3OR5A

Crystal structure of thiol:disulfide interchange protein, thioredoxin family protein from chlorobium tepidum tls
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
145
structure length
145
Chain Sequence
ADARPTPAPSFSGVTVDGKPFSSASLKGKAYIVNFFATWCPPCRSEIPDMVQVQKTWASRGFTFVGIAVNEQLPNVKNYMKTQGIIYPVMMATPELIRAFNGYIDGGITGIPTSFVIDASGNVSGVIVGPRSKADFDRIVKMALG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Thiol:disulfide interchange protein, thioredoxin family prot
publication title Crystal structure of thiol:disulfide interchange protein, thioredoxin family protein from Chlorobium tepidum TLS
rcsb
source organism Chlorobaculum tepidum
total genus 33
structure length 145
sequence length 145
ec nomenclature
pdb deposition date 2010-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08534 Redoxin Redoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3or5A00
1GNWA 4K6XA 2OE3A 5IO0A 1O8WA 3F3RA 3EINA 4KE3A 2PBJA 5FHIA 4PQIA 4NHZA 3WGEA 2VCWA 3LWAA 2IMEA 1GLPA 3KH7A 4PGTA 4TR3A 1J0FA 3ZFLA 4EVMA 9GSSA 4MZCA 1MD4A 2YCDA 2I1UA 4DSQA 2LJRA 3H1NA 1MTCA 4TOPA 1TRWA 2YV9A 2OBIA 2FWFA 2VAFA 3HJOA 3TKSE 3ZYWA 4XRAA 2LUSA 4YAPA 2NVLA 3D22A 3ZMKA 4MA9A 2CAIA 1K0OA 2GDRA 3IK9A 2XPDA 5CRHA 1GTBA 3IE3A 5LNKe 1BEDA 3G7JA 3D6IA 5IMVA 1YF0A 1TDIA 4OO4A 1H4OA 1X0RA 2L6DA 4ISDA 2FWGA 2VL2C 1A0FA 1F37A 4IW9A 2JZRA 1Z7PA 2X8CA 1PA3A 4G10A 1SJZA 2JZTA 5CRDA 2ON7A 5LCZA 1X9MB 1TRSA 4ML6A 1JZOA 1W4VA 4IJ3A 2CA8A 6GSWA 1G6YA 4F82A 1Q98A 5ECQB 3ZFBA 2CX3A 4MH3A 2YOIA 2MMOA 2YWMA 5DJMA 2N5FA 1GNEA 2DJJA 1YQ1A 5AN1A 1VRSD 4XHMA 2K6VA 5F05A 5JWQB 1M0UA 1NW2A 2PERA 1AAZA 2PN8A 7GSSA 1WPIA 1SENA 1A2MA 4IS0A 4N10A 1XXUA 1OYJA 3E9JB 1T7PB 4MZBA 5DJLA 2B3SA 4QL7A 2DBCA 3P7XA 1QK8A 2P5QA 1WWJA 14GSA 3F0IA 1PRXA 3KM6A 3KTLA 2X99A 4GSTA 5D73A 1IYIA 1WE0A 1XZOA 1GUKA 2I3YA 2P31A 3M9JA 1U88A 1CQGA 5D9VA 5KN1A 1J08A 2JACA 4X1UA 4MLYA 5E59A 3C1SA 4TXOB 5ELGA 2N5BA 3FKFA 4Q5RA 2X8GA 5AISA 2K9FA 4Q5FA 4KB3A 4OO5A 4PUAA 1ZYEA 3VURA 1S3AA 4DSSB 2FWHA 2BTOT 4KCEA 2PWJA 2XBIA 2IFQB 5B6NA 2YNXA 3BCKA 2BMXA 4K7OA 4WR4A 4X43A 3P2AA 3GH9A 3RAZA 5C04A 3ZVJD 4I5QA 2AV4A 3BD2A 3GUSA 1OVNA 2CZ3A 4V2NA 20GSA 1PX7A 2GT6A 2LRTA 5D9XA 1U6TA 3KP9A 5ECKB 2M46A 1FHEA 4MP4A 4ZILA 3GL3A 3GH6A 1FW1A 5IMCA 2B1LA 4HQZA 3ZIVA 5CP1A 3ZRDA 5ECOB 2PMTA 3FEUA 4PNGA 2C3QA 1ZGNA 3FRCA 1K0CA 4ZL8A 1EGRA 2LJAA 2K18A 3W6GA 6GSXA 4XS4A 3QAGA 5CRGA 4TR1B 1E6BA 3I6AA 2L5OA 2HZFA 4HJ2A 4WF5A 5ID2A 1OE8A 2CAQA 2L5LA 3ERGA 3UAPA 1XW9A 22GSA 2GZZA 1M2BA 3J7Yb 17GSA 1BG5A 4POLA 5A4VA 2FA8A 3WD6A 5IQYA 2VOCA 4OCFA 5DALA 2FY6A 3AY8A 1M99A 2HZEA 2RLIA 3CSHA 10GSA 1AQXA 1VF3A 5IIZA 2G0FA 1Y25A 2H1BA 6GSTA 5B8BA 1Y6EA 3IAS2 1MDIA 1B4QA 1PQNA 1S3DA 1KEBA 1O81A 4I2UA 4OFMA 2JSZA 1OC8A 3TOTA 1MDKA 3HCZA 1EV4A 1G7OA 3WGXA 1QMVA 2LEGA 2DJKA 3BBYA 1TK0B 1YEXA 4TN8A 4IQ1A 1PKWA 4YAVA 8GSSA 2RM6A 4KSOA 3F6FA 3TRPA 4K2DA 4GXZA 3L9UA 1ST9A 4LL4B 3V1WA 4MDCA 4OMVA 2H0GA 1XBSA 3QD9A 5CREA 4K7NA 2H6XA 2B7JA 2A2SA 2GSRA 2MMAA 4PQHA 1WJKA 4H86A 1OC3A 2WULA 2JADA 2L4CA 3VK9A 1GH2A 1N2AA 3QFBC 3D4MA 2B6MA 5J5NA 1MD3A 1V40A 3Q19A 3P90A 1XWCA 3IA1A 1ABAA 1DE1A 5IM9A 4TR4A 5KN0A 3G7IA 3KMOA 1K0BA 1F3BA 2VL9A 5D9TA 3WT2A 2VM1A 4L0WA 3JCML 3EE2A 2X64A 3F63A 1HD2A 2KP1A 3RBTA 4EF0A 3GSSA 3IK7A 5B7CA 3QDNA 1SU9A 1DE2A 1FVJA 1F3AA 1V58A 2DC5A 1EZKA 4JRRA 1YZXA 2VD1A 4D73B 3ISOA 4NPBA 1ILOA 2LTKA 1TOFA 1G0TA 4V1Ap 3U5RE 2M72A 3EVIA 5HR1A 2VCTA 4OCEA 4K0NA 2GQKA 1LBKA 3VWWA 2QKEA 2R2JA 1UN2A 1KBNA 1ZOFA 2L59A 2V6KA 4GQFA 5IMAA 4L0UA 4KH7A 1OKTA 3F3QA 4OWYA 2TIRA 3DXBA 5COHA 2PUKC 4PQ1A 2GSSA 4ZB8A 1JLWA 3FZ5A 1YDKA 1TI1A 2VCXA 3C73A 3HVXA 3LFLA 1PL1A 1XPVA 1XW5A 3VPTA 2DMMA 4JE1A 1X9WB 4IHUA 1RW1A 3ERWA 2VLVA 3TJBA 3IXRA 3GNJA 2OADA 4IELA 3TJFA 3RHBA 1XCCA 5HFGA 3N9JA 4ILFA 3LXZA 3VLNA 3KCMA 5DBQA 2G2QA 1U3AA 2ZCTA 4J56E 3TOUA 4HU7A 2TRCP 2L57A 4NV5A 1K3OA 2IL3A 4KSMA 4N30A 5DALB 5IPHA 2RM5A 2VO4A 2HZEB 1AIUA 4P3YB 4XIHA 3WT1A 4FO5A 3HY2A 3TGZA 2K8VA 2H1DA 1FO5A 3IRAA 3FYGA 5CRWA 2H66A 3EYTA 1A2JA 2F9SA 4OD7A 5G31A 5G30A 2DSAA 3SWLA 4XS1A 1TW9A 4POBA 3VWUA 3M9KA 4BVYA 6GSSA 1YJ6A 4KDUA 1TKDB 1G6WA 1QXHA 4L8EA 1URMA 3TJJA 3FZAA 3KMNA 2ALBA 1YF1A 3LSZA 5J9BA 1XVQA 1YKCA 2BJXA 1HYUA 4KA0A 2AYTA 1K0MA 2R37A 4KUNA 1TRVA 3L4NA 4IGJA 2I4AA 4K9ZA 1GULA 1TK8B 4O92A 3F4TA 1X5CA 3BCIA 3HVSA 2YANA 3G9BA 1SJIA 4WBJA 1SYRA 4LMVA 3EURA 3FR3A 4YH2A 4ZBAA 1Z5YE 3LEFA 1I9DA 2JU5A 2YV7A 5CAXA 2B5YA 2LRCA 1KNGA 2B5EA 12GSA 2LJKA 2HT9A 2WZ9A 4K8MA 2FLSA 4O32A 3UJ1A 1X5DA 2I9HA 3W8SA 3DKSA 4ML1A 4GSNA 3US3A 6GSVA 1SD9A 2LSTA 1TXXA 4ECCA 3CSJA 3L9VA 4YQMA 13GSA 3ZZXA 4FYBA 2A2RA 4POKA 3MNGA 4MK3A 4TW5A 3F4SA 4LL1B 2H70A 4X0XA 4JU5A 4F0CA 4KX4A 3DRNA 2PPTA 2H71A 1PSQA 2O7KA 4KDXA 3R2QA 2KLXA 1M2DA 2OA7A 3UL3A 4V2MA 3A2WA 1N8JA 4GRFA 3GFKA 1A2LA 2WGRA 1GSQA 3O76A 2GVPA 3VI5A 3PINA 1R4WA 1DBYA 3I43A 2DIZA 4E8EA 2AHEA 5HFKA 1USBA 2DJ0A 2FCHA 1WP0A 2OE0A 3TB2A 1XWKA 3MWHA 1SL1B 4V1Ag 3ZREA 1Z6MA 1ZYQB 2WB9A 4HUAA 4JR6A 2PVQA 5JWOB 2B7KA 1NHYA 3GA4A 3KEBA 2YN1A 2HYXA 3CBUA 5F0GA 4F03A 1M9AA 1VGLA 3TKSA 4GSSA 2NBSA 1YY7A 1BAYA 2CVKA 2XBQA 5ECRB 1GRXA 1BX9A 4MF6A 2KUCA 3P8WA 4MPFA 1T00A 3IC4A 2M80A 2J23A 2LNSA 1BQ7A 4YQUA 4ECJA 5GAND 5ELAA 1XVWA 2HFDA 1T3BA 3DVWA 2X8HA 3Q18A 1E2YA 2DJ2A 3GKKA 5F8BA 2FUG2 5ECNB 4IKHA 2VCZA 3CSIA 5LD0A 4BWQA 5E4WA 1R5PA 1HQOA 1U87A 2IIYA 1PL2A 1VF4A 4AJ8A 3TKPA 5ABRA 2DMLA 4ZXGA 1PD21 4J2FA 1S3CA 1PX6A 3QAVA 4I97A 4XS6A 5EY6A 3HDCA 4EO3A 3HVVA 4ZB6A 5HR0A 1OC9A 5G1LA 4IN0A 1X9SB 4WBRD 1SKRB 4MH2A 4IQAA 1ACVA 1LU4A 4GCIA 1SL2B 1JZRA 2H1AA 1HNAA 1TU8A 3EWLA 5H5SA 2NTOA 5GSSA 5J41A 2MYGA 18GSA 1DSBA 3UIWA 2L6CA 2AJQB 1GL8A 1ERWA 11GSA 4BWSA 5IOXA 2QGVA 2GSTA 2VCVA 1XWBA 3GTUA 5J3RA 1YKAA 3TRXA 2HSYA 4LMWA 3E3EA 1PN9A 2KHPA 3FR9A 1FB0A 2NDOA 1FVKA 2YWOA 4MMMA 2WDUA 3EC3A 3S9FA 2D2ZA 1B9XC 2H19A 4O7HA 2EIQA 2LNTA 2E2GA 1OKDA 5HFIA 3IHQA 3ERFA 4Z7XA 1SYXA 3APQA 5ECLB 1M9BA 1THXA 2MZCA 5JCUA 3GHAA 4TVEA 5A4UA 1TJDA 2C0FA 5FT3A 3GKNA 2YZHA 4NWYA 4E8HA 2O8VB 19GSA 1B9YC 4O5RA 4PNFA 4MF7A 2MBTA 4EE0A 3PR8A 4GQCA 1R7HA 2H6YA 3M8NA 1XIYA 2XPEA 1T4YA 2NPBA 3GMFA 5B6MA 3GYKA 2B5XA 4XRDA 3WYWA 4TR0A 3KH9A 2JZSA 3TKSC 3HJMA 3RHCA 1U3IA 3MDKA 2MMNA 4K1FA 1NHOA 2CX4A 1VF1A 1WRYA 3SBCA 2H30A 2H74A 2YWIA 3F9UA 4ZL9A 4TRXA 2ON5A 4GTUA 1GUMA 3A3TA 1Z6NA 2JL4A 1BYEA 4LA1A 4ECIA 2H72A 4IP6A 4NAXA 5GSTA 1SK1A 3DVXA 4MJAA 2IMKA 4PURA 5DVBA 4RQXA 3RPPA 4I6XA 2FWEA 2R5GA 4LLRA 1GTIA 2F8AA 4RUVA 1AXDA 3LGCA 2GLRA 1QFNA 3GRXA 2HNLA 5IOWA 4MABA 1UC7A 1K3YA 4IVFA 2AUVA 3KZQA 2WS2A 2PGTA 2C0EA 3ME8A 2MBSA 2ZUPA 2DJ3A 2XC2A 1J9BA 3EMXA 1GSDA 2F3MA 1SJ6A 4XS4B 1UVZA 2YP6A 3GSTA 3IV4A 3LG6A 4MJCA 3FK8A 3MSZA 3HA9A 2O89A 5D8IA 2LRNA 4HI7A 3IR4A 2HRNA 2J9HA 1B4PA 5ID2B 1KTEA 4AJ7A 2K8SA 2OKAA 2AAWA 2F51A 4YQVA 4TXOA 4EL1A 5DAKA 4WKWA 5DQSA 2TRXA 2HXKA 3ZLPA 3ZVJA 1GSSA 4DSSA 3CMIA 4EXJA 5CO3A 2IFQA 1ZMAA 1QGVA 1JFUA 2FNOA 3LJRA 2VCQA 3CTFA 1GSYA 2GZYA 4J57E 4KW6A 1PKZA 1X5EA 3NIVA 2CZ2A 1O7UA 3KJYA 3VPQA 1IYHA 4G2EA 1K0AA 3Q74A 3F4RA 1LJRA 2OE1A 1THOA 2H75A 4DSRA 5ECMB 3PH9A 4KDYA 3CYNA 2F8FA 3FZ9A 2IPAA 4PX1A 3H93A 2O87A 4EUYA 5DQYA 1SK2A 3PGTA 2O85A 1GTUA 4CW9A 1MDJA 4TR1A 4BL7A 4F9ZA 5G2ZA 4ECBA 1M2AA 1JZDA 3UVHA 2YJHA 2HE3A 2FA4A 2C0GA 1TK5B 1T4ZA 1A8YA 3A2VA 5A4WA 1O73A 4PXOA 4I2TA 6GSUA 4KGIA 3LYPA 1GSUA 2HSHA 4KCAA 2VIMA 1SD8A 4FH8A 1T1VA 3C7MA 3KGKA 3HD5A 5ECSA 1R26A 3CRTA 1Q4JA 3C1RA 2VLUA 2LV3A 2GTUA 5DCGA 4IP1A 2YZUA 5KEJA 1CQHA 4AJ6A 1I5GA 3TUEA 3IDVA 4RI7A 1FG4A 4GF0A 3HXSA 3TKQA 1TP9A 5HR3A 1Z7RA 1DUGA 5ECHB 1AUCA 2V2GA 1ZZYA 2CQ9A 2H0HA 5F06A 5DDLA 4NHWA 1TI3A 3IAM2 3GL5A 3EU4A 3GV1A 3HKRA 3DD3A 4EDZA 3ZL5A 3UBKA 3GX0A 3HZ8A 2MMZA 3HJPA 2V41A 2B1KA 3WGDA 1SK0A 1GSEA 5H5QA 3KD0A 3FHKA 4MZWA 4F0BA 3TRQA 1V57A 1ML6A 1R5AA 5IMFA 4ZBDA 3FW2A 2N5AA 5HR2A 2AB6A 3APOA 4G9HA 1PGTA 3I9V2 1UA5A 1GSFA 2V6OA 5G5EA 5L71A 4HZ4A 1H75A 1M7TA 5INYA 3HYPA 1WIKA 2RUEA 2IMFA 3I69A 1O85A 3N5OA 1ZL9A 2I81A 3C8EA 3G7YA 1GTAA 3NZNA 3CRUA 1EWXA 1F6MC 4EC0A 1AC1A 3D0ZA 3GIXA 3TJGA 2EIOA 2DIYA 3H4KA 1GWCA 4ZIJA 2C80A 2R6KA 4OFTA 1K3LA 3IPZA 3UOMA 1B8XA 5EPFA 3HHVA 1ERUA 1FB6A 5KN3A 2LKUA 3U6VA 3QAWA 5DAKB 4ACSA 2C3NA 3W8JA 1AW9A 3UMAA 4WETA 5CNWA 1TRUA 1XOAA 3L0HA 2V1MA 2FD3A 1OE7A 3GX8A 4D73A 3O6TA 2PU9C 4TXVA 2EIRA 4ZBBA 1GUHA 5ECPB 2C4JA 4MF5A 4JR4A 3DIEA 3QOUA 4HZ2A 1ZCPA 4XCSA 2YWNA 2H8LA 1EEJA 4OFNA 4G19A 3UVTA 3ME7A 2H6ZA 1SKWB 4L5OA 3LXTA 3IBHA 5JCWA 2P5RA 2FHEA 5AGYA 3QMXA 2GSQA 1PMTA 5H5RA 3VFIA 4Q5QA 2JSYA 4WEYA 2GT5A 4PUFC 1JLVA 1EV9A 5J4UA 2E7PA 4K0GA 1FAAA 1YEPA 1GLQA 1V9WA 5C00A 5GZZB 3M3MA 4QQ7A 2HI7A 3LORA 2H73A 1WOUA 4CDOA 6GSYA 3J7Yk 2ES7A 4FYUA 4HS1A 4HEA2 4GWRA 2H01A 1EP8A 1NSWA 4JBBA 4DEJA 5JCGA 4ZL7A 2WRTA 3HZ4A 3TJKA 3D21A 2HRFA 1HNBA 5F07A 1ERVA 4IJIA 2GZPA 4WXTA 1EGOA 3RDWA 2KP2A 1AQVA 1EOHA 1V98A 1A23A 3KXOA 4I8BA 3H79A 5ENUA 2R4VA 4N0VA 4HJMA 3BOAA 2CVDA 1XW6A 3F6DA 1SL0B 4FIWA 2V32A 5D96A 5G1KA 4MJEA 1TTZA 3DYRA 2E2MA 4Q5NA 3E0UA 3KP8A 2CV4A 2LQQA 3ZMLA 2H0IA 3NOFA 4NV2A 1A24A 3UEMA 3TDGA 2C1YA 2WFCA 1VF2A 1RK4A 5D93A 1C72A 5ECIB 4BPYA 5A5KA 2QC7A 2IWTA 4HOJA 2FGXA 3VWXA 1K0NA 1G7EA 5HQPA 1OAZA 2KOKA 1QUWA 5DCHA 3L78A 4CHSA 3ED3A 1ERTA 1Z9HA 5AIVA 3TCOA 2RUFA 3ZITA 4N0ZA 2VL3A 3F8UA 4NMUA 2VLTA 4NXIA 4EDYA 3D4TA 3QFAC 4BA7A 1MEKA 3A5WA 2H76A 4RQRA 3L9SA 3M1GA 3OR5A 1WMJA 1XWAA 1TU7A 4DVCA 4ZB9A 3H8QA 3VI7A 1V2AA 5JWRB 3GURA 2GS3A 2QSIA 4BVXA 5IPGA 3A2XA 4HU9A 3UARA 2DJ1A 1QQ2A 1A8LA 2PVOC 1JHBA 1Z3EA 4EKZA 1ON4A 2IJYA 2WCIA 3GKXA 3RPNA 3O3TA 1XFLA 3LYKA 4WR5A 4HDEA 1W89A 3QPMA 2H1GA 4JEDA 5IO2A 3MAKA 2VL2A 1T8EB 3DMLA 5EL8A 2E0QA 5CYYA 3BJ5A 2HLSA 3CTGA 1XWGA 4QL9A 2GQLA 3UBLA 2A4VA 3GN3A 3EU3A 2RIIA 1F2EA 3Q6OA 3DWVA 4MJBA 2C0DA 3IOSA 2IN3A 4HQSA 4N11A 16GSA 1EEMA 3DEXA 3DGQA 2CT6A 5IMDA 1SKSB 3CXGA 3D5JA 4TKYA 2GQMA 4RI6A 3FR6A 2C8UA 2IMDA 1HNCA 2DLXA 1F9MA 1EP7A 3EMPA 4WF4A 4V2LA 5B8AA 1XOBA 1AQWA 2YPMA 1EOGA 2VM2A 1K0DA 4KAEA 1OC9B 2ZNMA 5FWGA 4MCUA 4AF2A 1A0RP 5KN2A 2L4QA 5AIXA 3KTBA 1GP1A 2VUPA 4ID0A 2LS5A 2YJ7A 4L5LA 1RQMA 4FYCA 3KIJA 3QCPA 1BJXA 5J9CA 2GGTA 3FZ4A 4AGSA 3K8NA 4IBPA 2REMA 2LQOA 3ZTLA 5IMZA 4GLTA 4XTSA 1FOVA 5G5FA 4F2IA 1NM3A 3VWVA 4JZQA 4MPGA 2OACA 3GTUB 2C3TA 1O6JA 2IMIA 2CVBA 1JZWA 2WJUA 3GKMA 4ULXA 4POMA 3APSA 2P0GA 2Z9SA 5EVOA 2EC4A 1B48A 4KNDA 2VD0A 2OBKA 3LQ7A 3FY7A 3QR6A 2R3XA 2OJLA 1O8XA 3C71A 3TKRA 5GAPD 4K7IA 5D9WA 3M0FA 3ZIJA 2XHFA
