3UL3A

Structural insights into thioredoxin-2: a component of malaria parasite protein secretion machinery
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
103
structure length
103
Chain Sequence
RLQQNGSNIINGVNMKNTVIVLYFFAKWCQACTMQSTEMDKLQKYYGKRIYLLKVDLDKNESLARKFSVKSLPTIILLKNKTMLARKDHFVSSNDLIALIKKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Thioredoxin
publication title Structural insights into thioredoxin-2: a component of malaria parasite protein secretion machinery
doi rcsb
source organism Plasmodium falciparum
total genus 29
structure length 103
sequence length 103
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3ul3A01
2NPBA 1C72A 13GSA 5EVOA 1VRSD 2VIMA 2WFCA 4GSTA 1Z6NA 4LA1A 4K6XA 5D93A 4IKHA 5CP1A 1OKTA 1X5EA 3FZ5A 1GSEA 1I9DA 3KP8A 3IXRA 2DIYA 2MYGA 4MF7A 2OE1A 1K0AA 4BWQA 2I1UA 2VCVA 2IWTA 5G30A 3TDGA 1O8XA 4NHZA 5IQYA 5IO0A 4MMMA 1EWXA 2JSYA 4V1Ag 3LYKA 1T1VA 2YZUA 4JRRA 1ZCPA 5KN3A 4MZWA 2OA7A 3CYNA 5C00A 2MMOA 4I8BA 5CO3A 3ZZXA 2C0DA 3ED3A 5GZZB 1ML6A 2YN1A 4PQ1A 3C73A 2X64A 4Q5RA 1LU4A 3F3QA 2VD1A 2JSZA 3KIJA 2ZUPA 3UEMA 5JWOB 3TKPA 2YJ7A 5GSTA 3L78A 4FO5A 1JFUA 3F63A 4MA9A 5CRHA 4ZBDA 1M2AA 1GNWA 2DJJA 5ELGA 4MK3A 1YEPA 5AIXA 1WWJA 1TI1A 4G10A 1SKRB 3GL3A 3UJ1A 1SYRA 1T3BA 2CZ3A 2M80A 2VL2C 2FWEA 1JZOA 3G9BA 4QL9A 2DSAA 3HYPA 3LWAA 4RI6A 1M99A 3IE3A 4JZQA 3A5WA 5AN1A 3TB2A 2QGVA 4ISDA 2H19A 1G7EA 5G31A 1B9YC 2C80A 5C04A 3TRQA 4NXIA 3GN3A 1F2EA 4TXOA 3APOA 1JZWA 4PQHA 5ECHB 4WKWA 4PNGA 2R2JA 2B5YA 5F07A 1F37A 3C7MA 3ZMLA 3VPTA 4TXVA 1AW9A 2KUCA 4Q5NA 1OC9A 2CX4A 2DLXA 4HQZA 1WJKA 4YH2A 3TCOA 2FA4A 16GSA 2HFDA 2H1GA 2AHEA 3EINA 2I9HA 1XWBA 3TRXA 1LJRA 3LORA 1Z7RA 4K7IA 6GSUA 4MF6A 4POBA 5DQYA 2LJAA 1TU7A 4LMVA 4IHUA 4EDZA 4KUNA 4IJIA 1Q4JA 2MMZA 4EE0A 3MDKA 3QDNA 5IMFA 1M7TA 3GV1A 4XS1A 4LLRA 1EOHA 4PQIA 3ZRDA 3SWLA 2GQKA 4FH8A 2RM6A 1VF2A 2DBCA 3FY7A 2YANA 4OO5A 2VM1A 2VL9A 2VL2A 2BTOT 1AUCA 2FLSA 4ZL7A 3FYGA 2E2GA 5ECKB 4GQFA 3HJPA 4I2UA 1XBSA 5DQSA 4NMUA 4IW9A 3RHCA 1V98A 3ZVJA 1EV4A 3EURA 1O73A 3G7IA 5AIVA 5J9BA 3KZQA 1M9BA 3KP9A 2K8VA 4JBBA 3WGDA 5IMAA 3HCZA 20GSA 5D96A 2L57A 2VCXA 2H6XA 4V2NA 1PD21 3US3A 4ECJA 4F9ZA 6GSYA 2VLUA 2FWGA 4EF0A 3DVWA 3WGEA 6GSTA 3KH9A 4RQXA 1JLVA 1OE8A 2JU5A 2RM5A 4AJ8A 2C3TA 3ZTLA 3CBUA 1XCCA 1HQOA 2PVOC 4TXOB 3I6AA 5H5SA 4PXOA 3VWUA 5F05A 1THXA 2L4QA 5ECNB 4POLA 4TR0A 3HDCA 3FRCA 5DJLA 1G7OA 4MH3A 4LL4B 5DALA 1K3OA 1K0DA 3QCPA 4IQ1A 3MAKA 3GH6A 5IO2A 2L6CA 2ON7A 2ZCTA 4MLYA 2FNOA 3VWWA 2QKEA 3GUSA 1XVQA 2VO4A 1QK8A 4IGJA 1NW2A 2CAQA 2LRCA 4KSOA 6GSVA 1O85A 4G2EA 4TVEA 1GSFA 5H5RA 4L5OA 1OAZA 3KH7A 1BX9A 3LEFA 5E4WA 2WGRA 6GSWA 1TKDB 3VI5A 2AAWA 3KD0A 1EV9A 3TJJA 3BBYA 2MBTA 4YQUA 4HOJA 1TJDA 3GMFA 2F3MA 1FOVA 4HZ2A 5AGYA 3TKQA 1KNGA 5A4VA 2LRNA 2IIYA 1XW5A 1XW9A 1Y6EA 8GSSA 4MF5A 3HJMA 5LNKe 3EMPA 3GRXA 4IN0A 3LSZA 1XXUA 4F82A 2WULA 3D6IA 1YEXA 2WCIA 2CT6A 1SL0B 4TR1A 5D9WA 1K0MA 2O7KA 4Q5QA 4K7OA 2VAFA 5ECPB 1B4QA 1XZOA 3HD5A 2YP6A 3IA1A 1HNBA 1MDKA 1PQNA 4MH2A 2KP2A 5ECSA 3D4MA 2DJ1A 3BCIA 3H1NA 4OWYA 4N0VA 5CREA 3A2WA 1O6JA 2X8HA 3TJFA 1A2LA 5INYA 1XFLA 1X9MB 3KJYA 3RDWA 4KX4A 3L9SA 4WF4A 3CTFA 2KHPA 3GKMA 1W4VA 3TKSE 1AAZA 1TOFA 2O8VB 4EC0A 2A2SA 4OCEA 3F4SA 2HZFA 4NV5A 2GT5A 3GYKA 4F03A 4HEA2 3E3EA 3CSHA 3M9KA 2IJYA 1K3YA 4HJMA 4XS4A 5DALB 3GX0A 3MWHA 4JE1A 4JR6A 2A2RA 2H72A 3V1WA 2JACA 5JWRB 3GTUB 1SYXA 1YF1A 1WOUA 3IC4A 4CW9A 3QAVA 4ILFA 1M2BA 1TP9A 3ZMKA 1THOA 1JHBA 2VCTA 2FY6A 1U87A 2C1YA 3VK9A 2KOKA 3LFLA 1GLPA 3A2XA 1M0UA 5D8IA 1SKSB 1OC8A 4EL1A 4ACSA 3BJ5A 5DDLA 1PKWA 2A4VA 1DUGA 6GSSA 1R26A 3F9UA 1X5DA 3ERFA 2J23A 2DMLA 5CNWA 4HI7A 4AGSA 1ZOFA 2H6YA 3ZIVA 2R4VA 4MJBA 4PGTA 3H93A 3DMLA 1U3IA 5E59A 5B7CA 2YZHA 1GLQA 5FWGA 5J3RA 1X5CA 2F8AA 3F8UA 4KGIA 3CTGA 2C0FA 3WT1A 2GSQA 2VUPA 5DVBA 2C8UA 1WPIA 4JR4A 3FR9A 4HUAA 3D4TA 1A0FA 2HT9A 2IFQA 2C3NA 1TI3A 5G5FA 3VFIA 4IVFA 4PURA 5JCUA 4KSMA 4TR4A 2ES7A 3N5OA 2IMIA 1T4ZA 3MNGA 4TR1B 5HFIA 4GLTA 5IPGA 1XVWA 3GKXA 5B6NA 5D9VA 1QFNA 3KTBA 3ZVJD 2H8LA 2NVLA 4AJ7A 1KBNA 3GFKA 3F3RA 1N8JA 1BQ7A 2DMMA 5IM9A 1U88A 3TOUA 2P0GA 1GULA 3HVSA 3A2VA 14GSA 2FCHA 2J9HA 3QMXA 3TKSC 4F0BA 3L9VA 4OFTA 1YQ1A 3TKRA 5DCHA 4POKA 1YDKA 4WR4A 2VD0A 1QUWA 3UVTA 4IELA 3IAM2 4DVCA 1MDJA 2HI7A 2O85A 1XOBA 2V32A 4PUAA 1ZGNA 3FHKA 3IBHA 1GP1A 1O7UA 1OC3A 1A2JA 2OE3A 1AQXA 4I6XA 18GSA 1R5PA 4K8MA 3GH9A 4YQVA 3F4RA 2LEGA 1SU9A 2CAIA 1JLWA 3H79A 4N30A 3PH9A 4K1FA 2H0HA 1PKZA 2P5QA 4G9HA 5J9CA 3GSTA 4ZILA 1GH2A 3FKFA 4ZXGA 2GLRA 2WRTA 4MZBA 3D21A 1PN9A 4IP1A 3O6TA 2HSYA 1FAAA 3ME7A 1O81A 2VLTA 4GRFA 3PGTA 3TOTA 2GVPA 3KCMA 3EVIA 4K2DA 3U5RE 4JU5A 1G0TA 4IS0A 2C4JA 1GWCA 3IRAA 3LQ7A 5IPHA 1WE0A 2H6ZA 2FWFA 1YZXA 1DBYA 2H30A 2IFQB 2LV3A 4I97A 3C8EA 2L59A 2V2GA 4ZIJA 2PGTA 2H73A 2LNTA 4I2TA 3C1SA 4K0NA 1GSSA 1H75A 2X99A 1R7HA 2P5RA 3UIWA 4NHWA 1WRYA 3QD9A 1TK0B 1PRXA 3Q19A 1SL1B 5IMZA 4EO3A 2JZTA 4ZB6A 4EDYA 5HR3A 2PUKC 1M9AA 4GWRA 3HZ4A 3HJOA 2DJ2A 5ECOB 1GTBA 3VURA 2GZPA 1WIKA 1HD2A 3RAZA 1GTAA 5IMCA 1U3AA 1ACVA 4EKZA 4NPBA 2KLXA 2CV4A 1B48A 2YPMA 3K8NA 1UA5A 1F6MC 2CVDA 3RPNA 5KN2A 2B5XA 2N5AA 2YWOA 5J5NA 4ML1A 3HKRA 3I43A 2EC4A 1H4OA 5F0GA 17GSA 1QGVA 3P90A 1TRUA 3GX8A 1SK2A 3A3TA 4BL7A 1GTIA 2CX3A 5JCWA 5CRDA 4BA7A 1PMTA 2XHFA 1J9BA 4XS6A 1VF1A 1VF4A 5G1KA 19GSA 1G6WA 4AF2A 3I9V2 4OCFA 4TOPA 5EY6A 1NM3A 2HZEA 3KXOA 2LSTA 2MZCA 4QL7A 3BD2A 2O89A 5CYYA 4HU9A 3M8NA 1V2AA 1Z7PA 3WT2A 5LD0A 5GAPD 1Z5YE 1R4WA 2PU9C 3W8JA 3PINA 2F8FA 4MDCA 2YV9A 1B4PA 1OC9B 1BYEA 4TW5A 2XPEA 12GSA 1SD9A 2RLIA 5B8AA 2C0GA 2DJ3A 2CA8A 2RUFA 3JCML 5GAND 1G6YA 2PBJA 4OMVA 2H01A 2LQQA 1TXXA 4P3YB 2H76A 4FYUA 3GL5A 1YY7A 3L9UA 2N5BA 5ABRA 2O87A 1OKDA 4O92A 1SK1A 1A8YA 2FGXA 5ECRB 1AXDA 1R5AA 2IMKA 3I69A 11GSA 4KE3A 4G19A 3EU4A 5A4WA 2IN3A 1AQVA 1OE7A 4MPFA 2HE3A 2ALBA 1B8XA 2HXKA 3VPQA 2AJQB 4ML6A 2RUEA 4EVMA 2VL3A 4IJ3A 2QSIA 3IK9A 4RQRA 4Z7XA 1CQGA 5D9TA 2RIIA 1YKAA 4KH7A 5B8BA 3TGZA 3H4KA 4FYBA 4WBJA 2HYXA 4BWSA 1IYHA 3J7Yb 2PPTA 4MPGA 2HRFA 2TRCP 1CQHA 3W8SA 1AQWA 4X43A 3GKKA 5A5KA 4K0GA 2VM2A 2V41A 1KEBA 4GSNA 3KGKA 2BJXA 2NTOA 4YAPA 1I5GA 4AJ6A 2JL4A 3EMXA 3ZFLA 3CRTA 1UN2A 3CXGA 2L4CA 1RQMA 1VF3A 7GSSA 1F3BA 1KTEA 4ZL9A 3LGCA 2XBQA 3RHBA 1NHOA 5G1LA 4K7NA 10GSA 4X0XA 3FR3A 4F2IA 3DEXA 5F06A 2FD3A 3VI7A 1JZDA 3KMNA 3W6GA 3LYPA 3QAGA 3RBTA 4GCIA 2IMEA 2GSTA 1XWGA 3GIXA 1YF0A 3IV4A 2E7PA 3D22A 4YQMA 1YJ6A 2B3SA 3P8WA 4E8EA 3TJBA 2HZEB 5FT3A 2IMFA 2HRNA 2EIRA 1B9XC 1WP0A 3ZREA 4GF0A 4MCUA 4CDOA 3FW2A 3Q6OA 1T4YA 1U6TA 2NBSA 1NSWA 2LS5A 4IBPA 4DSRA 4XRAA 2HSHA 2CVKA 3Q74A 3L4NA 2DC5A 4V2MA 3F4TA 3O3TA 2H0IA 1ZMAA 2YWMA 3TRPA 5J41A 2K6VA 2OBIA 1FVKA 3KM6A 1K0NA 1FO5A 2JZRA 1GSYA 2DJKA 3KMOA 4Q5FA 4KA0A 4MJAA 2LQOA 5IMDA 1K0CA 2R5GA 3GURA 2JADA 4J56E 3VWXA 5F8BA 4LMWA 1T8EB 2DJ0A 3G7JA 1BEDA 2R6KA 1HNCA 2WS2A 3IDVA 2FUG2 4L8EA 1ST9A 2E2MA 3M3MA 4O5RA 3ERGA 1ERVA 2REMA 1ERUA 2Z9SA 4XHMA 4KDYA 2OE0A 3H8QA 5ID2A 2V1MA 2GDRA 3DD3A 1K3LA 3GNJA 2HLSA 4WR5A 1ZYEA 1RW1A 1DE1A 4KDXA 2WB9A 3F0IA 4J2FA 2EIOA 2D2ZA 2B1LA 2H71A 1J0FA 3SBCA 3CMIA 1EGOA 2LRTA 1GSUA 2G0FA 2MMNA 2C0EA 3ZIJA 1SKWB 2B7KA 5JWQB 3C71A 2YCDA 1ZYQB 1EOGA 3QPMA 5KEJA 2LKUA 1BAYA 3UMAA 3ZITA 4HS1A 1TTZA 5DJMA 5G5EA 1J08A 1UVZA 2B7JA 4IQAA 1MD3A 3HVXA 2H66A 4WXTA 3HVVA 1GNEA 2GZZA 2I81A 3LXTA 2LTKA 4CHSA 4TR3A 3M9JA 4XCSA 1XIYA 1MD4A 1EP8A 2H0GA 5HFGA 1GSQA 4XIHA 4FIWA 4MJEA 3EWLA 3ME8A 2AUVA 1GUKA 3HZ8A 4QQ7A 1WMJA 4KCEA 1TDIA 3FR6A 4TN8A 3CSJA 3NOFA 5D73A 5ENUA 1W89A 1NHYA 2OADA 3APSA 4ZL8A 1MEKA 4ID0A 1DE2A 3IR4A 2LNSA 4F0CA 2WZ9A 3QR6A 2YNXA 3DXBA 1TRVA 4OFMA 1X0RA 5HR0A 2M72A 4XTSA 4XS4B 2JZSA 5G2ZA 1FHEA 1PX6A 4EXJA 4BVYA 2WJUA 2ZNMA 2VOCA 2B5EA 1X9SB 1K0BA 3QFBC 1GUHA 1F3AA 1LBKA 1UC7A 2VCWA 3TUEA 3E0UA 1ERTA 5IOWA 2GSRA 4L5LA 4PX1A 1TRSA 4J57E 4L0WA 1E6BA 4DSQA 2K18A 1URMA 4POMA 3GSSA 1EGRA 2MMAA 4D73A 1ABAA 2FA8A 3N9JA 4HZ4A 4OD7A 4XRDA 3LG6A 3QAWA 5HFKA 1ILOA 2DIZA 4ZB8A 4O7HA 3ZL5A 1GRXA 1SD8A 3FK8A 2R37A 1X9WB 2V6KA 4I5QA 5ID2B 1FB6A 4GTUA 2B1KA 4TRXA 4BVXA 4MP4A 3VLNA 3DRNA 3TJGA 3LXZA 2YWNA 3R2QA 1RK4A 3RPPA 4LL1B 3M1GA 2OKAA 1EZKA 1ZZYA 2GTUA 3EE2A 3UAPA 2TIRA 1V57A 5CRGA 4OO4A 3UBLA 3WD6A 3IPZA 4GXZA 4PNFA 3IHQA 1S3AA 1FB0A 5EL8A 2C3QA 3GA4A 5A4UA 1A0RP 1MTCA 2IPAA 4ZBAA 1XW6A 4NWYA 2PVQA 2K9FA 3J7Yk 3TJKA 2F51A 4KB3A 3TKSA 3BCKA 3C1RA 1T7PB 3EC3A 1SJ6A 3G7YA 1XPVA 2PN8A 4MZCA 2PERA 3DWVA 1EP7A 3LJRA 5ECMB 1PL2A 5DAKA 3Q18A 3EYTA 3DVXA 3ZYWA 3GKNA 1PL1A 2FWHA 1Q98A 2ON5A 3CSIA 1A24A 1A8LA 1IYIA 5EPFA 2I4AA 3FEUA 4ULXA 2K8SA 5IOXA 1SK0A 4ECIA 1MDIA 5H5QA 4HQSA 1GTUA 3M0FA 3QOUA 2H70A 4ZBBA 3QFAC 5CAXA 3DIEA 2H1AA 1QMVA 1FG4A 3D5JA 1Z3EA 1K0OA 22GSA 2LJKA 4GQCA 5FHIA 1XWKA 1Z6MA 5ECIB 4KAEA 1HNAA 3APQA 3OR5A 4DSSA 2VLVA 5HR2A 2FHEA 4WBRD 1EEJA 3EU3A 2BMXA 3ISOA 1V40A 3L0HA 2OACA 3F6FA 4OFNA 1HYUA 5GSSA 1TK8B 2OBKA 4D73B 4DEJA 2IL3A 1S3DA 2GSSA 1ERWA 3P7XA 4ECBA 4E8HA 5COHA 5DCGA 3IOSA 3VWVA 4MJCA 2VCZA 2GQLA 4N11A 1QXHA 3WYWA 4WF5A 4TKYA 1Y25A 1ON4A 2GS3A 2XC2A 1TU8A 2V6OA 1GL8A 2OJLA 3MSZA 1FVJA 3PR8A 3GTUA 2B6MA 3S9FA 1SL2B 4YAVA 1PX7A 1AIUA 1EEMA 3HY2A 4N10A 4HDEA 2L6DA 4K9ZA 2GQMA 1USBA 1AC1A 3F6DA 4WEYA 1DSBA 2AV4A 2KP1A 1V58A 2HNLA 3FZ4A 3ZLPA 3NZNA 4RI7A 2XBIA 5J4UA 5IIZA 5AISA 3KEBA 1PSQA 1BG5A 6GSXA 1ZL9A 9GSSA 1PGTA 1F9MA 2LUSA 2H75A 3D0ZA 5ECQB 1T00A 4V1Ap 1YKCA 3P2AA 2R3XA 2X8GA 2G2QA 1GUMA 5HQPA 2CQ9A 2MBSA 5CRWA 4N0ZA 1GSDA 2P31A 2VCQA 2X8CA 2E0QA 1E2YA 2PWJA 4NV2A 3FZ9A 2H74A 3DGQA 4FYCA 1FW1A 5DAKB 5IMVA 4GSSA 4NAXA 4V2LA 1SJZA 1SENA 4MABA 4H86A 4KDUA 5DBQA 1M2DA 1PA3A 2QC7A 2L5OA 2F9SA 1N2AA 4X1UA 3U6VA 1OYJA 2CZ2A 1QQ2A 4WETA 2L5LA 1SJIA 3HHVA 1TRWA 2IMDA 2YJHA 4PUFC 1A2MA 5ECLB 3AY8A 2EIQA 4KW6A 4HU7A 4DSSB 1XWCA 3IK7A 3WGXA 2H1DA 4KNDA 5B6MA 3E9JB 1VGLA 3KTLA 4ECCA 2GGTA 4O32A 4JEDA 2WDUA 2CVBA 3UVHA 5KN0A 3UARA 1XWAA 4KCAA 3UBKA 3UL3A 3NIVA 1BJXA 5L71A 3HXSA 1TK5B 5JCGA 2YV7A 2GZYA 4IP6A 2M46A 2TRXA 4ZB9A 1JZRA 2I3YA 2PMTA 2YWIA 3BOAA 3UOMA 2LJRA 1A23A 3ZFBA 1OVNA 2YOIA 2H1BA 5HR1A 4EUYA 1V9WA 4BPYA 3DYRA 3ERWA 4L0UA 2AYTA 2NDOA 3GHAA 2AB6A 1S3CA 2N5FA 1O8WA 5LCZA 3CRUA 3FZAA 3HA9A 4RUVA 3O76A 5ELAA 1XOAA 3DKSA 4HJ2A 3IAS2 1TW9A 1Z9HA 2XPDA 5D9XA 2GT6A 5KN1A
