 3EVIA 3Q74A 4K7OA 5ID2B 1T4ZA 2OJLA 2HRKA 2JZSA 1OKTA 1GNEA 4G19A 2GTUA 4K1FA 5HR2A 4KCAA 5DDLA 2HRFA 2L4CA 4HU9A 4IQ1A 1ZYQB 3KMOA 4O5UA 2A2SA 3GSTA 3F4SA 2V2GA 4PUAA 1YKAA 1N8JA 3GTUA 2FHEA 4PQHA 2G0FA 1SYXA 2FWGA 2VAFA 2KP1A 5IMCA 5B6NA 4WKWA 2C3QA 1WOUA 1M0UA 4ML6A 1RK4A 4HEA2 2O7KA 3C1SA 2GT6A 4MCUA 3KTBA 1GLPA 3ZVJD 2XBQA 1OE7A 1OAZA 5CRGA 3VURA 5IIZA 1A2LA 4YQVA 1XW9A 3KXOA 2K8VA 5GAPD 3UVTA 3US3A 3UARA 3DRNA 4D73B 1GSDA 1F37A 4MZWA 1AUCA 1K0MA 4ECIA 5FHIA 1O7UA 2O8VB 2VCXA 3GURA 1PD21 1MDKA 3F8UA 3U6VA 4TR1A 4N0VA 3LQ7A 1JHBA 3ZMLA 1X5CA 1THXA 1EWXA 5JWQB 3R2QA 5AIVA 2AJQB 4PX1A 1G7EA 1PSQA 3H1NA 1WP0A 1B8XA 2LKUA 4QL7A 4DSRA 1FW1A 2JL4A 1XOAA 5JCWA 1V98A 2LJKA 5F0GA 5HFGA 2CAQA 1X5EA 2YANA 2LSTA 2LRTA 1PFOA 3ZVJA 4RQRA 1GLQA 4NV5A 5D9VA 5LCZA 3I43A 3UJ1A 1V58A 4L5LA 2I81A 3IAS2 1JZWA 4O5QA 2K18A 1UN2A 2I1UA 4AJ7A 3F6DA 20GSA 3CSJA 1TI1A 4NV2A 4EL1A 1NM3A 2PWJA 2OE1A 1JFUA 1E6BA 5IOWA 1GNWA 1GSEA 1A2JA 2GT5A 2VIMA 2O89A 3KCMA 3TKPA 3FW2A 5L71A 2FD3A 1AQVA 4NXIA 3UBKA 4GSSA 4KDXA 4FYUA 5HQPA 4TXVA 3GKXA 4O32A 2H6YA 5ECSA 1FVKA 3L0HA 4KA0A 1AQXA 4V1Ap 2JSYA 4PNGA 2H6ZA 1Z6MA 1ZZYA 1ERWA 2PGTA 1Z6NA 2PN8A 1A23A 2HE3A 2OE3A 3A5WA 3KZQA 5ECPB 2F9SA 1K3LA 4XIHA 2V6OA 3MIXA 3R3EA 1OC8A 3N9JA 3TOUA 4POMA 5C00A 3CSIA 1OYJA 3HVVA 3A5IA 2H1BA 4EDYA 3GMFA 1EZKA 2LS5A 5ECOB 2FCHA 4F0BA 2LTKA 2A2RA 2CVDA 3CXGA 3DGQA 4MDCA 2IN3A 3KIJA 4MPFA 2ZUPA 4KW6A 3OR5A 1QQ2A 6GSVA 5KN3A 3QD9A 4KB3A 2DMLA 2H19A 1WRYA 3TJBA 1DBYA 3TRPA 6GSXA 3RPNA 1VF4A 1EGOA 2CT6A 3HA9A 2C80A 1PN0A 1QK8A 2OADA 1PMTA 2A4HA 2VCTA 4ZXGA 3IOSA 4I8BA 4N11A 4V2LA 2MYGA 3IPZA 3TJKA 2VOCA 1B48A 2TIRA 5DJMA 4GLTA 4XHMA 3QMXA 4DEJA 2H0HA 2MMNA 3MYDA 4KDUA 3O6TA 1R4WA 2FNOA 1MTCA 1KEBA 4ECJA 4KX4A 1M2BA 1TK5B 5F06A 2GQKA 4ZBBA 4OMVA 2LQOA 2DKIA 2FA8A 4ACSA 2YCDA 1GSYA 1M7TA 2F8AA 2YPMA 2L6CA 1TRWA 2P31A 1TK0B 3M3MA 1YQ1A 2YWOA 3ZFBA 3PR8A 4XRAA 4F0CA 2WB9A 9GSSA 5EL8A 2H1DA 1NHOA 3E9JB 1TKDB 2B5YA 4KAEA 1GULA 5J9BA 2QC7A 3FZAA 5B6MA 3AY8A 3IHGA 2HZEB 3LWAA 5CRHA 4ZBAA 2VCWA 1SK0A 2H71A 3GKMA 1CQHA 4L0UA 10GSA 3TGZA 5CREA 4ZB8A 1R7HA 3DKSA 1LU4A 2WFCA 5B8AA 3D4MA 3LJRA 2V32A 1XBSA 4N30A 2XPEA 4JEDA 5IMZA 4YH2A 2OA7A 3O3TA 2FUG2 2GQLA 2C0EA 1XFLA 2OKAA 1AAZA 4POBA 1WJKA 2VUPA 2LV3A 4TKYA 4POLA 4HUAA 3HHVA 2NBSA 2CVBA 1VGLA 4MF5A 3F0IA 2X64A 4YKGA 4G0IA 4WBJA 4J56E 4ZB6A 2B6MA 1ZYPA 2HSMA 3K8NA 3QPMA 3C73A 4YAVA 2E2MA 1R26A 3S9FA 5G1LA 3P8WA 3CYNA 5EVOA
chains in the Genus database with same CATH topology
5IMAA 5D96A 5E59A 4Z2UA 2NDOA 4Z2RA 2WZ9A 1SENA 4NHWA 3HVXA 5D73A 2GSQA 2KLXA 2GGTA 2OE0A 1HNAA 2C4JA 4OO4A 2VCVA 1ZMAA 2X8CA 2VLVA 3CTGA 3EURA 2D2ZA 4F9ZA 2FWEA 4XCSA 1PGTA 4TXOB 1EP7A 2Z9SA 3M1GA 5D93A 2IJYA 1Y25A 3LFLA 5KN0A 3TKSC 4WF4A 1FOHA 3I69A 4PQIA 1OVNA 4KSMA 2OBKA 4KCEA 4K5SA 1GTAA 4PNFA 3D5JA 4KDYA 2DMMA 2A4VA 2LRCA 1T4YA 4O92A 1G6WA 5HR0A 3ZREA 4F2IA 1K0CA 4BL7B 2KHPA 3KP9A 5ELGA 1W4VA 3PH9A 1QFNA 4K7NA 2H70A 6GSSA 3F4RA 4XS4A 1T3BA 4MH2A 2L5LA 3QAVA 3CTFA 3KH9A 3PPUA 1U6TA 3GV1A 3NIVA 1F3AA 1W89A 1A0FA 3QAWA 1YY7A 2R0GA 5CNWA 5AGYA 5ENUA 1OE8A 1TI3A 2JADA 2FLSA 7GSSA 4JBBA 3LORA 3G7JA 3TDGA 3GTUB 4LLRA 2CQ9A 3FHKA 1XIYA 3HDCA 3ED3A 1ON4A 1TDIA 1A24A 2QSIA 1TK8B 3APQA 1H75A 1G6YA 1B4PA 1PL1A 4J2FA 2M80A 3BCKA 1XWAA 4L0WA 4K0GA 1XCCA 1O8WA 3IHQA 3WGEA 2I3YA 3MAKA 4FYCA 1B9XC 3WT1A 1V9WA 2QA1A 2H74A 2DSAA 3VWXA 1YDKA 1BYEA 4OD7A 5ECLB 4K7IA 2LJRA 1XZOA 1BG5A 3GX8A 3FYGA 2L59A 3EPTA 4MNNA 5IM9A 2YNXA 3VWVA 3DMLA 3F6FA 2H72A 3J7Yk 4DSQA 2P0GA 3G7IA 1GL8A 2IMEA 2OBIA 4TR1B 2HRNA 1Z7RA 1T1VA 1EOGA 4HQZA 2H01A 4RI6A 1TXXA 5G5EA 4TR3A 5GSSA 2IMKA 4OFMA 3ZYWA 2DKHA 2IMIA 4O5RA 3ERGA 3FKFA 4O7HA 5ECIB 3EWLA 4ULXA 3RHBA 1AXDA 4V2MA 4XRDA 2GSRA 3CSHA 1XPVA 5ECRB 3KJYA 2R2JA 3W8JA 4LL1B 1SK1A 4HU7A 2WRTA 3J7Yb 2YZUA 3VPTA 3CBUA 5IMVA 3FR3A 3Q18A 4GQCA 3A2XA 1ZCPA 4TR4A 1KNGA 2BJXA 1SU9A 1GSUA 2NVLA 4KGIA 3EMPA 3C8EA 4MJBA 3ZITA 1J0FA 2C8UA 2IPAA 3GUSA 4GQFA 1HD2A 5G30A 1G0TA 3GKNA 1NHYA 5GSTA 4Q5QA 2VL9A 2EC4A 4E8HA 5G1KA 4WF5A 2I4AA 1YEXA 4G10A 2G2QA 3ERWA 4MABA 2YJHA 1Z5YE 1USBA 4NAXA 2R37A 2HLSA 2RUFA 1S3AA 1VF1A 2LNSA 4MF6A 19GSA 2PMTA 3CRTA 4K5RA 3ZIVA 2DJ3A 2YV9A 1C72A 3IV4A 2F51A 1JLVA 4FYBA 3E3EA 3L9VA 1EV9A 3FZ9A 4FIWA 4EVMA 3FRCA 4DSSA 1VRSD 3JCML 2DC5A 3LW9A 4TW5A 4ILFA 3M0FA 2X49A 2EIRA 4MJAA 4ZILA 1FVJA 5G5FA 4ZIJA 2YN1A 4NMUA 3LXZA 3CRUA 5DCHA 2IIYA 2L5OA 2PERA 1SD8A 1WMJA 1U88A 3UBLA 3P7XA 1Z7PA 1AQWA 2R4VA 1OC9B 4K2XA 5DQYA 3D4TA 2B7KA 3UVHA 1XXUA 2WCIA 5EY6A 4CHSA 5J3RA 3D6IA 1ILOA 2C0DA 4GWRA 5DQSA 3E0UA 4MJCA 1M99A 1OC9A 4K0NA 3RAZA 3FMWA 4IN0A 5INYA 1XWKA 1ERVA 1O73A 3EMXA 3WGDA 2PPTA 5AN1A 5JWRB 5IPGA 2HXKA 1MEKA 1Q98A 2YWIA 4HZ4A 4G9HA 4HJMA 2GZZA 2C3NA 1F3BA 2I9HA 2AHEA 2GSSA 2ZCTA 1ACVA 1ZYEA 2M46A 5IMFA 3LG6A 2GVPA 4Q5NA 3KH7A 3A2VA 2H0IA 3MWHA 1J08A 3VWUA 4MMMA 2C0FA 3EU4A 2GSTA 3ZFLA 2RUEA 3V1WA 3TUEA 2C3TA 4ECBA 1BJXA 4MK3A 2CZ2A 1H4OA 1J9BA 5EPFA 3UMAA 2YP6A 4RI7A 1JZRA 2HI7A 2VM1A 5ECQB 1SJZA 4I6XA 1XW5A 2AUVA 2H0GA 2L4QA 4HDEA 5H5RA 4JU5A 4XS6A 2WDUA 1EEJA 1GUHA 1SYRA 4G0LA 1XOBA 2X4AA 3ERFA 3GHAA 1TW9A 2AV4A 3ZMKA 3LYKA 2JU5A 1DUGA 5DJLA 2GDRA 4AJ8A 5G31A 2FWHA 1SL2B 1YKCA 3UOMA 3M8NA 3WT2A 3IK9A 5JCGA 2JZRA 3NZNA 5KOWA 1YJ6A 5AISA 1HQOA 2H30A 3IR4A 3EYTA 3L9UA 4BVYB 3MSZA 3FEUA 1GTBA 16GSA 4ZBDA 1GH2A 1Q4JA 4IBPA 1TP9A 3F63A 2LUSA 5ECKB 2MBSA 3ZL5A 1QXHA 5J5NA 2DIYA 2IFQA 17GSA 3Q6OA 2IWTA 2REMA 1F9MA 3HJOA 1K3YA 4BVYA 2YJ7A 3Q19A 3M9KA 2K6VA 1ZGNA 2VCQA 4K9ZA 1SKRB 4FQUA 1CQGA 4TOPA 2ON7A 3CMIA 4ZL8A 2IMDA 2PBJA 3EU3A 4X1UA 1TTZA 2UZ8A 3DIEA 5IOXA 3RHCA 5COHA 4NHZA 4ZL7A 3TKSE 1K0DA 3WGXA 12GSA 3C1RA 5DBQA 3HY2A 1YF1A 2B5EA 3IRAA 4XTSA 4BA7A 3ZIJA 3KGKA 4YKFA 2X8HA 4E8EA 2MBTA 2WGRA 3LXTA 1X9WB 3F9UA 6GSWA 2R0PA 1B9YC 4EUYA 1PKWA 1UVZA 2B1KA 1SL0B 3L4NA 4IJIA 5KN2A 5DAKA 3WD6A 3U5RE 1EGRA 1S3DA 5CRDA 3QAGA 5LD0A 3GNJA 1YF0A 1SD9A 2JZTA 3FR9A 3BOAA 3GYKA 3ZRDA 3ZLPA 2L57A 4BWSA 4L5OA 4X4JA 3KEBA 5IPHA 3IXRA 4OCEA 2ZNMA 4IVFA 2B1LA 1R5AA 2WULA 4LMVA 5CP1A 2H75A 2DJ1A 2J9HA 2HT9A 2O85A 1PA3A 4PXOA 4TRXA 2ES7A 5ABRA 2VM2A 3FK8A 1M2DA 2DJ2A 4N10A 4Z7XA 3HJPA 2CZ3A 2WJUA 2QA2A 4YQMA 3VI7A 5H5QA 1OKDA 2PUKC 5FT3A 5DCGA 5F05A 2MMOA 2VD0A 3KM6A 5IO2A 4WBRD 4HJ2A 2KOKA 1U87A 1O81A 5DALB 2LEGA 2NTOA 4XS4B 2M72A 2HFDA 4IKHA 2C1YA 1ZYNA 1BAYA 2A2PA 4ECCA 2F3MA 4V2NA 2X8GA 5DALA 1RQMA 2C0GA 3O76A 3HXSA 3UEMA 4TR0A 2CX4A 3IC8A 2P5QA 1GP1A 1X0RA 3GA4A 1BEDA 3I9V2 3I6AA 1FO5A 4LA1A 1FB6A 3LGCA 2PVOC 2VLUA 1FG4A 4EE0A 1TJDA 4EF0A 2DJ0A 2K8SA 1DSBA 3L78A 2QKEA 4BWQA 4GCIA 3H8QA 2R6KA 1EP8A 5LNKe 4P3YB 6GSUA 4USSA 1M9BA 4CY8A 4POKA 3GH9A 2VCZA 4EXJA 1PQNA 3EINA 2QGVA 4MP4A 3RDWA 3UIWA 2XBIA 1GUKA 4DVCA 2X99A 1KTEA 5F8BA 1SKWB 4AF2A 2E7PA 3HD5A 4RQXA 5ID2A 2RIIA 18GSA 1VF3A 1ZOFA 3QOUA 1MDJA 4KE3A 2YZHA 2YV7A 2V1MA 3TB2A 2LJAA 1AC1A 2HSHA 1X9MB 4OFTA 4KNDA 4QL9A 2AAWA 4EDZA 3IA1A 2N5AA 4MZCA 3FZ4A 3DD3A 3IE3A 1ZL9A 1V57A 3N5OA 4EKZA 3ME7A 3BJ5A 2R0CA 3FZ5A 1K3OA 3GSSA 4MJEA 1K0BA 5A4WA 1XWGA 3EE2A 3VPQA 3VLNA 8GSSA 4HZ2A 4WEYA 4WR4A 3VK9A 3LYPA 