chains in the Genus database with same CATH superfamily
1GNWA 4K6XA 2OE3A 5IO0A 1O8WA 3F3RA 3EINA 4KE3A 2PBJA 5FHIA 4PQIA 4NHZA 3WGEA 2VCWA 3LWAA 2IMEA 1GLPA 3KH7A 4PGTA 4TR3A 1J0FA 3ZFLA 4EVMA 9GSSA 4MZCA 4MNNA 1MD4A 2YCDA 2I1UA 3EPTA 4DSQA 2LJRA 3H1NA 1MTCA 4TOPA 1TRWA 2YV9A 2OBIA 2FWFA 2VAFA 3HJOA 3TKSE 3ZYWA 4XRAA 2LUSA 4YAPA 2NVLA 3D22A 3ZMKA 4MA9A 2CAIA 1K0OA 2GDRA 3IK9A 2XPDA 5CRHA 1GTBA 3IE3A 5LNKe 1BEDA 3G7JA 3D6IA 5IMVA 1YF0A 1TDIA 1ZYPA 4OO4A 1H4OA 4BVXB 1X0RA 2L6DA 4ISDA 2FWGA 2VL2C 1A0FA 2DKIA 1F37A 4IW9A 2JZRA 1Z7PA 2X8CA 1PA3A 4G10A 1SJZA 2JZTA 5CRDA 2ON7A 5LCZA 1X9MB 1TRSA 4ML6A 1JZOA 1W4VA 4IJ3A 2CA8A 6GSWA 1G6YA 4F82A 1Q98A 5ECQB 3ZFBA 2CX3A 4MH3A 2YOIA 2MMOA 2YWMA 4G0IA 5DJMA 2N5FA 1GNEA 2DJJA 1YQ1A 5AN1A 1VRSD 4XHMA 2K6VA 5F05A 5JWQB 1M0UA 1NW2A 2PERA 1AAZA 2PN8A 7GSSA 1WPIA 1SENA 1A2MA 4IS0A 4KF9A 4N10A 1XXUA 1OYJA 3E9JB 1T7PB 4MZBA 5DJLA 2B3SA 4QL7A 2DBCA 3P7XA 1QK8A 2P5QA 1WWJA 14GSA 3F0IA 1PRXA 3KM6A 3KTLA 2X99A 4GSTA 5D73A 1IYIA 1WE0A 1XZOA 1GUKA 2I3YA 2P31A 3M9JA 1U88A 1CQGA 5D9VA 5KN1A 1J08A 2JACA 4X1UA 4MLYA 5E59A 3C1SA 4TXOB 5ELGA 2N5BA 3FKFA 4Q5RA 2X8GA 5AISA 2K9FA 4Q5FA 4KB3A 4OO5A 4PUAA 1ZYEA 3VURA 1S3AA 4DSSB 2FWHA 2BTOT 2X49A 4KCEA 2PWJA 2XBIA 2IFQB 5B6NA 2YNXA 3BCKA 2BMXA 4K7OA 4WR4A 4X43A 4Z2RA 3P2AA 3FMWA 3GH9A 3RAZA 5C04A 3ZVJD 4I5QA 2AV4A 3BD2A 3GUSA 1OVNA 2CZ3A 4V2NA 20GSA 1PX7A 2GT6A 2LRTA 5D9XA 1U6TA 3KP9A 5ECKB 2M46A 1FHEA 4MP4A 4ZILA 3GL3A 3GH6A 1FW1A 5IMCA 2B1LA 4HQZA 3ZIVA 5CP1A 3ZRDA 5ECOB 2PMTA 3FEUA 4PNGA 2C3QA 1ZGNA 3FRCA 1K0CA 4ZL8A 1EGRA 2LJAA 2K18A 3W6GA 6GSXA 4XS4A 3QAGA 5CRGA 4TR1B 4BL7B 2DKHA 1E6BA 3I6AA 2L5OA 2HZFA 4HJ2A 4WF5A 5ID2A 1OE8A 2CAQA 2L5LA 3ERGA 3UAPA 1XW9A 22GSA 2GZZA 1M2BA 3J7Yb 5BMUA 17GSA 1BG5A 4POLA 5A4VA 2FA8A 3WD6A 5IQYA 2VOCA 4OCFA 5DALA 2FY6A 3AY8A 1M99A 2HZEA 2RLIA 3CSHA 10GSA 1AQXA 1VF3A 5IIZA 2G0FA 1Y25A 2H1BA 6GSTA 5B8BA 4PTSA 1Y6EA 3IAS2 1MDIA 1B4QA 1PQNA 3MIXA 1S3DA 1KEBA 1O81A 4I2UA 4OFMA 2JSZA 1OC8A 3TOTA 1XG8A 1MDKA 4G0LA 3HCZA 1EV4A 1G7OA 3WGXA 1QMVA 2LEGA 2DJKA 3BBYA 1TK0B 1YEXA 4TN8A 4IQ1A 1PKWA 4YAVA 8GSSA 2RM6A 4KSOA 3F6FA 3TRPA 4K2DA 4GXZA 3L9UA 2A4HA 1ST9A 4LL4B 3V1WA 4MDCA 4OMVA 2H0GA 1XBSA 3QD9A 5CREA 4K7NA 2H6XA 2B7JA 2A2SA 2GSRA 2MMAA 4PQHA 1WJKA 4H86A 1OC3A 2WULA 2JADA 2L4CA 3VK9A 1GH2A 1N2AA 3QFBC 3D4MA 2B6MA 5J5NA 1MD3A 1V40A 3Q19A 3P90A 1XWCA 3IA1A 1ABAA 1DE1A 5IM9A 4TR4A 5KN0A 3G7IA 3KMOA 1K0BA 1F3BA 2VL9A 5D9TA 3WT2A 2VM1A 4L0WA 3JCML 3EE2A 2X64A 4Z2TA 3F63A 1HD2A 2KP1A 3RBTA 4EF0A 3GSSA 3IK7A 5B7CA 3QDNA 1SU9A 1DE2A 1FVJA 1F3AA 1V58A 2DC5A 1EZKA 4JRRA 1YZXA 2VD1A 4D73B 3ISOA 4NPBA 1ILOA 2LTKA 1TOFA 1G0TA 4V1Ap 3U5RE 2M72A 3EVIA 5HR1A 2VCTA 4OCEA 4K0NA 2GQKA 1LBKA 3VWWA 4YKGA 2QKEA 2R2JA 1UN2A 1KBNA 1ZOFA 2L59A 2V6KA 4GQFA 5IMAA 4L0UA 4KH7A 1OKTA 3F3QA 4OWYA 2TIRA 3DXBA 5COHA 2PUKC 4PQ1A 2GSSA 4ZB8A 1JLWA 3FZ5A 1YDKA 1TI1A 2VCXA 3C73A 3HVXA 3LFLA 1PL1A 1XPVA 1XW5A 3VPTA 2DMMA 2R0CA 4JE1A 1X9WB 4EIPA 4IHUA 1RW1A 3ERWA 2VLVA 3TJBA 1ZYNA 3IXRA 3GNJA 2OADA 4IELA 3TJFA 3RHBA 1XCCA 5HFGA 3N9JA 4ILFA 3LXZA 3VLNA 3KCMA 5DBQA 2G2QA 1U3AA 2ZCTA 4J56E 3TOUA 4HU7A 2TRCP 2L57A 4NV5A 1K3OA 2IL3A 4KSMA 4N30A 5DALB 5IPHA 2RM5A 2VO4A 2HZEB 1AIUA 4P3YB 4XIHA 3WT1A 4FO5A 3HY2A 3TGZA 2K8VA 2H1DA 1FO5A 3IRAA 3FYGA 5CRWA 2H66A 3EYTA 3LW9A 1A2JA 2F9SA 4OD7A 5G31A 5G30A 5KOXA 2DSAA 3SWLA 4XS1A 1TW9A 4POBA 3VWUA 3M9KA 4BVYA 6GSSA 1YJ6A 4KDUA 1TKDB 1G6WA 1QXHA 4L8EA 1URMA 3TJJA 3FZAA 3KMNA 2ALBA 1YF1A 3LSZA 5J9BA 1XVQA 4G0KA 1YKCA 2BJXA 1HYUA 4KA0A 2AYTA 1K0MA 2R37A 4KUNA 1TRVA 3L4NA 4IGJA 2I4AA 4K9ZA 1GULA 1TK8B 4O92A 3F4TA 1X5CA 3BCIA 3HVSA 2YANA 3G9BA 1SJIA 4WBJA 1SYRA 4LMVA 3EURA 3FR3A 4YH2A 4ZBAA 1Z5YE 3LEFA 1I9DA 2JU5A 2YV7A 5CAXA 2B5YA 2LRCA 1KNGA 2B5EA 12GSA 2LJKA 2HT9A 2WZ9A 4K8MA 2FLSA 4O32A 3UJ1A 1X5DA 2I9HA 3W8SA 3DKSA 4ML1A 4GSNA 3US3A 2X4AA 6GSVA 1SD9A 2LSTA 1TXXA 4ECCA 2QA1A 3CSJA 3L9VA 4YQMA 13GSA 3ZZXA 4FYBA 2A2RA 4POKA 3MNGA 4MK3A 4TW5A 3F4SA 4LL1B 2H70A 4X0XA 4JU5A 4F0CA 4KX4A 3DRNA 2PPTA 2H71A 1PSQA 2O7KA 4KDXA 3R2QA 2KLXA 1M2DA 2OA7A 3UL3A 4V2MA 3A2WA 1N8JA 4GRFA 3GFKA 1A2LA 2WGRA 4CY8A 1GSQA 3O76A 2GVPA 3VI5A 3PINA 1R4WA 1DBYA 3I43A 2A2PA 2DIZA 4E8EA 2AHEA 5HFKA 1USBA 2DJ0A 2FCHA 1WP0A 2OE0A 3TB2A 1XWKA 3MWHA 1SL1B 4V1Ag 3ZREA 1Z6MA 1ZYQB 2WB9A 4HUAA 4JR6A 2PVQA 5JWOB 2B7KA 1NHYA 3GA4A 3KEBA 2YN1A 2HYXA 3CBUA 5F0GA 4F03A 1M9AA 1VGLA 3TKSA 4GSSA 2NBSA 1YY7A 1BAYA 2CVKA 2XBQA 5ECRB 1GRXA 1BX9A 4MF6A 2KUCA 3P8WA 4MPFA 1T00A 3IC4A 2M80A 2J23A 2LNSA 1BQ7A 4YQUA 4ECJA 5GAND 5ELAA 3PPUA 1XVWA 2HFDA 1T3BA 3DVWA 2X8HA 3Q18A 1E2YA 2DJ2A 3GKKA 5F8BA 2FUG2 5ECNB 4IKHA 2VCZA 3CSIA 4ICYA 5LD0A 4BWQA 5E4WA 1R5PA 1HQOA 1U87A 2IIYA 1PL2A 1VF4A 4AJ8A 3TKPA 5ABRA 2DMLA 4ZXGA 1PD21 4Z2UA 4J2FA 4BVYB 1S3CA 1PX6A 3QAVA 4I97A 4XS6A 5EY6A 3HDCA 4EO3A 3HVVA 4ZB6A 5HR0A 1OC9A 5G1LA 4IN0A 1X9SB 4WBRD 1SKRB 4MH2A 4IQAA 1ACVA 1LU4A 4GCIA 1SL2B 1JZRA 2H1AA 1HNAA 1TU8A 3EWLA 5H5SA 2NTOA 5GSSA 5J41A 2MYGA 18GSA 1DSBA 3UIWA 2L6CA 2AJQB 1GL8A 1ERWA 11GSA 4BWSA 5IOXA 2QGVA 2GSTA 2VCVA 1XWBA 3GTUA 5J3RA 1YKAA 4CY6A 3TRXA 2HSYA 4LMWA 3E3EA 1PN9A 2KHPA 3FR9A 1FB0A 2NDOA 1FVKA 2YWOA 4MMMA 2WDUA 3EC3A 3S9FA 2D2ZA 1B9XC 2H19A 4O7HA 2EIQA 1S3RA 3A5IA 2LNTA 2E2GA 1OKDA 5HFIA 3IHQA 3ERFA 4Z7XA 1SYXA 3APQA 5ECLB 1M9BA 1THXA 2MZCA 5JCUA 4A5PA 3GHAA 4TVEA 5A4UA 1TJDA 2C0FA 5FT3A 3GKNA 2YZHA 4NWYA 4E8HA 2O8VB 19GSA 1B9YC 4O5RA 4PNFA 4MF7A 2MBTA 4EE0A 3PR8A 4GQCA 1R7HA 2H6YA 3M8NA 1XIYA 2XPEA 4YKFA 1T4YA 2NPBA 3GMFA 5B6MA 3GYKA 2B5XA 4XRDA 3WYWA 4TR0A 3KH9A 2JZSA 3TKSC 3HJMA 3RHCA 1U3IA 3MDKA 2MMNA 4K1FA 1NHOA 2CX4A 1VF1A 1WRYA 3SBCA 4HSCX 4K5RA 2H30A 2H74A 2YWIA 3IHGA 3F9UA 4ZL9A 4TRXA 2ON5A 4GTUA 1GUMA 2UZ8A 3A3TA 1Z6NA 2JL4A 1BYEA 4LA1A 4ECIA 2H72A 4IP6A 4NAXA 5GSTA 1SK1A 3DVXA 4MJAA 4O5QA 2IMKA 4PURA 4RQXA 5DVBA 3RPPA 4I6XA 2FWEA 2R5GA 4LLRA 1GTIA 2F8AA 4RUVA 1AXDA 3LGCA 2GLRA 1QFNA 3GRXA 2HNLA 5IOWA 4MABA 1UC7A 1K3YA 4IVFA 2AUVA 3KZQA 2WS2A 2PGTA 2C0EA 3ME8A 5BRTA 2MBSA 2ZUPA 2DJ3A 4USSA 2XC2A 1J9BA 3EMXA 1GSDA 2F3MA 1SJ6A 4XS4B 1UVZA 2YP6A 2R0GA 3GSTA 3IV4A 3LG6A 4MJCA 3FK8A 3MSZA 3HA9A 2O89A 5D8IA 2LRNA 4HI7A 3IR4A 2HRNA 2J9HA 1B4PA 5ID2B 1KTEA 4AJ7A 2K8SA 2OKAA 2AAWA 2F51A 4YQVA 4TXOA 4EL1A 4K2XA 5DAKA 4WKWA 5DQSA 2TRXA 2HXKA 3ZLPA 3ZVJA 1GSSA 4DSSA 3CMIA 4EXJA 5CO3A 2IFQA 1ZMAA 1QGVA 1JFUA 2FNOA 3LJRA 2VCQA 5KOWA 3CTFA 1GSYA 2GZYA 4J57E 4KW6A 1PKZA 1X5EA 3NIVA 2CZ2A 1O7UA 3KJYA 3VPQA 1IYHA 4G2EA 1K0AA 3Q74A 3F4RA 1LJRA 2OE1A 1THOA 2H75A 4DSRA 5ECMB 3PH9A 4KDYA 3CYNA 2F8FA 3FZ9A 2IPAA 4PX1A 3H93A 2O87A 4EUYA 5DQYA 1SK2A 3PGTA 2O85A 1GTUA 4CW9A 1MDJA 4TR1A 4BL7A 4F9ZA 5G2ZA 4ECBA 1M2AA 1JZDA 3UVHA 2YJHA 2HE3A 2FA4A 2C0GA 1TK5B 1T4ZA 1A8YA 3A2VA 5A4WA 1O73A 4PXOA 4I2TA 6GSUA 4KGIA 3LYPA 1GSUA 2HSHA 4KCAA 2VIMA 1SD8A 4FH8A 1T1VA 3C7MA 3KGKA 3HD5A 5ECSA 1R26A 4EIQA 3CRTA 1Q4JA 3C1RA 2VLUA 2LV3A 2GTUA 1M3JA 5DCGA 4IP1A 2YZUA 5KEJA 1CQHA 4AJ6A 1I5GA 3TUEA 3IDVA 4RI7A 1FG4A 4GF0A 3HXSA 3TKQA 1TP9A 5HR3A 1Z7RA 1DUGA 5ECHB 1AUCA 2V2GA 1ZZYA 2CQ9A 2H0HA 5F06A 5DDLA 4NHWA 1TI3A 3IAM2 3GL5A 3EU4A 3GV1A 3HKRA 3DD3A 4EDZA 3ZL5A 3UBKA 3GX0A 3HZ8A 2MMZA 3HJPA 2V41A 2B1KA 3WGDA 1SK0A 1GSEA 5H5QA 3KD0A 3FHKA 4MZWA 4F0BA 3TRQA 1V57A 1ML6A 1R5AA 5IMFA 4ZBDA 3FW2A 1FOHA 2N5AA 5HR2A 3MYDA 2AB6A 3APOA 4G9HA 1PGTA 3I9V2 1UA5A 1GSFA 2V6OA 5G5EA 5L71A 4HZ4A 1H75A 1M7TA 5INYA 3HYPA 1WIKA 4FQUA 2RUEA 2IMFA 3I69A 1O85A 3N5OA 1ZL9A 2I81A 3C8EA 3G7YA 1GTAA 3NZNA 3CRUA 1EWXA 1F6MC 4EC0A 1AC1A 3D0ZA 3GIXA 3TJGA 2EIOA 2DIYA 3H4KA 1GWCA 4ZIJA 2C80A 2R6KA 4OFTA 1K3LA 3IPZA 3UOMA 1B8XA 5EPFA 3HHVA 1ERUA 1FB6A 5KN3A 2LKUA 3U6VA 3QAWA 5DAKB 4ACSA 2C3NA 3W8JA 1AW9A 3UMAA 4WETA 5CNWA 4O5UA 1TRUA 1XOAA 3L0HA 2V1MA 2FD3A 1OE7A 3GX8A 4D73A 3O6TA 2PU9C 4TXVA 2EIRA 4ZBBA 1GUHA 5ECPB 2C4JA 4MF5A 4JR4A 3DIEA 3QOUA 