chains in the Genus database with same CATH superfamily
2NPBA 1C72A 13GSA 5EVOA 1VRSD 2VIMA 2WFCA 4GSTA 2HSMA 1Z6NA 4LA1A 4K6XA 5D93A 4IKHA 5CP1A 1OKTA 1X5EA 3FZ5A 1GSEA 1I9DA 3KP8A 3IXRA 2DIYA 2MYGA 4MF7A 2OE1A 1K0AA 4BWQA 2I1UA 2VCVA 2IWTA 5G30A 3TDGA 1O8XA 4NHZA 5IQYA 5IO0A 4MMMA 1EWXA 2JSYA 4V1Ag 3LYKA 1T1VA 2YZUA 4JRRA 1ZCPA 5KN3A 4MZWA 2OA7A 3CYNA 4Z2TA 5C00A 2MMOA 4I8BA 5CO3A 3ZZXA 4K2XA 2C0DA 3ED3A 5GZZB 1ML6A 2YN1A 4PQ1A 3C73A 4CY8A 2X64A 4ICYA 4Q5RA 1LU4A 3F3QA 2VD1A 2JSZA 3KIJA 2ZUPA 3UEMA 5JWOB 3TKPA 2YJ7A 5GSTA 3L78A 4FO5A 1JFUA 3F63A 4MA9A 5CRHA 4ZBDA 1M2AA 1GNWA 1ZYNA 2DJJA 5ELGA 4MK3A 1YEPA 5AIXA 1WWJA 1TI1A 4G10A 1SKRB 3GL3A 3UJ1A 1SYRA 1T3BA 2CZ3A 2M80A 2VL2C 2FWEA 1JZOA 3G9BA 4QL9A 2DSAA 3HYPA 3LWAA 4RI6A 1M99A 3IE3A 4JZQA 3A5WA 5AN1A 3TB2A 2QGVA 4ISDA 2H19A 1G7EA 5G31A 1B9YC 2C80A 5C04A 3TRQA 4NXIA 3GN3A 1F2EA 4TXOA 3APOA 1JZWA 4PQHA 5ECHB 4WKWA 3PPUA 4PNGA 2R2JA 2B5YA 5F07A 1F37A 3C7MA 3ZMLA 3VPTA 4TXVA 1AW9A 2KUCA 4Q5NA 1OC9A 2CX4A 2DLXA 4HQZA 1WJKA 4YH2A 3TCOA 2FA4A 16GSA 2HFDA 2H1GA 2AHEA 3EINA 2I9HA 2X49A 1XWBA 3TRXA 1LJRA 3LORA 1Z7RA 4K7IA 6GSUA 4MF6A 4POBA 5DQYA 2LJAA 1TU7A 4LMVA 4IHUA 4EDZA 4KUNA 4IJIA 1Q4JA 2MMZA 4EE0A 3MDKA 3QDNA 5IMFA 1M7TA 3GV1A 4XS1A 4LLRA 1EOHA 4PQIA 3ZRDA 3SWLA 2GQKA 4FH8A 2RM6A 1VF2A 2DBCA 3FY7A 2YANA 4OO5A 2VM1A 4USSA 2VL9A 2VL2A 2BTOT 1AUCA 2FLSA 4ZL7A 3FYGA 2E2GA 5ECKB 4GQFA 3HJPA 4I2UA 1XBSA 5DQSA 4NMUA 4FQUA 4IW9A 3RHCA 1V98A 3ZVJA 4G0LA 1EV4A 3EURA 1O73A 3G7IA 5AIVA 5J9BA 3KZQA 1M9BA 3KP9A 2K8VA 4JBBA 3WGDA 5IMAA 3HCZA 20GSA 2L57A 5D96A 2VCXA 2H6XA 4V2NA 1PD21 3US3A 4ECJA 4F9ZA 6GSYA 2VLUA 2FWGA 4EF0A 3DVWA 3WGEA 6GSTA 3KH9A 4RQXA 1JLVA 1OE8A 2JU5A 2RM5A 4AJ8A 2C3TA 3ZTLA 3CBUA 1XCCA 1HQOA 2PVOC 4TXOB 3I6AA 5H5SA 4PXOA 3VWUA 5F05A 1THXA 2L4QA 5ECNB 4POLA 5KOXA 4TR0A 3HDCA 4Z2UA 3FRCA 5DJLA 1G7OA 4MH3A 4LL4B 4MNNA 5DALA 1K3OA 1K0DA 3QCPA 4IQ1A 3MAKA 3GH6A 5IO2A 4BVXB 2L6CA 4A5PA 2ON7A 2ZCTA 4MLYA 2FNOA 3VWWA 2QKEA 3GUSA 1XVQA 2VO4A 1QK8A 4IGJA 1NW2A 2CAQA 2LRCA 4KSOA 6GSVA 1O85A 4G2EA 4TVEA 1GSFA 5H5RA 4L5OA 1OAZA 3KH7A 1BX9A 3LEFA 5E4WA 2WGRA 6GSWA 1TKDB 3VI5A 2AAWA 3KD0A 1EV9A 3TJJA 3BBYA 2MBTA 2QA2A 4YQUA 4HOJA 1TJDA 3GMFA 2F3MA 1FOVA 4HZ2A 5AGYA 3TKQA 1KNGA 5A4VA 2LRNA 2IIYA 1XW5A 1XW9A 2R0CA 1Y6EA 8GSSA 4MF5A 3HJMA 5LNKe 3EMPA 3GRXA 4IN0A 3LSZA 1XXUA 4F82A 2WULA 3D6IA 1YEXA 2WCIA 2CT6A 4PTSA 1SL0B 4TR1A 5D9WA 1K0MA 2O7KA 4Q5QA 4K7OA 2VAFA 5ECPB 1B4QA 1XZOA 3HD5A 2YP6A 3IA1A 1HNBA 1MDKA 1ZYPA 1PQNA 4MH2A 2KP2A 5ECSA 3D4MA 2DJ1A 3BCIA 1M3JA 3H1NA 4OWYA 4N0VA 5CREA 3A2WA 3HVNA 1O6JA 2X8HA 3TJFA 1A2LA 5INYA 1XFLA 1X9MB 3KJYA 3RDWA 4KX4A 3L9SA 4WF4A 3CTFA 2KHPA 3GKMA 1W4VA 3TKSE 1AAZA 1TOFA 2O8VB 4EC0A 2A2SA 4OCEA 3F4SA 2HZFA 4NV5A 2GT5A 3GYKA 4F03A 4HEA2 3E3EA 1M3IA 3CSHA 3M9KA 2IJYA 1K3YA 4HJMA 4XS4A 5DALB 3GX0A 3MWHA 4JE1A 4JR6A 2A2RA 2H72A 3IC8A 3V1WA 2JACA 5JWRB 3GTUB 1SYXA 1YF1A 1WOUA 3IC4A 4CW9A 3QAVA 4ILFA 1M2BA 1TP9A 3ZMKA 1THOA 1JHBA 2VCTA 2FY6A 1U87A 2C1YA 3VK9A 2KOKA 3LFLA 1GLPA 3A2XA 1M0UA 5D8IA 1SKSB 1OC8A 3R3EA 4EL1A 4ACSA 3BJ5A 5DDLA 1PKWA 2A4VA 1DUGA 6GSSA 1R26A 3F9UA 1X5DA 3ERFA 2J23A 2DMLA 5CNWA 4HI7A 4AGSA 1ZOFA 2H6YA 3ZIVA 2R4VA 4MJBA 4PGTA 3H93A 3DMLA 1U3IA 5E59A 5B7CA 2YZHA 1GLQA 5FWGA 5J3RA 1X5CA 2F8AA 3F8UA 4KGIA 3CTGA 2C0FA 3WT1A 4O5QA 2GSQA 2VUPA 5DVBA 2C8UA 1WPIA 4JR4A 3FR9A 4HUAA 3D4TA 1A0FA 2HT9A 2IFQA 2C3NA 4K5SA 1TI3A 5G5FA 3VFIA 4IVFA 4PURA 5JCUA 4KSMA 2HRAA 4TR4A 4EIQA 2ES7A 3N5OA 2IMIA 1T4ZA 3MNGA 4TR1B 5HFIA 4GLTA 5IPGA 1XVWA 3GKXA 5B6NA 5D9VA 1QFNA 3KTBA 3ZVJD 2H8LA 2NVLA 4AJ7A 1KBNA 3GFKA 3F3RA 1N8JA 1BQ7A 2DMMA 5IM9A 1U88A 3TOUA 2P0GA 1GULA 3HVSA 3A2VA 14GSA 2FCHA 2J9HA 3QMXA 3TKSC 4F0BA 3L9VA 4OFTA 1YQ1A 3TKRA 5DCHA 4G0KA 5BRTA 4POKA 1YDKA 4WR4A 2VD0A 1QUWA 3UVTA 4IELA 3IAM2 4DVCA 1MDJA 2HI7A 2O85A 1XOBA 2V32A 4PUAA 1ZGNA 3FHKA 3IBHA 1GP1A 1O7UA 1OC3A 1A2JA 2OE3A 1AQXA 4I6XA 18GSA 1R5PA 4K8MA 3GH9A 4YQVA 3F4RA 2LEGA 3IHGA 1SU9A 2CAIA 1JLWA 3H79A 4N30A 3PH9A 4K1FA 2H0HA 1PKZA 2P5QA 2R0GA 4G9HA 5J9CA 4HSCX 3GSTA 4ZILA 1GH2A 3FKFA 4ZXGA 2GLRA 2WRTA 4MZBA 3D21A 1PN9A 4IP1A 3O6TA 2HSYA 1FAAA 3ME7A 1O81A 2VLTA 4GRFA 3PGTA 3TOTA 2GVPA 3KCMA 3EVIA 4K2DA 3U5RE 4JU5A 1G0TA 4IS0A 2C4JA 1GWCA 3IRAA 3LQ7A 5IPHA 1WE0A 2H6ZA 2FWFA 1YZXA 1DBYA 2H30A 2IFQB 2LV3A 4I97A 3C8EA 2L59A 2V2GA 4ZIJA 2PGTA 2H73A 2LNTA 4I2TA 3C1SA 4K0NA 1GSSA 1H75A 2X99A 1R7HA 2P5RA 3UIWA 4NHWA 1WRYA 3QD9A 1TK0B 1PRXA 3Q19A 2HRKA 1SL1B 5IMZA 4EO3A 2JZTA 4ZB6A 4EDYA 5HR3A 2PUKC 1M9AA 4GWRA 3HZ4A 3HJOA 2DJ2A 5ECOB 1GTBA 3VURA 2GZPA 1WIKA 1HD2A 3RAZA 2X4AA 1GTAA 5IMCA 1U3AA 1ACVA 4EKZA 4NPBA 2KLXA 2CV4A 1B48A 2YPMA 3K8NA 1UA5A 1F6MC 2CVDA 3RPNA 5KN2A 2B5XA 2N5AA 2YWOA 5J5NA 4ML1A 3HKRA 3I43A 2EC4A 1H4OA 5F0GA 17GSA 1QGVA 3P90A 1TRUA 3GX8A 1SK2A 3A3TA 4BL7A 1GTIA 2CX3A 5JCWA 5CRDA 4BA7A 1PMTA 2XHFA 1J9BA 4XS6A 1VF1A 1VF4A 5G1KA 1PN0A 19GSA 1G6WA 4AF2A 3I9V2 4OCFA 4TOPA 5EY6A 1NM3A 2HZEA 3KXOA 2LSTA 2MZCA 4QL7A 3BD2A 2O89A 5CYYA 4HU9A 3M8NA 1V2AA 1Z7PA 3WT2A 5LD0A 5GAPD 1Z5YE 1R4WA 3CQFA 2PU9C 3W8JA 3PINA 2F8FA 4MDCA 4YKFA 2YV9A 3MIXA 1B4PA 1OC9B 1BYEA 4TW5A 2XPEA 12GSA 1SD9A 2RLIA 5B8AA 2C0GA 2DJ3A 2CA8A 2RUFA 3JCML 4G0IA 5GAND 1G6YA 2PBJA 4OMVA 2H01A 2LQQA 1TXXA 4P3YB 2H76A 4FYUA 3GL5A 1YY7A 3L9UA 2N5BA 5ABRA 2O87A 1OKDA 4O92A 1SK1A 1A8YA 2FGXA 5ECRB 1AXDA 1R5AA 2IMKA 3I69A 11GSA 4KE3A 4G19A 3EU4A 5A4WA 2IN3A 1AQVA 1OE7A 4MPFA 2HE3A 2ALBA 1B8XA 2HXKA 3VPQA 2AJQB 4ML6A 2RUEA 4EVMA 2VL3A 4IJ3A 2QSIA 3IK9A 4RQRA 4Z7XA 1CQGA 5D9TA 2RIIA 1YKAA 4KH7A 5B8BA 3TGZA 3H4KA 4FYBA 4WBJA 2HYXA 4BWSA 1IYHA 3J7Yb 2PPTA 4MPGA 2HRFA 2TRCP 1CQHA 3W8SA 1AQWA 4X43A 3GKKA 5A5KA 4K0GA 2VM2A 2V41A 1XG8A 1KEBA 4GSNA 3KGKA 2BJXA 2NTOA 4YAPA 1I5GA 4AJ6A 2JL4A 3EMXA 3ZFLA 3CRTA 1UN2A 3CXGA 2L4CA 1RQMA 1VF3A 7GSSA 1F3BA 1KTEA 4ZL9A 3LGCA 2XBQA 3RHBA 1NHOA 5G1LA 4BL7B 4K7NA 10GSA 4X0XA 3FR3A 4F2IA 3DEXA 5F06A 2FD3A 3VI7A 1JZDA 3KMNA 3W6GA 3LYPA 3QAGA 3RBTA 4GCIA 2IMEA 2GSTA 1XWGA 3GIXA 1YF0A 3IV4A 2E7PA 3D22A 4YQMA 1YJ6A 2B3SA 3P8WA 4E8EA 3TJBA 2HZEB 4K5RA 5FT3A 2IMFA 2HRNA 2EIRA 1B9XC 1WP0A 3ZREA 4GF0A 4MCUA 4CDOA 3FW2A 3Q6OA 1T4YA 1U6TA 2NBSA 1NSWA 2LS5A 4IBPA 4DSRA 4XRAA 2HSHA 2CVKA 3Q74A 3L4NA 2DC5A 4V2MA 3F4TA 2R0PA 3O3TA 2H0IA 1ZMAA 2YWMA 3TRPA 5J41A 2K6VA 2OBIA 1FVKA 3KM6A 1K0NA 1FO5A 2JZRA 1GSYA 2DJKA 3KMOA 4Q5FA 4KA0A 4MJAA 2LQOA 4EIPA 5IMDA 1K0CA 2DKHA 2R5GA 3GURA 2JADA 4J56E 3VWXA 5F8BA 1FOHA 4LMWA 1T8EB 2DJ0A 3G7JA 1BEDA 2R6KA 1HNCA 2WS2A 2A4HA 3IDVA 2FUG2 4L8EA 1ST9A 2E2MA 3M3MA 4O5RA 3ERGA 1ERVA 2REMA 1PFOA 1ERUA 2Z9SA 4XHMA 4KDYA 2OE0A 3H8QA 5ID2A 2V1MA 2GDRA 3DD3A 4O5UA 1K3LA 3GNJA 2HLSA 4WR5A 1ZYEA 1RW1A 1DE1A 4KDXA 2WB9A 3F0IA 4J2FA 2EIOA 2D2ZA 2B1LA 2H71A 1J0FA 3SBCA 3CMIA 1EGOA 2LRTA 1GSUA 2G0FA 2MMNA 2C0EA 3ZIJA 1SKWB 2B7KA 5JWQB 2QA1A 3C71A 2YCDA 1ZYQB 1EOGA 3QPMA 5KEJA 2LKUA 1BAYA 3UMAA 3ZITA 4HS1A 1TTZA 5DJMA 5G5EA 1J08A 1UVZA 2B7JA 4IQAA 1MD3A 3HVXA 2H66A 4WXTA 3HVVA 1GNEA 2GZZA 2I81A 3LXTA 2LTKA 4CHSA 4TR3A 3M9JA 4XCSA 1XIYA 1MD4A 1EP8A 2H0GA 5HFGA 1GSQA 4XIHA 4FIWA 4MJEA 3EWLA 3ME8A 2AUVA 1GUKA 3HZ8A 4QQ7A 1WMJA 4KCEA 1TDIA 3FR6A 4TN8A 3CSJA 3NOFA 5D73A 5ENUA 1W89A 1NHYA 2OADA 3APSA 4ZL8A 1MEKA 4ID0A 1DE2A 3IR4A 2LNSA 4F0CA 2WZ9A 3QR6A 2YNXA 3DXBA 1TRVA 4OFMA 1X0RA 5HR0A 2M72A 4XTSA 4XS4B 2JZSA 5G2ZA 1FHEA 1PX6A 4EXJA 4BVYA 2WJUA 2ZNMA 2VOCA 4KF9A 2B5EA 1X9SB 1K0BA 3QFBC 1GUHA 1F3AA 1LBKA 1UC7A 2VCWA 3TUEA 3E0UA 1ERTA 5IOWA 2GSRA 4L5LA 4PX1A 1TRSA 4J57E 4L0WA 1E6BA 4DSQA 2K18A 1URMA 4POMA 4BIKA 3GSSA 1EGRA 2MMAA 4D73A 3MYDA 1ABAA 2FA8A 3N9JA 4HZ4A 4OD7A 4XRDA 3LG6A 1S3RA 3QAWA 5HFKA 1ILOA 2DIZA 4ZB8A 4O7HA 3ZL5A 1GRXA 1SD8A 3FK8A 2R37A 1X9WB 2V6KA 4I5QA 5ID2B 1FB6A 4GTUA 2B1KA 4TRXA 4BVXA 4MP4A 3VLNA 3DRNA 3TJGA 3LXZA 2YWNA 3R2QA 1RK4A 3RPPA 4LL1B 3M1GA 2OKAA 1EZKA 1ZZYA 2GTUA 3EE2A 3UAPA 2TIRA 1V57A 5CRGA 4OO4A 3UBLA 3WD6A 3IPZA 4GXZA 4PNFA 3IHQA 1S3AA 1FB0A 5EL8A 2C3QA 3GA4A 5A4UA 1A0RP 1MTCA 2IPAA 4ZBAA 1XW6A 4NWYA 2PVQA 2K9FA 3J7Yk 3TJKA 2F51A 4KB3A 3TKSA 3BCKA 3C1RA 3FMWA 1T7PB 3EC3A 1SJ6A 3G7YA 1XPVA 2PN8A 4MZCA 2PERA 3DWVA 5KOWA 1EP7A 3LJRA 5ECMB 1PL2A 5DAKA 3Q18A 3EYTA 3DVXA 3ZYWA 3GKNA 1PL1A 2FWHA 1Q98A 2ON5A 3CSIA 1A24A 1A8LA 1IYIA 5EPFA 2I4AA 3FEUA 4ULXA 2K8SA 5IOXA 4X4JA 1SK0A 4ECIA 1MDIA 5H5QA 4HQSA 1GTUA 3M0FA 3QOUA 2H70A 4ZBBA 3QFAC 5CAXA 3DIEA 2H1AA 1QMVA 1FG4A 3D5JA 1Z3EA 1K0OA 22GSA 