1PN9A 2GS3A 5D9XA 1JZOA 1G7OA 4NPBA 22GSA 3P90A 5DVBA 1WPIA 3DYRA 1QMVA 5H5SA 3W8SA 3IC4A 4MH3A 1F2EA 1PX7A 5D8IA 4ZL9A 4D73A 4IHUA 4V1Ag 4IP6A 3KTLA 5J4UA 4KF9A 4WR5A 1K0OA 1IYIA 1BX9A 3W6GA 3C71A 1JLWA 1WWJA 5A5KA 5HR1A 4L8EA 5KN1A 1TOFA 5D9TA 1I9DA 4GF0A 3H93A 4LMWA 2YWNA 3HYPA 1X5DA 3BCIA 1EV4A 1O8XA 3WYWA 1YEPA 2H1GA 1A2MA 3MNGA 4LL4B 2VL3A 5CRWA 1O6JA 2H76A 3UAPA 4Q5RA 2TRXA 3ISOA 2CX3A 1GTIA 1EOHA 4HQSA 3F4TA 1GSSA 1BQ7A 1MD4A 4ICYA 3EC3A 3D21A 2RM6A 3GL5A 3GX0A 3TJFA 3D0ZA 4JR6A 4I2UA 4DSSB 2MMZA 4JRRA 3GH6A 1A8LA 5KEJA 4KH7A 3DEXA 1GSQA 4MPGA 3BD2A 3G7YA 2V6KA 4IQAA 3KD0A 5IMDA 2BMXA 4MLYA 4NWYA 4GTUA 1MDIA 1FB0A 4IS0A 3PGTA 1HNCA 4GRFA 2AB6A 2B5XA 3GFKA 5J41A 1GUMA 1V2AA 5KOXA 1N2AA 3GIXA 2GLRA 2J23A 3QDNA 2YOIA 4G0KA 4RUVA 3TJGA 1T7PB 3L9SA 2FGXA 2DJJA 3HCZA 1TU8A 1K0NA 2VO4A 3TKRA 4J57E 3LEFA 1JZDA 5ECMB 2JSZA 4I2TA 1S3CA 4XS1A 5ECNB 3QFAC 1PKZA 5F07A 2XHFA 3GN3A 2H6XA 2IL3A 2KUCA 1TRUA 3GL3A 4F82A 3IBHA 4JE1A 2MZCA 1Z9HA 4GXZA 3HJMA 1GRXA 2CAIA 1GTUA 4MF7A 5A4VA 1I5GA 11GSA 4X43A 5BRTA 3LSZA 2HZFA 1OC3A 3G9BA 4EIQA 4G2EA 4OCFA 4KSOA 5D9WA 4YAPA 2B3SA 3ME8A 1ST9A 1XVWA 3TKQA 3VI5A 3H79A 5AIXA 4OFNA 3FR6A 4WXTA 2R3XA 3HVSA 1LBKA 2DIZA 5ELAA 1B4QA 2GQMA 4H86A 4I97A 6GSYA 2H8LA 3P2AA 2E0QA 1Y6EA 3GRXA 2ON5A 2HNLA 3TRQA 1A0RP 3F3RA 2XPDA 1U3IA 3APSA 1T00A 3DVXA 1PRXA 3NOFA 4ZB9A 4TVEA 2ALBA 3PINA 2V41A 5FWGA 3BBYA 4OO5A 1F6MC 4MA9A 1AW9A 1KBNA 6GSTA 1EEMA 3H4KA 1SJ6A 3QR6A 3KMNA 4FO5A 3IAM2 13GSA 2F8FA 4F03A 3IDVA 2GZPA 1VF2A 3ZZXA 3QCPA 5JWOB 5B7CA 3UL3A 4Z2TA 4EIPA 1QUWA 3A2WA 1UA5A 3MDKA 5A4UA 1DE2A 4IP1A 4FH8A 2IFQB 2JACA 5G2ZA 2E2GA 2IMFA 4I5QA 3FY7A 2DJKA 3HZ4A 4PQ1A 2BTOT 4IW9A 5HR3A 4ML1A 2NPBA 1R5PA 3GKKA 4EC0A 2N5FA 2RLIA 2LRNA 4ISDA 1ERUA 5J9CA 1IYHA 2P5RA 1QGVA 3VWWA 1GSFA 2OACA 5B8BA 4YQUA 4Q5FA 1AIUA 2EIOA 4WETA 3TCOA 3D22A 4KUNA 2HZEA 4A5PA 1WIKA 1SL1B 1X9SB 3RBTA 1M9AA 2PVQA 4X0XA 4AJ6A 1MD3A 4OWYA 1M2AA 3HZ8A 1DE1A 4IGJA 4HS1A 1TRSA 1THOA 5DAKB 2TRCP 4QQ7A 1V40A 1Z3EA 3IK7A 1SK2A 3DWVA 2N5BA 2FWFA 4IELA 3HKRA 3TJJA 4K8MA 1O85A 1HYUA 1NSWA 1HNBA 3M9JA 3F3QA 4AGSA 2YWMA 5GZZB 2K9FA 2XC2A 3KP8A 2L6DA 2CVKA 5HFKA 4ID0A 4EO3A 2H66A 1GWCA 2CV4A 1YZXA 2FY6A 4K6XA 2HSYA 2WS2A 2AYTA 5IO0A 4K2DA 3TOTA 4TN8A 2HRAA 5E4WA 4GSTA 1PX6A 1ABAA 2KP2A 2LNTA 4CDOA 1A8YA 3ZTLA 5CO3A 3TKSA 4CY6A 3TRXA 1PL2A 1URMA 1WE0A 2RM5A 3VFIA 2PU9C 3SWLA 4IJ3A 2MMAA 5ECHB 1RW1A 4CW9A 2R5GA 2VD1A 4PTSA 1TU7A 4N0ZA 1NW2A 1XWBA 4JR4A 5JCUA 1FHEA 4HOJA 4PGTA 4PURA 5IQYA 4TXOA 1E2YA 2CA8A 1FAAA 2GZYA 4PUFC 4BVXB 2B7JA 5CAXA 2H1AA 1T8EB 5BMUA 1XWCA 2HYXA 3DVWA 1ML6A 1ERTA 3RPPA 1FOVA 2VL2A 2O87A 3C7MA 3QFBC 3APOA 5C04A 1TRVA 3DXBA 1UC7A 4BVXA 5GAND 2LQQA 14GSA 5CYYA 4BPYA 4JZQA 1K0AA 3A3TA 4GSNA 3SBCA 2H73A 4BL7A 2FA4A 4HI7A 5HFIA 2VL2C 1XW6A 4MZBA 1SKSB 1LJRA 2DBCA 1XVQA 1U3AA 2EIQA 2DLXA 2VLTA 1SJIA 3EVIA 3Q74A 4K7OA 5ID2B 1T4ZA 2OJLA 2HRKA 2JZSA 1OKTA 1GNEA 4G19A 2GTUA 4K1FA 5HR2A 4KCAA 5DDLA 2HRFA 2L4CA 4HU9A 4IQ1A 1ZYQB 3KMOA 4O5UA 2A2SA 3GSTA 3F4SA 2V2GA 4PUAA 1YKAA 1N8JA 3GTUA 2FHEA 4PQHA 2G0FA 1SYXA 2FWGA 2VAFA 2KP1A 5IMCA 5B6NA 4WKWA 2C3QA 1WOUA 1M0UA 4ML6A 1RK4A 4HEA2 2O7KA 3C1SA 2GT6A 4MCUA 3KTBA 1GLPA 3ZVJD 2XBQA 1OE7A 1OAZA 5CRGA 3VURA 5IIZA 1A2LA 4YQVA 1XW9A 3KXOA 2K8VA 5GAPD 3UVTA 3US3A 3UARA 3DRNA 4D73B 1GSDA 1F37A 4MZWA 1AUCA 1K0MA 4ECIA 5FHIA 1O7UA 2O8VB 2VCXA 3GURA 1PD21 1MDKA 3F8UA 3U6VA 4TR1A 4N0VA 3LQ7A 1JHBA 3ZMLA 1X5CA 1THXA 1EWXA 5JWQB 3R2QA 5AIVA 2AJQB 4PX1A 1G7EA 1PSQA 3H1NA 1WP0A 1B8XA 2LKUA 4QL7A 4DSRA 1FW1A 2JL4A 1XOAA 5JCWA 1V98A 2LJKA 5F0GA 5HFGA 2CAQA 1X5EA 2YANA 2LSTA 2LRTA 3ZVJA 4RQRA 1GLQA 4NV5A 5D9VA 5LCZA 3I43A 3UJ1A 1V58A 4L5LA 2I81A 3IAS2 1JZWA 4O5QA 2K18A 1UN2A 2I1UA 4AJ7A 3F6DA 20GSA 3CSJA 1TI1A 4NV2A 4EL1A 1NM3A 2PWJA 2OE1A 1JFUA 1E6BA 5IOWA 1GNWA 1GSEA 1A2JA 2GT5A 2VIMA 2O89A 3KCMA 3TKPA 3FW2A 5L71A 2FD3A 1AQVA 4NXIA 3UBKA 4GSSA 4KDXA 4FYUA 5HQPA 4TXVA 3GKXA 4O32A 2H6YA 5ECSA 1FVKA 3L0HA 4KA0A 1AQXA 4V1Ap 2JSYA 4PNGA 2H6ZA 1Z6MA 1ZZYA 1ERWA 2PGTA 1Z6NA 2PN8A 1A23A 2HE3A 2OE3A 3A5WA 3KZQA 5ECPB 2F9SA 1K3LA 4XIHA 2V6OA 3MIXA 3R3EA 1OC8A 3N9JA 3TOUA 4POMA 5C00A 3CSIA 1OYJA 3HVVA 3A5IA 2H1BA 4EDYA 3GMFA 1EZKA 2LS5A 5ECOB 2FCHA 4F0BA 2LTKA 2A2RA 2CVDA 3CXGA 3DGQA 4MDCA 2IN3A 3KIJA 4MPFA 2ZUPA 4KW6A 3OR5A 1QQ2A 6GSVA 5KN3A 3QD9A 4KB3A 2DMLA 2H19A 1WRYA 3TJBA 1DBYA 3TRPA 6GSXA 3RPNA 1VF4A 1EGOA 2CT6A 3HA9A 2C80A 1PN0A 1QK8A 2OADA 1PMTA 2A4HA 2VCTA 4ZXGA 3IOSA 4I8BA 4N11A 4V2LA 2MYGA 3IPZA 3TJKA 2VOCA 1B48A 2TIRA 5DJMA 4GLTA 4XHMA 3QMXA 4DEJA 2H0HA 2MMNA 3MYDA 4KDUA 3O6TA 1R4WA 2FNOA 1MTCA 1KEBA 4ECJA 4KX4A 1M2BA 1TK5B 5F06A 2GQKA 4ZBBA 4OMVA 2LQOA 2DKIA 2FA8A 4ACSA 2YCDA 1GSYA 1M7TA 2F8AA 2YPMA 2L6CA 1TRWA 2P31A 1TK0B 3M3MA 1YQ1A 2YWOA 3ZFBA 3PR8A 4XRAA 4F0CA 2WB9A 9GSSA 5EL8A 2H1DA 1NHOA 3E9JB 1TKDB 2B5YA 4KAEA 1GULA 5J9BA 2QC7A 3FZAA 5B6MA 3AY8A 3IHGA 2HZEB 3LWAA 5CRHA 4ZBAA 2VCWA 1SK0A 2H71A 3GKMA 1CQHA 4L0UA 10GSA 3TGZA 5CREA 4ZB8A 1R7HA 3DKSA 1LU4A 2WFCA 5B8AA 3D4MA 3LJRA 2V32A 1XBSA 4N30A 2XPEA 4JEDA 5IMZA 4YH2A 2OA7A 3O3TA 2FUG2 2GQLA 2C0EA 1XFLA 2OKAA 1AAZA 4POBA 1WJKA 2VUPA 2LV3A 4TKYA 4POLA 4HUAA 3HHVA 2NBSA 2CVBA 1VGLA 4MF5A 3F0IA 2X64A 4YKGA 4G0IA 4WBJA 4J56E 4ZB6A 2B6MA 1ZYPA 2HSMA 3K8NA 3QPMA 3C73A 4YAVA 2E2MA 1R26A 3S9FA 5G1LA 3P8WA 3CYNA 5EVOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IMA A;  5D96 A;  5E59 A;  2NDO A;  2WZ9 A;  1SEN A;  4NHW A;  3HVX A;  5D73 A;  2GSQ A;  2KLX A;  2GGT A;  2OE0 A;  1HNA A;  2C4J A;  4OO4 A;  2VCV A;  1ZMA A;  2X8C A;  2VLV A;  3CTG A;  3EUR A;  2D2Z A;  4F9Z A;  2FWE A;  4XCS A;  1PGT A;  4TXO B;  1EP7 A;  2Z9S A;  3M1G A;  5D93 A;  2IJY A;  1Y25 A;  3LFL A;  5KN0 A;  3TKS C;  4WF4 A;  3I69 A;  4PQI A;  1OVN A;  4KSM A;  2OBK A;  4KCE A;  1GTA A;  4PNF A;  3D5J A;  4KDY A;  2DMM A;  2A4V A;  2LRC A;  1T4Y A;  4O92 A;  1G6W A;  5HR0 A;  3ZRE A;  4F2I A;  1K0C A;  2KHP A;  3KP9 A;  5ELG A;  1W4V A;  3PH9 A;  1QFN A;  4K7N A;  2H70 A;  6GSS A;  3F4R A;  4XS4 A;  1T3B A;  4MH2 A;  2L5L A;  3QAV A;  3CTF A;  3KH9 A;  1U6T A;  3GV1 A;  3NIV A;  1F3A A;  1W89 A;  1A0F A;  3QAW A;  1YY7 A;  5CNW A;  5AGY A;  5ENU A;  1OE8 A;  1TI3 A;  2JAD A;  2FLS A;  7GSS A;  4JBB A;  3LOR A;  3G7J A;  3TDG A;  3GTU B;  4LLR A;  2CQ9 A;  3FHK A;  1XIY A;  3HDC A;  3ED3 A;  1ON4 A;  1TDI A;  1A24 A;  2QSI A;  1TK8 B;  3APQ A;  1H75 A;  1G6Y A;  1B4P A;  1PL1 A;  4J2F A;  2M80 A;  3BCK A;  1XWA A;  4L0W A;  4K0G A;  1XCC A;  1O8W A;  3IHQ A;  3WGE A;  2I3Y A;  3MAK A;  4FYC A;  1B9X C;  3WT1 A;  1V9W A;  2H74 A;  2DSA A;  3VWX A;  1YDK A;  1BYE A;  4OD7 A;  5ECL B;  4K7I A;  2LJR A;  1XZO A;  1BG5 A;  3GX8 A;  3FYG A;  2L59 A;  5IM9 A;  2YNX A;  3VWV A;  3DML A;  3F6F A;  2H72 A;  3J7Y k;  4DSQ A;  2P0G A;  3G7I A;  1GL8 A;  2IME A;  2OBI A;  4TR1 B;  2HRN A;  1Z7R A;  1T1V A;  1EOG A;  4HQZ A;  2H01 A;  4RI6 A;  1TXX A;  5G5E A;  4TR3 A;  5GSS A;  2IMK A;  4OFM A;  3ZYW A;  2IMI A;  4O5R A;  3ERG A;  3FKF A;  4O7H A;  5ECI B;  3EWL A;  4ULX A;  3RHB A;  1AXD