3A2XA

Peroxiredoxin (c50s) from aeropyrum pernix k1 (acetate-bound form)
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
243
structure length
243
Chain Sequence
PGSIPLIGERFPEMEVTTDHGVIKLPDHYVSQGKWFVLFSHPADFTPVSTTEFVSFARRYEDFQRLGVDLIGLSVDSVFSHIKWKEWIERHIGVRIPFPIIADPQGTVARRLGLLHAESATHTVRGVFIVDARGVIRTMLYYPMELGRLVDEILRIVKALKLGDSLKRAVPADWPNNEIIGEGLIVPPPTTEDQARARMESGQYRCLDWWFCWDTPASRDDVEEARRYLRRAAEKPAKLLYEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Probable peroxiredoxin
publication title Crystal structure of peroxiredoxin from Aeropyrum pernix K1 complexed with its substrate, hydrogen peroxide
pubmed doi rcsb
source organism Aeropyrum pernix
total genus 80
structure length 243
sequence length 243
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2009-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00578 AhpC-TSA AhpC/TSA family
A PF10417 1-cysPrx_C C-terminal domain of 1-Cys peroxiredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1020.20 Alpha Beta 2-Layer Sandwich Antioxidant, Horf6; Chain A, domain 2 Antioxidant, Horf6; Chain A, domain 2 3a2xA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3a2xA01
1WPIA 3L78A 3RPPA 6GSVA 3D4MA 3C1SA 2P5RA 1XWAA 2VCQA 2H0HA 4GTUA 2MMOA 2C0FA 4TR3A 3Q6OA 3RDWA 4I97A 1G0TA 4IHUA 3UJ1A 4DEJA 3UARA 1U88A 4MZBA 3GKKA 3ME7A 1XCCA 1JZRA 1M2BA 4Z7XA 4V1Ag 2O87A 3CRUA 3WGDA 3M3MA 4WEYA 2GSRA 1K0AA 1O81A 1AAZA 4Q5FA 2P31A 4FYBA 5CNWA 2YJHA 3DYRA 3ED3A 4FYCA 1V9WA 2L6DA 2L4QA 2Z9SA 3D5JA 3GH9A 5D96A 4JRRA 2C0EA 4N0ZA 4RQXA 2MYGA 22GSA 1SJIA 13GSA 3TUEA 2CQ9A 4OO4A 3GA4A 4WETA 1VF4A 4KNDA 4CW9A 1HYUA 3GRXA 2F51A 5A4UA 1T4ZA 1A23A 5IQYA 1LBKA 2H1BA 3F4RA 2RIIA 3GKNA 1ZOFA 5J3RA 5IMZA 3GNJA 4GQFA 2HRFA 4J56E 3UEMA 3F9UA 4TN8A 1AQWA 3ZITA 2IFQA 1MTCA 2GDRA 3UL3A 3UIWA 2IMKA 1XVQA 2YCDA 4MH2A 2I3YA 1PX7A 4XS4B 4PNFA 4ZBDA 1JZWA 4ZILA 3ZIJA 3QFAC 2CAQA 4K6XA 2A2SA 5ABRA 4MA9A 3IR4A 4MCUA 2JU5A 2QC7A 2YWIA 1V58A 1K0CA 5J41A 2PGTA 1OC8A 1JLWA 7GSSA 1RK4A 1QMVA 5DJMA 4K0NA 5GZZB 4X43A 4K7IA 1PGTA 1B9XC 3HZ8A 1IYHA 2O85A 3TKSA 2DSAA 3GTUB 3HVXA 3IOSA 1F2EA 3QMXA 1G7EA 4XHMA 5IOXA 3W8SA 1TJDA 3TKSE 3P2AA 3WYWA 4POLA 3KTLA 2OE1A 3C8EA 1YDKA 3LQ7A 4NHWA 2PVQA 3CSHA 3GHAA 1USBA 3I9V2 4LA1A 3UOMA 4X0XA 1XWKA 3DMLA 3I6AA 3IHQA 5FT3A 1TRUA 2NTOA 4HJMA 3DD3A 1HQOA 5DBQA 2DJ2A 4KCEA 3DWVA 2JZRA 3F4SA 4EL1A 4KB3A 3FR9A 2DIZA 3ZYWA 1EWXA 1PL1A 4POKA 3QFBC 2DBCA 5HR0A 2H1AA 1WJKA 2VAFA 4WF4A 4EE0A 3ZTLA 3UVTA 3M9JA 3A5WA 3TJBA 5CRWA 5JWOB 2O7KA 5ECLB 2ZNMA 4IKHA 2C0GA 2AYTA 1GSDA 6GSWA 2V32A 4O5RA 3FZAA 3IAS2 2A2RA 5A4VA 3HVSA 5CAXA 4LL1B 2GGTA 2I9HA 1DSBA 3IV4A 2DMMA 3TRXA 2K9FA 1M9BA 1R7HA 2XBIA 3FKFA 3HJPA 5E4WA 3VWVA 1EP8A 2PBJA 1K3OA 1PRXA 3UVHA 3TOTA 2YV9A 5ECRB 5LNKe 3K8NA 1QXHA 5DQSA 2B5XA 2VUPA 4I2TA 5KN2A 2XBQA 4V2MA 8GSSA 3EINA 2HE3A 4TR1B 11GSA 1H4OA 3APSA 1MDIA 1Z3EA 2LJAA 2WS2A 4NV5A 1WOUA 3LYKA 2H0IA 4Q5QA 3FZ5A 2WZ9A 3HJOA 4OFTA 1DE2A 4KUNA 2MZCA 1O6JA 1Q98A 2HSHA 4N30A 4AJ6A 4DSQA 2F8FA 3IAM2 3E3EA 5F0GA 2OACA 1TTZA 1GL8A 4ZBAA 4JE1A 2JZSA 2RM6A 3LFLA 3KXOA 3L4NA 3F3QA 3DVXA 1HNBA 5JCWA 5COHA 1TOFA 1X9MB 4ZL7A 1XOBA 2DJKA 5D73A 3ZLPA 4MABA 3D4TA 2LNTA 3GKXA 4L8EA 4JBBA 2TRXA 1X9SB 3KH9A 2V1MA 3M9KA 4HI7A 5IOWA 1C72A 1XW5A 2L6CA 3D6IA 4K9ZA 1TK0B 3KJYA 2NBSA 3I69A 3GX8A 5D9WA 3VPTA 1A8LA 5J9CA 1B8XA 2HNLA 1SD8A 2LJKA 1QQ2A 3TGZA 2VLVA 3EU4A 4KE3A 2PN8A 2IMFA 3P7XA 1B48A 4G19A 1OC9B 3EURA 3VLNA 4HU9A 5ID2A 20GSA 3RHCA 3UBLA 3KCMA 4AJ7A 2GT6A 1J0FA 4YQUA 3H1NA 1X5DA 5JWQB 2TRCP 3M0FA 4WF5A 2GT5A 3O6TA 3BOAA 2I1UA 4LMVA 1T3BA 2HXKA 5G5FA 2YJ7A 3GUSA 1V2AA 3L9SA 2R3XA 1Y25A 4KX4A 2H73A 1PX6A 4HDEA 1FHEA 4MLYA 3UAPA 4KA0A 1AC1A 5E59A 2AV4A 4JEDA 3KTBA 1QUWA 1GUMA 3W8JA 3V1WA 2EIQA 2RM5A 4F0CA 4BPYA 1TI1A 2I4AA 2H75A 4K2DA 4XIHA 1YEPA 3GL5A 3KP9A 6GSUA 2CVDA 3M8NA 2GZPA 3FR3A 4PGTA 2ZCTA 5IO0A 1WRYA 4MJAA 3LG6A 1J9BA 2L59A 3HHVA 1K0NA 1XIYA 4BWSA 1PL2A 1GSSA 1N2AA 5CRHA 2YOIA 4N11A 3Q19A 2R4VA 1X0RA 2V6OA 1A2LA 1G7OA 3KGKA 5CREA 3L0HA 3VWUA 5AGYA 1K0MA 2AJQB 3FK8A 5HR2A 2HYXA 2VOCA 6GSYA 1BX9A 5IO2A 4ULXA 5G2ZA 5GAPD 1G6YA 1Z7RA 4ECBA 5F06A 2HRNA 3VURA 3LSZA 5CRDA 2HSYA 2ALBA 3HKRA 4GSSA 2KP1A 1H75A 1FVKA 5CP1A 1Z6MA 3GYKA 3TRPA 2H8LA 1F6MC 3CTFA 5IMDA 3IBHA 1AUCA 4K7OA 4MF5A 3GIXA 2BTOT 1ML6A 3DEXA 3DVWA 1CQGA 1SL0B 1A2MA 4IP1A 4MDCA 1B4PA 4IELA 3VK9A 6GSTA 4BVYA 1ZYEA 4ECJA 4XRAA 3IA1A 4PQIA 4WR5A 2H6XA 3U6VA 2VO4A 3EVIA 3AY8A 2FA8A 1GH2A 4I8BA 4ZIJA 3LGCA 5HFKA 2DIYA 2VCZA 3FY7A 3WGEA 1YJ6A 2LEGA 4V1Ap 2YNXA 5ECOB 1GRXA 1A2JA 3BCKA 5IMVA 3A3TA 2ZUPA 2IPAA 2C80A 1XBSA 1EOHA 1N8JA 1AW9A 4XCSA 3NZNA 4LLRA 4MZWA 4XTSA 3LXTA 1SYXA 1KNGA 1Z6NA 3TKRA 2VCXA 3A2XA 4PURA 1AQVA 2GTUA 4D73B 4GF0A 1EZKA 3QAVA 4ILFA 5D8IA 2B7KA 4ECIA 2J23A 3HVVA 3G9BA 2YWNA 1FAAA 2VCTA 1GTAA 2M80A 4IW9A 3QDNA 4OCEA 2H01A 1Q4JA 1ZCPA 4Q5NA 1F9MA 1XWBA 4EO3A 3FZ4A 2REMA 1V57A 1OE7A 3MWHA 3QAWA 19GSA 4BWQA 4J57E 2PWJA 3D0ZA 3E0UA 2H6YA 2DJ1A 2RLIA 4K7NA 1TW9A 2H72A 2C4JA 5ENUA 2MMAA 2DJJA 2H74A 5G1KA 14GSA 3KMNA 2IWTA 3QOUA 1JZOA 4HEA2 3SBCA 3F8UA 3J7Yb 3MNGA 3KZQA 1F3AA 1SL2B 2C3TA 2OJLA 1MDKA 3DXBA 2H1GA 2WDUA 4YAVA 1U6TA 3GL3A 2AHEA 3R2QA 4FO5A 2WRTA 4G9HA 1NW2A 1Z9HA 5GAND 1MD3A 2YWOA 1HNAA 1AXDA 3NOFA 3W6GA 1TDIA 4BA7A 4N10A 4HS1A 2K18A 1TXXA 3P90A 2VLTA 3GN3A 3MDKA 4H86A 2B7JA 2FNOA 1TRWA 1T4YA 5IMFA 4IN0A 3J7Yk 2HT9A 1EEMA 2KLXA 4ML6A 1ILOA 3Q74A 1QK8A 3HY2A 2V6KA 1OAZA 4EC0A 2BMXA 2VD1A 1FG4A 4TKYA 4OFMA 5AIXA 3CYNA 5G30A 1OKDA 3OR5A 5D9VA 4WBJA 5DAKB 5DVBA 5L71A 5DJLA 4EF0A 5J5NA 1K0DA 1YY7A 3MSZA 3QAGA 4PUFC 2QGVA 2OE0A 2IMIA 2K6VA 5FWGA 5LCZA 3RBTA 2DJ0A 3ZMKA 4WXTA 1NHOA 1VF3A 3GKMA 5JCUA 4GRFA 2VL9A 3FRCA 5IPHA 4IQAA 1XWGA 3WT2A 3FHKA 17GSA 1EGRA 2L5LA 4GQCA 4OCFA 1XZOA 3APQA 12GSA 3HXSA 1ON4A 3C7MA 1XVWA 2GQLA 4POMA 4F2IA 3RPNA 2F9SA 2GSQA 2LRNA 1GSQA 2YP6A 2L57A 1EEJA 4MPGA 1GTBA 5ID2B 2KHPA 5CRGA 4TXOB 5B6NA 2VIMA 2GSSA 2F8AA 2LQQA 4DSSB 5B8AA 1O8WA 4KSOA 1BYEA 4ZL8A 4TW5A 1FOVA 3IDVA 2FGXA 5CYYA 4EXJA 5IIZA 5FHIA 5KEJA 1RW1A 4XS4A 5B6MA 5HQPA 5HFGA 4I5QA 5DDLA 2CZ3A 4AF2A 2NDOA 3RAZA 4TOPA 3GMFA 2LKUA 3H4KA 1LU4A 3HZ4A 4GSNA 3VWWA 6GSXA 4ZB6A 2WCIA 2EIRA 2FWEA 2JSYA 2X8HA 4L0UA 4L5LA 3WGXA 3IE3A 1FW1A 1JHBA 4DVCA 3GTUA 3HA9A 1Z7PA 2L5OA 10GSA 3G7JA 4Q5RA 5ECQB 1SKRB 1ERVA 2OBIA 1XOAA 3CBUA 2H71A 4CHSA 4I6XA 2N5AA 3KMOA 2F3MA 3GX0A 2HFDA 4KDXA 5ELAA 1UN2A 3TKQA 1MDJA 3LORA 4TR4A 1K3YA 2FUG2 3F0IA 4GLTA 1AQXA 1YF0A 3EE2A 4NPBA 2OBKA 5ECHB 3ERFA 2LRCA 1SK1A 1V98A 1ACVA 4EDYA 3BCIA 5C00A 2I81A 1PA3A 3ISOA 3D22A 4QL9A 2B1KA 3ZRDA 1X5EA 5ECIB 1W4VA 4MP4A 2FWHA 2PPTA 4NXIA 5IMCA 1TU8A 2KOKA 5H5SA 1A0RP 2KP2A 2LRTA 2IJYA 1WE0A 5EY6A 1X5CA 5D9TA 3ZL5A 2GQMA 1NSWA 4MMMA 1CQHA 3E9JB 5AISA 2OA7A 1TRSA 5IM9A 3F4TA 1F3BA 2X8CA 2NVLA 1GSEA 2HI7A 1VF2A 3GSTA 1GNEA 4GWRA 2C3NA 3IK9A 3N9JA 2FLSA 1K3LA 2PUKC 2OADA 5DALA 1R4WA 2FCHA 2A4VA 4TR1A 2ES7A 2H66A 2L4CA 5AIVA 2G2QA 3KD0A 4POBA 1XPVA 3IPZA 2B3SA 3GSSA 4F82A 1S3CA 3ZIVA 4RUVA 3M1GA 1M2AA 1FO5A 4IVFA 1ZL9A 3WT1A 4K8MA 4IJ3A 2CT6A 4GSTA 5HFIA 2LQOA 3D21A 4TVEA 4MJCA 1S3AA 4HZ4A 2XC2A 1JLVA 4EDZA 2VL3A 4RI7A 3S9FA 2X99A 3TKPA 3TJGA 2WULA 1A8YA 1SK2A 1BQ7A 1FB6A 1ZMAA 1QGVA 5G5EA 4OMVA 3QCPA 3TJJA 1WP0A 3PR8A 1O8XA 3IK7A 5GSTA 5CO3A 4IS0A 1OKTA 4JZQA 2XPEA 1SENA 1BJXA 1M0UA 2IFQB 4IBPA 1OC9A 3LEFA 4L0WA 3BD2A 2B5EA 4G10A 2WGRA 1W89A 3CTGA 1GTIA 4KSMA 1SJZA 3QD9A 4PXOA 2DC5A 2VM1A 2H76A 1O73A 5F07A 5H5RA 2VCVA 3DIEA 3Q18A 4ML1A 5ECKB 1V40A 2V41A 2GLRA 2MBSA 4FYUA 1WWJA 2C3QA 2YV7A 4RQRA 1U3IA 4L5OA 2JSZA 1K0OA 4GCIA 4F9ZA 2CX3A 1WMJA 4OFNA 3DKSA 1GSUA 3G7YA 3TB2A 4MJBA 3QR6A 4YH2A 3DGQA 3HD5A 1T8EB 4YAPA 2HZEA 3RHBA 5IPGA 1EOGA 1TK5B 2VCWA 4PX1A 1J08A 2R5GA 2WB9A 4K1FA 5AN1A 6GSSA 2LS5A 2GZZA 1GWCA 3U5RE 2VM2A 1MD4A 1R5PA 4ZXGA 1KEBA 2HLSA 5EVOA 2C8UA 1LJRA 5JCGA 2KUCA 4ZBBA 2P0GA 5ECPB 1TRVA 1U87A 16GSA 1XXUA 1XFLA 2K8VA 3VI7A 1GSYA 5KN1A 1F37A 4K0GA 3SWLA 4YQVA 3TRQA 5ECNB 3EYTA 1NHYA 3TJFA 1ABAA 1VGLA 1DBYA 3VFIA 4JR6A 2IIYA 1KTEA 5EPFA 2C1YA 4NMUA 3KH7A 5JWRB 1X9WB 1A0FA 2CA8A 1BG5A 2DJ3A 3TDGA 1SL1B 2M72A 2H1DA 1GUHA 5LD0A 1XWCA 2VL2C 3ZMLA 1K0BA 5G1LA 4F0BA 1WIKA 1FB0A 2IN3A 4O92A 4IQ1A 3VPQA 2VD0A 1Y6EA 1PMTA 3EC3A 2V2GA 3UMAA 3KEBA 2VLUA 2J9HA 2LTKA 3F6FA 3CSIA 3A2WA 1M99A 1SJ6A 2OKAA 5ECMB 1VRSD 2DMLA 4EVMA 1R5AA 1YQ1A 2H19A 4D73A 2ON5A 4EUYA 4DSRA 3PH9A 1GLPA 1BAYA 4JU5A 1M7TA 3ZZXA 2X8GA 2XHFA 3PINA 2EC4A 3QPMA 3IC4A 5ECSA 5F8BA 4OD7A 4JR4A 3TCOA 1TP9A 2RUFA 5D9XA 4HU7A 3ERWA 2B1LA 3ZVJD 3EU3A 2B6MA 2GQKA 2JACA 2E2MA 4E8HA 5HR1A 2RUEA 2JL4A 1DUGA 3I43A 5J9BA 2FD3A 2YZHA 1ERWA 3A2VA 4MF7A 3FR6A 4MF6A 4GXZA 5KN3A 2MMZA 18GSA 2CV4A 4MZCA 2FA4A 1HD2A 1SK0A 1A24A 4X1UA 3H8QA 4MH3A 3WD6A 2N5FA 1GSFA 1NM3A 3CXGA 3C1RA 3LJRA 1YZXA 2E0QA 4EKZA 3MAKA 5DCGA 3G7IA 4AGSA 4QQ7A 4KH7A 1T00A 2CVKA 4TR0A 5DQYA 2AUVA 4ZL9A 3TJKA 3DRNA 3ZVJA 1EGOA 1SU9A 3GV1A 3N5OA 1EV4A 4TXVA 2CX4A 4IGJA 2DLXA 3CSJA 1OYJA 4MJEA 4BVXA 4P3YB 1ZYQB 3HYPA 4ZB8A 2ON7A 1HNCA 4WBRD 1O85A 5DALB 1SKWB 1B4QA 2FY6A 4QL7A 1ERUA 4BL7A 2VL2A 4NV2A 3F6DA 4KGIA 3EMXA 1GTUA 1AIUA 1THOA 1FVJA 3L9UA 2LV3A 5C04A 2GS3A 9GSSA 4N0VA 3VWXA 4PQ1A 5IMAA 1TK8B 1R26A 3H79A 4HZ2A 2IL3A 4NAXA 4O32A 2JADA 5DAKA 3L9VA 4FIWA 1OE8A 2HZFA 2H6ZA 1EP7A 2R6KA 2YPMA 4RI6A 2H30A 5HR3A 1TKDB 5EL8A 1GLQA 1UC7A 2R2JA 1PSQA 2CZ2A 2X64A 5KN0A 2FWGA 3APOA 5G31A 2WJUA 3LWAA 3ZREA 4IJIA 1JZDA 1QFNA 2E2GA 2E7PA 1M9AA 1UVZA 1T1VA 1THXA 1ST9A 3FEUA 2K8SA 4ECCA 5A5KA 1PKZA 2FHEA 1GULA 2P5QA 2H70A 2OE3A 4HJ2A 4HOJA 1SKSB 4XS1A 2BJXA 1ERTA 2O89A 3EMPA 4KDUA 4KAEA 3LYPA 1T7PB 3H93A 5GSSA 2LJRA 1M2DA 2N5BA 4KCAA 4TXOA 4XRDA 2YN1A 2CVBA 4IP6A 3NIVA 1I5GA 1DE1A 4YQMA 1TU7A 4ID0A 4DSSA 4ACSA 4OWYA 5B8BA 1GP1A 3US3A 1G6WA 4HQZA 4KW6A 1E6BA 1TI3A 2IMDA 2IMEA 4O7HA 1PKWA 2G0FA 5A4WA 4WR4A 1PN9A 3ZFBA 2PU9C 3O76A 1ZGNA 2LNSA 1SD9A 2GZYA 2B5YA 1BEDA 4PQHA 2YWMA 4ZB9A 1ZZYA 1PQNA 5B7CA 4OO5A 2FWFA 3O3TA 2LSTA 4HQSA 4CDOA 5INYA 2LUSA 2QKEA 2GSTA 1E2YA 3GURA 4HUAA 2AB6A 4I2UA 4NHZA 2HZEB 1VF1A 4PUAA 3BBYA 1PD21 3KM6A 3KP8A 1OC3A 3GH6A 2H0GA 4MPFA 1URMA 3ERGA 1I9DA 1SYRA 2EIOA 4V2NA 2PERA 5D93A 1OVNA 4WKWA 2MBTA 3P8WA 2TIRA 2JZTA 3FW2A 1U3AA 5ELGA 2C0DA 4NWYA 5H5QA 2CAIA 4V2LA 3FYGA 4KDYA 3VI5A 1YKCA 2D2ZA 4E8EA 3HCZA 2R37A 4MK3A 2PVOC 4XS6A 3HDCA 1JFUA 2QSIA 5J4UA 1S3DA 2PMTA 2WFCA 3FZ9A 2YANA 3C71A 1YKAA 1EV9A 2YZUA 1RQMA 4ISDA 2MMNA 1GNWA 3GFKA 4FH8A 4G2EA 3F3RA 4LL4B 1YEXA 2NPBA 3TOUA 3BJ5A 4LMWA 1XW9A 1YF1A 3ZFLA 3ME8A 3KIJA 2O8VB 3IXRA 3C73A 3LXZA 2XPDA 3CMIA 1MEKA 1XW6A 3F63A 1O7UA 2M46A 4J2FA 4F03A 4AJ8A 1Z5YE 1GUKA 3IRAA 3PGTA 1UA5A 4TRXA 2AAWA 3CRTA 3JCML 5F05A 5DCHA 3TKSC 4PNGA 1IYIA 2GVPA 1B9YC 3UBKA 3EWLA 3HJMA 1KBNA
