4HS1A

High-resolution crystal structure of glutaredoxin like protein nrdh from mycobacterium tuberculosis.
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
84
structure length
84
Chain Sequence
TVTVYTKPACVQCSATSKALDKQGIAYQKVDISLDSEARDYVMALGYLQAPVVVAGNDHWSGFRPDRIKALAGAALTAHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutaredoxin NrdH, putative
publication title The Crystal Structure of Mycobacterium tuberculosis NrdH at 0.87 A Suggests a Possible Mode of Its Activity.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Electron transport
total genus 22
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2012-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00462 Glutaredoxin Glutaredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4hs1A00
3EU3A 1JZWA 2JZTA 1PA3A 1BAYA 1B9YC 1PN9A 4MPGA 5FWGA 2FUG2 4BA7A 2LRTA 2FWEA 5GSTA 4F9ZA 5ECKB 2HSYA 4YQUA 1YY7A 4H86A 3FYGA 5IOXA 1SJIA 5AIVA 1QQ2A 1WOUA 2CVDA 3IK7A 4HU7A 4O5RA 4PQHA 2FWFA 3HJMA 1PD21 6GSXA 3ME8A 1EV4A 1KBNA 2I9HA 2GGTA 4XCSA 3ZITA 1A23A 4NAXA 3ISOA 4CDOA 3TUEA 4Q5RA 3FZAA 4TKYA 4JE1A 3GSSA 3ZMKA 2AUVA 1TW9A 3Q18A 4WR4A 3IXRA 4K7NA 3UJ1A 4ILFA 3C1RA 4JRRA 2FD3A 1USBA 4ECIA 5ECOB 1U87A 1M7TA 4I2UA 1QMVA 4YQVA 2XPEA 1H75A 2PUKC 2FNOA 4KH7A 4HI7A 2VUPA 1B48A 3KMNA 2ES7A 5L71A 3QDNA 3FHKA 2E7PA 3Q19A 1BJXA 5ABRA 4TR1B 4GSTA 4EL1A 1A24A 5HR3A 4PUFC 4GQCA 4HQSA 5ECPB 3TKSC 2LTKA 3ED3A 3CXGA 2H1AA 3M1GA 4OO4A 3N9JA 3GMFA 3H8QA 5ECMB 3PINA 4ZBDA 4X1UA 5LCZA 3H1NA 3MAKA 1GTAA 1QUWA 4F2IA 2REMA 4ZXGA 3ZYWA 2H6ZA 2HE3A 1DSBA 3Q74A 2J9HA 4DSSB 1M9BA 1M2DA 1OC8A 2N5FA 4O7HA 4BPYA 3ZFBA 4K0NA 1B4QA 3LXTA 1ACVA 4QL7A 2I3YA 3CSIA 2CA8A 3A2WA 1K0OA 2X8CA 1H4OA 1VF3A 5IOWA 4TW5A 1WRYA 4AF2A 4I5QA 4L0UA 1T1VA 1MDIA 1GNEA 1TRSA 3TJBA 4EDZA 2LRNA 1KEBA 2XBQA 3PR8A 5ID2B 2RM6A 3IE3A 4V2NA 1FHEA 3VURA 1GLQA 2C0FA 4NXIA 6GSTA 5J4UA 1AXDA 4RQXA 2KLXA 4OO5A 2C8UA 2XC2A 3CRTA 3TJJA 4ID0A 1OC3A 4IQAA 2EIOA 5G2ZA 1SYXA 1WJKA 2O87A 2DMLA 1SD9A 2WULA 1GUMA 4XHMA 4WR5A 4N11A 6GSUA 2B6MA 5HFKA 1HNCA 4GWRA 2MBSA 4ZL8A 4POMA 2LJKA 4AJ8A 3O3TA 5DAKA 3TKQA 1LJRA 3UL3A 5AN1A 1I5GA 2HXKA 3ME7A 3US3A 4TR0A 2WDUA 3VWVA 4N30A 1Y6EA 3ZFLA 4EC0A 1ST9A 2A4VA 2IMFA 4RI6A 1ERVA 2FCHA 3TGZA 4ECCA 4QQ7A 3LSZA 4V1Ag 4OFTA 1NM3A 5GAPD 3CYNA 4N0VA 1Q4JA 4XS6A 3P7XA 1OE8A 1R4WA 1DUGA 2CVKA 5ECRB 5CRWA 5KN2A 1XZOA 3A2VA 2TRXA 3IPZA 1XCCA 2YOIA 2CQ9A 1FO5A 3GFKA 1FB6A 3P90A 2DJJA 1R26A 3ZIJA 3LGCA 2PGTA 1FAAA 2JZSA 4ZL7A 4IVFA 4EUYA 1TRWA 4XRDA 2RIIA 2X8HA 3RHBA 3OR5A 2H73A 1M99A 5D9XA 2VD1A 1SKWB 3TOUA 1BYEA 2TRCP 2BTOT 3O6TA 3HYPA 4MZWA 2NTOA 2PVQA 1GTBA 1SKRB 2IWTA 3G7IA 3L0HA 3TRXA 4FO5A 1B4PA 2C0GA 5HR0A 1EWXA 1ZL9A 4ULXA 1Z7RA 5C00A 4HJ2A 2KP2A 4F03A 1G6YA 2YPMA 5GSSA 3EU4A 4K1FA 3TJKA 1J0FA 1G7OA 5A5KA 1JZOA 3RAZA 2YWNA 3F8UA 3VK9A 9GSSA 1U3IA 3F4SA 4NHZA 2IN3A 2AYTA 5G5FA 1TRVA 3DIEA 3VWUA 2H8LA 2QKEA 5ECSA 1ZYQB 1TJDA 3F4RA 3FR9A 2VCXA 1W4VA 2L6CA 4ML1A 2FWGA 2L4QA 1K0DA 1NW2A 5H5QA 2B5YA 2LUSA 1YJ6A 1A0RP 1Z6MA 4POKA 1F9MA 1ILOA 2DJ2A 1AQWA 2IFQA 3L4NA 1TU7A 3UMAA 1TP9A 4YAVA 5DDLA 3APSA 3ERFA 1NSWA 3HVSA 4MH3A 1O85A 2L5LA 3LYPA 1SK1A 1HNBA 2ON7A 1OVNA 3CRUA 1XOAA 4V2MA 3TJFA 5B8BA 4EF0A 5DQSA 4AGSA 3QOUA 5D8IA 2VLVA 17GSA 3A2XA 4LL1B 3GX8A 2CAQA 3GKKA 2IIYA 1N8JA 3BBYA 4EE0A 1AQXA 2GSQA 5AISA 2RM5A 4PGTA 5F05A 2MMNA 2VL2C 2L57A 1AC1A 1XWGA 2P5RA 2VL9A 1XVWA 3D6IA 1RK4A 3F3QA 1SL2B 1U3AA 5J5NA 2LV3A 1AIUA 3IK9A 1EOGA 1ZOFA 4L5LA 5JWOB 4GTUA 3IR4A 1Z5YE 2DJKA 5DAKB 3EVIA 4EDYA 2G2QA 5CAXA 4MZCA 1XVQA 3VI5A 2F8FA 3FW2A 3SBCA 4IHUA 4D73A 1A0FA 1UA5A 1VF2A 3KEBA 4ML6A 14GSA 3NIVA 2YWOA 4J2FA 2JSZA 1GSFA 2JZRA 4IGJA 5KN3A 2R2JA 1O8XA 2DBCA 3GKXA 2H66A 2IPAA 4KAEA 3QR6A 1UC7A 2I1UA 3DYRA 1ON4A 4OFMA 4OCEA 3RPPA 7GSSA 5GAND 2YANA 1PRXA 3LJRA 4KSOA 2R37A 2GS3A 3GRXA 2DSAA 4EXJA 1GL8A 2L59A 3E0UA 2JADA 6GSWA 2WS2A 2FWHA 2M80A 3M3MA 5CYYA 3UARA 5D73A 4LMVA 2GLRA 3SWLA 2MMAA 4Q5QA 4MJBA 3F3RA 4P3YB 3PGTA 2LQOA 2VCWA 4ZB9A 4DEJA 3BCIA 3IV4A 3C71A 2A2SA 1O81A 3G7YA 1F37A 1GSUA 1A8LA 1DE1A 3ZIVA 4HUAA 1WPIA 3EWLA 2CX3A 1PGTA 2K8SA 2MMZA 2H30A 1XPVA 5INYA 4NWYA 3ZLPA 1G0TA 4AJ7A 1YKCA 5J41A 3DWVA 4BWQA 3RDWA 2OE3A 3FRCA 2GQLA 2YJHA 4GLTA 2YV7A 5FT3A 2OADA 5A4VA 4V1Ap 1JLVA 2H0IA 4WF5A 3HD5A 1IYHA 1U6TA 5A4WA 1TXXA 4KGIA 5CRDA 5CRGA 3IDVA 4NMUA 1K3YA 3KTBA 1SU9A 3AY8A 3VPQA 4F0CA 16GSA 4HU9A 2J23A 5CP1A 4N10A 2IFQB 4LL4B 2IMKA 2VO4A 4MABA 4TXVA 2OA7A 1EOHA 3F0IA 2V2GA 1R5AA 1DE2A 2FA8A 2PU9C 1X5DA 5G1LA 4WBRD 2AV4A 1OE7A 1O7UA 2M72A 5JCWA 1URMA 1ZMAA 4KB3A 2V32A 1QK8A 2C0EA 2GSRA 2GZZA 2K8VA 1UN2A 2O85A 1T4ZA 3GV1A 5DQYA 3C7MA 3DMLA 4TR4A 1PKWA 4X43A 3CTGA 3TRPA 5IIZA 3L78A 1GLPA 2KOKA 5LD0A 1O8WA 1Z9HA 4G2EA 22GSA 3W6GA 5IMCA 4HZ2A 4JU5A 20GSA 3W8SA 2DJ3A 2A2RA 4WKWA 3UBKA 3GHAA 1V40A 3M9KA 2GSTA 4YAPA 2QSIA 3GTUA 4K7OA 3W8JA 2WB9A 1CQGA 1T4YA 2EIRA 5F8BA 1SJ6A 2YWIA 1B8XA 4GSNA 1SL1B 2M46A 2AAWA 1I9DA 4O32A 2C0DA 2I81A 5IPGA 2F3MA 1EP7A 4IP1A 2P5QA 2DJ1A 4ECBA 2B5XA 3GURA 4KDYA 1XWCA 1MEKA 1GP1A 2QGVA 4POBA 3DEXA 3VWXA 4J57E 3ZRDA 4D73B 4HEA2 1M0UA 3QAVA 2LJAA 2YJ7A 4MMMA 4WETA 1SD8A 2MBTA 2NDOA 4TXOA 3RBTA 2JL4A 1XBSA 5DALA 5E4WA 3QFAC 1UVZA 3O76A 1WWJA 1V98A 3H79A 4X0XA 2C4JA 2TIRA 3IA1A 2FA4A 2D2ZA 3GL3A 1ML6A 1YQ1A 3LORA 3TCOA 4EVMA 4K6XA 4KUNA 4ZB6A 1A8YA 2WGRA 3UAPA 3HA9A 3KGKA 1EP8A 1K0AA 3L9SA 3KH9A 4GQFA 4HDEA 1KTEA 3DKSA 13GSA 5ECHB 2MMOA 5C04A 3C73A 4N0ZA 3M0FA 2B5EA 2L5OA 4PX1A 3L9VA 5HFGA 2C3QA 4Z7XA 2H1GA 1MD4A 4IN0A 3D4MA 3GNJA 3FZ4A 1NHYA 4PNFA 4K0GA 2H72A 4GRFA 1YF0A 1EGRA 2VAFA 4KNDA 3CBUA 3LWAA 3GH6A 3IOSA 4FYCA 6GSSA 3GL5A 4IKHA 2DIZA 2V6OA 3BJ5A 2GSSA 3GUSA 4BWSA 4V2LA 2VCTA 5IMZA 1Q98A 1DBYA 4WXTA 3J7Yb 5AGYA 1E6BA 3D22A 5JCUA 2HZEB 3RPNA 4JR4A 3ERWA 5B6NA 2H19A 3KTLA 3QAGA 4NHWA 4DVCA 3F6DA 2VM1A 2YP6A 5DCHA 2N5AA 2YN1A 1XXUA 4IJ3A 1T8EB 2PERA 5LNKe 4ACSA 1K0CA 4MF6A 4HQZA 2C1YA 3D4TA 1GULA 2VCVA 4DSRA 5IMAA 5J9BA 2EIQA 5IO2A 1SK2A 1TK8B 2E0QA 8GSSA 3TKRA 3L9UA 3EINA 3EMXA 2F9SA 1FG4A 4I6XA 5H5SA 5HFIA 2YNXA 3ZREA 5CO3A 2HRFA 4K7IA 4RUVA 4HJMA 3LG6A 1EGOA 2VLTA 2FGXA 3CTFA 3Q6OA 4I2TA 3KP8A 1V57A 1QXHA 3GTUB 2VL2A 3KM6A 2X8GA 4MJAA 1Z7PA 1PSQA 4IQ1A 3KZQA 2AHEA 3GKNA 4KDXA 3E3EA 3DD3A 2XHFA 1BEDA 2I4AA 5ECIB 1YF1A 3IAM2 4OFNA 1K3OA 5EPFA 1TI1A 3HZ8A 5D96A 2L6DA 2C3TA 5ECQB 4POLA 2IJYA 5IPHA 3HJPA 3BD2A 4MCUA 1GSDA 1MD3A 2XBIA 1E2YA 2NPBA 5IMFA 3KD0A 2VLUA 2PN8A 4ZIJA 3DXBA 4TXOB 2AB6A 4FYBA 1TOFA 4MJCA 4PURA 3V1WA 3VWWA 3CMIA 5DALB 3LQ7A 1XW9A 4XTSA 2KHPA 2VIMA 1PQNA 5DJMA 4PQIA 4KDUA 1X9MB 4MH2A 4XS4B 3KMOA 2WJUA 2PWJA 1PX7A 2HI7A 3IAS2 1SYRA 5CREA 4PXOA 2CT6A 1HQOA 3FZ9A 5J3RA 1XW5A 2H1BA 1W89A 1RW1A 1O6JA 2K6VA 1PKZA 2F8AA 1J08A 5HQPA 10GSA 3FR6A 4OMVA 4GCIA 1XIYA 3CSHA 2LNTA 5JWRB 3VI7A 5J9CA 3ZVJD 3KIJA 2RUFA 2HNLA 4KCEA 3EURA 2LEGA 1SENA 1THOA 5KEJA 3JCML 1YEPA 3D5JA 4YQMA 1GUHA 5D93A 4DSQA 5DCGA 5F07A 3QAWA 3K8NA 4XS1A 5HR1A 2C80A 1JFUA 3F9UA 1XWKA 4CHSA 3WT2A 1M9AA 2KP1A 4RI7A 4EKZA 4ZILA 2B7KA 2LS5A 2VOCA 2GZPA 2OBIA 3GH9A 3LEFA 3LXZA 1TU8A 3H4KA 3NZNA 3QFBC 4L5OA 4MA9A 2ON5A 1OC9B 1Z6NA 2ZNMA 1TRUA 1PX6A 5F06A 2H01A 4IS0A 1JHBA 4KE3A 2H6XA 3FKFA 3ZMLA 5ENUA 1TK0B 4KCAA 2NBSA 3FR3A 4MP4A 1N2AA 3C1SA 1EEJA 4KSMA 3I43A 3F6FA 3NOFA 5JWQB 2GQKA 4MF5A 1T3BA 1GTUA 4ZB8A 5JCGA 3RHCA 2C3NA 2H0HA 4WEYA 2H74A 2HYXA 3IBHA 4ECJA 2GQMA 3FZ5A 2E2GA 2O8VB 2CV4A 18GSA 1OKDA 2R4VA 4IP6A 3TKSA 1HYUA 3P8WA 4YH2A 4FIWA 2MZCA 1GUKA 4MJEA 1VRSD 4L8EA 2PVOC 1VF4A 2F51A 4ZBBA 5G5EA 2IMDA 2H76A 5ELAA 1LU4A 2RLIA 2H6YA 2L4CA 4NPBA 4F82A 4IJIA 5D9TA 2HZEA 2R5GA 4FYUA 1VGLA 3I9V2 4KX4A 2KUCA 3KH7A 3HVXA 1OAZA 3BOAA 2PPTA 2V6KA 4OD7A 1F3BA 2CZ2A 4CW9A 1X9WB 1GSQA 4WF4A 1JLWA 19GSA 5D9WA 2IMEA 3VFIA 1VF1A 2GT6A 3EMPA 2K9FA 3UVHA 2Z9SA 1M2BA 1F3AA 1OKTA 4E8HA 3WYWA 1S3CA 1LBKA 1AAZA 2LRCA 4NV5A 1X5EA 1ERTA 2B3SA 1HNAA 1EV9A 3F4TA 2HSHA 4JBBA 3KJYA 5F0GA 3WGDA 1S3DA 2PBJA 3TKSE 4MZBA 4ZBAA 2JU5A 2LKUA 3IRAA 1CQHA 5G31A 2B1KA 1JZDA 1WE0A 1S3AA 4BL7A 3M8NA 3MDKA 3GSTA 5D9VA 2H75A 2OE1A 4TR3A 4ZL9A 1ZCPA 3LYKA 2ZCTA 3FK8A 3HHVA 2VCQA 4GXZA 2WCIA 1XOBA 3WGEA 3ERGA 3APQA 4I8BA 2ZUPA 1A2LA 2GDRA 5KN1A 2FHEA 3IC4A 3HKRA 1GNWA 5DVBA 2O7KA 1FOVA 1OYJA 4I97A 3R2QA 2E2MA 3HVVA 2V41A 2WRTA 2BMXA 3HZ4A 3APOA 2O89A 5E59A 5KN0A 1SJZA 1G7EA 2WFCA 2IMIA 3PH9A 1SL0B 3N5OA 5DJLA 1ZYEA 2H0GA 1V58A 4MLYA 5G30A 2R6KA 3WD6A 2PMTA 3EE2A 2DJ0A 4XS4A 3J7Yk 3GIXA 4GSSA 2HFDA 3E9JB 1Z3EA 1MDKA 5IM9A 4GF0A 1TKDB 1ERUA 2OE0A 1TDIA 2JSYA 2CAIA 1KNGA 1F2EA 3DGQA 5B7CA 4HZ4A 2R3XA 4TN8A 1FVKA 1ZGNA 4Q5FA 5DBQA 3ZL5A 1WIKA 5ECLB 3VLNA 1B9XC 2LJRA 3EC3A 1K3LA 1K0NA 4KW6A 3GX0A 1FB0A 5A4UA 2H71A 3WT1A 3FY7A 4PNGA 5B6MA 1HD2A 1X0RA 4L0WA 1XWAA 4TRXA 3BCKA 4G19A 5EY6A 1GSYA 2DLXA 4OCFA 1QGVA 5CRHA 4PQ1A 2GT5A 4K8MA 3DVXA 1R5PA 3F63A 3HXSA 5EVOA 2NVLA 1F6MC 3U5RE 3HCZA 1OC9A 2X64A 3D0ZA 1M2AA 2YWMA 4LMWA 1PL1A 1QFNA 1AQVA 3ZZXA 3KP9A 4IELA 2DIYA 4XIHA 1ZZYA 4IBPA 2CVBA 4PUAA 3CSJA 3MNGA 1THXA 2VL3A 2YCDA 1WP0A 2LQQA 3TOTA 1SK0A 2ALBA 4TOPA 4E8EA 1X9SB 1ERWA 4HS1A 4JEDA 2VD0A 1ABAA 3KXOA 2P31A 3A3TA 4KA0A 3TRQA 1V2AA 1PL2A 3UIWA 2YV9A 2LSTA 1GRXA 3G9BA 2QC7A 3GYKA 1A2MA 4G10A 2X99A 3G7JA 5FHIA 3GA4A 1V9WA 4JR6A 3I69A 1GWCA 2VM2A 5G1KA 2H1DA 2HLSA 1YZXA 1AUCA 5COHA 2K18A 3TB2A 1MTCA 4IW9A 3U6VA 2MYGA 2OBKA 2GVPA 3HDCA 3UOMA 4G9HA 5EL8A 1AW9A 3A5WA 5AIXA 4K2DA 2YZHA 1BX9A 3TKPA 1BG5A 2HZFA 4J56E 5H5RA 4F0BA 1Y25A 2FY6A 3QCPA 2YZUA 4BVYA 2JACA 4Q5NA 3LFLA 1EEMA 1TI3A 3ZTLA 3S9FA 1C72A 2AJQB 4MK3A 3DVWA 2RUEA 3FEUA 3HJOA 2OJLA 4MF7A 2P0GA 3UBLA 3M9JA 2B7JA 3D21A 3QD9A 4TR1A 5CNWA 1IYIA 3I6AA 3DRNA 12GSA 2N5BA 1EZKA 2EC4A 1YDKA 2G0FA 2BJXA 3WGXA 1GTIA 2HT9A 1XWBA 2WZ9A 3VPTA 5IO0A 1U88A 3UVTA 11GSA 5IQYA 1T00A 4QL9A 3H93A 1K0BA 1NHOA 5GZZB 1YKAA 3C8EA 1X5CA 4DSSA 1TTZA 1RQMA 4LLRA 1J9BA 4MDCA 4WBJA 3KCMA 1K0MA 3GKMA 2CZ3A 3QPMA 1FW1A 3IHQA 1TK5B 3UEMA 2DC5A 2B1LA 2OKAA 1FVJA 3MWHA 1O73A 2LNSA 4O92A 1GSSA 1PMTA 4EO3A 5ID2A 5B8AA 2XPDA 4ISDA 3ZVJA 6GSYA 4NV2A 5IMDA 1XFLA 1WMJA 2OACA 3HY2A 3P2AA 4LA1A 3EYTA 4MPFA 4FH8A 5ELGA 4AJ6A 2FLSA 2V1MA 4BVXA 1BQ7A 1A2JA 5ECNB 5IMVA 3MSZA 3GN3A 1MDJA 1R7HA 2VCZA 3TJGA 3QMXA 1JZRA 6GSVA 1XW6A 4XRAA 1SKSB 2GZYA 1GH2A 1YEXA 3TDGA 2DMMA 1GSEA 2H70A 2IL3A 4HOJA 4RQRA 2HRNA 4OWYA 2CX4A 4TVEA 2GTUA 5HR2A 1G6WA 1T7PB 4JZQA 4K9ZA