4HZ2A 1ZCPA 4XCSA 2YWNA 2H8LA 1EEJA 4OFNA 4G19A 3UVTA 3ME7A 2H6ZA 1SKWB 4L5OA 3LXTA 3IBHA 5JCWA 2P5RA 2FHEA 5AGYA 3QMXA 2GSQA 1PMTA 5H5RA 3VFIA 4Q5QA 2JSYA 4WEYA 2GT5A 4PUFC 1JLVA 1EV9A 5J4UA 2E7PA 4K0GA 1FAAA 1YEPA 1GLQA 1V9WA 5C00A 5GZZB 3M3MA 4QQ7A 2HI7A 3LORA 2H73A 1WOUA 4CDOA 6GSYA 3J7Yk 2ES7A 4FYUA 4HS1A 4HEA2 4GWRA 2H01A 1EP8A 1NSWA 4JBBA 4DEJA 5JCGA 4ZL7A 2WRTA 3HZ4A 4K5SA 3TJKA 3D21A 2HRFA 1HNBA 5F07A 1ERVA 4IJIA 2GZPA 4WXTA 1EGOA 3RDWA 2KP2A 1AQVA 1EOHA 1V98A 1A23A 3KXOA 4I8BA 3R3EA 3H79A 5ENUA 2R4VA 4N0VA 4HJMA 3BOAA 2CVDA 1XW6A 3F6DA 1SL0B 4FIWA 2V32A 5D96A 5G1KA 4MJEA 1TTZA 3DYRA 2E2MA 4Q5NA 3E0UA 3KP8A 2CV4A 2LQQA 3ZMLA 2H0IA 3NOFA 4NV2A 1A24A 3UEMA 3IC8A 3TDGA 2C1YA 2WFCA 1VF2A 1RK4A 5D93A 1C72A 5ECIB 4BPYA 5A5KA 2QC7A 2IWTA 4HOJA 2FGXA 3VWXA 1K0NA 1G7EA 5HQPA 1OAZA 2KOKA 1QUWA 5DCHA 1PFOA 3L78A 4CHSA 3ED3A 1ERTA 1Z9HA 5AIVA 3TCOA 2RUFA 3ZITA 4N0ZA 2VL3A 3F8UA 4NMUA 2VLTA 4NXIA 4EDYA 3D4TA 3QFAC 4BA7A 1MEKA 3A5WA 2H76A 4RQRA 3L9SA 3M1GA 3OR5A 1WMJA 1XWAA 1TU7A 4DVCA 4ZB9A 3H8QA 3VI7A 1V2AA 5JWRB 2HRKA 3GURA 2GS3A 2QSIA 4BVXA 5IPGA 3A2XA 4HU9A 3UARA 2DJ1A 1QQ2A 1A8LA 2HSMA 2PVOC 1JHBA 1Z3EA 4EKZA 1ON4A 2IJYA 2WCIA 3GKXA 3RPNA 1PN0A 3O3TA 1XFLA 3LYKA 4WR5A 4HDEA 2HRAA 1W89A 3QPMA 2H1GA 4JEDA 5IO2A 3MAKA 2VL2A 1T8EB 3DMLA 5EL8A 2E0QA 5CYYA 2QA2A 3BJ5A 2HLSA 3CTGA 1XWGA 4QL9A 2GQLA 3UBLA 2A4VA 3GN3A 3EU3A 2RIIA 1F2EA 3Q6OA 3DWVA 4MJBA 2C0DA 3IOSA 2IN3A 4HQSA 4N11A 16GSA 1EEMA 3HVNA 3DEXA 3DGQA 2CT6A 5IMDA 1SKSB 3CXGA 3D5JA 4TKYA 2GQMA 4RI6A 3FR6A 1M3IA 2C8UA 2IMDA 1HNCA 2DLXA 1F9MA 1EP7A 4BIKA 3EMPA 4WF4A 4V2LA 5B8AA 1XOBA 1AQWA 2YPMA 1EOGA 2VM2A 1K0DA 4KAEA 1OC9B 2ZNMA 5FWGA 4MCUA 4AF2A 1A0RP 5KN2A 2L4QA 5AIXA 3KTBA 1GP1A 3CQFA 2VUPA 4ID0A 2LS5A 2YJ7A 4L5LA 1RQMA 4FYCA 3KIJA 3QCPA 1BJXA 5J9CA 2GGTA 3FZ4A 4AGSA 3K8NA 4IBPA 2REMA 2LQOA 3ZTLA 5IMZA 4GLTA 4XTSA 1FOVA 5G5FA 4F2IA 1NM3A 3VWVA 4JZQA 4MPGA 2OACA 3GTUB 2C3TA 1O6JA 2IMIA 2CVBA 1JZWA 2WJUA 3GKMA 4ULXA 4POMA 3APSA 2P0GA 2Z9SA 5EVOA 2EC4A 1B48A 4X4JA 2R0PA 4KNDA 2VD0A 2OBKA 3LQ7A 3FY7A 3QR6A 2R3XA 2OJLA 1O8XA 3C71A 3TKRA 5GAPD 4K7IA 5D9WA 3M0FA 3ZIJA 2XHFA
chains in the Genus database with same CATH topology
1GNWA 4K6XA 2OE3A 5IO0A 1O8WA 3F3RA 3EINA 4KE3A 2PBJA 5FHIA 4PQIA 4NHZA 3WGEA 2VCWA 3LWAA 2IMEA 1GLPA 3KH7A 4PGTA 4TR3A 1J0FA 3ZFLA 4EVMA 9GSSA 4MZCA 4MNNA 1MD4A 2YCDA 2I1UA 3EPTA 4DSQA 2LJRA 3H1NA 1MTCA 4TOPA 1TRWA 2YV9A 2OBIA 2FWFA 2VAFA 3HJOA 3TKSE 3ZYWA 4XRAA 2LUSA 4YAPA 2NVLA 3D22A 3ZMKA 4MA9A 2CAIA 1K0OA 2GDRA 3IK9A 2XPDA 5CRHA 1GTBA 3IE3A 5LNKe 1BEDA 3G7JA 3D6IA 5IMVA 1YF0A 1TDIA 1ZYPA 4OO4A 1H4OA 4BVXB 1X0RA 2L6DA 4ISDA 2FWGA 2VL2C 1A0FA 2DKIA 1F37A 4IW9A 2JZRA 1Z7PA 2X8CA 1PA3A 4G10A 1SJZA 2JZTA 5CRDA 2ON7A 5LCZA 1X9MB 1TRSA 4ML6A 1JZOA 1W4VA 4IJ3A 2CA8A 6GSWA 1G6YA 4F82A 1Q98A 5ECQB 3ZFBA 2CX3A 4MH3A 2YOIA 2MMOA 2YWMA 4G0IA 5DJMA 2N5FA 1GNEA 2DJJA 1YQ1A 5AN1A 1VRSD 4XHMA 2K6VA 5F05A 5JWQB 1M0UA 1NW2A 2PERA 1AAZA 2PN8A 7GSSA 1WPIA 1SENA 1A2MA 4IS0A 4KF9A 4N10A 1XXUA 1OYJA 3E9JB 1T7PB 4MZBA 5DJLA 2B3SA 4QL7A 2DBCA 3P7XA 1QK8A 2P5QA 1WWJA 14GSA 3F0IA 1PRXA 3KM6A 3KTLA 2X99A 4GSTA 5D73A 1IYIA 1WE0A 1XZOA 1GUKA 2I3YA 2P31A 3M9JA 1U88A 1CQGA 5D9VA 5KN1A 1J08A 2JACA 4X1UA 4MLYA 5E59A 3C1SA 4TXOB 5ELGA 2N5BA 3FKFA 4Q5RA 2X8GA 5AISA 2K9FA 4Q5FA 4KB3A 4OO5A 4PUAA 1ZYEA 3VURA 1S3AA 4DSSB 2FWHA 2BTOT 2X49A 4KCEA 2PWJA 2XBIA 2IFQB 5B6NA 2YNXA 3BCKA 2BMXA 4K7OA 4WR4A 4X43A 4Z2RA 3P2AA 3FMWA 3GH9A 3RAZA 5C04A 3ZVJD 4I5QA 2AV4A 3BD2A 3GUSA 1OVNA 2CZ3A 4V2NA 20GSA 1PX7A 2GT6A 2LRTA 5D9XA 1U6TA 3KP9A 5ECKB 2M46A 1FHEA 4MP4A 4ZILA 3GL3A 3GH6A 1FW1A 5IMCA 2B1LA 4HQZA 3ZIVA 5CP1A 3ZRDA 5ECOB 2PMTA 3FEUA 4PNGA 2C3QA 1ZGNA 3FRCA 1K0CA 4ZL8A 1EGRA 2LJAA 2K18A 3W6GA 6GSXA 4XS4A 3QAGA 5CRGA 4TR1B 4BL7B 2DKHA 1E6BA 3I6AA 2L5OA 2HZFA 4HJ2A 4WF5A 5ID2A 1OE8A 2CAQA 2L5LA 3ERGA 3UAPA 1XW9A 22GSA 2GZZA 1M2BA 3J7Yb 5BMUA 17GSA 1BG5A 4POLA 5A4VA 2FA8A 3WD6A 5IQYA 2VOCA 4OCFA 5DALA 2FY6A 3AY8A 1M99A 2HZEA 2RLIA 3CSHA 10GSA 1AQXA 1VF3A 5IIZA 2G0FA 1Y25A 2H1BA 6GSTA 5B8BA 4PTSA 1Y6EA 3IAS2 1MDIA 1B4QA 1PQNA 3MIXA 1S3DA 1KEBA 1O81A 4I2UA 4OFMA 2JSZA 1OC8A 3TOTA 1MDKA 4G0LA 3HCZA 1EV4A 1G7OA 3WGXA 1QMVA 2LEGA 2DJKA 3BBYA 1TK0B 1YEXA 4TN8A 4IQ1A 1PKWA 4YAVA 8GSSA 2RM6A 4KSOA 3F6FA 3TRPA 4K2DA 4GXZA 3L9UA 2A4HA 1ST9A 4LL4B 3V1WA 4MDCA 4OMVA 2H0GA 1XBSA 3QD9A 5CREA 4K7NA 2H6XA 2B7JA 2A2SA 2GSRA 2MMAA 4PQHA 1WJKA 4H86A 1OC3A 2WULA 2JADA 2L4CA 3VK9A 1GH2A 1N2AA 3QFBC 3D4MA 2B6MA 5J5NA 1MD3A 1V40A 3Q19A 3P90A 1XWCA 3IA1A 1ABAA 1DE1A 5IM9A 4TR4A 5KN0A 3G7IA 3KMOA 1K0BA 1F3BA 2VL9A 5D9TA 3WT2A 2VM1A 4L0WA 3JCML 3EE2A 2X64A 4Z2TA 3F63A 1HD2A 2KP1A 3RBTA 4EF0A 3GSSA 3IK7A 5B7CA 3QDNA 1SU9A 1DE2A 1FVJA 1F3AA 1V58A 2DC5A 1EZKA 4JRRA 1YZXA 2VD1A 4D73B 3ISOA 4NPBA 1ILOA 2LTKA 1TOFA 1G0TA 4V1Ap 3U5RE 2M72A 3EVIA 5HR1A 2VCTA 4OCEA 4K0NA 2GQKA 1LBKA 3VWWA 4YKGA 2QKEA 2R2JA 1UN2A 1KBNA 1ZOFA 2L59A 2V6KA 4GQFA 5IMAA 4L0UA 4KH7A 1OKTA 3F3QA 4OWYA 2TIRA 3DXBA 5COHA 2PUKC 4PQ1A 2GSSA 4ZB8A 1JLWA 3FZ5A 1YDKA 1TI1A 2VCXA 3C73A 3HVXA 3LFLA 1PL1A 1XPVA 1XW5A 3VPTA 2DMMA 2R0CA 4JE1A 1X9WB 4EIPA 4IHUA 1RW1A 3ERWA 2VLVA 3TJBA 1ZYNA 3IXRA 3GNJA 2OADA 4IELA 3TJFA 3RHBA 1XCCA 5HFGA 3N9JA 4ILFA 3LXZA 3VLNA 3KCMA 5DBQA 2G2QA 1U3AA 2ZCTA 4J56E 3TOUA 4HU7A 2TRCP 2L57A 4NV5A 1K3OA 2IL3A 4KSMA 4N30A 5DALB 5IPHA 2RM5A 2VO4A 2HZEB 1AIUA 4P3YB 4XIHA 3WT1A 4FO5A 3HY2A 3TGZA 2K8VA 2H1DA 1FO5A 3IRAA 3FYGA 5CRWA 2H66A 3EYTA 3LW9A 1A2JA 2F9SA 4OD7A 5G31A 5G30A 5KOXA 2DSAA 3SWLA 4XS1A 1TW9A 4POBA 3VWUA 3M9KA 4BVYA 6GSSA 1YJ6A 4KDUA 1TKDB 1G6WA 1QXHA 4L8EA 1URMA 3TJJA 3FZAA 3KMNA 2ALBA 1YF1A 3LSZA 5J9BA 1XVQA 4G0KA 1YKCA 2BJXA 1HYUA 4KA0A 2AYTA 1K0MA 2R37A 4KUNA 1TRVA 3L4NA 4IGJA 2I4AA 4K9ZA 1GULA 1TK8B 4O92A 3F4TA 1X5CA 3BCIA 3HVSA 2YANA 3G9BA 1SJIA 4WBJA 1SYRA 4LMVA 3EURA 3FR3A 4YH2A 4ZBAA 1Z5YE 3LEFA 1I9DA 2JU5A 2YV7A 5CAXA 2B5YA 2LRCA 1KNGA 2B5EA 12GSA 2LJKA 2HT9A 2WZ9A 4K8MA 2FLSA 4O32A 3UJ1A 1X5DA 2I9HA 3W8SA 3DKSA 4ML1A 4GSNA 3US3A 2X4AA 6GSVA 1SD9A 2LSTA 1TXXA 4ECCA 2QA1A 3CSJA 3L9VA 4YQMA 13GSA 3ZZXA 4FYBA 2A2RA 4POKA 3MNGA 4MK3A 4TW5A 3F4SA 4LL1B 2H70A 4X0XA 4JU5A 4F0CA 4KX4A 3DRNA 2PPTA 2H71A 1PSQA 2O7KA 4KDXA 3R2QA 2KLXA 1M2DA 2OA7A 3UL3A 4V2MA 3A2WA 1N8JA 4GRFA 3GFKA 1A2LA 2WGRA 4CY8A 1GSQA 3O76A 2GVPA 3VI5A 3PINA 1R4WA 1DBYA 3I43A 2A2PA 2DIZA 4E8EA 2AHEA 5HFKA 1USBA 2DJ0A 2FCHA 1WP0A 2OE0A 3TB2A 1XWKA 3MWHA 1SL1B 4V1Ag 3ZREA 1Z6MA 1ZYQB 2WB9A 4HUAA 4JR6A 2PVQA 5JWOB 2B7KA 1NHYA 3GA4A 3KEBA 2YN1A 2HYXA 3CBUA 5F0GA 4F03A 1M9AA 1VGLA 3TKSA 4GSSA 2NBSA 1YY7A 1BAYA 2CVKA 2XBQA 5ECRB 1GRXA 1BX9A 4MF6A 2KUCA 3P8WA 4MPFA 1T00A 3IC4A 2M80A 2J23A 2LNSA 1BQ7A 4YQUA 4ECJA 5GAND 5ELAA 3PPUA 1XVWA 2HFDA 1T3BA 3DVWA 2X8HA 3Q18A 1E2YA 2DJ2A 3GKKA 5F8BA 2FUG2 5ECNB 4IKHA 2VCZA 3CSIA 4ICYA 5LD0A 4BWQA 5E4WA 1R5PA 1HQOA 1U87A 2IIYA 1PL2A 1VF4A 4AJ8A 3TKPA 5ABRA 2DMLA 4ZXGA 1PD21 4Z2UA 4J2FA 4BVYB 1S3CA 1PX6A 3QAVA 4I97A 4XS6A 5EY6A 3HDCA 4EO3A 3HVVA 4ZB6A 5HR0A 1OC9A 5G1LA 4IN0A 1X9SB 4WBRD 1SKRB 4MH2A 4IQAA 1ACVA 1LU4A 4GCIA 1SL2B 1JZRA 2H1AA 1HNAA 1TU8A 3EWLA 5H5SA 2NTOA 5GSSA 5J41A 2MYGA 18GSA 1DSBA 3UIWA 2L6CA 2AJQB 1GL8A 1ERWA 11GSA 4BWSA 5IOXA 2QGVA 2GSTA 2VCVA 1XWBA 3GTUA 5J3RA 1YKAA 4CY6A 3TRXA 2HSYA 4LMWA 3E3EA 1PN9A 2KHPA 3FR9A 1FB0A 2NDOA 1FVKA 2YWOA 4MMMA 2WDUA 3EC3A 3S9FA 2D2ZA 1B9XC 2H19A 4O7HA 2EIQA 3A5IA 2LNTA 2E2GA 1OKDA 5HFIA 3IHQA 3ERFA 4Z7XA 1SYXA 3APQA 5ECLB 1M9BA 1THXA 2MZCA 5JCUA 4A5PA 3GHAA 4TVEA 5A4UA 1TJDA 2C0FA 5FT3A 3GKNA 2YZHA 4NWYA 4E8HA 2O8VB 19GSA 1B9YC 4O5RA 4PNFA 4MF7A 2MBTA 4EE0A 3PR8A 4GQCA 1R7HA 2H6YA 3M8NA 1XIYA 2XPEA 4YKFA 1T4YA 2NPBA 3GMFA 5B6MA 3GYKA 2B5XA 4XRDA 3WYWA 4TR0A 3KH9A 2JZSA 3TKSC 3HJMA 3RHCA 1U3IA 3MDKA 2MMNA 4K1FA 1NHOA 2CX4A 1VF1A 1WRYA 3SBCA 4K5RA 2H30A 2H74A 2YWIA 3IHGA 3F9UA 4ZL9A 4TRXA 2ON5A 4GTUA 1GUMA 2UZ8A 3A3TA 1Z6NA 2JL4A 1BYEA 4LA1A 4ECIA 2H72A 4IP6A 4NAXA 5GSTA 1SK1A 3DVXA 4MJAA 4O5QA 2IMKA 4PURA 4RQXA 5DVBA 3RPPA 4I6XA 2FWEA 2R5GA 4LLRA 1GTIA 2F8AA 4RUVA 1AXDA 3LGCA 2GLRA 1QFNA 3GRXA 2HNLA 5IOWA 4MABA 1UC7A 1K3YA 4IVFA 2AUVA 3KZQA 2WS2A 2PGTA 2C0EA 3ME8A 5BRTA 2MBSA 2ZUPA 2DJ3A 4USSA 2XC2A 1J9BA 3EMXA 1GSDA 2F3MA 1SJ6A 4XS4B 1UVZA 2YP6A 2R0GA 3GSTA 3IV4A 3LG6A 4MJCA 3FK8A 3MSZA 3HA9A 2O89A 5D8IA 2LRNA 4HI7A 3IR4A 2HRNA 2J9HA 1B4PA 5ID2B 1KTEA 4AJ7A 2K8SA 2OKAA 2AAWA 2F51A 4YQVA 4TXOA 4EL1A 4K2XA 5DAKA 4WKWA 5DQSA 2TRXA 2HXKA 3ZLPA 3ZVJA 1GSSA 4DSSA 3CMIA 4EXJA 5CO3A 2IFQA 1ZMAA 1QGVA 1JFUA 2FNOA 3LJRA 2VCQA 5KOWA 3CTFA 1GSYA 2GZYA 4J57E 4KW6A 1PKZA 1X5EA 3NIVA 2CZ2A 1O7UA 3KJYA 3VPQA 1IYHA 4G2EA 1K0AA 3Q74A 3F4RA 1LJRA 2OE1A 1THOA 2H75A 4DSRA 5ECMB 3PH9A 4KDYA 3CYNA 2F8FA 3FZ9A 2IPAA 4PX1A 3H93A 2O87A 4EUYA 5DQYA 1SK2A 3PGTA 2O85A 1GTUA 4CW9A 1MDJA 4TR1A 4BL7A 4F9ZA 5G2ZA 4ECBA 1M2AA 1JZDA 3UVHA 2YJHA 2HE3A 2FA4A 2C0GA 1TK5B 1T4ZA 1A8YA 3A2VA 5A4WA 1O73A 4PXOA 4I2TA 6GSUA 4KGIA 3LYPA 1GSUA 2HSHA 4KCAA 2VIMA 1SD8A 4FH8A 1T1VA 3C7MA 3KGKA 3HD5A 5ECSA 1R26A 4EIQA 3CRTA 1Q4JA 3C1RA 2VLUA 2LV3A 2GTUA 5DCGA 4IP1A 2YZUA 5KEJA 1CQHA 4AJ6A 1I5GA 3TUEA 3IDVA 4RI7A 1FG4A 4GF0A 3HXSA 