chains in the Genus database with same CATH superfamily
1WPIA 3L78A 3RPPA 6GSVA 3D4MA 3C1SA 2HSMA 2P5RA 1XWAA 2VCQA 2H0HA 4GTUA 2MMOA 2C0FA 4TR3A 3Q6OA 3RDWA 4I97A 1G0TA 4IHUA 3UJ1A 4DEJA 3UARA 1U88A 4MZBA 3GKKA 3ME7A 1XCCA 1JZRA 1M2BA 4O5QA 4Z7XA 4V1Ag 2O87A 3CRUA 3WGDA 3M3MA 4WEYA 2GSRA 1K0AA 1O81A 1AAZA 4Q5FA 2P31A 4FYBA 5CNWA 2YJHA 1PFOA 3DYRA 3ED3A 4FYCA 1V9WA 2L6DA 2L4QA 2Z9SA 3D5JA 3GH9A 5D96A 4JRRA 2C0EA 4N0ZA 4RQXA 4EIQA 2MYGA 22GSA 1SJIA 2QA2A 13GSA 3TUEA 2CQ9A 4OO4A 3GA4A 4WETA 1VF4A 4KNDA 4CW9A 1HYUA 3GRXA 2F51A 5A4UA 1T4ZA 1A23A 5IQYA 1LBKA 2H1BA 3F4RA 2RIIA 3GKNA 1ZOFA 5J3RA 5IMZA 3GNJA 4GQFA 2HRFA 4J56E 3UEMA 3F9UA 4TN8A 1AQWA 3ZITA 2IFQA 1MTCA 2GDRA 3UL3A 3UIWA 2IMKA 1XVQA 2YCDA 4MH2A 2I3YA 4XS4B 1PX7A 4PNFA 4ZBDA 1JZWA 4ZILA 3ZIJA 3QFAC 2X4AA 4PTSA 2CAQA 4K6XA 2A2SA 5ABRA 4MA9A 3IR4A 4MCUA 2JU5A 2QC7A 2YWIA 1V58A 1K0CA 5J41A 2PGTA 1OC8A 1JLWA 7GSSA 1RK4A 1QMVA 5DJMA 4K0NA 5GZZB 4X43A 4K7IA 1PGTA 1B9XC 3HZ8A 1IYHA 2O85A 3TKSA 2DSAA 3GTUB 3HVXA 4BL7B 3IOSA 1F2EA 3QMXA 1G7EA 4XHMA 5IOXA 3W8SA 1TJDA 3TKSE 3P2AA 3WYWA 4POLA 3KTLA 2OE1A 3C8EA 1YDKA 3LQ7A 4YKGA 4NHWA 2PVQA 3CSHA 3GHAA 1USBA 3I9V2 4LA1A 3UOMA 4X0XA 1XWKA 3DMLA 3I6AA 3IHQA 5FT3A 1TRUA 2NTOA 4HJMA 3DD3A 1HQOA 5DBQA 2DJ2A 4KCEA 3DWVA 2JZRA 3F4SA 4EL1A 4KB3A 3FR9A 2DIZA 3ZYWA 1EWXA 1PL1A 4POKA 3QFBC 2DBCA 5HR0A 2H1AA 1WJKA 2VAFA 4WF4A 4EE0A 3ZTLA 3UVTA 3M9JA 3A5WA 3TJBA 5CRWA 5JWOB 2O7KA 5ECLB 2ZNMA 4IKHA 2C0GA 2AYTA 1GSDA 6GSWA 2V32A 4O5RA 3FZAA 3IAS2 2A2RA 5A4VA 3HVSA 5CAXA 4LL1B 2GGTA 2I9HA 1DSBA 3IV4A 2DMMA 3TRXA 2K9FA 1M9BA 1R7HA 2XBIA 3FKFA 3HJPA 5E4WA 3VWVA 1EP8A 2PBJA 1K3OA 1PRXA 3UVHA 3TOTA 2YV9A 5ECRB 5LNKe 3K8NA 1QXHA 5DQSA 2B5XA 2VUPA 4I2TA 5KN2A 2XBQA 4V2MA 8GSSA 3EINA 2HE3A 4TR1B 11GSA 1H4OA 3APSA 1MDIA 1Z3EA 2LJAA 2WS2A 4NV5A 1WOUA 3LYKA 2H0IA 4Q5QA 3FZ5A 2WZ9A 3HJOA 4OFTA 1DE2A 4KUNA 2MZCA 1O6JA 1Q98A 2HSHA 4N30A 4K2XA 4AJ6A 4DSQA 2F8FA 3IAM2 3E3EA 5F0GA 2OACA 1TTZA 1GL8A 4ZBAA 4JE1A 2JZSA 2RM6A 3LFLA 3KXOA 3L4NA 3F3QA 3DVXA 1HNBA 5JCWA 5COHA 1TOFA 4G0LA 1X9MB 4ZL7A 4USSA 1XOBA 2DJKA 5D73A 3ZLPA 4MABA 3D4TA 2LNTA 3GKXA 4L8EA 4JBBA 2TRXA 1X9SB 3KH9A 2V1MA 3M9KA 4HI7A 5IOWA 1C72A 4K9ZA 1XW5A 2L6CA 3D6IA 1TK0B 3KJYA 2NBSA 3I69A 3GX8A 5D9WA 3VPTA 1A8LA 5J9CA 1B8XA 2HNLA 1SD8A 2LJKA 1QQ2A 3TGZA 2VLVA 4BIKA 3EU4A 4KE3A 2PN8A 2IMFA 2QA1A 3P7XA 1B48A 4G19A 1OC9B 3EURA 3VLNA 4HU9A 5ID2A 20GSA 3RHCA 3UBLA 3KCMA 4AJ7A 2GT6A 1J0FA 4YQUA 3H1NA 1X5DA 5JWQB 2TRCP 3M0FA 4WF5A 2GT5A 3O6TA 3BOAA 2I1UA 4LMVA 1T3BA 2HXKA 5G5FA 2YJ7A 3GUSA 1V2AA 3L9SA 2R3XA 1Y25A 4KX4A 2H73A 1PX6A 4HDEA 1FHEA 4MLYA 3UAPA 4KA0A 1AC1A 5E59A 2AV4A 4JEDA 3KTBA 1QUWA 1GUMA 3W8JA 3V1WA 2EIQA 2RM5A 4F0CA 4BPYA 1TI1A 2I4AA 2H75A 4K2DA 4XIHA 1YEPA 3GL5A 3KP9A 6GSUA 2CVDA 3M8NA 2GZPA 3FR3A 4PGTA 2ZCTA 5IO0A 1WRYA 5KOWA 4MJAA 3LG6A 1J9BA 2L59A 3HHVA 1K0NA 1XIYA 4BWSA 1PL2A 1GSSA 1N2AA 5CRHA 2YOIA 4N11A 3Q19A 2R4VA 1X0RA 2V6OA 1A2LA 1G7OA 3KGKA 5CREA 3L0HA 3VWUA 5AGYA 1K0MA 2AJQB 3FK8A 5HR2A 2HYXA 2VOCA 6GSYA 1BX9A 5IO2A 4ULXA 5G2ZA 5GAPD 1G6YA 1Z7RA 4ECBA 5F06A 2HRNA 3VURA 3LSZA 5CRDA 2HSYA 4KF9A 2ALBA 3HKRA 5BRTA 4GSSA 2KP1A 1H75A 1FVKA 5CP1A 1Z6MA 3GYKA 3MIXA 3TRPA 2H8LA 1F6MC 3CTFA 5IMDA 3IBHA 1AUCA 4K7OA 4MF5A 3GIXA 2BTOT 1ML6A 3DEXA 3DVWA 3A5IA 1CQGA 1SL0B 1A2MA 4IP1A 4MDCA 1B4PA 4IELA 3VK9A 6GSTA 4BVYA 1ZYEA 4ECJA 4XRAA 5BMUA 3IA1A 4PQIA 4WR5A 2H6XA 3U6VA 2VO4A 3EVIA 3AY8A 2FA8A 1GH2A 4I8BA 4ZIJA 4FQUA 3LGCA 5HFKA 2DIYA 2VCZA 3FY7A 4MNNA 3WGEA 1YJ6A 2LEGA 4V1Ap 2YNXA 5ECOB 1GRXA 1A2JA 3BCKA 5IMVA 3A3TA 2ZUPA 2IPAA 2C80A 1XBSA 1EOHA 1N8JA 1AW9A 4XCSA 3NZNA 4LLRA 4MZWA 4XTSA 3LXTA 1SYXA 1KNGA 1Z6NA 3TKRA 2VCXA 3A2XA 4PURA 1AQVA 2GTUA 4D73B 4EIPA 4GF0A 1EZKA 3QAVA 4ILFA 5D8IA 2B7KA 4ECIA 2J23A 3HVVA 3G9BA 2YWNA 1FAAA 2VCTA 1GTAA 2M80A 4IW9A 3QDNA 4OCEA 2H01A 1Q4JA 1ZCPA 4Q5NA 1F9MA 1XWBA 4EO3A 3FZ4A 2REMA 1V57A 1OE7A 3MWHA 3QAWA 19GSA 4BWQA 4J57E 2PWJA 3D0ZA 3E0UA 2H6YA 2DJ1A 2RLIA 4K7NA 1TW9A 2H72A 2C4JA 5ENUA 2MMAA 2DJJA 2H74A 5G1KA 14GSA 3KMNA 2IWTA 3QOUA 4A5PA 1JZOA 4HEA2 3SBCA 3F8UA 3J7Yb 3MNGA 3KZQA 1F3AA 1SL2B 4O5UA 2C3TA 2OJLA 1MDKA 3DXBA 1M3IA 2H1GA 2WDUA 4YAVA 1U6TA 3GL3A 2AHEA 3R2QA 4FO5A 2WRTA 4G9HA 1NW2A 1Z9HA 5GAND 1MD3A 2YWOA 4BVXB 1HNAA 1AXDA 3NOFA 3W6GA 1TDIA 4BA7A 4N10A 4HS1A 2K18A 1TXXA 3P90A 2VLTA 3GN3A 3MDKA 4H86A 2B7JA 2FNOA 1TRWA 1T4YA 5IMFA 4IN0A 3J7Yk 2HT9A 1EEMA 2KLXA 4ML6A 1ILOA 3Q74A 1QK8A 3HY2A 2V6KA 1OAZA 4EC0A 2BMXA 2VD1A 1FG4A 4TKYA 4OFMA 5AIXA 3CYNA 5G30A 1OKDA 3OR5A 5D9VA 4WBJA 5DAKB 5DVBA 5L71A 5DJLA 4EF0A 5J5NA 1K0DA 1YY7A 3MSZA 3QAGA 4PUFC 2QGVA 2OE0A 2IMIA 2K6VA 2HRAA 5FWGA 5LCZA 3RBTA 2DJ0A 3ZMKA 4WXTA 1NHOA 1VF3A 3GKMA 5JCUA 4GRFA 2VL9A 3FRCA 5IPHA 4IQAA 1XWGA 3WT2A 3FHKA 17GSA 1EGRA 2L5LA 4GQCA 4OCFA 2HRKA 3IC8A 1XZOA 3APQA 12GSA 3HXSA 1ON4A 3C7MA 1XVWA 3MYDA 2GQLA 4POMA 4G0IA 4F2IA 3RPNA 2F9SA 2GSQA 2LRNA 1GSQA 2YP6A 2L57A 1EEJA 4X4JA 4MPGA 1GTBA 5ID2B 2KHPA 5CRGA 4TXOB 5B6NA 2VIMA 2GSSA 2F8AA 2LQQA 4DSSB 5B8AA 1O8WA 4KSOA 1BYEA 4ZL8A 4TW5A 1FOVA 3IDVA 2FGXA 5CYYA 4EXJA 5IIZA 5FHIA 5KEJA 5B6MA 1RW1A 4XS4A 5HQPA 5HFGA 4I5QA 5DDLA 2CZ3A 4AF2A 2NDOA 3RAZA 4TOPA 3GMFA 2LKUA 3H4KA 1LU4A 3HZ4A 4GSNA 3VWWA 6GSXA 4ZB6A 2WCIA 2EIRA 2FWEA 2JSYA 2X8HA 4L0UA 4L5LA 3WGXA 3IE3A 1FW1A 1JHBA 4DVCA 3GTUA 3HA9A 1Z7PA 2L5OA 10GSA 3G7JA 2R0CA 4Q5RA 5ECQB 1SKRB 1ERVA 2OBIA 1XOAA 3CBUA 2H71A 4CHSA 4ICYA 4I6XA 2N5AA 3KMOA 2F3MA 3GX0A 2HFDA 4YKFA 4KDXA 5ELAA 1UN2A 3TKQA 1MDJA 3LORA 4HSCX 4TR4A 1K3YA 2FUG2 3F0IA 4GLTA 1AQXA 3FMWA 1YF0A 3EE2A 4NPBA 2OBKA 5ECHB 3ERFA 2LRCA 1SK1A 1V98A 1ACVA 4EDYA 3BCIA 5C00A 2I81A 1PA3A 3ISOA 3D22A 4QL9A 2B1KA 3ZRDA 1X5EA 5ECIB 1W4VA 4MP4A 2FWHA 2PPTA 4NXIA 5IMCA 1TU8A 2KOKA 5H5SA 1A0RP 2KP2A 2LRTA 2IJYA 1WE0A 5EY6A 1X5CA 5D9TA 3ZL5A 2GQMA 1NSWA 4MMMA 1CQHA 3E9JB 5AISA 2OA7A 1TRSA 5IM9A 3F4TA 1F3BA 2X8CA 4Z2UA 2NVLA 1GSEA 2HI7A 1VF2A 3GSTA 1GNEA 4GWRA 2C3NA 3IK9A 3N9JA 4CY8A 2FLSA 1K3LA 2PUKC 2OADA 2DKIA 5DALA 1R4WA 2FCHA 2A4VA 4TR1A 3EPTA 2ES7A 2H66A 2L4CA 5AIVA 2G2QA 3KD0A 4POBA 1XPVA 3IPZA 2B3SA 3GSSA 4F82A 1S3CA 3ZIVA 4RUVA 3M1GA 1M2AA 1FO5A 4IVFA 1ZL9A 3WT1A 4K8MA 4IJ3A 2CT6A 4GSTA 3R3EA 5HFIA 2LQOA 3D21A 4TVEA 4MJCA 1S3AA 4HZ4A 2XC2A 1JLVA 4EDZA 2VL3A 4RI7A 3S9FA 2X99A 3TKPA 3TJGA 2WULA 1A8YA 1SK2A 1BQ7A 1FB6A 1ZMAA 1QGVA 5G5EA 4OMVA 3QCPA 3TJJA 1WP0A 3PR8A 1O8XA 3IK7A 5GSTA 5CO3A 4IS0A 1OKTA 4JZQA 2XPEA 1SENA 2R0GA 1BJXA 1M0UA 2IFQB 4IBPA 1OC9A 2UZ8A 3LEFA 4L0WA 3BD2A 2B5EA 4G10A 2WGRA 1W89A 3CTGA 1GTIA 4KSMA 1SJZA 3QD9A 4PXOA 2DC5A 2VM1A 2H76A 1O73A 5F07A 5H5RA 2VCVA 3DIEA 3Q18A 4ML1A 5ECKB 1V40A 2V41A 2GLRA 2MBSA 4FYUA 1WWJA 2C3QA 2YV7A 4RQRA 1U3IA 4L5OA 2JSZA 1K0OA 4GCIA 4F9ZA 2CX3A 1S3RA 1WMJA 4OFNA 3DKSA 3PPUA 1GSUA 3G7YA 3TB2A 4MJBA 3QR6A 4YH2A 1M3JA 3DGQA 3HD5A 1T8EB 4YAPA 2HZEA 3RHBA 5IPGA 1EOGA 1TK5B 2VCWA 4PX1A 1J08A 2R5GA 2WB9A 4K1FA 5AN1A 6GSSA 2LS5A 4G0KA 2GZZA 1GWCA 3U5RE 2VM2A 1MD4A 1R5PA 4ZXGA 1KEBA 2HLSA 5EVOA 2C8UA 1LJRA 5JCGA 2KUCA 4ZBBA 2P0GA 3LW9A 5ECPB 1TRVA 1U87A 16GSA 1XXUA 1XFLA 2K8VA 5KOXA 3VI7A 1GSYA 5KN1A 1F37A 4K0GA 3SWLA 4YQVA 3TRQA 5ECNB 3EYTA 1NHYA 3TJFA 1ABAA 1VGLA 1DBYA 3VFIA 4JR6A 2IIYA 1KTEA 5EPFA 2C1YA 4NMUA 3KH7A 5JWRB 1X9WB 1A0FA 2CA8A 1BG5A 2DJ3A 3TDGA 1PN0A 1SL1B 2M72A 2H1DA 1GUHA 1XG8A 5LD0A 1XWCA 4Z2TA 2VL2C 3ZMLA 1K0BA 5G1LA 4F0BA 1WIKA 1FB0A 2IN3A 4O92A 4IQ1A 3VPQA 2VD0A 1Y6EA 1PMTA 3EC3A 2V2GA 3UMAA 3KEBA 2VLUA 2J9HA 2LTKA 3F6FA 3CSIA 3IHGA 2A2PA 3A2WA 1M99A 1SJ6A 2OKAA 5ECMB 1VRSD 2DMLA 4EVMA 1R5AA 1YQ1A 2H19A 4D73A 4Z2RA 2ON5A 4EUYA 4DSRA 3PH9A 1GLPA 1BAYA 4JU5A 1M7TA 3ZZXA 2X8GA 2XHFA 3PINA 2EC4A 3QPMA 3IC4A 5ECSA 5F8BA 4OD7A 4JR4A 3TCOA 1TP9A 2RUFA 5D9XA 4HU7A 3ERWA 2B1LA 3ZVJD 3EU3A 2B6MA 2GQKA 2JACA 2E2MA 4E8HA 5HR1A 2RUEA 2JL4A 1DUGA 3I43A 5J9BA 2FD3A 2YZHA 2R0PA 1ERWA 3A2VA 4MF7A 3FR6A 4MF6A 4GXZA 5KN3A 1FOHA 2MMZA 18GSA 2CV4A 4MZCA 2FA4A 1HD2A 1SK0A 1A24A 4X1UA 3H8QA 4MH3A 3WD6A 2N5FA 1GSFA 1NM3A 4K5SA 3CXGA 3C1RA 3LJRA 1YZXA 2E0QA 