4HS1A

High-resolution crystal structure of glutaredoxin like protein nrdh from mycobacterium tuberculosis.
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
84
structure length
84
Chain Sequence
TVTVYTKPACVQCSATSKALDKQGIAYQKVDISLDSEARDYVMALGYLQAPVVVAGNDHWSGFRPDRIKALAGAALTAHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Glutaredoxin NrdH, putative
publication title The Crystal Structure of Mycobacterium tuberculosis NrdH at 0.87 A Suggests a Possible Mode of Its Activity.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 22
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2012-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00462 Glutaredoxin Glutaredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4hs1A00
4YQVA 2B7KA 3TJFA 2HRFA 2RM5A 5JWQB 3CXGA 3FYGA 3ME7A 4TR1A 4OCFA 2P5QA 3IC4A 4ISDA 3UVHA 5DQSA 2B5XA 2VD1A 1MDIA 2OACA 6GSXA 2FUG2 2R37A 5G30A 2L59A 5ECOB 3KTBA 17GSA 3HA9A 4X1UA 1B48A 2YV9A 1M2BA 4K6XA 4TR1B 2B1KA 3MSZA 1TI1A 5KEJA 1G7EA 2P0GA 1T1VA 5GSSA 2JL4A 1A0FA 4IJIA 4PQHA 4V2MA 4F9ZA 1OVNA 2A4VA 2LSTA 4I97A 5IQYA 3FK8A 1Q98A 5CREA 3D6IA 6GSUA 2H1DA 4OMVA 4IKHA 5GAND 5G31A 3TGZA 4I2UA 3ZREA 1TRUA 2NTOA 3ERWA 1K3OA 1K0BA 1FAAA 5DALA 3PR8A 1YJ6A 4MZBA 1R4WA 4MH3A 4PQ1A 4K7OA 4ZB8A 3CSHA 1O85A 5JWRB 4KSMA 4QL9A 3IE3A 1BAYA 3GX8A 3M8NA 2LQOA 1SJZA 4XIHA 1EEMA 3OR5A 3GN3A 3KMNA 4KA0A 2C0DA 1A2LA 1BX9A 1XWKA 1OKTA 5DALB 1WP0A 4J57E 2NBSA 2WULA 2YANA 4KNDA 4MLYA 2LRTA 2LNTA 1GSDA 1KEBA 3M9KA 3KP9A 4TW5A 3QOUA 4CHSA 4F0BA 1JFUA 1GWCA 1GSUA 4ECCA 3BOAA 1CQGA 3H93A 2MBSA 5D73A 1T4ZA 4XTSA 4TR0A 3U5RE 1O6JA 3F8UA 3RBTA 1OAZA 1FOVA 4K0NA 1QMVA 3KXOA 1GNWA 1AQWA 3L9SA 1U3IA 2CVBA 5KN2A 5IMZA 2PWJA 1OYJA 2PN8A 5IMDA 5IOXA 3TOUA 3IOSA 2EIQA 5ECSA 5A5KA 3G7JA 2YPMA 4BWQA 4NHZA 2YWNA 2NVLA 4KCEA 3D4MA 2L5LA 1R5PA 3D0ZA 1Y6EA 3V1WA 2IMDA 4JU5A 1DSBA 4RQRA 2AHEA 2CVKA 3KP8A 3ZFLA 7GSSA 2DJKA 1C72A 1R5AA 3TOTA 4L0UA 4MCUA 2O8VB 2GGTA 2AB6A 3NIVA 1YDKA 3UMAA 1GLQA 4ZILA 3TKRA 1YEXA 4TXOA 4GF0A 1M7TA 4EKZA 3FZ5A 4ZBDA 5COHA 5KN1A 3LJRA 2RUEA 3MWHA 1GUKA 3A2VA 1JLWA 3C8EA 2C0GA 4WETA 3BJ5A 4GSTA 3P90A 2I9HA 3F0IA 3HJOA 2LEGA 4OFTA 2ZCTA 4GRFA 4MMMA 1SL0B 3QD9A 3KGKA 3FEUA 4TXOB 1WJKA 1X9SB 4FH8A 3TUEA 1Z5YE 4PX1A 2YJ7A 3LGCA 2PU9C 5JCUA 3G7YA 1SKWB 1VGLA 3TB2A 5IO2A 1OC3A 5J5NA 3WYWA 3IXRA 2RUFA 3HZ4A 4F2IA 1KTEA 3CSJA 1TK8B 3IK7A 3H8QA 14GSA 2DIYA 4HI7A 1DE1A 2GZPA 4TR4A 2YWMA 2AJQB 1XZOA 3MDKA 5G5EA 4LLRA 4X43A 1T3BA 1QFNA 4G2EA 5G5FA 3Q6OA 3I6AA 4MABA 2H73A 4ILFA 2XBIA 2HI7A 1WPIA 2LJAA 9GSSA 4O32A 2YWOA 1X5DA 2B5YA 3G7IA 1ST9A 1MTCA 1EP7A 1X5CA 2CX3A 2LTKA 1T8EB 1S3DA 4L8EA 2NDOA 3CMIA 2A2RA 3I43A 2B6MA 3ZIJA 2A2SA 2M72A 3QFAC 2JZTA 2L5OA 3FZ4A 4N0ZA 3CTFA 3L9UA 2X8CA 1A2MA 3ZTLA 3BCKA 1OE8A 2WFCA 4G19A 3ZVJA 1Z3EA 1F37A 3TKSA 1SK2A 5J9CA 5ELAA 1ILOA 22GSA 3EMXA 1HD2A 2P5RA 4E8HA 1TTZA 2VL2A 5CO3A 2YWIA 1K0NA 3CBUA 2OE1A 2B3SA 3QAWA 2VAFA 2H0GA 5DJLA 5D9VA 1XVWA 4WR5A 3IRAA 3E3EA 4MPFA 1ML6A 2H6XA 5CYYA 1BEDA 2C0EA 3FW2A 3QAVA 1CQHA 1G0TA 2B5EA 5HQPA 4RQXA 1PSQA 2L4QA 3GHAA 5GZZB 1M9AA 1EP8A 2KOKA 2OE0A 5DJMA 1GUMA 3ZZXA 3M1GA 3VURA 2IWTA 2DJ2A 3EU3A 4ULXA 4JBBA 4F0CA 4V1Ag 3TRQA 2WJUA 3DKSA 2EC4A 1QK8A 2DSAA 3GFKA 1EZKA 2B1LA 2X64A 2IFQA 1RQMA 2YNXA 4WXTA 4V2LA 2VLVA 3VWWA 4YQMA 2R6KA 3GSTA 6GSVA 2F3MA 4EDYA 1GSYA 4PURA 3F3QA 1B9XC 1TK0B 3TJJA 2HE3A 1IYIA 3LFLA 1GSFA 4HS1A 2CX4A 4EL1A 3RPNA 5JCWA 3C1RA 3HVVA 2ALBA 1ON4A 1I5GA 2AV4A 2IFQB 3IAM2 1GTAA 1WWJA 1PX6A 5H5RA 3FR3A 2HT9A 1OC9A 3FZAA 2OBIA 5DAKB 2F9SA 3LYKA 1XFLA 2JZRA 2PPTA 3WT1A 4OFNA 1M99A 2H72A 1ZCPA 2BJXA 1Q4JA 4ML1A 4K1FA 1FHEA 20GSA 2FA4A 2K6VA 2LRNA 2H0IA 2HSHA 4I8BA 1UN2A 2H75A 2VM2A 2C1YA 2IJYA 4FO5A 2I3YA 3APOA 1UC7A 2FCHA 5D93A 3GL3A 3HKRA 3J7Yb 5EVOA 3D22A 4ACSA 4FYBA 3HXSA 3UL3A 1F3BA 4G9HA 1VRSD 1J0FA 2XC2A 4KH7A 3GSSA 1XVQA 6GSYA 3ZL5A 1AUCA 2FWHA 3SWLA 2CVDA 2QC7A 3AY8A 4DEJA 1PD21 1XXUA 1S3CA 3VPTA 3Q19A 5B8BA 2R4VA 2F8FA 5E4WA 1YY7A 3GNJA 3IA1A 2JADA 2RIIA 4WBRD 3RPPA 1QUWA 1SK0A 1LU4A 1M0UA 2VD0A 3HY2A 1ZYQB 4I2TA 4K8MA 1MDKA 3FKFA 4EVMA 4XS1A 2MMOA 3LORA 18GSA 4NV5A 3EU4A 5ID2A 1XWGA 1KNGA 2FA8A 1SK1A 2DJ3A 1USBA 2H71A 4ECJA 1K0OA 4HUAA 1X0RA 2CAQA 4CDOA 5J41A 2HFDA 4NV2A 1ZMAA 4YAPA 1FB6A 1PX7A 3F3RA 2H1BA 5L71A 4EC0A 3KH7A 3LEFA 2GSSA 2MMZA 2TRXA 4DSQA 1F3AA 3DWVA 2IN3A 2BTOT 4KE3A 4GQFA 1BJXA 3GUSA 5LCZA 1QQ2A 2H8LA 5F8BA 3M0FA 1V2AA 2AYTA 1X9WB 3I9V2 2FLSA 4PUAA 2LNSA 4HDEA 2G2QA 5IMCA 3M3MA 2YCDA 3IDVA 1SJ6A 3VWVA 1AQVA 1Y25A 1FO5A 2QKEA 1U87A 4NXIA 1VF4A 3N9JA 1TK5B 4GWRA 3E9JB 2E2GA 2OKAA 2XBQA 4PNFA 1XPVA 4PUFC 2XHFA 4MJAA 4OD7A 1MD3A 2FD3A 1XOAA 3HZ8A 3WD6A 5CP1A 1HQOA 5HR3A 4BVYA 2V41A 4V2NA 1ZZYA 2GT6A 3ISOA 3ZMLA 2H1GA 2H76A 1K0CA 3FR9A 5KN3A 4TVEA 2M80A 2PBJA 4OO4A 2L6DA 3US3A 1OE7A 3N5OA 1TW9A 2N5BA 2WGRA 1XW5A 1THXA 3EYTA 1O8XA 2QGVA 1TXXA 2F8AA 3APSA 2MMNA 2YN1A 5AN1A 4F03A 3TJBA 5H5SA 1M2DA 13GSA 5DBQA 2CA8A 3GKXA 4WKWA 1VF2A 5ECRB 2XPDA 5A4VA 1O81A 3UVTA 2DJ1A 4N0VA 2D2ZA 2X8HA 5D96A 2R3XA 2XPEA 1YF0A 1JZWA 1JZRA 2L6CA 3FZ9A 4MZCA 2VL3A 4NAXA 1U88A 1GTIA 4AGSA 3PH9A 6GSWA 4Q5FA 3C71A 4JR6A 5ENUA 3F9UA 3UAPA 2JSZA 4MH2A 4O7HA 1EOGA 5CAXA 2K9FA 3CRTA 2DIZA 19GSA 2GSRA 3TDGA 4K0GA 3NOFA 3FRCA 4MZWA 4N30A 1G6YA 8GSSA 1EGRA 2GT5A 4EDZA 1GLPA 3DVXA 4MF5A 1J9BA 1F6MC 2RM6A 1VF3A 2X8GA 2PMTA 2H66A 3L9VA 1LBKA 2K18A 1V57A 3KMOA 2YV7A 4BPYA 2PERA 2FWEA 3EWLA 3QAGA 2VCTA 4IBPA 3IAS2 2H70A 4POKA 3HYPA 1WE0A 3ZMKA 1PKWA 2WRTA 5CRWA 2KP2A 2JACA 2C4JA 2L57A 4JR4A 3ZVJD 1AIUA 4MF7A 1GTBA 5IIZA 3HHVA 1SKSB 2IMEA 5CRHA 1WIKA 1A8YA 2C80A 5ECHB 3VLNA 3A5WA 1SJIA 4H86A 4K7IA 3R2QA 2WS2A 2DC5A 1JHBA 1I9DA 3WT2A 3EINA 4POLA 2VCXA 3UOMA 3O6TA 4KUNA 4K2DA 5INYA 1YQ1A 1O8WA 1U3AA 3RHCA 2OADA 2GQKA 3VFIA 1FB0A 1WRYA 2FGXA 2VCVA 4XS6A 5AIXA 3BBYA 4ECBA 4TRXA 3IV4A 2YP6A 3QMXA 4KSOA 2HSYA 2VLUA 3QR6A 4LMVA 1K0DA 5HR2A 3UBKA 3DXBA 4G10A 2HXKA 5DCGA 4LL4B 4EXJA 3F6FA 1PKZA 4N10A 1GSQA 3HJPA 2GZZA 2FHEA 5GAPD 2TRCP 5LD0A 3ZITA 3VPQA 2ON7A 3MNGA 1XCCA 3ED3A 1H75A 3D5JA 5J9BA 11GSA 4ZL7A 1Z6MA 3HDCA 1GP1A 1TRVA 1HNCA 2E2MA 5HR1A 2N5AA 2V1MA 1GH2A 2ES7A 3Q74A 3A3TA 1BYEA 1PL1A 5DVBA 5C00A 2PVOC 4IQ1A 2FNOA 4O5RA 2H6ZA 2O89A 4BVXA 2V6KA 1M2AA 4Q5QA 5IMAA 3LWAA 5D8IA 1A0RP 1B4PA 1J08A 1NHOA 1OKDA 3TKPA 2GVPA 3IPZA 2Z9SA 2H6YA 1SENA 3IBHA 4HOJA 4IW9A 4WEYA 1JZDA 1GTUA 3P2AA 4KW6A 1E6BA 1V98A 1EV4A 3A2WA 1BQ7A 1TJDA 2I4AA 5D9TA 3LSZA 2O85A 1XW6A 2HZFA 3CRUA 2EIRA 3TKSE 5JCGA 5ECNB 1VF1A 5B6MA 1E2YA 1URMA 2CQ9A 1PQNA 1XWCA 4FIWA 2DLXA 2VUPA 1SD9A 3DIEA 3CYNA 1GL8A 4ML6A 3UIWA 1QGVA 2R2JA 2V32A 1OC9B 1PN9A 1YKAA 5LNKe 1AW9A 1T4YA 3UBLA 4MDCA 1A8LA 4IJ3A 1AAZA 5EL8A 3P8WA 4TKYA 2LQQA 4D73A 1NHYA 2KUCA 2TIRA 3KIJA 4I6XA 3UEMA 3LXZA 3K8NA 1A23A 3ZIVA 4IP1A 3TKSC 2VCWA 1TU7A 3GL5A 2JZSA 4KCAA 10GSA 2ZUPA 3KJYA 2YOIA 3QFBC 2WZ9A 1WMJA 2VL2C 4D73B 1K3YA 2EIOA 3CTGA 1THOA 2PGTA 1SYRA 4PGTA 3UARA 4K7NA 2DJJA 5AISA 1S3AA 4IHUA 1TU8A 2MMAA 2JSYA 1GSEA 3D21A 3U6VA 1TP9A 1ABAA 3LQ7A 1PL2A 3ZRDA 3TJKA 3QDNA 4JE1A 2B7JA 4HZ2A 3VK9A 4RI6A 2HRNA 4MJCA 3UJ1A 1TRWA 3H79A 1R7HA 1PGTA 1B4QA 3VI7A 1XWBA 3VWXA 4GXZA 2HZEA 1DBYA 4P3YB 1BG5A 1N2AA 2F51A 4POBA 5B8AA 3VWUA 1GSSA 3DGQA 5ID2B 1V40A 1GRXA 5AIVA 2VM1A 2KLXA 1X9MB 2ON5A 2OJLA 2IMFA 1OC8A 2HZEB 1V9WA 2GSQA 4OCEA 6GSSA 3EC3A 4NWYA 3RHBA 4F82A 5A4WA 2C3NA 3G9BA 4HU7A 1W89A 5KN0A 1XBSA 3HVXA 3FY7A 3WGDA 4EO3A 4TN8A 1NM3A 4XHMA 3GX0A 4MJEA 1LJRA 2FWFA 4E8EA 2O87A 1A24A 3KTLA 4IS0A 5B6NA 3QPMA 2VCZA 1RW1A 4Z7XA 4LMWA 3GV1A 3C1SA 3GYKA 3DMLA 1X5EA 5E59A 5F06A 1O73A 2K8SA 2BMXA 2VO4A 1ERUA 1Z7PA 4KGIA 2KHPA 3EVIA 4RUVA 5CRGA 3EMPA 4KDYA 5F05A 2J9HA 4POMA 1Z6NA 4EUYA 4HQSA 1SYXA 2DMLA 3PINA 5HFGA 2IL3A 2I81A 5ECPB 2C3QA 1N8JA 5IM9A 1PMTA 2GLRA 1U6TA 3BCIA 2VL9A 3IHQA 3F4SA 4GQCA 3TCOA 5IPHA 4QL7A 4DSSA 1XIYA 1YZXA 3W8JA 1F2EA 4L5OA 1XOBA 4CW9A 3F63A 5F07A 3KCMA 1GNEA 2E0QA 3I69A 4YAVA 1EV9A 1ERVA 2WCIA 2DMMA 5G2ZA 4GSSA 3ZLPA 4XS4A 4AJ8A 2HLSA 4GCIA 4DSSB 1ERWA 3DD3A 4LA1A 2MZCA 4FYUA 3H4KA 4BL7A 1DE2A 2LV3A 1EOHA 2VCQA 5C04A 1EEJA 3FR6A 4XCSA 5ECMB 1Z9HA 4KB3A 4EF0A 2OE3A 4XS4B 1GULA 1AXDA 3L4NA 1TKDB 3O3TA 3GKKA 1K3LA 3O76A 4KAEA 1WOUA 4YQUA 2P31A 1W4VA 1HYUA 2LJRA 1ZL9A 3ZFBA 1EWXA 2J23A 3F6DA 1F9MA 3KZQA 4TOPA 5ECQB 4N11A 4ZIJA 4MF6A 5CRDA 5FT3A 4HJMA 2IMIA 1T7PB 4PXOA 3GTUA 4ZBBA 3GKMA 5IMVA 1G7OA 2HNLA 3EE2A 2REMA 1ERTA 1ACVA 4OWYA 1FVKA 2C0FA 4BA7A 1G6WA 1Z7RA 3HCZA 3F4RA 3GTUB 4ZL8A 5G1LA 4MP4A 4OO5A 1B8XA 2PUKC 4IELA 3VI5A 4JRRA 1HNBA 3A2XA 1SL1B 5AGYA 2C3TA 2JU5A 2GQMA 3C7MA 5ELGA 4I5QA 1SKRB 5J4UA 1R26A 2DBCA 2I1UA 3GH6A 4AJ7A 4J2FA 1TDIA 4L0WA 1NSWA 1MEKA 1FG4A 2LUSA 3TJGA 5DDLA 4J56E 3DEXA 4AF2A 1FVJA 1JZOA 2RLIA 4EE0A 4KX4A 2CAIA 3Q18A 3DYRA 4TR3A 1TRSA 4GSNA 4PNGA 1H4OA 3WGXA 1HNAA 3HD5A 1RK4A 3S9FA 3GMFA 4V1Ap 2CT6A 1UVZA 5HR0A 2H19A 1MDJA 2H01A 3W6GA 1XWAA 2VLTA 2H30A 2V6OA 1MD4A 2AAWA 5FWGA 2GS3A 4YH2A 2IMKA 5FHIA 3GIXA 5ECIB 3FHKA 5DQYA 3W8SA 4LL1B 1SD8A 1IYHA 4IN0A 3HJMA 3RDWA 3EURA 2YJHA 4HJ2A 4ZXGA 3M9JA 2LS5A 1UA5A 1SU9A 4MPGA 2WDUA 1O7UA 1PRXA 3KM6A 4WBJA 2OBKA 5IPGA 3L78A 1PA3A 1ZGNA 4NMUA 1AC1A 2CV4A 5CNWA 3HVSA 4O92A 2L4CA 2V2GA 1YKCA 5A4UA 3WGEA 2AUVA 2R5GA 2YZUA 3GRXA 3D4TA 1NW2A 2O7KA 1YF1A 3ZYWA 3E0UA 2WB9A 4AJ6A 5ECLB 3TRXA 5J3RA 3P7XA 16GSA 4HU9A 5IO0A 1AQXA 2CZ2A 5IMFA 3IK9A 4HEA2 4ZL9A 2MBTA 2X99A 2M46A 3C73A 1FW1A 4IQAA 5G1KA 1SL2B 2GDRA 3H1NA 4DSRA 3KH9A 1K0AA 4RI7A 3CSIA 5IOWA 4QQ7A 2VIMA 4JEDA 4MJBA 4XRDA 4ZB9A 4IVFA 3RAZA 3JCML 3GKNA 4WF5A 4HQZA 4ID0A 1GUHA 4ZBAA 4K9ZA 12GSA 1T00A 3MAKA 5DAKA 4XRAA 2KP1A 4DVCA 2G0FA 4WF4A 3ERGA 5HFKA 4L5LA 2DJ0A 1B9YC 1ZYEA 2ZNMA 2HYXA 4NPBA 5JWOB 1JLVA 2N5FA 1K0MA 4IP6A 2GZYA 3QCPA 2E7PA 3L0HA 2PVQA 1EGOA 3GH9A 4IGJA 3KEBA 2IIYA 4KDUA 2H74A 1QXHA 2IPAA 2YZHA 1M9BA 3LXTA 4NHWA 3SBCA 5DCHA 5ECKB 1XW9A 3TRPA 2MYGA 5ABRA 3DVWA 3J7Yk 4FYCA 4Q5NA 4KDXA 2OA7A 1TOFA 2GQLA 3ERFA 2QSIA 2CZ3A 2FY6A 5HFIA 4Q5RA 5GSTA 5D9XA 2GTUA 3GA4A 4MA9A 1A2JA 1TI3A 3LG6A 1KBNA 3LYPA 5B7CA 4GLTA 6GSTA 4HZ4A 3KD0A 3ME8A 2H0HA 2FWGA 5F0GA 5EY6A 2LJKA 4GTUA 2C8UA 2LRCA 5EPFA 3APQA 4OFMA 3TKQA 3DRNA 2K8VA 1DUGA 3F4TA 4TXVA 4ZB6A 2GSTA 1V58A 4MK3A 4BWSA 2VOCA 4ECIA 4JZQA 1ZOFA 3GURA 2H1AA 3BD2A 4WR4A 2NPBA 5D9WA 3PGTA 4PQIA 5H5QA 3NZNA 2LKUA 1YEPA 3IR4A 4X0XA