A;  4V2M A;  4XRD A;  2GSR A;  3CSH A;  1XPV A;  5ECR B;  3KJY A;  2R2J A;  3W8J A;  4LL1 B;  1SK1 A;  4HU7 A;  2WRT A;  3J7Y b;  2YZU A;  3VPT A;  3CBU A;  5IMV A;  3FR3 A;  3Q18 A;  4GQC A;  3A2X A;  1ZCP A;  4TR4 A;  1KNG A;  2BJX A;  1SU9 A;  1GSU A;  2NVL A;  4KGI A;  3EMP A;  3C8E A;  4MJB A;  3ZIT A;  1J0F A;  2C8U A;  2IPA A;  3GUS A;  4GQF A;  1HD2 A;  5G30 A;  1G0T A;  3GKN A;  1NHY A;  5GST A;  4Q5Q A;  2VL9 A;  2EC4 A;  4E8H A;  5G1K A;  4WF5 A;  2I4A A;  1YEX A;  4G10 A;  2G2Q A;  3ERW A;  4MAB A;  2YJH A;  1Z5Y E;  1USB A;  4NAX A;  2R37 A;  2HLS A;  2RUF A;  1S3A A;  1VF1 A;  2LNS A;  4MF6 A;  19GS A;  2PMT A;  3CRT A;  3ZIV A;  2DJ3 A;  2YV9 A;  1C72 A;  3IV4 A;  2F51 A;  1JLV A;  4FYB A;  3E3E A;  3L9V A;  1EV9 A;  3FZ9 A;  4FIW A;  4EVM A;  3FRC A;  4DSS A;  1VRS D;  3JCM L;  2DC5 A;  4TW5 A;  4ILF A;  3M0F A;  2EIR A;  4MJA A;  4ZIL A;  1FVJ A;  5G5F A;  4ZIJ A;  2YN1 A;  4NMU A;  3LXZ A;  3CRU A;  5DCH A;  2IIY A;  2L5O A;  2PER A;  1SD8 A;  1WMJ A;  1U88 A;  3UBL A;  3P7X A;  1Z7P A;  1AQW A;  2R4V A;  1OC9 B;  5DQY A;  3D4T A;  2B7K A;  3UVH A;  1XXU A;  2WCI A;  5EY6 A;  4CHS A;  5J3R A;  3D6I A;  1ILO A;  2C0D A;  4GWR A;  5DQS A;  3E0U A;  4MJC A;  1M99 A;  1OC9 A;  4K0N A;  3RAZ A;  4IN0 A;  5INY A;  1XWK A;  1ERV A;  1O73 A;  3EMX A;  3WGD A;  2PPT A;  5AN1 A;  5JWR B;  5IPG A;  2HXK A;  1MEK A;  1Q98 A;  2YWI A;  4HZ4 A;  4G9H A;  4HJM A;  2GZZ A;  2C3N A;  1F3B A;  2I9H A;  2AHE A;  2GSS A;  2ZCT A;  1ACV A;  1ZYE A;  2M46 A;  5IMF A;  3LG6 A;  2GVP A;  4Q5N A;  3KH7 A;  3A2V A;  2H0I A;  3MWH A;  1J08 A;  3VWU A;  4MMM A;  2C0F A;  3EU4 A;  2GST A;  3ZFL A;  2RUE A;  3V1W A;  3TUE A;  2C3T A;  4ECB A;  1BJX A;  4MK3 A;  2CZ2 A;  1H4O A;  1J9B A;  5EPF A;  3UMA A;  2YP6 A;  4RI7 A;  1JZR A;  2HI7 A;  2VM1 A;  5ECQ B;  1SJZ A;  4I6X A;  1XW5 A;  2AUV A;  2H0G A;  2L4Q A;  4HDE A;  5H5R A;  4JU5 A;  4XS6 A;  2WDU A;  1EEJ A;  1GUH A;  1SYR A;  1XOB A;  3ERF A;  3GHA A;  1TW9 A;  2AV4 A;  3ZMK A;  3LYK A;  2JU5 A;  1DUG A;  5DJL A;  2GDR A;  4AJ8 A;  5G31 A;  2FWH A;  1SL2 B;  1YKC A;  3UOM A;  3M8N A;  3WT2 A;  3IK9 A;  5JCG A;  2JZR A;  3NZN A;  1YJ6 A;  5AIS A;  1HQO A;  2H30 A;  3IR4 A;  3EYT A;  3L9U A;  3MSZ A;  3FEU A;  1GTB A;  16GS A;  4ZBD A;  1GH2 A;  1Q4J A;  4IBP A;  1TP9 A;  3F63 A;  2LUS A;  5ECK B;  2MBS A;  3ZL5 A;  1QXH A;  5J5N A;  2DIY A;  2IFQ A;  17GS A;  3Q6O A;  2IWT A;  2REM A;  1F9M A;  3HJO A;  1K3Y A;  4BVY A;  2YJ7 A;  3Q19 A;  3M9K A;  2K6V A;  1ZGN A;  2VCQ A;  4K9Z A;  1SKR B;  1CQG A;  4TOP A;  2ON7 A;  3CMI A;  4ZL8 A;  2IMD A;  2PBJ A;  3EU3 A;  4X1U A;  1TTZ A;  3DIE A;  5IOX A;  3RHC A;  5COH A;  4NHZ A;  4ZL7 A;  3TKS E;  1K0D A;  3WGX A;  12GS A;  3C1R A;  5DBQ A;  3HY2 A;  1YF1 A;  2B5E A;  3IRA A;  4XTS A;  4BA7 A;  3ZIJ A;  3KGK A;  2X8H A;  4E8E A;  2MBT A;  2WGR A;  3LXT A;  1X9W B;  3F9U A;  6GSW A;  1B9Y C;  4EUY A;  1PKW A;  1UVZ A;  2B1K A;  1SL0 B;  3L4N A;  4IJI A;  5KN2 A;  5DAK A;  3WD6 A;  3U5R E;  1EGR A;  1S3D A;  5CRD A;  3QAG A;  5LD0 A;  3GNJ A;  1YF0 A;  1SD9 A;  2JZT A;  3FR9 A;  3BOA A;  3GYK A;  3ZRD A;  3ZLP A;  2L57 A;  4BWS A;  4L5O A;  3KEB A;  5IPH A;  3IXR A;  4OCE A;  2ZNM A;  4IVF A;  2B1L A;  1R5A A;  2WUL A;  4LMV A;  5CP1 A;  2H75 A;  2DJ1 A;  2J9H A;  2HT9 A;  2O85 A;  1PA3 A;  4PXO A;  4TRX A;  2ES7 A;  5ABR A;  2VM2 A;  3FK8 A;  1M2D A;  2DJ2 A;  4N10 A;  4Z7X A;  3HJP A;  2CZ3 A;  2WJU A;  4YQM A;  3VI7 A;  5H5Q A;  1OKD A;  2PUK C;  5FT3 A;  5DCG A;  5F05 A;  2MMO A;  2VD0 A;  3KM6 A;  5IO2 A;  4WBR D;  4HJ2 A;  2KOK A;  1U87 A;  1O81 A;  5DAL B;  2LEG A;  2NTO A;  4XS4 B;  2M72 A;  2HFD A;  4IKH A;  2C1Y A;  1BAY A;  4ECC A;  2F3M A;  4V2N A;  2X8G A;  5DAL A;  1RQM A;  2C0G A;  3O76 A;  3HXS A;  3UEM A;  4TR0 A;  2CX4 A;  2P5Q A;  1GP1 A;  1X0R A;  3GA4 A;  1BED A;  3I9V 2;  3I6A A;  1FO5 A;  4LA1 A;  1FB6 A;  3LGC A;  2PVO C;  2VLU A;  1FG4 A;  4EE0 A;  1TJD A;  4EF0 A;  2DJ0 A;  2K8S A;  1DSB A;  3L78 A;  2QKE A;  4BWQ A;  4GCI A;  3H8Q A;  2R6K A;  1EP8 A;  5LNK e;  4P3Y B;  6GSU A;  1M9B A;  4POK A;  3GH9 A;  2VCZ A;  4EXJ A;  1PQN A;  3EIN A;  2QGV A;  4MP4 A;  3RDW A;  3UIW A;  2XBI A;  1GUK A;  4DVC A;  2X99 A;  1KTE A;  5F8B A;  1SKW B;  4AF2 A;  2E7P A;  3HD5 A;  4RQX A;  5ID2 A;  2RII A;  18GS A;  1VF3 A;  1ZOF A;  3QOU A;  1MDJ A;  4KE3 A;  2YZH A;  2YV7 A;  2V1M A;  3TB2 A;  2LJA A;  1AC1 A;  2HSH A;  1X9M B;  4OFT A;  4KND A;  4QL9 A;  2AAW A;  4EDZ A;  3IA1 A;  2N5A A;  4MZC A;  3FZ4 A;  3DD3 A;  3IE3 A;  1ZL9 A;  1V57 A;  3N5O A;  4EKZ A;  3ME7 A;  3BJ5 A;  3FZ5 A;  1K3O A;  3GSS A;  4MJE A;  1K0B A;  5A4W A;  1XWG A;  3EE2 A;  3VPQ A;  3VLN A;  8GSS A;  4HZ2 A;  4WEY A;  4WR4 A;  3VK9 A;  3LYP A;  1PN9 A;  2GS3 A;  5D9X A;  1JZO A;  1G7O A;  4NPB A;  22GS A;  3P90 A;  5DVB A;  1WPI A;  3DYR A;  1QMV A;  5H5S A;  3W8S A;  3IC4 A;  4MH3 A;  1F2E A;  1PX7 A;  5D8I A;  4ZL9 A;  4D73 A;  4IHU A;  4V1A g;  4IP6 A;  3KTL A;  5J4U A;  4WR5 A;  1K0O A;  1IYI A;  1BX9 A;  3W6G A;  3C71 A;  1JLW A;  1WWJ A;  5A5K A;  5HR1 A;  4L8E A;  5KN1 A;  1TOF A;  5D9T A;  1I9D A;  4GF0 A;  3H93 A;  4LMW A;  2YWN A;  3HYP A;  1X5D A;  3BCI A;  1EV4 A;  1O8X A;  3WYW A;  1YEP A;  2H1G A;  1A2M A;  3MNG A;  4LL4 B;  2VL3 A;  5CRW A;  1O6J A;  2H76 A;  3UAP A;  4Q5R A;  2TRX A;  3ISO A;  2CX3 A;  1GTI A;  1EOH A;  4HQS A;  3F4T A;  1GSS A;  1BQ7 A;  1MD4 A;  3EC3 A;  3D21 A;  2RM6 A;  3GL5 A;  3GX0 A;  3TJF A;  3D0Z A;  4JR6 A;  4I2U A;  4DSS B;  2MMZ A;  4JRR A;  3GH6 A;  1A8L A;  5KEJ A;  4KH7 A;  3DEX A;  1GSQ A;  4MPG A;  3BD2 A;  3G7Y A;  2V6K A;  4IQA A;  3KD0 A;  5IMD A;  2BMX A;  4MLY A;  4NWY A;  4GTU A;  1MDI A;  1FB0 A;  4IS0 A;  3PGT A;  1HNC A;  4GRF A;  2AB6 A;  2B5X A;  3GFK A;  5J41 A;  1GUM A;  1V2A A;  1N2A A;  3GIX A;  2GLR A;  2J23 A;  3QDN A;  2YOI A;  4RUV A;  3TJG A;  1T7P B;  3L9S A;  2FGX A;  2DJJ A;  3HCZ A;  1TU8 A;  1K0N A;  2VO4 A;  3TKR A;  4J57 E;  3LEF A;  1JZD A;  5ECM B;  2JSZ A;  4I2T A;  1S3C A;  4XS1 A;  5ECN B;  3QFA C;  1PKZ A;  5F07 A;  2XHF A;  3GN3 A;  2H6X A;  2IL3 A;  2KUC A;  1TRU A;  3GL3 A;  4F82 A;  3IBH A;  4JE1 A;  2MZC A;  1Z9H A;  4GXZ A;  3HJM A;  1GRX A;  2CAI A;  1GTU A;  4MF7 A;  5A4V A;  1I5G A;  11GS A;  4X43 A;  3LSZ A;  2HZF A;  1OC3 A;  3G9B A;  4G2E A;  4OCF A;  4KSO A;  5D9W A;  4YAP A;  2B3S A;  3ME8 A;  1ST9 A;  1XVW A;  3TKQ A;  3VI5 A;  3H79 A;  5AIX A;  4OFN A;  3FR6 A;  4WXT A;  2R3X A;  3HVS A;  1LBK A;  2DIZ A;  5ELA A;  1B4Q A;  2GQM A;  4H86 A;  4I97 A;  6GSY A;  2H8L A;  3P2A A;  2E0Q A;  1Y6E A;  3GRX A;  2ON5 A;  2HNL A;  3TRQ A;  1A0R P;  3F3R A;  2XPD A;  1U3I A;  3APS A;  1T00 A;  3DVX A;  1PRX A;  3NOF A;  4ZB9 A;  4TVE A;  2ALB A;  3PIN A;  2V41 A;  5FWG A;  3BBY A;  4OO5 A;  1F6M C;  4MA9 A;  1AW9 A;  1KBN A;  6GST A;  1EEM A;  3H4K A;  1SJ6 A;  3QR6 A;  3KMN A;  4FO5 A;  3IAM 2;  13GS A;  2F8F A;  4F03 A;  3IDV A;  2GZP A;  1VF2 A;  3ZZX