2LJKA 4GQCA 5FHIA 1XWKA 1Z6MA 5ECIB 4BVYB 4KAEA 1HNAA 3APQA 3OR5A 4DSSA 2VLVA 5HR2A 2FHEA 4WBRD 1EEJA 3EU3A 2BMXA 3ISOA 1V40A 3L0HA 4CY6A 2OACA 3F6FA 4OFNA 1HYUA 5GSSA 1TK8B 2OBKA 4D73B 4DEJA 2A2PA 2IL3A 1S3DA 2GSSA 1ERWA 3P7XA 4ECBA 4E8HA 5COHA 5DCGA 3IOSA 3VWVA 4MJCA 2VCZA 2GQLA 4N11A 1QXHA 3WYWA 4WF5A 4TKYA 1Y25A 1ON4A 2GS3A 2XC2A 1TU8A 2V6OA 1GL8A 2OJLA 3MSZA 1FVJA 3PR8A 3GTUA 2B6MA 3S9FA 1SL2B 4YAVA 1PX7A 1AIUA 1EEMA 5BMUA 3HY2A 4N10A 4HDEA 2L6DA 4K9ZA 2GQMA 1USBA 1AC1A 3F6DA 4WEYA 1DSBA 2AV4A 2KP1A 1V58A 2HNLA 3FZ4A 3ZLPA 3NZNA 4RI7A 2XBIA 5J4UA 5IIZA 5AISA 3KEBA 1PSQA 1BG5A 6GSXA 1ZL9A 9GSSA 1PGTA 1F9MA 2LUSA 2H75A 3D0ZA 5ECQB 1T00A 4V1Ap 1YKCA 3P2AA 2R3XA 2X8GA 2G2QA 1GUMA 5HQPA 2CQ9A 2MBSA 5CRWA 4N0ZA 1GSDA 2P31A 2VCQA 2X8CA 2E0QA 1E2YA 2PWJA 4NV2A 3FZ9A 4Z2RA 2H74A 3DGQA 4FYCA 1FW1A 5DAKB 5IMVA 4GSSA 4NAXA 4V2LA 1SJZA 1SENA 4MABA 4H86A 4KDUA 5DBQA 1M2DA 1PA3A 2QC7A 2L5OA 2F9SA 1N2AA 4X1UA 3U6VA 4YKGA 1OYJA 2CZ2A 1QQ2A 4WETA 2L5LA 1SJIA 3HHVA 1TRWA 2IMDA 2YJHA 4PUFC 1A2MA 3LW9A 5ECLB 3AY8A 2EIQA 4KW6A 4HU7A 4DSSB 1XWCA 3IK7A 3WGXA 2H1DA 4KNDA 5B6MA 3E9JB 1VGLA 3KTLA 4ECCA 2GGTA 4O32A 4JEDA 2WDUA 2CVBA 3UVHA 5KN0A 3UARA 1XWAA 4KCAA 3UBKA 3UL3A 3NIVA 1BJXA 5L71A 3HXSA 1TK5B 5JCGA 2YV7A 2GZYA 4IP6A 2M46A 2TRXA 4ZB9A 1JZRA 2I3YA 2PMTA 2YWIA 3BOAA 3EPTA 3UOMA 2LJRA 1A23A 3ZFBA 1OVNA 2YOIA 2H1BA 5HR1A 4EUYA 1V9WA 4BPYA 3DYRA 3ERWA 4L0UA 2AYTA 2NDOA 2DKIA 3GHAA 2AB6A 1S3CA 2N5FA 1O8WA 5LCZA 3CRUA 3FZAA 3HA9A 4RUVA 3A5IA 3O76A 5ELAA 1XOAA 3DKSA 4HJ2A 3IAS2 1TW9A 2UZ8A 1Z9HA 2XPDA 5D9XA 2GT6A 5KN1A
chains in the Genus database with same CATH topology
2NPBA 1C72A 13GSA 5EVOA 1VRSD 2VIMA 2WFCA 4GSTA 2HSMA 1Z6NA 4LA1A 4K6XA 5D93A 4IKHA 5CP1A 1OKTA 1X5EA 3FZ5A 1GSEA 1I9DA 3KP8A 3IXRA 2DIYA 2MYGA 4MF7A 2OE1A 1K0AA 4BWQA 2I1UA 2VCVA 2IWTA 5G30A 3TDGA 1O8XA 4NHZA 5IQYA 5IO0A 4MMMA 1EWXA 2JSYA 4V1Ag 3LYKA 1T1VA 2YZUA 4JRRA 1ZCPA 5KN3A 4MZWA 2OA7A 3CYNA 4Z2TA 5C00A 2MMOA 4I8BA 5CO3A 3ZZXA 4K2XA 2C0DA 3ED3A 5GZZB 1ML6A 2YN1A 4PQ1A 3C73A 4CY8A 2X64A 4ICYA 4Q5RA 1LU4A 3F3QA 2VD1A 2JSZA 3KIJA 2ZUPA 3UEMA 5JWOB 3TKPA 2YJ7A 5GSTA 3L78A 4FO5A 1JFUA 3F63A 4MA9A 5CRHA 4ZBDA 1M2AA 1GNWA 1ZYNA 2DJJA 5ELGA 4MK3A 1YEPA 5AIXA 1WWJA 1TI1A 4G10A 1SKRB 3GL3A 3UJ1A 1SYRA 1T3BA 2CZ3A 2M80A 2VL2C 2FWEA 1JZOA 3G9BA 4QL9A 2DSAA 3HYPA 3LWAA 4RI6A 1M99A 3IE3A 4JZQA 3A5WA 5AN1A 3TB2A 2QGVA 4ISDA 2H19A 1G7EA 5G31A 1B9YC 2C80A 5C04A 3TRQA 4NXIA 3GN3A 1F2EA 4TXOA 3APOA 1JZWA 4PQHA 5ECHB 4WKWA 3PPUA 4PNGA 2R2JA 2B5YA 5F07A 1F37A 3C7MA 3ZMLA 3VPTA 4TXVA 1AW9A 2KUCA 4Q5NA 1OC9A 2CX4A 2DLXA 4HQZA 1WJKA 4YH2A 3TCOA 2FA4A 16GSA 2HFDA 2H1GA 2AHEA 3EINA 2I9HA 2X49A 1XWBA 3TRXA 1LJRA 3LORA 1Z7RA 4K7IA 6GSUA 4MF6A 4POBA 5DQYA 2LJAA 1TU7A 4LMVA 4IHUA 4EDZA 4KUNA 4IJIA 1Q4JA 2MMZA 4EE0A 3MDKA 3QDNA 5IMFA 1M7TA 3GV1A 4XS1A 4LLRA 1EOHA 4PQIA 3ZRDA 3SWLA 2GQKA 4FH8A 2RM6A 1VF2A 2DBCA 3FY7A 2YANA 4OO5A 2VM1A 4USSA 2VL9A 2VL2A 2BTOT 1AUCA 2FLSA 4ZL7A 3FYGA 2E2GA 5ECKB 4GQFA 3HJPA 4I2UA 1XBSA 5DQSA 4NMUA 4FQUA 4IW9A 3RHCA 1V98A 3ZVJA 4G0LA 1EV4A 3EURA 1O73A 3G7IA 5AIVA 5J9BA 3KZQA 1M9BA 3KP9A 2K8VA 4JBBA 3WGDA 5IMAA 3HCZA 20GSA 5D96A 2L57A 2VCXA 2H6XA 4V2NA 1PD21 3US3A 4ECJA 4F9ZA 6GSYA 2VLUA 2FWGA 4EF0A 3DVWA 3WGEA 6GSTA 3KH9A 4RQXA 1JLVA 1OE8A 2JU5A 2RM5A 4AJ8A 2C3TA 3ZTLA 3CBUA 1XCCA 1HQOA 2PVOC 4TXOB 3I6AA 5H5SA 4PXOA 3VWUA 5F05A 1THXA 2L4QA 5ECNB 4POLA 5KOXA 4TR0A 3HDCA 4Z2UA 3FRCA 5DJLA 1G7OA 4MH3A 4LL4B 4MNNA 5DALA 1K3OA 1K0DA 3QCPA 4IQ1A 3MAKA 3GH6A 5IO2A 4BVXB 2L6CA 4A5PA 2ON7A 2ZCTA 4MLYA 2FNOA 3VWWA 2QKEA 3GUSA 1XVQA 2VO4A 1QK8A 4IGJA 1NW2A 2CAQA 2LRCA 4KSOA 6GSVA 1O85A 4G2EA 4TVEA 1GSFA 5H5RA 4L5OA 1OAZA 3KH7A 1BX9A 3LEFA 5E4WA 2WGRA 6GSWA 1TKDB 3VI5A 2AAWA 3KD0A 1EV9A 3TJJA 3BBYA 2MBTA 2QA2A 4YQUA 4HOJA 1TJDA 3GMFA 2F3MA 1FOVA 4HZ2A 5AGYA 3TKQA 1KNGA 5A4VA 2LRNA 2IIYA 1XW5A 1XW9A 2R0CA 1Y6EA 8GSSA 4MF5A 3HJMA 5LNKe 3EMPA 3GRXA 4IN0A 3LSZA 1XXUA 4F82A 2WULA 3D6IA 1YEXA 2WCIA 2CT6A 4PTSA 1SL0B 4TR1A 5D9WA 1K0MA 2O7KA 4Q5QA 4K7OA 2VAFA 5ECPB 1B4QA 1XZOA 3HD5A 2YP6A 3IA1A 1HNBA 1MDKA 1ZYPA 1PQNA 4MH2A 2KP2A 5ECSA 3D4MA 2DJ1A 3BCIA 3H1NA 4OWYA 4N0VA 5CREA 3A2WA 1O6JA 2X8HA 3TJFA 1A2LA 5INYA 1XFLA 1X9MB 3KJYA 3RDWA 4KX4A 3L9SA 4WF4A 3CTFA 2KHPA 3GKMA 1W4VA 3TKSE 1AAZA 1TOFA 2O8VB 4EC0A 2A2SA 4OCEA 3F4SA 2HZFA 4NV5A 2GT5A 3GYKA 4F03A 4HEA2 3E3EA 3CSHA 3M9KA 2IJYA 1K3YA 4HJMA 4XS4A 5DALB 3GX0A 3MWHA 4JE1A 4JR6A 2A2RA 2H72A 3IC8A 3V1WA 2JACA 5JWRB 3GTUB 1SYXA 1YF1A 1WOUA 3IC4A 4CW9A 3QAVA 4ILFA 1M2BA 1TP9A 3ZMKA 1THOA 1JHBA 2VCTA 2FY6A 1U87A 2C1YA 3VK9A 2KOKA 3LFLA 1GLPA 3A2XA 1M0UA 5D8IA 1SKSB 1OC8A 3R3EA 4EL1A 4ACSA 3BJ5A 5DDLA 1PKWA 2A4VA 1DUGA 6GSSA 1R26A 3F9UA 1X5DA 3ERFA 2J23A 2DMLA 5CNWA 4HI7A 4AGSA 1ZOFA 2H6YA 3ZIVA 2R4VA 4MJBA 4PGTA 3H93A 3DMLA 1U3IA 5E59A 5B7CA 2YZHA 1GLQA 5FWGA 5J3RA 1X5CA 2F8AA 3F8UA 4KGIA 3CTGA 2C0FA 3WT1A 4O5QA 2GSQA 2VUPA 5DVBA 2C8UA 1WPIA 4JR4A 3FR9A 4HUAA 3D4TA 1A0FA 2HT9A 2IFQA 2C3NA 4K5SA 1TI3A 5G5FA 3VFIA 4IVFA 4PURA 5JCUA 4KSMA 2HRAA 4TR4A 4EIQA 2ES7A 3N5OA 2IMIA 1T4ZA 3MNGA 4TR1B 5HFIA 4GLTA 5IPGA 1XVWA 3GKXA 5B6NA 5D9VA 1QFNA 3KTBA 3ZVJD 2H8LA 2NVLA 4AJ7A 1KBNA 3GFKA 3F3RA 1N8JA 1BQ7A 2DMMA 5IM9A 1U88A 3TOUA 2P0GA 1GULA 3HVSA 3A2VA 14GSA 2FCHA 2J9HA 3QMXA 3TKSC 4F0BA 3L9VA 4OFTA 1YQ1A 3TKRA 5DCHA 4G0KA 5BRTA 4POKA 1YDKA 4WR4A 2VD0A 1QUWA 3UVTA 4IELA 3IAM2 4DVCA 1MDJA 2HI7A 2O85A 1XOBA 2V32A 4PUAA 1ZGNA 3FHKA 3IBHA 1GP1A 1O7UA 1OC3A 1A2JA 2OE3A 1AQXA 4I6XA 18GSA 1R5PA 4K8MA 3GH9A 4YQVA 3F4RA 2LEGA 3IHGA 1SU9A 2CAIA 1JLWA 3H79A 4N30A 3PH9A 4K1FA 2H0HA 1PKZA 2P5QA 2R0GA 4G9HA 5J9CA 3GSTA 4ZILA 1GH2A 3FKFA 4ZXGA 2GLRA 2WRTA 4MZBA 3D21A 1PN9A 4IP1A 3O6TA 2HSYA 1FAAA 3ME7A 1O81A 2VLTA 4GRFA 3PGTA 3TOTA 2GVPA 3KCMA 3EVIA 4K2DA 3U5RE 4JU5A 1G0TA 4IS0A 2C4JA 1GWCA 3IRAA 3LQ7A 5IPHA 1WE0A 2H6ZA 2FWFA 1YZXA 1DBYA 2H30A 2IFQB 2LV3A 4I97A 3C8EA 2L59A 2V2GA 4ZIJA 2PGTA 2H73A 2LNTA 4I2TA 3C1SA 4K0NA 1GSSA 1H75A 2X99A 1R7HA 2P5RA 3UIWA 4NHWA 1WRYA 3QD9A 1TK0B 1PRXA 3Q19A 2HRKA 1SL1B 5IMZA 4EO3A 2JZTA 4ZB6A 4EDYA 5HR3A 2PUKC 1M9AA 4GWRA 3HZ4A 3HJOA 2DJ2A 5ECOB 1GTBA 3VURA 2GZPA 1WIKA 1HD2A 3RAZA 2X4AA 1GTAA 5IMCA 1U3AA 1ACVA 4EKZA 4NPBA 2KLXA 2CV4A 1B48A 2YPMA 3K8NA 1UA5A 1F6MC 2CVDA 3RPNA 5KN2A 2B5XA 2N5AA 2YWOA 5J5NA 4ML1A 3HKRA 3I43A 2EC4A 1H4OA 5F0GA 17GSA 1QGVA 3P90A 1TRUA 3GX8A 1SK2A 3A3TA 4BL7A 1GTIA 2CX3A 5JCWA 5CRDA 4BA7A 1PMTA 2XHFA 1J9BA 4XS6A 1VF1A 1VF4A 5G1KA 1PN0A 19GSA 1G6WA 4AF2A 3I9V2 4OCFA 4TOPA 5EY6A 1NM3A 2HZEA 3KXOA 2LSTA 2MZCA 4QL7A 3BD2A 2O89A 5CYYA 4HU9A 3M8NA 1V2AA 1Z7PA 3WT2A 5LD0A 5GAPD 1Z5YE 1R4WA 2PU9C 3W8JA 3PINA 2F8FA 4MDCA 4YKFA 2YV9A 3MIXA 1B4PA 1OC9B 1BYEA 4TW5A 2XPEA 12GSA 1SD9A 2RLIA 5B8AA 2C0GA 2DJ3A 2CA8A 2RUFA 3JCML 4G0IA 5GAND 1G6YA 2PBJA 4OMVA 2H01A 2LQQA 1TXXA 4P3YB 2H76A 4FYUA 3GL5A 1YY7A 3L9UA 2N5BA 5ABRA 2O87A 1OKDA 4O92A 1SK1A 1A8YA 2FGXA 5ECRB 1AXDA 1R5AA 2IMKA 3I69A 11GSA 4KE3A 4G19A 3EU4A 5A4WA 2IN3A 1AQVA 1OE7A 4MPFA 2HE3A 2ALBA 1B8XA 2HXKA 3VPQA 2AJQB 4ML6A 2RUEA 4EVMA 2VL3A 4IJ3A 2QSIA 3IK9A 4RQRA 4Z7XA 1CQGA 5D9TA 2RIIA 1YKAA 4KH7A 5B8BA 3TGZA 3H4KA 4FYBA 4WBJA 2HYXA 4BWSA 1IYHA 3J7Yb 2PPTA 4MPGA 2HRFA 2TRCP 1CQHA 3W8SA 1AQWA 4X43A 3GKKA 5A5KA 4K0GA 2VM2A 2V41A 1KEBA 4GSNA 3KGKA 2BJXA 2NTOA 4YAPA 1I5GA 4AJ6A 2JL4A 3EMXA 3ZFLA 3CRTA 1UN2A 3CXGA 2L4CA 1RQMA 1VF3A 7GSSA 1F3BA 1KTEA 4ZL9A 3LGCA 2XBQA 3RHBA 1NHOA 5G1LA 4BL7B 4K7NA 10GSA 4X0XA 3FR3A 4F2IA 3DEXA 5F06A 2FD3A 3VI7A 1JZDA 3KMNA 3W6GA 3LYPA 3QAGA 3RBTA 4GCIA 2IMEA 2GSTA 1XWGA 3GIXA 1YF0A 3IV4A 2E7PA 3D22A 4YQMA 1YJ6A 2B3SA 3P8WA 4E8EA 3TJBA 2HZEB 4K5RA 5FT3A 2IMFA 2HRNA 2EIRA 1B9XC 1WP0A 3ZREA 4GF0A 4MCUA 4CDOA 3FW2A 3Q6OA 1T4YA 1U6TA 2NBSA 1NSWA 2LS5A 4IBPA 4DSRA 4XRAA 2HSHA 2CVKA 3Q74A 3L4NA 2DC5A 4V2MA 3F4TA 2R0PA 3O3TA 2H0IA 1ZMAA 2YWMA 3TRPA 5J41A 2K6VA 2OBIA 1FVKA 3KM6A 1K0NA 1FO5A 2JZRA 1GSYA 2DJKA 3KMOA 4Q5FA 4KA0A 4MJAA 2LQOA 4EIPA 5IMDA 1K0CA 2DKHA 2R5GA 3GURA 2JADA 4J56E 3VWXA 5F8BA 1FOHA 4LMWA 1T8EB 2DJ0A 3G7JA 1BEDA 2R6KA 1HNCA 2WS2A 2A4HA 3IDVA 2FUG2 4L8EA 1ST9A 2E2MA 3M3MA 4O5RA 3ERGA 1ERVA 2REMA 1ERUA 2Z9SA 4XHMA 4KDYA 2OE0A 3H8QA 5ID2A 2V1MA 2GDRA 3DD3A 4O5UA 1K3LA 3GNJA 2HLSA 4WR5A 1ZYEA 1RW1A 1DE1A 4KDXA 2WB9A 3F0IA 4J2FA 2EIOA 2D2ZA 2B1LA 2H71A 1J0FA 3SBCA 3CMIA 1EGOA 2LRTA 1GSUA 2G0FA 2MMNA 2C0EA 3ZIJA 1SKWB 2B7KA 5JWQB 2QA1A 3C71A 2YCDA 1ZYQB 1EOGA 3QPMA 5KEJA 2LKUA 1BAYA 3UMAA 3ZITA 4HS1A 1TTZA 5DJMA 5G5EA 1J08A 1UVZA 2B7JA 4IQAA 1MD3A 3HVXA 2H66A 4WXTA 3HVVA 1GNEA 2GZZA 2I81A 3LXTA 2LTKA 4CHSA 4TR3A 3M9JA 4XCSA 1XIYA 1MD4A 1EP8A 2H0GA 5HFGA 1GSQA 4XIHA 4FIWA 4MJEA 3EWLA 3ME8A 2AUVA 1GUKA 3HZ8A 4QQ7A 1WMJA 4KCEA 1TDIA 3FR6A 4TN8A 3CSJA 3NOFA 5D73A 5ENUA 1W89A 1NHYA 2OADA 3APSA 4ZL8A 1MEKA 4ID0A 1DE2A 3IR4A 2LNSA 4F0CA 2WZ9A 3QR6A 2YNXA 3DXBA 1TRVA 4OFMA 1X0RA 5HR0A 2M72A 4XTSA 4XS4B 2JZSA 5G2ZA 1FHEA 1PX6A 4EXJA 4BVYA 2WJUA 2ZNMA 2VOCA 4KF9A 2B5EA 1X9SB 1K0BA 3QFBC 1GUHA 1F3AA 1LBKA 1UC7A 2VCWA 3TUEA 3E0UA 1ERTA 5IOWA 2GSRA 4L5LA 4PX1A 1TRSA 4J57E 4L0WA 1E6BA 4DSQA 2K18A 1URMA 4POMA 3GSSA 1EGRA 2MMAA 4D73A 3MYDA 1ABAA 2FA8A 3N9JA 4HZ4A 4OD7A 4XRDA 3LG6A 3QAWA 5HFKA 1ILOA 2DIZA 4ZB8A 4O7HA 3ZL5A 1GRXA 1SD8A 3FK8A 2R37A 1X9WB 2V6KA 4I5QA 5ID2B 1FB6A 4GTUA 2B1KA 4TRXA 4BVXA 4MP4A 