chains in the Genus database with same CATH superfamily
4YQVA 2B7KA 3TJFA 2HRFA 2RM5A 5JWQB 3CXGA 3FYGA 3ME7A 4TR1A 4ICYA 4OCFA 2P5QA 3IC4A 4ISDA 3UVHA 5DQSA 2B5XA 2VD1A 1MDIA 2OACA 6GSXA 2FUG2 2R37A 5G30A 2L59A 5ECOB 3KTBA 17GSA 3HA9A 4X1UA 1B48A 2YV9A 5BRTA 1M2BA 4K6XA 4TR1B 2B1KA 3MSZA 1TI1A 5KEJA 1G7EA 2P0GA 1T1VA 5GSSA 2JL4A 1A0FA 4IJIA 4PQHA 4V2MA 4F9ZA 1OVNA 2A4VA 2LSTA 4I97A 5IQYA 3FK8A 1Q98A 5CREA 3D6IA 6GSUA 2H1DA 4OMVA 4IKHA 5GAND 5G31A 3TGZA 4I2UA 3ZREA 1TRUA 2NTOA 3ERWA 1K3OA 1K0BA 1FAAA 5DALA 3PR8A 1YJ6A 4MZBA 1R4WA 4MH3A 4PQ1A 4K7OA 4ZB8A 3CSHA 1O85A 4YKGA 5JWRB 4KSMA 4QL9A 3IE3A 1BAYA 3GX8A 3M8NA 2LQOA 1SJZA 4XIHA 1EEMA 3OR5A 3GN3A 3KMNA 4KA0A 2C0DA 1A2LA 1BX9A 1XWKA 1OKTA 5DALB 1WP0A 4J57E 2NBSA 2WULA 2YANA 4KNDA 4MLYA 2LRTA 2LNTA 1GSDA 1KEBA 3M9KA 3KP9A 4TW5A 3QOUA 4CHSA 4F0BA 1JFUA 1GWCA 1GSUA 4ECCA 3BOAA 4KF9A 1CQGA 3H93A 2MBSA 5D73A 1T4ZA 4XTSA 4TR0A 3U5RE 1O6JA 3F8UA 3RBTA 1OAZA 1FOVA 4K0NA 1QMVA 4K2XA 3KXOA 1GNWA 1M3JA 1AQWA 3L9SA 1U3IA 2CVBA 5KN2A 5IMZA 2PWJA 1OYJA 2PN8A 5IMDA 5IOXA 3TOUA 3IOSA 2EIQA 5ECSA 5A5KA 3G7JA 2YPMA 4BWQA 4NHZA 2YWNA 2NVLA 4KCEA 3D4MA 2L5LA 1R5PA 3D0ZA 1Y6EA 3V1WA 2IMDA 2X49A 4JU5A 1DSBA 4RQRA 2AHEA 2CVKA 3KP8A 3ZFLA 7GSSA 2DJKA 1C72A 1R5AA 3TOTA 4L0UA 4MCUA 2O8VB 2GGTA 2AB6A 3NIVA 1YDKA 3UMAA 1GLQA 4ZILA 3TKRA 1YEXA 4TXOA 4GF0A 1M7TA 4EKZA 3FZ5A 4ZBDA 5COHA 5KN1A 3LJRA 2RUEA 3MWHA 3MYDA 1GUKA 3A2VA 1JLWA 3C8EA 2C0GA 4WETA 3BJ5A 4GSTA 3P90A 2I9HA 3F0IA 3HJOA 2LEGA 4OFTA 2ZCTA 4GRFA 4MMMA 1SL0B 2HSMA 3IHGA 3QD9A 3KGKA 3FEUA 4TXOB 1WJKA 1X9SB 4FH8A 3TUEA 1Z5YE 4PX1A 2YJ7A 3LGCA 2PU9C 5JCUA 3G7YA 4EIQA 1SKWB 1VGLA 3TB2A 5IO2A 1OC3A 5J5NA 3WYWA 3IXRA 2RUFA 3HZ4A 4F2IA 1KTEA 3CSJA 1TK8B 3IK7A 3H8QA 14GSA 2DIYA 4HI7A 1DE1A 2GZPA 4TR4A 2YWMA 2AJQB 1XZOA 3MDKA 5G5EA 4LLRA 4X43A 1T3BA 1QFNA 4G2EA 5G5FA 3Q6OA 3I6AA 4MABA 2H73A 4ILFA 2XBIA 2HI7A 1WPIA 2LJAA 9GSSA 4O32A 2YWOA 1X5DA 2B5YA 3G7IA 1ST9A 1MTCA 1EP7A 1X5CA 2CX3A 2LTKA 1T8EB 1S3DA 4L8EA 2NDOA 3CMIA 2A2RA 3I43A 2DKHA 2B6MA 3ZIJA 2A2SA 2M72A 3QFAC 2JZTA 2L5OA 3FZ4A 4N0ZA 3CTFA 3L9UA 2X8CA 1A2MA 3ZTLA 3BCKA 1OE8A 2WFCA 4G19A 3ZVJA 1Z3EA 1F37A 3TKSA 1SK2A 5J9CA 5ELAA 1ILOA 22GSA 3EMXA 1HD2A 3EPTA 2P5RA 4E8HA 1TTZA 2VL2A 5CO3A 2YWIA 1K0NA 3CBUA 2OE1A 2B3SA 3QAWA 2VAFA 2H0GA 5DJLA 5D9VA 1XVWA 4WR5A 3IRAA 3E3EA 4MPFA 1ML6A 2H6XA 5CYYA 1BEDA 2C0EA 3FW2A 4G0LA 3QAVA 1CQHA 1G0TA 2B5EA 5HQPA 4RQXA 1PSQA 2L4QA 3GHAA 5GZZB 1M9AA 1EP8A 4BIKA 2KOKA 2OE0A 1GUMA 5DJMA 3ZZXA 3M1GA 3VURA 2IWTA 2DJ2A 3EU3A 4ULXA 4JBBA 4F0CA 4V1Ag 3TRQA 2WJUA 3DKSA 2EC4A 1QK8A 4USSA 2DSAA 3GFKA 1EZKA 2B1LA 2X64A 2IFQA 1RQMA 2YNXA 4WXTA 4V2LA 2VLVA 3VWWA 4YQMA 2R6KA 3GSTA 6GSVA 2F3MA 4EDYA 1GSYA 4PURA 3F3QA 1B9XC 1TK0B 3TJJA 2HE3A 1IYIA 3LFLA 1GSFA 4HS1A 2CX4A 4EL1A 3RPNA 5JCWA 3C1RA 2A2PA 2ALBA 1ON4A 3HVVA 1I5GA 2AV4A 2IFQB 3IAM2 1GTAA 1WWJA 1PX6A 5H5RA 3FR3A 2HT9A 1OC9A 3FZAA 2OBIA 5DAKB 2F9SA 4Z2UA 3LYKA 1XFLA 2JZRA 2PPTA 3WT1A 4OFNA 1M99A 2H72A 1ZCPA 2BJXA 1Q4JA 4ML1A 4K1FA 1FHEA 20GSA 2FA4A 4FQUA 2K6VA 2LRNA 2H0IA 2HSHA 4I8BA 1UN2A 2H75A 2VM2A 2C1YA 2IJYA 4FO5A 2I3YA 3APOA 1UC7A 2FCHA 4CY6A 5D93A 3GL3A 3HKRA 3J7Yb 3A5IA 5EVOA 3D22A 4ACSA 4FYBA 3HXSA 3UL3A 1F3BA 4G9HA 3MIXA 1VRSD 1J0FA 2XC2A 4KH7A 3GSSA 1XVQA 6GSYA 3ZL5A 1AUCA 4G0IA 2FWHA 3SWLA 2CVDA 2QC7A 3AY8A 4DEJA 1PD21 1XXUA 1S3CA 3VPTA 3Q19A 5B8BA 2R4VA 2F8FA 5E4WA 1YY7A 3GNJA 3HVNA 3IA1A 2JADA 2RIIA 4WBRD 3RPPA 1QUWA 1SK0A 1LU4A 1M0UA 2VD0A 3HY2A 1ZYQB 4I2TA 4K8MA 4O5UA 1MDKA 4A5PA 3FKFA 4EVMA 4XS1A 2MMOA 3LORA 18GSA 4NV5A 3EU4A 5ID2A 1XWGA 1KNGA 2FA8A 1SK1A 2DJ3A 1USBA 2H71A 2QA1A 4ECJA 1K0OA 4HUAA 1X0RA 2CAQA 4CDOA 5J41A 2HFDA 4NV2A 1ZMAA 4YAPA 1FB6A 1PX7A 3F3RA 2H1BA 5L71A 4EC0A 3KH7A 3LEFA 2GSSA 2MMZA 2TRXA 4DSQA 1F3AA 3DWVA 2IN3A 2BTOT 4KE3A 4GQFA 1BJXA 3GUSA 1PFOA 5LCZA 4X4JA 1QQ2A 2H8LA 5F8BA 2A4HA 3M0FA 1V2AA 2AYTA 1X9WB 4Z2RA 3I9V2 2FLSA 4PUAA 2LNSA 4HDEA 3LW9A 2G2QA 5IMCA 5BMUA 3M3MA 2YCDA 3IDVA 1SJ6A 3VWVA 1AQVA 1Y25A 1FO5A 2QKEA 1U87A 4NXIA 4K5SA 1VF4A 4K5RA 3N9JA 1TK5B 4GWRA 3E9JB 2E2GA 2OKAA 2XBQA 4PNFA 1XPVA 4PUFC 2XHFA 5KOXA 4MJAA 3IC8A 4OD7A 1MD3A 2FD3A 1XOAA 3HZ8A 3WD6A 5CP1A 1HQOA 5HR3A 4BVYA 2V41A 4V2NA 1ZZYA 2GT6A 2QA2A 3ISOA 3ZMLA 2H1GA 2H76A 1K0CA 3FR9A 5KN3A 4TVEA 2M80A 2PBJA 4OO4A 2L6DA 3US3A 1OE7A 3N5OA 1TW9A 2N5BA 2WGRA 4BVYB 1XW5A 1THXA 1XG8A 3EYTA 1O8XA 2QGVA 1TXXA 2F8AA 3APSA 2MMNA 2YN1A 5AN1A 4F03A 3TJBA 5H5SA 1M2DA 13GSA 5DBQA 2CA8A 3GKXA 4WKWA 1VF2A 5ECRB 2XPDA 5A4VA 1O81A 3UVTA 2DJ1A 4N0VA 2D2ZA 2X8HA 5D96A 2R3XA 2XPEA 1YF0A 1JZWA 1JZRA 2L6CA 3FZ9A 4MZCA 2VL3A 4NAXA 1U88A 1GTIA 4AGSA 3PH9A 6GSWA 4Q5FA 3C71A 4JR6A 5ENUA 3F9UA 3UAPA 2JSZA 4MH2A 4O7HA 1EOGA 5CAXA 2K9FA 3CRTA 2DIZA 19GSA 2GSRA 3TDGA 4K0GA 3NOFA 3FRCA 4MZWA 4N30A 1G6YA 8GSSA 1EGRA 2GT5A 2HRKA 4EDZA 1GLPA 3DVXA 4MF5A 1J9BA 1F6MC 2RM6A 1VF3A 2X8GA 2PMTA 2H66A 3L9VA 1LBKA 2K18A 1V57A 3KMOA 2YV7A 4BPYA 2PERA 2FWEA 3EWLA 3QAGA 2VCTA 4IBPA 3IAS2 2H70A 4POKA 3HYPA 1WE0A 3ZMKA 1PKWA 2WRTA 5CRWA 2KP2A 4PTSA 2JACA 2C4JA 3CQFA 2L57A 4JR4A 3ZVJD 1AIUA 4MF7A 1GTBA 5IIZA 3HHVA 1SKSB 2IMEA 5CRHA 1WIKA 1A8YA 2C80A 5ECHB 3VLNA 3A5WA 1SJIA 4H86A 4K7IA 3R2QA 2WS2A 2DC5A 1JHBA 1I9DA 3WT2A 3EINA 4POLA 2VCXA 3UOMA 3O6TA 4KUNA 3R3EA 4K2DA 1YQ1A 5INYA 1O8WA 1U3AA 3RHCA 2OADA 2GQKA 3VFIA 1FB0A 1WRYA 2FGXA 2VCVA 1ZYNA 4XS6A 5AIXA 3BBYA 4ECBA 4TRXA 3IV4A 2YP6A 3QMXA 4KSOA 2HSYA 2VLUA 3QR6A 4LMVA 1K0DA 5HR2A 3UBKA 3DXBA 4G10A 2HXKA 5DCGA 4LL4B 4EXJA 3F6FA 1PKZA 4N10A 1GSQA 3HJPA 2GZZA 2FHEA 5GAPD 2TRCP 5LD0A 3ZITA 1FOHA 3VPQA 2ON7A 3MNGA 1XCCA 3ED3A 1H75A 3D5JA 4YKFA 5J9BA 11GSA 4ZL7A 1Z6MA 3HDCA 1GP1A 1TRVA 1HNCA 2E2MA 5HR1A 2N5AA 2R0PA 2V1MA 1GH2A 2ES7A 3Q74A 3A3TA 1BYEA 1PL1A 5DVBA 5C00A 2PVOC 4IQ1A 2FNOA 4O5RA 2H6ZA 2O89A 4BVXA 4MNNA 1M3IA 2V6KA 1M2AA 4Q5QA 5IMAA 3LWAA 5D8IA 1A0RP 1B4PA 1J08A 1NHOA 1OKDA 4BVXB 3TKPA 2GVPA 3IPZA 2Z9SA 2H6YA 1SENA 3IBHA 4HOJA 4IW9A 4WEYA 1JZDA 1GTUA 3P2AA 4KW6A 1E6BA 1V98A 1EV4A 3A2WA 1BQ7A 1TJDA 2I4AA 5D9TA 3PPUA 3LSZA 2O85A 1XW6A 2HZFA 3CRUA 2EIRA 3TKSE 5JCGA 5ECNB 1VF1A 5B6MA 1E2YA 1URMA 2CQ9A 1PQNA 1XWCA 4FIWA 2DLXA 2VUPA 2UZ8A 1SD9A 3DIEA 3CYNA 1GL8A 4ML6A 3UIWA 1QGVA 2R2JA 2V32A 1OC9B 1PN9A 1YKAA 5LNKe 1AW9A 1T4YA 3UBLA 4MDCA 1A8LA 4IJ3A 1AAZA 5EL8A 3P8WA 4TKYA 2LQQA 4D73A 1NHYA 2KUCA 2TIRA 3KIJA 4I6XA 3UEMA 3LXZA 3K8NA 1A23A 3ZIVA 4IP1A 3TKSC 2VCWA 1TU7A 3GL5A 2JZSA 4KCAA 10GSA 2ZUPA 3KJYA 2YOIA 3QFBC 2WZ9A 1WMJA 2VL2C 4D73B 1K3YA 2EIOA 3CTGA 1THOA 2PGTA 1SYRA 4PGTA 3UARA 4K7NA 2DJJA 5AISA 1S3AA 4IHUA 1TU8A 2MMAA 2JSYA 1GSEA 3D21A 3U6VA 1TP9A 1ABAA 3LQ7A 1PL2A 3ZRDA 3TJKA 3QDNA 4JE1A 2B7JA 4HZ2A 3VK9A 4RI6A 2HRNA 4MJCA 3UJ1A 1TRWA 3H79A 1R7HA 1PGTA 1B4QA 3VI7A 1XWBA 3VWXA 4GXZA 2HZEA 1DBYA 4P3YB 1BG5A 1N2AA 2F51A 4POBA 5B8AA 3VWUA 1GSSA 3DGQA 5ID2B 1V40A 1GRXA 5AIVA 2VM1A 2KLXA 1X9MB 2ON5A 2OJLA 2IMFA 1OC8A 2HZEB 1V9WA 2GSQA 4OCEA 6GSSA 3EC3A 4NWYA 3RHBA 4F82A 5A4WA 2C3NA 3G9BA 4HU7A 1W89A 5KN0A 1XBSA 3HVXA 3FY7A 3WGDA 4EO3A 4TN8A 1NM3A 4XHMA 3GX0A 4MJEA 1LJRA 2FWFA 4E8EA 2O87A 1A24A 3KTLA 4IS0A 5B6NA 3QPMA 2VCZA 1RW1A 4Z7XA 4LMWA 3GV1A 3C1SA 3GYKA 3DMLA 1X5EA 5E59A 5F06A 1O73A 2K8SA 2BMXA 2VO4A 1ERUA 1Z7PA 4KGIA 2KHPA 3EVIA 4RUVA 5CRGA 3EMPA 2HRAA 4KDYA 5F05A 2J9HA 4POMA 1Z6NA 4EUYA 4HQSA 1SYXA 2DMLA 3PINA 5HFGA 2IL3A 2I81A 5ECPB 2C3QA 1N8JA 5IM9A 1PMTA 2GLRA 1U6TA 3BCIA 2VL9A 3IHQA 3F4SA 4GQCA 3TCOA 5IPHA 4QL7A 4DSSA 1XIYA 1YZXA 3W8JA 1F2EA 4L5OA 1XOBA 4CW9A 3F63A 5F07A 4CY8A 3KCMA 1GNEA 2E0QA 3I69A 4YAVA 1EV9A 1ERVA 2WCIA 2DMMA 5G2ZA 4GSSA 3ZLPA 4XS4A 4AJ8A 2HLSA 4GCIA 4DSSB 5KOWA 1ERWA 3DD3A 4LA1A 2MZCA 4FYUA 3H4KA 4BL7A 1DE2A 2LV3A 1EOHA 2VCQA 5C04A 1EEJA 3FR6A 4XCSA 5ECMB 1Z9HA 2R0GA 4KB3A 4EF0A 2OE3A 4XS4B 1GULA 1AXDA 3L4NA 4EIPA 1TKDB 4BL7B 3O3TA 3GKKA 1K3LA 3O76A 4KAEA 1WOUA 4YQUA 2P31A 4Z2TA 1W4VA 1HYUA 2LJRA 1ZL9A 3ZFBA 1EWXA 2J23A 3F6DA 1F9MA 3KZQA 4TOPA 5ECQB 4N11A 4ZIJA 4MF6A 5CRDA 5FT3A 4HJMA 2IMIA 1T7PB 4PXOA 3GTUA 4ZBBA 3GKMA 5IMVA 1G7OA 2HNLA 2DKIA 2REMA 3EE2A 1ERTA 1ACVA 4OWYA 1FVKA 2C0FA 1S3RA 4BA7A 1G6WA 1Z7RA 3HCZA 3F4RA 3GTUB 4ZL8A 5G1LA 4MP4A 4OO5A 1B8XA 2PUKC 4IELA 3VI5A 4JRRA 1HNBA 3A2XA 1SL1B 4G0KA 5AGYA 2C3TA 2JU5A 2GQMA 3C7MA 5ELGA 4I5QA 1SKRB 5J4UA 1R26A 2DBCA 2I1UA 3GH6A 4AJ7A 4J2FA 1TDIA 4L0WA 1NSWA 1MEKA 1FG4A 2LUSA 3TJGA 