A;  3QCP A;  5JWO B;  5B7C A;  3UL3 A;  1QUW A;  3A2W A;  1UA5 A;  3MDK A;  5A4U A;  1DE2 A;  4IP1 A;  4FH8 A;  2IFQ B;  2JAC A;  5G2Z A;  2E2G A;  2IMF A;  4I5Q A;  3FY7 A;  2DJK A;  3HZ4 A;  4PQ1 A;  2BTO T;  4IW9 A;  5HR3 A;  4ML1 A;  2NPB A;  1R5P A;  3GKK A;  4EC0 A;  2N5F A;  2RLI A;  2LRN A;  4ISD A;  1ERU A;  5J9C A;  1IYH A;  2P5R A;  1QGV A;  3VWW A;  1GSF A;  2OAC A;  5B8B A;  4YQU A;  4Q5F A;  1AIU A;  2EIO A;  4WET A;  3TCO A;  3D22 A;  4KUN A;  2HZE A;  1WIK A;  1SL1 B;  1X9S B;  3RBT A;  1M9A A;  2PVQ A;  4X0X A;  4AJ6 A;  1MD3 A;  4OWY A;  1M2A A;  3HZ8 A;  1DE1 A;  4IGJ A;  4HS1 A;  1TRS A;  1THO A;  5DAK B;  2TRC P;  4QQ7 A;  1V40 A;  1Z3E A;  3IK7 A;  1SK2 A;  3DWV A;  2N5B A;  2FWF A;  4IEL A;  3HKR A;  3TJJ A;  4K8M A;  1O85 A;  1HYU A;  1NSW A;  1HNB A;  3M9J A;  3F3Q A;  4AGS A;  2YWM A;  5GZZ B;  2K9F A;  2XC2 A;  3KP8 A;  2L6D A;  2CVK A;  5HFK A;  4ID0 A;  4EO3 A;  2H66 A;  1GWC A;  2CV4 A;  1YZX A;  2FY6 A;  4K6X A;  2HSY A;  2WS2 A;  2AYT A;  5IO0 A;  4K2D A;  3TOT A;  4TN8 A;  5E4W A;  4GST A;  1PX6 A;  1ABA A;  2KP2 A;  2LNT A;  4CDO A;  1A8Y A;  3ZTL A;  5CO3 A;  3TKS A;  3TRX A;  1PL2 A;  1URM A;  1WE0 A;  2RM5 A;  3VFI A;  2PU9 C;  3SWL A;  4IJ3 A;  2MMA A;  5ECH B;  1RW1 A;  4CW9 A;  2R5G A;  2VD1 A;  1TU7 A;  4N0Z A;  1NW2 A;  1XWB A;  4JR4 A;  5JCU A;  1FHE A;  4HOJ A;  4PGT A;  4PUR A;  5IQY A;  4TXO A;  1E2Y A;  2CA8 A;  1FAA A;  2GZY A;  4PUF C;  2B7J A;  5CAX A;  2H1A A;  1T8E B;  1XWC A;  2HYX A;  3DVW A;  1ML6 A;  1ERT A;  3RPP A;  1FOV A;  2VL2 A;  2O87 A;  3C7M A;  3QFB C;  3APO A;  5C04 A;  1TRV A;  3DXB A;  1UC7 A;  4BVX A;  5GAN D;  2LQQ A;  14GS A;  5CYY A;  4BPY A;  4JZQ A;  1K0A A;  3A3T A;  4GSN A;  3SBC A;  2H73 A;  4BL7 A;  2FA4 A;  4HI7 A;  5HFI A;  2VL2 C;  1XW6 A;  4MZB A;  1SKS B;  1LJR A;  2DBC A;  1XVQ A;  1U3A A;  2EIQ A;  2DLX A;  2VLT A;  1SJI A;  3EVI A;  3Q74 A;  4K7O A;  5ID2 B;  1T4Z A;  2OJL A;  2JZS A;  1OKT A;  1GNE A;  4G19 A;  2GTU A;  4K1F A;  5HR2 A;  4KCA A;  5DDL A;  2HRF A;  2L4C A;  4HU9 A;  4IQ1 A;  1ZYQ B;  3KMO A;  2A2S A;  3GST A;  3F4S A;  2V2G A;  4PUA A;  1YKA A;  1N8J A;  3GTU A;  2FHE A;  4PQH A;  2G0F A;  1SYX A;  2FWG A;  2VAF A;  2KP1 A;  5IMC A;  5B6N A;  4WKW A;  2C3Q A;  1WOU A;  1M0U A;  4ML6 A;  1RK4 A;  4HEA 2;  2O7K A;  3C1S A;  2GT6 A;  4MCU A;  3KTB A;  1GLP A;  3ZVJ D;  2XBQ A;  1OE7 A;  1OAZ A;  5CRG A;  3VUR A;  5IIZ A;  1A2L A;  4YQV A;  1XW9 A;  3KXO A;  2K8V A;  5GAP D;  3UVT A;  3US3 A;  3UAR A;  3DRN A;  4D73 B;  1GSD A;  1F37 A;  4MZW A;  1AUC A;  1K0M A;  4ECI A;  5FHI A;  1O7U A;  2O8V B;  2VCX A;  3GUR A;  1PD2 1;  1MDK A;  3F8U A;  3U6V A;  4TR1 A;  4N0V A;  3LQ7 A;  1JHB A;  3ZML A;  1X5C A;  1THX A;  1EWX A;  5JWQ B;  3R2Q A;  5AIV A;  2AJQ B;  4PX1 A;  1G7E A;  1PSQ A;  3H1N A;  1WP0 A;  1B8X A;  2LKU A;  4QL7 A;  4DSR A;  1FW1 A;  2JL4 A;  1XOA A;  5JCW A;  1V98 A;  2LJK A;  5F0G A;  5HFG A;  2CAQ A;  1X5E A;  2YAN A;  2LST A;  2LRT A;  3ZVJ A;  4RQR A;  1GLQ A;  4NV5 A;  5D9V A;  5LCZ A;  3I43 A;  3UJ1 A;  1V58 A;  4L5L A;  2I81 A;  3IAS 2;  1JZW A;  2K18 A;  1UN2 A;  2I1U A;  4AJ7 A;  3F6D A;  20GS A;  3CSJ A;  1TI1 A;  4NV2 A;  4EL1 A;  1NM3 A;  2PWJ A;  2OE1 A;  1JFU A;  1E6B A;  5IOW A;  1GNW A;  1GSE A;  1A2J A;  2GT5 A;  2VIM A;  2O89 A;  3KCM A;  3TKP A;  3FW2 A;  5L71 A;  2FD3 A;  1AQV A;  4NXI A;  3UBK A;  4GSS A;  4KDX A;  4FYU A;  5HQP A;  4TXV A;  3GKX A;  4O32 A;  2H6Y A;  5ECS A;  1FVK A;  3L0H A;  4KA0 A;  1AQX A;  4V1A p;  2JSY A;  4PNG A;  2H6Z A;  1Z6M A;  1ZZY A;  1ERW A;  2PGT A;  1Z6N A;  2PN8 A;  1A23 A;  2HE3 A;  2OE3 A;  3A5W A;  3KZQ A;  5ECP B;  2F9S A;  1K3L A;  4XIH A;  2V6O A;  1OC8 A;  3N9J A;  3TOU A;  4POM A;  5C00 A;  3CSI A;  1OYJ A;  3HVV A;  2H1B A;  4EDY A;  3GMF A;  1EZK A;  2LS5 A;  5ECO B;  2FCH A;  4F0B A;  2LTK A;  2A2R A;  2CVD A;  3CXG A;  3DGQ A;  4MDC A;  2IN3 A;  3KIJ A;  4MPF A;  2ZUP A;  4KW6 A;  3OR5 A;  1QQ2 A;  6GSV A;  5KN3 A;  3QD9 A;  4KB3 A;  2DML A;  2H19 A;  1WRY A;  3TJB A;  1DBY A;  3TRP A;  6GSX A;  3RPN A;  1VF4 A;  1EGO A;  2CT6 A;  3HA9 A;  2C80 A;  2OAD A;  1QK8 A;  1PMT A;  2VCT A;  4ZXG A;  3IOS A;  4I8B A;  4N11 A;  4V2L A;  2MYG A;  3IPZ A;  3TJK A;  2VOC A;  1B48 A;  2TIR A;  5DJM A;  4GLT A;  4XHM A;  3QMX A;  4DEJ A;  2H0H A;  2MMN A;  4KDU A;  3O6T A;  1R4W A;  2FNO A;  1MTC A;  1KEB A;  4ECJ A;  4KX4 A;  1M2B A;  1TK5 B;  5F06 A;  2GQK A;  4ZBB A;  4OMV A;  2LQO A;  2FA8 A;  4ACS A;  2YCD A;  1GSY A;  1M7T A;  2F8A A;  2YPM A;  2L6C A;  1TRW A;  2P31 A;  1TK0 B;  3M3M A;  1YQ1 A;  2YWO A;  3ZFB A;  3PR8 A;  4XRA A;  4F0C A;  2WB9 A;  9GSS A;  5EL8 A;  2H1D A;  1NHO A;  3E9J B;  1TKD B;  2B5Y A;  4KAE A;  1GUL A;  5J9B A;  2QC7 A;  3FZA A;  5B6M A;  3AY8 A;  2HZE B;  3LWA A;  5CRH A;  4ZBA A;  2VCW A;  1SK0 A;  2H71 A;  3GKM A;  1CQH A;  4L0U A;  10GS A;  3TGZ A;  5CRE A;  4ZB8 A;  1R7H A;  3DKS A;  1LU4 A;  2WFC A;  5B8A A;  3D4M A;  3LJR A;  2V32 A;  1XBS A;  4N30 A;  2XPE A;  4JED A;  5IMZ A;  4YH2 A;  2OA7 A;  3O3T A;  2FUG 2;  2GQL A;  2C0E A;  1XFL A;  2OKA A;  1AAZ A;  4POB A;  1WJK A;  2VUP A;  2LV3 A;  4TKY A;  4POL A;  4HUA A;  3HHV A;  2NBS A;  2CVB A;  1VGL A;  4MF5 A;  3F0I A;  2X64 A;  4WBJ A;  4J56 E;  4ZB6 A;  2B6M A;  3K8N A;  3QPM A;  3C73 A;  4YAV A;  2E2M A;  1R26 A;  3S9F A;  5G1L A;  3P8W A;  3CYN A;  5EVO A; 
#chains in the Genus database with same CATH topology
 5IMA A;  5D96 A;  5E59 A;  4Z2U A;  2NDO A;  4Z2R A;  2WZ9 A;  1SEN A;  4NHW A;  3HVX A;  5D73 A;  2GSQ A;  2KLX A;  2GGT A;  2OE0 A;  1HNA A;  2C4J A;  4OO4 A;  2VCV A;  1ZMA A;  2X8C A;  2VLV A;  3CTG A;  3EUR A;  2D2Z A;  4F9Z A;  2FWE A;  4XCS A;  1PGT A;  4TXO B;  1EP7 A;  2Z9S A;  3M1G A;  5D93 A;  2IJY A;  1Y25 A;  3LFL A;  5KN0 A;  3TKS C;  4WF4 A;  1FOH A;  3I69 A;  4PQI A;  1OVN A;  4KSM A;  2OBK A;  4KCE A;  4K5S A;  1GTA A;  4PNF A;  3D5J A;  4KDY A;  2DMM A;  2A4V A;  2LRC A;  1T4Y A;  4O92 A;  1G6W A;  5HR0 A;  3ZRE A;  4F2I A;  1K0C A;  4BL7 B;  2KHP A;  3KP9 A;  5ELG A;  1W4V A;  3PH9 A;  1QFN A;  4K7N A;  2H70 A;  6GSS A;  3F4R A;  4XS4 A;  1T3B A;  4MH2 A;  2L5L A;  3QAV A;  3CTF A;  3KH9 A;  3PPU A;  1U6T A;  3GV1 A;  3NIV A;  1F3A A;  1W89 A;  1A0F A;  3QAW A;  1YY7 A;  2R0G A;  5CNW A;  5AGY A;  5ENU A;  1OE8 A;  1TI3 A;  2JAD A;  2FLS A;  7GSS A;  4JBB A;  3LOR A;  3G7J A;  3TDG A;  3GTU B;  4LLR A;  2CQ9 A;  3FHK A;  1XIY A;  3HDC A;  3ED3 A;  1ON4 A;  1TDI A;  1A24 A;  2QSI A;  1TK8 B;  1M3I A;  3APQ A;  1H75 A;  1G6Y A;  1B4P A;  1PL1 A;  4J2F A;  2M80 A;  3BCK A;  1XWA A;  4L0W A;  4K0G A;  1XCC A;  1O8W A;  3IHQ A;  3WGE A;  2I3Y A;  3MAK A;  4FYC A;  1B9X C;  3WT1 A;  1V9W A;  2QA1 A;  2H74 A;  2DSA A;  3VWX A;  1YDK A;  1BYE A;  4OD7 A;  5ECL B;  4K7I A;  2LJR A;  1XZO A;  1BG5 A;  3GX8 A;  1S3R A;  3FYG A;  2L59 A;  3EPT A;  4MNN A;  5IM9 A;  2YNX A;  3VWV A;  3DML A;  3F6F A;  2H72 A;  3J7Y k;  4DSQ A;  2P0G A;  