chains in the Genus database with same CATH superfamily
3EU3A 1JZWA 2JZTA 1PA3A 1BAYA 1B9YC 1PN9A 4MPGA 5FWGA 2FUG2 4BA7A 2LRTA 2FWEA 5GSTA 4F9ZA 5ECKB 2HSYA 4USSA 4YQUA 1YY7A 4H86A 3FYGA 5IOXA 1SJIA 5AIVA 1QQ2A 1WOUA 2CVDA 3IK7A 4HU7A 4O5RA 4PQHA 2FWFA 3HJMA 1PD21 4ICYA 6GSXA 3ME8A 1EV4A 1KBNA 5BMUA 2I9HA 2GGTA 2HSMA 4XCSA 3ZITA 1A23A 4NAXA 3ISOA 4CDOA 3TUEA 4Q5RA 3FZAA 4TKYA 4JE1A 3GSSA 3ZMKA 2AUVA 1TW9A 3Q18A 4WR4A 4BVYB 3IXRA 4K7NA 3UJ1A 4ILFA 3C1RA 4JRRA 2FD3A 1USBA 4ECIA 5ECOB 1U87A 1M7TA 4I2UA 1QMVA 4YQVA 2XPEA 1H75A 2PUKC 2FNOA 4KH7A 4HI7A 2VUPA 1B48A 3KMNA 2ES7A 5L71A 3QDNA 3FHKA 2E7PA 3Q19A 1BJXA 5ABRA 4TR1B 4GSTA 4EL1A 1A24A 5HR3A 4PUFC 4GQCA 4HQSA 5ECPB 3TKSC 2LTKA 3ED3A 3CXGA 2H1AA 3M1GA 4OO4A 3N9JA 3GMFA 3H8QA 5ECMB 3PINA 4ZBDA 4X1UA 5LCZA 3H1NA 3MAKA 1GTAA 1QUWA 4F2IA 2REMA 4ZXGA 3ZYWA 2H6ZA 2HE3A 1DSBA 3Q74A 2J9HA 4DSSB 1M9BA 1M2DA 1OC8A 2N5FA 4O7HA 4BPYA 3ZFBA 4K0NA 1B4QA 3LXTA 1ACVA 4QL7A 2I3YA 3CSIA 2CA8A 3A2WA 1K0OA 2X8CA 1H4OA 1VF3A 5IOWA 4TW5A 1WRYA 4AF2A 4I5QA 4L0UA 1T1VA 1MDIA 1GNEA 1TRSA 3TJBA 4EDZA 2LRNA 1KEBA 2XBQA 3PR8A 5ID2B 2RM6A 3IE3A 4V2NA 1FHEA 3VURA 1GLQA 2C0FA 4NXIA 6GSTA 5J4UA 1AXDA 4RQXA 2KLXA 4OO5A 2C8UA 2XC2A 3CRTA 4BVXB 3TJJA 4ID0A 1OC3A 4IQAA 2EIOA 5G2ZA 1SYXA 1WJKA 2O87A 2DMLA 4EIPA 1SD9A 2WULA 1GUMA 4XHMA 4WR5A 4N11A 6GSUA 2B6MA 5HFKA 1HNCA 4GWRA 2MBSA 4ZL8A 4POMA 2LJKA 4AJ8A 3MYDA 3O3TA 5DAKA 3TKQA 1LJRA 3UL3A 5AN1A 1I5GA 2HXKA 3ME7A 3US3A 4TR0A 2WDUA 3VWVA 4N30A 1Y6EA 3ZFLA 4EC0A 1ST9A 2A4VA 2IMFA 4RI6A 1ERVA 2FCHA 3TGZA 4ECCA 4QQ7A 3LSZA 4V1Ag 4OFTA 1NM3A 5GAPD 3CYNA 4N0VA 4YKGA 1Q4JA 4XS6A 3P7XA 1OE8A 1R4WA 1DUGA 2CVKA 5ECRB 5CRWA 5KN2A 1XZOA 3A2VA 2TRXA 3IPZA 1XCCA 2YOIA 2CQ9A 1FO5A 3GFKA 1FB6A 3P90A 2DJJA 1R26A 3ZIJA 3LGCA 2PGTA 1FAAA 2JZSA 4ZL7A 4IVFA 4EUYA 1TRWA 4XRDA 2RIIA 2X8HA 3RHBA 3OR5A 2H73A 1M99A 4FQUA 5D9XA 2VD1A 1SKWB 3TOUA 1BYEA 4G0IA 2TRCP 2BTOT 3O6TA 3HYPA 4MZWA 2NTOA 2PVQA 1GTBA 1SKRB 2IWTA 3G7IA 3L0HA 3TRXA 4FO5A 1B4PA 2C0GA 5HR0A 1EWXA 1ZL9A 4ULXA 1Z7RA 5C00A 4HJ2A 2KP2A 4F03A 1G6YA 2YPMA 5GSSA 3EU4A 2R0PA 4K1FA 3TJKA 1J0FA 1G7OA 5A5KA 1JZOA 3RAZA 2YWNA 3F8UA 3VK9A 9GSSA 1U3IA 3F4SA 4NHZA 2IN3A 2AYTA 5G5FA 1TRVA 3DIEA 3VWUA 2H8LA 2QKEA 4EIQA 5ECSA 1ZYQB 1TJDA 3F4RA 3FR9A 2VCXA 1S3RA 1W4VA 2L6CA 4ML1A 2FWGA 2L4QA 1K0DA 1NW2A 5H5QA 2B5YA 2LUSA 1YJ6A 1A0RP 1Z6MA 4POKA 1F9MA 1ILOA 2DJ2A 1AQWA 4G0KA 4O5QA 2IFQA 3L4NA 1TU7A 3UMAA 1TP9A 4YAVA 5DDLA 3APSA 3ERFA 1NSWA 3HVSA 4MH3A 1O85A 2L5LA 3LYPA 1PN0A 1SK1A 1HNBA 2ON7A 1OVNA 3CRUA 1XOAA 4V2MA 3TJFA 5B8BA 4EF0A 5DQSA 4AGSA 3QOUA 5D8IA 2VLVA 17GSA 3A2XA 4LL1B 3GX8A 2CAQA 3GKKA 2IIYA 1N8JA 3BBYA 4EE0A 1AQXA 2GSQA 5AISA 2RM5A 4PGTA 5F05A 2MMNA 2VL2C 2L57A 1AC1A 1XWGA 2P5RA 2VL9A 1XVWA 3D6IA 1RK4A 3F3QA 1SL2B 1U3AA 5J5NA 3MIXA 2LV3A 1AIUA 3IK9A 1EOGA 1ZOFA 4KF9A 4L5LA 5JWOB 4GTUA 3IR4A 1Z5YE 2DJKA 5DAKB 3EVIA 4EDYA 2G2QA 5CAXA 2QA2A 4MZCA 1XVQA 3VI5A 2F8FA 3FW2A 3SBCA 4IHUA 4D73A 1A0FA 1UA5A 1VF2A 3KEBA 4ML6A 14GSA 3NIVA 2YWOA 4J2FA 2JSZA 1GSFA 2JZRA 4IGJA 5KN3A 2R2JA 1O8XA 2DBCA 3GKXA 2H66A 2IPAA 4KAEA 3QR6A 1UC7A 2I1UA 3DYRA 1ON4A 4OFMA 4OCEA 3RPPA 7GSSA 5GAND 2YANA 1PRXA 3LJRA 4KSOA 2R37A 2GS3A 3GRXA 2DSAA 4EXJA 1GL8A 2L59A 3E0UA 2JADA 6GSWA 1PFOA 2WS2A 2FWHA 2M80A 3M3MA 5CYYA 3UARA 5D73A 4LMVA 2GLRA 3SWLA 2MMAA 4Q5QA 4MJBA 3F3RA 4P3YB 3PGTA 2LQOA 2VCWA 4ZB9A 4O5UA 4DEJA 3BCIA 3IV4A 3C71A 2A2SA 1O81A 3G7YA 1F37A 1GSUA 1A8LA 1DE1A 3ZIVA 4HUAA 1WPIA 3EWLA 2CX3A 1PGTA 2K8SA 2MMZA 2H30A 1XPVA 5INYA 4NWYA 3ZLPA 1G0TA 4AJ7A 1YKCA 5J41A 3DWVA 4BWQA 3RDWA 2OE3A 3FRCA 2GQLA 2YJHA 4GLTA 2YV7A 5FT3A 2OADA 5A4VA 4V1Ap 1JLVA 2H0IA 4WF5A 3HD5A 1IYHA 1U6TA 5A4WA 1TXXA 4KGIA 5CRDA 5CRGA 3IDVA 4NMUA 1K3YA 3KTBA 1SU9A 3AY8A 3VPQA 4F0CA 16GSA 4HU9A 2J23A 5CP1A 4N10A 2IFQB 4LL4B 2IMKA 2VO4A 4MABA 4TXVA 2OA7A 1EOHA 3F0IA 2V2GA 1R5AA 1DE2A 2FA8A 2PU9C 1X5DA 5G1LA 4WBRD 2AV4A 1OE7A 1O7UA 2M72A 5JCWA 1URMA 1ZMAA 4KB3A 2V32A 1QK8A 2C0EA 2GSRA 2GZZA 2K8VA 1UN2A 2O85A 1T4ZA 3GV1A 5DQYA 3C7MA 3DMLA 4TR4A 1PKWA 4X43A 3CTGA 3TRPA 5IIZA 3L78A 1GLPA 2KOKA 5LD0A 1O8WA 1Z9HA 4G2EA 4CY8A 22GSA 3W6GA 5IMCA 4HZ2A 4JU5A 20GSA 3W8SA 2DJ3A 2A2RA 4WKWA 3UBKA 3GHAA 1V40A 3M9KA 2GSTA 4YAPA 2QSIA 3GTUA 4K7OA 3W8JA 2WB9A 1CQGA 1T4YA 2EIRA 5F8BA 1SJ6A 2YWIA 2HRAA 1B8XA 4GSNA 1SL1B 2M46A 2AAWA 1I9DA 4O32A 2C0DA 2I81A 5IPGA 2F3MA 1EP7A 4IP1A 2P5QA 2DJ1A 4ECBA 2B5XA 3GURA 4KDYA 1XWCA 1MEKA 1GP1A 2QGVA 4POBA 3DEXA 4HSCX 3VWXA 4J57E 3ZRDA 4D73B 4HEA2 1M0UA 3QAVA 2LJAA 2YJ7A 4MMMA 4WETA 1SD8A 2MBTA 2NDOA 4TXOA 3RBTA 2JL4A 1XBSA 5DALA 5E4WA 3QFAC 1UVZA 3O76A 1WWJA 1V98A 3FMWA 3H79A 4X0XA 2C4JA 2TIRA 3IA1A 2FA4A 2D2ZA 3GL3A 1ML6A 5KOXA 1YQ1A 3LORA 3TCOA 4EVMA 4K6XA 4KUNA 4ZB6A 1A8YA 2WGRA 3UAPA 3HA9A 3KGKA 1EP8A 1K0AA 3L9SA 3KH9A 4GQFA 4HDEA 1KTEA 3DKSA 13GSA 5ECHB 2X4AA 2MMOA 5C04A 3C73A 4N0ZA 3M0FA 2B5EA 2L5OA 4PX1A 3L9VA 1ZYPA 5HFGA 2C3QA 4Z7XA 2H1GA 1MD4A 4IN0A 3D4MA 3GNJA 3FZ4A 1NHYA 4PNFA 4K0GA 2H72A 4GRFA 1YF0A 1EGRA 2VAFA 4KNDA 3CBUA 3LWAA 3GH6A 3IOSA 4FYCA 6GSSA 3GL5A 4IKHA 2DIZA 2V6OA 5BRTA 3BJ5A 2GSSA 3EPTA 3GUSA 4BWSA 1M3JA 4V2LA 2VCTA 5IMZA 1Q98A 1DBYA 4WXTA 3J7Yb 5AGYA 4A5PA 1E6BA 3D22A 5JCUA 2HZEB 3RPNA 4JR4A 3ERWA 5B6NA 2H19A 3KTLA 3QAGA 4NHWA 4DVCA 3F6DA 2VM1A 2YP6A 2QA1A 5KOWA 5DCHA 2N5AA 2YN1A 1XXUA 4IJ3A 1T8EB 2PERA 5LNKe 4ACSA 1K0CA 4MF6A 4HQZA 2C1YA 3D4TA 1GULA 2VCVA 4DSRA 5IMAA 4PTSA 5J9BA 2EIQA 5IO2A 1SK2A 1TK8B 2E0QA 2DKHA 3TKRA 3L9UA 8GSSA 3EINA 3EMXA 2F9SA 1FG4A 4I6XA 5H5SA 5HFIA 2YNXA 3ZREA 5CO3A 2HRFA 4K7IA 4RUVA 4HJMA 3LG6A 1EGOA 2VLTA 2FGXA 3CTFA 3Q6OA 4I2TA 3KP8A 1V57A 1QXHA 3GTUB 2VL2A 3KM6A 2X8GA 4MJAA 1Z7PA 4BL7B 1PSQA 4IQ1A 3KZQA 2AHEA 3GKNA 4KDXA 3E3EA 3DD3A 2XHFA 1BEDA 2I4AA 5ECIB 1YF1A 3IAM2 4OFNA 1K3OA 5EPFA 1TI1A 3HZ8A 5D96A 2L6DA 2C3TA 5ECQB 4POLA 2IJYA 5IPHA 3HJPA 3BD2A 4MCUA 1GSDA 1MD3A 2XBIA 1E2YA 2NPBA 5IMFA 3KD0A 2VLUA 2PN8A 4ZIJA 3DXBA 4TXOB 2AB6A 4FYBA 1TOFA 4MJCA 4PURA 3V1WA 3VWWA 3CMIA 5DALB 3LQ7A 1XW9A 4XTSA 2KHPA 2VIMA 1PQNA 5DJMA 4PQIA 4KDUA 1ZYNA 1X9MB 4MH2A 4K5SA 4XS4B 3KMOA 2WJUA 2PWJA 1PX7A 2HI7A 3IAS2 1SYRA 5CREA 3LW9A 4PXOA 2CT6A 1HQOA 3FZ9A 5J3RA 1XW5A 2H1BA 1W89A 1RW1A 1O6JA 2K6VA 1PKZA 2F8AA 1J08A 5HQPA 10GSA 3FR6A 3HVNA 4OMVA 4GCIA 1XIYA 3CSHA 2LNTA 5JWRB 3VI7A 5J9CA 3ZVJD 3KIJA 2RUFA 2HNLA 4KCEA 3EURA 2LEGA 1SENA 1THOA 5KEJA 3JCML 1YEPA 3D5JA 3IHGA 4YQMA 1GUHA 5D93A 4DSQA 5DCGA 5F07A 3QAWA 3K8NA 4XS1A 5HR1A 2C80A 1JFUA 3F9UA 1XWKA 4CHSA 3WT2A 1M9AA 2KP1A 4X4JA 4RI7A 4EKZA 4ZILA 2B7KA 2LS5A 2VOCA 1XG8A 2GZPA 2OBIA 3GH9A 3LEFA 3LXZA 1TU8A 3H4KA 3NZNA 3QFBC 4L5OA 2HRKA 4MA9A 2ON5A 1OC9B 1Z6NA 2ZNMA 1TRUA 1PX6A 5F06A 2H01A 4IS0A 1JHBA 4KE3A 2H6XA 3FKFA 4MNNA 3ZMLA 5ENUA 1TK0B 4KCAA 2NBSA 3FR3A 4MP4A 1N2AA 3C1SA 1EEJA 4KSMA 3I43A 2A4HA 3F6FA 3NOFA 5JWQB 2GQKA 4MF5A 1T3BA 1GTUA 4ZB8A 5JCGA 3RHCA 2C3NA 2H0HA 4WEYA 2H74A 2HYXA 3IBHA 4ECJA 2GQMA 3FZ5A 2E2GA 2O8VB 2CV4A 18GSA 1OKDA 2R4VA 4IP6A 3TKSA 1HYUA 3P8WA 4YH2A 4K5RA 4FIWA 2MZCA 1GUKA 4MJEA 1VRSD 4L8EA 2PVOC 1VF4A 2F51A 4ZBBA 5G5EA 2IMDA 2X49A 2H76A 5ELAA 1LU4A 2RLIA 2H6YA 2L4CA 4NPBA 4F82A 4IJIA 5D9TA 2HZEA 2R5GA 4FYUA 1VGLA 3I9V2 4KX4A 2KUCA 3KH7A 3HVXA 1OAZA 3BOAA 2PPTA 2V6KA 4OD7A 1F3BA 2CZ2A 4CW9A 1X9WB 1GSQA 4WF4A 1JLWA 19GSA 5D9WA 2IMEA 3VFIA 1VF1A 2GT6A 3EMPA 2K9FA 3UVHA 2Z9SA 1M2BA 1F3AA 1OKTA 4E8HA 3WYWA 1S3CA 1LBKA 1AAZA 2LRCA 4NV5A 1X5EA 1ERTA 2B3SA 1HNAA 1EV9A 3F4TA 2HSHA 4JBBA 3KJYA 5F0GA 3WGDA 1S3DA 2PBJA 3TKSE 4MZBA 4ZBAA 2JU5A 2LKUA 3IRAA 1CQHA 5G31A 2B1KA 3A5IA 1JZDA 1WE0A 1S3AA 4BL7A 3M8NA 3MDKA 3GSTA 5D9VA 2H75A 2OE1A 4TR3A 4ZL9A 1ZCPA 3LYKA 2ZCTA 3FK8A 3HHVA 2VCQA 4GXZA 2WCIA 1XOBA 3WGEA 3ERGA 3APQA 4I8BA 2ZUPA 1A2LA 2GDRA 5KN1A 2FHEA 3IC4A 3HKRA 1GNWA 5DVBA 2O7KA 1FOVA 2A2PA 1OYJA 4G0LA 3CQFA 4I97A 3R2QA 2E2MA 3HVVA 2V41A 2WRTA 2BMXA 3HZ4A 4Z2TA 3APOA 2O89A 5E59A 5KN0A 1SJZA 1G7EA 2WFCA 2IMIA 3PH9A 1SL0B 3N5OA 5DJLA 1ZYEA 2H0GA 1V58A 4MLYA 5G30A 2R6KA 3WD6A 2PMTA 3EE2A 2DJ0A 4XS4A 3J7Yk 3GIXA 4GSSA 2HFDA 3E9JB 1Z3EA 1MDKA 5IM9A 4GF0A 1TKDB 1ERUA 2OE0A 1FOHA 1TDIA 2JSYA 2CAIA 1KNGA 1F2EA 3DGQA 5B7CA 4HZ4A 2R3XA 4TN8A 1FVKA 1ZGNA 4Q5FA 5DBQA 3ZL5A 1WIKA 5ECLB 3VLNA 1B9XC 2LJRA 3EC3A 1K3LA 1K0NA 4KW6A 3GX0A 2DKIA 1FB0A 5A4UA 2H71A 3WT1A 3FY7A 4PNGA 5B6MA 1HD2A 1X0RA 4L0WA 1XWAA 