5DDLA 4J56E 3DEXA 4AF2A 1FVJA 1JZOA 2RLIA 4EE0A 4KX4A 2CAIA 3Q18A 3DYRA 4TR3A 1TRSA 4GSNA 4PNGA 1H4OA 3WGXA 1HNAA 3HD5A 1RK4A 3S9FA 3GMFA 4V1Ap 2CT6A 1UVZA 5HR0A 2H19A 1MDJA 2H01A 3W6GA 1XWAA 2VLTA 2H30A 2V6OA 1MD4A 2AAWA 5FWGA 2GS3A 4YH2A 2IMKA 5FHIA 3GIXA 5ECIB 3FHKA 5DQYA 3W8SA 4LL1B 4O5QA 1SD8A 1IYHA 4IN0A 3HJMA 3RDWA 3EURA 2YJHA 4HJ2A 4ZXGA 3M9JA 2LS5A 1UA5A 1SU9A 4MPGA 2WDUA 1O7UA 1PRXA 3KM6A 4WBJA 2OBKA 5IPGA 3L78A 1PA3A 1ZGNA 4NMUA 1AC1A 2CV4A 5CNWA 3HVSA 4O92A 2L4CA 2V2GA 1YKCA 5A4UA 3WGEA 2AUVA 2R5GA 2YZUA 3GRXA 3D4TA 1NW2A 2O7KA 1YF1A 3ZYWA 3E0UA 2WB9A 4AJ6A 5ECLB 3TRXA 5J3RA 3P7XA 16GSA 3FMWA 4HU9A 5IO0A 2X4AA 1AQXA 2CZ2A 5IMFA 3IK9A 4HEA2 4ZL9A 2MBTA 2X99A 1PN0A 2M46A 3C73A 1FW1A 4IQAA 5G1KA 1SL2B 2GDRA 3H1NA 4DSRA 3KH9A 1K0AA 4RI7A 4HSCX 3CSIA 5IOWA 4QQ7A 2VIMA 4JEDA 4MJBA 4XRDA 4ZB9A 4IVFA 3RAZA 3JCML 3GKNA 4WF5A 4HQZA 4ID0A 1GUHA 4ZBAA 4K9ZA 12GSA 1T00A 3MAKA 5DAKA 4XRAA 2KP1A 4DVCA 2G0FA 4WF4A 3ERGA 5HFKA 4L5LA 2DJ0A 1B9YC 1ZYEA 2ZNMA 2HYXA 4NPBA 5JWOB 1JLVA 2N5FA 1K0MA 4IP6A 2GZYA 3QCPA 2E7PA 3L0HA 2PVQA 1EGOA 3GH9A 4IGJA 3KEBA 2IIYA 4KDUA 2H74A 1QXHA 2IPAA 2YZHA 1M9BA 3LXTA 4NHWA 3SBCA 5DCHA 5ECKB 1XW9A 3TRPA 2MYGA 5ABRA 3DVWA 3J7Yk 4FYCA 4Q5NA 4KDXA 2OA7A 1TOFA 2GQLA 3ERFA 2QSIA 2CZ3A 2FY6A 5HFIA 4Q5RA 2R0CA 5GSTA 5D9XA 2GTUA 3GA4A 4MA9A 1A2JA 1TI3A 3LG6A 1KBNA 3LYPA 5B7CA 4GLTA 6GSTA 4HZ4A 3KD0A 3ME8A 2H0HA 2FWGA 5F0GA 5EY6A 2LJKA 4GTUA 2C8UA 2LRCA 5EPFA 1ZYPA 3APQA 4OFMA 3TKQA 3DRNA 2K8VA 1DUGA 3F4TA 4TXVA 4ZB6A 2GSTA 1V58A 4MK3A 4BWSA 2VOCA 4ECIA 4JZQA 1ZOFA 3GURA 2H1AA 3BD2A 4WR4A 2NPBA 5D9WA 3PGTA 4PQIA 5H5QA 3NZNA 2LKUA 1YEPA 3IR4A 4X0XA
chains in the Genus database with same CATH topology
4YQVA 2B7KA 3TJFA 2HRFA 2RM5A 5JWQB 3CXGA 3FYGA 3ME7A 4TR1A 4ICYA 4OCFA 2P5QA 3IC4A 4ISDA 3UVHA 5DQSA 2B5XA 2VD1A 1MDIA 2OACA 6GSXA 2FUG2 2R37A 5G30A 2L59A 5ECOB 3KTBA 17GSA 3HA9A 4X1UA 1B48A 2YV9A 5BRTA 1M2BA 4K6XA 4TR1B 2B1KA 3MSZA 1TI1A 5KEJA 1G7EA 2P0GA 1T1VA 5GSSA 2JL4A 1A0FA 4IJIA 4PQHA 4V2MA 4F9ZA 1OVNA 2A4VA 2LSTA 4I97A 5IQYA 3FK8A 1Q98A 5CREA 3D6IA 6GSUA 2H1DA 4OMVA 4IKHA 5GAND 5G31A 3TGZA 4I2UA 3ZREA 1TRUA 2NTOA 3ERWA 1K3OA 1K0BA 1FAAA 5DALA 3PR8A 1YJ6A 4MZBA 1R4WA 4MH3A 4PQ1A 4K7OA 4ZB8A 3CSHA 1O85A 4YKGA 5JWRB 4KSMA 4QL9A 3IE3A 1BAYA 3GX8A 3M8NA 2LQOA 1SJZA 4XIHA 1EEMA 3OR5A 3GN3A 3KMNA 4KA0A 2C0DA 1A2LA 1BX9A 1XWKA 1OKTA 5DALB 1WP0A 4J57E 2NBSA 2WULA 2YANA 4KNDA 4MLYA 2LRTA 2LNTA 1GSDA 1KEBA 3M9KA 3KP9A 4TW5A 3QOUA 4CHSA 4F0BA 1JFUA 1GWCA 1GSUA 4ECCA 3BOAA 4KF9A 1CQGA 3H93A 2MBSA 5D73A 1T4ZA 4XTSA 4TR0A 3U5RE 1O6JA 3F8UA 3RBTA 1OAZA 1FOVA 4K0NA 1QMVA 4K2XA 3KXOA 1GNWA 1AQWA 3L9SA 1U3IA 2CVBA 5KN2A 5IMZA 2PWJA 1OYJA 2PN8A 5IMDA 5IOXA 3TOUA 3IOSA 2EIQA 5ECSA 5A5KA 3G7JA 2YPMA 4BWQA 4NHZA 2YWNA 2NVLA 4KCEA 3D4MA 2L5LA 1R5PA 3D0ZA 1Y6EA 3V1WA 2IMDA 2X49A 4JU5A 1DSBA 4RQRA 2AHEA 2CVKA 3KP8A 3ZFLA 7GSSA 2DJKA 1C72A 1R5AA 3TOTA 4L0UA 4MCUA 2O8VB 2GGTA 2AB6A 3NIVA 1YDKA 3UMAA 1GLQA 4ZILA 3TKRA 1YEXA 4TXOA 4GF0A 1M7TA 4EKZA 3FZ5A 4ZBDA 5COHA 5KN1A 3LJRA 2RUEA 3MWHA 3MYDA 1GUKA 3A2VA 1JLWA 3C8EA 2C0GA 4WETA 3BJ5A 4GSTA 3P90A 2I9HA 3F0IA 3HJOA 2LEGA 4OFTA 2ZCTA 4GRFA 4MMMA 1SL0B 2HSMA 3IHGA 3QD9A 3KGKA 3FEUA 4TXOB 1WJKA 1X9SB 4FH8A 3TUEA 1Z5YE 4PX1A 2YJ7A 3LGCA 2PU9C 5JCUA 3G7YA 4EIQA 1SKWB 1VGLA 3TB2A 5IO2A 1OC3A 5J5NA 3WYWA 3IXRA 2RUFA 3HZ4A 4F2IA 1KTEA 3CSJA 1TK8B 3IK7A 3H8QA 14GSA 2DIYA 4HI7A 1DE1A 2GZPA 4TR4A 2YWMA 2AJQB 1XZOA 3MDKA 5G5EA 4LLRA 4X43A 1T3BA 1QFNA 4G2EA 5G5FA 3Q6OA 3I6AA 4MABA 2H73A 4ILFA 2XBIA 2HI7A 1WPIA 2LJAA 9GSSA 4O32A 2YWOA 1X5DA 2B5YA 3G7IA 1ST9A 1MTCA 1EP7A 1X5CA 2CX3A 2LTKA 1T8EB 1S3DA 4L8EA 2NDOA 3CMIA 2A2RA 3I43A 2DKHA 2B6MA 3ZIJA 2A2SA 2M72A 3QFAC 2JZTA 2L5OA 3FZ4A 4N0ZA 3CTFA 3L9UA 2X8CA 1A2MA 3ZTLA 3BCKA 1OE8A 2WFCA 4G19A 3ZVJA 1Z3EA 1F37A 3TKSA 1SK2A 5J9CA 5ELAA 1ILOA 22GSA 3EMXA 1HD2A 3EPTA 2P5RA 4E8HA 1TTZA 2VL2A 5CO3A 2YWIA 1K0NA 3CBUA 2OE1A 2B3SA 3QAWA 2VAFA 2H0GA 5DJLA 5D9VA 1XVWA 4WR5A 3IRAA 3E3EA 4MPFA 1ML6A 2H6XA 5CYYA 1BEDA 2C0EA 3FW2A 4G0LA 3QAVA 1CQHA 1G0TA 2B5EA 5HQPA 4RQXA 1PSQA 2L4QA 3GHAA 5GZZB 1M9AA 1EP8A 2KOKA 2OE0A 1GUMA 5DJMA 3ZZXA 3M1GA 3VURA 2IWTA 2DJ2A 3EU3A 4ULXA 4JBBA 4F0CA 4V1Ag 3TRQA 2WJUA 3DKSA 2EC4A 1QK8A 4USSA 2DSAA 3GFKA 1EZKA 2B1LA 2X64A 2IFQA 1RQMA 2YNXA 4WXTA 4V2LA 2VLVA 3VWWA 4YQMA 2R6KA 3GSTA 6GSVA 2F3MA 4EDYA 1GSYA 4PURA 3F3QA 1B9XC 1TK0B 3TJJA 2HE3A 1IYIA 3LFLA 1GSFA 4HS1A 2CX4A 4EL1A 3RPNA 5JCWA 3C1RA 2A2PA 2ALBA 1ON4A 3HVVA 1I5GA 2AV4A 2IFQB 3IAM2 1GTAA 1WWJA 1PX6A 5H5RA 3FR3A 2HT9A 1OC9A 3FZAA 2OBIA 5DAKB 2F9SA 4Z2UA 3LYKA 1XFLA 2JZRA 2PPTA 3WT1A 4OFNA 1M99A 2H72A 1ZCPA 2BJXA 1Q4JA 4ML1A 4K1FA 1FHEA 20GSA 2FA4A 4FQUA 2K6VA 2LRNA 2H0IA 2HSHA 4I8BA 1UN2A 2H75A 2VM2A 2C1YA 2IJYA 4FO5A 2I3YA 3APOA 1UC7A 2FCHA 4CY6A 5D93A 3GL3A 3HKRA 3J7Yb 3A5IA 5EVOA 3D22A 4ACSA 4FYBA 3HXSA 3UL3A 1F3BA 4G9HA 3MIXA 1VRSD 1J0FA 2XC2A 4KH7A 3GSSA 1XVQA 6GSYA 3ZL5A 1AUCA 4G0IA 2FWHA 3SWLA 2CVDA 2QC7A 3AY8A 4DEJA 1PD21 1XXUA 1S3CA 3VPTA 3Q19A 5B8BA 2R4VA 2F8FA 5E4WA 1YY7A 3GNJA 3IA1A 2JADA 2RIIA 4WBRD 3RPPA 1QUWA 1SK0A 1LU4A 1M0UA 2VD0A 3HY2A 1ZYQB 4I2TA 4K8MA 4O5UA 1MDKA 4A5PA 3FKFA 4EVMA 4XS1A 2MMOA 3LORA 18GSA 4NV5A 3EU4A 5ID2A 1XWGA 1KNGA 2FA8A 1SK1A 2DJ3A 1USBA 2H71A 2QA1A 4ECJA 1K0OA 4HUAA 1X0RA 2CAQA 4CDOA 5J41A 2HFDA 4NV2A 1ZMAA 4YAPA 1FB6A 1PX7A 3F3RA 2H1BA 5L71A 4EC0A 3KH7A 3LEFA 2GSSA 2MMZA 2TRXA 4DSQA 1F3AA 3DWVA 2IN3A 2BTOT 4KE3A 4GQFA 1BJXA 3GUSA 5LCZA 4X4JA 1QQ2A 2H8LA 5F8BA 2A4HA 3M0FA 1V2AA 2AYTA 1X9WB 4Z2RA 3I9V2 2FLSA 4PUAA 2LNSA 4HDEA 3LW9A 2G2QA 5IMCA 5BMUA 3M3MA 2YCDA 3IDVA 1SJ6A 3VWVA 1AQVA 1Y25A 1FO5A 2QKEA 1U87A 4NXIA 4K5SA 1VF4A 4K5RA 3N9JA 1TK5B 4GWRA 3E9JB 2E2GA 2OKAA 2XBQA 4PNFA 1XPVA 4PUFC 2XHFA 5KOXA 4MJAA 3IC8A 4OD7A 1MD3A 2FD3A 1XOAA 3HZ8A 3WD6A 5CP1A 1HQOA 5HR3A 4BVYA 2V41A 4V2NA 1ZZYA 2GT6A 2QA2A 3ISOA 3ZMLA 2H1GA 2H76A 1K0CA 3FR9A 5KN3A 4TVEA 2M80A 2PBJA 4OO4A 2L6DA 3US3A 1OE7A 3N5OA 1TW9A 2N5BA 2WGRA 4BVYB 1XW5A 1THXA 3EYTA 1O8XA 2QGVA 1TXXA 2F8AA 3APSA 2MMNA 2YN1A 5AN1A 4F03A 3TJBA 5H5SA 1M2DA 13GSA 5DBQA 2CA8A 3GKXA 4WKWA 1VF2A 5ECRB 2XPDA 5A4VA 1O81A 3UVTA 2DJ1A 4N0VA 2D2ZA 2X8HA 5D96A 2R3XA 2XPEA 1YF0A 1JZWA 1JZRA 2L6CA 3FZ9A 4MZCA 2VL3A 4NAXA 1U88A 1GTIA 4AGSA 3PH9A 6GSWA 4Q5FA 3C71A 4JR6A 5ENUA 3F9UA 3UAPA 2JSZA 4MH2A 4O7HA 1EOGA 5CAXA 2K9FA 3CRTA 2DIZA 19GSA 2GSRA 3TDGA 4K0GA 3NOFA 3FRCA 4MZWA 4N30A 1G6YA 8GSSA 1EGRA 2GT5A 2HRKA 4EDZA 1GLPA 3DVXA 4MF5A 1J9BA 1F6MC 2RM6A 1VF3A 2X8GA 2PMTA 2H66A 3L9VA 1LBKA 2K18A 1V57A 3KMOA 2YV7A 4BPYA 2PERA 2FWEA 3EWLA 3QAGA 2VCTA 4IBPA 3IAS2 2H70A 4POKA 3HYPA 1WE0A 3ZMKA 1PKWA 2WRTA 5CRWA 2KP2A 4PTSA 2JACA 2C4JA 2L57A 4JR4A 3ZVJD 1AIUA 4MF7A 1GTBA 5IIZA 3HHVA 1SKSB 2IMEA 5CRHA 1WIKA 1A8YA 2C80A 5ECHB 3VLNA 3A5WA 1SJIA 4H86A 4K7IA 3R2QA 2WS2A 2DC5A 1JHBA 1I9DA 3WT2A 3EINA 4POLA 2VCXA 3UOMA 3O6TA 4KUNA 3R3EA 4K2DA 1YQ1A 5INYA 1O8WA 1U3AA 3RHCA 2OADA 2GQKA 3VFIA 1FB0A 1WRYA 2FGXA 2VCVA 1ZYNA 4XS6A 5AIXA 3BBYA 4ECBA 4TRXA 3IV4A 2YP6A 3QMXA 4KSOA 2HSYA 2VLUA 3QR6A 4LMVA 1K0DA 5HR2A 3UBKA 3DXBA 4G10A 2HXKA 5DCGA 4LL4B 4EXJA 3F6FA 1PKZA 4N10A 1GSQA 3HJPA 2GZZA 2FHEA 5GAPD 2TRCP 5LD0A 3ZITA 1FOHA 3VPQA 2ON7A 3MNGA 1XCCA 3ED3A 1H75A 3D5JA 4YKFA 5J9BA 11GSA 4ZL7A 1Z6MA 3HDCA 1GP1A 1TRVA 1HNCA 2E2MA 5HR1A 2N5AA 2R0PA 2V1MA 1GH2A 2ES7A 3Q74A 3A3TA 1BYEA 1PL1A 5DVBA 5C00A 2PVOC 4IQ1A 2FNOA 4O5RA 2H6ZA 2O89A 4BVXA 4MNNA 2V6KA 1M2AA 4Q5QA 5IMAA 3LWAA 5D8IA 1A0RP 1B4PA 1J08A 1NHOA 1OKDA 4BVXB 3TKPA 2GVPA 3IPZA 2Z9SA 2H6YA 1SENA 3IBHA 4HOJA 4IW9A 4WEYA 1JZDA 1GTUA 3P2AA 4KW6A 1E6BA 1V98A 1EV4A 3A2WA 1BQ7A 1TJDA 2I4AA 5D9TA 3PPUA 3LSZA 2O85A 1XW6A 2HZFA 3CRUA 2EIRA 3TKSE 5JCGA 5ECNB 1VF1A 5B6MA 1E2YA 1URMA 2CQ9A 1PQNA 1XWCA 4FIWA 2DLXA 2VUPA 2UZ8A 1SD9A 3DIEA 3CYNA 1GL8A 4ML6A 3UIWA 1QGVA 2R2JA 2V32A 1OC9B 1PN9A 1YKAA 5LNKe 1AW9A 1T4YA 3UBLA 4MDCA 1A8LA 4IJ3A 1AAZA 5EL8A 3P8WA 4TKYA 2LQQA 4D73A 1NHYA 2KUCA 2TIRA 3KIJA 4I6XA 3UEMA 3LXZA 3K8NA 1A23A 3ZIVA 4IP1A 3TKSC 2VCWA 1TU7A 3GL5A 2JZSA 4KCAA 10GSA 2ZUPA 3KJYA 2YOIA 3QFBC 2WZ9A 1WMJA 2VL2C 4D73B 1K3YA 2EIOA 3CTGA 1THOA 2PGTA 1SYRA 4PGTA 3UARA 4K7NA 2DJJA 5AISA 1S3AA 4IHUA 1TU8A 2MMAA 2JSYA 1GSEA 3D21A 3U6VA 1TP9A 1ABAA 3LQ7A 1PL2A 3ZRDA 3TJKA 3QDNA 4JE1A 2B7JA 4HZ2A 3VK9A 4RI6A 2HRNA 4MJCA 3UJ1A 1TRWA 3H79A 1R7HA 1PGTA 1B4QA 3VI7A 1XWBA 3VWXA 4GXZA 2HZEA 1DBYA 4P3YB 1BG5A 1N2AA 2F51A 4POBA 5B8AA 3VWUA 1GSSA 3DGQA 5ID2B 1V40A 1GRXA 5AIVA 2VM1A 2KLXA 1X9MB 2ON5A 2OJLA 2IMFA 1OC8A 2HZEB 1V9WA 2GSQA 4OCEA 6GSSA 3EC3A 4NWYA 3RHBA 4F82A 5A4WA 2C3NA 3G9BA 4HU7A 1W89A 5KN0A 1XBSA 3HVXA 3FY7A 3WGDA 4EO3A 4TN8A 1NM3A 4XHMA 3GX0A 4MJEA 1LJRA 2FWFA 4E8EA 2O87A 1A24A 3KTLA 4IS0A 5B6NA 3QPMA 2VCZA 1RW1A 4Z7XA 4LMWA 3GV1A 3C1SA 3GYKA 3DMLA 1X5EA 5E59A 5F06A 1O73A 2K8SA 2BMXA 2VO4A 1ERUA 1Z7PA 4KGIA 2KHPA 3EVIA 4RUVA 5CRGA 3EMPA 2HRAA 4KDYA 5F05A 2J9HA 4POMA 1Z6NA 4EUYA 4HQSA 1SYXA 2DMLA 3PINA 5HFGA 2IL3A 2I81A 5ECPB 2C3QA 1N8JA 5IM9A 1PMTA 2GLRA 1U6TA 3BCIA 2VL9A 3IHQA 3F4SA 4GQCA 3TCOA 5IPHA 4QL7A 4DSSA 1XIYA 1YZXA 3W8JA 1F2EA 4L5OA 1XOBA 4CW9A 3F63A 5F07A 4CY8A 3KCMA 1GNEA 2E0QA 3I69A 4YAVA 1EV9A 1ERVA 2WCIA 2DMMA 5G2ZA 4GSSA 3ZLPA 4XS4A 4AJ8A 2HLSA 4GCIA 4DSSB 5KOWA 1ERWA 3DD3A 4LA1A 2MZCA 4FYUA 3H4KA 4BL7A 1DE2A 2LV3A 1EOHA 2VCQA 