3VLNA 3DRNA 3TJGA 3LXZA 2YWNA 3R2QA 1RK4A 3RPPA 4LL1B 3M1GA 2OKAA 1EZKA 1ZZYA 2GTUA 3EE2A 3UAPA 2TIRA 1V57A 5CRGA 4OO4A 3UBLA 3WD6A 3IPZA 4GXZA 4PNFA 3IHQA 1S3AA 1FB0A 5EL8A 2C3QA 3GA4A 5A4UA 1A0RP 1MTCA 2IPAA 4ZBAA 1XW6A 4NWYA 2PVQA 2K9FA 3J7Yk 3TJKA 2F51A 4KB3A 3TKSA 3BCKA 3C1RA 3FMWA 1T7PB 3EC3A 1SJ6A 3G7YA 1XPVA 2PN8A 4MZCA 2PERA 3DWVA 5KOWA 1EP7A 3LJRA 5ECMB 1PL2A 5DAKA 3Q18A 3EYTA 3DVXA 3ZYWA 3GKNA 1PL1A 2FWHA 1Q98A 2ON5A 3CSIA 1A24A 1A8LA 1IYIA 5EPFA 2I4AA 3FEUA 4ULXA 2K8SA 5IOXA 4X4JA 1SK0A 4ECIA 1MDIA 5H5QA 4HQSA 1GTUA 3M0FA 3QOUA 2H70A 4ZBBA 3QFAC 5CAXA 3DIEA 2H1AA 1QMVA 1FG4A 3D5JA 1Z3EA 1K0OA 22GSA 2LJKA 4GQCA 5FHIA 1XWKA 1Z6MA 5ECIB 4BVYB 4KAEA 1HNAA 3APQA 3OR5A 4DSSA 2VLVA 5HR2A 2FHEA 4WBRD 1EEJA 3EU3A 2BMXA 3ISOA 1V40A 3L0HA 4CY6A 2OACA 3F6FA 4OFNA 1HYUA 5GSSA 1TK8B 2OBKA 4D73B 4DEJA 2A2PA 2IL3A 1S3DA 2GSSA 1ERWA 3P7XA 4ECBA 4E8HA 5COHA 5DCGA 3IOSA 3VWVA 4MJCA 2VCZA 2GQLA 4N11A 1QXHA 3WYWA 4WF5A 4TKYA 1Y25A 1ON4A 2GS3A 2XC2A 1TU8A 2V6OA 1GL8A 2OJLA 3MSZA 1FVJA 3PR8A 3GTUA 2B6MA 3S9FA 1SL2B 4YAVA 1PX7A 1AIUA 1EEMA 5BMUA 3HY2A 4N10A 4HDEA 2L6DA 4K9ZA 2GQMA 1USBA 1AC1A 3F6DA 4WEYA 1DSBA 2AV4A 2KP1A 1V58A 2HNLA 3FZ4A 3ZLPA 3NZNA 4RI7A 2XBIA 5J4UA 5IIZA 5AISA 3KEBA 1PSQA 1BG5A 6GSXA 1ZL9A 9GSSA 1PGTA 1F9MA 2LUSA 2H75A 3D0ZA 5ECQB 1T00A 4V1Ap 1YKCA 3P2AA 2R3XA 2X8GA 2G2QA 1GUMA 5HQPA 2CQ9A 2MBSA 5CRWA 4N0ZA 1GSDA 2P31A 2VCQA 2X8CA 2E0QA 1E2YA 2PWJA 4NV2A 3FZ9A 4Z2RA 2H74A 3DGQA 4FYCA 1FW1A 5DAKB 5IMVA 4GSSA 4NAXA 4V2LA 1SJZA 1SENA 4MABA 4H86A 4KDUA 5DBQA 1M2DA 1PA3A 2QC7A 2L5OA 2F9SA 1N2AA 4X1UA 3U6VA 4YKGA 1OYJA 2CZ2A 1QQ2A 4WETA 2L5LA 1SJIA 3HHVA 1TRWA 2IMDA 2YJHA 4PUFC 1A2MA 3LW9A 5ECLB 3AY8A 2EIQA 4KW6A 4HU7A 4DSSB 1XWCA 3IK7A 3WGXA 2H1DA 4KNDA 5B6MA 3E9JB 1VGLA 3KTLA 4ECCA 2GGTA 4O32A 4JEDA 2WDUA 2CVBA 3UVHA 5KN0A 3UARA 1XWAA 4KCAA 3UBKA 3UL3A 3NIVA 1BJXA 5L71A 3HXSA 1TK5B 5JCGA 2YV7A 2GZYA 4IP6A 2M46A 2TRXA 4ZB9A 1JZRA 2I3YA 2PMTA 2YWIA 3BOAA 3EPTA 3UOMA 2LJRA 1A23A 3ZFBA 1OVNA 2YOIA 2H1BA 5HR1A 4EUYA 1V9WA 4BPYA 3DYRA 3ERWA 4L0UA 2AYTA 2NDOA 2DKIA 3GHAA 2AB6A 1S3CA 2N5FA 1O8WA 5LCZA 3CRUA 3FZAA 3HA9A 4RUVA 3A5IA 3O76A 5ELAA 1XOAA 3DKSA 4HJ2A 3IAS2 1TW9A 2UZ8A 1Z9HA 2XPDA 5D9XA 2GT6A 5KN1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NPB A;  1C72 A;  13GS A;  5EVO A;  1VRS D;  2VIM A;  2WFC A;  4GST A;  1Z6N A;  4LA1 A;  4K6X A;  5D93 A;  4IKH A;  5CP1 A;  1OKT A;  1X5E A;  3FZ5 A;  1GSE A;  1I9D A;  3KP8 A;  3IXR A;  2DIY A;  2MYG A;  4MF7 A;  2OE1 A;  1K0A A;  4BWQ A;  2I1U A;  2VCV A;  2IWT A;  5G30 A;  3TDG A;  1O8X A;  4NHZ A;  5IQY A;  5IO0 A;  4MMM A;  1EWX A;  2JSY A;  4V1A g;  3LYK A;  1T1V A;  2YZU A;  4JRR A;  1ZCP A;  5KN3 A;  4MZW A;  2OA7 A;  3CYN A;  5C00 A;  2MMO A;  4I8B A;  5CO3 A;  3ZZX A;  2C0D A;  3ED3 A;  5GZZ B;  1ML6 A;  2YN1 A;  4PQ1 A;  3C73 A;  2X64 A;  4Q5R A;  1LU4 A;  3F3Q A;  2VD1 A;  2JSZ A;  3KIJ A;  2ZUP A;  3UEM A;  5JWO B;  3TKP A;  2YJ7 A;  5GST A;  3L78 A;  4FO5 A;  1JFU A;  3F63 A;  4MA9 A;  5CRH A;  4ZBD A;  1M2A A;  1GNW A;  2DJJ A;  5ELG A;  4MK3 A;  1YEP A;  5AIX A;  1WWJ A;  1TI1 A;  4G10 A;  1SKR B;  3GL3 A;  3UJ1 A;  1SYR A;  1T3B A;  2CZ3 A;  2M80 A;  2VL2 C;  2FWE A;  1JZO A;  3G9B A;  4QL9 A;  2DSA A;  3HYP A;  3LWA A;  4RI6 A;  1M99 A;  3IE3 A;  4JZQ A;  3A5W A;  5AN1 A;  3TB2 A;  2QGV A;  4ISD A;  2H19 A;  1G7E A;  5G31 A;  1B9Y C;  2C80 A;  5C04 A;  3TRQ A;  4NXI A;  3GN3 A;  1F2E A;  4TXO A;  3APO A;  1JZW A;  4PQH A;  5ECH B;  4WKW A;  4PNG A;  2R2J A;  2B5Y A;  5F07 A;  1F37 A;  3C7M A;  3ZML A;  3VPT A;  4TXV A;  1AW9 A;  2KUC A;  4Q5N A;  1OC9 A;  2CX4 A;  2DLX A;  4HQZ A;  1WJK A;  4YH2 A;  3TCO A;  2FA4 A;  16GS A;  2HFD A;  2H1G A;  2AHE A;  3EIN A;  2I9H A;  1XWB A;  3TRX A;  1LJR A;  3LOR A;  1Z7R A;  4K7I A;  6GSU A;  4MF6 A;  4POB A;  5DQY A;  2LJA A;  1TU7 A;  4LMV A;  4IHU A;  4EDZ A;  4KUN A;  4IJI A;  1Q4J A;  2MMZ A;  4EE0 A;  3MDK A;  3QDN A;  5IMF A;  1M7T A;  3GV1 A;  4XS1 A;  4LLR A;  1EOH A;  4PQI A;  3ZRD A;  3SWL A;  2GQK A;  4FH8 A;  2RM6 A;  1VF2 A;  2DBC A;  3FY7 A;  2YAN A;  4OO5 A;  2VM1 A;  2VL9 A;  2VL2 A;  2BTO T;  1AUC A;  2FLS A;  4ZL7 A;  3FYG A;  2E2G A;  5ECK B;  4GQF A;  3HJP A;  4I2U A;  1XBS A;  5DQS A;  4NMU A;  4IW9 A;  3RHC A;  1V98 A;  3ZVJ A;  1EV4 A;  3EUR A;  1O73 A;  3G7I A;  5AIV A;  5J9B A;  3KZQ A;  1M9B A;  3KP9 A;  2K8V A;  4JBB A;  3WGD A;  5IMA A;  3HCZ A;  20GS A;  5D96 A;  2L57 A;  2VCX A;  2H6X A;  4V2N A;  1PD2 1;  3US3 A;  4ECJ A;  4F9Z A;  6GSY A;  2VLU A;  2FWG A;  4EF0 A;  3DVW A;  3WGE A;  6GST A;  3KH9 A;  4RQX A;  1JLV A;  1OE8 A;  2JU5 A;  2RM5 A;  4AJ8 A;  2C3T A;  3ZTL A;  3CBU A;  1XCC A;  1HQO A;  2PVO C;  4TXO B;  3I6A A;  5H5S A;  4PXO A;  3VWU A;  5F05 A;  1THX A;  2L4Q A;  5ECN B;  4POL A;  4TR0 A;  3HDC A;  3FRC A;  5DJL A;  1G7O A;  4MH3 A;  4LL4 B;  5DAL A;  1K3O A;  1K0D A;  3QCP A;  4IQ1 A;  3MAK A;  3GH6 A;  5IO2 A;  2L6C A;  2ON7 A;  2ZCT A;  4MLY A;  2FNO A;  3VWW A;  2QKE A;  3GUS A;  1XVQ A;  2VO4 A;  1QK8 A;  4IGJ A;  1NW2 A;  2CAQ A;  2LRC A;  4KSO A;  6GSV A;  1O85 A;  4G2E A;  4TVE A;  1GSF A;  5H5R A;  4L5O A;  1OAZ A;  3KH7 A;  1BX9 A;  3LEF A;  5E4W A;  2WGR A;  6GSW A;  1TKD B;  3VI5 A;  2AAW A;  3KD0 A;  1EV9 A;  3TJJ A;  3BBY A;  2MBT A;  4YQU A;  4HOJ A;  1TJD A;  3GMF A;  2F3M A;  1FOV A;  4HZ2 A;  5AGY A;  3TKQ A;  1KNG A;  5A4V A;  2LRN A;  2IIY A;  1XW5 A;  1XW9 A;  1Y6E A;  8GSS A;  4MF5 A;  3HJM A;  5LNK e;  3EMP A;  3GRX A;  4IN0 A;  3LSZ A;  1XXU A;  4F82 A;  2WUL A;  3D6I A;  1YEX A;  2WCI A;  2CT6 A;  1SL0 B;  4TR1 A;  5D9W A;  1K0M A;  2O7K A;  4Q5Q A;  4K7O A;  2VAF A;  5ECP B;  1B4Q A;  1XZO A;  3HD5 A;  2YP6 A;  3IA1 A;  1HNB A;  1MDK A;  1PQN A;  4MH2 A;  2KP2 A;  5ECS A;  3D4M A;  2DJ1 A;  3BCI A;  3H1N A;  4OWY A;  4N0V A;  5CRE A;  3A2W A;  1O6J A;  2X8H A;  3TJF A;  1A2L A;  5INY A;  1XFL A;  1X9M B;  3KJY A;  3RDW A;  4KX4 A;  3L9S A;  4WF4 A;  3CTF A;  2KHP A;  3GKM A;  1W4V A;  3TKS E;  1AAZ A;  1TOF A;  2O8V B;  4EC0 A;  2A2S A;  4OCE A;  3F4S A;  2HZF A;  4NV5 A;  2GT5 A;  3GYK A;  4F03 A;  4HEA 2;  3E3E A;  3CSH A;  3M9K A;  2IJY A;  1K3Y A;  4HJM A;  4XS4 A;  5DAL B;  3GX0 A;  3MWH A;  4JE1 A;  4JR6 A;  2A2R A;  2H72 A;  3V1W A;  2JAC A;  5JWR B;  3GTU B;  1SYX A;  1YF1 A;  1WOU A;  3IC4 A;  4CW9 A;  3QAV A;  4ILF A;  1M2B A;  1TP9 A;  3ZMK A;  1THO A;  1JHB A;  2VCT A;  2FY6 A;  1U87 A;  2C1Y A;  3VK9 A;  2KOK A;  3LFL A;  1GLP A;  3A2X A;  1M0U A;  5D8I A;  1SKS B;  1OC8 A;  4EL1 A;  4ACS A;  3BJ5 A;  5DDL A;  1PKW A;  2A4V A;  1DUG A;  6GSS A;  1R26 A;  3F9U A;  1X5D A;  3ERF A;  2J23 A;  2DML A;  5CNW A;  4HI7 A;  4AGS A;  1ZOF A;  2H6Y A;  3ZIV A;  2R4V A;  4MJB A;  4PGT A;  3H93 A;  3DML A;  1U3I A;  5E59 A;  5B7C A;  2YZH A;  1GLQ A;  5FWG A;  5J3R A;  1X5C A;  2F8A A;  3F8U A;  4KGI A;  3CTG A;  2C0F A;  3WT1 A;  2GSQ A;  2VUP A;  5DVB A;  2C8U A;  1WPI A;  4JR4 A;  3FR9 A;  4HUA A;  3D4T A;  1A0F A;  2HT9 A;  2IFQ A;  2C3N A;  1TI3 A;  5G5F A;  3VFI A;  4IVF A;  4PUR A;  5JCU A;  4KSM A;  4TR4 A;  2ES7 A;  3N5O A;  2IMI A;  1T4Z A;  3MNG A;  4TR1 B;  5HFI A;  4GLT A;  5IPG A;  1XVW A;  3GKX A;  5B6N A;  5D9V A;  1QFN A;  3KTB A;  3ZVJ D;  2H8L A;  2NVL A;  4AJ7 A;  1KBN A;  3GFK A;  3F3R A;  1N8J A;  1BQ7 A;  2DMM A;  5IM9 A;  1U88 A;  3TOU A;  2P0G A;  1GUL A;  3HVS A;  3A2V A;  14GS A;  2FCH A;  2J9H A;  3QMX A;  3TKS C;  4F0B A;  3L9V A;  4OFT A;  1YQ1 A;  3TKR A;  5DCH A;  4POK A;  1YDK A;  4WR4 A;  2VD0 A;  1QUW A;  3UVT A;  4IEL A;  3IAM 2;  4DVC A;  1MDJ A;  2HI7 A;  2O85 A;  1XOB A;  2V32 A;  4PUA A;  1ZGN A;  3FHK A;  3IBH A;  1GP1 A;  1O7U A;  1OC3 A;  1A2J A;  2OE3 A;  1AQX A;  4I6X A;  18GS A;  1R5P A;  4K8M A;  3GH9 A;  4YQV A;  3F4R A;  2LEG A;  1SU9 A;  2CAI A;  1JLW A;  3H79 A;  4N30 A;  3PH9 A;  4K1F A;  2H0H A;  1PKZ A;  2P5Q A;  4G9H A;  5J9C A;  3GST A;  4ZIL A;  1GH2 A;  3FKF A;  4ZXG A;  2GLR A;  2WRT A;  4MZB A;  3D21 A;  1PN9 A;  4IP1 A;  3O6T A;  2HSY A;  1FAA A;  3ME7 A;  1O81 A;  2VLT A;  4GRF A;  3PGT A;  3TOT A;  2GVP A;  3KCM A;  3EVI A;  4K2D A;  3U5R E;  4JU5 A;  1G0T A;  4IS0 A;  2C4J A;  1GWC A;  3IRA A;  3LQ7 A;  5IPH A;  1WE0 A;  2H6Z A;  2FWF A;  1YZX A;  1DBY A;  2H30 A;  2IFQ B;  2LV3 A;  4I97 A;  3C8E A;  2L59 A;  2V2G A;  4ZIJ A;  2PGT A;  2H73 A;  2LNT A;  4I2T A;  3C1S A;  4K0N A;  1GSS A;  1H75 A;  2X99 A;  1R7H A;  2P5R A;  3UIW A;  4NHW A;  1WRY A;  3QD9 A;  1TK0 B;  1PRX A;  3Q19 A;  1SL1 B;  5IMZ A;  4EO3 A;  2JZT A;  4ZB6 A;  4EDY A;  5HR3 A;  2PUK C;  1M9A A;  4GWR A;  3HZ4 A;  3HJO A;  2DJ2 A;  5ECO B;  1GTB A;  3VUR A;  2GZP A;  1WIK A;  1HD2 A;  3RAZ A;  1GTA A;  5IMC A;  1U3A A;  1ACV A;  4EKZ A;  4NPB A;  2KLX A;  2CV4 A;  1B48 A;  2YPM A;  3K8N A;  1UA5 A;  1F6M C;  2CVD A;  3RPN A;  5KN2 A;  2B5X A;  2N5A A;  2YWO A;  5J5N A;  4ML1 A;  3HKR A;  3I43 A;  2EC4 A;  1H4O A;  5F0G A;  17GS A;  1QGV A;  3P90 A;  1TRU A;  3GX8 A;  1SK2 A;  3A3T A;  4BL7 A;  1GTI A;  2CX3 A;  5JCW A;  5CRD A;  4BA7 A;  1PMT A;  2XHF A;  1J9B A;  4XS6 A;  1VF1 A;  1VF4 A;  5G1K A;  19GS A;  1G6W A;  4AF2 A;  3I9V 2;  4OCF A;  4TOP A;  5EY6 A;  1NM3 A;  