4TRXA 3BCKA 4G19A 5EY6A 1GSYA 2DLXA 4OCFA 1QGVA 5CRHA 4PQ1A 2GT5A 4K8MA 3DVXA 1R5PA 3F63A 3HXSA 5EVOA 2NVLA 1F6MC 3U5RE 2R0CA 3HCZA 1OC9A 2X64A 3D0ZA 1M2AA 2YWMA 4LMWA 1PL1A 1QFNA 1AQVA 3ZZXA 3KP9A 4IELA 2DIYA 4XIHA 1ZZYA 3PPUA 4IBPA 2CVBA 4PUAA 3CSJA 3MNGA 1THXA 2VL3A 2YCDA 4Z2RA 1WP0A 2LQQA 3TOTA 1SK0A 2ALBA 4TOPA 4E8EA 1X9SB 1ERWA 4HS1A 4JEDA 2VD0A 1ABAA 3KXOA 2P31A 3A3TA 4KA0A 3TRQA 1V2AA 1PL2A 3UIWA 2YV9A 2LSTA 1GRXA 3G9BA 2QC7A 3GYKA 1A2MA 4G10A 2X99A 3G7JA 5FHIA 3GA4A 1V9WA 4JR6A 3I69A 1GWCA 2VM2A 5G1KA 2H1DA 2HLSA 1YZXA 1AUCA 5COHA 2K18A 3TB2A 1MTCA 4IW9A 3U6VA 2MYGA 2OBKA 2GVPA 3HDCA 3UOMA 4G9HA 5EL8A 1AW9A 3A5WA 5AIXA 4K2DA 2YZHA 1BX9A 3TKPA 1BG5A 2HZFA 4J56E 5H5RA 4F0BA 1Y25A 2FY6A 3QCPA 2YZUA 4BVYA 2JACA 4Q5NA 3LFLA 1EEMA 1TI3A 3ZTLA 3S9FA 1C72A 2AJQB 4CY6A 4MK3A 3DVWA 2RUEA 3FEUA 3HJOA 4BIKA 2OJLA 4MF7A 2P0GA 3UBLA 3M9JA 2B7JA 3D21A 3QD9A 4TR1A 5CNWA 1IYIA 3I6AA 3DRNA 12GSA 2N5BA 1EZKA 2EC4A 1YDKA 2G0FA 2BJXA 3WGXA 1GTIA 2HT9A 1XWBA 2WZ9A 3VPTA 5IO0A 1U88A 3UVTA 11GSA 5IQYA 1T00A 4QL9A 3H93A 1K0BA 1NHOA 5GZZB 1YKAA 3C8EA 1X5CA 4DSSA 1TTZA 1RQMA 4LLRA 1J9BA 4MDCA 4WBJA 3KCMA 1K0MA 3GKMA 2CZ3A 3QPMA 4K2XA 1FW1A 3IHQA 1TK5B 3UEMA 2DC5A 2B1LA 2OKAA 1FVJA 3MWHA 1O73A 2LNSA 4O92A 1GSSA 1PMTA 4YKFA 4EO3A 5ID2A 5B8AA 2XPDA 4ISDA 3ZVJA 6GSYA 4NV2A 3IC8A 5IMDA 1XFLA 1WMJA 2OACA 3HY2A 3P2AA 4LA1A 3EYTA 4MPFA 4FH8A 5ELGA 4AJ6A 1M3IA 2FLSA 2V1MA 4BVXA 1BQ7A 1A2JA 5ECNB 5IMVA 3MSZA 2R0GA 3GN3A 1MDJA 1R7HA 2VCZA 3TJGA 3QMXA 1JZRA 6GSVA 1XW6A 4Z2UA 4XRAA 3R3EA 1SKSB 2GZYA 1GH2A 1YEXA 3TDGA 2DMMA 1GSEA 2H70A 2IL3A 4HOJA 4RQRA 2HRNA 4OWYA 2CX4A 4TVEA 2GTUA 5HR2A 1G6WA 1T7PB 4JZQA 2UZ8A 4K9ZA
chains in the Genus database with same CATH topology
3EU3A 1JZWA 2JZTA 1PA3A 1BAYA 1B9YC 1PN9A 4MPGA 5FWGA 2FUG2 4BA7A 2LRTA 2FWEA 5GSTA 4F9ZA 5ECKB 2HSYA 4USSA 4YQUA 1YY7A 4H86A 3FYGA 5IOXA 1SJIA 5AIVA 1QQ2A 1WOUA 2CVDA 3IK7A 4HU7A 4O5RA 4PQHA 2FWFA 3HJMA 1PD21 4ICYA 6GSXA 3ME8A 1EV4A 1KBNA 5BMUA 2I9HA 2GGTA 2HSMA 4XCSA 3ZITA 1A23A 4NAXA 3ISOA 4CDOA 3TUEA 4Q5RA 3FZAA 4TKYA 4JE1A 3GSSA 3ZMKA 2AUVA 1TW9A 3Q18A 4WR4A 4BVYB 3IXRA 4K7NA 3UJ1A 4ILFA 3C1RA 4JRRA 2FD3A 1USBA 4ECIA 5ECOB 1U87A 1M7TA 4I2UA 1QMVA 4YQVA 2XPEA 1H75A 2PUKC 2FNOA 4KH7A 4HI7A 2VUPA 1B48A 3KMNA 2ES7A 5L71A 3QDNA 3FHKA 2E7PA 3Q19A 1BJXA 5ABRA 4TR1B 4GSTA 4EL1A 1A24A 5HR3A 4PUFC 4GQCA 4HQSA 5ECPB 3TKSC 2LTKA 3ED3A 3CXGA 2H1AA 3M1GA 4OO4A 3N9JA 3GMFA 3H8QA 5ECMB 3PINA 4ZBDA 4X1UA 5LCZA 3H1NA 3MAKA 1GTAA 1QUWA 4F2IA 2REMA 4ZXGA 3ZYWA 2H6ZA 2HE3A 1DSBA 3Q74A 2J9HA 4DSSB 1M9BA 1M2DA 1OC8A 2N5FA 4O7HA 4BPYA 3ZFBA 4K0NA 1B4QA 3LXTA 1ACVA 4QL7A 2I3YA 3CSIA 2CA8A 3A2WA 1K0OA 2X8CA 1H4OA 1VF3A 5IOWA 4TW5A 1WRYA 4AF2A 4I5QA 4L0UA 1T1VA 1MDIA 1GNEA 1TRSA 3TJBA 4EDZA 2LRNA 1KEBA 2XBQA 3PR8A 5ID2B 2RM6A 3IE3A 4V2NA 1FHEA 3VURA 1GLQA 2C0FA 4NXIA 6GSTA 5J4UA 1AXDA 4RQXA 2KLXA 4OO5A 2C8UA 2XC2A 3CRTA 4BVXB 3TJJA 4ID0A 1OC3A 4IQAA 2EIOA 5G2ZA 1SYXA 1WJKA 2O87A 2DMLA 4EIPA 1SD9A 2WULA 1GUMA 4XHMA 4WR5A 4N11A 6GSUA 2B6MA 5HFKA 1HNCA 4GWRA 2MBSA 4ZL8A 4POMA 2LJKA 4AJ8A 3MYDA 3O3TA 5DAKA 3TKQA 1LJRA 3UL3A 5AN1A 1I5GA 2HXKA 3ME7A 3US3A 4TR0A 2WDUA 3VWVA 4N30A 1Y6EA 3ZFLA 4EC0A 1ST9A 2A4VA 2IMFA 4RI6A 1ERVA 2FCHA 3TGZA 4ECCA 4QQ7A 3LSZA 4V1Ag 4OFTA 1NM3A 5GAPD 3CYNA 4N0VA 4YKGA 1Q4JA 4XS6A 3P7XA 1OE8A 1R4WA 1DUGA 2CVKA 5ECRB 5CRWA 5KN2A 1XZOA 3A2VA 2TRXA 3IPZA 1XCCA 2YOIA 2CQ9A 1FO5A 3GFKA 1FB6A 3P90A 2DJJA 1R26A 3ZIJA 3LGCA 2PGTA 1FAAA 2JZSA 4ZL7A 4IVFA 4EUYA 1TRWA 4XRDA 2RIIA 2X8HA 3RHBA 3OR5A 2H73A 1M99A 4FQUA 5D9XA 2VD1A 1SKWB 3TOUA 1BYEA 4G0IA 2TRCP 2BTOT 3O6TA 3HYPA 4MZWA 2NTOA 2PVQA 1GTBA 1SKRB 2IWTA 3G7IA 3L0HA 3TRXA 4FO5A 1B4PA 2C0GA 5HR0A 1EWXA 1ZL9A 4ULXA 1Z7RA 5C00A 4HJ2A 2KP2A 4F03A 1G6YA 2YPMA 5GSSA 3EU4A 2R0PA 4K1FA 3TJKA 1J0FA 1G7OA 5A5KA 1JZOA 3RAZA 2YWNA 3F8UA 3VK9A 9GSSA 1U3IA 3F4SA 4NHZA 2IN3A 2AYTA 5G5FA 1TRVA 3DIEA 3VWUA 2H8LA 2QKEA 4EIQA 5ECSA 1ZYQB 1TJDA 3F4RA 3FR9A 2VCXA 1W4VA 2L6CA 4ML1A 2FWGA 2L4QA 1K0DA 1NW2A 5H5QA 2B5YA 2LUSA 1YJ6A 1A0RP 1Z6MA 4POKA 1F9MA 1ILOA 2DJ2A 1AQWA 4G0KA 4O5QA 2IFQA 3L4NA 1TU7A 3UMAA 1TP9A 4YAVA 5DDLA 3APSA 3ERFA 1NSWA 3HVSA 4MH3A 1O85A 2L5LA 3LYPA 1PN0A 1SK1A 1HNBA 2ON7A 1OVNA 3CRUA 1XOAA 4V2MA 3TJFA 5B8BA 4EF0A 5DQSA 4AGSA 3QOUA 5D8IA 2VLVA 17GSA 3A2XA 4LL1B 3GX8A 2CAQA 3GKKA 2IIYA 1N8JA 3BBYA 4EE0A 1AQXA 2GSQA 5AISA 2RM5A 4PGTA 5F05A 2MMNA 2VL2C 2L57A 1AC1A 1XWGA 2P5RA 2VL9A 1XVWA 3D6IA 1RK4A 3F3QA 1SL2B 1U3AA 5J5NA 3MIXA 2LV3A 1AIUA 3IK9A 1EOGA 1ZOFA 4KF9A 4L5LA 5JWOB 4GTUA 3IR4A 1Z5YE 2DJKA 5DAKB 3EVIA 4EDYA 2G2QA 5CAXA 2QA2A 4MZCA 1XVQA 3VI5A 2F8FA 3FW2A 3SBCA 4IHUA 4D73A 1A0FA 1UA5A 1VF2A 3KEBA 4ML6A 14GSA 3NIVA 2YWOA 4J2FA 2JSZA 1GSFA 2JZRA 4IGJA 5KN3A 2R2JA 1O8XA 2DBCA 3GKXA 2H66A 2IPAA 4KAEA 3QR6A 1UC7A 2I1UA 3DYRA 1ON4A 4OFMA 4OCEA 3RPPA 7GSSA 5GAND 2YANA 1PRXA 3LJRA 4KSOA 2R37A 2GS3A 3GRXA 2DSAA 4EXJA 1GL8A 2L59A 3E0UA 2JADA 6GSWA 2WS2A 2FWHA 2M80A 3M3MA 5CYYA 3UARA 5D73A 4LMVA 2GLRA 3SWLA 2MMAA 4Q5QA 4MJBA 3F3RA 4P3YB 3PGTA 2LQOA 2VCWA 4ZB9A 4O5UA 4DEJA 3BCIA 3IV4A 3C71A 2A2SA 1O81A 3G7YA 1F37A 1GSUA 1A8LA 1DE1A 3ZIVA 4HUAA 1WPIA 3EWLA 2CX3A 1PGTA 2K8SA 2MMZA 2H30A 1XPVA 5INYA 4NWYA 3ZLPA 1G0TA 4AJ7A 1YKCA 5J41A 3DWVA 4BWQA 3RDWA 2OE3A 3FRCA 2GQLA 2YJHA 4GLTA 2YV7A 5FT3A 2OADA 5A4VA 4V1Ap 1JLVA 2H0IA 4WF5A 3HD5A 1IYHA 1U6TA 5A4WA 1TXXA 4KGIA 5CRDA 5CRGA 3IDVA 4NMUA 1K3YA 3KTBA 1SU9A 3AY8A 3VPQA 4F0CA 16GSA 4HU9A 2J23A 5CP1A 4N10A 2IFQB 4LL4B 2IMKA 2VO4A 4MABA 4TXVA 2OA7A 1EOHA 3F0IA 2V2GA 1R5AA 1DE2A 2FA8A 2PU9C 1X5DA 5G1LA 4WBRD 2AV4A 1OE7A 1O7UA 2M72A 5JCWA 1URMA 1ZMAA 4KB3A 2V32A 1QK8A 2C0EA 2GSRA 2GZZA 2K8VA 1UN2A 2O85A 1T4ZA 3GV1A 5DQYA 3C7MA 3DMLA 4TR4A 1PKWA 4X43A 3CTGA 3TRPA 5IIZA 3L78A 1GLPA 2KOKA 5LD0A 1O8WA 1Z9HA 4G2EA 4CY8A 22GSA 3W6GA 5IMCA 4HZ2A 4JU5A 20GSA 3W8SA 2DJ3A 2A2RA 4WKWA 3UBKA 3GHAA 1V40A 3M9KA 2GSTA 4YAPA 2QSIA 3GTUA 4K7OA 3W8JA 2WB9A 1CQGA 1T4YA 2EIRA 5F8BA 1SJ6A 2YWIA 2HRAA 1B8XA 4GSNA 1SL1B 2M46A 2AAWA 1I9DA 4O32A 2C0DA 2I81A 5IPGA 2F3MA 1EP7A 4IP1A 2P5QA 2DJ1A 4ECBA 2B5XA 3GURA 4KDYA 1XWCA 1MEKA 1GP1A 2QGVA 4POBA 3DEXA 3VWXA 4J57E 3ZRDA 4D73B 4HEA2 1M0UA 3QAVA 2LJAA 2YJ7A 4MMMA 4WETA 1SD8A 2MBTA 2NDOA 4TXOA 3RBTA 2JL4A 1XBSA 5DALA 5E4WA 3QFAC 1UVZA 3O76A 1WWJA 1V98A 3FMWA 3H79A 4X0XA 2C4JA 2TIRA 3IA1A 2FA4A 2D2ZA 3GL3A 1ML6A 5KOXA 1YQ1A 3LORA 3TCOA 4EVMA 4K6XA 4KUNA 4ZB6A 1A8YA 2WGRA 3UAPA 3HA9A 3KGKA 1EP8A 1K0AA 3L9SA 3KH9A 4GQFA 4HDEA 1KTEA 3DKSA 13GSA 5ECHB 2X4AA 2MMOA 5C04A 3C73A 4N0ZA 3M0FA 2B5EA 2L5OA 4PX1A 3L9VA 1ZYPA 5HFGA 2C3QA 4Z7XA 2H1GA 1MD4A 4IN0A 3D4MA 3GNJA 3FZ4A 1NHYA 4PNFA 4K0GA 2H72A 4GRFA 1YF0A 1EGRA 2VAFA 4KNDA 3CBUA 3LWAA 3GH6A 3IOSA 4FYCA 6GSSA 3GL5A 4IKHA 2DIZA 2V6OA 5BRTA 3BJ5A 2GSSA 3EPTA 3GUSA 4BWSA 4V2LA 2VCTA 5IMZA 1Q98A 1DBYA 4WXTA 3J7Yb 5AGYA 4A5PA 1E6BA 3D22A 5JCUA 2HZEB 3RPNA 4JR4A 3ERWA 5B6NA 2H19A 3KTLA 3QAGA 4NHWA 4DVCA 3F6DA 2VM1A 2YP6A 2QA1A 5KOWA 5DCHA 2N5AA 2YN1A 1XXUA 4IJ3A 1T8EB 2PERA 5LNKe 4ACSA 1K0CA 4MF6A 4HQZA 2C1YA 3D4TA 1GULA 2VCVA 4DSRA 5IMAA 4PTSA 5J9BA 2EIQA 5IO2A 1SK2A 1TK8B 2E0QA 2DKHA 3TKRA 3L9UA 8GSSA 3EINA 3EMXA 2F9SA 1FG4A 4I6XA 5H5SA 5HFIA 2YNXA 3ZREA 5CO3A 2HRFA 4K7IA 4RUVA 4HJMA 3LG6A 1EGOA 2VLTA 2FGXA 3CTFA 3Q6OA 4I2TA 3KP8A 1V57A 1QXHA 3GTUB 2VL2A 3KM6A 2X8GA 4MJAA 1Z7PA 4BL7B 1PSQA 4IQ1A 3KZQA 2AHEA 3GKNA 4KDXA 3E3EA 3DD3A 2XHFA 1BEDA 2I4AA 5ECIB 1YF1A 3IAM2 4OFNA 1K3OA 5EPFA 1TI1A 3HZ8A 5D96A 2L6DA 2C3TA 5ECQB 4POLA 2IJYA 5IPHA 3HJPA 3BD2A 4MCUA 1GSDA 1MD3A 2XBIA 1E2YA 2NPBA 5IMFA 3KD0A 2VLUA 2PN8A 4ZIJA 3DXBA 4TXOB 2AB6A 4FYBA 1TOFA 4MJCA 4PURA 3V1WA 3VWWA 3CMIA 5DALB 3LQ7A 1XW9A 4XTSA 2KHPA 2VIMA 1PQNA 5DJMA 4PQIA 4KDUA 1ZYNA 1X9MB 4MH2A 4K5SA 4XS4B 3KMOA 2WJUA 2PWJA 1PX7A 2HI7A 3IAS2 1SYRA 5CREA 3LW9A 4PXOA 2CT6A 1HQOA 3FZ9A 5J3RA 1XW5A 2H1BA 1W89A 1RW1A 1O6JA 2K6VA 1PKZA 2F8AA 1J08A 5HQPA 10GSA 3FR6A 4OMVA 4GCIA 1XIYA 3CSHA 2LNTA 5JWRB 3VI7A 5J9CA 3ZVJD 3KIJA 2RUFA 2HNLA 4KCEA 3EURA 2LEGA 1SENA 1THOA 5KEJA 3JCML 1YEPA 3D5JA 3IHGA 4YQMA 1GUHA 5D93A 4DSQA 5DCGA 5F07A 3QAWA 3K8NA 4XS1A 5HR1A 2C80A 1JFUA 3F9UA 1XWKA 4CHSA 3WT2A 1M9AA 2KP1A 4X4JA 4RI7A 4EKZA 4ZILA 2B7KA 2LS5A 2VOCA 2GZPA 2OBIA 3GH9A 3LEFA 3LXZA 1TU8A 3H4KA 3NZNA 3QFBC 4L5OA 2HRKA 4MA9A 2ON5A 1OC9B 1Z6NA 2ZNMA 1TRUA 1PX6A 5F06A 2H01A 4IS0A 1JHBA 4KE3A 2H6XA 3FKFA 4MNNA 3ZMLA 5ENUA 1TK0B 4KCAA 2NBSA 3FR3A 4MP4A 1N2AA 3C1SA 1EEJA 4KSMA 3I43A 2A4HA 3F6FA 3NOFA 5JWQB 2GQKA 4MF5A 1T3BA 1GTUA 4ZB8A 5JCGA 3RHCA 2C3NA 2H0HA 4WEYA 2H74A 2HYXA 3IBHA 4ECJA 2GQMA 3FZ5A 2E2GA 2O8VB 2CV4A 18GSA 1OKDA 2R4VA 4IP6A 3TKSA 1HYUA 3P8WA 4YH2A 4K5RA 4FIWA 2MZCA 1GUKA 4MJEA 1VRSD 4L8EA 2PVOC 1VF4A 2F51A 4ZBBA 5G5EA 2IMDA 2X49A 2H76A 5ELAA 1LU4A 2RLIA 2H6YA 2L4CA 4NPBA 4F82A 4IJIA 5D9TA 2HZEA 2R5GA 4FYUA 1VGLA 3I9V2 4KX4A 2KUCA 3KH7A 3HVXA 1OAZA 3BOAA 2PPTA 2V6KA 4OD7A 1F3BA 2CZ2A 4CW9A 1X9WB 1GSQA 4WF4A 1JLWA 19GSA 5D9WA 2IMEA 3VFIA 1VF1A 2GT6A 3EMPA 2K9FA 3UVHA 2Z9SA 1M2BA 1F3AA 1OKTA 4E8HA 3WYWA 1S3CA 1LBKA 1AAZA 2LRCA 4NV5A 1X5EA 1ERTA 2B3SA 1HNAA 1EV9A 3F4TA 2HSHA 4JBBA 3KJYA 5F0GA 3WGDA 1S3DA 2PBJA 3TKSE 4MZBA 4ZBAA 2JU5A 2LKUA 3IRAA 1CQHA 5G31A 2B1KA 3A5IA 1JZDA 1WE0A 1S3AA 4BL7A 3M8NA 3MDKA 3GSTA 5D9VA 2H75A 2OE1A 4TR3A 4ZL9A 1ZCPA 3LYKA 2ZCTA 3FK8A 3HHVA 2VCQA 4GXZA 