4EKZA 3MAKA 5DCGA 3G7IA 4AGSA 4QQ7A 4KH7A 1T00A 2CVKA 4TR0A 5DQYA 2AUVA 4ZL9A 3TJKA 3DRNA 3ZVJA 1EGOA 1SU9A 3GV1A 3N5OA 1EV4A 4TXVA 2CX4A 4IGJA 2DLXA 3CSJA 1OYJA 2A4HA 4MJEA 2DKHA 4BVXA 4P3YB 1ZYQB 3HYPA 4ZB8A 2ON7A 1HNCA 4WBRD 1O85A 4K5RA 5DALB 1SKWB 1B4QA 2FY6A 4QL7A 1ERUA 4BL7A 2VL2A 4NV2A 3F6DA 4KGIA 3EMXA 1GTUA 1AIUA 1THOA 3CQFA 1FVJA 3L9UA 2LV3A 5C04A 2GS3A 9GSSA 4N0VA 3VWXA 4PQ1A 5IMAA 1TK8B 1R26A 3H79A 4HZ2A 2IL3A 4NAXA 4O32A 2JADA 5DAKA 3L9VA 4FIWA 1OE8A 2HZFA 2H6ZA 1EP7A 2R6KA 2YPMA 4RI6A 2H30A 5HR3A 1TKDB 5EL8A 1GLQA 1UC7A 2R2JA 1PSQA 2CZ2A 2X64A 5KN0A 2FWGA 3APOA 5G31A 2WJUA 3LWAA 3ZREA 4IJIA 1JZDA 1QFNA 2E2GA 2E7PA 1M9AA 1UVZA 1T1VA 1THXA 1ST9A 3FEUA 2K8SA 4ECCA 5A5KA 4BVYB 1PKZA 2FHEA 4CY6A 1GULA 2P5QA 2H70A 2OE3A 4HJ2A 4HOJA 1SKSB 4XS1A 2BJXA 1ERTA 2O89A 3EMPA 4KDUA 4KAEA 3LYPA 1T7PB 3H93A 5GSSA 2LJRA 1M2DA 2N5BA 4KCAA 4TXOA 4XRDA 2YN1A 2CVBA 4IP6A 3NIVA 1I5GA 1DE1A 4YQMA 1TU7A 4ID0A 4DSSA 4ACSA 4OWYA 5B8BA 1GP1A 3US3A 1G6WA 4HQZA 4KW6A 1E6BA 1TI3A 2IMDA 2IMEA 4O7HA 1PKWA 2G0FA 5A4WA 4WR4A 1PN9A 3ZFBA 2PU9C 3O76A 1ZGNA 2LNSA 1SD9A 2X49A 2GZYA 2B5YA 1BEDA 4PQHA 2YWMA 4ZB9A 1ZZYA 1PQNA 5B7CA 4OO5A 2FWFA 3O3TA 2LSTA 4HQSA 4CDOA 5INYA 2LUSA 2QKEA 2GSTA 1E2YA 3GURA 4HUAA 2AB6A 4I2UA 4NHZA 2HZEB 1VF1A 4PUAA 3BBYA 1PD21 3KM6A 3KP8A 1OC3A 3GH6A 2H0GA 4MPFA 1URMA 1ZYNA 3ERGA 1I9DA 1SYRA 2EIOA 4V2NA 2PERA 5D93A 1OVNA 4WKWA 2MBTA 3P8WA 2TIRA 2JZTA 3FW2A 1U3AA 5ELGA 2C0DA 4NWYA 5H5QA 2CAIA 4V2LA 3FYGA 4KDYA 3VI5A 1YKCA 2D2ZA 4E8EA 3HCZA 2R37A 4MK3A 2PVOC 4XS6A 3HDCA 1JFUA 2QSIA 3HVNA 5J4UA 1S3DA 2PMTA 2WFCA 3FZ9A 2YANA 3C71A 1YKAA 1EV9A 2YZUA 1RQMA 4ISDA 2MMNA 1GNWA 3GFKA 4FH8A 4G2EA 3F3RA 4LL4B 1YEXA 2NPBA 3TOUA 3BJ5A 4LMWA 1XW9A 1YF1A 3ZFLA 3ME8A 3KIJA 2O8VB 3IXRA 3C73A 3LXZA 2XPDA 3CMIA 1MEKA 1XW6A 3F63A 1O7UA 2M46A 4J2FA 4F03A 4AJ8A 1Z5YE 1GUKA 3IRAA 3PGTA 1UA5A 4TRXA 2AAWA 3CRTA 3JCML 5F05A 5DCHA 3TKSC 4PNGA 1IYIA 1ZYPA 2GVPA 1B9YC 3UBKA 3EWLA 3HJMA 1KBNA
chains in the Genus database with same CATH topology
1WPIA 3L78A 3RPPA 6GSVA 3D4MA 3C1SA 2HSMA 2P5RA 1XWAA 2VCQA 2H0HA 4GTUA 2MMOA 2C0FA 4TR3A 3Q6OA 3RDWA 4I97A 1G0TA 4IHUA 3UJ1A 4DEJA 3UARA 1U88A 4MZBA 3GKKA 3ME7A 1XCCA 1JZRA 1M2BA 4O5QA 4Z7XA 4V1Ag 2O87A 3CRUA 3WGDA 3M3MA 4WEYA 2GSRA 1K0AA 1O81A 1AAZA 4Q5FA 2P31A 4FYBA 5CNWA 2YJHA 3DYRA 3ED3A 4FYCA 1V9WA 2L6DA 2L4QA 2Z9SA 3D5JA 3GH9A 5D96A 4JRRA 2C0EA 4N0ZA 4RQXA 4EIQA 2MYGA 22GSA 1SJIA 2QA2A 13GSA 3TUEA 2CQ9A 4OO4A 3GA4A 4WETA 1VF4A 4KNDA 4CW9A 1HYUA 3GRXA 2F51A 5A4UA 1T4ZA 1A23A 5IQYA 1LBKA 2H1BA 3F4RA 2RIIA 3GKNA 1ZOFA 5J3RA 5IMZA 3GNJA 4GQFA 2HRFA 4J56E 3UEMA 3F9UA 4TN8A 1AQWA 3ZITA 2IFQA 1MTCA 2GDRA 3UL3A 3UIWA 2IMKA 1XVQA 2YCDA 4MH2A 2I3YA 4XS4B 1PX7A 4PNFA 4ZBDA 1JZWA 4ZILA 3ZIJA 3QFAC 2X4AA 4PTSA 2CAQA 4K6XA 2A2SA 5ABRA 4MA9A 3IR4A 4MCUA 2JU5A 2QC7A 2YWIA 1V58A 1K0CA 5J41A 2PGTA 1OC8A 1JLWA 7GSSA 1RK4A 1QMVA 5DJMA 4K0NA 5GZZB 4X43A 4K7IA 1PGTA 1B9XC 3HZ8A 1IYHA 2O85A 3TKSA 2DSAA 3GTUB 3HVXA 4BL7B 3IOSA 1F2EA 3QMXA 1G7EA 4XHMA 5IOXA 3W8SA 1TJDA 3TKSE 3P2AA 3WYWA 4POLA 3KTLA 2OE1A 3C8EA 1YDKA 3LQ7A 4YKGA 4NHWA 2PVQA 3CSHA 3GHAA 1USBA 3I9V2 4LA1A 3UOMA 4X0XA 1XWKA 3DMLA 3I6AA 3IHQA 5FT3A 1TRUA 2NTOA 4HJMA 3DD3A 1HQOA 5DBQA 2DJ2A 4KCEA 3DWVA 2JZRA 3F4SA 4EL1A 4KB3A 3FR9A 2DIZA 3ZYWA 1EWXA 1PL1A 4POKA 3QFBC 2DBCA 5HR0A 2H1AA 1WJKA 2VAFA 4WF4A 4EE0A 3ZTLA 3UVTA 3M9JA 3A5WA 3TJBA 5CRWA 5JWOB 2O7KA 5ECLB 2ZNMA 4IKHA 2C0GA 2AYTA 1GSDA 6GSWA 2V32A 4O5RA 3FZAA 3IAS2 2A2RA 5A4VA 3HVSA 5CAXA 4LL1B 2GGTA 2I9HA 1DSBA 3IV4A 2DMMA 3TRXA 2K9FA 1M9BA 1R7HA 2XBIA 3FKFA 3HJPA 5E4WA 3VWVA 1EP8A 2PBJA 1K3OA 1PRXA 3UVHA 3TOTA 2YV9A 5ECRB 5LNKe 3K8NA 1QXHA 5DQSA 2B5XA 2VUPA 4I2TA 5KN2A 2XBQA 4V2MA 8GSSA 3EINA 2HE3A 4TR1B 11GSA 1H4OA 3APSA 1MDIA 1Z3EA 2LJAA 2WS2A 4NV5A 1WOUA 3LYKA 2H0IA 4Q5QA 3FZ5A 2WZ9A 3HJOA 4OFTA 1DE2A 4KUNA 2MZCA 1O6JA 1Q98A 2HSHA 4N30A 4K2XA 4AJ6A 4DSQA 2F8FA 3IAM2 3E3EA 5F0GA 2OACA 1TTZA 1GL8A 4ZBAA 4JE1A 2JZSA 2RM6A 3LFLA 3KXOA 3L4NA 3F3QA 3DVXA 1HNBA 5JCWA 5COHA 1TOFA 4G0LA 1X9MB 4ZL7A 4USSA 1XOBA 2DJKA 5D73A 3ZLPA 4MABA 3D4TA 2LNTA 3GKXA 4L8EA 4JBBA 2TRXA 1X9SB 3KH9A 2V1MA 3M9KA 4HI7A 5IOWA 1C72A 4K9ZA 1XW5A 2L6CA 3D6IA 1TK0B 3KJYA 2NBSA 3I69A 3GX8A 5D9WA 3VPTA 1A8LA 5J9CA 1B8XA 2HNLA 1SD8A 2LJKA 1QQ2A 3TGZA 2VLVA 3EU4A 4KE3A 2PN8A 2IMFA 2QA1A 3P7XA 1B48A 4G19A 1OC9B 3EURA 3VLNA 4HU9A 5ID2A 20GSA 3RHCA 3UBLA 3KCMA 4AJ7A 2GT6A 1J0FA 4YQUA 3H1NA 1X5DA 5JWQB 2TRCP 3M0FA 4WF5A 2GT5A 3O6TA 3BOAA 2I1UA 4LMVA 1T3BA 2HXKA 5G5FA 2YJ7A 3GUSA 1V2AA 3L9SA 2R3XA 1Y25A 4KX4A 2H73A 1PX6A 4HDEA 1FHEA 4MLYA 3UAPA 4KA0A 1AC1A 5E59A 2AV4A 4JEDA 3KTBA 1QUWA 1GUMA 3W8JA 3V1WA 2EIQA 2RM5A 4F0CA 4BPYA 1TI1A 2I4AA 2H75A 4K2DA 4XIHA 1YEPA 3GL5A 3KP9A 6GSUA 2CVDA 3M8NA 2GZPA 3FR3A 4PGTA 2ZCTA 5IO0A 1WRYA 5KOWA 4MJAA 3LG6A 1J9BA 2L59A 3HHVA 1K0NA 1XIYA 4BWSA 1PL2A 1GSSA 1N2AA 5CRHA 2YOIA 4N11A 3Q19A 2R4VA 1X0RA 2V6OA 1A2LA 1G7OA 3KGKA 5CREA 3L0HA 3VWUA 5AGYA 1K0MA 2AJQB 3FK8A 5HR2A 2HYXA 2VOCA 6GSYA 1BX9A 5IO2A 4ULXA 5G2ZA 5GAPD 1G6YA 1Z7RA 4ECBA 5F06A 2HRNA 3VURA 3LSZA 5CRDA 2HSYA 4KF9A 2ALBA 3HKRA 5BRTA 4GSSA 2KP1A 1H75A 1FVKA 5CP1A 1Z6MA 3GYKA 3MIXA 3TRPA 2H8LA 1F6MC 3CTFA 5IMDA 3IBHA 1AUCA 4K7OA 4MF5A 3GIXA 2BTOT 1ML6A 3DEXA 3DVWA 3A5IA 1CQGA 1SL0B 1A2MA 4IP1A 4MDCA 1B4PA 4IELA 3VK9A 6GSTA 4BVYA 1ZYEA 4ECJA 4XRAA 5BMUA 3IA1A 4PQIA 4WR5A 2H6XA 3U6VA 2VO4A 3EVIA 3AY8A 2FA8A 1GH2A 4I8BA 4ZIJA 4FQUA 3LGCA 5HFKA 2DIYA 2VCZA 3FY7A 4MNNA 3WGEA 1YJ6A 2LEGA 4V1Ap 2YNXA 5ECOB 1GRXA 1A2JA 3BCKA 5IMVA 3A3TA 2ZUPA 2IPAA 2C80A 1XBSA 1EOHA 1N8JA 1AW9A 4XCSA 3NZNA 4LLRA 4MZWA 4XTSA 3LXTA 1SYXA 1KNGA 1Z6NA 3TKRA 2VCXA 3A2XA 4PURA 1AQVA 2GTUA 4D73B 4EIPA 4GF0A 1EZKA 3QAVA 4ILFA 5D8IA 2B7KA 4ECIA 2J23A 3HVVA 3G9BA 2YWNA 1FAAA 2VCTA 1GTAA 2M80A 4IW9A 3QDNA 4OCEA 2H01A 1Q4JA 1ZCPA 4Q5NA 1F9MA 1XWBA 4EO3A 3FZ4A 2REMA 1V57A 1OE7A 3MWHA 3QAWA 19GSA 4BWQA 4J57E 2PWJA 3D0ZA 3E0UA 2H6YA 2DJ1A 2RLIA 4K7NA 1TW9A 2H72A 2C4JA 5ENUA 2MMAA 2DJJA 2H74A 5G1KA 14GSA 3KMNA 2IWTA 3QOUA 4A5PA 1JZOA 4HEA2 3SBCA 3F8UA 3J7Yb 3MNGA 3KZQA 1F3AA 1SL2B 4O5UA 2C3TA 2OJLA 1MDKA 3DXBA 2H1GA 2WDUA 4YAVA 1U6TA 3GL3A 2AHEA 3R2QA 4FO5A 2WRTA 4G9HA 1NW2A 1Z9HA 5GAND 1MD3A 2YWOA 4BVXB 1HNAA 1AXDA 3NOFA 3W6GA 1TDIA 4BA7A 4N10A 4HS1A 2K18A 1TXXA 3P90A 2VLTA 3GN3A 3MDKA 4H86A 2B7JA 2FNOA 1TRWA 1T4YA 5IMFA 4IN0A 3J7Yk 2HT9A 1EEMA 2KLXA 4ML6A 1ILOA 3Q74A 1QK8A 3HY2A 2V6KA 1OAZA 4EC0A 2BMXA 2VD1A 1FG4A 4TKYA 4OFMA 5AIXA 3CYNA 5G30A 1OKDA 3OR5A 5D9VA 4WBJA 5DAKB 5DVBA 5L71A 5DJLA 4EF0A 5J5NA 1K0DA 1YY7A 3MSZA 3QAGA 4PUFC 2QGVA 2OE0A 2IMIA 2K6VA 2HRAA 5FWGA 5LCZA 3RBTA 2DJ0A 3ZMKA 4WXTA 1NHOA 1VF3A 3GKMA 5JCUA 4GRFA 2VL9A 3FRCA 5IPHA 4IQAA 1XWGA 3WT2A 3FHKA 17GSA 1EGRA 2L5LA 4GQCA 4OCFA 2HRKA 3IC8A 1XZOA 3APQA 12GSA 3HXSA 1ON4A 3C7MA 1XVWA 3MYDA 2GQLA 4POMA 4G0IA 4F2IA 3RPNA 2F9SA 2GSQA 2LRNA 1GSQA 2YP6A 2L57A 1EEJA 4X4JA 4MPGA 1GTBA 5ID2B 2KHPA 5CRGA 4TXOB 5B6NA 2VIMA 2GSSA 2F8AA 2LQQA 4DSSB 5B8AA 1O8WA 4KSOA 1BYEA 4ZL8A 4TW5A 1FOVA 3IDVA 2FGXA 5CYYA 4EXJA 5IIZA 5FHIA 5KEJA 1RW1A 4XS4A 5B6MA 5HQPA 5HFGA 4I5QA 5DDLA 2CZ3A 4AF2A 2NDOA 3RAZA 4TOPA 3GMFA 2LKUA 3H4KA 1LU4A 3HZ4A 4GSNA 3VWWA 6GSXA 4ZB6A 2WCIA 2EIRA 2FWEA 2JSYA 2X8HA 4L0UA 4L5LA 3WGXA 3IE3A 1FW1A 1JHBA 4DVCA 3GTUA 3HA9A 1Z7PA 2L5OA 10GSA 3G7JA 2R0CA 4Q5RA 5ECQB 1SKRB 1ERVA 2OBIA 1XOAA 3CBUA 2H71A 4CHSA 4ICYA 4I6XA 2N5AA 3KMOA 2F3MA 3GX0A 2HFDA 4YKFA 4KDXA 5ELAA 1UN2A 3TKQA 1MDJA 3LORA 4TR4A 1K3YA 2FUG2 3F0IA 4GLTA 1AQXA 3FMWA 1YF0A 3EE2A 4NPBA 2OBKA 5ECHB 3ERFA 2LRCA 1SK1A 1V98A 1ACVA 4EDYA 3BCIA 5C00A 2I81A 1PA3A 3ISOA 3D22A 4QL9A 2B1KA 3ZRDA 1X5EA 5ECIB 1W4VA 4MP4A 2FWHA 2PPTA 4NXIA 5IMCA 1TU8A 2KOKA 5H5SA 1A0RP 2KP2A 2LRTA 2IJYA 1WE0A 5EY6A 1X5CA 5D9TA 3ZL5A 2GQMA 1NSWA 4MMMA 1CQHA 3E9JB 5AISA 2OA7A 1TRSA 5IM9A 3F4TA 1F3BA 2X8CA 4Z2UA 2NVLA 1GSEA 2HI7A 1VF2A 3GSTA 1GNEA 4GWRA 2C3NA 3IK9A 3N9JA 4CY8A 2FLSA 1K3LA 2PUKC 2OADA 2DKIA 5DALA 1R4WA 2FCHA 2A4VA 4TR1A 3EPTA 2ES7A 2H66A 2L4CA 5AIVA 2G2QA 3KD0A 4POBA 1XPVA 3IPZA 2B3SA 3GSSA 4F82A 1S3CA 3ZIVA 4RUVA 3M1GA 1M2AA 1FO5A 4IVFA 1ZL9A 3WT1A 4K8MA 4IJ3A 2CT6A 4GSTA 3R3EA 5HFIA 2LQOA 3D21A 4TVEA 4MJCA 1S3AA 4HZ4A 2XC2A 1JLVA 4EDZA 2VL3A 4RI7A 3S9FA 2X99A 3TKPA 3TJGA 2WULA 1A8YA 1SK2A 1BQ7A 1FB6A 1ZMAA 1QGVA 5G5EA 4OMVA 3QCPA 3TJJA 1WP0A 3PR8A 1O8XA 3IK7A 5GSTA 5CO3A 4IS0A 1OKTA 4JZQA 2XPEA 1SENA 2R0GA 1BJXA 1M0UA 2IFQB 4IBPA 1OC9A 2UZ8A 3LEFA 4L0WA 3BD2A 2B5EA 4G10A 2WGRA 1W89A 3CTGA 1GTIA 4KSMA 1SJZA 3QD9A 4PXOA 2DC5A 2VM1A 2H76A 1O73A 5F07A 5H5RA 2VCVA 3DIEA 3Q18A 4ML1A 5ECKB 1V40A 2V41A 2GLRA 2MBSA 4FYUA 1WWJA 2C3QA 2YV7A 4RQRA 1U3IA 4L5OA 2JSZA 1K0OA 4GCIA 4F9ZA 2CX3A 1WMJA 4OFNA 3DKSA 3PPUA 1GSUA 3G7YA 3TB2A 4MJBA 3QR6A 4YH2A 3DGQA 3HD5A 1T8EB 4YAPA 2HZEA 3RHBA 5IPGA 1EOGA 1TK5B 2VCWA 4PX1A 1J08A 2R5GA 2WB9A 4K1FA 5AN1A 6GSSA 2LS5A 4G0KA 2GZZA 1GWCA 3U5RE 2VM2A 1MD4A 1R5PA 4ZXGA 1KEBA 2HLSA 5EVOA 2C8UA 1LJRA 5JCGA 2KUCA 4ZBBA 2P0GA 3LW9A 5ECPB 1TRVA 1U87A 16GSA 1XXUA 1XFLA 2K8VA 5KOXA 3VI7A 1GSYA 5KN1A 1F37A 4K0GA 3SWLA 4YQVA 3TRQA 5ECNB 3EYTA 1NHYA 3TJFA 1ABAA 1VGLA 1DBYA 3VFIA 4JR6A 2IIYA 1KTEA 5EPFA 2C1YA 4NMUA 3KH7A 5JWRB 1X9WB 1A0FA 2CA8A 1BG5A 2DJ3A 3TDGA 1PN0A 1SL1B 2M72A 2H1DA 1GUHA 5LD0A 1XWCA 4Z2TA 2VL2C 3ZMLA 1K0BA 5G1LA 4F0BA 1WIKA 1FB0A 2IN3A 4O92A 4IQ1A 3VPQA 2VD0A 1Y6EA 1PMTA 