2HZE A;  3KXO A;  2LST A;  2MZC A;  4QL7 A;  3BD2 A;  2O89 A;  5CYY A;  4HU9 A;  3M8N A;  1V2A A;  1Z7P A;  3WT2 A;  5LD0 A;  5GAP D;  1Z5Y E;  1R4W A;  2PU9 C;  3W8J A;  3PIN A;  2F8F A;  4MDC A;  2YV9 A;  1B4P A;  1OC9 B;  1BYE A;  4TW5 A;  2XPE A;  12GS A;  1SD9 A;  2RLI A;  5B8A A;  2C0G A;  2DJ3 A;  2CA8 A;  2RUF A;  3JCM L;  5GAN D;  1G6Y A;  2PBJ A;  4OMV A;  2H01 A;  2LQQ A;  1TXX A;  4P3Y B;  2H76 A;  4FYU A;  3GL5 A;  1YY7 A;  3L9U A;  2N5B A;  5ABR A;  2O87 A;  1OKD A;  4O92 A;  1SK1 A;  1A8Y A;  2FGX A;  5ECR B;  1AXD A;  1R5A A;  2IMK A;  3I69 A;  11GS A;  4KE3 A;  4G19 A;  3EU4 A;  5A4W A;  2IN3 A;  1AQV A;  1OE7 A;  4MPF A;  2HE3 A;  2ALB A;  1B8X A;  2HXK A;  3VPQ A;  2AJQ B;  4ML6 A;  2RUE A;  4EVM A;  2VL3 A;  4IJ3 A;  2QSI A;  3IK9 A;  4RQR A;  4Z7X A;  1CQG A;  5D9T A;  2RII A;  1YKA A;  4KH7 A;  5B8B A;  3TGZ A;  3H4K A;  4FYB A;  4WBJ A;  2HYX A;  4BWS A;  1IYH A;  3J7Y b;  2PPT A;  4MPG A;  2HRF A;  2TRC P;  1CQH A;  3W8S A;  1AQW A;  4X43 A;  3GKK A;  5A5K A;  4K0G A;  2VM2 A;  2V41 A;  1KEB A;  4GSN A;  3KGK A;  2BJX A;  2NTO A;  4YAP A;  1I5G A;  4AJ6 A;  2JL4 A;  3EMX A;  3ZFL A;  3CRT A;  1UN2 A;  3CXG A;  2L4C A;  1RQM A;  1VF3 A;  7GSS A;  1F3B A;  1KTE A;  4ZL9 A;  3LGC A;  2XBQ A;  3RHB A;  1NHO A;  5G1L A;  4K7N A;  10GS A;  4X0X A;  3FR3 A;  4F2I A;  3DEX A;  5F06 A;  2FD3 A;  3VI7 A;  1JZD A;  3KMN A;  3W6G A;  3LYP A;  3QAG A;  3RBT A;  4GCI A;  2IME A;  2GST A;  1XWG A;  3GIX A;  1YF0 A;  3IV4 A;  2E7P A;  3D22 A;  4YQM A;  1YJ6 A;  2B3S A;  3P8W A;  4E8E A;  3TJB A;  2HZE B;  5FT3 A;  2IMF A;  2HRN A;  2EIR A;  1B9X C;  1WP0 A;  3ZRE A;  4GF0 A;  4MCU A;  4CDO A;  3FW2 A;  3Q6O A;  1T4Y A;  1U6T A;  2NBS A;  1NSW A;  2LS5 A;  4IBP A;  4DSR A;  4XRA A;  2HSH A;  2CVK A;  3Q74 A;  3L4N A;  2DC5 A;  4V2M A;  3F4T A;  3O3T A;  2H0I A;  1ZMA A;  2YWM A;  3TRP A;  5J41 A;  2K6V A;  2OBI A;  1FVK A;  3KM6 A;  1K0N A;  1FO5 A;  2JZR A;  1GSY A;  2DJK A;  3KMO A;  4Q5F A;  4KA0 A;  4MJA A;  2LQO A;  5IMD A;  1K0C A;  2R5G A;  3GUR A;  2JAD A;  4J56 E;  3VWX A;  5F8B A;  4LMW A;  1T8E B;  2DJ0 A;  3G7J A;  1BED A;  2R6K A;  1HNC A;  2WS2 A;  3IDV A;  2FUG 2;  4L8E A;  1ST9 A;  2E2M A;  3M3M A;  4O5R A;  3ERG A;  1ERV A;  2REM A;  1ERU A;  2Z9S A;  4XHM A;  4KDY A;  2OE0 A;  3H8Q A;  5ID2 A;  2V1M A;  2GDR A;  3DD3 A;  1K3L A;  3GNJ A;  2HLS A;  4WR5 A;  1ZYE A;  1RW1 A;  1DE1 A;  4KDX A;  2WB9 A;  3F0I A;  4J2F A;  2EIO A;  2D2Z A;  2B1L A;  2H71 A;  1J0F A;  3SBC A;  3CMI A;  1EGO A;  2LRT A;  1GSU A;  2G0F A;  2MMN A;  2C0E A;  3ZIJ A;  1SKW B;  2B7K A;  5JWQ B;  3C71 A;  2YCD A;  1ZYQ B;  1EOG A;  3QPM A;  5KEJ A;  2LKU A;  1BAY A;  3UMA A;  3ZIT A;  4HS1 A;  1TTZ A;  5DJM A;  5G5E A;  1J08 A;  1UVZ A;  2B7J A;  4IQA A;  1MD3 A;  3HVX A;  2H66 A;  4WXT A;  3HVV A;  1GNE A;  2GZZ A;  2I81 A;  3LXT A;  2LTK A;  4CHS A;  4TR3 A;  3M9J A;  4XCS A;  1XIY A;  1MD4 A;  1EP8 A;  2H0G A;  5HFG A;  1GSQ A;  4XIH A;  4FIW A;  4MJE A;  3EWL A;  3ME8 A;  2AUV A;  1GUK A;  3HZ8 A;  4QQ7 A;  1WMJ A;  4KCE A;  1TDI A;  3FR6 A;  4TN8 A;  3CSJ A;  3NOF A;  5D73 A;  5ENU A;  1W89 A;  1NHY A;  2OAD A;  3APS A;  4ZL8 A;  1MEK A;  4ID0 A;  1DE2 A;  3IR4 A;  2LNS A;  4F0C A;  2WZ9 A;  3QR6 A;  2YNX A;  3DXB A;  1TRV A;  4OFM A;  1X0R A;  5HR0 A;  2M72 A;  4XTS A;  4XS4 B;  2JZS A;  5G2Z A;  1FHE A;  1PX6 A;  4EXJ A;  4BVY A;  2WJU A;  2ZNM A;  2VOC A;  2B5E A;  1X9S B;  1K0B A;  3QFB C;  1GUH A;  1F3A A;  1LBK A;  1UC7 A;  2VCW A;  3TUE A;  3E0U A;  1ERT A;  5IOW A;  2GSR A;  4L5L A;  4PX1 A;  1TRS A;  4J57 E;  4L0W A;  1E6B A;  4DSQ A;  2K18 A;  1URM A;  4POM A;  3GSS A;  1EGR A;  2MMA A;  4D73 A;  1ABA A;  2FA8 A;  3N9J A;  4HZ4 A;  4OD7 A;  4XRD A;  3LG6 A;  3QAW A;  5HFK A;  1ILO A;  2DIZ A;  4ZB8 A;  4O7H A;  3ZL5 A;  1GRX A;  1SD8 A;  3FK8 A;  2R37 A;  1X9W B;  2V6K A;  4I5Q A;  5ID2 B;  1FB6 A;  4GTU A;  2B1K A;  4TRX A;  4BVX A;  4MP4 A;  3VLN A;  3DRN A;  3TJG A;  3LXZ A;  2YWN A;  3R2Q A;  1RK4 A;  3RPP A;  4LL1 B;  3M1G A;  2OKA A;  1EZK A;  1ZZY A;  2GTU A;  3EE2 A;  3UAP A;  2TIR A;  1V57 A;  5CRG A;  4OO4 A;  3UBL A;  3WD6 A;  3IPZ A;  4GXZ A;  4PNF A;  3IHQ A;  1S3A A;  1FB0 A;  5EL8 A;  2C3Q A;  3GA4 A;  5A4U A;  1A0R P;  1MTC A;  2IPA A;  4ZBA A;  1XW6 A;  4NWY A;  2PVQ A;  2K9F A;  3J7Y k;  3TJK A;  2F51 A;  4KB3 A;  3TKS A;  3BCK A;  3C1R A;  1T7P B;  3EC3 A;  1SJ6 A;  3G7Y A;  1XPV A;  2PN8 A;  4MZC A;  2PER A;  3DWV A;  1EP7 A;  3LJR A;  5ECM B;  1PL2 A;  5DAK A;  3Q18 A;  3EYT A;  3DVX A;  3ZYW A;  3GKN A;  1PL1 A;  2FWH A;  1Q98 A;  2ON5 A;  3CSI A;  1A24 A;  1A8L A;  1IYI A;  5EPF A;  2I4A A;  3FEU A;  4ULX A;  2K8S A;  5IOX A;  1SK0 A;  4ECI A;  1MDI A;  5H5Q A;  4HQS A;  1GTU A;  3M0F A;  3QOU A;  2H70 A;  4ZBB A;  3QFA C;  5CAX A;  3DIE A;  2H1A A;  1QMV A;  1FG4 A;  3D5J A;  1Z3E A;  1K0O A;  22GS A;  2LJK A;  4GQC A;  5FHI A;  1XWK A;  1Z6M A;  5ECI B;  4KAE A;  1HNA A;  3APQ A;  3OR5 A;  4DSS A;  2VLV A;  5HR2 A;  2FHE A;  4WBR D;  1EEJ A;  3EU3 A;  2BMX A;  3ISO A;  1V40 A;  3L0H A;  2OAC A;  3F6F A;  4OFN A;  1HYU A;  5GSS A;  1TK8 B;  2OBK A;  4D73 B;  4DEJ A;  2IL3 A;  1S3D A;  2GSS A;  1ERW A;  3P7X A;  4ECB A;  4E8H A;  5COH A;  5DCG A;  3IOS A;  3VWV A;  4MJC A;  2VCZ A;  2GQL A;  4N11 A;  1QXH A;  3WYW A;  4WF5 A;  4TKY A;  1Y25 A;  1ON4 A;  2GS3 A;  2XC2 A;  1TU8 A;  2V6O A;  1GL8 A;  2OJL A;  3MSZ A;  1FVJ A;  3PR8 A;  3GTU A;  2B6M A;  3S9F A;  1SL2 B;  4YAV A;  1PX7 A;  1AIU A;  1EEM A;  3HY2 A;  4N10 A;  4HDE A;  2L6D A;  4K9Z A;  2GQM A;  1USB A;  1AC1 A;  3F6D A;  4WEY A;  1DSB A;  2AV4 A;  2KP1 A;  1V58 A;  2HNL A;  3FZ4 A;  3ZLP A;  3NZN A;  4RI7 A;  2XBI A;  5J4U A;  5IIZ A;  5AIS A;  3KEB A;  1PSQ A;  1BG5 A;  6GSX A;  1ZL9 A;  9GSS A;  1PGT A;  1F9M A;  2LUS A;  2H75 A;  3D0Z A;  5ECQ B;  1T00 A;  4V1A p;  1YKC A;  3P2A A;  2R3X A;  2X8G A;  2G2Q A;  1GUM A;  5HQP A;  2CQ9 A;  2MBS A;  5CRW A;  4N0Z A;  1GSD A;  2P31 A;  2VCQ A;  2X8C A;  2E0Q A;  1E2Y A;  2PWJ A;  4NV2 A;  3FZ9 A;  2H74 A;  3DGQ A;  4FYC A;  1FW1 A;  5DAK B;  5IMV A;  4GSS A;  4NAX A;  4V2L A;  1SJZ A;  1SEN A;  4MAB A;  4H86 A;  4KDU A;  5DBQ A;  1M2D A;  1PA3 A;  2QC7 A;  2L5O A;  2F9S A;  1N2A A;  4X1U A;  3U6V A;  1OYJ A;  2CZ2 A;  1QQ2 A;  4WET A;  2L5L A;  1SJI A;  3HHV A;  1TRW A;  2IMD A;  2YJH A;  4PUF C;  1A2M A;  5ECL B;  3AY8 A;  2EIQ A;  4KW6 A;  4HU7 A;  4DSS B;  1XWC A;  3IK7 A;  3WGX A;  2H1D A;  4KND A;  5B6M A;  3E9J B;  1VGL A;  3KTL A;  4ECC A;  2GGT A;  4O32 A;  4JED A;  2WDU A;  2CVB A;  3UVH A;  5KN0 A;  3UAR A;  1XWA A;  4KCA A;  3UBK A;  3UL3 A;  3NIV A;  1BJX A;  5L71 A;  3HXS A;  1TK5 B;  5JCG A;  2YV7 A;  2GZY A;  4IP6 A;  2M46 A;  2TRX A;  4ZB9 A;  1JZR A;  2I3Y A;  2PMT A;  2YWI A;  3BOA A;  3UOM A;  2LJR A;  1A23 A;  3ZFB A;  1OVN A;  2YOI A;  2H1B A;  5HR1 A;  4EUY A;  1V9W A;  4BPY A;  3DYR A;  3ERW A;  4L0U A;  2AYT A;  2NDO A;  3GHA A;  2AB6 A;  1S3C A;  2N5F A;  1O8W A;  5LCZ A;  3CRU A;  3FZA A;  3HA9 A;  4RUV A;  3O76 A;  5ELA A;  1XOA A;  3DKS A;  4HJ2 A;  3IAS 2;  1TW9 A;  1Z9H A;  2XPD A;  5D9X A;  2GT6 A;  5KN1 A; 
#chains in the Genus database with same CATH topology
 2NPB A;  1C72 A;  13GS A;  5EVO A;  1VRS D;  2VIM A;  2WFC A;  4GST A;  2HSM A;  1Z6N A;  4LA1 A;  4K6X A;  5D93 A;  4IKH A;  5CP1 A;  1OKT A;  1X5E A;  3FZ5 A;  1GSE A;  1I9D A;  3KP8 A;  3IXR A;  2DIY A;  2MYG A;  4MF7 A;  2OE1 A;  1K0A A;  4BWQ A;  2I1U A;  2VCV A;  2IWT A;  5G30 A;  3TDG A;  1O8X A;  4NHZ A;  5IQY A;  5IO0 A;  4MMM A;  1EWX A;  2JSY A;  4V1A g;  3LYK A;  1T1V A;  2YZU A;  4JRR A;  1ZCP A;  5KN3 A;  4MZW A;  2OA7 A;  3CYN A;  4Z2T A;  5C00 A;  2MMO A;  4I8B A;  5CO3 A;  3ZZX A;  4K2X A;  2C0D A;  3ED3 A;  5GZZ B;  1ML6 A;  2YN1 A;  4PQ1 A;  3C73 A;  4CY8 A;  2X64 A;  4ICY A;  4Q5R A;  1LU4 A;  3F3Q A;  2VD1 A;  2JSZ A;  3KIJ A;  2ZUP A;  3UEM A;  5JWO B;  3TKP A;  2YJ7 A;  5GST A;  3L78 A;  4FO5 A;  1JFU A;  3F63 A;  4MA9 A;  5CRH A;  4ZBD A;  1M2A A;  1GNW A;  1ZYN A;  2DJJ A;  5ELG A;  4MK3 A;  1YEP A;  5AIX A;  1WWJ A;  1TI1 A;  4G10 A;  1SKR B;  3GL3 A;  3UJ1 A;  1SYR A;  1T3B A;  2CZ3 A;  2M80 A;  2VL2 C;  2FWE A;  1JZO A;  3G9B A;  4QL9 A;  2DSA A;  3HYP A;  3LWA A;  4RI6 A;  1M99 A;  3IE3 A;  4JZQ A;  3A5W A;  5AN1 A;  3TB2 A;  2QGV A;  4ISD A;  2H19 A;  1G7E A;  5G31 A;  1B9Y C;  2C80 A;  5C04 A;  3TRQ A;  4NXI A;  3GN3 A;  1F2E A;  4TXO A;  3APO A;  1JZW A;  4PQH A;  5ECH B;  4WKW A;  3PPU A;  4PNG A;  2R2J A;  2B5Y A;  5F07 A;  1F37 A;  3C7M A;  3ZML A;  3VPT A;  4TXV A;  1AW9 A;  2KUC A;  4Q5N A;  1OC9 A;  2CX4 A;  2DLX A;  4HQZ A;  1WJK A;  4YH2 A;  3TCO A;  2FA4 A;  16GS A;  2HFD A;  2H1G A;  2AHE A;  3EIN A;  2I9H A;  2X49 A;  1XWB A;  3TRX A;  1LJR A;  3LOR A;  1Z7R A;  4K7I A;  6GSU A;  4MF6 A;  4POB A;  5DQY A;  2LJA A;  1TU7 A;  4LMV A;  4IHU A;  4EDZ A;  4KUN A;  4IJI A;  1Q4J A;  2MMZ A;  4EE0 A;  3MDK A;  3QDN A;  5IMF A;  1M7T A;  3GV1 A;  4XS1 A;  4LLR A;  1EOH A;  4PQI A;  3ZRD A;  3SWL A;  2GQK A;  4FH8 A;  2RM6 A;  1VF2 A;  2DBC A;  3FY7 A;  2YAN A;  4OO5 A;  2VM1 A;  4USS A;  2VL9 A;  2VL2 A;  2BTO T;  