3TKQA 1TP9A 5HR3A 1Z7RA 1DUGA 5ECHB 1AUCA 2V2GA 1ZZYA 2CQ9A 2H0HA 5F06A 5DDLA 4NHWA 1TI3A 3IAM2 3GL5A 3EU4A 3GV1A 3HKRA 3DD3A 4EDZA 3ZL5A 3UBKA 3GX0A 3HZ8A 2MMZA 3HJPA 2V41A 2B1KA 3WGDA 1SK0A 1GSEA 5H5QA 3KD0A 3FHKA 4MZWA 4F0BA 3TRQA 1V57A 1ML6A 1R5AA 5IMFA 4ZBDA 3FW2A 1FOHA 2N5AA 5HR2A 3MYDA 2AB6A 3APOA 4G9HA 1PGTA 3I9V2 1UA5A 1GSFA 2V6OA 5G5EA 5L71A 4HZ4A 1H75A 1M7TA 5INYA 3HYPA 1WIKA 4FQUA 2RUEA 2IMFA 3I69A 1O85A 3N5OA 1ZL9A 2I81A 3C8EA 3G7YA 1GTAA 3NZNA 3CRUA 1EWXA 1F6MC 4EC0A 1AC1A 3D0ZA 3GIXA 3TJGA 2EIOA 2DIYA 3H4KA 1GWCA 4ZIJA 2C80A 2R6KA 4OFTA 1K3LA 3IPZA 3UOMA 1B8XA 5EPFA 3HHVA 1ERUA 1FB6A 5KN3A 2LKUA 3U6VA 3QAWA 5DAKB 4ACSA 2C3NA 3W8JA 1AW9A 3UMAA 4WETA 5CNWA 4O5UA 1TRUA 1XOAA 3L0HA 2V1MA 2FD3A 1OE7A 3GX8A 4D73A 3O6TA 2PU9C 4TXVA 2EIRA 4ZBBA 1GUHA 5ECPB 2C4JA 4MF5A 4JR4A 3DIEA 3QOUA 4HZ2A 1ZCPA 4XCSA 2YWNA 2H8LA 1EEJA 4OFNA 4G19A 3UVTA 3ME7A 2H6ZA 1SKWB 4L5OA 3LXTA 3IBHA 5JCWA 2P5RA 2FHEA 5AGYA 3QMXA 2GSQA 1PMTA 5H5RA 3VFIA 4Q5QA 2JSYA 4WEYA 2GT5A 4PUFC 1JLVA 1EV9A 5J4UA 2E7PA 4K0GA 1FAAA 1YEPA 1GLQA 1V9WA 5C00A 5GZZB 3M3MA 4QQ7A 2HI7A 3LORA 2H73A 1WOUA 4CDOA 6GSYA 3J7Yk 2ES7A 4FYUA 4HS1A 4HEA2 4GWRA 2H01A 1EP8A 1NSWA 4JBBA 4DEJA 5JCGA 4ZL7A 2WRTA 3HZ4A 4K5SA 3TJKA 3D21A 2HRFA 1HNBA 5F07A 1ERVA 4IJIA 2GZPA 4WXTA 1EGOA 3RDWA 2KP2A 1AQVA 1EOHA 1V98A 1A23A 3KXOA 4I8BA 3R3EA 3H79A 5ENUA 2R4VA 4N0VA 4HJMA 3BOAA 2CVDA 1XW6A 3F6DA 1SL0B 4FIWA 2V32A 5D96A 5G1KA 4MJEA 1TTZA 3DYRA 2E2MA 4Q5NA 3E0UA 3KP8A 2CV4A 2LQQA 3ZMLA 2H0IA 3NOFA 4NV2A 1A24A 3UEMA 3IC8A 3TDGA 2C1YA 2WFCA 1VF2A 1RK4A 5D93A 1C72A 5ECIB 4BPYA 5A5KA 2QC7A 2IWTA 4HOJA 2FGXA 3VWXA 1K0NA 1G7EA 5HQPA 1OAZA 2KOKA 1QUWA 5DCHA 3L78A 4CHSA 3ED3A 1ERTA 1Z9HA 5AIVA 3TCOA 2RUFA 3ZITA 4N0ZA 2VL3A 3F8UA 4NMUA 2VLTA 4NXIA 4EDYA 3D4TA 3QFAC 4BA7A 1MEKA 3A5WA 2H76A 4RQRA 3L9SA 3M1GA 3OR5A 1WMJA 1XWAA 1TU7A 4DVCA 4ZB9A 3H8QA 3VI7A 1V2AA 5JWRB 2HRKA 3GURA 2GS3A 2QSIA 4BVXA 5IPGA 3A2XA 4HU9A 3UARA 2DJ1A 1QQ2A 1A8LA 2HSMA 2PVOC 1JHBA 1Z3EA 4EKZA 1ON4A 2IJYA 2WCIA 3GKXA 3RPNA 1PN0A 3O3TA 1XFLA 3LYKA 4WR5A 4HDEA 2HRAA 1W89A 3QPMA 2H1GA 4JEDA 5IO2A 3MAKA 2VL2A 1T8EB 3DMLA 5EL8A 2E0QA 5CYYA 2QA2A 3BJ5A 2HLSA 3CTGA 1XWGA 4QL9A 2GQLA 3UBLA 2A4VA 3GN3A 3EU3A 2RIIA 1F2EA 3Q6OA 3DWVA 4MJBA 2C0DA 3IOSA 2IN3A 4HQSA 4N11A 16GSA 1EEMA 3DEXA 3DGQA 2CT6A 5IMDA 1SKSB 3CXGA 3D5JA 4TKYA 2GQMA 4RI6A 3FR6A 2C8UA 2IMDA 1HNCA 2DLXA 1F9MA 1EP7A 3EMPA 4WF4A 4V2LA 5B8AA 1XOBA 1AQWA 2YPMA 1EOGA 2VM2A 1K0DA 4KAEA 1OC9B 2ZNMA 5FWGA 4MCUA 4AF2A 1A0RP 5KN2A 2L4QA 5AIXA 3KTBA 1GP1A 2VUPA 4ID0A 2LS5A 2YJ7A 4L5LA 1RQMA 4FYCA 3KIJA 3QCPA 1BJXA 5J9CA 2GGTA 3FZ4A 4AGSA 3K8NA 4IBPA 2REMA 2LQOA 3ZTLA 5IMZA 4GLTA 4XTSA 1FOVA 5G5FA 4F2IA 1NM3A 3VWVA 4JZQA 4MPGA 2OACA 3GTUB 2C3TA 1O6JA 2IMIA 2CVBA 1JZWA 2WJUA 3GKMA 4ULXA 4POMA 3APSA 2P0GA 2Z9SA 5EVOA 2EC4A 1B48A 4X4JA 2R0PA 4KNDA 2VD0A 2OBKA 3LQ7A 3FY7A 3QR6A 2R3XA 2OJLA 1O8XA 3C71A 3TKRA 5GAPD 4K7IA 5D9WA 3M0FA 3ZIJA 2XHFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GNW A;  4K6X A;  2OE3 A;  5IO0 A;  1O8W A;  3F3R A;  3EIN A;  4KE3 A;  2PBJ A;  5FHI A;  4PQI A;  4NHZ A;  3WGE A;  2VCW A;  3LWA A;  2IME A;  1GLP A;  3KH7 A;  4PGT A;  4TR3 A;  1J0F A;  3ZFL A;  4EVM A;  9GSS A;  4MZC A;  1MD4 A;  2YCD A;  2I1U A;  4DSQ A;  2LJR A;  3H1N A;  1MTC A;  4TOP A;  1TRW A;  2YV9 A;  2OBI A;  2FWF A;  2VAF A;  3HJO A;  3TKS E;  3ZYW A;  4XRA A;  2LUS A;  4YAP A;  2NVL A;  3D22 A;  3ZMK A;  4MA9 A;  2CAI A;  1K0O A;  2GDR A;  3IK9 A;  2XPD A;  5CRH A;  1GTB A;  3IE3 A;  5LNK e;  1BED A;  3G7J A;  3D6I A;  5IMV A;  1YF0 A;  1TDI A;  4OO4 A;  1H4O A;  1X0R A;  2L6D A;  4ISD A;  2FWG A;  2VL2 C;  1A0F A;  1F37 A;  4IW9 A;  2JZR A;  1Z7P A;  2X8C A;  1PA3 A;  4G10 A;  1SJZ A;  2JZT A;  5CRD A;  2ON7 A;  5LCZ A;  1X9M B;  1TRS A;  4ML6 A;  1JZO A;  1W4V A;  4IJ3 A;  2CA8 A;  6GSW A;  1G6Y A;  4F82 A;  1Q98 A;  5ECQ B;  3ZFB A;  2CX3 A;  4MH3 A;  2YOI A;  2MMO A;  2YWM A;  5DJM A;  2N5F A;  1GNE A;  2DJJ A;  1YQ1 A;  5AN1 A;  1VRS D;  4XHM A;  2K6V A;  5F05 A;  5JWQ B;  1M0U A;  1NW2 A;  2PER A;  1AAZ A;  2PN8 A;  7GSS A;  1WPI A;  1SEN A;  1A2M A;  4IS0 A;  4N10 A;  1XXU A;  1OYJ A;  3E9J B;  1T7P B;  4MZB A;  5DJL A;  2B3S A;  4QL7 A;  2DBC A;  3P7X A;  1QK8 A;  2P5Q A;  1WWJ A;  14GS A;  3F0I A;  1PRX A;  3KM6 A;  3KTL A;  2X99 A;  4GST A;  5D73 A;  1IYI A;  1WE0 A;  1XZO A;  1GUK A;  2I3Y A;  2P31 A;  3M9J A;  1U88 A;  1CQG A;  5D9V A;  5KN1 A;  1J08 A;  2JAC A;  4X1U A;  4MLY A;  5E59 A;  3C1S A;  4TXO B;  5ELG A;  2N5B A;  3FKF A;  4Q5R A;  2X8G A;  5AIS A;  2K9F A;  4Q5F A;  4KB3 A;  4OO5 A;  4PUA A;  1ZYE A;  3VUR A;  1S3A A;  4DSS B;  2FWH A;  2BTO T;  4KCE A;  2PWJ A;  2XBI A;  2IFQ B;  5B6N A;  2YNX A;  3BCK A;  2BMX A;  4K7O A;  4WR4 A;  4X43 A;  3P2A A;  3GH9 A;  3RAZ A;  5C04 A;  3ZVJ D;  4I5Q A;  2AV4 A;  3BD2 A;  3GUS A;  1OVN A;  2CZ3 A;  4V2N A;  20GS A;  1PX7 A;  2GT6 A;  2LRT A;  5D9X A;  1U6T A;  3KP9 A;  5ECK B;  2M46 A;  1FHE A;  4MP4 A;  4ZIL A;  3GL3 A;  3GH6 A;  1FW1 A;  5IMC A;  2B1L A;  4HQZ A;  3ZIV A;  5CP1 A;  3ZRD A;  5ECO B;  2PMT A;  3FEU A;  4PNG A;  2C3Q A;  1ZGN A;  3FRC A;  1K0C A;  4ZL8 A;  1EGR A;  2LJA A;  2K18 A;  3W6G A;  6GSX A;  4XS4 A;  3QAG A;  5CRG A;  4TR1 B;  1E6B A;  3I6A A;  2L5O A;  2HZF A;  4HJ2 A;  4WF5 A;  5ID2 A;  1OE8 A;  2CAQ A;  2L5L A;  3ERG A;  3UAP A;  1XW9 A;  22GS A;  2GZZ A;  1M2B A;  3J7Y b;  17GS A;  1BG5 A;  4POL A;  5A4V A;  2FA8 A;  3WD6 A;  5IQY A;  2VOC A;  4OCF A;  5DAL A;  2FY6 A;  3AY8 A;  1M99 A;  2HZE A;  2RLI A;  3CSH A;  10GS A;  1AQX A;  1VF3 A;  5IIZ A;  2G0F A;  1Y25 A;  2H1B A;  6GST A;  5B8B A;  1Y6E A;  3IAS 2;  1MDI A;  1B4Q A;  1PQN A;  1S3D A;  1KEB A;  1O81 A;  4I2U A;  4OFM A;  2JSZ A;  1OC8 A;  3TOT A;  1MDK A;  3HCZ A;  1EV4 A;  1G7O A;  3WGX A;  1QMV A;  2LEG A;  2DJK A;  3BBY A;  1TK0 B;  1YEX A;  4TN8 A;  4IQ1 A;  1PKW A;  4YAV A;  8GSS A;  2RM6 A;  4KSO A;  3F6F A;  3TRP A;  4K2D A;  4GXZ A;  3L9U A;  1ST9 A;  4LL4 B;  3V1W A;  4MDC A;  4OMV A;  2H0G A;  1XBS A;  3QD9 A;  5CRE A;  4K7N A;  2H6X A;  2B7J A;  2A2S A;  2GSR A;  2MMA A;  4PQH A;  1WJK A;  4H86 A;  1OC3 A;  2WUL A;  2JAD A;  2L4C A;  3VK9 A;  1GH2 A;  1N2A A;  3QFB C;  3D4M A;  2B6M A;  5J5N A;  1MD3 A;  1V40 A;  3Q19 A;  3P90 A;  1XWC A;  3IA1 A;  1ABA A;  1DE1 A;  5IM9 A;  4TR4 A;  5KN0 A;  3G7I A;  3KMO A;  1K0B A;  1F3B A;  2VL9 A;  5D9T A;  3WT2 A;  2VM1 A;  4L0W A;  3JCM L;  3EE2 A;  2X64 A;  3F63 A;  1HD2 A;  2KP1 A;  3RBT A;  4EF0 A;  3GSS A;  3IK7 A;  5B7C A;  3QDN A;  1SU9 A;  1DE2 A;  1FVJ A;  1F3A A;  1V58 A;  2DC5 A;  1EZK A;  4JRR A;  1YZX A;  2VD1 A;  4D73 B;  3ISO A;  4NPB A;  1ILO A;  2LTK A;  1TOF A;  1G0T A;  4V1A p;  3U5R E;  2M72 A;  3EVI A;  5HR1 A;  2VCT A;  4OCE A;  4K0N A;  2GQK A;  1LBK A;  3VWW A;  2QKE A;  2R2J A;  1UN2 A;  1KBN A;  1ZOF A;  2L59 A;  2V6K A;  4GQF A;  5IMA A;  4L0U A;  4KH7 A;  1OKT A;  3F3Q A;  4OWY A;  2TIR A;  3DXB A;  5COH A;  2PUK C;  4PQ1 A;  2GSS A;  4ZB8 A;  1JLW A;  3FZ5 A;  1YDK A;  1TI1 A;  2VCX A;  3C73 A;  3HVX A;  3LFL A;  1PL1 A;  1XPV A;  1XW5 A;  3VPT A;  2DMM A;  4JE1 A;  1X9W B;  4IHU A;  1RW1 A;  3ERW A;  2VLV A;  3TJB A;  3IXR A;  3GNJ A;  2OAD A;  4IEL A;  3TJF A;  3RHB A;  1XCC A;  5HFG A;  3N9J A;  4ILF A;  3LXZ A;  3VLN A;  3KCM A;  5DBQ A;  2G2Q A;  1U3A A;  2ZCT A;  4J56 E;  3TOU A;  4HU7 A;  2TRC P;  2L57 A;  4NV5 A;  1K3O A;  2IL3 A;  4KSM A;  4N30 A;  5DAL B;  5IPH A;  2RM5 A;  2VO4 A;  2HZE B;  1AIU A;  4P3Y B;  4XIH A;  3WT1 A;  4FO5 A;  3HY2 A;  3TGZ A;  2K8V A;  2H1D A;  1FO5 A;  3IRA A;  3FYG A;  5CRW A;  2H66 A;  3EYT A;  1A2J A;  2F9S A;  4OD7 A;  5G31 A;  5G30 A;  2DSA A;  3SWL A;  4XS1 A;  1TW9 A;  4POB A;  3VWU A;  3M9K A;  4BVY A;  6GSS A;  1YJ6 A;  4KDU A;  1TKD B;  1G6W A;  1QXH A;  4L8E A;  1URM A;  3TJJ A;  3FZA A;  3KMN A;  2ALB A;  1YF1 A;  3LSZ A;  5J9B A;  1XVQ A;  1YKC A;  2BJX A;  1HYU A;  4KA0 A;  2AYT A;  1K0M A;  2R37 A;  4KUN A;  1TRV A;  3L4N A;  4IGJ A;  2I4A A;  4K9Z A;  1GUL A;  1TK8 B;  4O92 A;  3F4T A;  1X5C A;  3BCI A;  3HVS A;  2YAN A;  3G9B A;  1SJI A;  4WBJ A;  1SYR A;  4LMV A;  3EUR A;  3FR3 A;  4YH2 A;  4ZBA A;  1Z5Y E;  3LEF A;  1I9D A;  2JU5 A;  2YV7 A;  5CAX A;  2B5Y A;  2LRC A;  1KNG A;  2B5E A;  12GS A;  2LJK A;  2HT9 A;  2WZ9 A;  4K8M A;  2FLS A;  4O32 A;  3UJ1 A;  1X5D A;  2I9H A;  3W8S A;  3DKS A;  4ML1 A;  4GSN A;  3US3 A;  6GSV A;  1SD9 A;  2LST A;  1TXX A;  4ECC A;  3CSJ A;  3L9V A;  4YQM A;  13GS A;  3ZZX A;  4FYB A;  2A2R A;  4POK A;  3MNG A;  4MK3 A;  4TW5 A;  3F4S A;  4LL1 B;  2H70 A;  4X0X A;  4JU5 A;  4F0C A;  4KX4 A;  3DRN A;  2PPT A;  2H71 A;  1PSQ A;  2O7K A;  4KDX A;  3R2Q A;  2KLX A;  1M2D A;  2OA7 A;  3UL3 A;  4V2M A;  3A2W A;  1N8J A;  4GRF A;  3GFK A;  1A2L A;  2WGR A;  1GSQ A;  3O76 A;  2GVP A;  3VI5 A;  3PIN A;  1R4W A;  1DBY A;  3I43 A;  2DIZ A;  4E8E A;  2AHE A;  5HFK A;  1USB A;  2DJ0 A;  2FCH A;  1WP0 A;  2OE0 A;  3TB2 A;  1XWK A;  3MWH A;  1SL1 B;  4V1A g;  3ZRE A;  1Z6M A;  1ZYQ B;  2WB9 A;  4HUA A;  4JR6 A;  2PVQ A;  5JWO B;  2B7K A;  1NHY A;  3GA4 A;  3KEB A;  2YN1 A;  2HYX A;  3CBU A;  5F0G A;  4F03 A;  1M9A A;  1VGL A;  3TKS A;  4GSS A;  2NBS A;  1YY7 A;  1BAY A;  2CVK A;  2XBQ A;  5ECR B;  1GRX A;  1BX9 A;  4MF6 A;  2KUC A;  3P8W A;  4MPF A;  1T00 A;  3IC4 A;  2M80 A;  2J23 A;  2LNS A;  1BQ7 A;  4YQU A;  4ECJ A;  5GAN D;  5ELA A;  1XVW A;  2HFD A;  1T3B A;  3DVW A;  2X8H A;  3Q18 A;  1E2Y A;  2DJ2 A;  3GKK A;  5F8B A;  2FUG 2;  5ECN B;  4IKH A;  2VCZ A;  3CSI A;  5LD0 A;  4BWQ A;  5E4W A;  1R5P A;  1HQO A;  1U87 A;  2IIY A;  1PL2 A;  1VF4 A;  4AJ8 A;  3TKP A;  5ABR A;  2DML A;  4ZXG A;  1PD2 1;  4J2F A;  1S3C A;  1PX6 A;  3QAV A;  4I97 A;  4XS6 A;  5EY6 A;  3HDC A;  4EO3 A;  3HVV A;  4ZB6 A;  5HR0 A;  1OC9 A;  5G1L A;  4IN0 A;  1X9S B;  4WBR D;  1SKR B;  4MH2 A;  4IQA A;  1ACV A;  1LU4 A;  4GCI A;  1SL2 B;  1JZR A;  2H1A A;  1HNA A;  1TU8 A;  3EWL A;  5H5S A;  2NTO A;  5GSS A;  5J41 A;  2MYG A;  18GS A;  1DSB A;  3UIW A;  2L6C A;  2AJQ B;  1GL8 A;  1ERW A;  11GS A;  4BWS A;  5IOX A;  2QGV A;  2GST A;  2VCV A;  1XWB A;  3GTU A;  5J3R A;  1YKA A;  3TRX A;  2HSY A;  4LMW A;  3E3E A;  1PN9 A;  2KHP A;  3FR9 A;  1FB0 A;  2NDO A;  1FVK A;  2YWO A;  4MMM A;  2WDU A;  3EC3 A;  3S9F A;  2D2Z A;  1B9X C;  2H19 A;  4O7H A;  2EIQ A;  2LNT A;  2E2G A;  1OKD A;  5HFI A;  3IHQ A;  3ERF A;  4Z7X A;  1SYX A;  3APQ A;  5ECL B;  1M9B A;  1THX A;  2MZC A;  5JCU A;  3GHA A;  4TVE A;  5A4U A;  1TJD A;  2C0F A;  5FT3 A;  3GKN A;  2YZH A;  4NWY A;  4E8H A;  2O8V B;  19GS A;  1B9Y C;  4O5R A;  4PNF A;  4MF7 A;  2MBT A;  4EE0 A;  3PR8 A;  4GQC A;  1R7H A;  2H6Y A;  3M8N A;  1XIY A;  2XPE A;  1T4Y A;  2NPB A;  3GMF A;  5B6M A;  3GYK A;  2B5X A;  4XRD A;  3WYW A;  4TR0 A;  3KH9 A;  2JZS A;  3TKS C;  3HJM A;  3RHC A;  1U3I A;  3MDK A;  2MMN A;  4K1F A;  1NHO A;  2CX4 A;  1VF1 A;  1WRY A;  3SBC A;  2H30 A;  2H74 A;  2YWI A;  3F9U A;  4ZL9 A;  4TRX A;  2ON5 A;  4GTU A;  1GUM A;  3A3T A;  1Z6N A;  2JL4 A;  1BYE A;  4LA1 A;  4ECI A;  2H72 A;  4IP6 A;  4NAX A;  5GST A;  1SK1 A;  3DVX A;  4MJA A;  2IMK A;  4PUR A;  5DVB A;  4RQX A;  3RPP A;  4I6X A;  2FWE A;  2R5G A;  4LLR A;  1GTI A;  2F8A A;  4RUV A;  1AXD A;  3LGC A;  2GLR A;  1QFN A;  3GRX A;  2HNL A;  5IOW A;  4MAB A;  1UC7 A;  1K3Y A;  4IVF A;  2AUV A;  3KZQ A;  2WS2 A;  2PGT A;  2C0E A;  3ME8 A;  2MBS A;  2ZUP A;  2DJ3 A;  2XC2 A;  1J9B A;  3EMX A;  1GSD A;  2F3M A;  1SJ6 A;  4XS4 B;  1UVZ A;  2YP6 A;  3GST A;  3IV4 A;  3LG6 A;  4MJC A;  3FK8 A;  3MSZ A;  3HA9 A;  2O89 A;  5D8I A;  2LRN A;  4HI7 A;  3IR4 A;  2HRN A;  2J9H A;  1B4P A;  5ID2 B;  1KTE A;  4AJ7 A;  2K8S A;  2OKA A;  2AAW A;  2F51 A;  4YQV A;  4TXO A;  4EL1 A;  5DAK A;  4WKW A;  5DQS A;  2TRX A;  2HXK A;  3ZLP A;  3ZVJ A;  1GSS A;  4DSS A;  3CMI A;  4EXJ A;  5CO3 A;  2IFQ A;  1ZMA A;  1QGV A;  1JFU A;  2FNO A;  3LJR A;  2VCQ A;  3CTF A;  1GSY A;  2GZY A;  4J57 E;  4KW6 A;  1PKZ A;  1X5E A;  3NIV A;  2CZ2 A;  1O7U A;  3KJY A;  3VPQ A;  1IYH A;  4G2E A;  1K0A A;  3Q74 A;  3F4R A;  1LJR A;  2OE1 A;  1THO A;  2H75 A;  4DSR A;  5ECM B;  3PH9 A;  4KDY A;  3CYN A;  2F8F A;  3FZ9 A;  2IPA A;  4PX1 A;  3H93 A;  2O87 A;  4EUY A;  5DQY A;  1SK2 A;  3PGT A;  2O85 A;  1GTU A;  4CW9 A;  1MDJ A;  4TR1 A;  4BL7 A;  4F9Z A;  5G2Z A;  4ECB A;  1M2A A;  1JZD A;  3UVH A;  2YJH A;  2HE3 A;  2FA4 A;  2C0G A;  1TK5 B;  1T4Z A;  1A8Y A;  3A2V A;  5A4W A;  1O73 A;  4PXO A;  4I2T A;  6GSU A;  4KGI A;  3LYP A;  1GSU A;  2HSH A;  4KCA A;  2VIM A;  1SD8 A;  4FH8 A;  1T1V A;  3C7M A;  3KGK A;  3HD5 A;  5ECS A;  1R26 A;  3CRT A;  1Q4J A;  3C1R A;  2VLU A;  2LV3 A;  2GTU A;  5DCG A;  4IP1 A;  2YZU A;  5KEJ A;  1CQH A;  4AJ6 A;  1I5G A;  3TUE A;  3IDV A;  4RI7 A;  1FG4 A;  4GF0 A;  3HXS A;  3TKQ A;  1TP9 A;  5HR3 A;  1Z7R A;  1DUG A;  5ECH B;  1AUC A;  2V2G A;  1ZZY A;  2CQ9 A;  2H0H A;  5F06 A;  5DDL A;  4NHW A;  1TI3 A;  3IAM 2;  3GL5 A;  3EU4 A;  3GV1 A;  3HKR A;  3DD3 A;  4EDZ A;  3ZL5 A;  3UBK A;  3GX0 A;  3HZ8 A;  2MMZ A;  3HJP A;  2V41 A;  2B1K A;  3WGD A;  1SK0 A;  1GSE A;  5H5Q A;  3KD0 A;  3FHK A;  4MZW A;  4F0B A;  3TRQ A;  1V57 A;  1ML6 A;  1R5A A;  5IMF A;  4ZBD A;  3FW2 A;  2N5A A;  5HR2 A;  2AB6 A;  3APO A;  4G9H A;  1PGT A;  3I9V 2;  1UA5 A;  1GSF A;  2V6O A;  5G5E A;  5L71 A;  4HZ4 A;  1H75 A;  1M7T A;  5INY A;  3HYP A;  1WIK A;  2RUE A;  2IMF A;  3I69 A;  1O85 A;  3N5O A;  1ZL9 A;  2I81 A;  3C8E A;  3G7Y A;  1GTA A;  3NZN A;  3CRU A;  1EWX A;  1F6M C;  4EC0 A;  1AC1 A;  3D0Z A;  3GIX A;  3TJG A;  2EIO A;  2DIY A;  3H4K A;  1GWC A;  4ZIJ A;  2C80 A;  2R6K A;  4OFT A;  1K3L A;  3IPZ A;  3UOM A;  1B8X A;  5EPF A;  3HHV A;  1ERU A;  1FB6 A;  5KN3 A;  2LKU A;  3U6V A;  3QAW A;  5DAK B;  4ACS A;  2C3N A;  3W8J A;  1AW9 A;  3UMA A;  4WET A;  5CNW A;  1TRU A;  1XOA A;  3L0H A;  2V1M A;  2FD3 A;  1OE7 A;  3GX8 A;  4D73 A;  3O6T A;  2PU9 C;  4TXV A;  2EIR A;  4ZBB A;  1GUH A;  5ECP B;  2C4J A;  4MF5 A;  4JR4 A;  3DIE A;  3QOU A;  4HZ2 A;  1ZCP A;  4XCS A;  2YWN A;  2H8L A;  1EEJ A;  4OFN A;  4G19 A;  3UVT A;  3ME7 A;  2H6Z A;  1SKW B;  4L5O A;  3LXT A;  3IBH A;  5JCW A;  2P5R A;  2FHE A;  5AGY A;  3QMX A;  2GSQ A;  1PMT A;  5H5R A;  3VFI A;  4Q5Q A;  2JSY A;  4WEY A;  2GT5 A;  4PUF C;  1JLV A;  1EV9 A;  5J4U A;  2E7P A;  4K0G A;  1FAA A;  1YEP A;  1GLQ A;  1V9W A;  5C00 A;  5GZZ B;  3M3M A;  4QQ7 A;  2HI7 A;  3LOR A;  2H73 A;  1WOU A;  4CDO A;  6GSY A;  3J7Y k;  2ES7 A;  4FYU A;  4HS1 A;  4HEA 2;  4GWR A;  2H01 A;  1EP8 A;  1NSW A;  4JBB A;  4DEJ A;  5JCG A;  4ZL7 A;  2WRT A;  3HZ4 A;  3TJK A;  3D21 A;  2HRF A;  1HNB A;  5F07 A;  1ERV A;  4IJI A;  2GZP A;  4WXT A;  1EGO A;  3RDW A;  2KP2 A;  1AQV A;  1EOH A;  1V98 A;  1A23 A;  3KXO A;  4I8B A;  3H79 A;  5ENU A;  2R4V A;  4N0V A;  4HJM A;  3BOA A;  2CVD A;  1XW6 A;  3F6D A;  1SL0 B;  4FIW A;  2V32 A;  5D96 A;  5G1K A;  4MJE A;  1TTZ A;  3DYR A;  2E2M A;  4Q5N A;  3E0U A;  3KP8 A;  2CV4 A;  2LQQ A;  3ZML A;  2H0I A;  3NOF A;  4NV2 A;  1A24 A;  3UEM A;  3TDG A;  2C1Y A;  2WFC A;  1VF2 A;  1RK4 A;  5D93 A;  1C72 A;  5ECI B;  4BPY A;  5A5K A;  2QC7 A;  2IWT A;  4HOJ A;  2FGX A;  3VWX A;  1K0N A;  1G7E A;  5HQP A;  1OAZ A;  2KOK A;  1QUW A;  5DCH A;  3L78 A;  4CHS A;  3ED3 A;  1ERT A;  1Z9H A;  5AIV A;  3TCO A;  2RUF A;  3ZIT A;  4N0Z A;  2VL3 A;  3F8U A;  4NMU A;  2VLT A;  4NXI A;  4EDY A;  3D4T A;  3QFA C;  4BA7 A;  1MEK A;  3A5W A;  2H76 A;  4RQR A;  3L9S A;  3M1G A;  3OR5 A;  1WMJ A;  1XWA A;  1TU7 A;  4DVC A;  4ZB9 A;  3H8Q A;  3VI7 A;  1V2A A;  5JWR B;  3GUR A;  2GS3 A;  2QSI A;  4BVX A;  5IPG A;  3A2X A;  4HU9 A;  3UAR A;  2DJ1 A;  1QQ2 A;  1A8L A;  2PVO C;  1JHB A;  1Z3E A;  4EKZ A;  1ON4 A;  2IJY A;  2WCI A;  3GKX A;  3RPN A;  3O3T A;  1XFL A;  3LYK A;  4WR5 A;  4HDE A;  1W89 A;  3QPM A;  2H1G A;  4JED A;  5IO2 A;  3MAK A;  2VL2 A;  1T8E B;  3DML A;  5EL8 A;  2E0Q A;  5CYY A;  3BJ5 A;  2HLS A;  3CTG A;  1XWG A;  4QL9 A;  2GQL A;  3UBL A;  2A4V A;  3GN3 A;  3EU3 A;  2RII A;  1F2E A;  3Q6O A;  3DWV A;  4MJB A;  2C0D A;  3IOS A;  2IN3 A;  4HQS A;  4N11 A;  16GS A;  1EEM A;  3DEX A;  3DGQ A;  2CT6 A;  5IMD A;  1SKS B;  3CXG A;  3D5J A;  4TKY A;  2GQM A;  4RI6 A;  3FR6 A;  2C8U A;  2IMD A;  1HNC A;  2DLX A;  1F9M A;  1EP7 A;  3EMP A;  4WF4 A;  4V2L A;  5B8A A;  1XOB A;  1AQW A;  2YPM A;  1EOG A;  2VM2 A;  1K0D A;  4KAE A;  1OC9 B;  2ZNM A;  5FWG A;  4MCU A;  4AF2 A;  1A0R P;  5KN2 A;  2L4Q A;  5AIX A;  3KTB A;  1GP1 A;  2VUP A;  4ID0 A;  2LS5 A;  2YJ7 A;  4L5L A;  1RQM A;  4FYC A;  3KIJ A;  3QCP A;  1BJX A;  5J9C A;  2GGT A;  3FZ4 A;  4AGS A;  3K8N A;  4IBP A;  2REM A;  2LQO A;  3ZTL A;  5IMZ A;  4GLT A;  4XTS A;  1FOV A;  5G5F A;  4F2I A;  1NM3 A;  3VWV A;  4JZQ A;  4MPG A;  2OAC A;  3GTU B;  2C3T A;  1O6J A;  2IMI A;  2CVB A;  1JZW A;  2WJU A;  3GKM A;  4ULX A;  4POM A;  3APS A;  2P0G A;  2Z9S A;  5EVO A;  2EC4 A;  1B48 A;  4KND A;  2VD0 A;  2OBK A;  3LQ7 A;  3FY7 A;  3QR6 A;  2R3X A;  2OJL A;  1O8X A;  3C71 A;  3TKR A;  5GAP D;  4K7I A;  5D9W A;  3M0F A;  3ZIJ A;  2XHF A; 
#chains in the Genus database with same CATH topology