5C04A 1EEJA 3FR6A 4XCSA 5ECMB 1Z9HA 2R0GA 4KB3A 4EF0A 2OE3A 4XS4B 1GULA 1AXDA 3L4NA 4EIPA 1TKDB 4BL7B 3O3TA 3GKKA 1K3LA 3O76A 4KAEA 1WOUA 4YQUA 2P31A 4Z2TA 1W4VA 1HYUA 2LJRA 1ZL9A 3ZFBA 1EWXA 2J23A 3F6DA 1F9MA 3KZQA 4TOPA 5ECQB 4N11A 4ZIJA 4MF6A 5CRDA 5FT3A 4HJMA 2IMIA 1T7PB 4PXOA 3GTUA 4ZBBA 3GKMA 5IMVA 1G7OA 2HNLA 2DKIA 2REMA 3EE2A 1ERTA 1ACVA 4OWYA 1FVKA 2C0FA 4BA7A 1G6WA 1Z7RA 3HCZA 3F4RA 3GTUB 4ZL8A 5G1LA 4MP4A 4OO5A 1B8XA 2PUKC 4IELA 3VI5A 4JRRA 1HNBA 3A2XA 1SL1B 4G0KA 5AGYA 2C3TA 2JU5A 2GQMA 3C7MA 5ELGA 4I5QA 1SKRB 5J4UA 1R26A 2DBCA 2I1UA 3GH6A 4AJ7A 4J2FA 1TDIA 4L0WA 1NSWA 1MEKA 1FG4A 2LUSA 3TJGA 5DDLA 4J56E 3DEXA 4AF2A 1FVJA 1JZOA 2RLIA 4EE0A 4KX4A 2CAIA 3Q18A 3DYRA 4TR3A 1TRSA 4GSNA 4PNGA 1H4OA 3WGXA 1HNAA 3HD5A 1RK4A 3S9FA 3GMFA 4V1Ap 2CT6A 1UVZA 5HR0A 2H19A 1MDJA 2H01A 3W6GA 1XWAA 2VLTA 2H30A 2V6OA 1MD4A 2AAWA 5FWGA 2GS3A 4YH2A 2IMKA 5FHIA 3GIXA 5ECIB 3FHKA 5DQYA 3W8SA 4LL1B 4O5QA 1SD8A 1IYHA 4IN0A 3HJMA 3RDWA 3EURA 2YJHA 4HJ2A 4ZXGA 3M9JA 2LS5A 1UA5A 1SU9A 4MPGA 2WDUA 1O7UA 1PRXA 3KM6A 4WBJA 2OBKA 5IPGA 3L78A 1PA3A 1ZGNA 4NMUA 1AC1A 2CV4A 5CNWA 3HVSA 4O92A 2L4CA 2V2GA 1YKCA 5A4UA 3WGEA 2AUVA 2R5GA 2YZUA 3GRXA 3D4TA 1NW2A 2O7KA 1YF1A 3ZYWA 3E0UA 2WB9A 4AJ6A 5ECLB 3TRXA 5J3RA 3P7XA 16GSA 3FMWA 4HU9A 5IO0A 2X4AA 1AQXA 2CZ2A 5IMFA 3IK9A 4HEA2 4ZL9A 2MBTA 2X99A 1PN0A 2M46A 3C73A 1FW1A 4IQAA 5G1KA 1SL2B 2GDRA 3H1NA 4DSRA 3KH9A 1K0AA 4RI7A 3CSIA 5IOWA 4QQ7A 2VIMA 4JEDA 4MJBA 4XRDA 4ZB9A 4IVFA 3RAZA 3JCML 3GKNA 4WF5A 4HQZA 4ID0A 1GUHA 4ZBAA 4K9ZA 12GSA 1T00A 3MAKA 5DAKA 4XRAA 2KP1A 4DVCA 2G0FA 4WF4A 3ERGA 5HFKA 4L5LA 2DJ0A 1B9YC 1ZYEA 2ZNMA 2HYXA 4NPBA 5JWOB 1JLVA 2N5FA 1K0MA 4IP6A 2GZYA 3QCPA 2E7PA 3L0HA 2PVQA 1EGOA 3GH9A 4IGJA 3KEBA 2IIYA 4KDUA 2H74A 1QXHA 2IPAA 2YZHA 1M9BA 3LXTA 4NHWA 3SBCA 5DCHA 5ECKB 1XW9A 3TRPA 2MYGA 5ABRA 3DVWA 3J7Yk 4FYCA 4Q5NA 4KDXA 2OA7A 1TOFA 2GQLA 3ERFA 2QSIA 2CZ3A 2FY6A 5HFIA 4Q5RA 2R0CA 5GSTA 5D9XA 2GTUA 3GA4A 4MA9A 1A2JA 1TI3A 3LG6A 1KBNA 3LYPA 5B7CA 4GLTA 6GSTA 4HZ4A 3KD0A 3ME8A 2H0HA 2FWGA 5F0GA 5EY6A 2LJKA 4GTUA 2C8UA 2LRCA 5EPFA 1ZYPA 3APQA 4OFMA 3TKQA 3DRNA 2K8VA 1DUGA 3F4TA 4TXVA 4ZB6A 2GSTA 1V58A 4MK3A 4BWSA 2VOCA 4ECIA 4JZQA 1ZOFA 3GURA 2H1AA 3BD2A 4WR4A 2NPBA 5D9WA 3PGTA 4PQIA 5H5QA 3NZNA 2LKUA 1YEPA 3IR4A 4X0XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YQV A;  2B7K A;  3TJF A;  2HRF A;  2RM5 A;  5JWQ B;  3CXG A;  3FYG A;  3ME7 A;  4TR1 A;  4OCF A;  2P5Q A;  3IC4 A;  4ISD A;  3UVH A;  5DQS A;  2B5X A;  2VD1 A;  1MDI A;  2OAC A;  6GSX A;  2FUG 2;  2R37 A;  5G30 A;  2L59 A;  5ECO B;  3KTB A;  17GS A;  3HA9 A;  4X1U A;  1B48 A;  2YV9 A;  1M2B A;  4K6X A;  4TR1 B;  2B1K A;  3MSZ A;  1TI1 A;  5KEJ A;  1G7E A;  2P0G A;  1T1V A;  5GSS A;  2JL4 A;  1A0F A;  4IJI A;  4PQH A;  4V2M A;  4F9Z A;  1OVN A;  2A4V A;  2LST A;  4I97 A;  5IQY A;  3FK8 A;  1Q98 A;  5CRE A;  3D6I A;  6GSU A;  2H1D A;  4OMV A;  4IKH A;  5GAN D;  5G31 A;  3TGZ A;  4I2U A;  3ZRE A;  1TRU A;  2NTO A;  3ERW A;  1K3O A;  1K0B A;  1FAA A;  5DAL A;  3PR8 A;  1YJ6 A;  4MZB A;  1R4W A;  4MH3 A;  4PQ1 A;  4K7O A;  4ZB8 A;  3CSH A;  1O85 A;  5JWR B;  4KSM A;  4QL9 A;  3IE3 A;  1BAY A;  3GX8 A;  3M8N A;  2LQO A;  1SJZ A;  4XIH A;  1EEM A;  3OR5 A;  3GN3 A;  3KMN A;  4KA0 A;  2C0D A;  1A2L A;  1BX9 A;  1XWK A;  1OKT A;  5DAL B;  1WP0 A;  4J57 E;  2NBS A;  2WUL A;  2YAN A;  4KND A;  4MLY A;  2LRT A;  2LNT A;  1GSD A;  1KEB A;  3M9K A;  3KP9 A;  4TW5 A;  3QOU A;  4CHS A;  4F0B A;  1JFU A;  1GWC A;  1GSU A;  4ECC A;  3BOA A;  1CQG A;  3H93 A;  2MBS A;  5D73 A;  1T4Z A;  4XTS A;  4TR0 A;  3U5R E;  1O6J A;  3F8U A;  3RBT A;  1OAZ A;  1FOV A;  4K0N A;  1QMV A;  3KXO A;  1GNW A;  1AQW A;  3L9S A;  1U3I A;  2CVB A;  5KN2 A;  5IMZ A;  2PWJ A;  1OYJ A;  2PN8 A;  5IMD A;  5IOX A;  3TOU A;  3IOS A;  2EIQ A;  5ECS A;  5A5K A;  3G7J A;  2YPM A;  4BWQ A;  4NHZ A;  2YWN A;  2NVL A;  4KCE A;  3D4M A;  2L5L A;  1R5P A;  3D0Z A;  1Y6E A;  3V1W A;  2IMD A;  4JU5 A;  1DSB A;  4RQR A;  2AHE A;  2CVK A;  3KP8 A;  3ZFL A;  7GSS A;  2DJK A;  1C72 A;  1R5A A;  3TOT A;  4L0U A;  4MCU A;  2O8V B;  2GGT A;  2AB6 A;  3NIV A;  1YDK A;  3UMA A;  1GLQ A;  4ZIL A;  3TKR A;  1YEX A;  4TXO A;  4GF0 A;  1M7T A;  4EKZ A;  3FZ5 A;  4ZBD A;  5COH A;  5KN1 A;  3LJR A;  2RUE A;  3MWH A;  1GUK A;  3A2V A;  1JLW A;  3C8E A;  2C0G A;  4WET A;  3BJ5 A;  4GST A;  3P90 A;  2I9H A;  3F0I A;  3HJO A;  2LEG A;  4OFT A;  2ZCT A;  4GRF A;  4MMM A;  1SL0 B;  3QD9 A;  3KGK A;  3FEU A;  4TXO B;  1WJK A;  1X9S B;  4FH8 A;  3TUE A;  1Z5Y E;  4PX1 A;  2YJ7 A;  3LGC A;  2PU9 C;  5JCU A;  3G7Y A;  1SKW B;  1VGL A;  3TB2 A;  5IO2 A;  1OC3 A;  5J5N A;  3WYW A;  3IXR A;  2RUF A;  3HZ4 A;  4F2I A;  1KTE A;  3CSJ A;  1TK8 B;  3IK7 A;  3H8Q A;  14GS A;  2DIY A;  4HI7 A;  1DE1 A;  2GZP A;  4TR4 A;  2YWM A;  2AJQ B;  1XZO A;  3MDK A;  5G5E A;  4LLR A;  4X43 A;  1T3B A;  1QFN A;  4G2E A;  5G5F A;  3Q6O A;  3I6A A;  4MAB A;  2H73 A;  4ILF A;  2XBI A;  2HI7 A;  1WPI A;  2LJA A;  9GSS A;  4O32 A;  2YWO A;  1X5D A;  2B5Y A;  3G7I A;  1ST9 A;  1MTC A;  1EP7 A;  1X5C A;  2CX3 A;  2LTK A;  1T8E B;  1S3D A;  4L8E A;  2NDO A;  3CMI A;  2A2R A;  3I43 A;  2B6M A;  3ZIJ A;  2A2S A;  2M72 A;  3QFA C;  2JZT A;  2L5O A;  3FZ4 A;  4N0Z A;  3CTF A;  3L9U A;  2X8C A;  1A2M A;  3ZTL A;  3BCK A;  1OE8 A;  2WFC A;  4G19 A;  3ZVJ A;  1Z3E A;  1F37 A;  3TKS A;  1SK2 A;  5J9C A;  5ELA A;  1ILO A;  22GS A;  3EMX A;  1HD2 A;  2P5R A;  4E8H A;  1TTZ A;  2VL2 A;  5CO3 A;  2YWI A;  1K0N A;  3CBU A;  2OE1 A;  2B3S A;  3QAW A;  2VAF A;  2H0G A;  5DJL A;  5D9V A;  1XVW A;  4WR5 A;  3IRA A;  3E3E A;  4MPF A;  1ML6 A;  2H6X A;  5CYY A;  1BED A;  2C0E A;  3FW2 A;  3QAV A;  1CQH A;  1G0T A;  2B5E A;  5HQP A;  4RQX A;  1PSQ A;  2L4Q A;  3GHA A;  5GZZ B;  1M9A A;  1EP8 A;  2KOK A;  2OE0 A;  5DJM A;  1GUM A;  3ZZX A;  3M1G A;  3VUR A;  2IWT A;  2DJ2 A;  3EU3 A;  4ULX A;  4JBB A;  4F0C A;  4V1A g;  3TRQ A;  2WJU A;  3DKS A;  2EC4 A;  1QK8 A;  2DSA A;  3GFK A;  1EZK A;  2B1L A;  2X64 A;  2IFQ A;  1RQM A;  2YNX A;  4WXT A;  4V2L A;  2VLV A;  3VWW A;  4YQM A;  2R6K A;  3GST A;  6GSV A;  2F3M A;  4EDY A;  1GSY A;  4PUR A;  3F3Q A;  1B9X C;  1TK0 B;  3TJJ A;  2HE3 A;  1IYI A;  3LFL A;  1GSF A;  4HS1 A;  2CX4 A;  4EL1 A;  3RPN A;  5JCW A;  3C1R A;  3HVV A;  2ALB A;  1ON4 A;  1I5G A;  2AV4 A;  2IFQ B;  3IAM 2;  1GTA A;  1WWJ A;  1PX6 A;  5H5R A;  3FR3 A;  2HT9 A;  1OC9 A;  3FZA A;  2OBI A;  5DAK B;  2F9S A;  3LYK A;  1XFL A;  2JZR A;  2PPT A;  3WT1 A;  4OFN A;  1M99 A;  2H72 A;  1ZCP A;  2BJX A;  1Q4J A;  4ML1 A;  4K1F A;  1FHE A;  20GS A;  2FA4 A;  2K6V A;  2LRN A;  2H0I A;  2HSH A;  4I8B A;  1UN2 A;  2H75 A;  2VM2 A;  2C1Y A;  2IJY A;  4FO5 A;  2I3Y A;  3APO A;  1UC7 A;  2FCH A;  5D93 A;  3GL3 A;  3HKR A;  3J7Y b;  5EVO A;  3D22 A;  4ACS A;  4FYB A;  3HXS A;  3UL3 A;  1F3B A;  4G9H A;  1VRS D;  1J0F A;  2XC2 A;  4KH7 A;  3GSS A;  1XVQ A;  6GSY A;  3ZL5 A;  1AUC A;  2FWH A;  3SWL A;  2CVD A;  2QC7 A;  3AY8 A;  4DEJ A;  1PD2 1;  1XXU A;  1S3C A;  3VPT A;  3Q19 A;  5B8B A;  2R4V A;  2F8F A;  5E4W A;  1YY7 A;  3GNJ A;  3IA1 A;  2JAD A;  2RII A;  4WBR D;  3RPP A;  1QUW A;  1SK0 A;  1LU4 A;  1M0U A;  2VD0 A;  3HY2 A;  1ZYQ B;  4I2T A;  4K8M A;  1MDK A;  3FKF A;  4EVM A;  4XS1 A;  2MMO A;  3LOR A;  18GS A;  4NV5 A;  3EU4 A;  5ID2 A;  1XWG A;  1KNG A;  2FA8 A;  1SK1 A;  2DJ3 A;  1USB A;  2H71 A;  4ECJ A;  1K0O A;  4HUA A;  1X0R A;  2CAQ A;  4CDO A;  5J41 A;  2HFD A;  4NV2 A;  1ZMA A;  4YAP A;  1FB6 A;  1PX7 A;  3F3R A;  2H1B A;  5L71 A;  4EC0 A;  3KH7 A;  3LEF A;  2GSS A;  2MMZ A;  2TRX A;  4DSQ A;  1F3A A;  3DWV A;  2IN3 A;  2BTO T;  4KE3 A;  4GQF A;  1BJX A;  3GUS A;  5LCZ A;  1QQ2 A;  2H8L A;  5F8B A;  3M0F A;  1V2A A;  2AYT A;  1X9W B;  3I9V 2;  2FLS A;  4PUA A;  2LNS A;  4HDE A;  2G2Q A;  5IMC A;  3M3M A;  2YCD A;  3IDV A;  1SJ6 A;  3VWV A;  1AQV A;  1Y25 A;  1FO5 A;  2QKE A;  1U87 A;  4NXI A;  1VF4 A;  3N9J A;  1TK5 B;  4GWR A;  3E9J B;  2E2G A;  2OKA A;  2XBQ A;  4PNF A;  1XPV A;  4PUF C;  2XHF A;  4MJA A;  4OD7 A;  1MD3 A;  2FD3 A;  1XOA A;  3HZ8 A;  3WD6 A;  5CP1 A;  1HQO A;  5HR3 A;  4BVY A;  2V41 A;  4V2N A;  1ZZY A;  2GT6 A;  3ISO A;  3ZML A;  2H1G A;  2H76 A;  1K0C A;  3FR9 A;  5KN3 A;  4TVE A;  2M80 A;  2PBJ A;  4OO4 A;  2L6D A;  3US3 A;  1OE7 A;  3N5O A;  1TW9 A;  2N5B A;  2WGR A;  1XW5 A;  1THX A;  3EYT A;  1O8X A;  2QGV A;  1TXX A;  2F8A A;  3APS A;  2MMN A;  2YN1 A;  5AN1 A;  4F03 A;  3TJB A;  5H5S A;  1M2D A;  13GS A;  5DBQ A;  2CA8 A;  3GKX A;  4WKW A;  1VF2 A;  5ECR B;  2XPD A;  5A4V A;  1O81 A;  3UVT A;  2DJ1 A;  4N0V A;  2D2Z A;  2X8H A;  5D96 A;  2R3X A;  2XPE A;  1YF0 A;  1JZW A;  1JZR A;  2L6C A;  3FZ9 A;  4MZC A;  2VL3 A;  4NAX A;  1U88 A;  1GTI A;  4AGS A;  3PH9 A;  6GSW A;  4Q5F A;  3C71 A;  4JR6 A;  5ENU A;  3F9U A;  3UAP A;  2JSZ A;  4MH2 A;  4O7H A;  1EOG A;  5CAX A;  2K9F A;  3CRT A;  2DIZ A;  19GS A;  2GSR A;  3TDG A;  4K0G A;  3NOF A;  3FRC A;  4MZW A;  4N30 A;  1G6Y A;  8GSS A;  1EGR A;  2GT5 A;  4EDZ A;  1GLP A;  3DVX A;  4MF5 A;  1J9B A;  1F6M C;  2RM6 A;  1VF3 A;  2X8G A;  2PMT A;  2H66 A;  3L9V A;  1LBK A;  2K18 A;  1V57 A;  3KMO A;  2YV7 A;  4BPY A;  2PER A;  2FWE A;  3EWL A;  3QAG A;  2VCT A;  4IBP A;  3IAS 2;  2H70 A;  4POK A;  3HYP A;  1WE0 A;  3ZMK A;  1PKW A;  2WRT A;  5CRW A;  2KP2 A;  2JAC A;  2C4J A;  2L57 A;  4JR4 A;  3ZVJ D;  1AIU A;  4MF7 A;  1GTB A;  5IIZ A;  3HHV A;  1SKS B;  2IME A;  5CRH A;  1WIK A;  1A8Y A;  2C80 A;  5ECH B;  3VLN A;  3A5W A;  1SJI A;  4H86 A;  4K7I A;  3R2Q A;  2WS2 A;  2DC5 A;  1JHB A;  1I9D A;  3WT2 A;  3EIN A;  4POL A;  2VCX A;  3UOM A;  3O6T A;  4KUN A;  4K2D A;  5INY A;  1YQ1 A;  1O8W A;  1U3A A;  3RHC A;  2OAD A;  2GQK A;  3VFI A;  1FB0 A;  1WRY A;  2FGX A;  2VCV A;  4XS6 A;  5AIX A;  3BBY A;  4ECB A;  4TRX A;  3IV4 A;  2YP6 A;  3QMX A;  4KSO A;  2HSY A;  2VLU A;  3QR6 A;  4LMV A;  1K0D A;  5HR2 A;  3UBK A;  3DXB A;  4G10 A;  2HXK A;  5DCG A;  4LL4 B;  4EXJ A;  3F6F A;  1PKZ A;  4N10 A;  1GSQ A;  3HJP A;  2GZZ A;  2FHE A;  5GAP D;  2TRC P;  5LD0 A;  3ZIT A;  3VPQ A;  2ON7 A;  3MNG A;  1XCC A;  3ED3 A;  1H75 A;  3D5J A;  5J9B A;  11GS A;  4ZL7 A;  1Z6M A;  3HDC A;  1GP1 A;  1TRV A;  1HNC A;  2E2M A;  5HR1 A;  2N5A A;  2V1M A;  1GH2 A;  2ES7 A;  3Q74 A;  3A3T A;  1BYE A;  1PL1 A;  5DVB A;  5C00 A;  2PVO C;  4IQ1 A;  2FNO A;  4O5R A;  2H6Z A;  2O89 A;  4BVX A;  2V6K A;  1M2A A;  4Q5Q A;  5IMA A;  3LWA A;  5D8I A;  1A0R P;  1B4P A;  1J08 A;  1NHO A;  1OKD A;  3TKP A;  2GVP A;  3IPZ A;  2Z9S A;  2H6Y A;  1SEN A;  3IBH A;  4HOJ A;  4IW9 A;  4WEY A;  1JZD A;  1GTU A;  3P2A A;  4KW6 A;  1E6B A;  1V98 A;  1EV4 A;  3A2W A;  1BQ7 A;  1TJD A;  2I4A A;  5D9T A;  3LSZ A;  2O85 A;  1XW6 A;  2HZF A;  3CRU A;  2EIR A;  3TKS E;  5JCG A;  5ECN B;  1VF1 A;  5B6M A;  1E2Y A;  1URM A;  2CQ9 A;  1PQN A;  1XWC A;  4FIW A;  2DLX A;  2VUP A;  1SD9 A;  3DIE A;  3CYN A;  1GL8 A;  4ML6 A;  3UIW A;  1QGV A;  2R2J A;  2V32 A;  1OC9 B;  1PN9 A;  1YKA A;  5LNK e;  1AW9 A;  1T4Y A;  3UBL A;  4MDC A;  1A8L A;  4IJ3 A;  1AAZ A;  5EL8 A;  3P8W A;  4TKY A;  2LQQ A;  4D73 A;  1NHY A;  2KUC A;  2TIR A;  3KIJ A;  4I6X A;  3UEM A;  3LXZ A;  3K8N A;  1A23 A;  3ZIV A;  4IP1 A;  3TKS C;  2VCW A;  1TU7 A;  3GL5 A;  2JZS A;  4KCA A;  10GS A;  2ZUP A;  3KJY A;  2YOI A;  3QFB C;  2WZ9 A;  1WMJ A;  2VL2 C;  4D73 B;  1K3Y A;  2EIO A;  3CTG A;  1THO A;  2PGT A;  1SYR A;  4PGT A;  3UAR A;  4K7N A;  2DJJ A;  5AIS A;  1S3A A;  4IHU A;  1TU8 A;  2MMA A;  2JSY A;  1GSE A;  3D21 A;  3U6V A;  1TP9 A;  1ABA A;  3LQ7 A;  1PL2 A;  3ZRD A;  3TJK A;  3QDN A;  4JE1 A;  2B7J A;  4HZ2 A;  3VK9 A;  4RI6 A;  2HRN A;  4MJC A;  3UJ1 A;  1TRW A;  3H79 A;  1R7H A;  1PGT A;  1B4Q A;  3VI7 A;  1XWB A;  3VWX A;  4GXZ A;  2HZE A;  1DBY A;  4P3Y B;  1BG5 A;  1N2A A;  2F51 A;  4POB A;  5B8A A;  3VWU A;  1GSS A;  3DGQ A;  5ID2 B;  1V40 A;  1GRX A;  5AIV A;  2VM1 A;  2KLX A;  1X9M B;  2ON5 A;  2OJL A;  2IMF A;  1OC8 A;  2HZE B;  1V9W A;  2GSQ A;  4OCE A;  6GSS A;  3EC3 A;  4NWY A;  3RHB A;  4F82 A;  5A4W A;  2C3N A;  3G9B A;  4HU7 A;  1W89 A;  5KN0 A;  1XBS A;  3HVX A;  3FY7 A;  3WGD A;  4EO3 A;  4TN8 A;  1NM3 A;  4XHM A;  3GX0 A;  4MJE A;  1LJR A;  2FWF A;  4E8E A;  2O87 A;  1A24 A;  3KTL A;  4IS0 A;  5B6N A;  3QPM A;  2VCZ A;  1RW1 A;  4Z7X A;  4LMW A;  3GV1 A;  3C1S A;  3GYK A;  3DML A;  1X5E A;  5E59 A;  5F06 A;  1O73 A;  2K8S A;  2BMX A;  2VO4 A;  1ERU A;  1Z7P A;  4KGI A;  2KHP A;  3EVI A;  4RUV A;  5CRG A;  3EMP A;  4KDY A;  5F05 A;  2J9H A;  4POM A;  1Z6N A;  4EUY A;  4HQS A;  1SYX A;  2DML A;  3PIN A;  5HFG A;  2IL3 A;  2I81 A;  5ECP B;  2C3Q A;  1N8J A;  5IM9 A;  1PMT A;  2GLR A;  1U6T A;  3BCI A;  2VL9 A;  3IHQ A;  3F4S A;  4GQC A;  3TCO A;  5IPH A;  4QL7 A;  4DSS A;  1XIY A;  1YZX A;  3W8J A;  1F2E A;  4L5O A;  1XOB A;  4CW9 A;  3F63 A;  5F07 A;  3KCM A;  1GNE A;  2E0Q A;  3I69 A;  4YAV A;  1EV9 A;  1ERV A;  2WCI A;  2DMM A;  5G2Z A;  4GSS A;  3ZLP A;  4XS4 A;  4AJ8 A;  2HLS A;  4GCI A;  4DSS B;  1ERW A;  3DD3 A;  4LA1 A;  2MZC A;  4FYU A;  3H4K A;  4BL7 A;  1DE2 A;  2LV3 A;  1EOH A;  2VCQ A;  5C04 A;  1EEJ A;  3FR6 A;  4XCS A;  5ECM B;  1Z9H A;  4KB3 A;  4EF0 A;  2OE3 A;  4XS4 B;  1GUL A;  1AXD A;  3L4N A;  1TKD B;  3O3T A;  3GKK A;  1K3L A;  3O76 A;  4KAE A;  1WOU A;  4YQU A;  2P31 A;  1W4V A;  1HYU A;  2LJR A;  1ZL9 A;  3ZFB A;  1EWX A;  2J23 A;  3F6D A;  1F9M A;  3KZQ A;  4TOP A;  5ECQ B;  4N11 A;  4ZIJ A;  4MF6 A;  5CRD A;  5FT3 A;  4HJM A;  2IMI A;  1T7P B;  4PXO A;  3GTU A;  4ZBB A;  3GKM A;  5IMV A;  1G7O A;  2HNL A;  3EE2 A;  2REM A;  1ERT A;  1ACV A;  4OWY A;  1FVK A;  2C0F A;  4BA7 A;  1G6W A;  1Z7R A;  3HCZ A;  3F4R A;  3GTU B;  4ZL8 A;  5G1L A;  4MP4 A;  4OO5 A;  1B8X A;  2PUK C;  4IEL A;  3VI5 A;  4JRR A;  1HNB A;  3A2X A;  1SL1 B;  5AGY A;  2C3T A;  2JU5 A;  2GQM A;  3C7M A;  5ELG A;  4I5Q A;  1SKR B;  5J4U A;  1R26 A;  2DBC A;  2I1U A;  3GH6 A;  4AJ7 A;  4J2F A;  1TDI A;  4L0W A;  1NSW A;  1MEK A;  1FG4 A;  2LUS A;  3TJG A;  5DDL A;  4J56 E;  3DEX A;  4AF2 A;  1FVJ A;  1JZO A;  2RLI A;  4EE0 A;  4KX4 A;  2CAI A;  3Q18 A;  3DYR A;  4TR3 A;  1TRS A;  4GSN A;  4PNG A;  1H4O A;  3WGX A;  1HNA A;  3HD5 A;  1RK4 A;  3S9F A;  3GMF A;  4V1A p;  2CT6 A;  1UVZ A;  5HR0 A;  2H19 A;  1MDJ A;  2H01 A;  3W6G A;  1XWA A;  2VLT A;  2H30 A;  2V6O A;  1MD4 A;  2AAW A;  5FWG A;  2GS3 A;  4YH2 A;  2IMK A;  5FHI A;  3GIX A;  5ECI B;  3FHK A;  5DQY A;  3W8S A;  4LL1 B;  1SD8 A;  1IYH A;  4IN0 A;  3HJM A;  3RDW A;  3EUR A;  2YJH A;  4HJ2 A;  4ZXG A;  3M9J A;  2LS5 A;  1UA5 A;  1SU9 A;  4MPG A;  2WDU A;  1O7U A;  1PRX A;  3KM6 A;  4WBJ A;  2OBK A;  5IPG A;  3L78 A;  1PA3 A;  1ZGN A;  4NMU A;  1AC1 A;  2CV4 A;  5CNW A;  3HVS A;  4O92 A;  2L4C A;  2V2G A;  1YKC A;  5A4U A;  3WGE A;  2AUV A;  2R5G A;  2YZU A;  3GRX A;  3D4T A;  1NW2 A;  2O7K A;  1YF1 A;  3ZYW A;  3E0U A;  2WB9 A;  4AJ6 A;  5ECL B;  3TRX A;  5J3R A;  3P7X A;  16GS A;  4HU9 A;  5IO0 A;  1AQX A;  2CZ2 A;  5IMF A;  3IK9 A;  4HEA 2;  4ZL9 A;  2MBT A;  2X99 A;  2M46 A;  3C73 A;  1FW1 A;  4IQA A;  5G1K A;  1SL2 B;  2GDR A;  3H1N A;  4DSR A;  3KH9 A;  1K0A A;  4RI7 A;  3CSI A;  5IOW A;  4QQ7 A;  2VIM A;  4JED A;  4MJB A;  4XRD A;  4ZB9 A;  4IVF A;  3RAZ A;  3JCM L;  3GKN A;  4WF5 A;  4HQZ A;  4ID0 A;  1GUH A;  4ZBA A;  4K9Z A;  12GS A;  1T00 A;  3MAK A;  5DAK A;  4XRA A;  2KP1 A;  4DVC A;  2G0F A;  4WF4 A;  3ERG A;  5HFK A;  4L5L A;  2DJ0 A;  1B9Y C;  1ZYE A;  2ZNM A;  2HYX A;  4NPB A;  5JWO B;  1JLV A;  2N5F A;  1K0M A;  4IP6 A;  2GZY A;  3QCP A;  2E7P A;  3L0H A;  2PVQ A;  1EGO A;  3GH9 A;  4IGJ A;  3KEB A;  2IIY A;  4KDU A;  2H74 A;  1QXH A;  2IPA A;  2YZH A;  1M9B A;  3LXT A;  4NHW A;  3SBC A;  5DCH A;  5ECK B;  1XW9 A;  3TRP A;  2MYG A;  5ABR A;  3DVW A;  3J7Y k;  4FYC A;  4Q5N A;  4KDX A;  2OA7 A;  1TOF A;  2GQL A;  3ERF A;  2QSI A;  2CZ3 A;  2FY6 A;  5HFI A;  4Q5R A;  5GST A;  5D9X A;  2GTU A;  3GA4 A;  4MA9 A;  1A2J A;  1TI3 A;  3LG6 A;  1KBN A;  3LYP A;  5B7C A;  4GLT A;  6GST A;  4HZ4 A;  3KD0 A;  3ME8 A;  2H0H A;  2FWG A;  5F0G A;  5EY6 A;  2LJK A;  4GTU A;  2C8U A;  2LRC A;  5EPF A;  3APQ A;  4OFM A;  3TKQ A;  3DRN A;  2K8V A;  1DUG A;  3F4T A;  4TXV A;  4ZB6 A;  2GST A;  1V58 A;  4MK3 A;  4BWS A;  2VOC A;  4ECI A;  4JZQ A;  1ZOF A;  3GUR A;  2H1A A;  3BD2 A;  4WR4 A;  2NPB A;  5D9W A;  3PGT A;  4PQI A;  5H5Q A;  3NZN A;  2LKU A;  1YEP A;  3IR4 A;  4X0X A; 
#chains in the Genus database with same CATH topology
 4YQV A;  2B7K A;  3TJF A;  2HRF A;  2RM5 A;  5JWQ B;  3CXG A;  3FYG A;  3ME7 A;  4TR1 A;  4ICY A;  4OCF A;  2P5Q A;  3IC4 A;  4ISD A;  3UVH A;  5DQS A;  2B5X A;  2VD1 A;  1MDI A;  2OAC A;  6GSX A;  2FUG 2;  2R37 A;  5G30 A;  2L59 A;  5ECO B;  3KTB A;  17GS A;  3HA9 A;  4X1U A;  1B48 A;  2YV9 A;  5BRT A;  1M2B A;  4K6X A;  4TR1 B;  2B1K A;  3MSZ A;  1TI1 A;  5KEJ A;  1G7E A;  2P0G A;  1T1V A;  5GSS A;  2JL4 A;  1A0F A;  4IJI A;  4PQH A;  4V2M A;  4F9Z A;  1OVN A;  2A4V A;  2LST A;  4I97 A;  5IQY A;  3FK8 A;  1Q98 A;  5CRE A;  3D6I A;  6GSU A;  2H1D A;  4OMV A;  4IKH A;  5GAN D;  5G31 A;  3TGZ A;  4I2U A;  3ZRE A;  1TRU A;  2NTO A;  3ERW A;  1K3O A;  1K0B A;  1FAA A;  5DAL A;  3PR8 A;  1YJ6 A;  4MZB A;  1R4W A;  4MH3 A;  4PQ1 A;  4K7O A;  4ZB8 A;  3CSH A;  1O85 A;  4YKG A;  5JWR B;  4KSM A;  4QL9 A;  3IE3 A;  1BAY A;  3GX8 A;  3M8N A;  2LQO A;  1SJZ A;  4XIH A;  1EEM A;  3OR5 A;  3GN3 A;  3KMN A;  4KA0 A;  2C0D A;  1A2L A;  1BX9 A;  1XWK A;  1OKT A;  5DAL B;  1WP0 A;  4J57 E;  2NBS A;  2WUL A;  2YAN A;  4KND A;  4MLY A;  2LRT A;  2LNT A;  1GSD A;  1KEB A;  3M9K A;  3KP9 A;  4TW5 A;  3QOU A;  4CHS A;  4F0B A;  1JFU A;  1GWC A;  1GSU A;  4ECC A;  3BOA A;  4KF9 A;  1CQG A;  3H93 A;  2MBS A;  5D73 A;  1T4Z A;  4XTS A;  4TR0 A;  3U5R E;  1O6J A;  3F8U A;  3RBT A;  1OAZ A;  1FOV A;  4K0N A;  1QMV A;  4K2X A;  3KXO A;  1GNW A;  1M3J A;  1AQW A;  3L9S A;  1U3I A;  2CVB A;  5KN2 A;  5IMZ A;  2PWJ A;  1OYJ A;  2PN8 A;  5IMD A;  5IOX A;  3TOU A;  3IOS A;  2EIQ A;  5ECS A;  5A5K A;  3G7J A;  2YPM A;  4BWQ A;  4NHZ A;  2YWN A;  2NVL A;  4KCE A;  3D4M A;  2L5L A;  1R5P A;  3D0Z A;  1Y6E A;  3V1W A;  2IMD A;  2X49 A;  4JU5 A;  1DSB A;  4RQR A;  2AHE A;  2CVK A;  3KP8 A;  3ZFL A;  7GSS A;  2DJK A;  1C72 A;  1R5A A;  3TOT A;  4L0U A;  4MCU A;  2O8V B;  2GGT A;  2AB6 A;  3NIV A;  1YDK A;  3UMA A;  1GLQ A;  4ZIL A;  3TKR A;  1YEX A;  