1AUC A;  2FLS A;  4ZL7 A;  3FYG A;  2E2G A;  5ECK B;  4GQF A;  3HJP A;  4I2U A;  1XBS A;  5DQS A;  4NMU A;  4FQU A;  4IW9 A;  3RHC A;  1V98 A;  3ZVJ A;  4G0L A;  1EV4 A;  3EUR A;  1O73 A;  3G7I A;  5AIV A;  5J9B A;  3KZQ A;  1M9B A;  3KP9 A;  2K8V A;  4JBB A;  3WGD A;  5IMA A;  3HCZ A;  20GS A;  2L57 A;  5D96 A;  2VCX A;  2H6X A;  4V2N A;  1PD2 1;  3US3 A;  4ECJ A;  4F9Z A;  6GSY A;  2VLU A;  2FWG A;  4EF0 A;  3DVW A;  3WGE A;  6GST A;  3KH9 A;  4RQX A;  1JLV A;  1OE8 A;  2JU5 A;  2RM5 A;  4AJ8 A;  2C3T A;  3ZTL A;  3CBU A;  1XCC A;  1HQO A;  2PVO C;  4TXO B;  3I6A A;  5H5S A;  4PXO A;  3VWU A;  5F05 A;  1THX A;  2L4Q A;  5ECN B;  4POL A;  5KOX A;  4TR0 A;  3HDC A;  4Z2U A;  3FRC A;  5DJL A;  1G7O A;  4MH3 A;  4LL4 B;  4MNN A;  5DAL A;  1K3O A;  1K0D A;  3QCP A;  4IQ1 A;  3MAK A;  3GH6 A;  5IO2 A;  4BVX B;  2L6C A;  4A5P A;  2ON7 A;  2ZCT A;  4MLY A;  2FNO A;  3VWW A;  2QKE A;  3GUS A;  1XVQ A;  2VO4 A;  1QK8 A;  4IGJ A;  1NW2 A;  2CAQ A;  2LRC A;  4KSO A;  6GSV A;  1O85 A;  4G2E A;  4TVE A;  1GSF A;  5H5R A;  4L5O A;  1OAZ A;  3KH7 A;  1BX9 A;  3LEF A;  5E4W A;  2WGR A;  6GSW A;  1TKD B;  3VI5 A;  2AAW A;  3KD0 A;  1EV9 A;  3TJJ A;  3BBY A;  2MBT A;  2QA2 A;  4YQU A;  4HOJ A;  1TJD A;  3GMF A;  2F3M A;  1FOV A;  4HZ2 A;  5AGY A;  3TKQ A;  1KNG A;  5A4V A;  2LRN A;  2IIY A;  1XW5 A;  1XW9 A;  2R0C A;  1Y6E A;  8GSS A;  4MF5 A;  3HJM A;  5LNK e;  3EMP A;  3GRX A;  4IN0 A;  3LSZ A;  1XXU A;  4F82 A;  2WUL A;  3D6I A;  1YEX A;  2WCI A;  2CT6 A;  4PTS A;  1SL0 B;  4TR1 A;  5D9W A;  1K0M A;  2O7K A;  4Q5Q A;  4K7O A;  2VAF A;  5ECP B;  1B4Q A;  1XZO A;  3HD5 A;  2YP6 A;  3IA1 A;  1HNB A;  1MDK A;  1ZYP A;  1PQN A;  4MH2 A;  2KP2 A;  5ECS A;  3D4M A;  2DJ1 A;  3BCI A;  1M3J A;  3H1N A;  4OWY A;  4N0V A;  5CRE A;  3A2W A;  3HVN A;  1O6J A;  2X8H A;  3TJF A;  1A2L A;  5INY A;  1XFL A;  1X9M B;  3KJY A;  3RDW A;  4KX4 A;  3L9S A;  4WF4 A;  3CTF A;  2KHP A;  3GKM A;  1W4V A;  3TKS E;  1AAZ A;  1TOF A;  2O8V B;  4EC0 A;  2A2S A;  4OCE A;  3F4S A;  2HZF A;  4NV5 A;  2GT5 A;  3GYK A;  4F03 A;  4HEA 2;  3E3E A;  1M3I A;  3CSH A;  3M9K A;  2IJY A;  1K3Y A;  4HJM A;  4XS4 A;  5DAL B;  3GX0 A;  3MWH A;  4JE1 A;  4JR6 A;  2A2R A;  2H72 A;  3IC8 A;  3V1W A;  2JAC A;  5JWR B;  3GTU B;  1SYX A;  1YF1 A;  1WOU A;  3IC4 A;  4CW9 A;  3QAV A;  4ILF A;  1M2B A;  1TP9 A;  3ZMK A;  1THO A;  1JHB A;  2VCT A;  2FY6 A;  1U87 A;  2C1Y A;  3VK9 A;  2KOK A;  3LFL A;  1GLP A;  3A2X A;  1M0U A;  5D8I A;  1SKS B;  1OC8 A;  3R3E A;  4EL1 A;  4ACS A;  3BJ5 A;  5DDL A;  1PKW A;  2A4V A;  1DUG A;  6GSS A;  1R26 A;  3F9U A;  1X5D A;  3ERF A;  2J23 A;  2DML A;  5CNW A;  4HI7 A;  4AGS A;  1ZOF A;  2H6Y A;  3ZIV A;  2R4V A;  4MJB A;  4PGT A;  3H93 A;  3DML A;  1U3I A;  5E59 A;  5B7C A;  2YZH A;  1GLQ A;  5FWG A;  5J3R A;  1X5C A;  2F8A A;  3F8U A;  4KGI A;  3CTG A;  2C0F A;  3WT1 A;  4O5Q A;  2GSQ A;  2VUP A;  5DVB A;  2C8U A;  1WPI A;  4JR4 A;  3FR9 A;  4HUA A;  3D4T A;  1A0F A;  2HT9 A;  2IFQ A;  2C3N A;  4K5S A;  1TI3 A;  5G5F A;  3VFI A;  4IVF A;  4PUR A;  5JCU A;  4KSM A;  2HRA A;  4TR4 A;  4EIQ A;  2ES7 A;  3N5O A;  2IMI A;  1T4Z A;  3MNG A;  4TR1 B;  5HFI A;  4GLT A;  5IPG A;  1XVW A;  3GKX A;  5B6N A;  5D9V A;  1QFN A;  3KTB A;  3ZVJ D;  2H8L A;  2NVL A;  4AJ7 A;  1KBN A;  3GFK A;  3F3R A;  1N8J A;  1BQ7 A;  2DMM A;  5IM9 A;  1U88 A;  3TOU A;  2P0G A;  1GUL A;  3HVS A;  3A2V A;  14GS A;  2FCH A;  2J9H A;  3QMX A;  3TKS C;  4F0B A;  3L9V A;  4OFT A;  1YQ1 A;  3TKR A;  5DCH A;  4G0K A;  5BRT A;  4POK A;  1YDK A;  4WR4 A;  2VD0 A;  1QUW A;  3UVT A;  4IEL A;  3IAM 2;  4DVC A;  1MDJ A;  2HI7 A;  2O85 A;  1XOB A;  2V32 A;  4PUA A;  1ZGN A;  3FHK A;  3IBH A;  1GP1 A;  1O7U A;  1OC3 A;  1A2J A;  2OE3 A;  1AQX A;  4I6X A;  18GS A;  1R5P A;  4K8M A;  3GH9 A;  4YQV A;  3F4R A;  2LEG A;  3IHG A;  1SU9 A;  2CAI A;  1JLW A;  3H79 A;  4N30 A;  3PH9 A;  4K1F A;  2H0H A;  1PKZ A;  2P5Q A;  2R0G A;  4G9H A;  5J9C A;  4HSC X;  3GST A;  4ZIL A;  1GH2 A;  3FKF A;  4ZXG A;  2GLR A;  2WRT A;  4MZB A;  3D21 A;  1PN9 A;  4IP1 A;  3O6T A;  2HSY A;  1FAA A;  3ME7 A;  1O81 A;  2VLT A;  4GRF A;  3PGT A;  3TOT A;  2GVP A;  3KCM A;  3EVI A;  4K2D A;  3U5R E;  4JU5 A;  1G0T A;  4IS0 A;  2C4J A;  1GWC A;  3IRA A;  3LQ7 A;  5IPH A;  1WE0 A;  2H6Z A;  2FWF A;  1YZX A;  1DBY A;  2H30 A;  2IFQ B;  2LV3 A;  4I97 A;  3C8E A;  2L59 A;  2V2G A;  4ZIJ A;  2PGT A;  2H73 A;  2LNT A;  4I2T A;  3C1S A;  4K0N A;  1GSS A;  1H75 A;  2X99 A;  1R7H A;  2P5R A;  3UIW A;  4NHW A;  1WRY A;  3QD9 A;  1TK0 B;  1PRX A;  3Q19 A;  2HRK A;  1SL1 B;  5IMZ A;  4EO3 A;  2JZT A;  4ZB6 A;  4EDY A;  5HR3 A;  2PUK C;  1M9A A;  4GWR A;  3HZ4 A;  3HJO A;  2DJ2 A;  5ECO B;  1GTB A;  3VUR A;  2GZP A;  1WIK A;  1HD2 A;  3RAZ A;  2X4A A;  1GTA A;  5IMC A;  1U3A A;  1ACV A;  4EKZ A;  4NPB A;  2KLX A;  2CV4 A;  1B48 A;  2YPM A;  3K8N A;  1UA5 A;  1F6M C;  2CVD A;  3RPN A;  5KN2 A;  2B5X A;  2N5A A;  2YWO A;  5J5N A;  4ML1 A;  3HKR A;  3I43 A;  2EC4 A;  1H4O A;  5F0G A;  17GS A;  1QGV A;  3P90 A;  1TRU A;  3GX8 A;  1SK2 A;  3A3T A;  4BL7 A;  1GTI A;  2CX3 A;  5JCW A;  5CRD A;  4BA7 A;  1PMT A;  2XHF A;  1J9B A;  4XS6 A;  1VF1 A;  1VF4 A;  5G1K A;  1PN0 A;  19GS A;  1G6W A;  4AF2 A;  3I9V 2;  4OCF A;  4TOP A;  5EY6 A;  1NM3 A;  2HZE A;  3KXO A;  2LST A;  2MZC A;  4QL7 A;  3BD2 A;  2O89 A;  5CYY A;  4HU9 A;  3M8N A;  1V2A A;  1Z7P A;  3WT2 A;  5LD0 A;  5GAP D;  1Z5Y E;  1R4W A;  3CQF A;  2PU9 C;  3W8J A;  3PIN A;  2F8F A;  4MDC A;  4YKF A;  2YV9 A;  3MIX A;  1B4P A;  1OC9 B;  1BYE A;  4TW5 A;  2XPE A;  12GS A;  1SD9 A;  2RLI A;  5B8A A;  2C0G A;  2DJ3 A;  2CA8 A;  2RUF A;  3JCM L;  4G0I A;  5GAN D;  1G6Y A;  2PBJ A;  4OMV A;  2H01 A;  2LQQ A;  1TXX A;  4P3Y B;  2H76 A;  4FYU A;  3GL5 A;  1YY7 A;  3L9U A;  2N5B A;  5ABR A;  2O87 A;  1OKD A;  4O92 A;  1SK1 A;  1A8Y A;  2FGX A;  5ECR B;  1AXD A;  1R5A A;  2IMK A;  3I69 A;  11GS A;  4KE3 A;  4G19 A;  3EU4 A;  5A4W A;  2IN3 A;  1AQV A;  1OE7 A;  4MPF A;  2HE3 A;  2ALB A;  1B8X A;  2HXK A;  3VPQ A;  2AJQ B;  4ML6 A;  2RUE A;  4EVM A;  2VL3 A;  4IJ3 A;  2QSI A;  3IK9 A;  4RQR A;  4Z7X A;  1CQG A;  5D9T A;  2RII A;  1YKA A;  4KH7 A;  5B8B A;  3TGZ A;  3H4K A;  4FYB A;  4WBJ A;  2HYX A;  4BWS A;  1IYH A;  3J7Y b;  2PPT A;  4MPG A;  2HRF A;  2TRC P;  1CQH A;  3W8S A;  1AQW A;  4X43 A;  3GKK A;  5A5K A;  4K0G A;  2VM2 A;  2V41 A;  1XG8 A;  1KEB A;  4GSN A;  3KGK A;  2BJX A;  2NTO A;  4YAP A;  1I5G A;  4AJ6 A;  2JL4 A;  3EMX A;  3ZFL A;  3CRT A;  1UN2 A;  3CXG A;  2L4C A;  1RQM A;  1VF3 A;  7GSS A;  1F3B A;  1KTE A;  4ZL9 A;  3LGC A;  2XBQ A;  3RHB A;  1NHO A;  5G1L A;  4BL7 B;  4K7N A;  10GS A;  4X0X A;  3FR3 A;  4F2I A;  3DEX A;  5F06 A;  2FD3 A;  3VI7 A;  1JZD A;  3KMN A;  3W6G A;  3LYP A;  3QAG A;  3RBT A;  4GCI A;  2IME A;  2GST A;  1XWG A;  3GIX A;  1YF0 A;  3IV4 A;  2E7P A;  3D22 A;  4YQM A;  1YJ6 A;  2B3S A;  3P8W A;  4E8E A;  3TJB A;  2HZE B;  4K5R A;  5FT3 A;  2IMF A;  2HRN A;  2EIR A;  1B9X C;  1WP0 A;  3ZRE A;  4GF0 A;  4MCU A;  4CDO A;  3FW2 A;  3Q6O A;  1T4Y A;  1U6T A;  2NBS A;  1NSW A;  2LS5 A;  4IBP A;  4DSR A;  4XRA A;  2HSH A;  2CVK A;  3Q74 A;  3L4N A;  2DC5 A;  4V2M A;  3F4T A;  2R0P A;  3O3T A;  2H0I A;  1ZMA A;  2YWM A;  3TRP A;  5J41 A;  2K6V A;  2OBI A;  1FVK A;  3KM6 A;  1K0N A;  1FO5 A;  2JZR A;  1GSY A;  2DJK A;  3KMO A;  4Q5F A;  4KA0 A;  4MJA A;  2LQO A;  4EIP A;  5IMD A;  1K0C A;  2DKH A;  2R5G A;  3GUR A;  2JAD A;  4J56 E;  3VWX A;  5F8B A;  1FOH A;  4LMW A;  1T8E B;  2DJ0 A;  3G7J A;  1BED A;  2R6K A;  1HNC A;  2WS2 A;  2A4H A;  3IDV A;  2FUG 2;  4L8E A;  1ST9 A;  2E2M A;  3M3M A;  4O5R A;  3ERG A;  1ERV A;  2REM A;  1PFO A;  1ERU A;  2Z9S A;  4XHM A;  4KDY A;  2OE0 A;  3H8Q A;  5ID2 A;  2V1M A;  2GDR A;  3DD3 A;  4O5U A;  1K3L A;  3GNJ A;  2HLS A;  4WR5 A;  1ZYE A;  1RW1 A;  1DE1 A;  4KDX A;  2WB9 A;  3F0I A;  4J2F A;  2EIO A;  2D2Z A;  2B1L A;  2H71 A;  1J0F A;  3SBC A;  3CMI A;  1EGO A;  2LRT A;  1GSU A;  2G0F A;  2MMN A;  2C0E A;  3ZIJ A;  1SKW B;  2B7K A;  5JWQ B;  2QA1 A;  3C71 A;  2YCD A;  1ZYQ B;  1EOG A;  3QPM A;  5KEJ A;  2LKU A;  1BAY A;  3UMA A;  3ZIT A;  4HS1 A;  1TTZ A;  5DJM A;  5G5E A;  1J08 A;  1UVZ A;  2B7J A;  4IQA A;  1MD3 A;  3HVX A;  2H66 A;  4WXT A;  3HVV A;  1GNE A;  2GZZ A;  2I81 A;  3LXT A;  2LTK A;  4CHS A;  4TR3 A;  3M9J A;  4XCS A;  1XIY A;  1MD4 A;  1EP8 A;  2H0G A;  5HFG A;  1GSQ A;  4XIH A;  4FIW A;  4MJE A;  3EWL A;  3ME8 A;  2AUV A;  1GUK A;  3HZ8 A;  4QQ7 A;  1WMJ A;  4KCE A;  1TDI A;  3FR6 A;  4TN8 A;  3CSJ A;  3NOF A;  5D73 A;  5ENU A;  1W89 A;  1NHY A;  2OAD A;  3APS A;  4ZL8 A;  1MEK A;  4ID0 A;  1DE2 A;  3IR4 A;  2LNS A;  4F0C A;  2WZ9 A;  3QR6 A;  2YNX A;  3DXB A;  1TRV A;  4OFM A;  1X0R A;  5HR0 A;  2M72 A;  4XTS A;  4XS4 B;  2JZS A;  5G2Z A;  1FHE A;  1PX6 A;  4EXJ A;  4BVY A;  2WJU A;  2ZNM A;  2VOC A;  4KF9 A;  2B5E A;  1X9S B;  1K0B A;  3QFB C;  1GUH A;  1F3A A;  1LBK A;  1UC7 A;  2VCW A;  3TUE A;  3E0U A;  1ERT A;  5IOW A;  2GSR A;  4L5L A;  4PX1 A;  1TRS A;  4J57 E;  4L0W A;  1E6B A;  4DSQ A;  2K18 A;  1URM A;  4POM A;  4BIK A;  3GSS A;  1EGR A;  2MMA A;  4D73 A;  3MYD A;  