2WCIA 1XOBA 3WGEA 3ERGA 3APQA 4I8BA 2ZUPA 1A2LA 2GDRA 5KN1A 2FHEA 3IC4A 3HKRA 1GNWA 5DVBA 2O7KA 1FOVA 2A2PA 1OYJA 4G0LA 4I97A 3R2QA 2E2MA 3HVVA 2V41A 2WRTA 2BMXA 3HZ4A 4Z2TA 3APOA 2O89A 5E59A 5KN0A 1SJZA 1G7EA 2WFCA 2IMIA 3PH9A 1SL0B 3N5OA 5DJLA 1ZYEA 2H0GA 1V58A 4MLYA 5G30A 2R6KA 3WD6A 2PMTA 3EE2A 2DJ0A 4XS4A 3J7Yk 3GIXA 4GSSA 2HFDA 3E9JB 1Z3EA 1MDKA 5IM9A 4GF0A 1TKDB 1ERUA 2OE0A 1FOHA 1TDIA 2JSYA 2CAIA 1KNGA 1F2EA 3DGQA 5B7CA 4HZ4A 2R3XA 4TN8A 1FVKA 1ZGNA 4Q5FA 5DBQA 3ZL5A 1WIKA 5ECLB 3VLNA 1B9XC 2LJRA 3EC3A 1K3LA 1K0NA 4KW6A 3GX0A 2DKIA 1FB0A 5A4UA 2H71A 3WT1A 3FY7A 4PNGA 5B6MA 1HD2A 1X0RA 4L0WA 1XWAA 4TRXA 3BCKA 4G19A 5EY6A 1GSYA 2DLXA 4OCFA 1QGVA 5CRHA 4PQ1A 2GT5A 4K8MA 3DVXA 1R5PA 3F63A 3HXSA 5EVOA 2NVLA 1F6MC 3U5RE 2R0CA 3HCZA 1OC9A 2X64A 3D0ZA 1M2AA 2YWMA 4LMWA 1PL1A 1QFNA 1AQVA 3ZZXA 3KP9A 4IELA 2DIYA 4XIHA 1ZZYA 3PPUA 4IBPA 2CVBA 4PUAA 3CSJA 3MNGA 1THXA 2VL3A 2YCDA 4Z2RA 1WP0A 2LQQA 3TOTA 1SK0A 2ALBA 4TOPA 4E8EA 1X9SB 1ERWA 4HS1A 4JEDA 2VD0A 1ABAA 3KXOA 2P31A 3A3TA 4KA0A 3TRQA 1V2AA 1PL2A 3UIWA 2YV9A 2LSTA 1GRXA 3G9BA 2QC7A 3GYKA 1A2MA 4G10A 2X99A 3G7JA 5FHIA 3GA4A 1V9WA 4JR6A 3I69A 1GWCA 2VM2A 5G1KA 2H1DA 2HLSA 1YZXA 1AUCA 5COHA 2K18A 3TB2A 1MTCA 4IW9A 3U6VA 2MYGA 2OBKA 2GVPA 3HDCA 3UOMA 4G9HA 5EL8A 1AW9A 3A5WA 5AIXA 4K2DA 2YZHA 1BX9A 3TKPA 1BG5A 2HZFA 4J56E 5H5RA 4F0BA 1Y25A 2FY6A 3QCPA 2YZUA 4BVYA 2JACA 4Q5NA 3LFLA 1EEMA 1TI3A 3ZTLA 3S9FA 1C72A 2AJQB 4CY6A 4MK3A 3DVWA 2RUEA 3FEUA 3HJOA 2OJLA 4MF7A 2P0GA 3UBLA 3M9JA 2B7JA 3D21A 3QD9A 4TR1A 5CNWA 1IYIA 3I6AA 3DRNA 12GSA 2N5BA 1EZKA 2EC4A 1YDKA 2G0FA 2BJXA 3WGXA 1GTIA 2HT9A 1XWBA 2WZ9A 3VPTA 5IO0A 1U88A 3UVTA 11GSA 5IQYA 1T00A 4QL9A 3H93A 1K0BA 1NHOA 5GZZB 1YKAA 3C8EA 1X5CA 4DSSA 1TTZA 1RQMA 4LLRA 1J9BA 4MDCA 4WBJA 3KCMA 1K0MA 3GKMA 2CZ3A 3QPMA 4K2XA 1FW1A 3IHQA 1TK5B 3UEMA 2DC5A 2B1LA 2OKAA 1FVJA 3MWHA 1O73A 2LNSA 4O92A 1GSSA 1PMTA 4YKFA 4EO3A 5ID2A 5B8AA 2XPDA 4ISDA 3ZVJA 6GSYA 4NV2A 3IC8A 5IMDA 1XFLA 1WMJA 2OACA 3HY2A 3P2AA 4LA1A 3EYTA 4MPFA 4FH8A 5ELGA 4AJ6A 2FLSA 2V1MA 4BVXA 1BQ7A 1A2JA 5ECNB 5IMVA 3MSZA 2R0GA 3GN3A 1MDJA 1R7HA 2VCZA 3TJGA 3QMXA 1JZRA 6GSVA 1XW6A 4Z2UA 4XRAA 3R3EA 1SKSB 2GZYA 1GH2A 1YEXA 3TDGA 2DMMA 1GSEA 2H70A 2IL3A 4HOJA 4RQRA 2HRNA 4OWYA 2CX4A 4TVEA 2GTUA 5HR2A 1G6WA 1T7PB 4JZQA 2UZ8A 4K9ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EU3 A;  1JZW A;  2JZT A;  1PA3 A;  1BAY A;  1B9Y C;  1PN9 A;  4MPG A;  5FWG A;  2FUG 2;  4BA7 A;  2LRT A;  2FWE A;  5GST A;  4F9Z A;  5ECK B;  2HSY A;  4YQU A;  1YY7 A;  4H86 A;  3FYG A;  5IOX A;  1SJI A;  5AIV A;  1QQ2 A;  1WOU A;  2CVD A;  3IK7 A;  4HU7 A;  4O5R A;  4PQH A;  2FWF A;  3HJM A;  1PD2 1;  6GSX A;  3ME8 A;  1EV4 A;  1KBN A;  2I9H A;  2GGT A;  4XCS A;  3ZIT A;  1A23 A;  4NAX A;  3ISO A;  4CDO A;  3TUE A;  4Q5R A;  3FZA A;  4TKY A;  4JE1 A;  3GSS A;  3ZMK A;  2AUV A;  1TW9 A;  3Q18 A;  4WR4 A;  3IXR A;  4K7N A;  3UJ1 A;  4ILF A;  3C1R A;  4JRR A;  2FD3 A;  1USB A;  4ECI A;  5ECO B;  1U87 A;  1M7T A;  4I2U A;  1QMV A;  4YQV A;  2XPE A;  1H75 A;  2PUK C;  2FNO A;  4KH7 A;  4HI7 A;  2VUP A;  1B48 A;  3KMN A;  2ES7 A;  5L71 A;  3QDN A;  3FHK A;  2E7P A;  3Q19 A;  1BJX A;  5ABR A;  4TR1 B;  4GST A;  4EL1 A;  1A24 A;  5HR3 A;  4PUF C;  4GQC A;  4HQS A;  5ECP B;  3TKS C;  2LTK A;  3ED3 A;  3CXG A;  2H1A A;  3M1G A;  4OO4 A;  3N9J A;  3GMF A;  3H8Q A;  5ECM B;  3PIN A;  4ZBD A;  4X1U A;  5LCZ A;  3H1N A;  3MAK A;  1GTA A;  1QUW A;  4F2I A;  2REM A;  4ZXG A;  3ZYW A;  2H6Z A;  2HE3 A;  1DSB A;  3Q74 A;  2J9H A;  4DSS B;  1M9B A;  1M2D A;  1OC8 A;  2N5F A;  4O7H A;  4BPY A;  3ZFB A;  4K0N A;  1B4Q A;  3LXT A;  1ACV A;  4QL7 A;  2I3Y A;  3CSI A;  2CA8 A;  3A2W A;  1K0O A;  2X8C A;  1H4O A;  1VF3 A;  5IOW A;  4TW5 A;  1WRY A;  4AF2 A;  4I5Q A;  4L0U A;  1T1V A;  1MDI A;  1GNE A;  1TRS A;  3TJB A;  4EDZ A;  2LRN A;  1KEB A;  2XBQ A;  3PR8 A;  5ID2 B;  2RM6 A;  3IE3 A;  4V2N A;  1FHE A;  3VUR A;  1GLQ A;  2C0F A;  4NXI A;  6GST A;  5J4U A;  1AXD A;  4RQX A;  2KLX A;  4OO5 A;  2C8U A;  2XC2 A;  3CRT A;  3TJJ A;  4ID0 A;  1OC3 A;  4IQA A;  2EIO A;  5G2Z A;  1SYX A;  1WJK A;  2O87 A;  2DML A;  1SD9 A;  2WUL A;  1GUM A;  4XHM A;  4WR5 A;  4N11 A;  6GSU A;  2B6M A;  5HFK A;  1HNC A;  4GWR A;  2MBS A;  4ZL8 A;  4POM A;  2LJK A;  4AJ8 A;  3O3T A;  5DAK A;  3TKQ A;  1LJR A;  3UL3 A;  5AN1 A;  1I5G A;  2HXK A;  3ME7 A;  3US3 A;  4TR0 A;  2WDU A;  3VWV A;  4N30 A;  1Y6E A;  3ZFL A;  4EC0 A;  1ST9 A;  2A4V A;  2IMF A;  4RI6 A;  1ERV A;  2FCH A;  3TGZ A;  4ECC A;  4QQ7 A;  3LSZ A;  4V1A g;  4OFT A;  1NM3 A;  5GAP D;  3CYN A;  4N0V A;  1Q4J A;  4XS6 A;  3P7X A;  1OE8 A;  1R4W A;  1DUG A;  2CVK A;  5ECR B;  5CRW A;  5KN2 A;  1XZO A;  3A2V A;  2TRX A;  3IPZ A;  1XCC A;  2YOI A;  2CQ9 A;  1FO5 A;  3GFK A;  1FB6 A;  3P90 A;  2DJJ A;  1R26 A;  3ZIJ A;  3LGC A;  2PGT A;  1FAA A;  2JZS A;  4ZL7 A;  4IVF A;  4EUY A;  1TRW A;  4XRD A;  2RII A;  2X8H A;  3RHB A;  3OR5 A;  2H73 A;  1M99 A;  5D9X A;  2VD1 A;  1SKW B;  3TOU A;  1BYE A;  2TRC P;  2BTO T;  3O6T A;  3HYP A;  4MZW A;  2NTO A;  2PVQ A;  1GTB A;  1SKR B;  2IWT A;  3G7I A;  3L0H A;  3TRX A;  4FO5 A;  1B4P A;  2C0G A;  5HR0 A;  1EWX A;  1ZL9 A;  4ULX A;  1Z7R A;  5C00 A;  4HJ2 A;  2KP2 A;  4F03 A;  1G6Y A;  2YPM A;  5GSS A;  3EU4 A;  4K1F A;  3TJK A;  1J0F A;  1G7O A;  5A5K A;  1JZO A;  3RAZ A;  2YWN A;  3F8U A;  3VK9 A;  9GSS A;  1U3I A;  3F4S A;  4NHZ A;  2IN3 A;  2AYT A;  5G5F A;  1TRV A;  3DIE A;  3VWU A;  2H8L A;  2QKE A;  5ECS A;  1ZYQ B;  1TJD A;  3F4R A;  3FR9 A;  2VCX A;  1W4V A;  2L6C A;  4ML1 A;  2FWG A;  2L4Q A;  1K0D A;  1NW2 A;  5H5Q A;  2B5Y A;  2LUS A;  1YJ6 A;  1A0R P;  1Z6M A;  4POK A;  1F9M A;  1ILO A;  2DJ2 A;  1AQW A;  2IFQ A;  3L4N A;  1TU7 A;  3UMA A;  1TP9 A;  4YAV A;  5DDL A;  3APS A;  3ERF A;  1NSW A;  3HVS A;  4MH3 A;  1O85 A;  2L5L A;  3LYP A;  1SK1 A;  1HNB A;  2ON7 A;  1OVN A;  3CRU A;  1XOA A;  4V2M A;  3TJF A;  5B8B A;  4EF0 A;  5DQS A;  4AGS A;  3QOU A;  5D8I A;  2VLV A;  17GS A;  3A2X A;  4LL1 B;  3GX8 A;  2CAQ A;  3GKK A;  2IIY A;  1N8J A;  3BBY A;  4EE0 A;  1AQX A;  2GSQ A;  5AIS A;  2RM5 A;  4PGT A;  5F05 A;  2MMN A;  2VL2 C;  2L57 A;  1AC1 A;  1XWG A;  2P5R A;  2VL9 A;  1XVW A;  3D6I A;  1RK4 A;  3F3Q A;  1SL2 B;  1U3A A;  5J5N A;  2LV3 A;  1AIU A;  3IK9 A;  1EOG A;  1ZOF A;  4L5L A;  5JWO B;  4GTU A;  3IR4 A;  1Z5Y E;  2DJK A;  5DAK B;  3EVI A;  4EDY A;  2G2Q A;  5CAX A;  4MZC A;  1XVQ A;  3VI5 A;  2F8F A;  3FW2 A;  3SBC A;  4IHU A;  4D73 A;  1A0F A;  1UA5 A;  1VF2 A;  3KEB A;  4ML6 A;  14GS A;  3NIV A;  2YWO A;  4J2F A;  2JSZ A;  1GSF A;  2JZR A;  4IGJ A;  5KN3 A;  2R2J A;  1O8X A;  2DBC A;  3GKX A;  2H66 A;  2IPA A;  4KAE A;  3QR6 A;  1UC7 A;  2I1U A;  3DYR A;  1ON4 A;  4OFM A;  4OCE A;  3RPP A;  7GSS A;  5GAN D;  2YAN A;  1PRX A;  3LJR A;  4KSO A;  2R37 A;  2GS3 A;  3GRX A;  2DSA A;  4EXJ A;  1GL8 A;  2L59 A;  3E0U A;  2JAD A;  6GSW A;  2WS2 A;  2FWH A;  2M80 A;  3M3M A;  5CYY A;  3UAR A;  5D73 A;  4LMV A;  2GLR A;  3SWL A;  2MMA A;  4Q5Q A;  4MJB A;  3F3R A;  4P3Y B;  3PGT A;  2LQO A;  2VCW A;  4ZB9 A;  4DEJ A;  3BCI A;  3IV4 A;  3C71 A;  2A2S A;  1O81 A;  3G7Y A;  1F37 A;  1GSU A;  1A8L A;  1DE1 A;  3ZIV A;  4HUA A;  1WPI A;  3EWL A;  2CX3 A;  1PGT A;  2K8S A;  2MMZ A;  2H30 A;  1XPV A;  5INY A;  4NWY A;  3ZLP A;  1G0T A;  4AJ7 A;  1YKC A;  5J41 A;  3DWV A;  4BWQ A;  3RDW A;  2OE3 A;  3FRC A;  2GQL A;  2YJH A;  4GLT A;  2YV7 A;  5FT3 A;  2OAD A;  5A4V A;  4V1A p;  1JLV A;  2H0I A;  4WF5 A;  3HD5 A;  1IYH A;  1U6T A;  5A4W A;  1TXX A;  4KGI A;  5CRD A;  5CRG A;  3IDV A;  4NMU A;  1K3Y A;  3KTB A;  1SU9 A;  3AY8 A;  3VPQ A;  4F0C A;  16GS A;  4HU9 A;  2J23 A;  5CP1 A;  4N10 A;  2IFQ B;  4LL4 B;  2IMK A;  2VO4 A;  4MAB A;  4TXV A;  2OA7 A;  1EOH A;  3F0I A;  2V2G A;  1R5A A;  1DE2 A;  2FA8 A;  2PU9 C;  1X5D A;  5G1L A;  4WBR D;  2AV4 A;  1OE7 A;  1O7U A;  2M72 A;  5JCW A;  1URM A;  1ZMA A;  4KB3 A;  2V32 A;  1QK8 A;  2C0E A;  2GSR A;  2GZZ A;  2K8V A;  1UN2 A;  2O85 A;  1T4Z A;  3GV1 A;  5DQY A;  3C7M A;  3DML A;  4TR4 A;  1PKW A;  4X43 A;  3CTG A;  3TRP A;  5IIZ A;  3L78 A;  1GLP A;  2KOK A;  5LD0 A;  1O8W A;  1Z9H A;  4G2E A;  22GS A;  3W6G A;  5IMC A;  4HZ2 A;  4JU5 A;  20GS A;  3W8S A;  2DJ3 A;  2A2R A;  4WKW A;  3UBK A;  3GHA A;  1V40 A;  3M9K A;  2GST A;  4YAP A;  2QSI A;  3GTU A;  4K7O A;  3W8J A;  2WB9 A;  1CQG A;  1T4Y A;  2EIR A;  5F8B A;  1SJ6 A;  2YWI A;  1B8X A;  4GSN A;  1SL1 B;  2M46 A;  2AAW A;  1I9D A;  4O32 A;  2C0D A;  2I81 A;  5IPG A;  2F3M A;  1EP7 A;  4IP1 A;  2P5Q A;  2DJ1 A;  4ECB A;  2B5X A;  3GUR A;  4KDY A;  1XWC A;  1MEK A;  1GP1 A;  2QGV A;  4POB A;  3DEX A;  3VWX A;  4J57 E;  3ZRD A;  4D73 B;  4HEA 2;  1M0U A;  3QAV A;  2LJA A;  2YJ7 A;  4MMM A;  4WET A;  1SD8 A;  2MBT A;  2NDO A;  4TXO A;  3RBT A;  2JL4 A;  1XBS A;  5DAL A;  5E4W A;  3QFA C;  1UVZ A;  3O76 A;  1WWJ A;  1V98 A;  3H79 A;  4X0X A;  2C4J A;  2TIR A;  3IA1 A;  2FA4 A;  2D2Z A;  3GL3 A;  1ML6 A;  1YQ1 A;  3LOR A;  3TCO A;  4EVM A;  4K6X A;  4KUN A;  4ZB6 A;  1A8Y A;  2WGR A;  3UAP A;  3HA9 A;  3KGK A;  1EP8 A;  1K0A A;  3L9S A;  3KH9 A;  4GQF A;  4HDE A;  1KTE A;  3DKS A;  13GS A;  5ECH B;  2MMO A;  5C04 A;  