3EC3A 2V2GA 3UMAA 3KEBA 2VLUA 2J9HA 2LTKA 3F6FA 3CSIA 3IHGA 2A2PA 3A2WA 1M99A 1SJ6A 2OKAA 5ECMB 1VRSD 2DMLA 4EVMA 1R5AA 1YQ1A 2H19A 4D73A 4Z2RA 2ON5A 4EUYA 4DSRA 3PH9A 1GLPA 1BAYA 4JU5A 1M7TA 3ZZXA 2X8GA 2XHFA 3PINA 2EC4A 3QPMA 3IC4A 5ECSA 5F8BA 4OD7A 4JR4A 3TCOA 1TP9A 2RUFA 5D9XA 4HU7A 3ERWA 2B1LA 3ZVJD 3EU3A 2B6MA 2GQKA 2JACA 2E2MA 4E8HA 5HR1A 2RUEA 2JL4A 1DUGA 3I43A 5J9BA 2FD3A 2YZHA 2R0PA 1ERWA 3A2VA 4MF7A 3FR6A 4MF6A 4GXZA 5KN3A 1FOHA 2MMZA 18GSA 2CV4A 4MZCA 2FA4A 1HD2A 1SK0A 1A24A 4X1UA 3H8QA 4MH3A 3WD6A 2N5FA 1GSFA 1NM3A 4K5SA 3CXGA 3C1RA 3LJRA 1YZXA 2E0QA 4EKZA 3MAKA 5DCGA 3G7IA 4AGSA 4QQ7A 4KH7A 1T00A 2CVKA 4TR0A 5DQYA 2AUVA 4ZL9A 3TJKA 3DRNA 3ZVJA 1EGOA 1SU9A 3GV1A 3N5OA 1EV4A 4TXVA 2CX4A 4IGJA 2DLXA 3CSJA 1OYJA 2A4HA 4MJEA 2DKHA 4BVXA 4P3YB 1ZYQB 3HYPA 4ZB8A 2ON7A 1HNCA 4WBRD 1O85A 4K5RA 5DALB 1SKWB 1B4QA 2FY6A 4QL7A 1ERUA 4BL7A 2VL2A 4NV2A 3F6DA 4KGIA 3EMXA 1GTUA 1AIUA 1THOA 1FVJA 3L9UA 2LV3A 5C04A 2GS3A 9GSSA 4N0VA 3VWXA 4PQ1A 5IMAA 1TK8B 1R26A 3H79A 4HZ2A 2IL3A 4NAXA 4O32A 2JADA 5DAKA 3L9VA 4FIWA 1OE8A 2HZFA 2H6ZA 1EP7A 2R6KA 2YPMA 4RI6A 2H30A 5HR3A 1TKDB 5EL8A 1GLQA 1UC7A 2R2JA 1PSQA 2CZ2A 2X64A 5KN0A 2FWGA 3APOA 5G31A 2WJUA 3LWAA 3ZREA 4IJIA 1JZDA 1QFNA 2E2GA 2E7PA 1M9AA 1UVZA 1T1VA 1THXA 1ST9A 3FEUA 2K8SA 4ECCA 5A5KA 4BVYB 1PKZA 2FHEA 4CY6A 1GULA 2P5QA 2H70A 2OE3A 4HJ2A 4HOJA 1SKSB 4XS1A 2BJXA 1ERTA 2O89A 3EMPA 4KDUA 4KAEA 3LYPA 1T7PB 3H93A 5GSSA 2LJRA 1M2DA 2N5BA 4KCAA 4TXOA 4XRDA 2YN1A 2CVBA 4IP6A 3NIVA 1I5GA 1DE1A 4YQMA 1TU7A 4ID0A 4DSSA 4ACSA 4OWYA 5B8BA 1GP1A 3US3A 1G6WA 4HQZA 4KW6A 1E6BA 1TI3A 2IMDA 2IMEA 4O7HA 1PKWA 2G0FA 5A4WA 4WR4A 1PN9A 3ZFBA 2PU9C 3O76A 1ZGNA 2LNSA 1SD9A 2X49A 2GZYA 2B5YA 1BEDA 4PQHA 2YWMA 4ZB9A 1ZZYA 1PQNA 5B7CA 4OO5A 2FWFA 3O3TA 2LSTA 4HQSA 4CDOA 5INYA 2LUSA 2QKEA 2GSTA 1E2YA 3GURA 4HUAA 2AB6A 4I2UA 4NHZA 2HZEB 1VF1A 4PUAA 3BBYA 1PD21 3KM6A 3KP8A 1OC3A 3GH6A 2H0GA 4MPFA 1URMA 1ZYNA 3ERGA 1I9DA 1SYRA 2EIOA 4V2NA 2PERA 5D93A 1OVNA 4WKWA 2MBTA 3P8WA 2TIRA 2JZTA 3FW2A 1U3AA 5ELGA 2C0DA 4NWYA 5H5QA 2CAIA 4V2LA 3FYGA 4KDYA 3VI5A 1YKCA 2D2ZA 4E8EA 3HCZA 2R37A 4MK3A 2PVOC 4XS6A 3HDCA 1JFUA 2QSIA 5J4UA 1S3DA 2PMTA 2WFCA 3FZ9A 2YANA 3C71A 1YKAA 1EV9A 2YZUA 1RQMA 4ISDA 2MMNA 1GNWA 3GFKA 4FH8A 4G2EA 3F3RA 4LL4B 1YEXA 2NPBA 3TOUA 3BJ5A 4LMWA 1XW9A 1YF1A 3ZFLA 3ME8A 3KIJA 2O8VB 3IXRA 3C73A 3LXZA 2XPDA 3CMIA 1MEKA 1XW6A 3F63A 1O7UA 2M46A 4J2FA 4F03A 4AJ8A 1Z5YE 1GUKA 3IRAA 3PGTA 1UA5A 4TRXA 2AAWA 3CRTA 3JCML 5F05A 5DCHA 3TKSC 4PNGA 1IYIA 1ZYPA 2GVPA 1B9YC 3UBKA 3EWLA 3HJMA 1KBNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WPI A;  3L78 A;  3RPP A;  6GSV A;  3D4M A;  3C1S A;  2P5R A;  1XWA A;  2VCQ A;  2H0H A;  4GTU A;  2MMO A;  2C0F A;  4TR3 A;  3Q6O A;  3RDW A;  4I97 A;  1G0T A;  4IHU A;  3UJ1 A;  4DEJ A;  3UAR A;  1U88 A;  4MZB A;  3GKK A;  3ME7 A;  1XCC A;  1JZR A;  1M2B A;  4Z7X A;  4V1A g;  2O87 A;  3CRU A;  3WGD A;  3M3M A;  4WEY A;  2GSR A;  1K0A A;  1O81 A;  1AAZ A;  4Q5F A;  2P31 A;  4FYB A;  5CNW A;  2YJH A;  3DYR A;  3ED3 A;  4FYC A;  1V9W A;  2L6D A;  2L4Q A;  2Z9S A;  3D5J A;  3GH9 A;  5D96 A;  4JRR A;  2C0E A;  4N0Z A;  4RQX A;  2MYG A;  22GS A;  1SJI A;  13GS A;  3TUE A;  2CQ9 A;  4OO4 A;  3GA4 A;  4WET A;  1VF4 A;  4KND A;  4CW9 A;  1HYU A;  3GRX A;  2F51 A;  5A4U A;  1T4Z A;  1A23 A;  5IQY A;  1LBK A;  2H1B A;  3F4R A;  2RII A;  3GKN A;  1ZOF A;  5J3R A;  5IMZ A;  3GNJ A;  4GQF A;  2HRF A;  4J56 E;  3UEM A;  3F9U A;  4TN8 A;  1AQW A;  3ZIT A;  2IFQ A;  1MTC A;  2GDR A;  3UL3 A;  3UIW A;  2IMK A;  1XVQ A;  2YCD A;  4MH2 A;  2I3Y A;  1PX7 A;  4XS4 B;  4PNF A;  4ZBD A;  1JZW A;  4ZIL A;  3ZIJ A;  3QFA C;  2CAQ A;  4K6X A;  2A2S A;  5ABR A;  4MA9 A;  3IR4 A;  4MCU A;  2JU5 A;  2QC7 A;  2YWI A;  1V58 A;  1K0C A;  5J41 A;  2PGT A;  1OC8 A;  1JLW A;  7GSS A;  1RK4 A;  1QMV A;  5DJM A;  4K0N A;  5GZZ B;  4X43 A;  4K7I A;  1PGT A;  1B9X C;  3HZ8 A;  1IYH A;  2O85 A;  3TKS A;  2DSA A;  3GTU B;  3HVX A;  3IOS A;  1F2E A;  3QMX A;  1G7E A;  4XHM A;  5IOX A;  3W8S A;  1TJD A;  3TKS E;  3P2A A;  3WYW A;  4POL A;  3KTL A;  2OE1 A;  3C8E A;  1YDK A;  3LQ7 A;  4NHW A;  2PVQ A;  3CSH A;  3GHA A;  1USB A;  3I9V 2;  4LA1 A;  3UOM A;  4X0X A;  1XWK A;  3DML A;  3I6A A;  3IHQ A;  5FT3 A;  1TRU A;  2NTO A;  4HJM A;  3DD3 A;  1HQO A;  5DBQ A;  2DJ2 A;  4KCE A;  3DWV A;  2JZR A;  3F4S A;  4EL1 A;  4KB3 A;  3FR9 A;  2DIZ A;  3ZYW A;  1EWX A;  1PL1 A;  4POK A;  3QFB C;  2DBC A;  5HR0 A;  2H1A A;  1WJK A;  2VAF A;  4WF4 A;  4EE0 A;  3ZTL A;  3UVT A;  3M9J A;  3A5W A;  3TJB A;  5CRW A;  5JWO B;  2O7K A;  5ECL B;  2ZNM A;  4IKH A;  2C0G A;  2AYT A;  1GSD A;  6GSW A;  2V32 A;  4O5R A;  3FZA A;  3IAS 2;  2A2R A;  5A4V A;  3HVS A;  5CAX A;  4LL1 B;  2GGT A;  2I9H A;  1DSB A;  3IV4 A;  2DMM A;  3TRX A;  2K9F A;  1M9B A;  1R7H A;  2XBI A;  3FKF A;  3HJP A;  5E4W A;  3VWV A;  1EP8 A;  2PBJ A;  1K3O A;  1PRX A;  3UVH A;  3TOT A;  2YV9 A;  5ECR B;  5LNK e;  3K8N A;  1QXH A;  5DQS A;  2B5X A;  2VUP A;  4I2T A;  5KN2 A;  2XBQ A;  4V2M A;  8GSS A;  3EIN A;  2HE3 A;  4TR1 B;  11GS A;  1H4O A;  3APS A;  1MDI A;  1Z3E A;  2LJA A;  2WS2 A;  4NV5 A;  1WOU A;  3LYK A;  2H0I A;  4Q5Q A;  3FZ5 A;  2WZ9 A;  3HJO A;  4OFT A;  1DE2 A;  4KUN A;  2MZC A;  1O6J A;  1Q98 A;  2HSH A;  4N30 A;  4AJ6 A;  4DSQ A;  2F8F A;  3IAM 2;  3E3E A;  5F0G A;  2OAC A;  1TTZ A;  1GL8 A;  4ZBA A;  4JE1 A;  2JZS A;  2RM6 A;  3LFL A;  3KXO A;  3L4N A;  3F3Q A;  3DVX A;  1HNB A;  5JCW A;  5COH A;  1TOF A;  1X9M B;  4ZL7 A;  1XOB A;  2DJK A;  5D73 A;  3ZLP A;  4MAB A;  3D4T A;  2LNT A;  3GKX A;  4L8E A;  4JBB A;  2TRX A;  1X9S B;  3KH9 A;  2V1M A;  3M9K A;  4HI7 A;  5IOW A;  1C72 A;  1XW5 A;  2L6C A;  3D6I A;  4K9Z A;  1TK0 B;  3KJY A;  2NBS A;  3I69 A;  3GX8 A;  5D9W A;  3VPT A;  1A8L A;  5J9C A;  1B8X A;  2HNL A;  1SD8 A;  2LJK A;  1QQ2 A;  3TGZ A;  2VLV A;  3EU4 A;  4KE3 A;  2PN8 A;  2IMF A;  3P7X A;  1B48 A;  4G19 A;  1OC9 B;  3EUR A;  3VLN A;  4HU9 A;  5ID2 A;  20GS A;  3RHC A;  3UBL A;  3KCM A;  4AJ7 A;  2GT6 A;  1J0F A;  4YQU A;  3H1N A;  1X5D A;  5JWQ B;  2TRC P;  3M0F A;  4WF5 A;  2GT5 A;  3O6T A;  3BOA A;  2I1U A;  4LMV A;  1T3B A;  2HXK A;  5G5F A;  2YJ7 A;  3GUS A;  1V2A A;  3L9S A;  2R3X A;  1Y25 A;  4KX4 A;  2H73 A;  1PX6 A;  4HDE A;  1FHE A;  4MLY A;  3UAP A;  4KA0 A;  1AC1 A;  5E59 A;  2AV4 A;  4JED A;  3KTB A;  1QUW A;  1GUM A;  3W8J A;  3V1W A;  2EIQ A;  2RM5 A;  4F0C A;  4BPY A;  1TI1 A;  2I4A A;  2H75 A;  4K2D A;  4XIH A;  1YEP A;  3GL5 A;  3KP9 A;  6GSU A;  2CVD A;  3M8N A;  2GZP A;  3FR3 A;  4PGT A;  2ZCT A;  5IO0 A;  1WRY A;  4MJA A;  3LG6 A;  1J9B A;  2L59 A;  3HHV A;  1K0N A;  1XIY A;  4BWS A;  1PL2 A;  1GSS A;  1N2A A;  5CRH A;  2YOI A;  4N11 A;  3Q19 A;  2R4V A;  1X0R A;  2V6O A;  1A2L A;  1G7O A;  3KGK A;  5CRE A;  3L0H A;  3VWU A;  5AGY A;  1K0M A;  2AJQ B;  3FK8 A;  5HR2 A;  2HYX A;  2VOC A;  6GSY A;  1BX9 A;  5IO2 A;  4ULX A;  5G2Z A;  5GAP D;  1G6Y A;  1Z7R A;  4ECB A;  5F06 A;  2HRN A;  3VUR A;  3LSZ A;  5CRD A;  2HSY A;  2ALB A;  3HKR A;  4GSS A;  2KP1 A;  1H75 A;  1FVK A;  5CP1 A;  1Z6M A;  3GYK A;  3TRP A;  2H8L A;  1F6M C;  3CTF A;  5IMD A;  3IBH A;  1AUC A;  4K7O A;  4MF5 A;  3GIX A;  2BTO T;  1ML6 A;  3DEX A;  3DVW A;  1CQG A;  1SL0 B;  1A2M A;  4IP1 A;  4MDC A;  1B4P A;  4IEL A;  3VK9 A;  6GST A;  4BVY A;  1ZYE A;  4ECJ A;  4XRA A;  3IA1 A;  4PQI A;  4WR5 A;  2H6X A;  3U6V A;  2VO4 A;  3EVI A;  3AY8 A;  2FA8 A;  1GH2 A;  4I8B A;  4ZIJ A;  3LGC A;  5HFK A;  2DIY A;  2VCZ A;  3FY7 A;  3WGE A;  1YJ6 A;  2LEG A;  4V1A p;  2YNX A;  5ECO B;  1GRX A;  1A2J A;  3BCK A;  5IMV A;  3A3T A;  2ZUP A;  2IPA A;  2C80 A;  1XBS A;  1EOH A;  1N8J A;  1AW9 A;  4XCS A;  3NZN A;  4LLR A;  4MZW A;  4XTS A;  3LXT A;  1SYX A;  1KNG A;  1Z6N A;  3TKR A;  2VCX A;  3A2X A;  4PUR A;  1AQV A;  2GTU A;  4D73 B;  4GF0 A;  1EZK A;  3QAV A;  4ILF A;  5D8I A;  2B7K A;  4ECI A;  2J23 A;  3HVV A;  3G9B A;  2YWN A;  1FAA A;  2VCT A;  1GTA A;  2M80 A;  4IW9 A;  3QDN A;  4OCE A;  2H01 A;  1Q4J A;  1ZCP A;  4Q5N A;  1F9M A;  1XWB A;  4EO3 A;  3FZ4 A;  2REM A;  1V57 A;  1OE7 A;  3MWH A;  3QAW A;  19GS A;  4BWQ A;  4J57 E;  2PWJ A;  3D0Z A;  3E0U A;  2H6Y A;  2DJ1 A;  2RLI A;  4K7N A;  1TW9 A;  2H72 A;  2C4J A;  5ENU A;  2MMA A;  2DJJ A;  2H74 A;  5G1K A;  14GS A;  3KMN A;  2IWT A;  3QOU A;  1JZO A;  4HEA 2;  3SBC A;  3F8U A;  3J7Y b;  3MNG A;  3KZQ A;  1F3A A;  1SL2 B;  2C3T A;  2OJL A;  1MDK A;  3DXB A;  2H1G A;  2WDU A;  4YAV A;  1U6T A;  3GL3 A;  2AHE A;  3R2Q A;  4FO5 A;  2WRT A;  4G9H A;  1NW2 A;  1Z9H A;  5GAN D;  1MD3 A;  2YWO A;  1HNA A;  1AXD A;  3NOF A;  3W6G A;  1TDI A;  4BA7 A;  4N10 A;  4HS1 A;  2K18 A;  1TXX A;  3P90 A;  2VLT A;  3GN3 A;  3MDK A;  4H86 A;  2B7J A;  2FNO A;  1TRW A;  1T4Y A;  5IMF A;  4IN0 A;  3J7Y k;  2HT9 A;  1EEM A;  2KLX A;  4ML6 A;  1ILO A;  3Q74 A;  1QK8 A;  3HY2 A;  2V6K A;  1OAZ A;  4EC0 A;  2BMX A;  2VD1 A;  1FG4 A;  4TKY A;  4OFM A;  5AIX A;  3CYN A;  5G30 A;  1OKD A;  3OR5 A;  5D9V A;  4WBJ A;  5DAK B;  5DVB A;  5L71 A;  5DJL A;  4EF0 A;  5J5N A;  1K0D A;  1YY7 A;  3MSZ A;  3QAG A;  4PUF C;  2QGV A;  2OE0 A;  2IMI A;  2K6V A;  5FWG A;  5LCZ A;  3RBT A;  2DJ0 A;  3ZMK A;  4WXT A;  1NHO A;  1VF3 A;  3GKM A;  5JCU A;  4GRF A;  