4TXO A;  4GF0 A;  1M7T A;  4EKZ A;  3FZ5 A;  4ZBD A;  5COH A;  5KN1 A;  3LJR A;  2RUE A;  3MWH A;  3MYD A;  1GUK A;  3A2V A;  1JLW A;  3C8E A;  2C0G A;  4WET A;  3BJ5 A;  4GST A;  3P90 A;  2I9H A;  3F0I A;  3HJO A;  2LEG A;  4OFT A;  2ZCT A;  4GRF A;  4MMM A;  1SL0 B;  2HSM A;  3IHG A;  3QD9 A;  3KGK A;  3FEU A;  4TXO B;  1WJK A;  1X9S B;  4FH8 A;  3TUE A;  1Z5Y E;  4PX1 A;  2YJ7 A;  3LGC A;  2PU9 C;  5JCU A;  3G7Y A;  4EIQ A;  1SKW B;  1VGL A;  3TB2 A;  5IO2 A;  1OC3 A;  5J5N A;  3WYW A;  3IXR A;  2RUF A;  3HZ4 A;  4F2I A;  1KTE A;  3CSJ A;  1TK8 B;  3IK7 A;  3H8Q A;  14GS A;  2DIY A;  4HI7 A;  1DE1 A;  2GZP A;  4TR4 A;  2YWM A;  2AJQ B;  1XZO A;  3MDK A;  5G5E A;  4LLR A;  4X43 A;  1T3B A;  1QFN A;  4G2E A;  5G5F A;  3Q6O A;  3I6A A;  4MAB A;  2H73 A;  4ILF A;  2XBI A;  2HI7 A;  1WPI A;  2LJA A;  9GSS A;  4O32 A;  2YWO A;  1X5D A;  2B5Y A;  3G7I A;  1ST9 A;  1MTC A;  1EP7 A;  1X5C A;  2CX3 A;  2LTK A;  1T8E B;  1S3D A;  4L8E A;  2NDO A;  3CMI A;  2A2R A;  3I43 A;  2DKH A;  2B6M A;  3ZIJ A;  2A2S A;  2M72 A;  3QFA C;  2JZT A;  2L5O A;  3FZ4 A;  4N0Z A;  3CTF A;  3L9U A;  2X8C A;  1A2M A;  3ZTL A;  3BCK A;  1OE8 A;  2WFC A;  4G19 A;  3ZVJ A;  1Z3E A;  1F37 A;  3TKS A;  1SK2 A;  5J9C A;  5ELA A;  1ILO A;  22GS A;  3EMX A;  1HD2 A;  3EPT A;  2P5R A;  4E8H A;  1TTZ A;  2VL2 A;  5CO3 A;  2YWI A;  1K0N A;  3CBU A;  2OE1 A;  2B3S A;  3QAW A;  2VAF A;  2H0G A;  5DJL A;  5D9V A;  1XVW A;  4WR5 A;  3IRA A;  3E3E A;  4MPF A;  1ML6 A;  2H6X A;  5CYY A;  1BED A;  2C0E A;  3FW2 A;  4G0L A;  3QAV A;  1CQH A;  1G0T A;  2B5E A;  5HQP A;  4RQX A;  1PSQ A;  2L4Q A;  3GHA A;  5GZZ B;  1M9A A;  1EP8 A;  4BIK A;  2KOK A;  2OE0 A;  1GUM A;  5DJM A;  3ZZX A;  3M1G A;  3VUR A;  2IWT A;  2DJ2 A;  3EU3 A;  4ULX A;  4JBB A;  4F0C A;  4V1A g;  3TRQ A;  2WJU A;  3DKS A;  2EC4 A;  1QK8 A;  4USS A;  2DSA A;  3GFK A;  1EZK A;  2B1L A;  2X64 A;  2IFQ A;  1RQM A;  2YNX A;  4WXT A;  4V2L A;  2VLV A;  3VWW A;  4YQM A;  2R6K A;  3GST A;  6GSV A;  2F3M A;  4EDY A;  1GSY A;  4PUR A;  3F3Q A;  1B9X C;  1TK0 B;  3TJJ A;  2HE3 A;  1IYI A;  3LFL A;  1GSF A;  4HS1 A;  2CX4 A;  4EL1 A;  3RPN A;  5JCW A;  3C1R A;  2A2P A;  2ALB A;  1ON4 A;  3HVV A;  1I5G A;  2AV4 A;  2IFQ B;  3IAM 2;  1GTA A;  1WWJ A;  1PX6 A;  5H5R A;  3FR3 A;  2HT9 A;  1OC9 A;  3FZA A;  2OBI A;  5DAK B;  2F9S A;  4Z2U A;  3LYK A;  1XFL A;  2JZR A;  2PPT A;  3WT1 A;  4OFN A;  1M99 A;  2H72 A;  1ZCP A;  2BJX A;  1Q4J A;  4ML1 A;  4K1F A;  1FHE A;  20GS A;  2FA4 A;  4FQU A;  2K6V A;  2LRN A;  2H0I A;  2HSH A;  4I8B A;  1UN2 A;  2H75 A;  2VM2 A;  2C1Y A;  2IJY A;  4FO5 A;  2I3Y A;  3APO A;  1UC7 A;  2FCH A;  4CY6 A;  5D93 A;  3GL3 A;  3HKR A;  3J7Y b;  3A5I A;  5EVO A;  3D22 A;  4ACS A;  4FYB A;  3HXS A;  3UL3 A;  1F3B A;  4G9H A;  3MIX A;  1VRS D;  1J0F A;  2XC2 A;  4KH7 A;  3GSS A;  1XVQ A;  6GSY A;  3ZL5 A;  1AUC A;  4G0I A;  2FWH A;  3SWL A;  2CVD A;  2QC7 A;  3AY8 A;  4DEJ A;  1PD2 1;  1XXU A;  1S3C A;  3VPT A;  3Q19 A;  5B8B A;  2R4V A;  2F8F A;  5E4W A;  1YY7 A;  3GNJ A;  3HVN A;  3IA1 A;  2JAD A;  2RII A;  4WBR D;  3RPP A;  1QUW A;  1SK0 A;  1LU4 A;  1M0U A;  2VD0 A;  3HY2 A;  1ZYQ B;  4I2T A;  4K8M A;  4O5U A;  1MDK A;  4A5P A;  3FKF A;  4EVM A;  4XS1 A;  2MMO A;  3LOR A;  18GS A;  4NV5 A;  3EU4 A;  5ID2 A;  1XWG A;  1KNG A;  2FA8 A;  1SK1 A;  2DJ3 A;  1USB A;  2H71 A;  2QA1 A;  4ECJ A;  1K0O A;  4HUA A;  1X0R A;  2CAQ A;  4CDO A;  5J41 A;  2HFD A;  4NV2 A;  1ZMA A;  4YAP A;  1FB6 A;  1PX7 A;  3F3R A;  2H1B A;  5L71 A;  4EC0 A;  3KH7 A;  3LEF A;  2GSS A;  2MMZ A;  2TRX A;  4DSQ A;  1F3A A;  3DWV A;  2IN3 A;  2BTO T;  4KE3 A;  4GQF A;  1BJX A;  3GUS A;  1PFO A;  5LCZ A;  4X4J A;  1QQ2 A;  2H8L A;  5F8B A;  2A4H A;  3M0F A;  1V2A A;  2AYT A;  1X9W B;  4Z2R A;  3I9V 2;  2FLS A;  4PUA A;  2LNS A;  4HDE A;  3LW9 A;  2G2Q A;  5IMC A;  5BMU A;  3M3M A;  2YCD A;  3IDV A;  1SJ6 A;  3VWV A;  1AQV A;  1Y25 A;  1FO5 A;  2QKE A;  1U87 A;  4NXI A;  4K5S A;  1VF4 A;  4K5R A;  3N9J A;  1TK5 B;  4GWR A;  3E9J B;  2E2G A;  2OKA A;  2XBQ A;  4PNF A;  1XPV A;  4PUF C;  2XHF A;  5KOX A;  4MJA A;  3IC8 A;  4OD7 A;  1MD3 A;  2FD3 A;  1XOA A;  3HZ8 A;  3WD6 A;  5CP1 A;  1HQO A;  5HR3 A;  4BVY A;  2V41 A;  4V2N A;  1ZZY A;  2GT6 A;  2QA2 A;  3ISO A;  3ZML A;  2H1G A;  2H76 A;  1K0C A;  3FR9 A;  5KN3 A;  4TVE A;  2M80 A;  2PBJ A;  4OO4 A;  2L6D A;  3US3 A;  1OE7 A;  3N5O A;  1TW9 A;  2N5B A;  2WGR A;  4BVY B;  1XW5 A;  1THX A;  1XG8 A;  3EYT A;  1O8X A;  2QGV A;  1TXX A;  2F8A A;  3APS A;  2MMN A;  2YN1 A;  5AN1 A;  4F03 A;  3TJB A;  5H5S A;  1M2D A;  13GS A;  5DBQ A;  2CA8 A;  3GKX A;  4WKW A;  1VF2 A;  5ECR B;  2XPD A;  5A4V A;  1O81 A;  3UVT A;  2DJ1 A;  4N0V A;  2D2Z A;  2X8H A;  5D96 A;  2R3X A;  2XPE A;  1YF0 A;  1JZW A;  1JZR A;  2L6C A;  3FZ9 A;  4MZC A;  2VL3 A;  4NAX A;  1U88 A;  1GTI A;  4AGS A;  3PH9 A;  6GSW A;  4Q5F A;  3C71 A;  4JR6 A;  5ENU A;  3F9U A;  3UAP A;  2JSZ A;  4MH2 A;  4O7H A;  1EOG A;  5CAX A;  2K9F A;  3CRT A;  2DIZ A;  19GS A;  2GSR A;  3TDG A;  4K0G A;  3NOF A;  3FRC A;  4MZW A;  4N30 A;  1G6Y A;  8GSS A;  1EGR A;  2GT5 A;  2HRK A;  4EDZ A;  1GLP A;  3DVX A;  4MF5 A;  1J9B A;  1F6M C;  2RM6 A;  1VF3 A;  2X8G A;  2PMT A;  2H66 A;  3L9V A;  1LBK A;  2K18 A;  1V57 A;  3KMO A;  2YV7 A;  4BPY A;  2PER A;  2FWE A;  3EWL A;  3QAG A;  2VCT A;  4IBP A;  3IAS 2;  2H70 A;  4POK A;  3HYP A;  1WE0 A;  3ZMK A;  1PKW A;  2WRT A;  5CRW A;  2KP2 A;  4PTS A;  2JAC A;  2C4J A;  3CQF A;  2L57 A;  4JR4 A;  3ZVJ D;  1AIU A;  4MF7 A;  1GTB A;  5IIZ A;  3HHV A;  1SKS B;  2IME A;  5CRH A;  1WIK A;  1A8Y A;  2C80 A;  5ECH B;  3VLN A;  3A5W A;  1SJI A;  4H86 A;  4K7I A;  3R2Q A;  2WS2 A;  2DC5 A;  1JHB A;  1I9D A;  3WT2 A;  3EIN A;  4POL A;  2VCX A;  3UOM A;  3O6T A;  4KUN A;  3R3E A;  4K2D A;  1YQ1 A;  5INY A;  1O8W A;  1U3A A;  3RHC A;  2OAD A;  2GQK A;  3VFI A;  1FB0 A;  1WRY A;  2FGX A;  2VCV A;  1ZYN A;  4XS6 A;  5AIX A;  3BBY A;  4ECB A;  4TRX A;  3IV4 A;  2YP6 A;  3QMX A;  4KSO A;  2HSY A;  2VLU A;  3QR6 A;  4LMV A;  1K0D A;  5HR2 A;  3UBK A;  3DXB A;  4G10 A;  2HXK A;  5DCG A;  4LL4 B;  4EXJ A;  3F6F A;  1PKZ A;  4N10 A;  1GSQ A;  3HJP A;  2GZZ A;  2FHE A;  5GAP D;  2TRC P;  5LD0 A;  3ZIT A;  1FOH A;  3VPQ A;  2ON7 A;  3MNG A;  1XCC A;  3ED3 A;  1H75 A;  3D5J A;  4YKF A;  5J9B A;  11GS A;  4ZL7 A;  1Z6M A;  3HDC A;  1GP1 A;  1TRV A;  1HNC A;  2E2M A;  5HR1 A;  2N5A A;  2R0P A;  2V1M A;  1GH2 A;  2ES7 A;  3Q74 A;  3A3T A;  1BYE A;  1PL1 A;  5DVB A;  5C00 A;  2PVO C;  4IQ1 A;  2FNO A;  4O5R A;  2H6Z A;  2O89 A;  4BVX A;  4MNN A;  1M3I A;  2V6K A;  1M2A A;  4Q5Q A;  5IMA A;  3LWA A;  5D8I A;  1A0R P;  1B4P A;  1J08 A;  1NHO A;  1OKD A;  4BVX B;  3TKP A;  2GVP A;  3IPZ A;  2Z9S A;  2H6Y A;  1SEN A;  3IBH A;  4HOJ A;  4IW9 A;  4WEY A;  1JZD A;  1GTU A;  3P2A A;  4KW6 A;  1E6B A;  1V98 A;  1EV4 A;  3A2W A;  1BQ7 A;  1TJD A;  2I4A A;  5D9T A;  3PPU A;  3LSZ A;  2O85 A;  1XW6 A;  2HZF A;  3CRU A;  2EIR A;  3TKS E;  5JCG A;  5ECN B;  1VF1 A;  5B6M A;  1E2Y A;  1URM A;  2CQ9 A;  1PQN A;  1XWC A;  4FIW A;  2DLX A;  2VUP A;  2UZ8 A;  1SD9 A;  3DIE A;  3CYN A;  1GL8 A;  4ML6 A;  3UIW A;  1QGV A;  2R2J A;  2V32 A;  1OC9 B;  1PN9 A;  1YKA A;  5LNK e;  1AW9 A;  1T4Y A;  3UBL A;  4MDC A;  1A8L A;  4IJ3 A;  1AAZ A;  5EL8 A;  3P8W A;  4TKY A;  2LQQ A;  4D73 A;  1NHY A;  2KUC A;  2TIR A;  3KIJ A;  4I6X A;  3UEM A;  3LXZ A;  3K8N A;  1A23 A;  3ZIV A;  4IP1 A;  3TKS C;  2VCW A;  1TU7 A;  3GL5 A;  2JZS A;  4KCA A;  10GS A;  2ZUP A;  3KJY A;  2YOI A;  3QFB C;  2WZ9 A;  1WMJ A;  2VL2 C;  4D73 B;  1K3Y A;  2EIO A;  3CTG A;  1THO A;  2PGT A;  1SYR A;  4PGT A;  3UAR A;  4K7N A;  2DJJ A;  5AIS A;  1S3A A;  4IHU A;  1TU8 A;  2MMA A;  2JSY A;  1GSE A;  3D21 A;  3U6V A;  1TP9 A;  1ABA A;  3LQ7 A;  1PL2 A;  3ZRD A;  3TJK A;  3QDN A;  4JE1 A;  2B7J A;  4HZ2 A;  3VK9 A;  4RI6 A;  2HRN A;  4MJC A;  3UJ1 A;  1TRW A;  3H79 A;  1R7H A;  1PGT A;  1B4Q A;  3VI7 A;  1XWB A;  3VWX A;  4GXZ A;  2HZE A;  1DBY A;  4P3Y B;  1BG5 A;  1N2A A;  2F51 A;  4POB A;  5B8A A;  3VWU A;  1GSS A;  3DGQ A;  5ID2 B;  1V40 A;  1GRX A;  5AIV A;  2VM1 A;  2KLX A;  1X9M B;  2ON5 A;  2OJL A;  2IMF A;  1OC8 A;  2HZE B;  1V9W A;  2GSQ A;  4OCE A;  6GSS A;  3EC3 A;  4NWY A;  3RHB A;  4F82 A;  5A4W A;  2C3N A;  3G9B A;  4HU7 A;  1W89 A;  5KN0 A;  1XBS A;  3HVX A;  3FY7 A;  3WGD A;  4EO3 A;  4TN8 A;  1NM3 A;  4XHM A;  3GX0 A;  4MJE A;  1LJR A;  2FWF A;  4E8E A;  2O87 A;  1A24 A;  3KTL A;  4IS0 A;  5B6N A;  3QPM A;  2VCZ A;  1RW1 A;  4Z7X A;  4LMW A;  3GV1 A;  3C1S A;  3GYK A;  3DML A;  1X5E A;  5E59 A;  5F06 A;  1O73 A;  2K8S A;  2BMX A;  2VO4 A;  1ERU A;  1Z7P A;  4KGI A;  2KHP A;  3EVI A;  4RUV A;  5CRG A;  3EMP A;  2HRA A;  4KDY A;  5F05 A;  2J9H A;  4POM A;  1Z6N A;  4EUY A;  4HQS A;  1SYX A;  2DML A;  3PIN A;  5HFG A;  2IL3 A;  2I81 A;  5ECP B;  2C3Q A;  1N8J A;  5IM9 A;  1PMT A;  2GLR A;  1U6T A;  3BCI A;  2VL9 A;  3IHQ A;  3F4S A;  4GQC A;  3TCO A;  5IPH A;  4QL7 A;  4DSS A;  1XIY A;  1YZX A;  3W8J A;  1F2E A;  4L5O A;  1XOB A;  4CW9 A;  3F63 A;  5F07 A;  4CY8 A;  3KCM A;  1GNE A;  2E0Q A;  3I69 A;  4YAV A;  1EV9 A;  1ERV A;  2WCI A;  2DMM