3C73 A;  4N0Z A;  3M0F A;  2B5E A;  2L5O A;  4PX1 A;  3L9V A;  5HFG A;  2C3Q A;  4Z7X A;  2H1G A;  1MD4 A;  4IN0 A;  3D4M A;  3GNJ A;  3FZ4 A;  1NHY A;  4PNF A;  4K0G A;  2H72 A;  4GRF A;  1YF0 A;  1EGR A;  2VAF A;  4KND A;  3CBU A;  3LWA A;  3GH6 A;  3IOS A;  4FYC A;  6GSS A;  3GL5 A;  4IKH A;  2DIZ A;  2V6O A;  3BJ5 A;  2GSS A;  3GUS A;  4BWS A;  4V2L A;  2VCT A;  5IMZ A;  1Q98 A;  1DBY A;  4WXT A;  3J7Y b;  5AGY A;  1E6B A;  3D22 A;  5JCU A;  2HZE B;  3RPN A;  4JR4 A;  3ERW A;  5B6N A;  2H19 A;  3KTL A;  3QAG A;  4NHW A;  4DVC A;  3F6D A;  2VM1 A;  2YP6 A;  5DCH A;  2N5A A;  2YN1 A;  1XXU A;  4IJ3 A;  1T8E B;  2PER A;  5LNK e;  4ACS A;  1K0C A;  4MF6 A;  4HQZ A;  2C1Y A;  3D4T A;  1GUL A;  2VCV A;  4DSR A;  5IMA A;  5J9B A;  2EIQ A;  5IO2 A;  1SK2 A;  1TK8 B;  2E0Q A;  8GSS A;  3TKR A;  3L9U A;  3EIN A;  3EMX A;  2F9S A;  1FG4 A;  4I6X A;  5H5S A;  5HFI A;  2YNX A;  3ZRE A;  5CO3 A;  2HRF A;  4K7I A;  4RUV A;  4HJM A;  3LG6 A;  1EGO A;  2VLT A;  2FGX A;  3CTF A;  3Q6O A;  4I2T A;  3KP8 A;  1V57 A;  1QXH A;  3GTU B;  2VL2 A;  3KM6 A;  2X8G A;  4MJA A;  1Z7P A;  1PSQ A;  4IQ1 A;  3KZQ A;  2AHE A;  3GKN A;  4KDX A;  3E3E A;  3DD3 A;  2XHF A;  1BED A;  2I4A A;  5ECI B;  1YF1 A;  3IAM 2;  4OFN A;  1K3O A;  5EPF A;  1TI1 A;  3HZ8 A;  5D96 A;  2L6D A;  2C3T A;  5ECQ B;  4POL A;  2IJY A;  5IPH A;  3HJP A;  3BD2 A;  4MCU A;  1GSD A;  1MD3 A;  2XBI A;  1E2Y A;  2NPB A;  5IMF A;  3KD0 A;  2VLU A;  2PN8 A;  4ZIJ A;  3DXB A;  4TXO B;  2AB6 A;  4FYB A;  1TOF A;  4MJC A;  4PUR A;  3V1W A;  3VWW A;  3CMI A;  5DAL B;  3LQ7 A;  1XW9 A;  4XTS A;  2KHP A;  2VIM A;  1PQN A;  5DJM A;  4PQI A;  4KDU A;  1X9M B;  4MH2 A;  4XS4 B;  3KMO A;  2WJU A;  2PWJ A;  1PX7 A;  2HI7 A;  3IAS 2;  1SYR A;  5CRE A;  4PXO A;  2CT6 A;  1HQO A;  3FZ9 A;  5J3R A;  1XW5 A;  2H1B A;  1W89 A;  1RW1 A;  1O6J A;  2K6V A;  1PKZ A;  2F8A A;  1J08 A;  5HQP A;  10GS A;  3FR6 A;  4OMV A;  4GCI A;  1XIY A;  3CSH A;  2LNT A;  5JWR B;  3VI7 A;  5J9C A;  3ZVJ D;  3KIJ A;  2RUF A;  2HNL A;  4KCE A;  3EUR A;  2LEG A;  1SEN A;  1THO A;  5KEJ A;  3JCM L;  1YEP A;  3D5J A;  4YQM A;  1GUH A;  5D93 A;  4DSQ A;  5DCG A;  5F07 A;  3QAW A;  3K8N A;  4XS1 A;  5HR1 A;  2C80 A;  1JFU A;  3F9U A;  1XWK A;  4CHS A;  3WT2 A;  1M9A A;  2KP1 A;  4RI7 A;  4EKZ A;  4ZIL A;  2B7K A;  2LS5 A;  2VOC A;  2GZP A;  2OBI A;  3GH9 A;  3LEF A;  3LXZ A;  1TU8 A;  3H4K A;  3NZN A;  3QFB C;  4L5O A;  4MA9 A;  2ON5 A;  1OC9 B;  1Z6N A;  2ZNM A;  1TRU A;  1PX6 A;  5F06 A;  2H01 A;  4IS0 A;  1JHB A;  4KE3 A;  2H6X A;  3FKF A;  3ZML A;  5ENU A;  1TK0 B;  4KCA A;  2NBS A;  3FR3 A;  4MP4 A;  1N2A A;  3C1S A;  1EEJ A;  4KSM A;  3I43 A;  3F6F A;  3NOF A;  5JWQ B;  2GQK A;  4MF5 A;  1T3B A;  1GTU A;  4ZB8 A;  5JCG A;  3RHC A;  2C3N A;  2H0H A;  4WEY A;  2H74 A;  2HYX A;  3IBH A;  4ECJ A;  2GQM A;  3FZ5 A;  2E2G A;  2O8V B;  2CV4 A;  18GS A;  1OKD A;  2R4V A;  4IP6 A;  3TKS A;  1HYU A;  3P8W A;  4YH2 A;  4FIW A;  2MZC A;  1GUK A;  4MJE A;  1VRS D;  4L8E A;  2PVO C;  1VF4 A;  2F51 A;  4ZBB A;  5G5E A;  2IMD A;  2H76 A;  5ELA A;  1LU4 A;  2RLI A;  2H6Y A;  2L4C A;  4NPB A;  4F82 A;  4IJI A;  5D9T A;  2HZE A;  2R5G A;  4FYU A;  1VGL A;  3I9V 2;  4KX4 A;  2KUC A;  3KH7 A;  3HVX A;  1OAZ A;  3BOA A;  2PPT A;  2V6K A;  4OD7 A;  1F3B A;  2CZ2 A;  4CW9 A;  1X9W B;  1GSQ A;  4WF4 A;  1JLW A;  19GS A;  5D9W A;  2IME A;  3VFI A;  1VF1 A;  2GT6 A;  3EMP A;  2K9F A;  3UVH A;  2Z9S A;  1M2B A;  1F3A A;  1OKT A;  4E8H A;  3WYW A;  1S3C A;  1LBK A;  1AAZ A;  2LRC A;  4NV5 A;  1X5E A;  1ERT A;  2B3S A;  1HNA A;  1EV9 A;  3F4T A;  2HSH A;  4JBB A;  3KJY A;  5F0G A;  3WGD A;  1S3D A;  2PBJ A;  3TKS E;  4MZB A;  4ZBA A;  2JU5 A;  2LKU A;  3IRA A;  1CQH A;  5G31 A;  2B1K A;  1JZD A;  1WE0 A;  1S3A A;  4BL7 A;  3M8N A;  3MDK A;  3GST A;  5D9V A;  2H75 A;  2OE1 A;  4TR3 A;  4ZL9 A;  1ZCP A;  3LYK A;  2ZCT A;  3FK8 A;  3HHV A;  2VCQ A;  4GXZ A;  2WCI A;  1XOB A;  3WGE A;  3ERG A;  3APQ A;  4I8B A;  2ZUP A;  1A2L A;  2GDR A;  5KN1 A;  2FHE A;  3IC4 A;  3HKR A;  1GNW A;  5DVB A;  2O7K A;  1FOV A;  1OYJ A;  4I97 A;  3R2Q A;  2E2M A;  3HVV A;  2V41 A;  2WRT A;  2BMX A;  3HZ4 A;  3APO A;  2O89 A;  5E59 A;  5KN0 A;  1SJZ A;  1G7E A;  2WFC A;  2IMI A;  3PH9 A;  1SL0 B;  3N5O A;  5DJL A;  1ZYE A;  2H0G A;  1V58 A;  4MLY A;  5G30 A;  2R6K A;  3WD6 A;  2PMT A;  3EE2 A;  2DJ0 A;  4XS4 A;  3J7Y k;  3GIX A;  4GSS A;  2HFD A;  3E9J B;  1Z3E A;  1MDK A;  5IM9 A;  4GF0 A;  1TKD B;  1ERU A;  2OE0 A;  1TDI A;  2JSY A;  2CAI A;  1KNG A;  1F2E A;  3DGQ A;  5B7C A;  4HZ4 A;  2R3X A;  4TN8 A;  1FVK A;  1ZGN A;  4Q5F A;  5DBQ A;  3ZL5 A;  1WIK A;  5ECL B;  3VLN A;  1B9X C;  2LJR A;  3EC3 A;  1K3L A;  1K0N A;  4KW6 A;  3GX0 A;  1FB0 A;  5A4U A;  2H71 A;  3WT1 A;  3FY7 A;  4PNG A;  5B6M A;  1HD2 A;  1X0R A;  4L0W A;  1XWA A;  4TRX A;  3BCK A;  4G19 A;  5EY6 A;  1GSY A;  2DLX A;  4OCF A;  1QGV A;  5CRH A;  4PQ1 A;  2GT5 A;  4K8M A;  3DVX A;  1R5P A;  3F63 A;  3HXS A;  5EVO A;  2NVL A;  1F6M C;  3U5R E;  3HCZ A;  1OC9 A;  2X64 A;  3D0Z A;  1M2A A;  2YWM A;  4LMW A;  1PL1 A;  1QFN A;  1AQV A;  3ZZX A;  3KP9 A;  4IEL A;  2DIY A;  4XIH A;  1ZZY A;  4IBP A;  2CVB A;  4PUA A;  3CSJ A;  3MNG A;  1THX A;  2VL3 A;  2YCD A;  1WP0 A;  2LQQ A;  3TOT A;  1SK0 A;  2ALB A;  4TOP A;  4E8E A;  1X9S B;  1ERW A;  4HS1 A;  4JED A;  2VD0 A;  1ABA A;  3KXO A;  2P31 A;  3A3T A;  4KA0 A;  3TRQ A;  1V2A A;  1PL2 A;  3UIW A;  2YV9 A;  2LST A;  1GRX A;  3G9B A;  2QC7 A;  3GYK A;  1A2M A;  4G10 A;  2X99 A;  3G7J A;  5FHI A;  3GA4 A;  1V9W A;  4JR6 A;  3I69 A;  1GWC A;  2VM2 A;  5G1K A;  2H1D A;  2HLS A;  1YZX A;  1AUC A;  5COH A;  2K18 A;  3TB2 A;  1MTC A;  4IW9 A;  3U6V A;  2MYG A;  2OBK A;  2GVP A;  3HDC A;  3UOM A;  4G9H A;  5EL8 A;  1AW9 A;  3A5W A;  5AIX A;  4K2D A;  2YZH A;  1BX9 A;  3TKP A;  1BG5 A;  2HZF A;  4J56 E;  5H5R A;  4F0B A;  1Y25 A;  2FY6 A;  3QCP A;  2YZU A;  4BVY A;  2JAC A;  4Q5N A;  3LFL A;  1EEM A;  1TI3 A;  3ZTL A;  3S9F A;  1C72 A;  2AJQ B;  4MK3 A;  3DVW A;  2RUE A;  3FEU A;  3HJO A;  2OJL A;  4MF7 A;  2P0G A;  3UBL A;  3M9J A;  2B7J A;  3D21 A;  3QD9 A;  4TR1 A;  5CNW A;  1IYI A;  3I6A A;  3DRN A;  12GS A;  2N5B A;  1EZK A;  2EC4 A;  1YDK A;  2G0F A;  2BJX A;  3WGX A;  1GTI A;  2HT9 A;  1XWB A;  2WZ9 A;  3VPT A;  5IO0 A;  1U88 A;  3UVT A;  11GS A;  5IQY A;  1T00 A;  4QL9 A;  3H93 A;  1K0B A;  1NHO A;  5GZZ B;  1YKA A;  3C8E A;  1X5C A;  4DSS A;  1TTZ A;  1RQM A;  4LLR A;  1J9B A;  4MDC A;  4WBJ A;  3KCM A;  1K0M A;  3GKM A;  2CZ3 A;  3QPM A;  1FW1 A;  3IHQ A;  1TK5 B;  3UEM A;  2DC5 A;  2B1L A;  2OKA A;  1FVJ A;  3MWH A;  1O73 A;  2LNS A;  4O92 A;  1GSS A;  1PMT A;  4EO3 A;  5ID2 A;  5B8A A;  2XPD A;  4ISD A;  3ZVJ A;  6GSY A;  4NV2 A;  5IMD A;  1XFL A;  1WMJ A;  2OAC A;  3HY2 A;  3P2A A;  4LA1 A;  3EYT A;  4MPF A;  4FH8 A;  5ELG A;  4AJ6 A;  2FLS A;  2V1M A;  4BVX A;  1BQ7 A;  1A2J A;  5ECN B;  5IMV A;  3MSZ A;  3GN3 A;  1MDJ A;  1R7H A;  2VCZ A;  3TJG A;  3QMX A;  1JZR A;  6GSV A;  1XW6 A;  4XRA A;  1SKS B;  2GZY A;  1GH2 A;  1YEX A;  3TDG A;  2DMM A;  1GSE A;  2H70 A;  2IL3 A;  4HOJ A;  4RQR A;  2HRN A;  4OWY A;  2CX4 A;  4TVE A;  2GTU A;  5HR2 A;  1G6W A;  1T7P B;  4JZQ A;  4K9Z A; 
#chains in the Genus database with same CATH topology
 3EU3 A;  1JZW A;  2JZT A;  1PA3 A;  1BAY A;  1B9Y C;  1PN9 A;  4MPG A;  5FWG A;  2FUG 2;  4BA7 A;  2LRT A;  2FWE A;  5GST A;  4F9Z A;  5ECK B;  2HSY A;  4USS A;  4YQU A;  1YY7 A;  4H86 A;  3FYG A;  5IOX A;  1SJI A;  5AIV A;  1QQ2 A;  1WOU A;  2CVD A;  3IK7 A;  4HU7 A;  4O5R A;  4PQH A;  2FWF A;  3HJM A;  1PD2 1;  4ICY A;  6GSX A;  3ME8 A;  1EV4 A;  1KBN A;  5BMU A;  2I9H A;  2GGT A;  2HSM A;  4XCS A;  3ZIT A;  1A23 A;  4NAX A;  3ISO A;  4CDO A;  3TUE A;  4Q5R A;  3FZA A;  4TKY A;  4JE1 A;  3GSS A;  3ZMK A;  2AUV A;  1TW9 A;  3Q18 A;  4WR4 A;  4BVY B;  3IXR A;  4K7N A;  3UJ1 A;  4ILF A;  3C1R A;  4JRR A;  2FD3 A;  1USB A;  4ECI A;  5ECO B;  1U87 A;  1M7T A;  4I2U A;  1QMV A;  4YQV A;  2XPE A;  1H75 A;  2PUK C;  2FNO A;  4KH7 A;  4HI7 A;  2VUP A;  1B48 A;  3KMN A;  2ES7 A;  5L71 A;  3QDN A;  3FHK A;  2E7P A;  3Q19 A;  1BJX A;  5ABR A;  4TR1 B;  4GST A;  4EL1 A;  1A24 A;  5HR3 A;  4PUF C;  4GQC A;  4HQS A;  5ECP B;  3TKS C;  2LTK A;  3ED3 A;  3CXG A;  2H1A A;  3M1G A;  4OO4 A;  3N9J A;  3GMF A;  3H8Q A;  5ECM B;  3PIN A;  4ZBD A;  4X1U A;  5LCZ A;  3H1N A;  3MAK A;  1GTA A;  1QUW A;  4F2I A;  2REM A;  4ZXG A;  3ZYW A;  2H6Z A;  2HE3 A;  1DSB A;  3Q74 A;  2J9H A;  4DSS B;  1M9B A;  1M2D A;  1OC8 A;  2N5F A;  4O7H A;  4BPY A;  3ZFB A;  4K0N A;  1B4Q A;  3LXT A;  1ACV A;  4QL7 A;  2I3Y A;  3CSI A;  2CA8 A;  3A2W A;  1K0O A;  2X8C A;  1H4O A;  1VF3 A;  5IOW A;  4TW5 A;  1WRY A;  4AF2 A;  4I5Q A;  4L0U A;  1T1V A;  1MDI A;  1GNE A;  1TRS A;  3TJB A;  4EDZ A;  2LRN A;  1KEB A;  2XBQ A;  3PR8 A;  5ID2 B;  2RM6 A;  3IE3 A;  4V2N A;  1FHE A;  3VUR A;  1GLQ A;  2C0F A;  4NXI A;  6GST A;  5J4U A;  1AXD A;  4RQX A;  2KLX A;  4OO5 A;  2C8U A;  2XC2 A;  3CRT A;  4BVX B;  3TJJ A;  4ID0 A;  1OC3 A;  4IQA A;  2EIO A;  5G2Z A;  1SYX A;  1WJK A;  2O87 A;  2DML A;  4EIP A;  1SD9 A;  2WUL A;  1GUM A;  4XHM A;  4WR5 A;  4N11 A;  