3G7I A;  1GL8 A;  2IME A;  2OBI A;  4TR1 B;  2HRN A;  1Z7R A;  1T1V A;  1EOG A;  4HQZ A;  2H01 A;  4RI6 A;  1TXX A;  5G5E A;  4TR3 A;  5GSS A;  2IMK A;  4OFM A;  3ZYW A;  2DKH A;  2IMI A;  4O5R A;  3ERG A;  3FKF A;  4O7H A;  5ECI B;  3EWL A;  4ULX A;  3RHB A;  1AXD A;  4V2M A;  4XRD A;  1XG8 A;  2GSR A;  3CSH A;  1XPV A;  5ECR B;  3KJY A;  2R2J A;  3W8J A;  4LL1 B;  1SK1 A;  4HU7 A;  2WRT A;  3J7Y b;  2YZU A;  3VPT A;  3CBU A;  5IMV A;  3FR3 A;  3Q18 A;  4GQC A;  3A2X A;  1ZCP A;  4TR4 A;  1KNG A;  2BJX A;  1SU9 A;  1GSU A;  2NVL A;  4KGI A;  3EMP A;  3C8E A;  4MJB A;  3ZIT A;  1J0F A;  2C8U A;  2IPA A;  3GUS A;  4GQF A;  1HD2 A;  5G30 A;  1G0T A;  3CQF A;  3GKN A;  1NHY A;  5GST A;  4Q5Q A;  2VL9 A;  2EC4 A;  4E8H A;  5G1K A;  4WF5 A;  2I4A A;  1YEX A;  4G10 A;  2G2Q A;  3ERW A;  4MAB A;  2YJH A;  1Z5Y E;  1USB A;  4NAX A;  2R37 A;  2HLS A;  2RUF A;  1S3A A;  1VF1 A;  2LNS A;  4MF6 A;  19GS A;  2PMT A;  3CRT A;  4K5R A;  3ZIV A;  2DJ3 A;  2YV9 A;  1C72 A;  3IV4 A;  2F51 A;  1JLV A;  4FYB A;  3E3E A;  3L9V A;  1EV9 A;  3FZ9 A;  4FIW A;  4EVM A;  3FRC A;  4DSS A;  1VRS D;  3JCM L;  2DC5 A;  3LW9 A;  4TW5 A;  4ILF A;  3M0F A;  2X49 A;  2EIR A;  4MJA A;  4ZIL A;  1FVJ A;  5G5F A;  4ZIJ A;  2YN1 A;  4NMU A;  3LXZ A;  3CRU A;  5DCH A;  2IIY A;  2L5O A;  2PER A;  1SD8 A;  1WMJ A;  1U88 A;  3UBL A;  3P7X A;  1Z7P A;  1AQW A;  2R4V A;  1OC9 B;  4K2X A;  5DQY A;  3D4T A;  2B7K A;  3UVH A;  1XXU A;  2WCI A;  5EY6 A;  4CHS A;  5J3R A;  3D6I A;  1ILO A;  2C0D A;  4GWR A;  5DQS A;  3E0U A;  4MJC A;  1M99 A;  1OC9 A;  4K0N A;  3RAZ A;  3FMW A;  4IN0 A;  5INY A;  1XWK A;  1ERV A;  1O73 A;  3EMX A;  3WGD A;  2PPT A;  5AN1 A;  5JWR B;  5IPG A;  2HXK A;  1MEK A;  1Q98 A;  2YWI A;  4HZ4 A;  4G9H A;  4HJM A;  2GZZ A;  2C3N A;  1F3B A;  2I9H A;  2AHE A;  2GSS A;  2ZCT A;  1ACV A;  1ZYE A;  2M46 A;  5IMF A;  3LG6 A;  2GVP A;  4Q5N A;  3KH7 A;  3A2V A;  2H0I A;  3MWH A;  1J08 A;  3VWU A;  4MMM A;  2C0F A;  3EU4 A;  2GST A;  3ZFL A;  2RUE A;  3V1W A;  3TUE A;  2C3T A;  4ECB A;  1BJX A;  4MK3 A;  2CZ2 A;  1H4O A;  1J9B A;  5EPF A;  3UMA A;  2YP6 A;  4RI7 A;  1JZR A;  2HI7 A;  2VM1 A;  5ECQ B;  1SJZ A;  4I6X A;  1XW5 A;  2AUV A;  2H0G A;  2L4Q A;  4HDE A;  5H5R A;  4JU5 A;  4XS6 A;  2WDU A;  1EEJ A;  1GUH A;  1SYR A;  3HVN A;  4G0L A;  1XOB A;  2X4A A;  3ERF A;  3GHA A;  1TW9 A;  2AV4 A;  3ZMK A;  3LYK A;  2JU5 A;  1DUG A;  5DJL A;  2GDR A;  4AJ8 A;  5G31 A;  2FWH A;  1SL2 B;  1YKC A;  3UOM A;  3M8N A;  3WT2 A;  3IK9 A;  5JCG A;  2JZR A;  3NZN A;  5KOW A;  1YJ6 A;  5AIS A;  1HQO A;  2H30 A;  3IR4 A;  3EYT A;  3L9U A;  4BVY B;  3MSZ A;  3FEU A;  1GTB A;  16GS A;  4ZBD A;  1GH2 A;  1Q4J A;  4IBP A;  1TP9 A;  3F63 A;  2LUS A;  5ECK B;  2MBS A;  3ZL5 A;  1QXH A;  5J5N A;  2DIY A;  2IFQ A;  17GS A;  3Q6O A;  2IWT A;  2REM A;  1F9M A;  3HJO A;  1K3Y A;  4BVY A;  2YJ7 A;  3Q19 A;  3M9K A;  2K6V A;  1ZGN A;  2VCQ A;  4K9Z A;  1SKR B;  4FQU A;  1CQG A;  4TOP A;  2ON7 A;  4HSC X;  3CMI A;  4ZL8 A;  2IMD A;  2PBJ A;  3EU3 A;  4X1U A;  1TTZ A;  2UZ8 A;  3DIE A;  5IOX A;  3RHC A;  5COH A;  4NHZ A;  4ZL7 A;  3TKS E;  1K0D A;  3WGX A;  12GS A;  3C1R A;  5DBQ A;  3HY2 A;  1YF1 A;  2B5E A;  3IRA A;  4XTS A;  4BA7 A;  3ZIJ A;  3KGK A;  4YKF A;  2X8H A;  4E8E A;  2MBT A;  2WGR A;  3LXT A;  1X9W B;  3F9U A;  6GSW A;  2R0P A;  1B9Y C;  4EUY A;  1PKW A;  1UVZ A;  2B1K A;  1SL0 B;  3L4N A;  4IJI A;  5KN2 A;  5DAK A;  3WD6 A;  3U5R E;  1EGR A;  1S3D A;  5CRD A;  3QAG A;  5LD0 A;  3GNJ A;  1YF0 A;  1SD9 A;  2JZT A;  3FR9 A;  3BOA A;  3GYK A;  3ZRD A;  3ZLP A;  2L57 A;  4BWS A;  4L5O A;  4X4J A;  3KEB A;  5IPH A;  3IXR A;  4OCE A;  2ZNM A;  4IVF A;  2B1L A;  1R5A A;  2WUL A;  4LMV A;  5CP1 A;  2H75 A;  2DJ1 A;  2J9H A;  2HT9 A;  2O85 A;  1PA3 A;  4PXO A;  4TRX A;  2ES7 A;  5ABR A;  2VM2 A;  3FK8 A;  1M2D A;  2DJ2 A;  4N10 A;  4Z7X A;  3HJP A;  2CZ3 A;  2WJU A;  2QA2 A;  4YQM A;  3VI7 A;  5H5Q A;  1OKD A;  2PUK C;  5FT3 A;  5DCG A;  5F05 A;  2MMO A;  2VD0 A;  3KM6 A;  5IO2 A;  4WBR D;  4HJ2 A;  2KOK A;  1U87 A;  1O81 A;  5DAL B;  2LEG A;  2NTO A;  4XS4 B;  2M72 A;  2HFD A;  4IKH A;  2C1Y A;  1ZYN A;  1BAY A;  2A2P A;  4ECC A;  2F3M A;  4V2N A;  2X8G A;  5DAL A;  1RQM A;  2C0G A;  3O76 A;  3HXS A;  3UEM A;  4TR0 A;  2CX4 A;  3IC8 A;  2P5Q A;  1GP1 A;  1X0R A;  3GA4 A;  1BED A;  3I9V 2;  3I6A A;  1FO5 A;  4LA1 A;  1FB6 A;  3LGC A;  2PVO C;  2VLU A;  1FG4 A;  4EE0 A;  1TJD A;  4EF0 A;  2DJ0 A;  2K8S A;  1DSB A;  3L78 A;  2QKE A;  4BWQ A;  4GCI A;  3H8Q A;  2R6K A;  1EP8 A;  5LNK e;  4P3Y B;  6GSU A;  4USS A;  1M9B A;  4CY8 A;  4POK A;  3GH9 A;  2VCZ A;  4EXJ A;  1PQN A;  3EIN A;  2QGV A;  4MP4 A;  3RDW A;  3UIW A;  2XBI A;  1GUK A;  4DVC A;  2X99 A;  1KTE A;  5F8B A;  1SKW B;  4AF2 A;  2E7P A;  3HD5 A;  4RQX A;  5ID2 A;  2RII A;  18GS A;  1VF3 A;  1ZOF A;  3QOU A;  1MDJ A;  4KE3 A;  2YZH A;  2YV7 A;  2V1M A;  3TB2 A;  2LJA A;  1AC1 A;  2HSH A;  1X9M B;  4OFT A;  4KND A;  4QL9 A;  2AAW A;  4EDZ A;  3IA1 A;  2N5A A;  4MZC A;  3FZ4 A;  3DD3 A;  3IE3 A;  1ZL9 A;  1V57 A;  3N5O A;  4EKZ A;  3ME7 A;  3BJ5 A;  2R0C A;  3FZ5 A;  1K3O A;  3GSS A;  4MJE A;  1K0B A;  5A4W A;  1XWG A;  3EE2 A;  3VPQ A;  1M3J A;  3VLN A;  8GSS A;  4HZ2 A;  4WEY A;  4WR4 A;  3VK9 A;  3LYP A;  1PN9 A;  2GS3 A;  5D9X A;  1JZO A;  1G7O A;  4NPB A;  22GS A;  3P90 A;  5DVB A;  1WPI A;  3DYR A;  1QMV A;  5H5S A;  3W8S A;  3IC4 A;  4MH3 A;  1F2E A;  1PX7 A;  5D8I A;  4ZL9 A;  4D73 A;  4IHU A;  4V1A g;  4IP6 A;  3KTL A;  5J4U A;  4KF9 A;  4WR5 A;  1K0O A;  1IYI A;  1BX9 A;  3W6G A;  3C71 A;  1JLW A;  1WWJ A;  5A5K A;  5HR1 A;  4L8E A;  5KN1 A;  1TOF A;  5D9T A;  1I9D A;  4GF0 A;  3H93 A;  4LMW A;  2YWN A;  3HYP A;  1X5D A;  3BCI A;  1EV4 A;  1O8X A;  3WYW A;  1YEP A;  2H1G A;  1A2M A;  3MNG A;  4LL4 B;  2VL3 A;  5CRW A;  1O6J A;  4BIK A;  2H76 A;  3UAP A;  4Q5R A;  2TRX A;  3ISO A;  2CX3 A;  1GTI A;  1EOH A;  4HQS A;  3F4T A;  1GSS A;  1BQ7 A;  1MD4 A;  4ICY A;  3EC3 A;  3D21 A;  2RM6 A;  3GL5 A;  3GX0 A;  3TJF A;  3D0Z A;  4JR6 A;  4I2U A;  4DSS B;  2MMZ A;  4JRR A;  3GH6 A;  1A8L A;  5KEJ A;  4KH7 A;  3DEX A;  1GSQ A;  4MPG A;  3BD2 A;  3G7Y A;  2V6K A;  4IQA A;  3KD0 A;  5IMD A;  2BMX A;  4MLY A;  4NWY A;  4GTU A;  1MDI A;  1FB0 A;  4IS0 A;  3PGT A;  1HNC A;  4GRF A;  2AB6 A;  2B5X A;  3GFK A;  5J41 A;  1GUM A;  1V2A A;  5KOX A;  1N2A A;  3GIX A;  2GLR A;  2J23 A;  3QDN A;  2YOI A;  4G0K A;  4RUV A;  3TJG A;  1T7P B;  3L9S A;  2FGX A;  2DJJ A;  3HCZ A;  1TU8 A;  1K0N A;  2VO4 A;  3TKR A;  4J57 E;  3LEF A;  1JZD A;  5ECM B;  2JSZ A;  4I2T A;  1S3C A;  4XS1 A;  5ECN B;  3QFA C;  1PKZ A;  5F07 A;  2XHF A;  3GN3 A;  2H6X A;  2IL3 A;  2KUC A;  1TRU A;  3GL3 A;  4F82 A;  3IBH A;  4JE1 A;  2MZC A;  1Z9H A;  4GXZ A;  3HJM A;  1GRX A;  2CAI A;  1GTU A;  4MF7 A;  5A4V A;  1I5G A;  11GS A;  4X43 A;  5BRT A;  3LSZ A;  2HZF A;  1OC3 A;  3G9B A;  4EIQ A;  4G2E A;  4OCF A;  4KSO A;  5D9W A;  4YAP A;  2B3S A;  3ME8 A;  