A;  5G2Z A;  4GSS A;  3ZLP A;  4XS4 A;  4AJ8 A;  2HLS A;  4GCI A;  4DSS B;  5KOW A;  1ERW A;  3DD3 A;  4LA1 A;  2MZC A;  4FYU A;  3H4K A;  4BL7 A;  1DE2 A;  2LV3 A;  1EOH A;  2VCQ A;  5C04 A;  1EEJ A;  3FR6 A;  4XCS A;  5ECM B;  1Z9H A;  2R0G A;  4KB3 A;  4EF0 A;  2OE3 A;  4XS4 B;  1GUL A;  1AXD A;  3L4N A;  4EIP A;  1TKD B;  4BL7 B;  3O3T A;  3GKK A;  1K3L A;  3O76 A;  4KAE A;  1WOU A;  4YQU A;  2P31 A;  4Z2T A;  1W4V A;  1HYU A;  2LJR A;  1ZL9 A;  3ZFB A;  1EWX A;  2J23 A;  3F6D A;  1F9M A;  3KZQ A;  4TOP A;  5ECQ B;  4N11 A;  4ZIJ A;  4MF6 A;  5CRD A;  5FT3 A;  4HJM A;  2IMI A;  1T7P B;  4PXO A;  3GTU A;  4ZBB A;  3GKM A;  5IMV A;  1G7O A;  2HNL A;  2DKI A;  2REM A;  3EE2 A;  1ERT A;  1ACV A;  4OWY A;  1FVK A;  2C0F A;  1S3R A;  4BA7 A;  1G6W A;  1Z7R A;  3HCZ A;  3F4R A;  3GTU B;  4ZL8 A;  5G1L A;  4MP4 A;  4OO5 A;  1B8X A;  2PUK C;  4IEL A;  3VI5 A;  4JRR A;  1HNB A;  3A2X A;  1SL1 B;  4G0K A;  5AGY A;  2C3T A;  2JU5 A;  2GQM A;  3C7M A;  5ELG A;  4I5Q A;  1SKR B;  5J4U A;  1R26 A;  2DBC A;  2I1U A;  3GH6 A;  4AJ7 A;  4J2F A;  1TDI A;  4L0W A;  1NSW A;  1MEK A;  1FG4 A;  2LUS A;  3TJG A;  5DDL A;  4J56 E;  3DEX A;  4AF2 A;  1FVJ A;  1JZO A;  2RLI A;  4EE0 A;  4KX4 A;  2CAI A;  3Q18 A;  3DYR A;  4TR3 A;  1TRS A;  4GSN A;  4PNG A;  1H4O A;  3WGX A;  1HNA A;  3HD5 A;  1RK4 A;  3S9F A;  3GMF A;  4V1A p;  2CT6 A;  1UVZ A;  5HR0 A;  2H19 A;  1MDJ A;  2H01 A;  3W6G A;  1XWA A;  2VLT A;  2H30 A;  2V6O A;  1MD4 A;  2AAW A;  5FWG A;  2GS3 A;  4YH2 A;  2IMK A;  5FHI A;  3GIX A;  5ECI B;  3FHK A;  5DQY A;  3W8S A;  4LL1 B;  4O5Q A;  1SD8 A;  1IYH A;  4IN0 A;  3HJM A;  3RDW A;  3EUR A;  2YJH A;  4HJ2 A;  4ZXG A;  3M9J A;  2LS5 A;  1UA5 A;  1SU9 A;  4MPG A;  2WDU A;  1O7U A;  1PRX A;  3KM6 A;  4WBJ A;  2OBK A;  5IPG A;  3L78 A;  1PA3 A;  1ZGN A;  4NMU A;  1AC1 A;  2CV4 A;  5CNW A;  3HVS A;  4O92 A;  2L4C A;  2V2G A;  1YKC A;  5A4U A;  3WGE A;  2AUV A;  2R5G A;  2YZU A;  3GRX A;  3D4T A;  1NW2 A;  2O7K A;  1YF1 A;  3ZYW A;  3E0U A;  2WB9 A;  4AJ6 A;  5ECL B;  3TRX A;  5J3R A;  3P7X A;  16GS A;  3FMW A;  4HU9 A;  5IO0 A;  2X4A A;  1AQX A;  2CZ2 A;  5IMF A;  3IK9 A;  4HEA 2;  4ZL9 A;  2MBT A;  2X99 A;  1PN0 A;  2M46 A;  3C73 A;  1FW1 A;  4IQA A;  5G1K A;  1SL2 B;  2GDR A;  3H1N A;  4DSR A;  3KH9 A;  1K0A A;  4RI7 A;  4HSC X;  3CSI A;  5IOW A;  4QQ7 A;  2VIM A;  4JED A;  4MJB A;  4XRD A;  4ZB9 A;  4IVF A;  3RAZ A;  3JCM L;  3GKN A;  4WF5 A;  4HQZ A;  4ID0 A;  1GUH A;  4ZBA A;  4K9Z A;  12GS A;  1T00 A;  3MAK A;  5DAK A;  4XRA A;  2KP1 A;  4DVC A;  2G0F A;  4WF4 A;  3ERG A;  5HFK A;  4L5L A;  2DJ0 A;  1B9Y C;  1ZYE A;  2ZNM A;  2HYX A;  4NPB A;  5JWO B;  1JLV A;  2N5F A;  1K0M A;  4IP6 A;  2GZY A;  3QCP A;  2E7P A;  3L0H A;  2PVQ A;  1EGO A;  3GH9 A;  4IGJ A;  3KEB A;  2IIY A;  4KDU A;  2H74 A;  1QXH A;  2IPA A;  2YZH A;  1M9B A;  3LXT A;  4NHW A;  3SBC A;  5DCH A;  5ECK B;  1XW9 A;  3TRP A;  2MYG A;  5ABR A;  3DVW A;  3J7Y k;  4FYC A;  4Q5N A;  4KDX A;  2OA7 A;  1TOF A;  2GQL A;  3ERF A;  2QSI A;  2CZ3 A;  2FY6 A;  5HFI A;  4Q5R A;  2R0C A;  5GST A;  5D9X A;  2GTU A;  3GA4 A;  4MA9 A;  1A2J A;  1TI3 A;  3LG6 A;  1KBN A;  3LYP A;  5B7C A;  4GLT A;  6GST A;  4HZ4 A;  3KD0 A;  3ME8 A;  2H0H A;  2FWG A;  5F0G A;  5EY6 A;  2LJK A;  4GTU A;  2C8U A;  2LRC A;  5EPF A;  1ZYP A;  3APQ A;  4OFM A;  3TKQ A;  3DRN A;  2K8V A;  1DUG A;  3F4T A;  4TXV A;  4ZB6 A;  2GST A;  1V58 A;  4MK3 A;  4BWS A;  2VOC A;  4ECI A;  4JZQ A;  1ZOF A;  3GUR A;  2H1A A;  3BD2 A;  4WR4 A;  2NPB A;  5D9W A;  3PGT A;  4PQI A;  5H5Q A;  3NZN A;  2LKU A;  1YEP A;  3IR4 A;  4X0X A; 
#chains in the Genus database with same CATH homology
 4YQV A;  2B7K A;  3TJF A;  2HRF A;  2RM5 A;  5JWQ B;  3CXG A;  3FYG A;  3ME7 A;  4TR1 A;  4ICY A;  4OCF A;  2P5Q A;  3IC4 A;  4ISD A;  3UVH A;  5DQS A;  2B5X A;  2VD1 A;  1MDI A;  2OAC A;  6GSX A;  2FUG 2;  2R37 A;  5G30 A;  2L59 A;  5ECO B;  3KTB A;  17GS A;  3HA9 A;  4X1U A;  1B48 A;  2YV9 A;  5BRT A;  1M2B A;  4K6X A;  4TR1 B;  2B1K A;  3MSZ A;  1TI1 A;  5KEJ A;  1G7E A;  2P0G A;  1T1V A;  5GSS A;  2JL4 A;  1A0F A;  4IJI A;  4PQH A;  4V2M A;  4F9Z A;  1OVN A;  2A4V A;  2LST A;  4I97 A;  5IQY A;  3FK8 A;  1Q98 A;  5CRE A;  3D6I A;  6GSU A;  2H1D A;  4OMV A;  4IKH A;  5GAN D;  5G31 A;  3TGZ A;  4I2U A;  3ZRE A;  1TRU A;  2NTO A;  3ERW A;  1K3O A;  1K0B A;  1FAA A;  5DAL A;  3PR8 A;  1YJ6 A;  4MZB A;  1R4W A;  4MH3 A;  4PQ1 A;  4K7O A;  4ZB8 A;  3CSH A;  1O85 A;  4YKG A;  5JWR B;  4KSM A;  4QL9 A;  3IE3 A;  1BAY A;  3GX8 A;  3M8N A;  2LQO A;  1SJZ A;  4XIH A;  1EEM A;  3OR5 A;  3GN3 A;  3KMN A;  4KA0 A;  2C0D A;  1A2L A;  1BX9 A;  1XWK A;  1OKT A;  5DAL B;  1WP0 A;  4J57 E;  2NBS A;  2WUL A;  2YAN A;  4KND A;  4MLY A;  2LRT A;  2LNT A;  1GSD A;  1KEB A;  3M9K A;  3KP9 A;  4TW5 A;  3QOU A;  4CHS A;  4F0B A;  1JFU A;  1GWC A;  1GSU A;  4ECC A;  3BOA A;  4KF9 A;  1CQG A;  3H93 A;  2MBS A;  5D73 A;  1T4Z A;  4XTS A;  4TR0 A;  3U5R E;  1O6J A;  3F8U A;  3RBT A;  1OAZ A;  1FOV A;  4K0N A;  1QMV A;  4K2X A;  3KXO A;  1GNW A;  1AQW A;  3L9S A;  1U3I A;  2CVB A;  5KN2 A;  5IMZ A;  2PWJ A;  1OYJ A;  2PN8 A;  5IMD A;  5IOX A;  3TOU A;  3IOS A;  2EIQ A;  5ECS A;  5A5K A;  3G7J A;  2YPM A;  4BWQ A;  4NHZ A;  2YWN A;  2NVL A;  4KCE A;  3D4M A;  2L5L A;  1R5P A;  3D0Z A;  1Y6E A;  3V1W A;  2IMD A;  2X49 A;  4JU5 A;  1DSB A;  4RQR A;  2AHE A;  2CVK A;  3KP8 A;  3ZFL A;  7GSS A;  2DJK A;  1C72 A;  1R5A A;  3TOT A;  4L0U A;  4MCU A;  2O8V B;  2GGT A;  2AB6 A;  3NIV A;  1YDK A;  3UMA A;  1GLQ A;  4ZIL A;  3TKR A;  1YEX A;  4TXO A;  4GF0 A;  1M7T A;  4EKZ A;  3FZ5 A;  4ZBD A;  5COH A;  5KN1 A;  3LJR A;  2RUE A;  3MWH A;  3MYD A;  1GUK A;  3A2V A;  1JLW A;  3C8E A;  2C0G A;  4WET A;  3BJ5 A;  4GST A;  3P90 A;  2I9H A;  3F0I A;  3HJO A;  2LEG A;  4OFT A;  2ZCT A;  4GRF A;  4MMM A;  1SL0 B;  2HSM A;  3IHG A;  3QD9 A;  3KGK A;  3FEU A;  4TXO B;  1WJK A;  1X9S B;  4FH8 A;  3TUE A;  1Z5Y E;  4PX1 A;  2YJ7 A;  3LGC A;  2PU9 C;  5JCU A;  3G7Y A;  4EIQ A;  1SKW B;  1VGL A;  3TB2 A;  5IO2 A;  1OC3 A;  5J5N A;  3WYW A;  3IXR A;  2RUF A;  3HZ4 A;  4F2I A;  1KTE A;  3CSJ A;  1TK8 B;  3IK7 A;  3H8Q A;  14GS A;  2DIY A;  4HI7 A;  1DE1 A;  2GZP A;  4TR4 A;  2YWM A;  2AJQ B;  1XZO A;  3MDK A;  5G5E A;  4LLR A;  4X43 A;  1T3B A;  1QFN A;  4G2E A;  5G5F A;  3Q6O A;  3I6A A;  4MAB A;  2H73 A;  4ILF A;  2XBI A;  2HI7 A;  1WPI A;  2LJA A;  9GSS A;  4O32 A;  2YWO A;  1X5D A;  2B5Y A;  3G7I A;  1ST9 A;  1MTC A;  1EP7 A;  1X5C A;  2CX3 A;  2LTK A;  1T8E B;  1S3D A;  4L8E A;  2NDO A;  3CMI A;  2A2R A;  3I43 A;  2DKH A;  2B6M A;  3ZIJ A;  2A2S A;  2M72 A;  3QFA C;  2JZT A;  2L5O A;  3FZ4 A;  4N0Z A;  3CTF A;  3L9U A;  2X8C A;  1A2M A;  3ZTL A;  3BCK A;  1OE8 A;  2WFC A;  4G19 A;  3ZVJ A;  1Z3E A;  1F37 A;  3TKS A;  1SK2 A;  5J9C A;  5ELA A;  1ILO A;  22GS A;  3EMX A;  1HD2 A;  3EPT A;  2P5R A;  4E8H A;  1TTZ A;  2VL2 A;  5CO3 A;  2YWI A;  1K0N A;  3CBU A;  2OE1 A;  2B3S A;  3QAW A;  2VAF A;  2H0G A;  5DJL A;  5D9V A;  1XVW A;  4WR5 A;  3IRA A;  3E3E A;  4MPF A;  1ML6 A;  2H6X A;  5CYY A;  1BED A;  2C0E A;  3FW2 A;  4G0L A;  3QAV A;  1CQH A;  1G0T A;  2B5E A;  5HQP A;  4RQX A;  1PSQ A;  2L4Q A;  3GHA A;  5GZZ B;  1M9A A;  1EP8 A;  2KOK A;  2OE0 A;  1GUM A;  5DJM A;  3ZZX A;  3M1G A;  3VUR A;  2IWT A;  2DJ2 A;  3EU3 A;  4ULX A;  4JBB A;  4F0C A;  4V1A g;  3TRQ A;  2WJU A;  3DKS A;  2EC4 A;  1QK8 A;  4USS A;  2DSA A;  3GFK A;  1EZK A;  2B1L A;  2X64 A;  2IFQ A;  1RQM A;  2YNX A;  4WXT A;  4V2L A;  2VLV A;  3VWW A;  4YQM A;  2R6K A;  3GST A;  6GSV A;  2F3M A;  4EDY A;  1GSY A;  4PUR A;  3F3Q A;  1B9X C;  1TK0 B;  3TJJ A;  2HE3 A;  1IYI A;  3LFL A;  1GSF A;  4HS1 A;  2CX4 A;  4EL1 A;  3RPN A;  5JCW A;  3C1R A;  2A2P A;  2ALB A;  1ON4 A;  3HVV A;  1I5G A;  2AV4 A;  2IFQ B;  3IAM 2;  1GTA A;  1WWJ A;  1PX6 A;  5H5R A;  3FR3 A;  2HT9 A;  1OC9 A;  3FZA A;  2OBI A;  5DAK B;  2F9S A;  4Z2U A;  3LYK A;  1XFL A;  2JZR A;  2PPT A;  3WT1 A;  4OFN A;  1M99 A;  2H72 A;  1ZCP A;  2BJX A;  1Q4J A;  4ML1 A;  4K1F A;  1FHE A;  20GS A;  2FA4 A;  4FQU A;  2K6V A;  2LRN A;  2H0I A;  2HSH A;  4I8B A;  1UN2 A;  2H75 A;  2VM2 A;  2C1Y A;  2IJY A;  4FO5 A;  2I3Y A;  3APO A;  1UC7 A;  2FCH A;  4CY6 A;  5D93 A;  3GL3 A;  3HKR A;  3J7Y b;  3A5I A;  5EVO A;  3D22 A;  4ACS A;  4FYB A;  3HXS A;  3UL3 A;  1F3B A;  4G9H A;  3MIX A;  1VRS D;  1J0F A;  2XC2 A;  4KH7 A;  3GSS A;  1XVQ A;  6GSY A;  3ZL5 A;  1AUC A;  4G0I A;  2FWH A;  3SWL A;  2CVD A;  2QC7 A;  3AY8 A;  4DEJ A;  1PD2 1;  1XXU A;  1S3C A;  3VPT A;  3Q19 A;  5B8B A;  2R4V A;  2F8F A;  5E4W A;  1YY7 A;  3GNJ A;  3IA1 A;  2JAD A;  2RII A;  4WBR D;  3RPP A;  1QUW A;  1SK0 A;  1LU4 A;  1M0U A;  2VD0 A;  3HY2 A;  1ZYQ B;  4I2T A;  4K8M A;  4O5U A;  1MDK A;  4A5P A;  3FKF A;  4EVM A;  4XS1 A;  2MMO A;  3LOR A;  18GS A;  4NV5 A;  3EU4 A;  5ID2 A;  1XWG A;  1KNG A;  2FA8 A;  1SK1 A;  2DJ3 A;  1USB A;  2H71 A;  2QA1 A;  4ECJ A;  1K0O A;  4HUA A;  1X0R A;  2CAQ A;  4CDO A;  5J41 A;  2HFD A;  4NV2 A;  1ZMA A;  4YAP A;  1FB6 A;  1PX7 A;  3F3R A;  2H1B A;  5L71 A;  4EC0 A;  3KH7 A;  3LEF A;  2GSS A;  2MMZ A;  2TRX A;  4DSQ A;  1F3A A;  3DWV A;  