6GSU A;  2B6M A;  5HFK A;  1HNC A;  4GWR A;  2MBS A;  4ZL8 A;  4POM A;  2LJK A;  4AJ8 A;  3MYD A;  3O3T A;  5DAK A;  3TKQ A;  1LJR A;  3UL3 A;  5AN1 A;  1I5G A;  2HXK A;  3ME7 A;  3US3 A;  4TR0 A;  2WDU A;  3VWV A;  4N30 A;  1Y6E A;  3ZFL A;  4EC0 A;  1ST9 A;  2A4V A;  2IMF A;  4RI6 A;  1ERV A;  2FCH A;  3TGZ A;  4ECC A;  4QQ7 A;  3LSZ A;  4V1A g;  4OFT A;  1NM3 A;  5GAP D;  3CYN A;  4N0V A;  4YKG A;  1Q4J A;  4XS6 A;  3P7X A;  1OE8 A;  1R4W A;  1DUG A;  2CVK A;  5ECR B;  5CRW A;  5KN2 A;  1XZO A;  3A2V A;  2TRX A;  3IPZ A;  1XCC A;  2YOI A;  2CQ9 A;  1FO5 A;  3GFK A;  1FB6 A;  3P90 A;  2DJJ A;  1R26 A;  3ZIJ A;  3LGC A;  2PGT A;  1FAA A;  2JZS A;  4ZL7 A;  4IVF A;  4EUY A;  1TRW A;  4XRD A;  2RII A;  2X8H A;  3RHB A;  3OR5 A;  2H73 A;  1M99 A;  4FQU A;  5D9X A;  2VD1 A;  1SKW B;  3TOU A;  1BYE A;  4G0I A;  2TRC P;  2BTO T;  3O6T A;  3HYP A;  4MZW A;  2NTO A;  2PVQ A;  1GTB A;  1SKR B;  2IWT A;  3G7I A;  3L0H A;  3TRX A;  4FO5 A;  1B4P A;  2C0G A;  5HR0 A;  1EWX A;  1ZL9 A;  4ULX A;  1Z7R A;  5C00 A;  4HJ2 A;  2KP2 A;  4F03 A;  1G6Y A;  2YPM A;  5GSS A;  3EU4 A;  2R0P A;  4K1F A;  3TJK A;  1J0F A;  1G7O A;  5A5K A;  1JZO A;  3RAZ A;  2YWN A;  3F8U A;  3VK9 A;  9GSS A;  1U3I A;  3F4S A;  4NHZ A;  2IN3 A;  2AYT A;  5G5F A;  1TRV A;  3DIE A;  3VWU A;  2H8L A;  2QKE A;  4EIQ A;  5ECS A;  1ZYQ B;  1TJD A;  3F4R A;  3FR9 A;  2VCX A;  1S3R A;  1W4V A;  2L6C A;  4ML1 A;  2FWG A;  2L4Q A;  1K0D A;  1NW2 A;  5H5Q A;  2B5Y A;  2LUS A;  1YJ6 A;  1A0R P;  1Z6M A;  4POK A;  1F9M A;  1ILO A;  2DJ2 A;  1AQW A;  4G0K A;  4O5Q A;  2IFQ A;  3L4N A;  1TU7 A;  3UMA A;  1TP9 A;  4YAV A;  5DDL A;  3APS A;  3ERF A;  1NSW A;  3HVS A;  4MH3 A;  1O85 A;  2L5L A;  3LYP A;  1PN0 A;  1SK1 A;  1HNB A;  2ON7 A;  1OVN A;  3CRU A;  1XOA A;  4V2M A;  3TJF A;  5B8B A;  4EF0 A;  5DQS A;  4AGS A;  3QOU A;  5D8I A;  2VLV A;  17GS A;  3A2X A;  4LL1 B;  3GX8 A;  2CAQ A;  3GKK A;  2IIY A;  1N8J A;  3BBY A;  4EE0 A;  1AQX A;  2GSQ A;  5AIS A;  2RM5 A;  4PGT A;  5F05 A;  2MMN A;  2VL2 C;  2L57 A;  1AC1 A;  1XWG A;  2P5R A;  2VL9 A;  1XVW A;  3D6I A;  1RK4 A;  3F3Q A;  1SL2 B;  1U3A A;  5J5N A;  3MIX A;  2LV3 A;  1AIU A;  3IK9 A;  1EOG A;  1ZOF A;  4KF9 A;  4L5L A;  5JWO B;  4GTU A;  3IR4 A;  1Z5Y E;  2DJK A;  5DAK B;  3EVI A;  4EDY A;  2G2Q A;  5CAX A;  2QA2 A;  4MZC A;  1XVQ A;  3VI5 A;  2F8F A;  3FW2 A;  3SBC A;  4IHU A;  4D73 A;  1A0F A;  1UA5 A;  1VF2 A;  3KEB A;  4ML6 A;  14GS A;  3NIV A;  2YWO A;  4J2F A;  2JSZ A;  1GSF A;  2JZR A;  4IGJ A;  5KN3 A;  2R2J A;  1O8X A;  2DBC A;  3GKX A;  2H66 A;  2IPA A;  4KAE A;  3QR6 A;  1UC7 A;  2I1U A;  3DYR A;  1ON4 A;  4OFM A;  4OCE A;  3RPP A;  7GSS A;  5GAN D;  2YAN A;  1PRX A;  3LJR A;  4KSO A;  2R37 A;  2GS3 A;  3GRX A;  2DSA A;  4EXJ A;  1GL8 A;  2L59 A;  3E0U A;  2JAD A;  6GSW A;  1PFO A;  2WS2 A;  2FWH A;  2M80 A;  3M3M A;  5CYY A;  3UAR A;  5D73 A;  4LMV A;  2GLR A;  3SWL A;  2MMA A;  4Q5Q A;  4MJB A;  3F3R A;  4P3Y B;  3PGT A;  2LQO A;  2VCW A;  4ZB9 A;  4O5U A;  4DEJ A;  3BCI A;  3IV4 A;  3C71 A;  2A2S A;  1O81 A;  3G7Y A;  1F37 A;  1GSU A;  1A8L A;  1DE1 A;  3ZIV A;  4HUA A;  1WPI A;  3EWL A;  2CX3 A;  1PGT A;  2K8S A;  2MMZ A;  2H30 A;  1XPV A;  5INY A;  4NWY A;  3ZLP A;  1G0T A;  4AJ7 A;  1YKC A;  5J41 A;  3DWV A;  4BWQ A;  3RDW A;  2OE3 A;  3FRC A;  2GQL A;  2YJH A;  4GLT A;  2YV7 A;  5FT3 A;  2OAD A;  5A4V A;  4V1A p;  1JLV A;  2H0I A;  4WF5 A;  3HD5 A;  1IYH A;  1U6T A;  5A4W A;  1TXX A;  4KGI A;  5CRD A;  5CRG A;  3IDV A;  4NMU A;  1K3Y A;  3KTB A;  1SU9 A;  3AY8 A;  3VPQ A;  4F0C A;  16GS A;  4HU9 A;  2J23 A;  5CP1 A;  4N10 A;  2IFQ B;  4LL4 B;  2IMK A;  2VO4 A;  4MAB A;  4TXV A;  2OA7 A;  1EOH A;  3F0I A;  2V2G A;  1R5A A;  1DE2 A;  2FA8 A;  2PU9 C;  1X5D A;  5G1L A;  4WBR D;  2AV4 A;  1OE7 A;  1O7U A;  2M72 A;  5JCW A;  1URM A;  1ZMA A;  4KB3 A;  2V32 A;  1QK8 A;  2C0E A;  2GSR A;  2GZZ A;  2K8V A;  1UN2 A;  2O85 A;  1T4Z A;  3GV1 A;  5DQY A;  3C7M A;  3DML A;  4TR4 A;  1PKW A;  4X43 A;  3CTG A;  3TRP A;  5IIZ A;  3L78 A;  1GLP A;  2KOK A;  5LD0 A;  1O8W A;  1Z9H A;  4G2E A;  4CY8 A;  22GS A;  3W6G A;  5IMC A;  4HZ2 A;  4JU5 A;  20GS A;  3W8S A;  2DJ3 A;  2A2R A;  4WKW A;  3UBK A;  3GHA A;  1V40 A;  3M9K A;  2GST A;  4YAP A;  2QSI A;  3GTU A;  4K7O A;  3W8J A;  2WB9 A;  1CQG A;  1T4Y A;  2EIR A;  5F8B A;  1SJ6 A;  2YWI A;  2HRA A;  1B8X A;  4GSN A;  1SL1 B;  2M46 A;  2AAW A;  1I9D A;  4O32 A;  2C0D A;  2I81 A;  5IPG A;  2F3M A;  1EP7 A;  4IP1 A;  2P5Q A;  2DJ1 A;  4ECB A;  2B5X A;  3GUR A;  4KDY A;  1XWC A;  1MEK A;  1GP1 A;  2QGV A;  4POB A;  3DEX A;  4HSC X;  3VWX A;  4J57 E;  3ZRD A;  4D73 B;  4HEA 2;  1M0U A;  3QAV A;  2LJA A;  2YJ7 A;  4MMM A;  4WET A;  1SD8 A;  2MBT A;  2NDO A;  4TXO A;  3RBT A;  2JL4 A;  1XBS A;  5DAL A;  5E4W A;  3QFA C;  1UVZ A;  3O76 A;  1WWJ A;  1V98 A;  3FMW A;  3H79 A;  4X0X A;  2C4J A;  2TIR A;  3IA1 A;  2FA4 A;  2D2Z A;  3GL3 A;  1ML6 A;  5KOX A;  1YQ1 A;  3LOR A;  3TCO A;  4EVM A;  4K6X A;  4KUN A;  4ZB6 A;  1A8Y A;  2WGR A;  3UAP A;  3HA9 A;  3KGK A;  1EP8 A;  1K0A A;  3L9S A;  3KH9 A;  4GQF A;  4HDE A;  1KTE A;  3DKS A;  13GS A;  5ECH B;  2X4A A;  2MMO A;  5C04 A;  3C73 A;  4N0Z A;  3M0F A;  2B5E A;  2L5O A;  4PX1 A;  3L9V A;  1ZYP A;  5HFG A;  2C3Q A;  4Z7X A;  2H1G A;  1MD4 A;  4IN0 A;  3D4M A;  3GNJ A;  3FZ4 A;  1NHY A;  4PNF A;  4K0G A;  2H72 A;  4GRF A;  1YF0 A;  1EGR A;  2VAF A;  4KND A;  3CBU A;  3LWA A;  3GH6 A;  3IOS A;  4FYC A;  6GSS A;  3GL5 A;  4IKH A;  2DIZ A;  2V6O A;  5BRT A;  3BJ5 A;  2GSS A;  3EPT A;  3GUS A;  4BWS A;  1M3J A;  4V2L A;  2VCT A;  5IMZ A;  1Q98 A;  1DBY A;  4WXT A;  3J7Y b;  5AGY A;  4A5P A;  1E6B A;  3D22 A;  5JCU A;  2HZE B;  3RPN A;  4JR4 A;  3ERW A;  5B6N A;  2H19 A;  3KTL A;  3QAG A;  4NHW A;  4DVC A;  3F6D A;  2VM1 A;  2YP6 A;  2QA1 A;  5KOW A;  5DCH A;  2N5A A;  2YN1 A;  1XXU A;  4IJ3 A;  1T8E B;  2PER A;  5LNK e;  4ACS A;  1K0C A;  4MF6 A;  4HQZ A;  2C1Y A;  3D4T A;  1GUL A;  2VCV A;  4DSR A;  5IMA A;  4PTS A;  5J9B A;  2EIQ A;  5IO2 A;  1SK2 A;  1TK8 B;  2E0Q A;  2DKH A;  3TKR A;  3L9U A;  8GSS A;  3EIN A;  3EMX A;  2F9S A;  1FG4 A;  4I6X A;  5H5S A;  5HFI A;  2YNX A;  3ZRE A;  5CO3 A;  2HRF A;  4K7I A;  4RUV A;  4HJM A;  3LG6 A;  1EGO A;  2VLT A;  2FGX A;  3CTF A;  3Q6O A;  4I2T A;  3KP8 A;  1V57 A;  1QXH A;  3GTU B;  2VL2 A;  3KM6 A;  2X8G A;  4MJA A;  1Z7P A;  4BL7 B;  1PSQ A;  4IQ1 A;  3KZQ A;  2AHE A;  3GKN A;  4KDX A;  3E3E A;  3DD3 A;  2XHF A;  1BED A;  2I4A A;  5ECI B;  1YF1 A;  3IAM 2;  4OFN A;  1K3O A;  5EPF A;  1TI1 A;  3HZ8 A;  5D96 A;  2L6D A;  2C3T A;  5ECQ B;  4POL A;  2IJY A;  5IPH A;  3HJP A;  3BD2 A;  4MCU A;  1GSD A;  1MD3 A;  2XBI A;  1E2Y A;  2NPB A;  5IMF A;  3KD0 A;  2VLU A;  2PN8 A;  4ZIJ A;  3DXB A;  4TXO B;  2AB6 A;  4FYB A;  1TOF A;  4MJC A;  4PUR A;  3V1W A;  3VWW A;  3CMI A;  5DAL B;  3LQ7 A;  1XW9 A;  4XTS A;  2KHP A;  2VIM A;  1PQN A;  5DJM A;  4PQI A;  4KDU A;  1ZYN A;  1X9M B;  4MH2 A;  4K5S A;  4XS4 B;  3KMO A;  2WJU A;  2PWJ A;  1PX7 A;  2HI7 A;  3IAS 2;  1SYR A;  5CRE A;  3LW9 A;  4PXO A;  2CT6 A;  1HQO A;  3FZ9 A;  5J3R A;  1XW5 A;  2H1B A;  1W89 A;  1RW1 A;  1O6J A;  2K6V A;  1PKZ A;  2F8A A;  1J08 A;  5HQP A;  10GS A;  3FR6 A;  3HVN A;  4OMV A;  4GCI A;  1XIY A;  3CSH A;  2LNT A;  5JWR B;  3VI7 A;  5J9C A;  3ZVJ D;  3KIJ A;  2RUF A;  2HNL A;  4KCE A;  3EUR A;  2LEG A;  1SEN A;  1THO A;  5KEJ A;  3JCM L;  1YEP A;  3D5J A;  3IHG A;  4YQM A;  1GUH A;  5D93 A;  4DSQ A;  5DCG A;  5F07 A;  3QAW A;  3K8N A;  4XS1 A;  5HR1 A;  2C80 A;  1JFU A;  3F9U A;  1XWK A;  4CHS A;  3WT2 A;  1M9A A;  2KP1 A;  4X4J A;  4RI7 A;  4EKZ A;  4ZIL A;  2B7K A;  2LS5 A;  2VOC A;  1XG8 A;  2GZP A;  2OBI A;  3GH9 A;  3LEF A;  3LXZ A;  1TU8 A;  3H4K A;  3NZN A;  3QFB C;  4L5O A;  2HRK A;  4MA9 A;  2ON5 A;  1OC9 B;  1Z6N A;  2ZNM A;  1TRU A;  1PX6 A;  5F06 A;  2H01 A;  4IS0 A;  1JHB A;  4KE3 A;  2H6X A;  3FKF A;  4MNN A;  3ZML A;  5ENU A;  1TK0 B;  4KCA A;  2NBS A;  3FR3 A;  4MP4 A;  1N2A A;  3C1S A;  1EEJ A;  4KSM A;  3I43 A;  2A4H A;  3F6F A;  3NOF A;  5JWQ B;  2GQK A;  4MF5 A;  1T3B A;  1GTU A;  4ZB8 A;  5JCG A;  3RHC A;  2C3N A;  2H0H A;  4WEY A;  2H74 A;  2HYX A;  3IBH A;  4ECJ A;  2GQM A;  3FZ5 A;  2E2G A;  2O8V B;  2CV4 A;  18GS A;  1OKD A;  2R4V A;  4IP6 A;  3TKS A;  1HYU A;  3P8W A;  4YH2 A;  4K5R A;  4FIW A;  2MZC A;  1GUK A;  4MJE A;  1VRS D;  4L8E A;  2PVO C;  1VF4 A;  2F51 A;  4ZBB A;  5G5E A;  2IMD A;  2X49 A;  2H76 A;  5ELA A;  1LU4 A;  2RLI A;  2H6Y A;  2L4C A;  4NPB A;  4F82 A;  4IJI A;  5D9T A;  2HZE A;  2R5G A;  4FYU A;  1VGL A;  3I9V 2;  4KX4 A;  2KUC A;  3KH7 A;  3HVX A;  1OAZ A;  3BOA A;  2PPT A;  2V6K A;  4OD7 A;  1F3B A;  2CZ2 A;  4CW9 A;  1X9W B;  1GSQ A;  4WF4 A;  1JLW A;  19GS A;  5D9W A;  2IME A;  3VFI A;  1VF1 A;  2GT6 A;  3EMP A;  2K9F A;  3UVH A;  2Z9S A;  1M2B A;  1F3A A;  1OKT A;  4E8H A;  3WYW A;  1S3C A;  1LBK A;  1AAZ A;  2LRC A;  4NV5 A;  1X5E A;  1ERT A;  2B3S A;  1HNA A;  1EV9 A;  3F4T A;  2HSH A;  4JBB A;  3KJY A;  5F0G A;  3WGD A;  1S3D A;  2PBJ A;  3TKS E;  4MZB A;  4ZBA A;  2JU5 A;  2LKU A;  3IRA A;  1CQH A;  5G31 A;  2B1K A;  3A5I A;  1JZD A;  1WE0 A;  