1ABA A;  2FA8 A;  3N9J A;  4HZ4 A;  4OD7 A;  4XRD A;  3LG6 A;  1S3R A;  3QAW A;  5HFK A;  1ILO A;  2DIZ A;  4ZB8 A;  4O7H A;  3ZL5 A;  1GRX A;  1SD8 A;  3FK8 A;  2R37 A;  1X9W B;  2V6K A;  4I5Q A;  5ID2 B;  1FB6 A;  4GTU A;  2B1K A;  4TRX A;  4BVX A;  4MP4 A;  3VLN A;  3DRN A;  3TJG A;  3LXZ A;  2YWN A;  3R2Q A;  1RK4 A;  3RPP A;  4LL1 B;  3M1G A;  2OKA A;  1EZK A;  1ZZY A;  2GTU A;  3EE2 A;  3UAP A;  2TIR A;  1V57 A;  5CRG A;  4OO4 A;  3UBL A;  3WD6 A;  3IPZ A;  4GXZ A;  4PNF A;  3IHQ A;  1S3A A;  1FB0 A;  5EL8 A;  2C3Q A;  3GA4 A;  5A4U A;  1A0R P;  1MTC A;  2IPA A;  4ZBA A;  1XW6 A;  4NWY A;  2PVQ A;  2K9F A;  3J7Y k;  3TJK A;  2F51 A;  4KB3 A;  3TKS A;  3BCK A;  3C1R A;  3FMW A;  1T7P B;  3EC3 A;  1SJ6 A;  3G7Y A;  1XPV A;  2PN8 A;  4MZC A;  2PER A;  3DWV A;  5KOW A;  1EP7 A;  3LJR A;  5ECM B;  1PL2 A;  5DAK A;  3Q18 A;  3EYT A;  3DVX A;  3ZYW A;  3GKN A;  1PL1 A;  2FWH A;  1Q98 A;  2ON5 A;  3CSI A;  1A24 A;  1A8L A;  1IYI A;  5EPF A;  2I4A A;  3FEU A;  4ULX A;  2K8S A;  5IOX A;  4X4J A;  1SK0 A;  4ECI A;  1MDI A;  5H5Q A;  4HQS A;  1GTU A;  3M0F A;  3QOU A;  2H70 A;  4ZBB A;  3QFA C;  5CAX A;  3DIE A;  2H1A A;  1QMV A;  1FG4 A;  3D5J A;  1Z3E A;  1K0O A;  22GS A;  2LJK A;  4GQC A;  5FHI A;  1XWK A;  1Z6M A;  5ECI B;  4BVY B;  4KAE A;  1HNA A;  3APQ A;  3OR5 A;  4DSS A;  2VLV A;  5HR2 A;  2FHE A;  4WBR D;  1EEJ A;  3EU3 A;  2BMX A;  3ISO A;  1V40 A;  3L0H A;  4CY6 A;  2OAC A;  3F6F A;  4OFN A;  1HYU A;  5GSS A;  1TK8 B;  2OBK A;  4D73 B;  4DEJ A;  2A2P A;  2IL3 A;  1S3D A;  2GSS A;  1ERW A;  3P7X A;  4ECB A;  4E8H A;  5COH A;  5DCG A;  3IOS A;  3VWV A;  4MJC A;  2VCZ A;  2GQL A;  4N11 A;  1QXH A;  3WYW A;  4WF5 A;  4TKY A;  1Y25 A;  1ON4 A;  2GS3 A;  2XC2 A;  1TU8 A;  2V6O A;  1GL8 A;  2OJL A;  3MSZ A;  1FVJ A;  3PR8 A;  3GTU A;  2B6M A;  3S9F A;  1SL2 B;  4YAV A;  1PX7 A;  1AIU A;  1EEM A;  5BMU A;  3HY2 A;  4N10 A;  4HDE A;  2L6D A;  4K9Z A;  2GQM A;  1USB A;  1AC1 A;  3F6D A;  4WEY A;  1DSB A;  2AV4 A;  2KP1 A;  1V58 A;  2HNL A;  3FZ4 A;  3ZLP A;  3NZN A;  4RI7 A;  2XBI A;  5J4U A;  5IIZ A;  5AIS A;  3KEB A;  1PSQ A;  1BG5 A;  6GSX A;  1ZL9 A;  9GSS A;  1PGT A;  1F9M A;  2LUS A;  2H75 A;  3D0Z A;  5ECQ B;  1T00 A;  4V1A p;  1YKC A;  3P2A A;  2R3X A;  2X8G A;  2G2Q A;  1GUM A;  5HQP A;  2CQ9 A;  2MBS A;  5CRW A;  4N0Z A;  1GSD A;  2P31 A;  2VCQ A;  2X8C A;  2E0Q A;  1E2Y A;  2PWJ A;  4NV2 A;  3FZ9 A;  4Z2R A;  2H74 A;  3DGQ A;  4FYC A;  1FW1 A;  5DAK B;  5IMV A;  4GSS A;  4NAX A;  4V2L A;  1SJZ A;  1SEN A;  4MAB A;  4H86 A;  4KDU A;  5DBQ A;  1M2D A;  1PA3 A;  2QC7 A;  2L5O A;  2F9S A;  1N2A A;  4X1U A;  3U6V A;  4YKG A;  1OYJ A;  2CZ2 A;  1QQ2 A;  4WET A;  2L5L A;  1SJI A;  3HHV A;  1TRW A;  2IMD A;  2YJH A;  4PUF C;  1A2M A;  3LW9 A;  5ECL B;  3AY8 A;  2EIQ A;  4KW6 A;  4HU7 A;  4DSS B;  1XWC A;  3IK7 A;  3WGX A;  2H1D A;  4KND A;  5B6M A;  3E9J B;  1VGL A;  3KTL A;  4ECC A;  2GGT A;  4O32 A;  4JED A;  2WDU A;  2CVB A;  3UVH A;  5KN0 A;  3UAR A;  1XWA A;  4KCA A;  3UBK A;  3UL3 A;  3NIV A;  1BJX A;  5L71 A;  3HXS A;  1TK5 B;  5JCG A;  2YV7 A;  2GZY A;  4IP6 A;  2M46 A;  2TRX A;  4ZB9 A;  1JZR A;  2I3Y A;  2PMT A;  2YWI A;  3BOA A;  3EPT A;  3UOM A;  2LJR A;  1A23 A;  3ZFB A;  1OVN A;  2YOI A;  2H1B A;  5HR1 A;  4EUY A;  1V9W A;  4BPY A;  3DYR A;  3ERW A;  4L0U A;  2AYT A;  2NDO A;  2DKI A;  3GHA A;  2AB6 A;  1S3C A;  2N5F A;  1O8W A;  5LCZ A;  3CRU A;  3FZA A;  3HA9 A;  4RUV A;  3A5I A;  3O76 A;  5ELA A;  1XOA A;  3DKS A;  4HJ2 A;  3IAS 2;  1TW9 A;  2UZ8 A;  1Z9H A;  2XPD A;  5D9X A;  2GT6 A;  5KN1 A; 
#chains in the Genus database with same CATH homology
 2NPB A;  1C72 A;  13GS A;  5EVO A;  1VRS D;  2VIM A;  2WFC A;  4GST A;  2HSM A;  1Z6N A;  4LA1 A;  4K6X A;  5D93 A;  4IKH A;  5CP1 A;  1OKT A;  1X5E A;  3FZ5 A;  1GSE A;  1I9D A;  3KP8 A;  3IXR A;  2DIY A;  2MYG A;  4MF7 A;  2OE1 A;  1K0A A;  4BWQ A;  2I1U A;  2VCV A;  2IWT A;  5G30 A;  3TDG A;  1O8X A;  4NHZ A;  5IQY A;  5IO0 A;  4MMM A;  1EWX A;  2JSY A;  4V1A g;  3LYK A;  1T1V A;  2YZU A;  4JRR A;  1ZCP A;  5KN3 A;  4MZW A;  2OA7 A;  3CYN A;  4Z2T A;  5C00 A;  2MMO A;  4I8B A;  5CO3 A;  3ZZX A;  4K2X A;  2C0D A;  3ED3 A;  5GZZ B;  1ML6 A;  2YN1 A;  4PQ1 A;  3C73 A;  4CY8 A;  2X64 A;  4ICY A;  4Q5R A;  1LU4 A;  3F3Q A;  2VD1 A;  2JSZ A;  3KIJ A;  2ZUP A;  3UEM A;  5JWO B;  3TKP A;  2YJ7 A;  5GST A;  3L78 A;  4FO5 A;  1JFU A;  3F63 A;  4MA9 A;  5CRH A;  4ZBD A;  1M2A A;  1GNW A;  1ZYN A;  2DJJ A;  5ELG A;  4MK3 A;  1YEP A;  5AIX A;  1WWJ A;  1TI1 A;  4G10 A;  1SKR B;  3GL3 A;  3UJ1 A;  1SYR A;  1T3B A;  2CZ3 A;  2M80 A;  2VL2 C;  2FWE A;  1JZO A;  3G9B A;  4QL9 A;  2DSA A;  3HYP A;  3LWA A;  4RI6 A;  1M99 A;  3IE3 A;  4JZQ A;  3A5W A;  5AN1 A;  3TB2 A;  2QGV A;  4ISD A;  2H19 A;  1G7E A;  5G31 A;  1B9Y C;  2C80 A;  5C04 A;  3TRQ A;  4NXI A;  3GN3 A;  1F2E A;  4TXO A;  3APO A;  1JZW A;  4PQH A;  5ECH B;  4WKW A;  3PPU A;  4PNG A;  2R2J A;  2B5Y A;  5F07 A;  1F37 A;  3C7M A;  3ZML A;  3VPT A;  4TXV A;  1AW9 A;  2KUC A;  4Q5N A;  1OC9 A;  2CX4 A;  2DLX A;  4HQZ A;  1WJK A;  4YH2 A;  3TCO A;  2FA4 A;  16GS A;  2HFD A;  2H1G A;  2AHE A;  3EIN A;  2I9H A;  2X49 A;  1XWB A;  3TRX A;  1LJR A;  3LOR A;  1Z7R A;  4K7I A;  6GSU A;  4MF6 A;  4POB A;  5DQY A;  2LJA A;  1TU7 A;  4LMV A;  4IHU A;  4EDZ A;  4KUN A;  4IJI A;  1Q4J A;  2MMZ A;  4EE0 A;  3MDK A;  3QDN A;  5IMF A;  1M7T A;  3GV1 A;  4XS1 A;  4LLR A;  1EOH A;  4PQI A;  3ZRD A;  3SWL A;  2GQK A;  4FH8 A;  2RM6 A;  1VF2 A;  2DBC A;  3FY7 A;  2YAN A;  4OO5 A;  2VM1 A;  4USS A;  2VL9 A;  2VL2 A;  2BTO T;  1AUC A;  2FLS A;  4ZL7 A;  3FYG A;  2E2G A;  5ECK B;  4GQF A;  3HJP A;  4I2U A;  1XBS A;  5DQS A;  4NMU A;  4FQU A;  4IW9 A;  3RHC A;  1V98 A;  3ZVJ A;  4G0L A;  1EV4 A;  3EUR A;  1O73 A;  3G7I A;  5AIV A;  5J9B A;  3KZQ A;  1M9B A;  3KP9 A;  2K8V A;  4JBB A;  3WGD A;  5IMA A;  3HCZ A;  20GS A;  5D96 A;  2L57 A;  2VCX A;  2H6X A;  4V2N A;  1PD2 1;  3US3 A;  4ECJ A;  4F9Z A;  6GSY A;  2VLU A;  2FWG A;  4EF0 A;  3DVW A;  3WGE A;  6GST A;  3KH9 A;  4RQX A;  1JLV A;  1OE8 A;  2JU5 A;  2RM5 A;  4AJ8 A;  2C3T A;  3ZTL A;  3CBU A;  1XCC A;  1HQO A;  2PVO C;  4TXO B;  3I6A A;  5H5S A;  4PXO A;  3VWU A;  5F05 A;  1THX A;  2L4Q A;  5ECN B;  4POL A;  5KOX A;  4TR0 A;  3HDC A;  4Z2U A;  3FRC A;  5DJL A;  1G7O A;  4MH3 A;  4LL4 B;  4MNN A;  5DAL A;  1K3O A;  1K0D A;  3QCP A;  4IQ1 A;  3MAK A;  3GH6 A;  5IO2 A;  4BVX B;  2L6C A;  4A5P A;  2ON7 A;  2ZCT A;  4MLY A;  2FNO A;  3VWW A;  2QKE A;  3GUS A;  1XVQ A;  2VO4 A;  1QK8 A;  4IGJ A;  1NW2 A;  2CAQ A;  2LRC A;  4KSO A;  6GSV A;  1O85 A;  4G2E A;  4TVE A;  1GSF A;  5H5R A;  4L5O A;  1OAZ A;  3KH7 A;  1BX9 A;  3LEF A;  5E4W A;  2WGR A;  6GSW A;  1TKD B;  3VI5 A;  2AAW A;  3KD0 A;  1EV9 A;  3TJJ A;  3BBY A;  2MBT A;  2QA2 A;  4YQU A;  4HOJ A;  1TJD A;  3GMF A;  2F3M A;  1FOV A;  4HZ2 A;  5AGY A;  3TKQ A;  1KNG A;  5A4V A;  2LRN A;  2IIY A;  1XW5 A;  1XW9 A;  2R0C A;  1Y6E A;  8GSS A;  4MF5 A;  3HJM A;  5LNK e;  3EMP A;  3GRX A;  4IN0 A;  3LSZ A;  1XXU A;  4F82 A;  2WUL A;  3D6I A;  1YEX A;  2WCI A;  2CT6 A;  4PTS A;  1SL0 B;  4TR1 A;  5D9W A;  1K0M A;  2O7K A;  4Q5Q A;  4K7O A;  2VAF A;  5ECP B;  1B4Q A;  1XZO A;  3HD5 A;  2YP6 A;  3IA1 A;  1HNB A;  1MDK A;  1ZYP A;  1PQN A;  4MH2 A;  2KP2 A;  5ECS A;  3D4M A;  2DJ1 A;  3BCI A;  3H1N A;  4OWY A;  4N0V A;  5CRE A;  3A2W A;  1O6J A;  2X8H A;  3TJF A;  1A2L A;  5INY A;  1XFL A;  1X9M B;  3KJY A;  3RDW A;  4KX4 A;  3L9S A;  4WF4 A;  3CTF A;  2KHP A;  3GKM A;  1W4V A;  3TKS E;  1AAZ A;  1TOF A;  2O8V B;  4EC0 A;  2A2S A;  4OCE A;  3F4S A;  2HZF A;  4NV5 A;  2GT5 A;  3GYK A;  4F03 A;  4HEA 2;  3E3E A;  3CSH A;  3M9K A;  2IJY A;  1K3Y A;  4HJM A;  4XS4 A;  5DAL B;  3GX0 A;  3MWH A;  4JE1 A;  4JR6 A;  2A2R A;  2H72 A;  3IC8 A;  3V1W A;  2JAC A;  5JWR B;  3GTU B;  1SYX A;  1YF1 A;  1WOU A;  3IC4 A;  4CW9 A;  3QAV A;  4ILF A;  1M2B A;  1TP9 A;  3ZMK A;  1THO A;  1JHB A;  2VCT A;  2FY6 A;  1U87 A;  2C1Y A;  3VK9 A;  2KOK A;  3LFL A;  1GLP A;  3A2X A;  1M0U A;  5D8I A;  1SKS B;  1OC8 A;  3R3E A;  4EL1 A;  4ACS A;  3BJ5 A;  5DDL A;  1PKW A;  2A4V A;  1DUG A;  6GSS A;  1R26 A;  3F9U A;  1X5D A;  3ERF A;  2J23 A;  2DML A;  5CNW A;  4HI7 A;  4AGS A;  1ZOF A;  2H6Y A;  3ZIV A;  2R4V A;  4MJB A;  4PGT A;  3H93 A;  3DML A;  1U3I A;  5E59 A;  5B7C A;  2YZH A;  1GLQ A;  5FWG A;  5J3R A;  1X5C A;  2F8A A;  3F8U A;  4KGI A;  3CTG A;  2C0F A;  3WT1 A;  4O5Q A;  2GSQ A;  2VUP A;  5DVB A;  2C8U A;  1WPI A;  4JR4 A;  3FR9 A;  4HUA A;  3D4T A;  1A0F A;  2HT9 A;  2IFQ A;  2C3N A;  4K5S A;  1TI3 A;  5G5F A;  3VFI A;  4IVF A;  4PUR A;  5JCU A;  4KSM A;  2HRA A;  4TR4 A;  4EIQ A;  2ES7 A;  3N5O A;  2IMI A;  1T4Z A;  3MNG A;  4TR1 B;  5HFI A;  4GLT A;  5IPG A;  1XVW A;  3GKX A;  5B6N A;  5D9V A;  1QFN A;  3KTB A;  3ZVJ D;  2H8L A;  2NVL A;  4AJ7 A;  1KBN A;  3GFK A;  3F3R A;  1N8J A;  1BQ7 A;  2DMM A;  5IM9 A;  1U88 A;  3TOU A;  2P0G A;  1GUL A;  3HVS A;  3A2V A;  14GS A;  2FCH A;  2J9H A;  3QMX A;  3TKS C;  4F0B A;  3L9V A;  4OFT A;  1YQ1 A;  3TKR A;  5DCH A;  4G0K A;  5BRT A;  4POK A;  1YDK A;  4WR4 A;  2VD0 A;  1QUW A;  3UVT