1ST9 A;  1XVW A;  3TKQ A;  3VI5 A;  3H79 A;  5AIX A;  4OFN A;  3FR6 A;  4WXT A;  2R3X A;  3HVS A;  1LBK A;  2DIZ A;  5ELA A;  1B4Q A;  2GQM A;  4H86 A;  4I97 A;  6GSY A;  2H8L A;  3P2A A;  2E0Q A;  1Y6E A;  3GRX A;  2ON5 A;  2HNL A;  3TRQ A;  1A0R P;  3F3R A;  2XPD A;  1U3I A;  3APS A;  1T00 A;  3DVX A;  1PRX A;  3NOF A;  4ZB9 A;  4TVE A;  2ALB A;  3PIN A;  2V41 A;  5FWG A;  3BBY A;  4OO5 A;  1F6M C;  4MA9 A;  1AW9 A;  1KBN A;  6GST A;  1EEM A;  3H4K A;  1SJ6 A;  3QR6 A;  3KMN A;  4FO5 A;  3IAM 2;  13GS A;  2F8F A;  4F03 A;  3IDV A;  2GZP A;  1VF2 A;  3ZZX A;  3QCP A;  5JWO B;  5B7C A;  3UL3 A;  4Z2T A;  4EIP A;  1QUW A;  3A2W A;  1UA5 A;  3MDK A;  5A4U A;  1DE2 A;  4IP1 A;  4FH8 A;  2IFQ B;  2JAC A;  5G2Z A;  2E2G A;  2IMF A;  4I5Q A;  3FY7 A;  2DJK A;  3HZ4 A;  4PQ1 A;  2BTO T;  4IW9 A;  5HR3 A;  4ML1 A;  2NPB A;  1R5P A;  3GKK A;  4EC0 A;  2N5F A;  2RLI A;  2LRN A;  4ISD A;  1ERU A;  5J9C A;  1IYH A;  2P5R A;  1QGV A;  3VWW A;  1GSF A;  2OAC A;  5B8B A;  4YQU A;  4Q5F A;  1AIU A;  2EIO A;  4WET A;  3TCO A;  3D22 A;  4KUN A;  2HZE A;  4A5P A;  1WIK A;  1SL1 B;  1X9S B;  3RBT A;  1M9A A;  2PVQ A;  4X0X A;  4AJ6 A;  1MD3 A;  4OWY A;  1M2A A;  3HZ8 A;  1DE1 A;  4IGJ A;  4HS1 A;  1TRS A;  1THO A;  5DAK B;  2TRC P;  4QQ7 A;  1V40 A;  1Z3E A;  3IK7 A;  1SK2 A;  3DWV A;  2N5B A;  2FWF A;  4IEL A;  3HKR A;  3TJJ A;  4K8M A;  1O85 A;  1HYU A;  1NSW A;  1HNB A;  3M9J A;  3F3Q A;  4AGS A;  2YWM A;  5GZZ B;  2K9F A;  2XC2 A;  3KP8 A;  2L6D A;  2CVK A;  5HFK A;  4ID0 A;  4EO3 A;  2H66 A;  1GWC A;  2CV4 A;  1YZX A;  2FY6 A;  4K6X A;  2HSY A;  2WS2 A;  2AYT A;  5IO0 A;  4K2D A;  3TOT A;  4TN8 A;  2HRA A;  5E4W A;  4GST A;  1PX6 A;  1ABA A;  2KP2 A;  2LNT A;  4CDO A;  1A8Y A;  3ZTL A;  5CO3 A;  3TKS A;  4CY6 A;  3TRX A;  1PL2 A;  1URM A;  1WE0 A;  2RM5 A;  3VFI A;  2PU9 C;  3SWL A;  4IJ3 A;  2MMA A;  5ECH B;  1RW1 A;  4CW9 A;  2R5G A;  2VD1 A;  4PTS A;  1TU7 A;  4N0Z A;  1NW2 A;  1XWB A;  4JR4 A;  5JCU A;  1FHE A;  4HOJ A;  4PGT A;  4PUR A;  5IQY A;  4TXO A;  1E2Y A;  2CA8 A;  1FAA A;  2GZY A;  4PUF C;  4BVX B;  2B7J A;  5CAX A;  2H1A A;  1T8E B;  5BMU A;  1XWC A;  2HYX A;  3DVW A;  1ML6 A;  1ERT A;  3RPP A;  1FOV A;  2VL2 A;  2O87 A;  3C7M A;  3QFB C;  3APO A;  5C04 A;  1TRV A;  3DXB A;  1UC7 A;  4BVX A;  5GAN D;  2LQQ A;  14GS A;  5CYY A;  4BPY A;  4JZQ A;  1K0A A;  3A3T A;  4GSN A;  3SBC A;  2H73 A;  4BL7 A;  2FA4 A;  4HI7 A;  5HFI A;  2VL2 C;  1XW6 A;  4MZB A;  1SKS B;  1LJR A;  2DBC A;  1XVQ A;  1U3A A;  2EIQ A;  2DLX A;  2VLT A;  1SJI A;  3EVI A;  3Q74 A;  4K7O A;  5ID2 B;  1T4Z A;  2OJL A;  2HRK A;  2JZS A;  1OKT A;  1GNE A;  4G19 A;  2GTU A;  4K1F A;  5HR2 A;  4KCA A;  5DDL A;  2HRF A;  2L4C A;  4HU9 A;  4IQ1 A;  1ZYQ B;  3KMO A;  4O5U A;  2A2S A;  3GST A;  3F4S A;  2V2G A;  4PUA A;  1YKA A;  1N8J A;  3GTU A;  2FHE A;  4PQH A;  2G0F A;  1SYX A;  2FWG A;  2VAF A;  2KP1 A;  5IMC A;  5B6N A;  4WKW A;  2C3Q A;  1WOU A;  1M0U A;  4ML6 A;  1RK4 A;  4HEA 2;  2O7K A;  3C1S A;  2GT6 A;  4MCU A;  3KTB A;  1GLP A;  3ZVJ D;  2XBQ A;  1OE7 A;  1OAZ A;  5CRG A;  3VUR A;  5IIZ A;  1A2L A;  4YQV A;  1XW9 A;  3KXO A;  2K8V A;  5GAP D;  3UVT A;  3US3 A;  3UAR A;  3DRN A;  4D73 B;  1GSD A;  1F37 A;  4MZW A;  1AUC A;  1K0M A;  4ECI A;  5FHI A;  1O7U A;  2O8V B;  2VCX A;  3GUR A;  1PD2 1;  1MDK A;  3F8U A;  3U6V A;  4TR1 A;  4N0V A;  3LQ7 A;  1JHB A;  3ZML A;  1X5C A;  1THX A;  1EWX A;  5JWQ B;  3R2Q A;  5AIV A;  2AJQ B;  4PX1 A;  1G7E A;  1PSQ A;  3H1N A;  1WP0 A;  1B8X A;  2LKU A;  4QL7 A;  4DSR A;  1FW1 A;  2JL4 A;  1XOA A;  5JCW A;  1V98 A;  2LJK A;  5F0G A;  5HFG A;  2CAQ A;  1X5E A;  2YAN A;  2LST A;  2LRT A;  1PFO A;  3ZVJ A;  4RQR A;  1GLQ A;  4NV5 A;  5D9V A;  5LCZ A;  3I43 A;  3UJ1 A;  1V58 A;  4L5L A;  2I81 A;  3IAS 2;  1JZW A;  4O5Q A;  2K18 A;  1UN2 A;  2I1U A;  4AJ7 A;  3F6D A;  20GS A;  3CSJ A;  1TI1 A;  4NV2 A;  4EL1 A;  1NM3 A;  2PWJ A;  2OE1 A;  1JFU A;  1E6B A;  5IOW A;  1GNW A;  1GSE A;  1A2J A;  2GT5 A;  2VIM A;  2O89 A;  3KCM A;  3TKP A;  3FW2 A;  5L71 A;  2FD3 A;  1AQV A;  4NXI A;  3UBK A;  4GSS A;  4KDX A;  4FYU A;  5HQP A;  4TXV A;  3GKX A;  4O32 A;  2H6Y A;  5ECS A;  1FVK A;  3L0H A;  4KA0 A;  1AQX A;  4V1A p;  2JSY A;  4PNG A;  2H6Z A;  1Z6M A;  1ZZY A;  1ERW A;  2PGT A;  1Z6N A;  2PN8 A;  1A23 A;  2HE3 A;  2OE3 A;  3A5W A;  3KZQ A;  5ECP B;  2F9S A;  1K3L A;  4XIH A;  2V6O A;  3MIX A;  3R3E A;  1OC8 A;  3N9J A;  3TOU A;  4POM A;  5C00 A;  3CSI A;  1OYJ A;  3HVV A;  3A5I A;  2H1B A;  4EDY A;  3GMF A;  1EZK A;  2LS5 A;  5ECO B;  2FCH A;  4F0B A;  2LTK A;  2A2R A;  2CVD A;  3CXG A;  3DGQ A;  4MDC A;  2IN3 A;  3KIJ A;  4MPF A;  2ZUP A;  4KW6 A;  3OR5 A;  1QQ2 A;  6GSV A;  5KN3 A;  3QD9 A;  4KB3 A;  2DML A;  2H19 A;  1WRY A;  3TJB A;  1DBY A;  3TRP A;  6GSX A;  3RPN A;  1VF4 A;  1EGO A;  2CT6 A;  3HA9 A;  2C80 A;  1PN0 A;  1QK8 A;  2OAD A;  1PMT A;  2A4H A;  2VCT A;  4ZXG A;  3IOS A;  4I8B A;  4N11 A;  4V2L A;  2MYG A;  3IPZ A;  3TJK A;  2VOC A;  1B48 A;  2TIR A;  5DJM A;  4GLT A;  4XHM A;  3QMX A;  4DEJ A;  2H0H A;  2MMN A;  3MYD A;  4KDU A;  3O6T A;  1R4W A;  2FNO A;  1MTC A;  1KEB A;  4ECJ A;  4KX4 A;  1M2B A;  1TK5 B;  5F06 A;  2GQK A;  4ZBB A;  4OMV A;  2LQO A;  2DKI A;  2FA8 A;  4ACS A;  2YCD A;  1GSY A;  1M7T A;  2F8A A;  2YPM A;  2L6C A;  1TRW A;  2P31 A;  1TK0 B;  3M3M A;  1YQ1 A;  2YWO A;  3ZFB A;  3PR8 A;  4XRA A;  4F0C A;  2WB9 A;  9GSS A;  5EL8 A;  2H1D A;  1NHO A;  3E9J B;  1TKD B;  2B5Y A;  4KAE A;  1GUL A;  5J9B A;  2QC7 A;  3FZA A;  5B6M A;  3AY8 A;  3IHG A;  2HZE B;  3LWA A;  5CRH A;  4ZBA A;  2VCW A;  1SK0 A;  2H71 A;  3GKM A;  1CQH A;  4L0U A;  10GS A;  3TGZ A;  5CRE A;  4ZB8 A;  1R7H A;  3DKS A;  1LU4 A;  2WFC A;  5B8A A;  3D4M A;  3LJR A;  2V32 A;  1XBS A;  4N30 A;  2XPE A;  4JED A;  5IMZ A;  4YH2 A;  2OA7 A;  3O3T A;  2FUG 2;  2GQL A;  2C0E A;  1XFL A;  2OKA A;  1AAZ A;  4POB A;  1WJK A;  2VUP A;  2LV3 A;  4TKY A;  4POL A;  4HUA A;  3HHV A;  2NBS A;  2CVB A;  1VGL A;  4MF5 A;  3F0I A;  2X64 A;  4YKG A;  4G0I A;  4WBJ A;  4J56 E;  4ZB6 A;  2B6M A;  1ZYP A;  2HSM A;  3K8N A;  3QPM A;  3C73 A;  4YAV A;  2E2M A;  1R26 A;  3S9F A;  5G1L A;  3P8W A;  3CYN A;  5EVO A; 
#chains in the Genus database with same CATH homology