1S3A A;  4BL7 A;  3M8N A;  3MDK A;  3GST A;  5D9V A;  2H75 A;  2OE1 A;  4TR3 A;  4ZL9 A;  1ZCP A;  3LYK A;  2ZCT A;  3FK8 A;  3HHV A;  2VCQ A;  4GXZ A;  2WCI A;  1XOB A;  3WGE A;  3ERG A;  3APQ A;  4I8B A;  2ZUP A;  1A2L A;  2GDR A;  5KN1 A;  2FHE A;  3IC4 A;  3HKR A;  1GNW A;  5DVB A;  2O7K A;  1FOV A;  2A2P A;  1OYJ A;  4G0L A;  3CQF A;  4I97 A;  3R2Q A;  2E2M A;  3HVV A;  2V41 A;  2WRT A;  2BMX A;  3HZ4 A;  4Z2T A;  3APO A;  2O89 A;  5E59 A;  5KN0 A;  1SJZ A;  1G7E A;  2WFC A;  2IMI A;  3PH9 A;  1SL0 B;  3N5O A;  5DJL A;  1ZYE A;  2H0G A;  1V58 A;  4MLY A;  5G30 A;  2R6K A;  3WD6 A;  2PMT A;  3EE2 A;  2DJ0 A;  4XS4 A;  3J7Y k;  3GIX A;  4GSS A;  2HFD A;  3E9J B;  1Z3E A;  1MDK A;  5IM9 A;  4GF0 A;  1TKD B;  1ERU A;  2OE0 A;  1FOH A;  1TDI A;  2JSY A;  2CAI A;  1KNG A;  1F2E A;  3DGQ A;  5B7C A;  4HZ4 A;  2R3X A;  4TN8 A;  1FVK A;  1ZGN A;  4Q5F A;  5DBQ A;  3ZL5 A;  1WIK A;  5ECL B;  3VLN A;  1B9X C;  2LJR A;  3EC3 A;  1K3L A;  1K0N A;  4KW6 A;  3GX0 A;  2DKI A;  1FB0 A;  5A4U A;  2H71 A;  3WT1 A;  3FY7 A;  4PNG A;  5B6M A;  1HD2 A;  1X0R A;  4L0W A;  1XWA A;  4TRX A;  3BCK A;  4G19 A;  5EY6 A;  1GSY A;  2DLX A;  4OCF A;  1QGV A;  5CRH A;  4PQ1 A;  2GT5 A;  4K8M A;  3DVX A;  1R5P A;  3F63 A;  3HXS A;  5EVO A;  2NVL A;  1F6M C;  3U5R E;  2R0C A;  3HCZ A;  1OC9 A;  2X64 A;  3D0Z A;  1M2A A;  2YWM A;  4LMW A;  1PL1 A;  1QFN A;  1AQV A;  3ZZX A;  3KP9 A;  4IEL A;  2DIY A;  4XIH A;  1ZZY A;  3PPU A;  4IBP A;  2CVB A;  4PUA A;  3CSJ A;  3MNG A;  1THX A;  2VL3 A;  2YCD A;  4Z2R A;  1WP0 A;  2LQQ A;  3TOT A;  1SK0 A;  2ALB A;  4TOP A;  4E8E A;  1X9S B;  1ERW A;  4HS1 A;  4JED A;  2VD0 A;  1ABA A;  3KXO A;  2P31 A;  3A3T A;  4KA0 A;  3TRQ A;  1V2A A;  1PL2 A;  3UIW A;  2YV9 A;  2LST A;  1GRX A;  3G9B A;  2QC7 A;  3GYK A;  1A2M A;  4G10 A;  2X99 A;  3G7J A;  5FHI A;  3GA4 A;  1V9W A;  4JR6 A;  3I69 A;  1GWC A;  2VM2 A;  5G1K A;  2H1D A;  2HLS A;  1YZX A;  1AUC A;  5COH A;  2K18 A;  3TB2 A;  1MTC A;  4IW9 A;  3U6V A;  2MYG A;  2OBK A;  2GVP A;  3HDC A;  3UOM A;  4G9H A;  5EL8 A;  1AW9 A;  3A5W A;  5AIX A;  4K2D A;  2YZH A;  1BX9 A;  3TKP A;  1BG5 A;  2HZF A;  4J56 E;  5H5R A;  4F0B A;  1Y25 A;  2FY6 A;  3QCP A;  2YZU A;  4BVY A;  2JAC A;  4Q5N A;  3LFL A;  1EEM A;  1TI3 A;  3ZTL A;  3S9F A;  1C72 A;  2AJQ B;  4CY6 A;  4MK3 A;  3DVW A;  2RUE A;  3FEU A;  3HJO A;  4BIK A;  2OJL A;  4MF7 A;  2P0G A;  3UBL A;  3M9J A;  2B7J A;  3D21 A;  3QD9 A;  4TR1 A;  5CNW A;  1IYI A;  3I6A A;  3DRN A;  12GS A;  2N5B A;  1EZK A;  2EC4 A;  1YDK A;  2G0F A;  2BJX A;  3WGX A;  1GTI A;  2HT9 A;  1XWB A;  2WZ9 A;  3VPT A;  5IO0 A;  1U88 A;  3UVT A;  11GS A;  5IQY A;  1T00 A;  4QL9 A;  3H93 A;  1K0B A;  1NHO A;  5GZZ B;  1YKA A;  3C8E A;  1X5C A;  4DSS A;  1TTZ A;  1RQM A;  4LLR A;  1J9B A;  4MDC A;  4WBJ A;  3KCM A;  1K0M A;  3GKM A;  2CZ3 A;  3QPM A;  4K2X A;  1FW1 A;  3IHQ A;  1TK5 B;  3UEM A;  2DC5 A;  2B1L A;  2OKA A;  1FVJ A;  3MWH A;  1O73 A;  2LNS A;  4O92 A;  1GSS A;  1PMT A;  4YKF A;  4EO3 A;  5ID2 A;  5B8A A;  2XPD A;  4ISD A;  3ZVJ A;  6GSY A;  4NV2 A;  3IC8 A;  5IMD A;  1XFL A;  1WMJ A;  2OAC A;  3HY2 A;  3P2A A;  4LA1 A;  3EYT A;  4MPF A;  4FH8 A;  5ELG A;  4AJ6 A;  1M3I A;  2FLS A;  2V1M A;  4BVX A;  1BQ7 A;  1A2J A;  5ECN B;  5IMV A;  3MSZ A;  2R0G A;  3GN3 A;  1MDJ A;  1R7H A;  2VCZ A;  3TJG A;  3QMX A;  1JZR A;  6GSV A;  1XW6 A;  4Z2U A;  4XRA A;  3R3E A;  1SKS B;  2GZY A;  1GH2 A;  1YEX A;  3TDG A;  2DMM A;  1GSE A;  2H70 A;  2IL3 A;  4HOJ A;  4RQR A;  2HRN A;  4OWY A;  2CX4 A;  4TVE A;  2GTU A;  5HR2 A;  1G6W A;  1T7P B;  4JZQ A;  2UZ8 A;  4K9Z A; 
#chains in the Genus database with same CATH homology
 3EU3 A;  1JZW A;  2JZT A;  1PA3 A;  1BAY A;  1B9Y C;  1PN9 A;  4MPG A;  5FWG A;  2FUG 2;  4BA7 A;  2LRT A;  2FWE A;  5GST A;  4F9Z A;  5ECK B;  2HSY A;  4USS A;  4YQU A;  1YY7 A;  4H86 A;  3FYG A;  5IOX A;  1SJI A;  5AIV A;  1QQ2 A;  1WOU A;  2CVD A;  3IK7 A;  4HU7 A;  4O5R A;  4PQH A;  2FWF A;  3HJM A;  1PD2 1;  4ICY A;  6GSX A;  3ME8 A;  1EV4 A;  1KBN A;  5BMU A;  2I9H A;  2GGT A;  2HSM A;  4XCS A;  3ZIT A;  1A23 A;  4NAX A;  3ISO A;  4CDO A;  3TUE A;  4Q5R A;  3FZA A;  4TKY A;  4JE1 A;  3GSS A;  3ZMK A;  2AUV A;  1TW9 A;  3Q18 A;  4WR4 A;  4BVY B;  3IXR A;  4K7N A;  3UJ1 A;  4ILF A;  3C1R A;  4JRR A;  2FD3 A;  1USB A;  4ECI A;  5ECO B;  1U87 A;  1M7T A;  4I2U A;  1QMV A;  4YQV A;  2XPE A;  1H75 A;  2PUK C;  2FNO A;  4KH7 A;  4HI7 A;  2VUP A;  1B48 A;  3KMN A;  2ES7 A;  5L71 A;  3QDN A;  3FHK A;  2E7P A;  3Q19 A;  1BJX A;  5ABR A;  4TR1 B;  4GST A;  4EL1 A;  1A24 A;  5HR3 A;  4PUF C;  4GQC A;  4HQS A;  5ECP B;  3TKS C;  2LTK A;  3ED3 A;  3CXG A;  2H1A A;  3M1G A;  4OO4 A;  3N9J A;  3GMF A;  3H8Q A;  5ECM B;  3PIN A;  4ZBD A;  4X1U A;  5LCZ A;  3H1N A;  3MAK A;  1GTA A;  1QUW A;  4F2I A;  2REM A;  4ZXG A;  3ZYW A;  2H6Z A;  2HE3 A;  1DSB A;  3Q74 A;  2J9H A;  4DSS B;  1M9B A;  1M2D A;  1OC8 A;  2N5F A;  4O7H A;  4BPY A;  3ZFB A;  4K0N A;  1B4Q A;  3LXT A;  1ACV A;  4QL7 A;  2I3Y A;  3CSI A;  2CA8 A;  3A2W A;  1K0O A;  2X8C A;  1H4O A;  1VF3 A;  5IOW A;  4TW5 A;  1WRY A;  4AF2 A;  4I5Q A;  4L0U A;  1T1V A;  1MDI A;  1GNE A;  1TRS A;  3TJB A;  4EDZ A;  2LRN A;  1KEB A;  2XBQ A;  3PR8 A;  5ID2 B;  2RM6 A;  3IE3 A;  4V2N A;  1FHE A;  3VUR A;  1GLQ A;  2C0F A;  4NXI A;  6GST A;  5J4U A;  1AXD A;  4RQX A;  2KLX A;  4OO5 A;  2C8U A;  2XC2 A;  3CRT A;  4BVX B;  3TJJ A;  4ID0 A;  1OC3 A;  4IQA A;  2EIO A;  5G2Z A;  1SYX A;  1WJK A;  2O87 A;  2DML A;  4EIP A;  1SD9 A;  2WUL A;  1GUM A;  4XHM A;  4WR5 A;  4N11 A;  6GSU A;  2B6M A;  5HFK A;  1HNC A;  4GWR A;  2MBS A;  4ZL8 A;  4POM A;  2LJK A;  4AJ8 A;  3MYD A;  3O3T A;  5DAK A;  3TKQ A;  1LJR A;  3UL3 A;  5AN1 A;  1I5G A;  2HXK A;  3ME7 A;  3US3 A;  4TR0 A;  2WDU A;  3VWV A;  4N30 A;  1Y6E A;  3ZFL A;  4EC0 A;  1ST9 A;  2A4V A;  2IMF A;  4RI6 A;  1ERV A;  2FCH A;  3TGZ A;  4ECC A;  4QQ7 A;  3LSZ A;  4V1A g;  4OFT A;  1NM3 A;  5GAP D;  3CYN A;  4N0V A;  4YKG A;  1Q4J A;  4XS6 A;  3P7X A;  1OE8 A;  1R4W A;  1DUG A;  2CVK A;  5ECR B;  5CRW A;  5KN2 A;  1XZO A;  3A2V A;  2TRX A;  3IPZ A;  1XCC A;  2YOI A;  2CQ9 A;  1FO5 A;  3GFK A;  1FB6 A;  3P90 A;  2DJJ A;  1R26 A;  3ZIJ A;  3LGC A;  2PGT A;  1FAA A;  2JZS A;  4ZL7 A;  4IVF A;  4EUY A;  1TRW A;  4XRD A;  2RII A;  2X8H A;  3RHB A;  3OR5 A;  2H73 A;  1M99 A;  4FQU A;  5D9X A;  2VD1 A;  1SKW B;  3TOU A;  1BYE A;  4G0I A;  2TRC P;  2BTO T;  3O6T A;  3HYP A;  4MZW A;  2NTO A;  2PVQ A;  1GTB A;  1SKR B;  2IWT A;  3G7I A;  3L0H A;  3TRX A;  4FO5 A;  1B4P A;  2C0G A;  5HR0 A;  1EWX A;  1ZL9 A;  4ULX A;  1Z7R A;  5C00 A;  4HJ2 A;  2KP2 A;  4F03 A;  1G6Y A;  2YPM A;  5GSS A;  3EU4 A;  2R0P A;  4K1F A;  3TJK A;  1J0F A;  1G7O A;  5A5K A;  1JZO A;  3RAZ A;  2YWN A;  3F8U A;  3VK9 A;  9GSS A;  1U3I A;  3F4S A;  4NHZ A;  2IN3 A;  2AYT A;  5G5F A;  1TRV A;  3DIE A;  3VWU A;  2H8L A;  2QKE A;  4EIQ A;  5ECS A;  1ZYQ B;  1TJD A;  3F4R A;  3FR9 A;  2VCX A;  1W4V A;  2L6C A;  4ML1 A;  2FWG A;  2L4Q A;  1K0D A;  1NW2 A;  5H5Q A;  2B5Y A;  2LUS A;  1YJ6 A;  1A0R P;  1Z6M A;  4POK A;  1F9M A;  1ILO A;  2DJ2 A;  1AQW A;  4G0K A;  4O5Q A;  2IFQ A;  3L4N A;  1TU7 A;  3UMA A;  1TP9 A;  4YAV A;  5DDL A;  3APS A;  3ERF A;  1NSW A;  3HVS A;  4MH3 A;  1O85 A;  2L5L A;  3LYP A;  1PN0 A;  1SK1 A;  1HNB A;  2ON7 A;  1OVN A;  3CRU A;  1XOA A;  4V2M A;  3TJF A;  5B8B A;  4EF0 A;  5DQS A;  4AGS A;  3QOU A;  5D8I A;  2VLV A;  17GS A;  3A2X A;  4LL1 B;  3GX8 A;  2CAQ A;  3GKK A;  2IIY A;  1N8J A;  3BBY A;  4EE0 A;  1AQX A;  2GSQ A;  5AIS A;  2RM5 A;  4PGT A;  5F05 A;  2MMN A;  2VL2 C;  2L57 A;  1AC1 A;  1XWG A;  2P5R A;  2VL9 A;  1XVW A;  3D6I A;  1RK4 A;  3F3Q A;  1SL2 B;  1U3A A;  5J5N A;  3MIX A;  2LV3 A;  1AIU A;  3IK9 A;  1EOG A;  1ZOF A;  4KF9 A;  4L5L A;  5JWO B;  4GTU A;  3IR4 A;  1Z5Y E;  2DJK A;  5DAK B;  3EVI A;  4EDY A;  2G2Q A;  5CAX A;  2QA2 A;  4MZC A;  1XVQ A;  3VI5 A;  2F8F A;  3FW2 A;  3SBC A;  4IHU A;  4D73 A;  1A0F A;  1UA5 A;  1VF2 A;  3KEB A;  4ML6 A;  14GS A;  3NIV A;  2YWO A;  4J2F A;  2JSZ A;  1GSF A;  2JZR A;  4IGJ A;  5KN3 A;  2R2J A;  1O8X A;  2DBC A;  3GKX A;  2H66 A;  2IPA A;  4KAE A;  3QR6 A;  1UC7 A;  2I1U A;  3DYR A;  1ON4 A;  4OFM A;  4OCE A;  3RPP A;  7GSS A;  5GAN D;  2YAN A;  1PRX A;  3LJR A;  4KSO A;  2R37 A;  2GS3 A;  3GRX A;  2DSA A;  4EXJ A;  1GL8 A;  2L59 A;  3E0U A;  2JAD A;  6GSW A;  2WS2 A;  2FWH A;  2M80 A;  3M3M A;  5CYY A;  3UAR A;  5D73 A;  4LMV A;  2GLR A;  3SWL A;  2MMA A;  4Q5Q A;  4MJB A;  3F3R A;  4P3Y B;  3PGT A;  2LQO A;  2VCW A;  4ZB9 A;  4O5U A;  4DEJ A;  3BCI A;  3IV4 A;  3C71 A;  2A2S A;  1O81 A;  3G7Y A;  1F37 A;  1GSU A;  1A8L A;  1DE1 A;  3ZIV A;  4HUA A;  1WPI A;  3EWL A;  2CX3 A;  1PGT A;  2K8S A;  2MMZ A;  2H30 A;  1XPV A;  5INY A;  4NWY A;  3ZLP A;  1G0T A;  4AJ7 A;  1YKC A;  5J41 A;  3DWV A;  4BWQ A;  3RDW A;  2OE3 A;  3FRC A;  2GQL A;  2YJH A;  4GLT A;  2YV7 A;  5FT3 A;  2OAD A;  5A4V A;  4V1A p;  1JLV A;  2H0I A;  4WF5 A;  3HD5 A;  1IYH A;  1U6T A;  5A4W A;  1TXX A;  4KGI A;  5CRD A;  5CRG A;  3IDV A;  4NMU A;  1K3Y A;  3KTB A;  1SU9 A;  3AY8 A;  3VPQ A;  4F0C A;  16GS A;  4HU9 A;  2J23 