2VL9 A;  3FRC A;  5IPH A;  4IQA A;  1XWG A;  3WT2 A;  3FHK A;  17GS A;  1EGR A;  2L5L A;  4GQC A;  4OCF A;  1XZO A;  3APQ A;  12GS A;  3HXS A;  1ON4 A;  3C7M A;  1XVW A;  2GQL A;  4POM A;  4F2I A;  3RPN A;  2F9S A;  2GSQ A;  2LRN A;  1GSQ A;  2YP6 A;  2L57 A;  1EEJ A;  4MPG A;  1GTB A;  5ID2 B;  2KHP A;  5CRG A;  4TXO B;  5B6N A;  2VIM A;  2GSS A;  2F8A A;  2LQQ A;  4DSS B;  5B8A A;  1O8W A;  4KSO A;  1BYE A;  4ZL8 A;  4TW5 A;  1FOV A;  3IDV A;  2FGX A;  5CYY A;  4EXJ A;  5IIZ A;  5FHI A;  5KEJ A;  1RW1 A;  4XS4 A;  5B6M A;  5HQP A;  5HFG A;  4I5Q A;  5DDL A;  2CZ3 A;  4AF2 A;  2NDO A;  3RAZ A;  4TOP A;  3GMF A;  2LKU A;  3H4K A;  1LU4 A;  3HZ4 A;  4GSN A;  3VWW A;  6GSX A;  4ZB6 A;  2WCI A;  2EIR A;  2FWE A;  2JSY A;  2X8H A;  4L0U A;  4L5L A;  3WGX A;  3IE3 A;  1FW1 A;  1JHB A;  4DVC A;  3GTU A;  3HA9 A;  1Z7P A;  2L5O A;  10GS A;  3G7J A;  4Q5R A;  5ECQ B;  1SKR B;  1ERV A;  2OBI A;  1XOA A;  3CBU A;  2H71 A;  4CHS A;  4I6X A;  2N5A A;  3KMO A;  2F3M A;  3GX0 A;  2HFD A;  4KDX A;  5ELA A;  1UN2 A;  3TKQ A;  1MDJ A;  3LOR A;  4TR4 A;  1K3Y A;  2FUG 2;  3F0I A;  4GLT A;  1AQX A;  1YF0 A;  3EE2 A;  4NPB A;  2OBK A;  5ECH B;  3ERF A;  2LRC A;  1SK1 A;  1V98 A;  1ACV A;  4EDY A;  3BCI A;  5C00 A;  2I81 A;  1PA3 A;  3ISO A;  3D22 A;  4QL9 A;  2B1K A;  3ZRD A;  1X5E A;  5ECI B;  1W4V A;  4MP4 A;  2FWH A;  2PPT A;  4NXI A;  5IMC A;  1TU8 A;  2KOK A;  5H5S A;  1A0R P;  2KP2 A;  2LRT A;  2IJY A;  1WE0 A;  5EY6 A;  1X5C A;  5D9T A;  3ZL5 A;  2GQM A;  1NSW A;  4MMM A;  1CQH A;  3E9J B;  5AIS A;  2OA7 A;  1TRS A;  5IM9 A;  3F4T A;  1F3B A;  2X8C A;  2NVL A;  1GSE A;  2HI7 A;  1VF2 A;  3GST A;  1GNE A;  4GWR A;  2C3N A;  3IK9 A;  3N9J A;  2FLS A;  1K3L A;  2PUK C;  2OAD A;  5DAL A;  1R4W A;  2FCH A;  2A4V A;  4TR1 A;  2ES7 A;  2H66 A;  2L4C A;  5AIV A;  2G2Q A;  3KD0 A;  4POB A;  1XPV A;  3IPZ A;  2B3S A;  3GSS A;  4F82 A;  1S3C A;  3ZIV A;  4RUV A;  3M1G A;  1M2A A;  1FO5 A;  4IVF A;  1ZL9 A;  3WT1 A;  4K8M A;  4IJ3 A;  2CT6 A;  4GST A;  5HFI A;  2LQO A;  3D21 A;  4TVE A;  4MJC A;  1S3A A;  4HZ4 A;  2XC2 A;  1JLV A;  4EDZ A;  2VL3 A;  4RI7 A;  3S9F A;  2X99 A;  3TKP A;  3TJG A;  2WUL A;  1A8Y A;  1SK2 A;  1BQ7 A;  1FB6 A;  1ZMA A;  1QGV A;  5G5E A;  4OMV A;  3QCP A;  3TJJ A;  1WP0 A;  3PR8 A;  1O8X A;  3IK7 A;  5GST A;  5CO3 A;  4IS0 A;  1OKT A;  4JZQ A;  2XPE A;  1SEN A;  1BJX A;  1M0U A;  2IFQ B;  4IBP A;  1OC9 A;  3LEF A;  4L0W A;  3BD2 A;  2B5E A;  4G10 A;  2WGR A;  1W89 A;  3CTG A;  1GTI A;  4KSM A;  1SJZ A;  3QD9 A;  4PXO A;  2DC5 A;  2VM1 A;  2H76 A;  1O73 A;  5F07 A;  5H5R A;  2VCV A;  3DIE A;  3Q18 A;  4ML1 A;  5ECK B;  1V40 A;  2V41 A;  2GLR A;  2MBS A;  4FYU A;  1WWJ A;  2C3Q A;  2YV7 A;  4RQR A;  1U3I A;  4L5O A;  2JSZ A;  1K0O A;  4GCI A;  4F9Z A;  2CX3 A;  1WMJ A;  4OFN A;  3DKS A;  1GSU A;  3G7Y A;  3TB2 A;  4MJB A;  3QR6 A;  4YH2 A;  3DGQ A;  3HD5 A;  1T8E B;  4YAP A;  2HZE A;  3RHB A;  5IPG A;  1EOG A;  1TK5 B;  2VCW A;  4PX1 A;  1J08 A;  2R5G A;  2WB9 A;  4K1F A;  5AN1 A;  6GSS A;  2LS5 A;  2GZZ A;  1GWC A;  3U5R E;  2VM2 A;  1MD4 A;  1R5P A;  4ZXG A;  1KEB A;  2HLS A;  5EVO A;  2C8U A;  1LJR A;  5JCG A;  2KUC A;  4ZBB A;  2P0G A;  5ECP B;  1TRV A;  1U87 A;  16GS A;  1XXU A;  1XFL A;  2K8V A;  3VI7 A;  1GSY A;  5KN1 A;  1F37 A;  4K0G A;  3SWL A;  4YQV A;  3TRQ A;  5ECN B;  3EYT A;  1NHY A;  3TJF A;  1ABA A;  1VGL A;  1DBY A;  3VFI A;  4JR6 A;  2IIY A;  1KTE A;  5EPF A;  2C1Y A;  4NMU A;  3KH7 A;  5JWR B;  1X9W B;  1A0F A;  2CA8 A;  1BG5 A;  2DJ3 A;  3TDG A;  1SL1 B;  2M72 A;  2H1D A;  1GUH A;  5LD0 A;  1XWC A;  2VL2 C;  3ZML A;  1K0B A;  5G1L A;  4F0B A;  1WIK A;  1FB0 A;  2IN3 A;  4O92 A;  4IQ1 A;  3VPQ A;  2VD0 A;  1Y6E A;  1PMT A;  3EC3 A;  2V2G A;  3UMA A;  3KEB A;  2VLU A;  2J9H A;  2LTK A;  3F6F A;  3CSI A;  3A2W A;  1M99 A;  1SJ6 A;  2OKA A;  5ECM B;  1VRS D;  2DML A;  4EVM A;  1R5A A;  1YQ1 A;  2H19 A;  4D73 A;  2ON5 A;  4EUY A;  4DSR A;  3PH9 A;  1GLP A;  1BAY A;  4JU5 A;  1M7T A;  3ZZX A;  2X8G A;  2XHF A;  3PIN A;  2EC4 A;  3QPM A;  3IC4 A;  5ECS A;  5F8B A;  4OD7 A;  4JR4 A;  3TCO A;  1TP9 A;  2RUF A;  5D9X A;  4HU7 A;  3ERW A;  2B1L A;  3ZVJ D;  3EU3 A;  2B6M A;  2GQK A;  2JAC A;  2E2M A;  4E8H A;  5HR1 A;  2RUE A;  2JL4 A;  1DUG A;  3I43 A;  5J9B A;  2FD3 A;  2YZH A;  1ERW A;  3A2V A;  4MF7 A;  3FR6 A;  4MF6 A;  4GXZ A;  5KN3 A;  2MMZ A;  18GS A;  2CV4 A;  4MZC A;  2FA4 A;  1HD2 A;  1SK0 A;  1A24 A;  4X1U A;  3H8Q A;  4MH3 A;  3WD6 A;  2N5F A;  1GSF A;  1NM3 A;  3CXG A;  3C1R A;  3LJR A;  1YZX A;  2E0Q A;  4EKZ A;  3MAK A;  5DCG A;  3G7I A;  4AGS A;  4QQ7 A;  4KH7 A;  1T00 A;  2CVK A;  4TR0 A;  5DQY A;  2AUV A;  4ZL9 A;  3TJK A;  3DRN A;  3ZVJ A;  1EGO A;  1SU9 A;  3GV1 A;  3N5O A;  1EV4 A;  4TXV A;  2CX4 A;  4IGJ A;  2DLX A;  3CSJ A;  1OYJ A;  4MJE A;  4BVX A;  4P3Y B;  1ZYQ B;  3HYP A;  4ZB8 A;  2ON7 A;  1HNC A;  4WBR D;  1O85 A;  5DAL B;  1SKW B;  1B4Q A;  2FY6 A;  4QL7 A;  1ERU A;  4BL7 A;  2VL2 A;  4NV2 A;  3F6D A;  4KGI A;  3EMX A;  1GTU A;  1AIU A;  1THO A;  1FVJ A;  3L9U A;  2LV3 A;  5C04 A;  2GS3 A;  9GSS A;  4N0V A;  3VWX A;  4PQ1 A;  5IMA A;  1TK8 B;  1R26 A;  3H79 A;  4HZ2 A;  2IL3 A;  4NAX A;  4O32 A;  2JAD A;  5DAK A;  3L9V A;  4FIW A;  1OE8 A;  2HZF A;  2H6Z A;  1EP7 A;  2R6K A;  2YPM A;  4RI6 A;  2H30 A;  5HR3 A;  1TKD B;  5EL8 A;  1GLQ A;  1UC7 A;  2R2J A;  1PSQ A;  2CZ2 A;  2X64 A;  5KN0 A;  2FWG A;  3APO A;  5G31 A;  2WJU A;  3LWA A;  3ZRE A;  4IJI A;  1JZD A;  1QFN A;  2E2G A;  2E7P A;  1M9A A;  1UVZ A;  1T1V A;  1THX A;  1ST9 A;  3FEU A;  2K8S A;  4ECC A;  5A5K A;  1PKZ A;  2FHE A;  1GUL A;  2P5Q A;  2H70 A;  2OE3 A;  4HJ2 A;  4HOJ A;  1SKS B;  4XS1 A;  2BJX A;  1ERT A;  2O89 A;  3EMP A;  4KDU A;  4KAE A;  3LYP A;  1T7P B;  3H93 A;  5GSS A;  2LJR A;  1M2D A;  2N5B A;  4KCA A;  4TXO A;  4XRD A;  2YN1 A;  2CVB A;  4IP6 A;  3NIV A;  1I5G A;  1DE1 A;  4YQM A;  1TU7 A;  4ID0 A;  4DSS A;  4ACS A;  4OWY A;  5B8B A;  1GP1 A;  3US3 A;  1G6W A;  4HQZ A;  4KW6 A;  1E6B A;  1TI3 A;  2IMD A;  2IME A;  4O7H A;  1PKW A;  2G0F A;  5A4W A;  4WR4 A;  1PN9 A;  3ZFB A;  2PU9 C;  3O76 A;  1ZGN A;  2LNS A;  1SD9 A;  2GZY A;  2B5Y A;  1BED A;  4PQH A;  2YWM A;  4ZB9 A;  1ZZY A;  1PQN A;  5B7C A;  4OO5 A;  2FWF A;  3O3T A;  2LST A;  4HQS A;  4CDO A;  5INY A;  2LUS A;  2QKE A;  2GST A;  1E2Y A;  3GUR A;  4HUA A;  2AB6 A;  4I2U A;  4NHZ A;  2HZE B;  1VF1 A;  4PUA A;  3BBY A;  1PD2 1;  3KM6 A;  3KP8 A;  1OC3 A;  3GH6 A;  2H0G A;  4MPF A;  1URM A;  3ERG A;  1I9D A;  1SYR A;  2EIO A;  4V2N A;  2PER A;  5D93 A;  1OVN A;  4WKW A;  2MBT A;  3P8W A;  2TIR A;  2JZT A;  3FW2 A;  1U3A A;  5ELG A;  2C0D A;  4NWY A;  5H5Q A;  2CAI A;  4V2L A;  3FYG A;  4KDY A;  3VI5 A;  1YKC A;  2D2Z A;  4E8E A;  3HCZ A;  2R37 A;  4MK3 A;  2PVO C;  4XS6 A;  3HDC A;  1JFU A;  2QSI A;  5J4U A;  1S3D A;  2PMT A;  2WFC A;  3FZ9 A;  2YAN A;  3C71 A;  1YKA A;  1EV9 A;  2YZU A;  1RQM A;  4ISD A;  2MMN A;  1GNW A;  3GFK A;  4FH8 A;  4G2E A;  3F3R A;  4LL4 B;  1YEX A;  2NPB A;  3TOU A;  3BJ5 A;  4LMW A;  1XW9 A;  1YF1 A;  3ZFL A;  3ME8 A;  3KIJ A;  2O8V B;  3IXR A;  3C73 A;  3LXZ A;  2XPD A;  3CMI A;  1MEK A;  1XW6 A;  3F63 A;  1O7U A;  2M46 A;  4J2F A;  4F03 A;  4AJ8 A;  1Z5Y E;  1GUK A;  3IRA A;  3PGT A;  1UA5 A;  4TRX A;  2AAW A;  3CRT A;  3JCM L;  5F05 A;  5DCH A;  3TKS C;  4PNG A;  1IYI A;  2GVP A;  1B9Y C;  3UBK A;  3EWL A;  3HJM A;  1KBN A; 
#chains in the Genus database with same CATH topology
 1WPI A;  3L78 A;  3RPP A;  6GSV A;  3D4M A;  3C1S A;  2HSM A;  2P5R A;  1XWA A;  2VCQ A;  2H0H A;  4GTU A;  2MMO A;  2C0F A;  4TR3 A;  3Q6O A;  3RDW A;  4I97 A;  1G0T A;  4IHU A;  3UJ1 A;  4DEJ A;  3UAR A;  1U88 A;  4MZB A;  3GKK A;  3ME7 A;  1XCC A;  1JZR A;  1M2B A;  4O5Q A;  4Z7X A;  4V1A g;  2O87 A;  3CRU A;  3WGD A;  3M3M A;  4WEY A;  2GSR A;  1K0A A;  1O81 A;  1AAZ A;  4Q5F A;  2P31 A;  4FYB A;  5CNW A;  2YJH A;  1PFO A;  3DYR A;  3ED3 A;  4FYC A;  1V9W A;  2L6D A;  2L4Q A;  2Z9S A;  3D5J A;  3GH9 A;  5D96 A;  4JRR A;  2C0E A;  4N0Z A;  4RQX A;  4EIQ A;  2MYG A;  22GS A;  1SJI A;  2QA2 A;  13GS A;  3TUE A;  2CQ9 A;  4OO4 A;  3GA4 A;  4WET A;  1VF4 A;  4KND A;  4CW9 A;  1HYU A;  3GRX A;  2F51 A;  5A4U A;  1T4Z A;  1A23 A;  5IQY A;  1LBK A;  2H1B A;  3F4R A;  2RII A;  3GKN A;  1ZOF A;  5J3R A;  5IMZ A;  3GNJ A;  4GQF A;  2HRF A;  4J56 E;  3UEM A;  3F9U A;  4TN8 A;  1AQW A;  3ZIT A;  2IFQ A;  1MTC A;  2GDR A;  3UL3 A;  3UIW A;  2IMK A;  1XVQ A;  2YCD A;  4MH2 A;  2I3Y A;  4XS4 B;  1PX7 A;  4PNF A;  4ZBD A;  1JZW A;  4ZIL A;  3ZIJ A;  3QFA C;  2X4A A;  4PTS A;  2CAQ A;  4K6X A;  2A2S A;  5ABR A;  4MA9 A;  3IR4 A;  4MCU A;  2JU5 A;  2QC7 A;  2YWI A;  1V58 A;  1K0C A;  5J41 A;  2PGT A;  1OC8 A;  1JLW A;  7GSS A;  1RK4 A;  1QMV A;  5DJM A;  4K0N A;  5GZZ B;  4X43 A;  4K7I A;  1PGT A;  1B9X C;  3HZ8 A;  1IYH A;  2O85 A;  3TKS A;  2DSA A;  3GTU B;  3HVX A;  4BL7 B;  3IOS A;  1F2E A;  3QMX A;  1G7E A;  4XHM A;  5IOX A;  3W8S A;  1TJD A;  3TKS E;  3P2A A;  3WYW A;  4POL A;  3KTL A;  2OE1 A;  3C8E A;  1YDK A;  3LQ7 A;  4YKG A;  4NHW A;  2PVQ A;  3CSH A;  3GHA A;  1USB A;  3I9V 2;  4LA1 A;  3UOM A;  4X0X A;  1XWK A;  3DML A;  3I6A A;  3IHQ A;  5FT3 A;  1TRU A;  2NTO A;  