 5IMA A;  5D96 A;  5E59 A;  4Z2U A;  2NDO A;  4Z2R A;  2WZ9 A;  1SEN A;  4NHW A;  3HVX A;  5D73 A;  2GSQ A;  2KLX A;  2GGT A;  2OE0 A;  1HNA A;  2C4J A;  4OO4 A;  2VCV A;  1ZMA A;  2X8C A;  2VLV A;  3CTG A;  3EUR A;  2D2Z A;  4F9Z A;  2FWE A;  4XCS A;  1PGT A;  4TXO B;  1EP7 A;  2Z9S A;  3M1G A;  5D93 A;  2IJY A;  1Y25 A;  3LFL A;  5KN0 A;  3TKS C;  4WF4 A;  1FOH A;  3I69 A;  4PQI A;  1OVN A;  4KSM A;  2OBK A;  4KCE A;  4K5S A;  1GTA A;  4PNF A;  3D5J A;  4KDY A;  2DMM A;  2A4V A;  2LRC A;  1T4Y A;  4O92 A;  1G6W A;  5HR0 A;  3ZRE A;  4F2I A;  1K0C A;  4BL7 B;  2KHP A;  3KP9 A;  5ELG A;  1W4V A;  3PH9 A;  1QFN A;  4K7N A;  2H70 A;  6GSS A;  3F4R A;  4XS4 A;  1T3B A;  4MH2 A;  2L5L A;  3QAV A;  3CTF A;  3KH9 A;  3PPU A;  1U6T A;  3GV1 A;  3NIV A;  1F3A A;  1W89 A;  1A0F A;  3QAW A;  1YY7 A;  2R0G A;  5CNW A;  5AGY A;  5ENU A;  1OE8 A;  1TI3 A;  2JAD A;  2FLS A;  7GSS A;  4JBB A;  3LOR A;  3G7J A;  3TDG A;  3GTU B;  4LLR A;  2CQ9 A;  3FHK A;  1XIY A;  3HDC A;  3ED3 A;  1ON4 A;  1TDI A;  1A24 A;  2QSI A;  1TK8 B;  3APQ A;  1H75 A;  1G6Y A;  1B4P A;  1PL1 A;  4J2F A;  2M80 A;  3BCK A;  1XWA A;  4L0W A;  4K0G A;  1XCC A;  1O8W A;  3IHQ A;  3WGE A;  2I3Y A;  3MAK A;  4FYC A;  1B9X C;  3WT1 A;  1V9W A;  2QA1 A;  2H74 A;  2DSA A;  3VWX A;  1YDK A;  1BYE A;  4OD7 A;  5ECL B;  4K7I A;  2LJR A;  1XZO A;  1BG5 A;  3GX8 A;  3FYG A;  2L59 A;  3EPT A;  4MNN A;  5IM9 A;  2YNX A;  3VWV A;  3DML A;  3F6F A;  2H72 A;  3J7Y k;  4DSQ A;  2P0G A;  3G7I A;  1GL8 A;  2IME A;  2OBI A;  4TR1 B;  2HRN A;  1Z7R A;  1T1V A;  1EOG A;  4HQZ A;  2H01 A;  4RI6 A;  1TXX A;  5G5E A;  4TR3 A;  5GSS A;  2IMK A;  4OFM A;  3ZYW A;  2DKH A;  2IMI A;  4O5R A;  3ERG A;  3FKF A;  4O7H A;  5ECI B;  3EWL A;  4ULX A;  3RHB A;  1AXD A;  4V2M A;  4XRD A;  2GSR A;  3CSH A;  1XPV A;  5ECR B;  3KJY A;  2R2J A;  3W8J A;  4LL1 B;  1SK1 A;  4HU7 A;  2WRT A;  3J7Y b;  2YZU A;  3VPT A;  3CBU A;  5IMV A;  3FR3 A;  3Q18 A;  4GQC A;  3A2X A;  1ZCP A;  4TR4 A;  1KNG A;  2BJX A;  1SU9 A;  1GSU A;  2NVL A;  4KGI A;  3EMP A;  3C8E A;  4MJB A;  3ZIT A;  1J0F A;  2C8U A;  2IPA A;  3GUS A;  4GQF A;  1HD2 A;  5G30 A;  1G0T A;  3GKN A;  1NHY A;  5GST A;  4Q5Q A;  2VL9 A;  2EC4 A;  4E8H A;  5G1K A;  4WF5 A;  2I4A A;  1YEX A;  4G10 A;  2G2Q A;  3ERW A;  4MAB A;  2YJH A;  1Z5Y E;  1USB A;  4NAX A;  2R37 A;  2HLS A;  2RUF A;  1S3A A;  1VF1 A;  2LNS A;  4MF6 A;  19GS A;  2PMT A;  3CRT A;  4K5R A;  3ZIV A;  2DJ3 A;  2YV9 A;  1C72 A;  3IV4 A;  2F51 A;  1JLV A;  4FYB A;  3E3E A;  3L9V A;  1EV9 A;  3FZ9 A;  4FIW A;  4EVM A;  3FRC A;  4DSS A;  1VRS D;  3JCM L;  2DC5 A;  3LW9 A;  4TW5 A;  4ILF A;  3M0F A;  2X49 A;  2EIR A;  4MJA A;  4ZIL A;  1FVJ A;  5G5F A;  4ZIJ A;  2YN1 A;  4NMU A;  3LXZ A;  3CRU A;  5DCH A;  2IIY A;  2L5O A;  2PER A;  1SD8 A;  1WMJ A;  1U88 A;  3UBL A;  3P7X A;  1Z7P A;  1AQW A;  2R4V A;  1OC9 B;  4K2X A;  5DQY A;  3D4T A;  2B7K A;  3UVH A;  1XXU A;  2WCI A;  5EY6 A;  4CHS A;  5J3R A;  3D6I A;  1ILO A;  2C0D A;  4GWR A;  5DQS A;  3E0U A;  4MJC A;  1M99 A;  1OC9 A;  4K0N A;  3RAZ A;  3FMW A;  4IN0 A;  5INY A;  1XWK A;  1ERV A;  1O73 A;  3EMX A;  3WGD A;  2PPT A;  5AN1 A;  5JWR B;  5IPG A;  2HXK A;  1MEK A;  1Q98 A;  2YWI A;  4HZ4 A;  4G9H A;  4HJM A;  2GZZ A;  2C3N A;  1F3B A;  2I9H A;  2AHE A;  2GSS A;  2ZCT A;  1ACV A;  1ZYE A;  2M46 A;  5IMF A;  3LG6 A;  2GVP A;  4Q5N A;  3KH7 A;  3A2V A;  2H0I A;  3MWH A;  1J08 A;  3VWU A;  4MMM A;  2C0F A;  3EU4 A;  2GST A;  3ZFL A;  2RUE A;  3V1W A;  3TUE A;  2C3T A;  4ECB A;  1BJX A;  4MK3 A;  2CZ2 A;  1H4O A;  1J9B A;  5EPF A;  3UMA A;  2YP6 A;  4RI7 A;  1JZR A;  2HI7 A;  2VM1 A;  5ECQ B;  1SJZ A;  4I6X A;  1XW5 A;  2AUV A;  2H0G A;  2L4Q A;  4HDE A;  5H5R A;  4JU5 A;  4XS6 A;  2WDU A;  1EEJ A;  1GUH A;  1SYR A;  4G0L A;  1XOB A;  2X4A A;  3ERF A;  3GHA A;  1TW9 A;  2AV4 A;  3ZMK A;  3LYK A;  2JU5 A;  1DUG A;  5DJL A;  2GDR A;  4AJ8 A;  5G31 A;  2FWH A;  1SL2 B;  1YKC A;  3UOM A;  3M8N A;  3WT2 A;  3IK9 A;  5JCG A;  2JZR A;  3NZN A;  5KOW A;  1YJ6 A;  5AIS A;  1HQO A;  2H30 A;  3IR4 A;  3EYT A;  3L9U A;  4BVY B;  3MSZ A;  3FEU A;  1GTB A;  16GS A;  4ZBD A;  1GH2 A;  1Q4J A;  4IBP A;  1TP9 A;  3F63 A;  2LUS A;  5ECK B;  2MBS A;  3ZL5 A;  1QXH A;  5J5N A;  2DIY A;  2IFQ A;  17GS A;  3Q6O A;  2IWT A;  2REM A;  1F9M A;  3HJO A;  1K3Y A;  4BVY A;  2YJ7 A;  3Q19 A;  3M9K A;  2K6V A;  1ZGN A;  2VCQ A;  4K9Z A;  1SKR B;  4FQU A;  1CQG A;  4TOP A;  2ON7 A;  3CMI A;  4ZL8 A;  2IMD A;  2PBJ A;  3EU3 A;  4X1U A;  1TTZ A;  2UZ8 A;  3DIE A;  5IOX A;  3RHC A;  5COH A;  4NHZ A;  4ZL7 A;  3TKS E;  1K0D A;  3WGX A;  12GS A;  3C1R A;  5DBQ A;  3HY2 A;  1YF1 A;  2B5E A;  3IRA A;  4XTS A;  4BA7 A;  3ZIJ A;  3KGK A;  4YKF A;  2X8H A;  4E8E A;  2MBT A;  2WGR A;  3LXT A;  1X9W B;  3F9U A;  6GSW A;  2R0P A;  1B9Y C;  4EUY A;  1PKW A;  1UVZ A;  2B1K A;  1SL0 B;  3L4N A;  4IJI A;  5KN2 A;  5DAK A;  3WD6 A;  3U5R E;  1EGR A;  1S3D A;  5CRD A;  3QAG A;  5LD0 A;  3GNJ A;  1YF0 A;  1SD9 A;  2JZT A;  3FR9 A;  3BOA A;  3GYK A;  3ZRD A;  3ZLP A;  2L57 A;  4BWS A;  4L5O A;  4X4J A;  3KEB A;  5IPH A;  3IXR A;  4OCE A;  2ZNM A;  4IVF A;  2B1L A;  1R5A A;  2WUL A;  4LMV A;  5CP1 A;  2H75 A;  2DJ1 A;  2J9H A;  2HT9 A;  2O85 A;  1PA3 A;  4PXO A;  4TRX A;  2ES7 A;  5ABR A;  2VM2 A;  3FK8 A;  1M2D A;  2DJ2 A;  4N10 A;  4Z7X A;  3HJP A;  2CZ3 A;  2WJU A;  2QA2 A;  4YQM A;  3VI7 A;  5H5Q A;  1OKD A;  2PUK C;  5FT3 A;  5DCG A;  5F05 A;  2MMO A;  2VD0 A;  3KM6 A;  5IO2 A;  4WBR D;  4HJ2 A;  2KOK A;  1U87 A;  1O81 A;  5DAL B;  2LEG A;  2NTO A;  4XS4 B;  2M72 A;  2HFD A;  4IKH A;  2C1Y A;  1ZYN A;  1BAY A;  2A2P A;  4ECC A;  2F3M A;  4V2N A;  2X8G A;  5DAL A;  1RQM A;  2C0G A;  3O76 A;  3HXS A;  3UEM A;  4TR0 A;  2CX4 A;  3IC8 A;  2P5Q A;  1GP1 A;  1X0R A;  3GA4 A;  1BED A;  3I9V 2;  3I6A A;  1FO5 A;  4LA1 A;  1FB6 A;  3LGC A;  2PVO C;  2VLU A;  1FG4 A;  4EE0 A;  1TJD A;  4EF0 A;  2DJ0 A;  2K8S A;  1DSB A;  3L78 A;  2QKE A;  4BWQ A;  4GCI A;  3H8Q A;  2R6K A;  1EP8 A;  5LNK e;  4P3Y B;  6GSU A;  4USS A;  1M9B A;  4CY8 A;  4POK A;  3GH9 A;  2VCZ A;  4EXJ A;  1PQN A;  3EIN A;  2QGV A;  4MP4 A;  3RDW A;  3UIW A;  2XBI A;  1GUK A;  4DVC A;  2X99 A;  1KTE A;  5F8B A;  1SKW B;  4AF2 A;  2E7P A;  3HD5 A;  4RQX A;  5ID2 A;  2RII A;  18GS A;  1VF3 A;  1ZOF A;  3QOU A;  1MDJ A;  4KE3 A;  2YZH A;  2YV7 A;  2V1M A;  3TB2 A;  2LJA A;  1AC1 A;  2HSH A;  1X9M B;  4OFT A;  4KND A;  4QL9 A;  2AAW A;  4EDZ A;  3IA1 A;  2N5A A;  4MZC A;  3FZ4 A;  3DD3 A;  3IE3 A;  1ZL9 A;  1V57 A;  3N5O A;  4EKZ A;  3ME7 A;  3BJ5 A;  2R0C A;  3FZ5 A;  1K3O A;  3GSS A;  4MJE A;  1K0B A;  5A4W A;  1XWG A;  3EE2 A;  3VPQ A;  3VLN A;  8GSS A;  4HZ2 A;  4WEY A;  4WR4 A;  3VK9 A;  3LYP A;  1PN9 A;  2GS3 A;  5D9X A;  1JZO A;  1G7O A;  4NPB A;  22GS A;  3P90 A;  5DVB A;  1WPI A;  3DYR A;  1QMV A;  5H5S A;  3W8S A;  3IC4 A;  4MH3 A;  1F2E A;  1PX7 A;  5D8I A;  4ZL9 A;  4D73 A;  4IHU A;  4V1A g;  4IP6 A;  3KTL A;  5J4U A;  4KF9 A;  4WR5 A;  1K0O A;  1IYI A;  1BX9 A;  3W6G A;  3C71 A;  1JLW A;  1WWJ A;  5A5K A;  5HR1 A;  4L8E A;  5KN1 A;  1TOF A;  5D9T A;  1I9D A;  4GF0 A;  3H93 A;  4LMW A;  2YWN A;  3HYP A;  1X5D A;  3BCI A;  1EV4 A;  1O8X A;  3WYW A;  1YEP A;  2H1G A;  1A2M A;  3MNG A;  4LL4 B;  2VL3 A;  5CRW A;  1O6J A;  2H76 A;  3UAP A;  4Q5R A;  2TRX A;  3ISO A;  2CX3 A;  1GTI A;  1EOH A;  4HQS A;  3F4T A;  1GSS A;  1BQ7 A;  1MD4 A;  4ICY A;  3EC3 A;  3D21 A;  2RM6 A;  3GL5 A;  3GX0 A;  3TJF A;  3D0Z A;  4JR6 A;  4I2U A;  4DSS B;  2MMZ A;  4JRR A;  3GH6 A;  1A8L A;  5KEJ A;  4KH7 A;  3DEX A;  1GSQ A;  4MPG A;  3BD2 A;  3G7Y A;  2V6K A;  4IQA A;  3KD0 A;  5IMD A;  2BMX A;  4MLY A;  4NWY A;  4GTU