 1GNW A;  4K6X A;  2OE3 A;  5IO0 A;  1O8W A;  3F3R A;  3EIN A;  4KE3 A;  2PBJ A;  5FHI A;  4PQI A;  4NHZ A;  3WGE A;  2VCW A;  3LWA A;  2IME A;  1GLP A;  3KH7 A;  4PGT A;  4TR3 A;  1J0F A;  3ZFL A;  4EVM A;  9GSS A;  4MZC A;  4MNN A;  1MD4 A;  2YCD A;  2I1U A;  3EPT A;  4DSQ A;  2LJR A;  3H1N A;  1MTC A;  4TOP A;  1TRW A;  2YV9 A;  2OBI A;  2FWF A;  2VAF A;  3HJO A;  3TKS E;  3ZYW A;  4XRA A;  2LUS A;  4YAP A;  2NVL A;  3D22 A;  3ZMK A;  4MA9 A;  2CAI A;  1K0O A;  2GDR A;  3IK9 A;  2XPD A;  5CRH A;  1GTB A;  3IE3 A;  5LNK e;  1BED A;  3G7J A;  3D6I A;  5IMV A;  1YF0 A;  1TDI A;  1ZYP A;  4OO4 A;  1H4O A;  4BVX B;  1X0R A;  2L6D A;  4ISD A;  2FWG A;  2VL2 C;  1A0F A;  2DKI A;  1F37 A;  4IW9 A;  2JZR A;  1Z7P A;  2X8C A;  1PA3 A;  4G10 A;  1SJZ A;  2JZT A;  5CRD A;  2ON7 A;  5LCZ A;  1X9M B;  1TRS A;  4ML6 A;  1JZO A;  1W4V A;  4IJ3 A;  2CA8 A;  6GSW A;  1G6Y A;  4F82 A;  1Q98 A;  5ECQ B;  3ZFB A;  2CX3 A;  4MH3 A;  2YOI A;  2MMO A;  2YWM A;  4G0I A;  5DJM A;  2N5F A;  1GNE A;  2DJJ A;  1YQ1 A;  5AN1 A;  1VRS D;  4XHM A;  2K6V A;  5F05 A;  5JWQ B;  1M0U A;  1NW2 A;  2PER A;  1AAZ A;  2PN8 A;  7GSS A;  1WPI A;  1SEN A;  1A2M A;  4IS0 A;  4KF9 A;  4N10 A;  1XXU A;  1OYJ A;  3E9J B;  1T7P B;  4MZB A;  5DJL A;  2B3S A;  4QL7 A;  2DBC A;  3P7X A;  1QK8 A;  2P5Q A;  1WWJ A;  14GS A;  3F0I A;  1PRX A;  3KM6 A;  3KTL A;  2X99 A;  4GST A;  5D73 A;  1IYI A;  1WE0 A;  1XZO A;  1GUK A;  2I3Y A;  2P31 A;  3M9J A;  1U88 A;  1CQG A;  5D9V A;  5KN1 A;  1J08 A;  2JAC A;  4X1U A;  4MLY A;  5E59 A;  3C1S A;  4TXO B;  5ELG A;  2N5B A;  3FKF A;  4Q5R A;  2X8G A;  5AIS A;  2K9F A;  4Q5F A;  4KB3 A;  4OO5 A;  4PUA A;  1ZYE A;  3VUR A;  1S3A A;  4DSS B;  2FWH A;  2BTO T;  2X49 A;  4KCE A;  2PWJ A;  2XBI A;  2IFQ B;  5B6N A;  2YNX A;  3BCK A;  2BMX A;  4K7O A;  4WR4 A;  4X43 A;  4Z2R A;  3P2A A;  3FMW A;  3GH9 A;  3RAZ A;  5C04 A;  3ZVJ D;  4I5Q A;  2AV4 A;  3BD2 A;  3GUS A;  1OVN A;  2CZ3 A;  4V2N A;  20GS A;  1PX7 A;  2GT6 A;  2LRT A;  5D9X A;  1U6T A;  3KP9 A;  5ECK B;  2M46 A;  1FHE A;  4MP4 A;  4ZIL A;  3GL3 A;  3GH6 A;  1FW1 A;  5IMC A;  2B1L A;  4HQZ A;  3ZIV A;  5CP1 A;  3ZRD A;  5ECO B;  2PMT A;  3FEU A;  4PNG A;  2C3Q A;  1ZGN A;  3FRC A;  1K0C A;  4ZL8 A;  1EGR A;  2LJA A;  2K18 A;  3W6G A;  6GSX A;  4XS4 A;  3QAG A;  5CRG A;  4TR1 B;  4BL7 B;  2DKH A;  1E6B A;  3I6A A;  2L5O A;  2HZF A;  4HJ2 A;  4WF5 A;  5ID2 A;  1OE8 A;  2CAQ A;  2L5L A;  3ERG A;  3UAP A;  1XW9 A;  22GS A;  2GZZ A;  1M2B A;  3J7Y b;  5BMU A;  17GS A;  1BG5 A;  4POL A;  5A4V A;  2FA8 A;  3WD6 A;  5IQY A;  2VOC A;  4OCF A;  5DAL A;  2FY6 A;  3AY8 A;  1M99 A;  2HZE A;  2RLI A;  3CSH A;  10GS A;  1AQX A;  1VF3 A;  5IIZ A;  2G0F A;  1Y25 A;  2H1B A;  6GST A;  5B8B A;  4PTS A;  1Y6E A;  3IAS 2;  1MDI A;  1B4Q A;  1PQN A;  3MIX A;  1S3D A;  1KEB A;  1O81 A;  4I2U A;  4OFM A;  2JSZ A;  1OC8 A;  3TOT A;  1XG8 A;  1MDK A;  4G0L A;  3HCZ A;  1EV4 A;  1G7O A;  3WGX A;  1QMV A;  2LEG A;  2DJK A;  3BBY A;  1TK0 B;  1YEX A;  4TN8 A;  4IQ1 A;  1PKW A;  4YAV A;  8GSS A;  2RM6 A;  4KSO A;  3F6F A;  3TRP A;  4K2D A;  4GXZ A;  3L9U A;  2A4H A;  1ST9 A;  4LL4 B;  3V1W A;  4MDC A;  4OMV A;  2H0G A;  1XBS A;  3QD9 A;  5CRE A;  4K7N A;  2H6X A;  2B7J A;  2A2S A;  2GSR A;  2MMA A;  4PQH A;  1WJK A;  4H86 A;  1OC3 A;  2WUL A;  2JAD A;  2L4C A;  3VK9 A;  1GH2 A;  1N2A A;  3QFB C;  3D4M A;  2B6M A;  5J5N A;  1MD3 A;  1V40 A;  3Q19 A;  3P90 A;  1XWC A;  3IA1 A;  1ABA A;  1DE1 A;  5IM9 A;  4TR4 A;  5KN0 A;  3G7I A;  3KMO A;  1K0B A;  1F3B A;  2VL9 A;  5D9T A;  3WT2 A;  2VM1 A;  4L0W A;  3JCM L;  3EE2 A;  2X64 A;  4Z2T A;  3F63 A;  1HD2 A;  2KP1 A;  3RBT A;  4EF0 A;  3GSS A;  3IK7 A;  5B7C A;  3QDN A;  1SU9 A;  1DE2 A;  1FVJ A;  1F3A A;  1V58 A;  2DC5 A;  1EZK A;  4JRR A;  1YZX A;  2VD1 A;  4D73 B;  3ISO A;  4NPB A;  1ILO A;  2LTK A;  1TOF A;  1G0T A;  4V1A p;  3U5R E;  2M72 A;  3EVI A;  5HR1 A;  2VCT A;  4OCE A;  4K0N A;  2GQK A;  1LBK A;  3VWW A;  4YKG A;  2QKE A;  2R2J A;  1UN2 A;  1KBN A;  1ZOF A;  2L59 A;  2V6K A;  4GQF A;  5IMA A;  4L0U A;  4KH7 A;  1OKT A;  3F3Q A;  4OWY A;  2TIR A;  3DXB A;  5COH A;  2PUK C;  4PQ1 A;  2GSS A;  4ZB8 A;  1JLW A;  3FZ5 A;  1YDK A;  1TI1 A;  2VCX A;  3C73 A;  3HVX A;  3LFL A;  1PL1 A;  1XPV A;  1XW5 A;  3VPT A;  2DMM A;  2R0C A;  4JE1 A;  1X9W B;  4EIP A;  4IHU A;  1RW1 A;  3ERW A;  2VLV A;  3TJB A;  1ZYN A;  3IXR A;  3GNJ A;  2OAD A;  4IEL A;  3TJF A;  3RHB A;  1XCC A;  5HFG A;  3N9J A;  4ILF A;  3LXZ A;  3VLN A;  3KCM A;  5DBQ A;  2G2Q A;  1U3A A;  2ZCT A;  4J56 E;  3TOU A;  4HU7 A;  2TRC P;  2L57 A;  4NV5 A;  1K3O A;  2IL3 A;  4KSM A;  4N30 A;  5DAL B;  5IPH A;  2RM5 A;  2VO4 A;  2HZE B;  1AIU A;  4P3Y B;  4XIH A;  3WT1 A;  4FO5 A;  3HY2 A;  3TGZ A;  2K8V A;  2H1D A;  1FO5 A;  3IRA A;  3FYG A;  5CRW A;  2H66 A;  3EYT A;  3LW9 A;  1A2J A;  2F9S A;  4OD7 A;  5G31 A;  5G30 A;  5KOX A;  2DSA A;  3SWL A;  4XS1 A;  1TW9 A;  4POB A;  3VWU A;  3M9K A;  4BVY A;  6GSS A;  1YJ6 A;  4KDU A;  1TKD B;  1G6W A;  1QXH A;  4L8E A;  1URM A;  3TJJ A;  3FZA A;  3KMN A;  2ALB A;  1YF1 A;  3LSZ A;  5J9B A;  1XVQ A;  4G0K A;  1YKC A;  2BJX A;  1HYU A;  4KA0 A;  2AYT A;  1K0M A;  2R37 A;  4KUN A;  1TRV A;  3L4N A;  4IGJ A;  2I4A A;  4K9Z A;  1GUL A;  1TK8 B;  4O92 A;  3F4T A;  1X5C A;  3BCI A;  3HVS A;  2YAN A;  3G9B A;  1SJI A;  4WBJ A;  1SYR A;  4LMV A;  3EUR A;  3FR3 A;  4YH2 A;  4ZBA A;  1Z5Y E;  3LEF A;  1I9D A;  2JU5 A;  2YV7 A;  5CAX A;  2B5Y A;  2LRC A;  1KNG A;  2B5E A;  12GS A;  2LJK A;  2HT9 A;  2WZ9 A;  4K8M A;  2FLS A;  4O32 A;  3UJ1 A;  1X5D A;  2I9H A;  3W8S A;  3DKS A;  4ML1 A;  4GSN A;  3US3 A;  2X4A A;  6GSV A;  1SD9 A;  2LST A;  1TXX A;  4ECC A;  2QA1 A;  3CSJ A;  3L9V A;  4YQM A;  13GS A;  3ZZX A;  4FYB A;  2A2R A;  4POK A;  3MNG A;  4MK3 A;  4TW5 A;  3F4S A;  4LL1 B;  2H70 A;  4X0X A;  4JU5 A;  4F0C A;  4KX4 A;  3DRN A;  2PPT A;  2H71 A;  1PSQ A;  2O7K A;  4KDX A;  3R2Q A;  2KLX A;  1M2D A;  2OA7 A;  3UL3 A;  4V2M A;  3A2W A;  1N8J A;  4GRF A;  3GFK A;  1A2L A;  2WGR A;  4CY8 A;  1GSQ A;  3O76 A;  2GVP A;  3VI5 A;  3PIN A;  1R4W A;  1DBY A;  3I43 A;  2A2P A;  2DIZ A;  4E8E A;  2AHE A;  5HFK A;  1USB A;  2DJ0 A;  2FCH A;  1WP0 A;  2OE0 A;  3TB2 A;  1XWK A;  3MWH A;  1SL1 B;  4V1A g;  3ZRE A;  1Z6M A;  1ZYQ B;  2WB9 A;  4HUA A;  4JR6 A;  2PVQ A;  5JWO B;  2B7K A;  1NHY A;  3GA4 A;  3KEB A;  2YN1 A;  2HYX A;  3CBU A;  5F0G A;  4F03 A;  1M9A A;  1VGL A;  3TKS A;  4GSS A;  2NBS A;  1YY7 A;  1BAY A;  2CVK A;  2XBQ A;  5ECR B;  1GRX A;  1BX9 A;  4MF6 A;  2KUC A;  3P8W A;  4MPF A;  1T00 A;  3IC4 A;  2M80 A;  2J23 A;  2LNS A;  1BQ7 A;  4YQU A;  4ECJ A;  5GAN D;  5ELA A;  3PPU A;  1XVW A;  2HFD A;  1T3B A;  3DVW A;  2X8H A;  3Q18 A;  1E2Y A;  2DJ2 A;  3GKK A;  5F8B A;  2FUG 2;  5ECN B;  4IKH A;  2VCZ A;  3CSI A;  4ICY A;  5LD0 A;  4BWQ A;  5E4W A;  1R5P A;  1HQO A;  1U87 A;  2IIY A;  1PL2 A;  1VF4 A;  4AJ8 A;  3TKP A;  5ABR A;  2DML A;  4ZXG A;  1PD2 1;  4Z2U A;  4J2F A;  4BVY B;  1S3C A;  1PX6 A;  3QAV A;  4I97 A;  4XS6 A;  5EY6 A;  3HDC A;  4EO3 A;  3HVV A;  4ZB6 A;  5HR0 A;  1OC9 A;  5G1L A;  4IN0 A;  1X9S B;  4WBR D;  1SKR B;  4MH2 A;  4IQA A;  1ACV A;  1LU4 A;  4GCI A;  1SL2 B;  1JZR A;  2H1A A;  1HNA A;  1TU8 A;  3EWL A;  5H5S A;  2NTO A;  5GSS A;  5J41 A;  2MYG A;  18GS A;  1DSB A;  3UIW A;  2L6C A;  2AJQ B;  1GL8 A;  1ERW A;  11GS A;  4BWS A;  5IOX A;  2QGV A;  2GST A;  2VCV A;  1XWB A;  3GTU A;  5J3R A;  1YKA A;  4CY6 A;  3TRX A;  2HSY A;  4LMW A;  3E3E A;  1PN9 A;  2KHP A;  3FR9 A;  1FB0 A;  2NDO A;  1FVK A;  2YWO A;  4MMM A;  2WDU A;  3EC3 A;  3S9F A;  2D2Z A;  1B9X C;  2H19 A;  4O7H A;  2EIQ A;  1S3R A;  3A5I A;  2LNT A;  2E2G A;  1OKD A;  5HFI A;  3IHQ A;  3ERF A;  4Z7X A;  1SYX A;  3APQ A;  5ECL B;  1M9B A;  1THX A;  2MZC A;  5JCU A;  4A5P A;  3GHA A;  4TVE A;  5A4U A;  1TJD A;  2C0F A;  5FT3 A;  3GKN A;  2YZH A;  4NWY A;  4E8H A;  2O8V B;  19GS A;  1B9Y C;  4O5R A;  4PNF A;  4MF7 A;  2MBT A;  4EE0 A;  3PR8 A;  4GQC A;  1R7H A;  2H6Y A;  3M8N A;  1XIY A;  2XPE A;  4YKF A;  1T4Y A;  2NPB A;  3GMF A;  5B6M A;  3GYK A;  2B5X A;  4XRD A;  3WYW A;  4TR0 A;  3KH9 A;  2JZS A;  3TKS C;  3HJM A;  3RHC A;  1U3I A;  3MDK A;  2MMN A;  4K1F A;  1NHO A;  2CX4 A;  1VF1 A;  1WRY A;  3SBC A;  4HSC X;  4K5R A;  2H30 A;  2H74 A;  2YWI A;  3IHG A;  3F9U A;  4ZL9 A;  4TRX A;  2ON5 A;  4GTU A;  1GUM A;  2UZ8 A;  3A3T A;  1Z6N A;  2JL4 A;  1BYE A;  4LA1 A;  4ECI A;  2H72 A;  4IP6 A;  4NAX A;  5GST A;  1SK1 A;  3DVX A;  4MJA A;  4O5Q A;  2IMK A;  4PUR A;  4RQX A;  5DVB A;  3RPP A;  4I6X A;  2FWE A;  2R5G A;  4LLR A;  1GTI A;  2F8A A;  4RUV A;  1AXD A;  3LGC A;  2GLR A;  1QFN A;  3GRX A;  2HNL A;  5IOW A;  4MAB A;  1UC7 A;  1K3Y A;  4IVF A;  2AUV A;  3KZQ A;  2WS2 A;  2PGT A;  2C0E A;  3ME8 A;  5BRT A;  2MBS A;  2ZUP A;  2DJ3 A;  4USS A;  2XC2 A;  1J9B A;  3EMX A;  1GSD A;  2F3M A;  1SJ6 A;  4XS4 B;  1UVZ A;  2YP6 A;  2R0G A;  3GST A;  3IV4 A;  3LG6 A;  4MJC A;  3FK8 A;  3MSZ A;  3HA9 A;  2O89 A;  5D8I A;  2LRN A;  4HI7 A;  3IR4 A;  2HRN A;  2J9H A;  1B4P A;  5ID2 B;  1KTE A;  4AJ7 A;  2K8S A;  2OKA A;  2AAW A;  2F51 A;  4YQV A;  4TXO A;  4EL1 A;  4K2X A;  5DAK A;  4WKW A;  5DQS A;  2TRX A;  2HXK A;  3ZLP A;  3ZVJ A;  1GSS A;  4DSS A;  3CMI A;  4EXJ A;  5CO3 A;  2IFQ A;  1ZMA A;  1QGV A;  1JFU A;  2FNO A;  3LJR A;  2VCQ A;  5KOW A;  3CTF A;  1GSY A;  2GZY A;  4J57 E;  4KW6 A;  1PKZ A;  1X5E A;  3NIV A;  2CZ2 A;  1O7U A;  3KJY A;  3VPQ A;  1IYH A;  4G2E A;  1K0A A;  3Q74 A;  3F4R A;  1LJR A;  2OE1 A;  1THO A;  2H75 A;  4DSR A;  5ECM B;  3PH9 A;  4KDY A;  3CYN A;  2F8F A;  3FZ9 A;  2IPA A;  4PX1 A;  3H93 A;  2O87 A;  4EUY A;  5DQY A;  1SK2 A;  3PGT A;  2O85 A;  1GTU A;  4CW9 A;  1MDJ A;  4TR1 A;  4BL7 A;  4F9Z A;  5G2Z A;  4ECB A;  1M2A A;  1JZD A;  3UVH A;  2YJH A;  2HE3 A;  2FA4 A;  2C0G A;  1TK5 B;  1T4Z A;  1A8Y A;  3A2V A;  5A4W A;  1O73 A;  4PXO