4HJM A;  3DD3 A;  1HQO A;  5DBQ A;  2DJ2 A;  4KCE A;  3DWV A;  2JZR A;  3F4S A;  4EL1 A;  4KB3 A;  3FR9 A;  2DIZ A;  3ZYW A;  1EWX A;  1PL1 A;  4POK A;  3QFB C;  2DBC A;  5HR0 A;  2H1A A;  1WJK A;  2VAF A;  4WF4 A;  4EE0 A;  3ZTL A;  3UVT A;  3M9J A;  3A5W A;  3TJB A;  5CRW A;  5JWO B;  2O7K A;  5ECL B;  2ZNM A;  4IKH A;  2C0G A;  2AYT A;  1GSD A;  6GSW A;  2V32 A;  4O5R A;  3FZA A;  3IAS 2;  2A2R A;  5A4V A;  3HVS A;  5CAX A;  4LL1 B;  2GGT A;  2I9H A;  1DSB A;  3IV4 A;  2DMM A;  3TRX A;  2K9F A;  1M9B A;  1R7H A;  2XBI A;  3FKF A;  3HJP A;  5E4W A;  3VWV A;  1EP8 A;  2PBJ A;  1K3O A;  1PRX A;  3UVH A;  3TOT A;  2YV9 A;  5ECR B;  5LNK e;  3K8N A;  1QXH A;  5DQS A;  2B5X A;  2VUP A;  4I2T A;  5KN2 A;  2XBQ A;  4V2M A;  8GSS A;  3EIN A;  2HE3 A;  4TR1 B;  11GS A;  1H4O A;  3APS A;  1MDI A;  1Z3E A;  2LJA A;  2WS2 A;  4NV5 A;  1WOU A;  3LYK A;  2H0I A;  4Q5Q A;  3FZ5 A;  2WZ9 A;  3HJO A;  4OFT A;  1DE2 A;  4KUN A;  2MZC A;  1O6J A;  1Q98 A;  2HSH A;  4N30 A;  4K2X A;  4AJ6 A;  4DSQ A;  2F8F A;  3IAM 2;  3E3E A;  5F0G A;  2OAC A;  1TTZ A;  1GL8 A;  4ZBA A;  4JE1 A;  2JZS A;  2RM6 A;  3LFL A;  3KXO A;  3L4N A;  3F3Q A;  3DVX A;  1HNB A;  5JCW A;  5COH A;  1TOF A;  4G0L A;  1X9M B;  4ZL7 A;  4USS A;  1XOB A;  2DJK A;  5D73 A;  3ZLP A;  4MAB A;  3D4T A;  2LNT A;  3GKX A;  4L8E A;  4JBB A;  2TRX A;  1X9S B;  3KH9 A;  2V1M A;  3M9K A;  4HI7 A;  5IOW A;  1C72 A;  4K9Z A;  1XW5 A;  2L6C A;  3D6I A;  1TK0 B;  3KJY A;  2NBS A;  3I69 A;  3GX8 A;  5D9W A;  3VPT A;  1A8L A;  5J9C A;  1B8X A;  2HNL A;  1SD8 A;  2LJK A;  1QQ2 A;  3TGZ A;  2VLV A;  4BIK A;  3EU4 A;  4KE3 A;  2PN8 A;  2IMF A;  2QA1 A;  3P7X A;  1B48 A;  4G19 A;  1OC9 B;  3EUR A;  3VLN A;  4HU9 A;  5ID2 A;  20GS A;  3RHC A;  3UBL A;  3KCM A;  4AJ7 A;  2GT6 A;  1J0F A;  4YQU A;  3H1N A;  1X5D A;  5JWQ B;  2TRC P;  3M0F A;  4WF5 A;  2GT5 A;  3O6T A;  3BOA A;  2I1U A;  4LMV A;  1T3B A;  2HXK A;  5G5F A;  2YJ7 A;  3GUS A;  1V2A A;  3L9S A;  2R3X A;  1Y25 A;  4KX4 A;  2H73 A;  1PX6 A;  4HDE A;  1FHE A;  4MLY A;  3UAP A;  4KA0 A;  1AC1 A;  5E59 A;  2AV4 A;  4JED A;  3KTB A;  1QUW A;  1GUM A;  3W8J A;  3V1W A;  2EIQ A;  2RM5 A;  4F0C A;  4BPY A;  1TI1 A;  2I4A A;  2H75 A;  4K2D A;  4XIH A;  1YEP A;  3GL5 A;  3KP9 A;  6GSU A;  2CVD A;  3M8N A;  2GZP A;  3FR3 A;  4PGT A;  2ZCT A;  5IO0 A;  1WRY A;  5KOW A;  4MJA A;  3LG6 A;  1J9B A;  2L59 A;  3HHV A;  1K0N A;  1XIY A;  4BWS A;  1PL2 A;  1GSS A;  1N2A A;  5CRH A;  2YOI A;  4N11 A;  3Q19 A;  2R4V A;  1X0R A;  2V6O A;  1A2L A;  1G7O A;  3KGK A;  5CRE A;  3L0H A;  3VWU A;  5AGY A;  1K0M A;  2AJQ B;  3FK8 A;  5HR2 A;  2HYX A;  2VOC A;  6GSY A;  1BX9 A;  5IO2 A;  4ULX A;  5G2Z A;  5GAP D;  1G6Y A;  1Z7R A;  4ECB A;  5F06 A;  2HRN A;  3VUR A;  3LSZ A;  5CRD A;  2HSY A;  4KF9 A;  2ALB A;  3HKR A;  5BRT A;  4GSS A;  2KP1 A;  1H75 A;  1FVK A;  5CP1 A;  1Z6M A;  3GYK A;  3MIX A;  3TRP A;  2H8L A;  1F6M C;  3CTF A;  5IMD A;  3IBH A;  1AUC A;  4K7O A;  4MF5 A;  3GIX A;  2BTO T;  1ML6 A;  3DEX A;  3DVW A;  3A5I A;  1CQG A;  1SL0 B;  1A2M A;  4IP1 A;  4MDC A;  1B4P A;  4IEL A;  3VK9 A;  6GST A;  4BVY A;  1ZYE A;  4ECJ A;  4XRA A;  5BMU A;  3IA1 A;  4PQI A;  4WR5 A;  2H6X A;  3U6V A;  2VO4 A;  3EVI A;  3AY8 A;  2FA8 A;  1GH2 A;  4I8B A;  4ZIJ A;  4FQU A;  3LGC A;  5HFK A;  2DIY A;  2VCZ A;  3FY7 A;  4MNN A;  3WGE A;  1YJ6 A;  2LEG A;  4V1A p;  2YNX A;  5ECO B;  1GRX A;  1A2J A;  3BCK A;  5IMV A;  3A3T A;  2ZUP A;  2IPA A;  2C80 A;  1XBS A;  1EOH A;  1N8J A;  1AW9 A;  4XCS A;  3NZN A;  4LLR A;  4MZW A;  4XTS A;  3LXT A;  1SYX A;  1KNG A;  1Z6N A;  3TKR A;  2VCX A;  3A2X A;  4PUR A;  1AQV A;  2GTU A;  4D73 B;  4EIP A;  4GF0 A;  1EZK A;  3QAV A;  4ILF A;  5D8I A;  2B7K A;  4ECI A;  2J23 A;  3HVV A;  3G9B A;  2YWN A;  1FAA A;  2VCT A;  1GTA A;  2M80 A;  4IW9 A;  3QDN A;  4OCE A;  2H01 A;  1Q4J A;  1ZCP A;  4Q5N A;  1F9M A;  1XWB A;  4EO3 A;  3FZ4 A;  2REM A;  1V57 A;  1OE7 A;  3MWH A;  3QAW A;  19GS A;  4BWQ A;  4J57 E;  2PWJ A;  3D0Z A;  3E0U A;  2H6Y A;  2DJ1 A;  2RLI A;  4K7N A;  1TW9 A;  2H72 A;  2C4J A;  5ENU A;  2MMA A;  2DJJ A;  2H74 A;  5G1K A;  14GS A;  3KMN A;  2IWT A;  3QOU A;  4A5P A;  1JZO A;  4HEA 2;  3SBC A;  3F8U A;  3J7Y b;  3MNG A;  3KZQ A;  1F3A A;  1SL2 B;  4O5U A;  2C3T A;  2OJL A;  1MDK A;  3DXB A;  1M3I A;  2H1G A;  2WDU A;  4YAV A;  1U6T A;  3GL3 A;  2AHE A;  3R2Q A;  4FO5 A;  2WRT A;  4G9H A;  1NW2 A;  1Z9H A;  5GAN D;  1MD3 A;  2YWO A;  4BVX B;  1HNA A;  1AXD A;  3NOF A;  3W6G A;  1TDI A;  4BA7 A;  4N10 A;  4HS1 A;  2K18 A;  1TXX A;  3P90 A;  2VLT A;  3GN3 A;  3MDK A;  4H86 A;  2B7J A;  2FNO A;  1TRW A;  1T4Y A;  5IMF A;  4IN0 A;  3J7Y k;  2HT9 A;  1EEM A;  2KLX A;  4ML6 A;  1ILO A;  3Q74 A;  1QK8 A;  3HY2 A;  2V6K A;  1OAZ A;  4EC0 A;  2BMX A;  2VD1 A;  1FG4 A;  4TKY A;  4OFM A;  5AIX A;  3CYN A;  5G30 A;  1OKD A;  3OR5 A;  5D9V A;  4WBJ A;  5DAK B;  5DVB A;  5L71 A;  5DJL A;  4EF0 A;  5J5N A;  1K0D A;  1YY7 A;  3MSZ A;  3QAG A;  4PUF C;  2QGV A;  2OE0 A;  2IMI A;  2K6V A;  2HRA A;  5FWG A;  5LCZ A;  3RBT A;  2DJ0 A;  3ZMK A;  4WXT A;  1NHO A;  1VF3 A;  3GKM A;  5JCU A;  4GRF A;  2VL9 A;  3FRC A;  5IPH A;  4IQA A;  1XWG A;  3WT2 A;  3FHK A;  17GS A;  1EGR A;  2L5L A;  4GQC A;  4OCF A;  2HRK A;  3IC8 A;  1XZO A;  3APQ A;  12GS A;  3HXS A;  1ON4 A;  3C7M A;  1XVW A;  3MYD A;  2GQL A;  4POM A;  4G0I A;  4F2I A;  3RPN A;  2F9S A;  2GSQ A;  2LRN A;  1GSQ A;  2YP6 A;  2L57 A;  1EEJ A;  4X4J A;  4MPG A;  1GTB A;  5ID2 B;  2KHP A;  5CRG A;  4TXO B;  5B6N A;  2VIM A;  2GSS A;  2F8A A;  2LQQ A;  4DSS B;  5B8A A;  1O8W A;  4KSO A;  1BYE A;  4ZL8 A;  4TW5 A;  1FOV A;  3IDV A;  2FGX A;  5CYY A;  4EXJ A;  5IIZ A;  5FHI A;  5KEJ A;  5B6M A;  1RW1 A;  4XS4 A;  5HQP A;  5HFG A;  4I5Q A;  5DDL A;  2CZ3 A;  4AF2 A;  2NDO A;  3RAZ A;  4TOP A;  3GMF A;  2LKU A;  3H4K A;  1LU4 A;  3HZ4 A;  4GSN A;  3VWW A;  6GSX A;  4ZB6 A;  2WCI A;  2EIR A;  2FWE A;  2JSY A;  2X8H A;  4L0U A;  4L5L A;  3WGX A;  3IE3 A;  1FW1 A;  1JHB A;  4DVC A;  3GTU A;  3HA9 A;  1Z7P A;  2L5O A;  10GS A;  3G7J A;  2R0C A;  4Q5R A;  5ECQ B;  1SKR B;  1ERV A;  2OBI A;  1XOA A;  3CBU A;  2H71 A;  4CHS A;  4ICY A;  4I6X A;  2N5A A;  3KMO A;  2F3M A;  3GX0 A;  2HFD A;  4YKF A;  4KDX A;  5ELA A;  1UN2 A;  3TKQ A;  1MDJ A;  3LOR A;  4HSC X;  4TR4 A;  1K3Y A;  2FUG 2;  3F0I A;  4GLT A;  1AQX A;  3FMW A;  1YF0 A;  3EE2 A;  4NPB A;  2OBK A;  5ECH B;  3ERF A;  2LRC A;  1SK1 A;  1V98 A;  1ACV A;  4EDY A;  3BCI A;  5C00 A;  2I81 A;  1PA3 A;  3ISO A;  3D22 A;  4QL9 A;  2B1K A;  3ZRD A;  1X5E A;  5ECI B;  1W4V A;  4MP4 A;  2FWH A;  2PPT A;  4NXI A;  5IMC A;  1TU8 A;  2KOK A;  5H5S A;  1A0R P;  2KP2 A;  2LRT A;  2IJY A;  1WE0 A;  5EY6 A;  1X5C A;  5D9T A;  3ZL5 A;  2GQM A;  1NSW A;  4MMM A;  1CQH A;  3E9J B;  5AIS A;  2OA7 A;  1TRS A;  5IM9 A;  3F4T A;  1F3B A;  2X8C A;  4Z2U A;  2NVL A;  1GSE A;  2HI7 A;  1VF2 A;  3GST A;  1GNE A;  4GWR A;  2C3N A;  3IK9 A;  3N9J A;  4CY8 A;  2FLS A;  1K3L A;  2PUK C;  2OAD A;  2DKI A;  5DAL A;  1R4W A;  2FCH A;  2A4V A;  4TR1 A;  3EPT A;  2ES7 A;  2H66 A;  2L4C A;  5AIV A;  2G2Q A;  3KD0 A;  4POB A;  1XPV A;  3IPZ A;  2B3S A;  3GSS A;  4F82 A;  1S3C A;  3ZIV A;  4RUV A;  3M1G A;  1M2A A;  1FO5 A;  4IVF A;  1ZL9 A;  3WT1 A;  4K8M A;  4IJ3 A;  2CT6 A;  4GST A;  3R3E A;  5HFI A;  2LQO A;  3D21 A;  4TVE A;  4MJC A;  1S3A A;  4HZ4 A;  2XC2 A;  1JLV A;  4EDZ A;  2VL3 A;  4RI7 A;  3S9F A;  2X99 A;  3TKP A;  3TJG A;  2WUL A;  1A8Y A;  1SK2 A;  1BQ7 A;  1FB6 A;  1ZMA A;  1QGV A;  5G5E A;  4OMV A;  3QCP A;  3TJJ A;  1WP0 A;  3PR8 A;  1O8X A;  3IK7 A;  5GST A;  5CO3 A;  4IS0 A;  1OKT A;  4JZQ A;  2XPE A;  1SEN A;  2R0G A;  1BJX A;  1M0U A;  2IFQ B;  4IBP A;  1OC9 A;  2UZ8 A;  3LEF A;  4L0W A;  3BD2 A;  2B5E A;  4G10 A;  2WGR A;  1W89 A;  3CTG A;  1GTI A;  4KSM A;  1SJZ A;  3QD9 A;  4PXO A;  2DC5 A;  2VM1 A;  2H76 A;  1O73 A;  5F07 A;  5H5R A;  2VCV A;  3DIE A;  3Q18 A;  4ML1 A;  5ECK B;  1V40 A;  2V41 A;  2GLR A;  2MBS A;  4FYU A;  1WWJ A;  2C3Q A;  2YV7 A;  4RQR A;  1U3I A;  4L5O A;  2JSZ A;  1K0O A;  4GCI A;  4F9Z A;  2CX3 A;  1S3R A;  1WMJ A;  4OFN A;  3DKS A;  3PPU A;  1GSU A;  3G7Y A;  3TB2 A;  4MJB A;  3QR6 A;  4YH2 A;  1M3J A;  3DGQ A;  3HD5 A;  1T8E B;  4YAP A;  2HZE A;  3RHB A;  5IPG A;  1EOG A;  1TK5 B;  2VCW A;  4PX1 A;  1J08 A;  2R5G A;  2WB9 A;  4K1F A;  5AN1 A;  6GSS A;  2LS5 A;  4G0K A;  2GZZ A;  1GWC A;  3U5R E;  2VM2 A;  1MD4 A;  1R5P A;  4ZXG A;  1KEB A;  2HLS A;  5EVO A;  2C8U A;  1LJR A;  5JCG A;  2KUC A;  4ZBB A;  2P0G A;  3LW9 A;  5ECP B;  1TRV A;  1U87 A;  16GS A;  1XXU A;  1XFL A;  2K8V A;  5KOX A;  3VI7 A;  1GSY A;  5KN1 A;  1F37 A;  4K0G A;  3SWL A;  4YQV A;  3TRQ A;  5ECN B;  3EYT A;  1NHY A;  3TJF A;  1ABA A;  1VGL A;  1DBY A;  3VFI A;  4JR6 A;  2IIY A;  1KTE A;  5EPF A;  2C1Y A;  4NMU A;  3KH7 A;  5JWR B;  1X9W B;  1A0F A;  2CA8 A;  1BG5 A;  2DJ3 A;  3TDG A;  1PN0 A;  1SL1 B;  2M72 A;  2H1D A;  1GUH A;  1XG8 A;  5LD0 A;  1XWC A;  4Z2T A;  2VL2 C;  3ZML A;  1K0B A;  5G1L A;  4F0B A;  1WIK A;  1FB0 A;  2IN3 A;  4O92 A;  4IQ1 A;  3VPQ A;  2VD0 A;  1Y6E A;  1PMT A;  3EC3 A;  2V2G A;  3UMA A;  3KEB A;  2VLU A;  2J9H A;  2LTK A;  3F6F A;  3CSI A;  3IHG A;  2A2P A;  3A2W