2IN3 A;  2BTO T;  4KE3 A;  4GQF A;  1BJX A;  3GUS A;  5LCZ A;  4X4J A;  1QQ2 A;  2H8L A;  5F8B A;  2A4H A;  3M0F A;  1V2A A;  2AYT A;  1X9W B;  4Z2R A;  3I9V 2;  2FLS A;  4PUA A;  2LNS A;  4HDE A;  3LW9 A;  2G2Q A;  5IMC A;  5BMU A;  3M3M A;  2YCD A;  3IDV A;  1SJ6 A;  3VWV A;  1AQV A;  1Y25 A;  1FO5 A;  2QKE A;  1U87 A;  4NXI A;  4K5S A;  1VF4 A;  4K5R A;  3N9J A;  1TK5 B;  4GWR A;  3E9J B;  2E2G A;  2OKA A;  2XBQ A;  4PNF A;  1XPV A;  4PUF C;  2XHF A;  5KOX A;  4MJA A;  3IC8 A;  4OD7 A;  1MD3 A;  2FD3 A;  1XOA A;  3HZ8 A;  3WD6 A;  5CP1 A;  1HQO A;  5HR3 A;  4BVY A;  2V41 A;  4V2N A;  1ZZY A;  2GT6 A;  2QA2 A;  3ISO A;  3ZML A;  2H1G A;  2H76 A;  1K0C A;  3FR9 A;  5KN3 A;  4TVE A;  2M80 A;  2PBJ A;  4OO4 A;  2L6D A;  3US3 A;  1OE7 A;  3N5O A;  1TW9 A;  2N5B A;  2WGR A;  4BVY B;  1XW5 A;  1THX A;  3EYT A;  1O8X A;  2QGV A;  1TXX A;  2F8A A;  3APS A;  2MMN A;  2YN1 A;  5AN1 A;  4F03 A;  3TJB A;  5H5S A;  1M2D A;  13GS A;  5DBQ A;  2CA8 A;  3GKX A;  4WKW A;  1VF2 A;  5ECR B;  2XPD A;  5A4V A;  1O81 A;  3UVT A;  2DJ1 A;  4N0V A;  2D2Z A;  2X8H A;  5D96 A;  2R3X A;  2XPE A;  1YF0 A;  1JZW A;  1JZR A;  2L6C A;  3FZ9 A;  4MZC A;  2VL3 A;  4NAX A;  1U88 A;  1GTI A;  4AGS A;  3PH9 A;  6GSW A;  4Q5F A;  3C71 A;  4JR6 A;  5ENU A;  3F9U A;  3UAP A;  2JSZ A;  4MH2 A;  4O7H A;  1EOG A;  5CAX A;  2K9F A;  3CRT A;  2DIZ A;  19GS A;  2GSR A;  3TDG A;  4K0G A;  3NOF A;  3FRC A;  4MZW A;  4N30 A;  1G6Y A;  8GSS A;  1EGR A;  2GT5 A;  2HRK A;  4EDZ A;  1GLP A;  3DVX A;  4MF5 A;  1J9B A;  1F6M C;  2RM6 A;  1VF3 A;  2X8G A;  2PMT A;  2H66 A;  3L9V A;  1LBK A;  2K18 A;  1V57 A;  3KMO A;  2YV7 A;  4BPY A;  2PER A;  2FWE A;  3EWL A;  3QAG A;  2VCT A;  4IBP A;  3IAS 2;  2H70 A;  4POK A;  3HYP A;  1WE0 A;  3ZMK A;  1PKW A;  2WRT A;  5CRW A;  2KP2 A;  4PTS A;  2JAC A;  2C4J A;  2L57 A;  4JR4 A;  3ZVJ D;  1AIU A;  4MF7 A;  1GTB A;  5IIZ A;  3HHV A;  1SKS B;  2IME A;  5CRH A;  1WIK A;  1A8Y A;  2C80 A;  5ECH B;  3VLN A;  3A5W A;  1SJI A;  4H86 A;  4K7I A;  3R2Q A;  2WS2 A;  2DC5 A;  1JHB A;  1I9D A;  3WT2 A;  3EIN A;  4POL A;  2VCX A;  3UOM A;  3O6T A;  4KUN A;  3R3E A;  4K2D A;  1YQ1 A;  5INY A;  1O8W A;  1U3A A;  3RHC A;  2OAD A;  2GQK A;  3VFI A;  1FB0 A;  1WRY A;  2FGX A;  2VCV A;  1ZYN A;  4XS6 A;  5AIX A;  3BBY A;  4ECB A;  4TRX A;  3IV4 A;  2YP6 A;  3QMX A;  4KSO A;  2HSY A;  2VLU A;  3QR6 A;  4LMV A;  1K0D A;  5HR2 A;  3UBK A;  3DXB A;  4G10 A;  2HXK A;  5DCG A;  4LL4 B;  4EXJ A;  3F6F A;  1PKZ A;  4N10 A;  1GSQ A;  3HJP A;  2GZZ A;  2FHE A;  5GAP D;  2TRC P;  5LD0 A;  3ZIT A;  1FOH A;  3VPQ A;  2ON7 A;  3MNG A;  1XCC A;  3ED3 A;  1H75 A;  3D5J A;  4YKF A;  5J9B A;  11GS A;  4ZL7 A;  1Z6M A;  3HDC A;  1GP1 A;  1TRV A;  1HNC A;  2E2M A;  5HR1 A;  2N5A A;  2R0P A;  2V1M A;  1GH2 A;  2ES7 A;  3Q74 A;  3A3T A;  1BYE A;  1PL1 A;  5DVB A;  5C00 A;  2PVO C;  4IQ1 A;  2FNO A;  4O5R A;  2H6Z A;  2O89 A;  4BVX A;  4MNN A;  2V6K A;  1M2A A;  4Q5Q A;  5IMA A;  3LWA A;  5D8I A;  1A0R P;  1B4P A;  1J08 A;  1NHO A;  1OKD A;  4BVX B;  3TKP A;  2GVP A;  3IPZ A;  2Z9S A;  2H6Y A;  1SEN A;  3IBH A;  4HOJ A;  4IW9 A;  4WEY A;  1JZD A;  1GTU A;  3P2A A;  4KW6 A;  1E6B A;  1V98 A;  1EV4 A;  3A2W A;  1BQ7 A;  1TJD A;  2I4A A;  5D9T A;  3PPU A;  3LSZ A;  2O85 A;  1XW6 A;  2HZF A;  3CRU A;  2EIR A;  3TKS E;  5JCG A;  5ECN B;  1VF1 A;  5B6M A;  1E2Y A;  1URM A;  2CQ9 A;  1PQN A;  1XWC A;  4FIW A;  2DLX A;  2VUP A;  2UZ8 A;  1SD9 A;  3DIE A;  3CYN A;  1GL8 A;  4ML6 A;  3UIW A;  1QGV A;  2R2J A;  2V32 A;  1OC9 B;  1PN9 A;  1YKA A;  5LNK e;  1AW9 A;  1T4Y A;  3UBL A;  4MDC A;  1A8L A;  4IJ3 A;  1AAZ A;  5EL8 A;  3P8W A;  4TKY A;  2LQQ A;  4D73 A;  1NHY A;  2KUC A;  2TIR A;  3KIJ A;  4I6X A;  3UEM A;  3LXZ A;  3K8N A;  1A23 A;  3ZIV A;  4IP1 A;  3TKS C;  2VCW A;  1TU7 A;  3GL5 A;  2JZS A;  4KCA A;  10GS A;  2ZUP A;  3KJY A;  2YOI A;  3QFB C;  2WZ9 A;  1WMJ A;  2VL2 C;  4D73 B;  1K3Y A;  2EIO A;  3CTG A;  1THO A;  2PGT A;  1SYR A;  4PGT A;  3UAR A;  4K7N A;  2DJJ A;  5AIS A;  1S3A A;  4IHU A;  1TU8 A;  2MMA A;  2JSY A;  1GSE A;  3D21 A;  3U6V A;  1TP9 A;  1ABA A;  3LQ7 A;  1PL2 A;  3ZRD A;  3TJK A;  3QDN A;  4JE1 A;  2B7J A;  4HZ2 A;  3VK9 A;  4RI6 A;  2HRN A;  4MJC A;  3UJ1 A;  1TRW A;  3H79 A;  1R7H A;  1PGT A;  1B4Q A;  3VI7 A;  1XWB A;  3VWX A;  4GXZ A;  2HZE A;  1DBY A;  4P3Y B;  1BG5 A;  1N2A A;  2F51 A;  4POB A;  5B8A A;  3VWU A;  1GSS A;  3DGQ A;  5ID2 B;  1V40 A;  1GRX A;  5AIV A;  2VM1 A;  2KLX A;  1X9M B;  2ON5 A;  2OJL A;  2IMF A;  1OC8 A;  2HZE B;  1V9W A;  2GSQ A;  4OCE A;  6GSS A;  3EC3 A;  4NWY A;  3RHB A;  4F82 A;  5A4W A;  2C3N A;  3G9B A;  4HU7 A;  1W89 A;  5KN0 A;  1XBS A;  3HVX A;  3FY7 A;  3WGD A;  4EO3 A;  4TN8 A;  1NM3 A;  4XHM A;  3GX0 A;  4MJE A;  1LJR A;  2FWF A;  4E8E A;  2O87 A;  1A24 A;  3KTL A;  4IS0 A;  5B6N A;  3QPM A;  2VCZ A;  1RW1 A;  4Z7X A;  4LMW A;  3GV1 A;  3C1S A;  3GYK A;  3DML A;  1X5E A;  5E59 A;  5F06 A;  1O73 A;  2K8S A;  2BMX A;  2VO4 A;  1ERU A;  1Z7P A;  4KGI A;  2KHP A;  3EVI A;  4RUV A;  5CRG A;  3EMP A;  2HRA A;  4KDY A;  5F05 A;  2J9H A;  4POM A;  1Z6N A;  4EUY A;  4HQS A;  1SYX A;  2DML A;  3PIN A;  5HFG A;  2IL3 A;  2I81 A;  5ECP B;  2C3Q A;  1N8J A;  5IM9 A;  1PMT A;  2GLR A;  1U6T A;  3BCI A;  2VL9 A;  3IHQ A;  3F4S A;  4GQC A;  3TCO A;  5IPH A;  4QL7 A;  4DSS A;  1XIY A;  1YZX A;  3W8J A;  1F2E A;  4L5O A;  1XOB A;  4CW9 A;  3F63 A;  5F07 A;  4CY8 A;  3KCM A;  1GNE A;  2E0Q A;  3I69 A;  4YAV A;  1EV9 A;  1ERV A;  2WCI A;  2DMM A;  5G2Z A;  4GSS A;  3ZLP A;  4XS4 A;  4AJ8 A;  2HLS A;  4GCI A;  4DSS B;  5KOW A;  1ERW A;  3DD3 A;  4LA1 A;  2MZC A;  4FYU A;  3H4K A;  4BL7 A;  1DE2 A;  2LV3 A;  1EOH A;  2VCQ A;  5C04 A;  1EEJ A;  3FR6 A;  4XCS A;  5ECM B;  1Z9H A;  2R0G A;  4KB3 A;  4EF0 A;  2OE3 A;  4XS4 B;  1GUL A;  1AXD A;  3L4N A;  4EIP A;  1TKD B;  4BL7 B;  3O3T A;  3GKK A;  1K3L A;  3O76 A;  4KAE A;  1WOU A;  4YQU A;  2P31 A;  4Z2T A;  1W4V A;  1HYU A;  2LJR A;  1ZL9 A;  3ZFB A;  1EWX A;  2J23 A;  3F6D A;  1F9M A;  3KZQ A;  4TOP A;  5ECQ B;  4N11 A;  4ZIJ A;  4MF6 A;  5CRD A;  5FT3 A;  4HJM A;  2IMI A;  1T7P B;  4PXO A;  3GTU A;  4ZBB A;  3GKM A;  5IMV A;  1G7O A;  2HNL A;  2DKI A;  2REM A;  3EE2 A;  1ERT A;  1ACV A;  4OWY A;  1FVK A;  2C0F A;  4BA7 A;  1G6W A;  1Z7R A;  3HCZ A;  3F4R A;  3GTU B;  4ZL8 A;  5G1L A;  4MP4 A;  4OO5 A;  1B8X A;  2PUK C;  4IEL A;  3VI5 A;  4JRR A;  1HNB A;  3A2X A;  1SL1 B;  4G0K A;  5AGY A;  2C3T A;  2JU5 A;  2GQM A;  3C7M A;  5ELG A;  4I5Q A;  1SKR B;  5J4U A;  1R26 A;  2DBC A;  2I1U A;  3GH6 A;  4AJ7 A;  4J2F A;  1TDI A;  4L0W A;  1NSW A;  1MEK A;  1FG4 A;  2LUS A;  3TJG A;  5DDL A;  4J56 E;  3DEX A;  4AF2 A;  1FVJ A;  1JZO A;  2RLI A;  4EE0 A;  4KX4 A;  2CAI A;  3Q18 A;  3DYR A;  4TR3 A;  1TRS A;  4GSN A;  4PNG A;  1H4O A;  3WGX A;  1HNA A;  3HD5 A;  1RK4 A;  3S9F A;  3GMF A;  4V1A p;  2CT6 A;  1UVZ A;  5HR0 A;  2H19 A;  1MDJ A;  2H01 A;  3W6G A;  1XWA A;  2VLT A;  2H30 A;  2V6O A;  1MD4 A;  2AAW A;  5FWG A;  2GS3 A;  4YH2 A;  2IMK A;  5FHI A;  3GIX A;  5ECI B;  3FHK A;  5DQY A;  3W8S A;  4LL1 B;  4O5Q A;  1SD8 A;  1IYH A;  4IN0 A;  3HJM A;  3RDW A;  3EUR A;  2YJH A;  4HJ2 A;  4ZXG A;  3M9J A;  2LS5 A;  1UA5 A;  1SU9 A;  4MPG A;  2WDU A;  1O7U A;  1PRX A;  3KM6 A;  4WBJ A;  2OBK A;  5IPG A;  3L78 A;  1PA3 A;  1ZGN A;  4NMU A;  1AC1 A;  2CV4 A;  5CNW A;  3HVS A;  4O92 A;  2L4C A;  2V2G A;  1YKC A;  5A4U A;  3WGE A;  2AUV A;  2R5G A;  2YZU A;  3GRX A;  3D4T A;  1NW2 A;  2O7K A;  1YF1 A;  3ZYW A;  3E0U A;  2WB9 A;  4AJ6 A;  5ECL B;  3TRX A;  5J3R A;  3P7X A;  16GS A;  3FMW A;  4HU9 A;  5IO0 A;  2X4A A;  1AQX A;  2CZ2 A;  5IMF A;  3IK9 A;  4HEA 2;  4ZL9 A;  2MBT A;  2X99 A;  1PN0 A;  2M46 A;  3C73 A;  1FW1 A;  4IQA A;  5G1K A;  1SL2 B;  2GDR A;  3H1N A;  4DSR A;  3KH9 A;  1K0A A;  4RI7 A;  3CSI A;  5IOW A;  4QQ7 A;  2VIM A;  4JED A;  4MJB A;  4XRD A;  4ZB9 A;  4IVF A;  3RAZ A;  3JCM L;  3GKN A;  4WF5 A;  4HQZ A;  4ID0 A;  1GUH A;  4ZBA A;  4K9Z A;  12GS A;  1T00 A;  3MAK A;  5DAK A;  4XRA A;  2KP1 A;  4DVC A;  2G0F A;  4WF4 A;  3ERG A;  5HFK A;  4L5L A;  2DJ0 A;  1B9Y C;  1ZYE A;  2ZNM A;  2HYX A;  4NPB A;  5JWO B;  1JLV A;  2N5F A;  1K0M A;  4IP6 A;  2GZY A;  3QCP A;  2E7P A;  3L0H A;  2PVQ A;  1EGO A;  3GH9 A;  4IGJ A;  3KEB A;  2IIY A;  4KDU A;  2H74 A;  1QXH A;  2IPA A;  2YZH A;  1M9B A;  3LXT A;  4NHW A;  3SBC A;  5DCH A;  5ECK B;  1XW9 A;  3TRP A;  2MYG A;  5ABR A;  3DVW A;  3J7Y k;  4FYC A;  4Q5N A;  4KDX A;  2OA7 A;  1TOF A;  2GQL A;  3ERF A;  2QSI A;  2CZ3 A;  2FY6 A;  5HFI A;  4Q5R A;  2R0C A;  5GST A;  5D9X A;  2GTU A;  3GA4 A;  4MA9 A;  1A2J A;  1TI3 A;  3LG6 A;  1KBN A;  3LYP A;  5B7C A;  4GLT A;  6GST A;  4HZ4 A;  3KD0 A;  3ME8 A;  2H0H A;  2FWG A;  5F0G A;  5EY6 A;  2LJK A;  4GTU A;  2C8U A;  2LRC A;  5EPF A;  1ZYP A;  3APQ A;  4OFM A;  3TKQ A;  3DRN A;  2K8V A;  1DUG A;  3F4T A;  4TXV A;  4ZB6 A;  2GST A;  1V58 A;  4MK3 A;  4BWS A;  2VOC A;  4ECI A;  4JZQ A;  1ZOF A;  3GUR A;  2H1A A;  3BD2 A;  4WR4 A;  2NPB A;  5D9W A;  3PGT A;  4PQI A;  5H5Q A;  3NZN A;  2LKU A;  1YEP A;  3IR4 A;  4X0X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...