A;  4I2T A;  6GSU A;  4KGI A;  3LYP A;  1GSU A;  2HSH A;  4KCA A;  2VIM A;  1SD8 A;  4FH8 A;  1T1V A;  3C7M A;  3KGK A;  3HD5 A;  5ECS A;  1R26 A;  4EIQ A;  3CRT A;  1Q4J A;  3C1R A;  2VLU A;  2LV3 A;  2GTU A;  1M3J A;  5DCG A;  4IP1 A;  2YZU A;  5KEJ A;  1CQH A;  4AJ6 A;  1I5G A;  3TUE A;  3IDV A;  4RI7 A;  1FG4 A;  4GF0 A;  3HXS A;  3TKQ A;  1TP9 A;  5HR3 A;  1Z7R A;  1DUG A;  5ECH B;  1AUC A;  2V2G A;  1ZZY A;  2CQ9 A;  2H0H A;  5F06 A;  5DDL A;  4NHW A;  1TI3 A;  3IAM 2;  3GL5 A;  3EU4 A;  3GV1 A;  3HKR A;  3DD3 A;  4EDZ A;  3ZL5 A;  3UBK A;  3GX0 A;  3HZ8 A;  2MMZ A;  3HJP A;  2V41 A;  2B1K A;  3WGD A;  1SK0 A;  1GSE A;  5H5Q A;  3KD0 A;  3FHK A;  4MZW A;  4F0B A;  3TRQ A;  1V57 A;  1ML6 A;  1R5A A;  5IMF A;  4ZBD A;  3FW2 A;  1FOH A;  2N5A A;  5HR2 A;  3MYD A;  2AB6 A;  3APO A;  4G9H A;  1PGT A;  3I9V 2;  1UA5 A;  1GSF A;  2V6O A;  5G5E A;  5L71 A;  4HZ4 A;  1H75 A;  1M7T A;  5INY A;  3HYP A;  1WIK A;  4FQU A;  2RUE A;  2IMF A;  3I69 A;  1O85 A;  3N5O A;  1ZL9 A;  2I81 A;  3C8E A;  3G7Y A;  1GTA A;  3NZN A;  3CRU A;  1EWX A;  1F6M C;  4EC0 A;  1AC1 A;  3D0Z A;  3GIX A;  3TJG A;  2EIO A;  2DIY A;  3H4K A;  1GWC A;  4ZIJ A;  2C80 A;  2R6K A;  4OFT A;  1K3L A;  3IPZ A;  3UOM A;  1B8X A;  5EPF A;  3HHV A;  1ERU A;  1FB6 A;  5KN3 A;  2LKU A;  3U6V A;  3QAW A;  5DAK B;  4ACS A;  2C3N A;  3W8J A;  1AW9 A;  3UMA A;  4WET A;  5CNW A;  4O5U A;  1TRU A;  1XOA A;  3L0H A;  2V1M A;  2FD3 A;  1OE7 A;  3GX8 A;  4D73 A;  3O6T A;  2PU9 C;  4TXV A;  2EIR A;  4ZBB A;  1GUH A;  5ECP B;  2C4J A;  4MF5 A;  4JR4 A;  3DIE A;  3QOU A;  4HZ2 A;  1ZCP A;  4XCS A;  2YWN A;  2H8L A;  1EEJ A;  4OFN A;  4G19 A;  3UVT A;  3ME7 A;  2H6Z A;  1SKW B;  4L5O A;  3LXT A;  3IBH A;  5JCW A;  2P5R A;  2FHE A;  5AGY A;  3QMX A;  2GSQ A;  1PMT A;  5H5R A;  3VFI A;  4Q5Q A;  2JSY A;  4WEY A;  2GT5 A;  4PUF C;  1JLV A;  1EV9 A;  5J4U A;  2E7P A;  4K0G A;  1FAA A;  1YEP A;  1GLQ A;  1V9W A;  5C00 A;  5GZZ B;  3M3M A;  4QQ7 A;  2HI7 A;  3LOR A;  2H73 A;  1WOU A;  4CDO A;  6GSY A;  3J7Y k;  2ES7 A;  4FYU A;  4HS1 A;  4HEA 2;  4GWR A;  2H01 A;  1EP8 A;  1NSW A;  4JBB A;  4DEJ A;  5JCG A;  4ZL7 A;  2WRT A;  3HZ4 A;  4K5S A;  3TJK A;  3D21 A;  2HRF A;  1HNB A;  5F07 A;  1ERV A;  4IJI A;  2GZP A;  4WXT A;  1EGO A;  3RDW A;  2KP2 A;  1AQV A;  1EOH A;  1V98 A;  1A23 A;  3KXO A;  4I8B A;  3R3E A;  3H79 A;  5ENU A;  2R4V A;  4N0V A;  4HJM A;  3BOA A;  2CVD A;  1XW6 A;  3F6D A;  1SL0 B;  4FIW A;  2V32 A;  5D96 A;  5G1K A;  4MJE A;  1TTZ A;  3DYR A;  2E2M A;  4Q5N A;  3E0U A;  3KP8 A;  2CV4 A;  2LQQ A;  3ZML A;  2H0I A;  3NOF A;  4NV2 A;  1A24 A;  3UEM A;  3IC8 A;  3TDG A;  2C1Y A;  2WFC A;  1VF2 A;  1RK4 A;  5D93 A;  1C72 A;  5ECI B;  4BPY A;  5A5K A;  2QC7 A;  2IWT A;  4HOJ A;  2FGX A;  3VWX A;  1K0N A;  1G7E A;  5HQP A;  1OAZ A;  2KOK A;  1QUW A;  5DCH A;  1PFO A;  3L78 A;  4CHS A;  3ED3 A;  1ERT A;  1Z9H A;  5AIV A;  3TCO A;  2RUF A;  3ZIT A;  4N0Z A;  2VL3 A;  3F8U A;  4NMU A;  2VLT A;  4NXI A;  4EDY A;  3D4T A;  3QFA C;  4BA7 A;  1MEK A;  3A5W A;  2H76 A;  4RQR A;  3L9S A;  3M1G A;  3OR5 A;  1WMJ A;  1XWA A;  1TU7 A;  4DVC A;  4ZB9 A;  3H8Q A;  3VI7 A;  1V2A A;  5JWR B;  2HRK A;  3GUR A;  2GS3 A;  2QSI A;  4BVX A;  5IPG A;  3A2X A;  4HU9 A;  3UAR A;  2DJ1 A;  1QQ2 A;  1A8L A;  2HSM A;  2PVO C;  1JHB A;  1Z3E A;  4EKZ A;  1ON4 A;  2IJY A;  2WCI A;  3GKX A;  3RPN A;  1PN0 A;  3O3T A;  1XFL A;  3LYK A;  4WR5 A;  4HDE A;  2HRA A;  1W89 A;  3QPM A;  2H1G A;  4JED A;  5IO2 A;  3MAK A;  2VL2 A;  1T8E B;  3DML A;  5EL8 A;  2E0Q A;  5CYY A;  2QA2 A;  3BJ5 A;  2HLS A;  3CTG A;  1XWG A;  4QL9 A;  2GQL A;  3UBL A;  2A4V A;  3GN3 A;  3EU3 A;  2RII A;  1F2E A;  3Q6O A;  3DWV A;  4MJB A;  2C0D A;  3IOS A;  2IN3 A;  4HQS A;  4N11 A;  16GS A;  1EEM A;  3HVN A;  3DEX A;  3DGQ A;  2CT6 A;  5IMD A;  1SKS B;  3CXG A;  3D5J A;  4TKY A;  2GQM A;  4RI6 A;  3FR6 A;  1M3I A;  2C8U A;  2IMD A;  1HNC A;  2DLX A;  1F9M A;  1EP7 A;  4BIK A;  3EMP A;  4WF4 A;  4V2L A;  5B8A A;  1XOB A;  1AQW A;  2YPM A;  1EOG A;  2VM2 A;  1K0D A;  4KAE A;  1OC9 B;  2ZNM A;  5FWG A;  4MCU A;  4AF2 A;  1A0R P;  5KN2 A;  2L4Q A;  5AIX A;  3KTB A;  1GP1 A;  3CQF A;  2VUP A;  4ID0 A;  2LS5 A;  2YJ7 A;  4L5L A;  1RQM A;  4FYC A;  3KIJ A;  3QCP A;  1BJX A;  5J9C A;  2GGT A;  3FZ4 A;  4AGS A;  3K8N A;  4IBP A;  2REM A;  2LQO A;  3ZTL A;  5IMZ A;  4GLT A;  4XTS A;  1FOV A;  5G5F A;  4F2I A;  1NM3 A;  3VWV A;  4JZQ A;  4MPG A;  2OAC A;  3GTU B;  2C3T A;  1O6J A;  2IMI A;  2CVB A;  1JZW A;  2WJU A;  3GKM A;  4ULX A;  4POM A;  3APS A;  2P0G A;  2Z9S A;  5EVO A;  2EC4 A;  1B48 A;  4X4J A;  2R0P A;  4KND A;  2VD0 A;  2OBK A;  3LQ7 A;  3FY7 A;  3QR6 A;  2R3X A;  2OJL A;  1O8X A;  3C71 A;  3TKR A;  5GAP D;  4K7I A;  5D9W A;  3M0F A;  3ZIJ A;  2XHF A; 
#chains in the Genus database with same CATH homology
 1GNW A;  4K6X A;  2OE3 A;  5IO0 A;  1O8W A;  3F3R A;  3EIN A;  4KE3 A;  2PBJ A;  5FHI A;  4PQI A;  4NHZ A;  3WGE A;  2VCW A;  3LWA A;  2IME A;  1GLP A;  3KH7 A;  4PGT A;  4TR3 A;  1J0F A;  3ZFL A;  4EVM A;  9GSS A;  4MZC A;  4MNN A;  1MD4 A;  2YCD A;  2I1U A;  3EPT A;  4DSQ A;  2LJR A;  3H1N A;  1MTC A;  4TOP A;  1TRW A;  2YV9 A;  2OBI A;  2FWF A;  2VAF A;  3HJO A;  3TKS E;  3ZYW A;  4XRA A;  2LUS A;  4YAP A;  2NVL A;  3D22 A;  3ZMK A;  4MA9 A;  2CAI A;  1K0O A;  2GDR A;  3IK9 A;  2XPD A;  5CRH A;  1GTB A;  3IE3 A;  5LNK e;  1BED A;  3G7J A;  3D6I A;  5IMV A;  1YF0 A;  1TDI A;  1ZYP A;  4OO4 A;  1H4O A;  4BVX B;  1X0R A;  2L6D A;  4ISD A;  2FWG A;  2VL2 C;  1A0F A;  2DKI A;  1F37 A;  4IW9 A;  2JZR A;  1Z7P A;  2X8C A;  1PA3 A;  4G10 A;  1SJZ A;  2JZT A;  5CRD A;  2ON7 A;  5LCZ A;  1X9M B;  1TRS A;  4ML6 A;  1JZO A;  1W4V A;  4IJ3 A;  2CA8 A;  6GSW A;  1G6Y A;  4F82 A;  1Q98 A;  5ECQ B;  3ZFB A;  2CX3 A;  4MH3 A;  2YOI A;  2MMO A;  2YWM A;  4G0I A;  5DJM A;  2N5F A;  1GNE A;  2DJJ A;  1YQ1 A;  5AN1 A;  1VRS D;  4XHM A;  2K6V A;  5F05 A;  5JWQ B;  1M0U A;  1NW2 A;  2PER A;  1AAZ A;  2PN8 A;  7GSS A;  1WPI A;  1SEN A;  1A2M A;  4IS0 A;  4KF9 A;  4N10 A;  1XXU A;  1OYJ A;  3E9J B;  1T7P B;  4MZB A;  5DJL A;  2B3S A;  4QL7 A;  2DBC A;  3P7X A;  1QK8 A;  2P5Q A;  1WWJ A;  14GS A;  3F0I A;  1PRX A;  3KM6 A;  3KTL A;  2X99 A;  4GST A;  5D73 A;  1IYI A;  1WE0 A;  1XZO A;  1GUK A;  2I3Y A;  2P31 A;  3M9J A;  1U88 A;  1CQG A;  5D9V A;  5KN1 A;  1J08 A;  2JAC A;  4X1U A;  4MLY A;  5E59 A;  3C1S A;  4TXO B;  5ELG A;  2N5B A;  3FKF A;  4Q5R A;  2X8G A;  5AIS A;  2K9F A;  4Q5F A;  4KB3 A;  4OO5 A;  4PUA A;  1ZYE A;  3VUR A;  1S3A A;  4DSS B;  2FWH A;  2BTO T;  2X49 A;  4KCE A;  2PWJ A;  2XBI A;  2IFQ B;  5B6N A;  2YNX A;  3BCK A;  2BMX A;  4K7O A;  4WR4 A;  4X43 A;  4Z2R A;  3P2A A;  3FMW A;  3GH9 A;  3RAZ A;  5C04 A;  3ZVJ D;  4I5Q A;  2AV4 A;  3BD2 A;  3GUS A;  1OVN A;  2CZ3 A;  4V2N A;  20GS A;  1PX7 A;  2GT6 A;  2LRT A;  5D9X A;  1U6T A;  3KP9 A;  5ECK B;  2M46 A;  1FHE A;  4MP4 A;  4ZIL A;  3GL3 A;  3GH6 A;  1FW1 A;  5IMC A;  2B1L A;  4HQZ A;  3ZIV A;  5CP1 A;  3ZRD A;  5ECO B;  2PMT A;  3FEU A;  4PNG A;  2C3Q A;  1ZGN A;  3FRC A;  1K0C A;  4ZL8 A;  1EGR A;  2LJA A;  2K18 A;  3W6G A;  6GSX A;  4XS4 A;  3QAG A;  5CRG A;  4TR1 B;  4BL7 B;  2DKH A;  1E6B A;  3I6A A;  2L5O A;  2HZF A;  4HJ2 A;  4WF5 A;  5ID2 A;  1OE8 A;  2CAQ A;  2L5L A;  3ERG A;  3UAP A;  1XW9 A;  22GS A;  2GZZ A;  1M2B A;  3J7Y b;  5BMU A;  17GS A;  1BG5 A;  4POL A;  5A4V A;  2FA8 A;  3WD6 A;  5IQY A;  2VOC A;  4OCF A;  5DAL A;  2FY6 A;  3AY8 A;  1M99 A;  2HZE A;  2RLI A;  3CSH A;  10GS A;  1AQX A;  1VF3 A;  5IIZ A;  2G0F A;  1Y25 A;  2H1B A;  6GST A;  5B8B A;  4PTS A;  1Y6E A;  3IAS 2;  1MDI A;  1B4Q A;  1PQN A;  3MIX A;  1S3D A;  1KEB A;  1O81 A;  4I2U A;  4OFM A;  2JSZ A;  1OC8 A;  3TOT A;  1MDK A;  4G0L A;  3HCZ A;  1EV4 A;  1G7O A;  3WGX A;  1QMV A;  2LEG A;  2DJK A;  3BBY A;  1TK0 B;  1YEX A;  4TN8 A;  4IQ1 A;  1PKW A;  4YAV A;  8GSS A;  2RM6 A;  4KSO A;  3F6F A;  3TRP A;  4K2D A;  4GXZ A;  3L9U A;  2A4H A;  1ST9 A;  4LL4 B;  3V1W A;  4MDC A;  4OMV A;  2H0G A;  1XBS A;  3QD9 A;  5CRE A;  4K7N A;  2H6X A;  2B7J A;  2A2S A;  2GSR A;  2MMA A;  4PQH A;  1WJK A;  4H86 A;  1OC3 A;  2WUL A;  2JAD A;  2L4C A;  3VK9 A;  1GH2 A;  1N2A A;  3QFB C;  3D4M A;  2B6M A;  5J5N A;  1MD3 A;  1V40 A;  3Q19 A;  3P90 A;  1XWC A;  3IA1 A;  1ABA A;  1DE1 A;  5IM9 A;  4TR4 A;  5KN0 A;  3G7I A;  3KMO A;  1K0B A;  1F3B A;  2VL9 A;  5D9T A;  3WT2 A;  2VM1 A;  4L0W A;  3JCM L;  3EE2 A;  2X64 A;  4Z2T A;  3F63 A;  1HD2 A;  2KP1 A;  3RBT A;  4EF0 A;  3GSS A;  3IK7 A;  5B7C A;  3QDN A;  1SU9 A;  1DE2 A;  1FVJ A;  1F3A A;  1V58 A;  2DC5 A;  1EZK A;  4JRR A;  1YZX A;  2VD1 A;  4D73 B;  3ISO A;  4NPB A;  1ILO A;  2LTK A;  1TOF A;  1G0T A;  4V1A p;  3U5R E;  2M72 A;  3EVI A;  5HR1 A;  2VCT A;  4OCE A;  4K0N A;  2GQK A;  1LBK A;  3VWW A;  4YKG A;  2QKE A;  2R2J A;  1UN2 A;  1KBN A;  1ZOF A;  2L59 A;  2V6K A;  4GQF A;  5IMA A;  4L0U A;  4KH7 A;  1OKT A;  3F3Q A;  4OWY A;  2TIR A;  3DXB A;  5COH A;  2PUK C;  4PQ1 