A;  1M99 A;  1SJ6 A;  2OKA A;  5ECM B;  1VRS D;  2DML A;  4EVM A;  1R5A A;  1YQ1 A;  2H19 A;  4D73 A;  4Z2R A;  2ON5 A;  4EUY A;  4DSR A;  3PH9 A;  1GLP A;  1BAY A;  4JU5 A;  1M7T A;  3ZZX A;  2X8G A;  2XHF A;  3PIN A;  2EC4 A;  3QPM A;  3IC4 A;  5ECS A;  5F8B A;  4OD7 A;  4JR4 A;  3TCO A;  1TP9 A;  2RUF A;  5D9X A;  4HU7 A;  3ERW A;  2B1L A;  3ZVJ D;  3EU3 A;  2B6M A;  2GQK A;  2JAC A;  2E2M A;  4E8H A;  5HR1 A;  2RUE A;  2JL4 A;  1DUG A;  3I43 A;  5J9B A;  2FD3 A;  2YZH A;  2R0P A;  1ERW A;  3A2V A;  4MF7 A;  3FR6 A;  4MF6 A;  4GXZ A;  5KN3 A;  1FOH A;  2MMZ A;  18GS A;  2CV4 A;  4MZC A;  2FA4 A;  1HD2 A;  1SK0 A;  1A24 A;  4X1U A;  3H8Q A;  4MH3 A;  3WD6 A;  2N5F A;  1GSF A;  1NM3 A;  4K5S A;  3CXG A;  3C1R A;  3LJR A;  1YZX A;  2E0Q A;  4EKZ A;  3MAK A;  5DCG A;  3G7I A;  4AGS A;  4QQ7 A;  4KH7 A;  1T00 A;  2CVK A;  4TR0 A;  5DQY A;  2AUV A;  4ZL9 A;  3TJK A;  3DRN A;  3ZVJ A;  1EGO A;  1SU9 A;  3GV1 A;  3N5O A;  1EV4 A;  4TXV A;  2CX4 A;  4IGJ A;  2DLX A;  3CSJ A;  1OYJ A;  2A4H A;  4MJE A;  2DKH A;  4BVX A;  4P3Y B;  1ZYQ B;  3HYP A;  4ZB8 A;  2ON7 A;  1HNC A;  4WBR D;  1O85 A;  4K5R A;  5DAL B;  1SKW B;  1B4Q A;  2FY6 A;  4QL7 A;  1ERU A;  4BL7 A;  2VL2 A;  4NV2 A;  3F6D A;  4KGI A;  3EMX A;  1GTU A;  1AIU A;  1THO A;  3CQF A;  1FVJ A;  3L9U A;  2LV3 A;  5C04 A;  2GS3 A;  9GSS A;  4N0V A;  3VWX A;  4PQ1 A;  5IMA A;  1TK8 B;  1R26 A;  3H79 A;  4HZ2 A;  2IL3 A;  4NAX A;  4O32 A;  2JAD A;  5DAK A;  3L9V A;  4FIW A;  1OE8 A;  2HZF A;  2H6Z A;  1EP7 A;  2R6K A;  2YPM A;  4RI6 A;  2H30 A;  5HR3 A;  1TKD B;  5EL8 A;  1GLQ A;  1UC7 A;  2R2J A;  1PSQ A;  2CZ2 A;  2X64 A;  5KN0 A;  2FWG A;  3APO A;  5G31 A;  2WJU A;  3LWA A;  3ZRE A;  4IJI A;  1JZD A;  1QFN A;  2E2G A;  2E7P A;  1M9A A;  1UVZ A;  1T1V A;  1THX A;  1ST9 A;  3FEU A;  2K8S A;  4ECC A;  5A5K A;  4BVY B;  1PKZ A;  2FHE A;  4CY6 A;  1GUL A;  2P5Q A;  2H70 A;  2OE3 A;  4HJ2 A;  4HOJ A;  1SKS B;  4XS1 A;  2BJX A;  1ERT A;  2O89 A;  3EMP A;  4KDU A;  4KAE A;  3LYP A;  1T7P B;  3H93 A;  5GSS A;  2LJR A;  1M2D A;  2N5B A;  4KCA A;  4TXO A;  4XRD A;  2YN1 A;  2CVB A;  4IP6 A;  3NIV A;  1I5G A;  1DE1 A;  4YQM A;  1TU7 A;  4ID0 A;  4DSS A;  4ACS A;  4OWY A;  5B8B A;  1GP1 A;  3US3 A;  1G6W A;  4HQZ A;  4KW6 A;  1E6B A;  1TI3 A;  2IMD A;  2IME A;  4O7H A;  1PKW A;  2G0F A;  5A4W A;  4WR4 A;  1PN9 A;  3ZFB A;  2PU9 C;  3O76 A;  1ZGN A;  2LNS A;  1SD9 A;  2X49 A;  2GZY A;  2B5Y A;  1BED A;  4PQH A;  2YWM A;  4ZB9 A;  1ZZY A;  1PQN A;  5B7C A;  4OO5 A;  2FWF A;  3O3T A;  2LST A;  4HQS A;  4CDO A;  5INY A;  2LUS A;  2QKE A;  2GST A;  1E2Y A;  3GUR A;  4HUA A;  2AB6 A;  4I2U A;  4NHZ A;  2HZE B;  1VF1 A;  4PUA A;  3BBY A;  1PD2 1;  3KM6 A;  3KP8 A;  1OC3 A;  3GH6 A;  2H0G A;  4MPF A;  1URM A;  1ZYN A;  3ERG A;  1I9D A;  1SYR A;  2EIO A;  4V2N A;  2PER A;  5D93 A;  1OVN A;  4WKW A;  2MBT A;  3P8W A;  2TIR A;  2JZT A;  3FW2 A;  1U3A A;  5ELG A;  2C0D A;  4NWY A;  5H5Q A;  2CAI A;  4V2L A;  3FYG A;  4KDY A;  3VI5 A;  1YKC A;  2D2Z A;  4E8E A;  3HCZ A;  2R37 A;  4MK3 A;  2PVO C;  4XS6 A;  3HDC A;  1JFU A;  2QSI A;  3HVN A;  5J4U A;  1S3D A;  2PMT A;  2WFC A;  3FZ9 A;  2YAN A;  3C71 A;  1YKA A;  1EV9 A;  2YZU A;  1RQM A;  4ISD A;  2MMN A;  1GNW A;  3GFK A;  4FH8 A;  4G2E A;  3F3R A;  4LL4 B;  1YEX A;  2NPB A;  3TOU A;  3BJ5 A;  4LMW A;  1XW9 A;  1YF1 A;  3ZFL A;  3ME8 A;  3KIJ A;  2O8V B;  3IXR A;  3C73 A;  3LXZ A;  2XPD A;  3CMI A;  1MEK A;  1XW6 A;  3F63 A;  1O7U A;  2M46 A;  4J2F A;  4F03 A;  4AJ8 A;  1Z5Y E;  1GUK A;  3IRA A;  3PGT A;  1UA5 A;  4TRX A;  2AAW A;  3CRT A;  3JCM L;  5F05 A;  5DCH A;  3TKS C;  4PNG A;  1IYI A;  1ZYP A;  2GVP A;  1B9Y C;  3UBK A;  3EWL A;  3HJM A;  1KBN A; 
#chains in the Genus database with same CATH homology
 1WPI A;  3L78 A;  3RPP A;  6GSV A;  3D4M A;  3C1S A;  2HSM A;  2P5R A;  1XWA A;  2VCQ A;  2H0H A;  4GTU A;  2MMO A;  2C0F A;  4TR3 A;  3Q6O A;  3RDW A;  4I97 A;  1G0T A;  4IHU A;  3UJ1 A;  4DEJ A;  3UAR A;  1U88 A;  4MZB A;  3GKK A;  3ME7 A;  1XCC A;  1JZR A;  1M2B A;  4O5Q A;  4Z7X A;  4V1A g;  2O87 A;  3CRU A;  3WGD A;  3M3M A;  4WEY A;  2GSR A;  1K0A A;  1O81 A;  1AAZ A;  4Q5F A;  2P31 A;  4FYB A;  5CNW A;  2YJH A;  3DYR A;  3ED3 A;  4FYC A;  1V9W A;  2L6D A;  2L4Q A;  2Z9S A;  3D5J A;  3GH9 A;  5D96 A;  4JRR A;  2C0E A;  4N0Z A;  4RQX A;  4EIQ A;  2MYG A;  22GS A;  1SJI A;  2QA2 A;  13GS A;  3TUE A;  2CQ9 A;  4OO4 A;  3GA4 A;  4WET A;  1VF4 A;  4KND A;  4CW9 A;  1HYU A;  3GRX A;  2F51 A;  5A4U A;  1T4Z A;  1A23 A;  5IQY A;  1LBK A;  2H1B A;  3F4R A;  2RII A;  3GKN A;  1ZOF A;  5J3R A;  5IMZ A;  3GNJ A;  4GQF A;  2HRF A;  4J56 E;  3UEM A;  3F9U A;  4TN8 A;  1AQW A;  3ZIT A;  2IFQ A;  1MTC A;  2GDR A;  3UL3 A;  3UIW A;  2IMK A;  1XVQ A;  2YCD A;  4MH2 A;  2I3Y A;  4XS4 B;  1PX7 A;  4PNF A;  4ZBD A;  1JZW A;  4ZIL A;  3ZIJ A;  3QFA C;  2X4A A;  4PTS A;  2CAQ A;  4K6X A;  2A2S A;  5ABR A;  4MA9 A;  3IR4 A;  4MCU A;  2JU5 A;  2QC7 A;  2YWI A;  1V58 A;  1K0C A;  5J41 A;  2PGT A;  1OC8 A;  1JLW A;  7GSS A;  1RK4 A;  1QMV A;  5DJM A;  4K0N A;  5GZZ B;  4X43 A;  4K7I A;  1PGT A;  1B9X C;  3HZ8 A;  1IYH A;  2O85 A;  3TKS A;  2DSA A;  3GTU B;  3HVX A;  4BL7 B;  3IOS A;  1F2E A;  3QMX A;  1G7E A;  4XHM A;  5IOX A;  3W8S A;  1TJD A;  3TKS E;  3P2A A;  3WYW A;  4POL A;  3KTL A;  2OE1 A;  3C8E A;  1YDK A;  3LQ7 A;  4YKG A;  4NHW A;  2PVQ A;  3CSH A;  3GHA A;  1USB A;  3I9V 2;  4LA1 A;  3UOM A;  4X0X A;  1XWK A;  3DML A;  3I6A A;  3IHQ A;  5FT3 A;  1TRU A;  2NTO A;  4HJM A;  3DD3 A;  1HQO A;  5DBQ A;  2DJ2 A;  4KCE A;  3DWV A;  2JZR A;  3F4S A;  4EL1 A;  4KB3 A;  3FR9 A;  2DIZ A;  3ZYW A;  1EWX A;  1PL1 A;  4POK A;  3QFB C;  2DBC A;  5HR0 A;  2H1A A;  1WJK A;  2VAF A;  4WF4 A;  4EE0 A;  3ZTL A;  3UVT A;  3M9J A;  3A5W A;  3TJB A;  5CRW A;  5JWO B;  2O7K A;  5ECL B;  2ZNM A;  4IKH A;  2C0G A;  2AYT A;  1GSD A;  6GSW A;  2V32 A;  4O5R A;  3FZA A;  3IAS 2;  2A2R A;  5A4V A;  3HVS A;  5CAX A;  4LL1 B;  2GGT A;  2I9H A;  1DSB A;  3IV4 A;  2DMM A;  3TRX A;  2K9F A;  1M9B A;  1R7H A;  2XBI A;  3FKF A;  3HJP A;  5E4W A;  3VWV A;  1EP8 A;  2PBJ A;  1K3O A;  1PRX A;  3UVH A;  3TOT A;  2YV9 A;  5ECR B;  5LNK e;  3K8N A;  1QXH A;  5DQS A;  2B5X A;  2VUP A;  4I2T A;  5KN2 A;  2XBQ A;  4V2M A;  8GSS A;  3EIN A;  2HE3 A;  4TR1 B;  11GS A;  1H4O A;  3APS A;  1MDI A;  1Z3E A;  2LJA A;  2WS2 A;  4NV5 A;  1WOU A;  3LYK A;  2H0I A;  4Q5Q A;  3FZ5 A;  2WZ9 A;  3HJO A;  4OFT A;  1DE2 A;  4KUN A;  2MZC A;  1O6J A;  1Q98 A;  2HSH A;  4N30 A;  4K2X A;  4AJ6 A;  4DSQ A;  2F8F A;  3IAM 2;  3E3E A;  5F0G A;  2OAC A;  1TTZ A;  1GL8 A;  4ZBA A;  4JE1 A;  2JZS A;  2RM6 A;  3LFL A;  3KXO A;  3L4N A;  3F3Q A;  3DVX A;  1HNB A;  5JCW A;  5COH A;  1TOF A;  4G0L A;  1X9M B;  4ZL7 A;  4USS A;  1XOB A;  2DJK A;  5D73 A;  3ZLP A;  4MAB A;  3D4T A;  2LNT A;  3GKX A;  4L8E A;  4JBB A;  2TRX A;  1X9S B;  3KH9 A;  2V1M A;  3M9K A;  4HI7 A;  5IOW A;  1C72 A;  4K9Z A;  1XW5 A;  2L6C A;  3D6I A;  1TK0 B;  3KJY A;  2NBS A;  3I69 A;  3GX8 A;  5D9W A;  3VPT A;  1A8L A;  5J9C A;  1B8X A;  2HNL A;  1SD8 A;  2LJK A;  1QQ2 A;  3TGZ A;  2VLV A;  3EU4 A;  4KE3 A;  2PN8 A;  2IMF A;  2QA1 A;  3P7X A;  1B48 A;  4G19 A;  1OC9 B;  3EUR A;  3VLN A;  4HU9 A;  5ID2 A;  20GS A;  3RHC A;  3UBL A;  3KCM A;  4AJ7 A;  2GT6 A;  1J0F A;  4YQU A;  3H1N A;  1X5D A;  5JWQ B;  2TRC P;  3M0F A;  4WF5 A;  2GT5 A;  3O6T A;  3BOA A;  2I1U A;  4LMV A;  1T3B A;  2HXK A;  5G5F A;  2YJ7 A;  3GUS A;  1V2A A;  3L9S A;  2R3X A;  1Y25 A;  4KX4 A;  2H73 A;  1PX6 A;  4HDE A;  1FHE A;  4MLY A;  3UAP A;  4KA0 A;  1AC1 A;  5E59 A;  2AV4 A;  4JED A;  3KTB A;  1QUW A;  1GUM A;  3W8J A;  3V1W A;  2EIQ A;  2RM5 A;  4F0C A;  4BPY A;  1TI1 A;  2I4A A;  2H75 A;  4K2D A;  4XIH A;  1YEP A;  3GL5 A;  3KP9 A;  6GSU A;  2CVD A;  3M8N A;  2GZP A;  3FR3 A;  4PGT A;  2ZCT A;  5IO0 A;  1WRY A;  5KOW A;  4MJA A;  3LG6 A;  1J9B A;  2L59 A;  3HHV A;  1K0N A;  1XIY A;  4BWS A;  1PL2 A;  1GSS A;  1N2A A;  5CRH A;  2YOI A;  4N11 A;  3Q19 A;  2R4V A;  1X0R A;  2V6O A;  1A2L A;  1G7O A;  3KGK A;  5CRE A;  3L0H A;  3VWU A;  5AGY A;  1K0M A;  2AJQ B;  3FK8 A;  5HR2 A;  2HYX A;  2VOC A;  6GSY A;  1BX9 A;  5IO2 A;  4ULX A;  5G2Z A;  5GAP D;  1G6Y A;  1Z7R A;  4ECB A;  5F06 A;  2HRN A;  3VUR A;  3LSZ A;  5CRD A;  2HSY A;  4KF9 A;  2ALB A;  3HKR A;  5BRT A;  4GSS A;  2KP1 A;  1H75 A;  1FVK A;  5CP1 A;  1Z6M A;  3GYK A;  3MIX A;  3TRP A;  2H8L A;  1F6M C;  3CTF A;  5IMD A;  3IBH A;  1AUC A;  4K7O A;  4MF5 A;  3GIX A;  2BTO T;  1ML6 A;  3DEX A;  3DVW A;  3A5I A;  1CQG A;  1SL0 B;  1A2M A;  4IP1 A;  4MDC A;  1B4P A;  4IEL A;  3VK9 A;  6GST A;  4BVY A;  1ZYE A;  4ECJ A;  4XRA A;  5BMU A;  3IA1 A;  4PQI A;  4WR5 A;  2H6X A;  3U6V A;  2VO4 A;  3EVI A;  3AY8 A;  2FA8 A;  1GH2 A;  4I8B A;  4ZIJ A;  4FQU A;  3LGC A;  5HFK A;  2DIY A;  2VCZ A;  3FY7 A;  4MNN A;  3WGE A;  1YJ6 A;  2LEG A;  4V1A p;  2YNX A;  5ECO B;  1GRX A;  1A2J A;  3BCK A;  5IMV A;  3A3T A;  2ZUP A;  2IPA A;  2C80 A;  1XBS A;  1EOH A;  1N8J A;  1AW9 A;  4XCS A;  3NZN A;  4LLR A;  4MZW A;  4XTS A;  3LXT A;  1SYX A;  1KNG A;  1Z6N A;  3TKR A;  2VCX A;  3A2X A;  4PUR A;  1AQV A;  2GTU A;  4D73 B;  4EIP A;  4GF0 A;  1EZK A;  3QAV A;  4ILF