A;  1MDI A;  1FB0 A;  4IS0 A;  3PGT A;  1HNC A;  4GRF A;  2AB6 A;  2B5X A;  3GFK A;  5J41 A;  1GUM A;  1V2A A;  5KOX A;  1N2A A;  3GIX A;  2GLR A;  2J23 A;  3QDN A;  2YOI A;  4G0K A;  4RUV A;  3TJG A;  1T7P B;  3L9S A;  2FGX A;  2DJJ A;  3HCZ A;  1TU8 A;  1K0N A;  2VO4 A;  3TKR A;  4J57 E;  3LEF A;  1JZD A;  5ECM B;  2JSZ A;  4I2T A;  1S3C A;  4XS1 A;  5ECN B;  3QFA C;  1PKZ A;  5F07 A;  2XHF A;  3GN3 A;  2H6X A;  2IL3 A;  2KUC A;  1TRU A;  3GL3 A;  4F82 A;  3IBH A;  4JE1 A;  2MZC A;  1Z9H A;  4GXZ A;  3HJM A;  1GRX A;  2CAI A;  1GTU A;  4MF7 A;  5A4V A;  1I5G A;  11GS A;  4X43 A;  5BRT A;  3LSZ A;  2HZF A;  1OC3 A;  3G9B A;  4EIQ A;  4G2E A;  4OCF A;  4KSO A;  5D9W A;  4YAP A;  2B3S A;  3ME8 A;  1ST9 A;  1XVW A;  3TKQ A;  3VI5 A;  3H79 A;  5AIX A;  4OFN A;  3FR6 A;  4WXT A;  2R3X A;  3HVS A;  1LBK A;  2DIZ A;  5ELA A;  1B4Q A;  2GQM A;  4H86 A;  4I97 A;  6GSY A;  2H8L A;  3P2A A;  2E0Q A;  1Y6E A;  3GRX A;  2ON5 A;  2HNL A;  3TRQ A;  1A0R P;  3F3R A;  2XPD A;  1U3I A;  3APS A;  1T00 A;  3DVX A;  1PRX A;  3NOF A;  4ZB9 A;  4TVE A;  2ALB A;  3PIN A;  2V41 A;  5FWG A;  3BBY A;  4OO5 A;  1F6M C;  4MA9 A;  1AW9 A;  1KBN A;  6GST A;  1EEM A;  3H4K A;  1SJ6 A;  3QR6 A;  3KMN A;  4FO5 A;  3IAM 2;  13GS A;  2F8F A;  4F03 A;  3IDV A;  2GZP A;  1VF2 A;  3ZZX A;  3QCP A;  5JWO B;  5B7C A;  3UL3 A;  4Z2T A;  4EIP A;  1QUW A;  3A2W A;  1UA5 A;  3MDK A;  5A4U A;  1DE2 A;  4IP1 A;  4FH8 A;  2IFQ B;  2JAC A;  5G2Z A;  2E2G A;  2IMF A;  4I5Q A;  3FY7 A;  2DJK A;  3HZ4 A;  4PQ1 A;  2BTO T;  4IW9 A;  5HR3 A;  4ML1 A;  2NPB A;  1R5P A;  3GKK A;  4EC0 A;  2N5F A;  2RLI A;  2LRN A;  4ISD A;  1ERU A;  5J9C A;  1IYH A;  2P5R A;  1QGV A;  3VWW A;  1GSF A;  2OAC A;  5B8B A;  4YQU A;  4Q5F A;  1AIU A;  2EIO A;  4WET A;  3TCO A;  3D22 A;  4KUN A;  2HZE A;  4A5P A;  1WIK A;  1SL1 B;  1X9S B;  3RBT A;  1M9A A;  2PVQ A;  4X0X A;  4AJ6 A;  1MD3 A;  4OWY A;  1M2A A;  3HZ8 A;  1DE1 A;  4IGJ A;  4HS1 A;  1TRS A;  1THO A;  5DAK B;  2TRC P;  4QQ7 A;  1V40 A;  1Z3E A;  3IK7 A;  1SK2 A;  3DWV A;  2N5B A;  2FWF A;  4IEL A;  3HKR A;  3TJJ A;  4K8M A;  1O85 A;  1HYU A;  1NSW A;  1HNB A;  3M9J A;  3F3Q A;  4AGS A;  2YWM A;  5GZZ B;  2K9F A;  2XC2 A;  3KP8 A;  2L6D A;  2CVK A;  5HFK A;  4ID0 A;  4EO3 A;  2H66 A;  1GWC A;  2CV4 A;  1YZX A;  2FY6 A;  4K6X A;  2HSY A;  2WS2 A;  2AYT A;  5IO0 A;  4K2D A;  3TOT A;  4TN8 A;  2HRA A;  5E4W A;  4GST A;  1PX6 A;  1ABA A;  2KP2 A;  2LNT A;  4CDO A;  1A8Y A;  3ZTL A;  5CO3 A;  3TKS A;  4CY6 A;  3TRX A;  1PL2 A;  1URM A;  1WE0 A;  2RM5 A;  3VFI A;  2PU9 C;  3SWL A;  4IJ3 A;  2MMA A;  5ECH B;  1RW1 A;  4CW9 A;  2R5G A;  2VD1 A;  4PTS A;  1TU7 A;  4N0Z A;  1NW2 A;  1XWB A;  4JR4 A;  5JCU A;  1FHE A;  4HOJ A;  4PGT A;  4PUR A;  5IQY A;  4TXO A;  1E2Y A;  2CA8 A;  1FAA A;  2GZY A;  4PUF C;  4BVX B;  2B7J A;  5CAX A;  2H1A A;  1T8E B;  5BMU A;  1XWC A;  2HYX A;  3DVW A;  1ML6 A;  1ERT A;  3RPP A;  1FOV A;  2VL2 A;  2O87 A;  3C7M A;  3QFB C;  3APO A;  5C04 A;  1TRV A;  3DXB A;  1UC7 A;  4BVX A;  5GAN D;  2LQQ A;  14GS A;  5CYY A;  4BPY A;  4JZQ A;  1K0A A;  3A3T A;  4GSN A;  3SBC A;  2H73 A;  4BL7 A;  2FA4 A;  4HI7 A;  5HFI A;  2VL2 C;  1XW6 A;  4MZB A;  1SKS B;  1LJR A;  2DBC A;  1XVQ A;  1U3A A;  2EIQ A;  2DLX A;  2VLT A;  1SJI A;  3EVI A;  3Q74 A;  4K7O A;  5ID2 B;  1T4Z A;  2OJL A;  2HRK A;  2JZS A;  1OKT A;  1GNE A;  4G19 A;  2GTU A;  4K1F A;  5HR2 A;  4KCA A;  5DDL A;  2HRF A;  2L4C A;  4HU9 A;  4IQ1 A;  1ZYQ B;  3KMO A;  4O5U A;  2A2S A;  3GST A;  3F4S A;  2V2G A;  4PUA A;  1YKA A;  1N8J A;  3GTU A;  2FHE A;  4PQH A;  2G0F A;  1SYX A;  2FWG A;  2VAF A;  2KP1 A;  5IMC A;  5B6N A;  4WKW A;  2C3Q A;  1WOU A;  1M0U A;  4ML6 A;  1RK4 A;  4HEA 2;  2O7K A;  3C1S A;  2GT6 A;  4MCU A;  3KTB A;  1GLP A;  3ZVJ D;  2XBQ A;  1OE7 A;  1OAZ A;  5CRG A;  3VUR A;  5IIZ A;  1A2L A;  4YQV A;  1XW9 A;  3KXO A;  2K8V A;  5GAP D;  3UVT A;  3US3 A;  3UAR A;  3DRN A;  4D73 B;  1GSD A;  1F37 A;  4MZW A;  1AUC A;  1K0M A;  4ECI A;  5FHI A;  1O7U A;  2O8V B;  2VCX A;  3GUR A;  1PD2 1;  1MDK A;  3F8U A;  3U6V A;  4TR1 A;  4N0V A;  3LQ7 A;  1JHB A;  3ZML A;  1X5C A;  1THX A;  1EWX A;  5JWQ B;  3R2Q A;  5AIV A;  2AJQ B;  4PX1 A;  1G7E A;  1PSQ A;  3H1N A;  1WP0 A;  1B8X A;  2LKU A;  4QL7 A;  4DSR A;  1FW1 A;  2JL4 A;  1XOA A;  5JCW A;  1V98 A;  2LJK A;  5F0G A;  5HFG A;  2CAQ A;  1X5E A;  2YAN A;  2LST A;  2LRT A;  3ZVJ A;  4RQR A;  1GLQ A;  4NV5 A;  5D9V A;  5LCZ A;  3I43 A;  3UJ1 A;  1V58 A;  4L5L A;  2I81 A;  3IAS 2;  1JZW A;  4O5Q A;  2K18 A;  1UN2 A;  2I1U A;  4AJ7 A;  3F6D A;  20GS A;  3CSJ A;  1TI1 A;  4NV2 A;  4EL1 A;  1NM3 A;  2PWJ A;  2OE1 A;  1JFU A;  1E6B A;  5IOW A;  1GNW A;  1GSE A;  1A2J A;  2GT5 A;  2VIM A;  2O89 A;  3KCM A;  3TKP A;  3FW2 A;  5L71 A;  2FD3 A;  1AQV A;  4NXI A;  3UBK A;  4GSS A;  4KDX A;  4FYU A;  5HQP A;  4TXV A;  3GKX A;  4O32 A;  2H6Y A;  5ECS A;  1FVK A;  3L0H A;  4KA0 A;  1AQX A;  4V1A p;  2JSY A;  4PNG A;  2H6Z A;  1Z6M A;  1ZZY A;  1ERW A;  2PGT A;  1Z6N A;  2PN8 A;  1A23 A;  2HE3 A;  2OE3 A;  3A5W A;  3KZQ A;  5ECP B;  2F9S A;  1K3L A;  4XIH A;  2V6O A;  3MIX A;  3R3E A;  1OC8 A;  3N9J A;  3TOU A;  4POM A;  5C00 A;  3CSI A;  1OYJ A;  3HVV A;  3A5I A;  2H1B A;  4EDY A;  3GMF A;  1EZK A;  2LS5 A;  5ECO B;  2FCH A;  4F0B A;  2LTK A;  2A2R A;  2CVD A;  3CXG A;  3DGQ A;  4MDC A;  2IN3 A;  3KIJ A;  4MPF A;  2ZUP A;  4KW6 A;  3OR5 A;  1QQ2 A;  6GSV A;  5KN3 A;  3QD9 A;  4KB3 A;  2DML A;  2H19 A;  1WRY A;  3TJB A;  1DBY A;  3TRP A;  6GSX A;  3RPN A;  1VF4 A;  1EGO A;  2CT6 A;  3HA9 A;  2C80 A;  1PN0 A;  1QK8 A;  2OAD A;  1PMT A;  2A4H A;  2VCT A;  4ZXG A;  3IOS A;  4I8B A;  4N11 A;  4V2L A;  2MYG A;  3IPZ A;  3TJK A;  2VOC A;  1B48 A;  2TIR A;  5DJM A;  4GLT A;  4XHM A;  3QMX A;  4DEJ A;  2H0H A;  2MMN A;  3MYD A;  4KDU A;  3O6T A;  1R4W A;  2FNO A;  1MTC A;  1KEB A;  4ECJ A;  4KX4 A;  1M2B A;  1TK5 B;  5F06 A;  2GQK A;  4ZBB A;  4OMV A;  2LQO A;  2DKI A;  2FA8 A;  4ACS A;  2YCD A;  1GSY A;  1M7T A;  2F8A A;  2YPM A;  2L6C A;  1TRW A;  2P31 A;  1TK0 B;  3M3M A;  1YQ1 A;  2YWO A;  3ZFB A;  3PR8 A;  4XRA A;  4F0C A;  2WB9 A;  9GSS A;  5EL8 A;  2H1D A;  1NHO A;  3E9J B;  1TKD B;  2B5Y A;  4KAE A;  1GUL A;  5J9B A;  2QC7 A;  3FZA A;  5B6M A;  3AY8 A;  3IHG A;  2HZE B;  3LWA A;  5CRH A;  4ZBA A;  2VCW A;  1SK0 A;  2H71 A;  3GKM A;  1CQH A;  4L0U A;  10GS A;  3TGZ A;  5CRE A;  4ZB8 A;  1R7H A;  3DKS A;  1LU4 A;  2WFC A;  5B8A A;  3D4M A;  3LJR A;  2V32 A;  1XBS A;  4N30 A;  2XPE A;  4JED A;  5IMZ A;  4YH2 A;  2OA7 A;  3O3T A;  2FUG 2;  2GQL A;  2C0E A;  1XFL A;  2OKA A;  1AAZ A;  4POB A;  1WJK A;  2VUP A;  2LV3 A;  4TKY A;  4POL A;  4HUA A;  3HHV A;  2NBS A;  2CVB A;  1VGL A;  4MF5 A;  3F0I A;  2X64 A;  4YKG A;  4G0I A;  4WBJ A;  4J56 E;  4ZB6 A;  2B6M A;  1ZYP A;  2HSM A;  3K8N A;  3QPM A;  3C73 A;  4YAV A;  2E2M A;  1R26 A;  3S9F A;  5G1L A;  3P8W A;  3CYN A;  5EVO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...