A;  5CP1 A;  4N10 A;  2IFQ B;  4LL4 B;  2IMK A;  2VO4 A;  4MAB A;  4TXV A;  2OA7 A;  1EOH A;  3F0I A;  2V2G A;  1R5A A;  1DE2 A;  2FA8 A;  2PU9 C;  1X5D A;  5G1L A;  4WBR D;  2AV4 A;  1OE7 A;  1O7U A;  2M72 A;  5JCW A;  1URM A;  1ZMA A;  4KB3 A;  2V32 A;  1QK8 A;  2C0E A;  2GSR A;  2GZZ A;  2K8V A;  1UN2 A;  2O85 A;  1T4Z A;  3GV1 A;  5DQY A;  3C7M A;  3DML A;  4TR4 A;  1PKW A;  4X43 A;  3CTG A;  3TRP A;  5IIZ A;  3L78 A;  1GLP A;  2KOK A;  5LD0 A;  1O8W A;  1Z9H A;  4G2E A;  4CY8 A;  22GS A;  3W6G A;  5IMC A;  4HZ2 A;  4JU5 A;  20GS A;  3W8S A;  2DJ3 A;  2A2R A;  4WKW A;  3UBK A;  3GHA A;  1V40 A;  3M9K A;  2GST A;  4YAP A;  2QSI A;  3GTU A;  4K7O A;  3W8J A;  2WB9 A;  1CQG A;  1T4Y A;  2EIR A;  5F8B A;  1SJ6 A;  2YWI A;  2HRA A;  1B8X A;  4GSN A;  1SL1 B;  2M46 A;  2AAW A;  1I9D A;  4O32 A;  2C0D A;  2I81 A;  5IPG A;  2F3M A;  1EP7 A;  4IP1 A;  2P5Q A;  2DJ1 A;  4ECB A;  2B5X A;  3GUR A;  4KDY A;  1XWC A;  1MEK A;  1GP1 A;  2QGV A;  4POB A;  3DEX A;  3VWX A;  4J57 E;  3ZRD A;  4D73 B;  4HEA 2;  1M0U A;  3QAV A;  2LJA A;  2YJ7 A;  4MMM A;  4WET A;  1SD8 A;  2MBT A;  2NDO A;  4TXO A;  3RBT A;  2JL4 A;  1XBS A;  5DAL A;  5E4W A;  3QFA C;  1UVZ A;  3O76 A;  1WWJ A;  1V98 A;  3FMW A;  3H79 A;  4X0X A;  2C4J A;  2TIR A;  3IA1 A;  2FA4 A;  2D2Z A;  3GL3 A;  1ML6 A;  5KOX A;  1YQ1 A;  3LOR A;  3TCO A;  4EVM A;  4K6X A;  4KUN A;  4ZB6 A;  1A8Y A;  2WGR A;  3UAP A;  3HA9 A;  3KGK A;  1EP8 A;  1K0A A;  3L9S A;  3KH9 A;  4GQF A;  4HDE A;  1KTE A;  3DKS A;  13GS A;  5ECH B;  2X4A A;  2MMO A;  5C04 A;  3C73 A;  4N0Z A;  3M0F A;  2B5E A;  2L5O A;  4PX1 A;  3L9V A;  1ZYP A;  5HFG A;  2C3Q A;  4Z7X A;  2H1G A;  1MD4 A;  4IN0 A;  3D4M A;  3GNJ A;  3FZ4 A;  1NHY A;  4PNF A;  4K0G A;  2H72 A;  4GRF A;  1YF0 A;  1EGR A;  2VAF A;  4KND A;  3CBU A;  3LWA A;  3GH6 A;  3IOS A;  4FYC A;  6GSS A;  3GL5 A;  4IKH A;  2DIZ A;  2V6O A;  5BRT A;  3BJ5 A;  2GSS A;  3EPT A;  3GUS A;  4BWS A;  4V2L A;  2VCT A;  5IMZ A;  1Q98 A;  1DBY A;  4WXT A;  3J7Y b;  5AGY A;  4A5P A;  1E6B A;  3D22 A;  5JCU A;  2HZE B;  3RPN A;  4JR4 A;  3ERW A;  5B6N A;  2H19 A;  3KTL A;  3QAG A;  4NHW A;  4DVC A;  3F6D A;  2VM1 A;  2YP6 A;  2QA1 A;  5KOW A;  5DCH A;  2N5A A;  2YN1 A;  1XXU A;  4IJ3 A;  1T8E B;  2PER A;  5LNK e;  4ACS A;  1K0C A;  4MF6 A;  4HQZ A;  2C1Y A;  3D4T A;  1GUL A;  2VCV A;  4DSR A;  5IMA A;  4PTS A;  5J9B A;  2EIQ A;  5IO2 A;  1SK2 A;  1TK8 B;  2E0Q A;  2DKH A;  3TKR A;  3L9U A;  8GSS A;  3EIN A;  3EMX A;  2F9S A;  1FG4 A;  4I6X A;  5H5S A;  5HFI A;  2YNX A;  3ZRE A;  5CO3 A;  2HRF A;  4K7I A;  4RUV A;  4HJM A;  3LG6 A;  1EGO A;  2VLT A;  2FGX A;  3CTF A;  3Q6O A;  4I2T A;  3KP8 A;  1V57 A;  1QXH A;  3GTU B;  2VL2 A;  3KM6 A;  2X8G A;  4MJA A;  1Z7P A;  4BL7 B;  1PSQ A;  4IQ1 A;  3KZQ A;  2AHE A;  3GKN A;  4KDX A;  3E3E A;  3DD3 A;  2XHF A;  1BED A;  2I4A A;  5ECI B;  1YF1 A;  3IAM 2;  4OFN A;  1K3O A;  5EPF A;  1TI1 A;  3HZ8 A;  5D96 A;  2L6D A;  2C3T A;  5ECQ B;  4POL A;  2IJY A;  5IPH A;  3HJP A;  3BD2 A;  4MCU A;  1GSD A;  1MD3 A;  2XBI A;  1E2Y A;  2NPB A;  5IMF A;  3KD0 A;  2VLU A;  2PN8 A;  4ZIJ A;  3DXB A;  4TXO B;  2AB6 A;  4FYB A;  1TOF A;  4MJC A;  4PUR A;  3V1W A;  3VWW A;  3CMI A;  5DAL B;  3LQ7 A;  1XW9 A;  4XTS A;  2KHP A;  2VIM A;  1PQN A;  5DJM A;  4PQI A;  4KDU A;  1ZYN A;  1X9M B;  4MH2 A;  4K5S A;  4XS4 B;  3KMO A;  2WJU A;  2PWJ A;  1PX7 A;  2HI7 A;  3IAS 2;  1SYR A;  5CRE A;  3LW9 A;  4PXO A;  2CT6 A;  1HQO A;  3FZ9 A;  5J3R A;  1XW5 A;  2H1B A;  1W89 A;  1RW1 A;  1O6J A;  2K6V A;  1PKZ A;  2F8A A;  1J08 A;  5HQP A;  10GS A;  3FR6 A;  4OMV A;  4GCI A;  1XIY A;  3CSH A;  2LNT A;  5JWR B;  3VI7 A;  5J9C A;  3ZVJ D;  3KIJ A;  2RUF A;  2HNL A;  4KCE A;  3EUR A;  2LEG A;  1SEN A;  1THO A;  5KEJ A;  3JCM L;  1YEP A;  3D5J A;  3IHG A;  4YQM A;  1GUH A;  5D93 A;  4DSQ A;  5DCG A;  5F07 A;  3QAW A;  3K8N A;  4XS1 A;  5HR1 A;  2C80 A;  1JFU A;  3F9U A;  1XWK A;  4CHS A;  3WT2 A;  1M9A A;  2KP1 A;  4X4J A;  4RI7 A;  4EKZ A;  4ZIL A;  2B7K A;  2LS5 A;  2VOC A;  2GZP A;  2OBI A;  3GH9 A;  3LEF A;  3LXZ A;  1TU8 A;  3H4K A;  3NZN A;  3QFB C;  4L5O A;  2HRK A;  4MA9 A;  2ON5 A;  1OC9 B;  1Z6N A;  2ZNM A;  1TRU A;  1PX6 A;  5F06 A;  2H01 A;  4IS0 A;  1JHB A;  4KE3 A;  2H6X A;  3FKF A;  4MNN A;  3ZML A;  5ENU A;  1TK0 B;  4KCA A;  2NBS A;  3FR3 A;  4MP4 A;  1N2A A;  3C1S A;  1EEJ A;  4KSM A;  3I43 A;  2A4H A;  3F6F A;  3NOF A;  5JWQ B;  2GQK A;  4MF5 A;  1T3B A;  1GTU A;  4ZB8 A;  5JCG A;  3RHC A;  2C3N A;  2H0H A;  4WEY A;  2H74 A;  2HYX A;  3IBH A;  4ECJ A;  2GQM A;  3FZ5 A;  2E2G A;  2O8V B;  2CV4 A;  18GS A;  1OKD A;  2R4V A;  4IP6 A;  3TKS A;  1HYU A;  3P8W A;  4YH2 A;  4K5R A;  4FIW A;  2MZC A;  1GUK A;  4MJE A;  1VRS D;  4L8E A;  2PVO C;  1VF4 A;  2F51 A;  4ZBB A;  5G5E A;  2IMD A;  2X49 A;  2H76 A;  5ELA A;  1LU4 A;  2RLI A;  2H6Y A;  2L4C A;  4NPB A;  4F82 A;  4IJI A;  5D9T A;  2HZE A;  2R5G A;  4FYU A;  1VGL A;  3I9V 2;  4KX4 A;  2KUC A;  3KH7 A;  3HVX A;  1OAZ A;  3BOA A;  2PPT A;  2V6K A;  4OD7 A;  1F3B A;  2CZ2 A;  4CW9 A;  1X9W B;  1GSQ A;  4WF4 A;  1JLW A;  19GS A;  5D9W A;  2IME A;  3VFI A;  1VF1 A;  2GT6 A;  3EMP A;  2K9F A;  3UVH A;  2Z9S A;  1M2B A;  1F3A A;  1OKT A;  4E8H A;  3WYW A;  1S3C A;  1LBK A;  1AAZ A;  2LRC A;  4NV5 A;  1X5E A;  1ERT A;  2B3S A;  1HNA A;  1EV9 A;  3F4T A;  2HSH A;  4JBB A;  3KJY A;  5F0G A;  3WGD A;  1S3D A;  2PBJ A;  3TKS E;  4MZB A;  4ZBA A;  2JU5 A;  2LKU A;  3IRA A;  1CQH A;  5G31 A;  2B1K A;  3A5I A;  1JZD A;  1WE0 A;  1S3A A;  4BL7 A;  3M8N A;  3MDK A;  3GST A;  5D9V A;  2H75 A;  2OE1 A;  4TR3 A;  4ZL9 A;  1ZCP A;  3LYK A;  2ZCT A;  3FK8 A;  3HHV A;  2VCQ A;  4GXZ A;  2WCI A;  1XOB A;  3WGE A;  3ERG A;  3APQ A;  4I8B A;  2ZUP A;  1A2L A;  2GDR A;  5KN1 A;  2FHE A;  3IC4 A;  3HKR A;  1GNW A;  5DVB A;  2O7K A;  1FOV A;  2A2P A;  1OYJ A;  4G0L A;  4I97 A;  3R2Q A;  2E2M A;  3HVV A;  2V41 A;  2WRT A;  2BMX A;  3HZ4 A;  4Z2T A;  3APO A;  2O89 A;  5E59 A;  5KN0 A;  1SJZ A;  1G7E A;  2WFC A;  2IMI A;  3PH9 A;  1SL0 B;  3N5O A;  5DJL A;  1ZYE A;  2H0G A;  1V58 A;  4MLY A;  5G30 A;  2R6K A;  3WD6 A;  2PMT A;  3EE2 A;  2DJ0 A;  4XS4 A;  3J7Y k;  3GIX A;  4GSS A;  2HFD A;  3E9J B;  1Z3E A;  1MDK A;  5IM9 A;  4GF0 A;  1TKD B;  1ERU A;  2OE0 A;  1FOH A;  1TDI A;  2JSY A;  2CAI A;  1KNG A;  1F2E A;  3DGQ A;  5B7C A;  4HZ4 A;  2R3X A;  4TN8 A;  1FVK A;  1ZGN A;  4Q5F A;  5DBQ A;  3ZL5 A;  1WIK A;  5ECL B;  3VLN A;  1B9X C;  2LJR A;  3EC3 A;  1K3L A;  1K0N A;  4KW6 A;  3GX0 A;  2DKI A;  1FB0 A;  5A4U A;  2H71 A;  3WT1 A;  3FY7 A;  4PNG A;  5B6M A;  1HD2 A;  1X0R A;  4L0W A;  1XWA A;  4TRX A;  3BCK A;  4G19 A;  5EY6 A;  1GSY A;  2DLX A;  4OCF A;  1QGV A;  5CRH A;  4PQ1 A;  2GT5 A;  4K8M A;  3DVX A;  1R5P A;  3F63 A;  3HXS A;  5EVO A;  2NVL A;  1F6M C;  3U5R E;  2R0C A;  3HCZ A;  1OC9 A;  2X64 A;  3D0Z A;  1M2A A;  2YWM A;  4LMW A;  1PL1 A;  1QFN A;  1AQV A;  3ZZX A;  3KP9 A;  4IEL A;  2DIY A;  4XIH A;  1ZZY A;  3PPU A;  4IBP A;  2CVB A;  4PUA A;  3CSJ A;  3MNG A;  1THX A;  2VL3 A;  2YCD A;  4Z2R A;  1WP0 A;  2LQQ A;  3TOT A;  1SK0 A;  2ALB A;  4TOP A;  4E8E A;  1X9S B;  1ERW A;  4HS1 A;  4JED A;  2VD0 A;  1ABA A;  3KXO A;  2P31 A;  3A3T A;  4KA0 A;  3TRQ A;  1V2A A;  1PL2 A;  3UIW A;  2YV9 A;  2LST A;  1GRX A;  3G9B A;  2QC7 A;  3GYK A;  1A2M A;  4G10 A;  2X99 A;  3G7J A;  5FHI A;  3GA4 A;  1V9W A;  4JR6 A;  3I69 A;  1GWC A;  2VM2 A;  5G1K A;  2H1D A;  2HLS A;  1YZX A;  1AUC A;  5COH A;  2K18 A;  3TB2 A;  1MTC A;  4IW9 A;  3U6V A;  2MYG A;  2OBK A;  2GVP A;  3HDC A;  3UOM A;  4G9H A;  5EL8 A;  1AW9 A;  3A5W A;  5AIX A;  4K2D A;  2YZH A;  1BX9 A;  3TKP A;  1BG5 A;  2HZF A;  4J56 E;  5H5R A;  4F0B A;  1Y25 A;  2FY6 A;  3QCP A;  2YZU A;  4BVY A;  2JAC A;  4Q5N A;  3LFL A;  1EEM A;  1TI3 A;  3ZTL A;  3S9F A;  1C72 A;  2AJQ B;  4CY6 A;  4MK3 A;  3DVW A;  2RUE A;  3FEU A;  3HJO A;  2OJL A;  4MF7 A;  2P0G A;  3UBL A;  3M9J A;  2B7J A;  3D21 A;  3QD9 A;  4TR1 A;  5CNW A;  1IYI A;  3I6A A;  3DRN A;  12GS A;  2N5B A;  1EZK A;  2EC4 A;  1YDK A;  2G0F A;  2BJX A;  3WGX A;  1GTI A;  2HT9 A;  1XWB A;  2WZ9 A;  3VPT A;  5IO0 A;  1U88 A;  3UVT A;  11GS A;  5IQY A;  1T00 A;  4QL9 A;  3H93 A;  1K0B A;  1NHO A;  5GZZ B;  1YKA A;  3C8E A;  1X5C A;  4DSS A;  1TTZ A;  1RQM A;  4LLR A;  1J9B A;  4MDC A;  4WBJ A;  3KCM A;  1K0M A;  3GKM A;  2CZ3 A;  3QPM A;  4K2X A;  1FW1 A;  3IHQ A;  1TK5 B;  3UEM A;  2DC5 A;  2B1L A;  2OKA A;  1FVJ A;  3MWH A;  1O73 A;  2LNS A;  4O92 A;  1GSS A;  1PMT A;  4YKF A;  4EO3 A;  5ID2 A;  5B8A A;  2XPD A;  4ISD A;  3ZVJ A;  6GSY A;  4NV2 A;  3IC8 A;  5IMD A;  1XFL A;  1WMJ A;  2OAC A;  3HY2 A;  3P2A A;  4LA1 A;  3EYT A;  4MPF A;  4FH8 A;  5ELG A;  4AJ6 A;  2FLS A;  2V1M A;  4BVX A;  1BQ7 A;  1A2J A;  5ECN B;  5IMV A;  3MSZ A;  2R0G A;  3GN3 A;  1MDJ A;  1R7H A;  2VCZ A;  3TJG A;  3QMX A;  1JZR A;  6GSV A;  1XW6 A;  4Z2U A;  4XRA A;  3R3E A;  1SKS B;  2GZY A;  1GH2 A;  1YEX A;  3TDG A;  2DMM A;  1GSE A;  2H70 A;  2IL3 A;  4HOJ A;  4RQR A;  2HRN A;  4OWY A;  2CX4 A;  4TVE A;  2GTU A;  5HR2 A;  1G6W A;  1T7P B;  4JZQ A;  2UZ8 A;  4K9Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...