A;  4IEL A;  3IAM 2;  4DVC A;  1MDJ A;  2HI7 A;  2O85 A;  1XOB A;  2V32 A;  4PUA A;  1ZGN A;  3FHK A;  3IBH A;  1GP1 A;  1O7U A;  1OC3 A;  1A2J A;  2OE3 A;  1AQX A;  4I6X A;  18GS A;  1R5P A;  4K8M A;  3GH9 A;  4YQV A;  3F4R A;  2LEG A;  3IHG A;  1SU9 A;  2CAI A;  1JLW A;  3H79 A;  4N30 A;  3PH9 A;  4K1F A;  2H0H A;  1PKZ A;  2P5Q A;  2R0G A;  4G9H A;  5J9C A;  3GST A;  4ZIL A;  1GH2 A;  3FKF A;  4ZXG A;  2GLR A;  2WRT A;  4MZB A;  3D21 A;  1PN9 A;  4IP1 A;  3O6T A;  2HSY A;  1FAA A;  3ME7 A;  1O81 A;  2VLT A;  4GRF A;  3PGT A;  3TOT A;  2GVP A;  3KCM A;  3EVI A;  4K2D A;  3U5R E;  4JU5 A;  1G0T A;  4IS0 A;  2C4J A;  1GWC A;  3IRA A;  3LQ7 A;  5IPH A;  1WE0 A;  2H6Z A;  2FWF A;  1YZX A;  1DBY A;  2H30 A;  2IFQ B;  2LV3 A;  4I97 A;  3C8E A;  2L59 A;  2V2G A;  4ZIJ A;  2PGT A;  2H73 A;  2LNT A;  4I2T A;  3C1S A;  4K0N A;  1GSS A;  1H75 A;  2X99 A;  1R7H A;  2P5R A;  3UIW A;  4NHW A;  1WRY A;  3QD9 A;  1TK0 B;  1PRX A;  3Q19 A;  2HRK A;  1SL1 B;  5IMZ A;  4EO3 A;  2JZT A;  4ZB6 A;  4EDY A;  5HR3 A;  2PUK C;  1M9A A;  4GWR A;  3HZ4 A;  3HJO A;  2DJ2 A;  5ECO B;  1GTB A;  3VUR A;  2GZP A;  1WIK A;  1HD2 A;  3RAZ A;  2X4A A;  1GTA A;  5IMC A;  1U3A A;  1ACV A;  4EKZ A;  4NPB A;  2KLX A;  2CV4 A;  1B48 A;  2YPM A;  3K8N A;  1UA5 A;  1F6M C;  2CVD A;  3RPN A;  5KN2 A;  2B5X A;  2N5A A;  2YWO A;  5J5N A;  4ML1 A;  3HKR A;  3I43 A;  2EC4 A;  1H4O A;  5F0G A;  17GS A;  1QGV A;  3P90 A;  1TRU A;  3GX8 A;  1SK2 A;  3A3T A;  4BL7 A;  1GTI A;  2CX3 A;  5JCW A;  5CRD A;  4BA7 A;  1PMT A;  2XHF A;  1J9B A;  4XS6 A;  1VF1 A;  1VF4 A;  5G1K A;  1PN0 A;  19GS A;  1G6W A;  4AF2 A;  3I9V 2;  4OCF A;  4TOP A;  5EY6 A;  1NM3 A;  2HZE A;  3KXO A;  2LST A;  2MZC A;  4QL7 A;  3BD2 A;  2O89 A;  5CYY A;  4HU9 A;  3M8N A;  1V2A A;  1Z7P A;  3WT2 A;  5LD0 A;  5GAP D;  1Z5Y E;  1R4W A;  2PU9 C;  3W8J A;  3PIN A;  2F8F A;  4MDC A;  4YKF A;  2YV9 A;  3MIX A;  1B4P A;  1OC9 B;  1BYE A;  4TW5 A;  2XPE A;  12GS A;  1SD9 A;  2RLI A;  5B8A A;  2C0G A;  2DJ3 A;  2CA8 A;  2RUF A;  3JCM L;  4G0I A;  5GAN D;  1G6Y A;  2PBJ A;  4OMV A;  2H01 A;  2LQQ A;  1TXX A;  4P3Y B;  2H76 A;  4FYU A;  3GL5 A;  1YY7 A;  3L9U A;  2N5B A;  5ABR A;  2O87 A;  1OKD A;  4O92 A;  1SK1 A;  1A8Y A;  2FGX A;  5ECR B;  1AXD A;  1R5A A;  2IMK A;  3I69 A;  11GS A;  4KE3 A;  4G19 A;  3EU4 A;  5A4W A;  2IN3 A;  1AQV A;  1OE7 A;  4MPF A;  2HE3 A;  2ALB A;  1B8X A;  2HXK A;  3VPQ A;  2AJQ B;  4ML6 A;  2RUE A;  4EVM A;  2VL3 A;  4IJ3 A;  2QSI A;  3IK9 A;  4RQR A;  4Z7X A;  1CQG A;  5D9T A;  2RII A;  1YKA A;  4KH7 A;  5B8B A;  3TGZ A;  3H4K A;  4FYB A;  4WBJ A;  2HYX A;  4BWS A;  1IYH A;  3J7Y b;  2PPT A;  4MPG A;  2HRF A;  2TRC P;  1CQH A;  3W8S A;  1AQW A;  4X43 A;  3GKK A;  5A5K A;  4K0G A;  2VM2 A;  2V41 A;  1KEB A;  4GSN A;  3KGK A;  2BJX A;  2NTO A;  4YAP A;  1I5G A;  4AJ6 A;  2JL4 A;  3EMX A;  3ZFL A;  3CRT A;  1UN2 A;  3CXG A;  2L4C A;  1RQM A;  1VF3 A;  7GSS A;  1F3B A;  1KTE A;  4ZL9 A;  3LGC A;  2XBQ A;  3RHB A;  1NHO A;  5G1L A;  4BL7 B;  4K7N A;  10GS A;  4X0X A;  3FR3 A;  4F2I A;  3DEX A;  5F06 A;  2FD3 A;  3VI7 A;  1JZD A;  3KMN A;  3W6G A;  3LYP A;  3QAG A;  3RBT A;  4GCI A;  2IME A;  2GST A;  1XWG A;  3GIX A;  1YF0 A;  3IV4 A;  2E7P A;  3D22 A;  4YQM A;  1YJ6 A;  2B3S A;  3P8W A;  4E8E A;  3TJB A;  2HZE B;  4K5R A;  5FT3 A;  2IMF A;  2HRN A;  2EIR A;  1B9X C;  1WP0 A;  3ZRE A;  4GF0 A;  4MCU A;  4CDO A;  3FW2 A;  3Q6O A;  1T4Y A;  1U6T A;  2NBS A;  1NSW A;  2LS5 A;  4IBP A;  4DSR A;  4XRA A;  2HSH A;  2CVK A;  3Q74 A;  3L4N A;  2DC5 A;  4V2M A;  3F4T A;  2R0P A;  3O3T A;  2H0I A;  1ZMA A;  2YWM A;  3TRP A;  5J41 A;  2K6V A;  2OBI A;  1FVK A;  3KM6 A;  1K0N A;  1FO5 A;  2JZR A;  1GSY A;  2DJK A;  3KMO A;  4Q5F A;  4KA0 A;  4MJA A;  2LQO A;  4EIP A;  5IMD A;  1K0C A;  2DKH A;  2R5G A;  3GUR A;  2JAD A;  4J56 E;  3VWX A;  5F8B A;  1FOH A;  4LMW A;  1T8E B;  2DJ0 A;  3G7J A;  1BED A;  2R6K A;  1HNC A;  2WS2 A;  2A4H A;  3IDV A;  2FUG 2;  4L8E A;  1ST9 A;  2E2M A;  3M3M A;  4O5R A;  3ERG A;  1ERV A;  2REM A;  1ERU A;  2Z9S A;  4XHM A;  4KDY A;  2OE0 A;  3H8Q A;  5ID2 A;  2V1M A;  2GDR A;  3DD3 A;  4O5U A;  1K3L A;  3GNJ A;  2HLS A;  4WR5 A;  1ZYE A;  1RW1 A;  1DE1 A;  4KDX A;  2WB9 A;  3F0I A;  4J2F A;  2EIO A;  2D2Z A;  2B1L A;  2H71 A;  1J0F A;  3SBC A;  3CMI A;  1EGO A;  2LRT A;  1GSU A;  2G0F A;  2MMN A;  2C0E A;  3ZIJ A;  1SKW B;  2B7K A;  5JWQ B;  2QA1 A;  3C71 A;  2YCD A;  1ZYQ B;  1EOG A;  3QPM A;  5KEJ A;  2LKU A;  1BAY A;  3UMA A;  3ZIT A;  4HS1 A;  1TTZ A;  5DJM A;  5G5E A;  1J08 A;  1UVZ A;  2B7J A;  4IQA A;  1MD3 A;  3HVX A;  2H66 A;  4WXT A;  3HVV A;  1GNE A;  2GZZ A;  2I81 A;  3LXT A;  2LTK A;  4CHS A;  4TR3 A;  3M9J A;  4XCS A;  1XIY A;  1MD4 A;  1EP8 A;  2H0G A;  5HFG A;  1GSQ A;  4XIH A;  4FIW A;  4MJE A;  3EWL A;  3ME8 A;  2AUV A;  1GUK A;  3HZ8 A;  4QQ7 A;  1WMJ A;  4KCE A;  1TDI A;  3FR6 A;  4TN8 A;  3CSJ A;  3NOF A;  5D73 A;  5ENU A;  1W89 A;  1NHY A;  2OAD A;  3APS A;  4ZL8 A;  1MEK A;  4ID0 A;  1DE2 A;  3IR4 A;  2LNS A;  4F0C A;  2WZ9 A;  3QR6 A;  2YNX A;  3DXB A;  1TRV A;  4OFM A;  1X0R A;  5HR0 A;  2M72 A;  4XTS A;  4XS4 B;  2JZS A;  5G2Z A;  1FHE A;  1PX6 A;  4EXJ A;  4BVY A;  2WJU A;  2ZNM A;  2VOC A;  4KF9 A;  2B5E A;  1X9S B;  1K0B A;  3QFB C;  1GUH A;  1F3A A;  1LBK A;  1UC7 A;  2VCW A;  3TUE A;  3E0U A;  1ERT A;  5IOW A;  2GSR A;  4L5L A;  4PX1 A;  1TRS A;  4J57 E;  4L0W A;  1E6B A;  4DSQ A;  2K18 A;  1URM A;  4POM A;  3GSS A;  1EGR A;  2MMA A;  4D73 A;  3MYD A;  1ABA A;  2FA8 A;  3N9J A;  4HZ4 A;  4OD7 A;  4XRD A;  3LG6 A;  3QAW A;  5HFK A;  1ILO A;  2DIZ A;  4ZB8 A;  4O7H A;  3ZL5 A;  1GRX A;  1SD8 A;  3FK8 A;  2R37 A;  1X9W B;  2V6K A;  4I5Q A;  5ID2 B;  1FB6 A;  4GTU A;  2B1K A;  4TRX A;  4BVX A;  4MP4 A;  3VLN A;  3DRN A;  3TJG A;  3LXZ A;  2YWN A;  3R2Q A;  1RK4 A;  3RPP A;  4LL1 B;  3M1G A;  2OKA A;  1EZK A;  1ZZY A;  2GTU A;  3EE2 A;  3UAP A;  2TIR A;  1V57 A;  5CRG A;  4OO4 A;  3UBL A;  3WD6 A;  3IPZ A;  4GXZ A;  4PNF A;  3IHQ A;  1S3A A;  1FB0 A;  5EL8 A;  2C3Q A;  3GA4 A;  5A4U A;  1A0R P;  1MTC A;  2IPA A;  4ZBA A;  1XW6 A;  4NWY A;  2PVQ A;  2K9F A;  3J7Y k;  3TJK A;  2F51 A;  4KB3 A;  3TKS A;  3BCK A;  3C1R A;  3FMW A;  1T7P B;  3EC3 A;  1SJ6 A;  3G7Y A;  1XPV A;  2PN8 A;  4MZC A;  2PER A;  3DWV A;  5KOW A;  1EP7 A;  3LJR A;  5ECM B;  1PL2 A;  5DAK A;  3Q18 A;  3EYT A;  3DVX A;  3ZYW A;  3GKN A;  1PL1 A;  2FWH A;  1Q98 A;  2ON5 A;  3CSI A;  1A24 A;  1A8L A;  1IYI A;  5EPF A;  2I4A A;  3FEU A;  4ULX A;  2K8S A;  5IOX A;  4X4J A;  1SK0 A;  4ECI A;  1MDI A;  5H5Q A;  4HQS A;  1GTU A;  3M0F A;  3QOU A;  2H70 A;  4ZBB A;  3QFA C;  5CAX A;  3DIE A;  2H1A A;  1QMV A;  1FG4 A;  3D5J A;  1Z3E A;  1K0O A;  22GS A;  2LJK A;  4GQC A;  5FHI A;  1XWK A;  1Z6M A;  5ECI B;  4BVY B;  4KAE A;  1HNA A;  3APQ A;  3OR5 A;  4DSS A;  2VLV A;  5HR2 A;  2FHE A;  4WBR D;  1EEJ A;  3EU3 A;  2BMX A;  3ISO A;  1V40 A;  3L0H A;  4CY6 A;  2OAC A;  3F6F A;  4OFN A;  1HYU A;  5GSS A;  1TK8 B;  2OBK A;  4D73 B;  4DEJ A;  2A2P A;  2IL3 A;  1S3D A;  2GSS A;  1ERW A;  3P7X A;  4ECB A;  4E8H A;  5COH A;  5DCG A;  3IOS A;  3VWV A;  4MJC A;  2VCZ A;  2GQL A;  4N11 A;  1QXH A;  3WYW A;  4WF5 A;  4TKY A;  1Y25 A;  1ON4 A;  2GS3 A;  2XC2 A;  1TU8 A;  2V6O A;  1GL8 A;  2OJL A;  3MSZ A;  1FVJ A;  3PR8 A;  3GTU A;  2B6M A;  3S9F A;  1SL2 B;  4YAV A;  1PX7 A;  1AIU A;  1EEM A;  5BMU A;  3HY2 A;  4N10 A;  4HDE A;  2L6D A;  4K9Z A;  2GQM A;  1USB A;  1AC1 A;  3F6D A;  4WEY A;  1DSB A;  2AV4 A;  2KP1 A;  1V58 A;  2HNL A;  3FZ4 A;  3ZLP A;  3NZN A;  4RI7 A;  2XBI A;  5J4U A;  5IIZ A;  5AIS A;  3KEB A;  1PSQ A;  1BG5 A;  6GSX A;  1ZL9 A;  9GSS A;  1PGT A;  1F9M A;  2LUS A;  2H75 A;  3D0Z A;  5ECQ B;  1T00 A;  4V1A p;  1YKC A;  3P2A A;  2R3X A;  2X8G A;  2G2Q A;  1GUM A;  5HQP A;  2CQ9 A;  2MBS A;  5CRW A;  4N0Z A;  1GSD A;  2P31 A;  2VCQ A;  2X8C A;  2E0Q A;  1E2Y A;  2PWJ A;  4NV2 A;  3FZ9 A;  4Z2R A;  2H74 A;  3DGQ A;  4FYC A;  1FW1 A;  5DAK B;  5IMV A;  4GSS A;  4NAX A;  4V2L A;  1SJZ A;  1SEN A;  4MAB A;  4H86 A;  4KDU A;  5DBQ A;  1M2D A;  1PA3 A;  2QC7 A;  2L5O A;  2F9S A;  1N2A A;  4X1U A;  3U6V A;  4YKG A;  1OYJ A;  2CZ2 A;  1QQ2 A;  4WET A;  2L5L A;  1SJI A;  3HHV A;  1TRW A;  2IMD A;  2YJH A;  4PUF C;  1A2M A;  3LW9 A;  5ECL B;  3AY8 A;  2EIQ A;  4KW6 A;  4HU7 A;  4DSS B;  1XWC A;  3IK7 A;  3WGX A;  2H1D A;  4KND A;  5B6M A;  3E9J B;  1VGL A;  3KTL A;  4ECC A;  2GGT A;  4O32 A;  4JED A;  2WDU A;  2CVB A;  3UVH A;  5KN0 A;  3UAR A;  1XWA A;  4KCA A;  3UBK A;  3UL3 A;  3NIV A;  1BJX A;  5L71 A;  3HXS A;  1TK5 B;  5JCG A;  2YV7 A;  2GZY A;  4IP6 A;  2M46 A;  2TRX A;  4ZB9 A;  1JZR A;  2I3Y A;  2PMT A;  2YWI A;  3BOA A;  3EPT A;  3UOM A;  2LJR A;  1A23 A;  3ZFB A;  1OVN A;  2YOI A;  2H1B A;  5HR1 A;  4EUY A;  1V9W A;  4BPY A;  3DYR A;  3ERW A;  4L0U A;  2AYT A;  2NDO A;  2DKI A;  3GHA A;  2AB6 A;  1S3C A;  2N5F A;  1O8W A;  5LCZ A;  3CRU A;  3FZA A;  3HA9 A;  4RUV A;  3A5I A;  3O76 A;  5ELA A;  1XOA A;  3DKS A;  4HJ2 A;  3IAS 2;  1TW9 A;  2UZ8 A;  1Z9H A;  2XPD A;  5D9X A;  2GT6 A;  5KN1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...