A;  5D8I A;  2B7K A;  4ECI A;  2J23 A;  3HVV A;  3G9B A;  2YWN A;  1FAA A;  2VCT A;  1GTA A;  2M80 A;  4IW9 A;  3QDN A;  4OCE A;  2H01 A;  1Q4J A;  1ZCP A;  4Q5N A;  1F9M A;  1XWB A;  4EO3 A;  3FZ4 A;  2REM A;  1V57 A;  1OE7 A;  3MWH A;  3QAW A;  19GS A;  4BWQ A;  4J57 E;  2PWJ A;  3D0Z A;  3E0U A;  2H6Y A;  2DJ1 A;  2RLI A;  4K7N A;  1TW9 A;  2H72 A;  2C4J A;  5ENU A;  2MMA A;  2DJJ A;  2H74 A;  5G1K A;  14GS A;  3KMN A;  2IWT A;  3QOU A;  4A5P A;  1JZO A;  4HEA 2;  3SBC A;  3F8U A;  3J7Y b;  3MNG A;  3KZQ A;  1F3A A;  1SL2 B;  4O5U A;  2C3T A;  2OJL A;  1MDK A;  3DXB A;  2H1G A;  2WDU A;  4YAV A;  1U6T A;  3GL3 A;  2AHE A;  3R2Q A;  4FO5 A;  2WRT A;  4G9H A;  1NW2 A;  1Z9H A;  5GAN D;  1MD3 A;  2YWO A;  4BVX B;  1HNA A;  1AXD A;  3NOF A;  3W6G A;  1TDI A;  4BA7 A;  4N10 A;  4HS1 A;  2K18 A;  1TXX A;  3P90 A;  2VLT A;  3GN3 A;  3MDK A;  4H86 A;  2B7J A;  2FNO A;  1TRW A;  1T4Y A;  5IMF A;  4IN0 A;  3J7Y k;  2HT9 A;  1EEM A;  2KLX A;  4ML6 A;  1ILO A;  3Q74 A;  1QK8 A;  3HY2 A;  2V6K A;  1OAZ A;  4EC0 A;  2BMX A;  2VD1 A;  1FG4 A;  4TKY A;  4OFM A;  5AIX A;  3CYN A;  5G30 A;  1OKD A;  3OR5 A;  5D9V A;  4WBJ A;  5DAK B;  5DVB A;  5L71 A;  5DJL A;  4EF0 A;  5J5N A;  1K0D A;  1YY7 A;  3MSZ A;  3QAG A;  4PUF C;  2QGV A;  2OE0 A;  2IMI A;  2K6V A;  2HRA A;  5FWG A;  5LCZ A;  3RBT A;  2DJ0 A;  3ZMK A;  4WXT A;  1NHO A;  1VF3 A;  3GKM A;  5JCU A;  4GRF A;  2VL9 A;  3FRC A;  5IPH A;  4IQA A;  1XWG A;  3WT2 A;  3FHK A;  17GS A;  1EGR A;  2L5L A;  4GQC A;  4OCF A;  2HRK A;  3IC8 A;  1XZO A;  3APQ A;  12GS A;  3HXS A;  1ON4 A;  3C7M A;  1XVW A;  3MYD A;  2GQL A;  4POM A;  4G0I A;  4F2I A;  3RPN A;  2F9S A;  2GSQ A;  2LRN A;  1GSQ A;  2YP6 A;  2L57 A;  1EEJ A;  4X4J A;  4MPG A;  1GTB A;  5ID2 B;  2KHP A;  5CRG A;  4TXO B;  5B6N A;  2VIM A;  2GSS A;  2F8A A;  2LQQ A;  4DSS B;  5B8A A;  1O8W A;  4KSO A;  1BYE A;  4ZL8 A;  4TW5 A;  1FOV A;  3IDV A;  2FGX A;  5CYY A;  4EXJ A;  5IIZ A;  5FHI A;  5KEJ A;  1RW1 A;  4XS4 A;  5B6M A;  5HQP A;  5HFG A;  4I5Q A;  5DDL A;  2CZ3 A;  4AF2 A;  2NDO A;  3RAZ A;  4TOP A;  3GMF A;  2LKU A;  3H4K A;  1LU4 A;  3HZ4 A;  4GSN A;  3VWW A;  6GSX A;  4ZB6 A;  2WCI A;  2EIR A;  2FWE A;  2JSY A;  2X8H A;  4L0U A;  4L5L A;  3WGX A;  3IE3 A;  1FW1 A;  1JHB A;  4DVC A;  3GTU A;  3HA9 A;  1Z7P A;  2L5O A;  10GS A;  3G7J A;  2R0C A;  4Q5R A;  5ECQ B;  1SKR B;  1ERV A;  2OBI A;  1XOA A;  3CBU A;  2H71 A;  4CHS A;  4ICY A;  4I6X A;  2N5A A;  3KMO A;  2F3M A;  3GX0 A;  2HFD A;  4YKF A;  4KDX A;  5ELA A;  1UN2 A;  3TKQ A;  1MDJ A;  3LOR A;  4TR4 A;  1K3Y A;  2FUG 2;  3F0I A;  4GLT A;  1AQX A;  3FMW A;  1YF0 A;  3EE2 A;  4NPB A;  2OBK A;  5ECH B;  3ERF A;  2LRC A;  1SK1 A;  1V98 A;  1ACV A;  4EDY A;  3BCI A;  5C00 A;  2I81 A;  1PA3 A;  3ISO A;  3D22 A;  4QL9 A;  2B1K A;  3ZRD A;  1X5E A;  5ECI B;  1W4V A;  4MP4 A;  2FWH A;  2PPT A;  4NXI A;  5IMC A;  1TU8 A;  2KOK A;  5H5S A;  1A0R P;  2KP2 A;  2LRT A;  2IJY A;  1WE0 A;  5EY6 A;  1X5C A;  5D9T A;  3ZL5 A;  2GQM A;  1NSW A;  4MMM A;  1CQH A;  3E9J B;  5AIS A;  2OA7 A;  1TRS A;  5IM9 A;  3F4T A;  1F3B A;  2X8C A;  4Z2U A;  2NVL A;  1GSE A;  2HI7 A;  1VF2 A;  3GST A;  1GNE A;  4GWR A;  2C3N A;  3IK9 A;  3N9J A;  4CY8 A;  2FLS A;  1K3L A;  2PUK C;  2OAD A;  2DKI A;  5DAL A;  1R4W A;  2FCH A;  2A4V A;  4TR1 A;  3EPT A;  2ES7 A;  2H66 A;  2L4C A;  5AIV A;  2G2Q A;  3KD0 A;  4POB A;  1XPV A;  3IPZ A;  2B3S A;  3GSS A;  4F82 A;  1S3C A;  3ZIV A;  4RUV A;  3M1G A;  1M2A A;  1FO5 A;  4IVF A;  1ZL9 A;  3WT1 A;  4K8M A;  4IJ3 A;  2CT6 A;  4GST A;  3R3E A;  5HFI A;  2LQO A;  3D21 A;  4TVE A;  4MJC A;  1S3A A;  4HZ4 A;  2XC2 A;  1JLV A;  4EDZ A;  2VL3 A;  4RI7 A;  3S9F A;  2X99 A;  3TKP A;  3TJG A;  2WUL A;  1A8Y A;  1SK2 A;  1BQ7 A;  1FB6 A;  1ZMA A;  1QGV A;  5G5E A;  4OMV A;  3QCP A;  3TJJ A;  1WP0 A;  3PR8 A;  1O8X A;  3IK7 A;  5GST A;  5CO3 A;  4IS0 A;  1OKT A;  4JZQ A;  2XPE A;  1SEN A;  2R0G A;  1BJX A;  1M0U A;  2IFQ B;  4IBP A;  1OC9 A;  2UZ8 A;  3LEF A;  4L0W A;  3BD2 A;  2B5E A;  4G10 A;  2WGR A;  1W89 A;  3CTG A;  1GTI A;  4KSM A;  1SJZ A;  3QD9 A;  4PXO A;  2DC5 A;  2VM1 A;  2H76 A;  1O73 A;  5F07 A;  5H5R A;  2VCV A;  3DIE A;  3Q18 A;  4ML1 A;  5ECK B;  1V40 A;  2V41 A;  2GLR A;  2MBS A;  4FYU A;  1WWJ A;  2C3Q A;  2YV7 A;  4RQR A;  1U3I A;  4L5O A;  2JSZ A;  1K0O A;  4GCI A;  4F9Z A;  2CX3 A;  1WMJ A;  4OFN A;  3DKS A;  3PPU A;  1GSU A;  3G7Y A;  3TB2 A;  4MJB A;  3QR6 A;  4YH2 A;  3DGQ A;  3HD5 A;  1T8E B;  4YAP A;  2HZE A;  3RHB A;  5IPG A;  1EOG A;  1TK5 B;  2VCW A;  4PX1 A;  1J08 A;  2R5G A;  2WB9 A;  4K1F A;  5AN1 A;  6GSS A;  2LS5 A;  4G0K A;  2GZZ A;  1GWC A;  3U5R E;  2VM2 A;  1MD4 A;  1R5P A;  4ZXG A;  1KEB A;  2HLS A;  5EVO A;  2C8U A;  1LJR A;  5JCG A;  2KUC A;  4ZBB A;  2P0G A;  3LW9 A;  5ECP B;  1TRV A;  1U87 A;  16GS A;  1XXU A;  1XFL A;  2K8V A;  5KOX A;  3VI7 A;  1GSY A;  5KN1 A;  1F37 A;  4K0G A;  3SWL A;  4YQV A;  3TRQ A;  5ECN B;  3EYT A;  1NHY A;  3TJF A;  1ABA A;  1VGL A;  1DBY A;  3VFI A;  4JR6 A;  2IIY A;  1KTE A;  5EPF A;  2C1Y A;  4NMU A;  3KH7 A;  5JWR B;  1X9W B;  1A0F A;  2CA8 A;  1BG5 A;  2DJ3 A;  3TDG A;  1PN0 A;  1SL1 B;  2M72 A;  2H1D A;  1GUH A;  5LD0 A;  1XWC A;  4Z2T A;  2VL2 C;  3ZML A;  1K0B A;  5G1L A;  4F0B A;  1WIK A;  1FB0 A;  2IN3 A;  4O92 A;  4IQ1 A;  3VPQ A;  2VD0 A;  1Y6E A;  1PMT A;  3EC3 A;  2V2G A;  3UMA A;  3KEB A;  2VLU A;  2J9H A;  2LTK A;  3F6F A;  3CSI A;  3IHG A;  2A2P A;  3A2W A;  1M99 A;  1SJ6 A;  2OKA A;  5ECM B;  1VRS D;  2DML A;  4EVM A;  1R5A A;  1YQ1 A;  2H19 A;  4D73 A;  4Z2R A;  2ON5 A;  4EUY A;  4DSR A;  3PH9 A;  1GLP A;  1BAY A;  4JU5 A;  1M7T A;  3ZZX A;  2X8G A;  2XHF A;  3PIN A;  2EC4 A;  3QPM A;  3IC4 A;  5ECS A;  5F8B A;  4OD7 A;  4JR4 A;  3TCO A;  1TP9 A;  2RUF A;  5D9X A;  4HU7 A;  3ERW A;  2B1L A;  3ZVJ D;  3EU3 A;  2B6M A;  2GQK A;  2JAC A;  2E2M A;  4E8H A;  5HR1 A;  2RUE A;  2JL4 A;  1DUG A;  3I43 A;  5J9B A;  2FD3 A;  2YZH A;  2R0P A;  1ERW A;  3A2V A;  4MF7 A;  3FR6 A;  4MF6 A;  4GXZ A;  5KN3 A;  1FOH A;  2MMZ A;  18GS A;  2CV4 A;  4MZC A;  2FA4 A;  1HD2 A;  1SK0 A;  1A24 A;  4X1U A;  3H8Q A;  4MH3 A;  3WD6 A;  2N5F A;  1GSF A;  1NM3 A;  4K5S A;  3CXG A;  3C1R A;  3LJR A;  1YZX A;  2E0Q A;  4EKZ A;  3MAK A;  5DCG A;  3G7I A;  4AGS A;  4QQ7 A;  4KH7 A;  1T00 A;  2CVK A;  4TR0 A;  5DQY A;  2AUV A;  4ZL9 A;  3TJK A;  3DRN A;  3ZVJ A;  1EGO A;  1SU9 A;  3GV1 A;  3N5O A;  1EV4 A;  4TXV A;  2CX4 A;  4IGJ A;  2DLX A;  3CSJ A;  1OYJ A;  2A4H A;  4MJE A;  2DKH A;  4BVX A;  4P3Y B;  1ZYQ B;  3HYP A;  4ZB8 A;  2ON7 A;  1HNC A;  4WBR D;  1O85 A;  4K5R A;  5DAL B;  1SKW B;  1B4Q A;  2FY6 A;  4QL7 A;  1ERU A;  4BL7 A;  2VL2 A;  4NV2 A;  3F6D A;  4KGI A;  3EMX A;  1GTU A;  1AIU A;  1THO A;  1FVJ A;  3L9U A;  2LV3 A;  5C04 A;  2GS3 A;  9GSS A;  4N0V A;  3VWX A;  4PQ1 A;  5IMA A;  1TK8 B;  1R26 A;  3H79 A;  4HZ2 A;  2IL3 A;  4NAX A;  4O32 A;  2JAD A;  5DAK A;  3L9V A;  4FIW A;  1OE8 A;  2HZF A;  2H6Z A;  1EP7 A;  2R6K A;  2YPM A;  4RI6 A;  2H30 A;  5HR3 A;  1TKD B;  5EL8 A;  1GLQ A;  1UC7 A;  2R2J A;  1PSQ A;  2CZ2 A;  2X64 A;  5KN0 A;  2FWG A;  3APO A;  5G31 A;  2WJU A;  3LWA A;  3ZRE A;  4IJI A;  1JZD A;  1QFN A;  2E2G A;  2E7P A;  1M9A A;  1UVZ A;  1T1V A;  1THX A;  1ST9 A;  3FEU A;  2K8S A;  4ECC A;  5A5K A;  4BVY B;  1PKZ A;  2FHE A;  4CY6 A;  1GUL A;  2P5Q A;  2H70 A;  2OE3 A;  4HJ2 A;  4HOJ A;  1SKS B;  4XS1 A;  2BJX A;  1ERT A;  2O89 A;  3EMP A;  4KDU A;  4KAE A;  3LYP A;  1T7P B;  3H93 A;  5GSS A;  2LJR A;  1M2D A;  2N5B A;  4KCA A;  4TXO A;  4XRD A;  2YN1 A;  2CVB A;  4IP6 A;  3NIV A;  1I5G A;  1DE1 A;  4YQM A;  1TU7 A;  4ID0 A;  4DSS A;  4ACS A;  4OWY A;  5B8B A;  1GP1 A;  3US3 A;  1G6W A;  4HQZ A;  4KW6 A;  1E6B A;  1TI3 A;  2IMD A;  2IME A;  4O7H A;  1PKW A;  2G0F A;  5A4W A;  4WR4 A;  1PN9 A;  3ZFB A;  2PU9 C;  3O76 A;  1ZGN A;  2LNS A;  1SD9 A;  2X49 A;  2GZY A;  2B5Y A;  1BED A;  4PQH A;  2YWM A;  4ZB9 A;  1ZZY A;  1PQN A;  5B7C A;  4OO5 A;  2FWF A;  3O3T A;  2LST A;  4HQS A;  4CDO A;  5INY A;  2LUS A;  2QKE A;  2GST A;  1E2Y A;  3GUR A;  4HUA A;  2AB6 A;  4I2U A;  4NHZ A;  2HZE B;  1VF1 A;  4PUA A;  3BBY A;  1PD2 1;  3KM6 A;  3KP8 A;  1OC3 A;  3GH6 A;  2H0G A;  4MPF A;  1URM A;  1ZYN A;  3ERG A;  1I9D A;  1SYR A;  2EIO A;  4V2N A;  2PER A;  5D93 A;  1OVN A;  4WKW A;  2MBT A;  3P8W A;  2TIR A;  2JZT A;  3FW2 A;  1U3A A;  5ELG A;  2C0D A;  4NWY A;  5H5Q A;  2CAI A;  4V2L A;  3FYG A;  4KDY A;  3VI5 A;  1YKC A;  2D2Z A;  4E8E A;  3HCZ A;  2R37 A;  4MK3 A;  2PVO C;  4XS6 A;  3HDC A;  1JFU A;  2QSI A;  5J4U A;  1S3D A;  2PMT A;  2WFC A;  3FZ9 A;  2YAN A;  3C71 A;  1YKA A;  1EV9 A;  2YZU A;  1RQM A;  4ISD A;  2MMN A;  1GNW A;  3GFK A;  4FH8 A;  4G2E A;  3F3R A;  4LL4 B;  1YEX A;  2NPB A;  3TOU A;  3BJ5 A;  4LMW A;  1XW9 A;  1YF1 A;  3ZFL A;  3ME8 A;  3KIJ A;  2O8V B;  3IXR A;  3C73 A;  3LXZ A;  2XPD A;  3CMI A;  1MEK A;  1XW6 A;  3F63 A;  1O7U A;  2M46 A;  4J2F A;  4F03 A;  4AJ8 A;  1Z5Y E;  1GUK A;  3IRA A;  3PGT A;  1UA5 A;  4TRX A;  2AAW A;  3CRT A;  3JCM L;  5F05 A;  5DCH A;  3TKS C;  4PNG A;  1IYI A;  1ZYP A;  2GVP A;  1B9Y C;  3UBK A;  3EWL A;  3HJM A;  1KBN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...