A;  2GSS A;  4ZB8 A;  1JLW A;  3FZ5 A;  1YDK A;  1TI1 A;  2VCX A;  3C73 A;  3HVX A;  3LFL A;  1PL1 A;  1XPV A;  1XW5 A;  3VPT A;  2DMM A;  2R0C A;  4JE1 A;  1X9W B;  4EIP A;  4IHU A;  1RW1 A;  3ERW A;  2VLV A;  3TJB A;  1ZYN A;  3IXR A;  3GNJ A;  2OAD A;  4IEL A;  3TJF A;  3RHB A;  1XCC A;  5HFG A;  3N9J A;  4ILF A;  3LXZ A;  3VLN A;  3KCM A;  5DBQ A;  2G2Q A;  1U3A A;  2ZCT A;  4J56 E;  3TOU A;  4HU7 A;  2TRC P;  2L57 A;  4NV5 A;  1K3O A;  2IL3 A;  4KSM A;  4N30 A;  5DAL B;  5IPH A;  2RM5 A;  2VO4 A;  2HZE B;  1AIU A;  4P3Y B;  4XIH A;  3WT1 A;  4FO5 A;  3HY2 A;  3TGZ A;  2K8V A;  2H1D A;  1FO5 A;  3IRA A;  3FYG A;  5CRW A;  2H66 A;  3EYT A;  3LW9 A;  1A2J A;  2F9S A;  4OD7 A;  5G31 A;  5G30 A;  5KOX A;  2DSA A;  3SWL A;  4XS1 A;  1TW9 A;  4POB A;  3VWU A;  3M9K A;  4BVY A;  6GSS A;  1YJ6 A;  4KDU A;  1TKD B;  1G6W A;  1QXH A;  4L8E A;  1URM A;  3TJJ A;  3FZA A;  3KMN A;  2ALB A;  1YF1 A;  3LSZ A;  5J9B A;  1XVQ A;  4G0K A;  1YKC A;  2BJX A;  1HYU A;  4KA0 A;  2AYT A;  1K0M A;  2R37 A;  4KUN A;  1TRV A;  3L4N A;  4IGJ A;  2I4A A;  4K9Z A;  1GUL A;  1TK8 B;  4O92 A;  3F4T A;  1X5C A;  3BCI A;  3HVS A;  2YAN A;  3G9B A;  1SJI A;  4WBJ A;  1SYR A;  4LMV A;  3EUR A;  3FR3 A;  4YH2 A;  4ZBA A;  1Z5Y E;  3LEF A;  1I9D A;  2JU5 A;  2YV7 A;  5CAX A;  2B5Y A;  2LRC A;  1KNG A;  2B5E A;  12GS A;  2LJK A;  2HT9 A;  2WZ9 A;  4K8M A;  2FLS A;  4O32 A;  3UJ1 A;  1X5D A;  2I9H A;  3W8S A;  3DKS A;  4ML1 A;  4GSN A;  3US3 A;  2X4A A;  6GSV A;  1SD9 A;  2LST A;  1TXX A;  4ECC A;  2QA1 A;  3CSJ A;  3L9V A;  4YQM A;  13GS A;  3ZZX A;  4FYB A;  2A2R A;  4POK A;  3MNG A;  4MK3 A;  4TW5 A;  3F4S A;  4LL1 B;  2H70 A;  4X0X A;  4JU5 A;  4F0C A;  4KX4 A;  3DRN A;  2PPT A;  2H71 A;  1PSQ A;  2O7K A;  4KDX A;  3R2Q A;  2KLX A;  1M2D A;  2OA7 A;  3UL3 A;  4V2M A;  3A2W A;  1N8J A;  4GRF A;  3GFK A;  1A2L A;  2WGR A;  4CY8 A;  1GSQ A;  3O76 A;  2GVP A;  3VI5 A;  3PIN A;  1R4W A;  1DBY A;  3I43 A;  2A2P A;  2DIZ A;  4E8E A;  2AHE A;  5HFK A;  1USB A;  2DJ0 A;  2FCH A;  1WP0 A;  2OE0 A;  3TB2 A;  1XWK A;  3MWH A;  1SL1 B;  4V1A g;  3ZRE A;  1Z6M A;  1ZYQ B;  2WB9 A;  4HUA A;  4JR6 A;  2PVQ A;  5JWO B;  2B7K A;  1NHY A;  3GA4 A;  3KEB A;  2YN1 A;  2HYX A;  3CBU A;  5F0G A;  4F03 A;  1M9A A;  1VGL A;  3TKS A;  4GSS A;  2NBS A;  1YY7 A;  1BAY A;  2CVK A;  2XBQ A;  5ECR B;  1GRX A;  1BX9 A;  4MF6 A;  2KUC A;  3P8W A;  4MPF A;  1T00 A;  3IC4 A;  2M80 A;  2J23 A;  2LNS A;  1BQ7 A;  4YQU A;  4ECJ A;  5GAN D;  5ELA A;  3PPU A;  1XVW A;  2HFD A;  1T3B A;  3DVW A;  2X8H A;  3Q18 A;  1E2Y A;  2DJ2 A;  3GKK A;  5F8B A;  2FUG 2;  5ECN B;  4IKH A;  2VCZ A;  3CSI A;  4ICY A;  5LD0 A;  4BWQ A;  5E4W A;  1R5P A;  1HQO A;  1U87 A;  2IIY A;  1PL2 A;  1VF4 A;  4AJ8 A;  3TKP A;  5ABR A;  2DML A;  4ZXG A;  1PD2 1;  4Z2U A;  4J2F A;  4BVY B;  1S3C A;  1PX6 A;  3QAV A;  4I97 A;  4XS6 A;  5EY6 A;  3HDC A;  4EO3 A;  3HVV A;  4ZB6 A;  5HR0 A;  1OC9 A;  5G1L A;  4IN0 A;  1X9S B;  4WBR D;  1SKR B;  4MH2 A;  4IQA A;  1ACV A;  1LU4 A;  4GCI A;  1SL2 B;  1JZR A;  2H1A A;  1HNA A;  1TU8 A;  3EWL A;  5H5S A;  2NTO A;  5GSS A;  5J41 A;  2MYG A;  18GS A;  1DSB A;  3UIW A;  2L6C A;  2AJQ B;  1GL8 A;  1ERW A;  11GS A;  4BWS A;  5IOX A;  2QGV A;  2GST A;  2VCV A;  1XWB A;  3GTU A;  5J3R A;  1YKA A;  4CY6 A;  3TRX A;  2HSY A;  4LMW A;  3E3E A;  1PN9 A;  2KHP A;  3FR9 A;  1FB0 A;  2NDO A;  1FVK A;  2YWO A;  4MMM A;  2WDU A;  3EC3 A;  3S9F A;  2D2Z A;  1B9X C;  2H19 A;  4O7H A;  2EIQ A;  3A5I A;  2LNT A;  2E2G A;  1OKD A;  5HFI A;  3IHQ A;  3ERF A;  4Z7X A;  1SYX A;  3APQ A;  5ECL B;  1M9B A;  1THX A;  2MZC A;  5JCU A;  4A5P A;  3GHA A;  4TVE A;  5A4U A;  1TJD A;  2C0F A;  5FT3 A;  3GKN A;  2YZH A;  4NWY A;  4E8H A;  2O8V B;  19GS A;  1B9Y C;  4O5R A;  4PNF A;  4MF7 A;  2MBT A;  4EE0 A;  3PR8 A;  4GQC A;  1R7H A;  2H6Y A;  3M8N A;  1XIY A;  2XPE A;  4YKF A;  1T4Y A;  2NPB A;  3GMF A;  5B6M A;  3GYK A;  2B5X A;  4XRD A;  3WYW A;  4TR0 A;  3KH9 A;  2JZS A;  3TKS C;  3HJM A;  3RHC A;  1U3I A;  3MDK A;  2MMN A;  4K1F A;  1NHO A;  2CX4 A;  1VF1 A;  1WRY A;  3SBC A;  4K5R A;  2H30 A;  2H74 A;  2YWI A;  3IHG A;  3F9U A;  4ZL9 A;  4TRX A;  2ON5 A;  4GTU A;  1GUM A;  2UZ8 A;  3A3T A;  1Z6N A;  2JL4 A;  1BYE A;  4LA1 A;  4ECI A;  2H72 A;  4IP6 A;  4NAX A;  5GST A;  1SK1 A;  3DVX A;  4MJA A;  4O5Q A;  2IMK A;  4PUR A;  4RQX A;  5DVB A;  3RPP A;  4I6X A;  2FWE A;  2R5G A;  4LLR A;  1GTI A;  2F8A A;  4RUV A;  1AXD A;  3LGC A;  2GLR A;  1QFN A;  3GRX A;  2HNL A;  5IOW A;  4MAB A;  1UC7 A;  1K3Y A;  4IVF A;  2AUV A;  3KZQ A;  2WS2 A;  2PGT A;  2C0E A;  3ME8 A;  5BRT A;  2MBS A;  2ZUP A;  2DJ3 A;  4USS A;  2XC2 A;  1J9B A;  3EMX A;  1GSD A;  2F3M A;  1SJ6 A;  4XS4 B;  1UVZ A;  2YP6 A;  2R0G A;  3GST A;  3IV4 A;  3LG6 A;  4MJC A;  3FK8 A;  3MSZ A;  3HA9 A;  2O89 A;  5D8I A;  2LRN A;  4HI7 A;  3IR4 A;  2HRN A;  2J9H A;  1B4P A;  5ID2 B;  1KTE A;  4AJ7 A;  2K8S A;  2OKA A;  2AAW A;  2F51 A;  4YQV A;  4TXO A;  4EL1 A;  4K2X A;  5DAK A;  4WKW A;  5DQS A;  2TRX A;  2HXK A;  3ZLP A;  3ZVJ A;  1GSS A;  4DSS A;  3CMI A;  4EXJ A;  5CO3 A;  2IFQ A;  1ZMA A;  1QGV A;  1JFU A;  2FNO A;  3LJR A;  2VCQ A;  5KOW A;  3CTF A;  1GSY A;  2GZY A;  4J57 E;  4KW6 A;  1PKZ A;  1X5E A;  3NIV A;  2CZ2 A;  1O7U A;  3KJY A;  3VPQ A;  1IYH A;  4G2E A;  1K0A A;  3Q74 A;  3F4R A;  1LJR A;  2OE1 A;  1THO A;  2H75 A;  4DSR A;  5ECM B;  3PH9 A;  4KDY A;  3CYN A;  2F8F A;  3FZ9 A;  2IPA A;  4PX1 A;  3H93 A;  2O87 A;  4EUY A;  5DQY A;  1SK2 A;  3PGT A;  2O85 A;  1GTU A;  4CW9 A;  1MDJ A;  4TR1 A;  4BL7 A;  4F9Z A;  5G2Z A;  4ECB A;  1M2A A;  1JZD A;  3UVH A;  2YJH A;  2HE3 A;  2FA4 A;  2C0G A;  1TK5 B;  1T4Z A;  1A8Y A;  3A2V A;  5A4W A;  1O73 A;  4PXO A;  4I2T A;  6GSU A;  4KGI A;  3LYP A;  1GSU A;  2HSH A;  4KCA A;  2VIM A;  1SD8 A;  4FH8 A;  1T1V A;  3C7M A;  3KGK A;  3HD5 A;  5ECS A;  1R26 A;  4EIQ A;  3CRT A;  1Q4J A;  3C1R A;  2VLU A;  2LV3 A;  2GTU A;  5DCG A;  4IP1 A;  2YZU A;  5KEJ A;  1CQH A;  4AJ6 A;  1I5G A;  3TUE A;  3IDV A;  4RI7 A;  1FG4 A;  4GF0 A;  3HXS A;  3TKQ A;  1TP9 A;  5HR3 A;  1Z7R A;  1DUG A;  5ECH B;  1AUC A;  2V2G A;  1ZZY A;  2CQ9 A;  2H0H A;  5F06 A;  5DDL A;  4NHW A;  1TI3 A;  3IAM 2;  3GL5 A;  3EU4 A;  3GV1 A;  3HKR A;  3DD3 A;  4EDZ A;  3ZL5 A;  3UBK A;  3GX0 A;  3HZ8 A;  2MMZ A;  3HJP A;  2V41 A;  2B1K A;  3WGD A;  1SK0 A;  1GSE A;  5H5Q A;  3KD0 A;  3FHK A;  4MZW A;  4F0B A;  3TRQ A;  1V57 A;  1ML6 A;  1R5A A;  5IMF A;  4ZBD A;  3FW2 A;  1FOH A;  2N5A A;  5HR2 A;  3MYD A;  2AB6 A;  3APO A;  4G9H A;  1PGT A;  3I9V 2;  1UA5 A;  1GSF A;  2V6O A;  5G5E A;  5L71 A;  4HZ4 A;  1H75 A;  1M7T A;  5INY A;  3HYP A;  1WIK A;  4FQU A;  2RUE A;  2IMF A;  3I69 A;  1O85 A;  3N5O A;  1ZL9 A;  2I81 A;  3C8E A;  3G7Y A;  1GTA A;  3NZN A;  3CRU A;  1EWX A;  1F6M C;  4EC0 A;  1AC1 A;  3D0Z A;  3GIX A;  3TJG A;  2EIO A;  2DIY A;  3H4K A;  1GWC A;  4ZIJ A;  2C80 A;  2R6K A;  4OFT A;  1K3L A;  3IPZ A;  3UOM A;  1B8X A;  5EPF A;  3HHV A;  1ERU A;  1FB6 A;  5KN3 A;  2LKU A;  3U6V A;  3QAW A;  5DAK B;  4ACS A;  2C3N A;  3W8J A;  1AW9 A;  3UMA A;  4WET A;  5CNW A;  4O5U A;  1TRU A;  1XOA A;  3L0H A;  2V1M A;  2FD3 A;  1OE7 A;  3GX8 A;  4D73 A;  3O6T A;  2PU9 C;  4TXV A;  2EIR A;  4ZBB A;  1GUH A;  5ECP B;  2C4J A;  4MF5 A;  4JR4 A;  3DIE A;  3QOU A;  4HZ2 A;  1ZCP A;  4XCS A;  2YWN A;  2H8L A;  1EEJ A;  4OFN A;  4G19 A;  3UVT A;  3ME7 A;  2H6Z A;  1SKW B;  4L5O A;  3LXT A;  3IBH A;  5JCW A;  2P5R A;  2FHE A;  5AGY A;  3QMX A;  2GSQ A;  1PMT A;  5H5R A;  3VFI A;  4Q5Q A;  2JSY A;  4WEY A;  2GT5 A;  4PUF C;  1JLV A;  1EV9 A;  5J4U A;  2E7P A;  4K0G A;  1FAA A;  1YEP A;  1GLQ A;  1V9W A;  5C00 A;  5GZZ B;  3M3M A;  4QQ7 A;  2HI7 A;  3LOR A;  2H73 A;  1WOU A;  4CDO A;  6GSY A;  3J7Y k;  2ES7 A;  4FYU A;  4HS1 A;  4HEA 2;  4GWR A;  2H01 A;  1EP8 A;  1NSW A;  4JBB A;  4DEJ A;  5JCG A;  4ZL7 A;  2WRT A;  3HZ4 A;  4K5S A;  3TJK A;  3D21 A;  2HRF A;  1HNB A;  5F07 A;  1ERV A;  4IJI A;  2GZP A;  4WXT A;  1EGO A;  3RDW A;  2KP2 A;  1AQV A;  1EOH A;  1V98 A;  1A23 A;  3KXO A;  4I8B A;  3R3E A;  3H79 A;  5ENU A;  2R4V A;  4N0V A;  4HJM A;  3BOA A;  2CVD A;  1XW6 A;  3F6D A;  1SL0 B;  4FIW A;  2V32 A;  5D96 A;  5G1K A;  4MJE A;  1TTZ A;  3DYR A;  2E2M A;  4Q5N A;  3E0U A;  3KP8 A;  2CV4 A;  2LQQ A;  3ZML A;  2H0I A;  3NOF A;  4NV2 A;  1A24 A;  3UEM A;  3IC8 A;  3TDG A;  2C1Y A;  2WFC A;  1VF2 A;  1RK4 A;  5D93 A;  1C72 A;  5ECI B;  4BPY A;  5A5K A;  2QC7 A;  2IWT A;  4HOJ A;  2FGX A;  3VWX A;  1K0N A;  1G7E A;  5HQP A;  1OAZ A;  2KOK A;  1QUW A;  5DCH A;  3L78 A;  4CHS A;  3ED3 A;  1ERT A;  1Z9H A;  5AIV A;  3TCO A;  2RUF A;  3ZIT A;  4N0Z A;  2VL3 A;  3F8U A;  4NMU A;  2VLT A;  4NXI A;  4EDY A;  3D4T A;  3QFA C;  4BA7 A;  1MEK A;  3A5W A;  2H76 A;  4RQR A;  3L9S A;  3M1G A;  3OR5 A;  1WMJ A;  1XWA A;  1TU7 A;  4DVC A;  4ZB9 A;  3H8Q A;  3VI7 A;  1V2A A;  5JWR B;  2HRK A;  3GUR A;  2GS3 A;  2QSI A;  4BVX A;  5IPG A;  3A2X A;  4HU9 A;  3UAR A;  2DJ1 A;  1QQ2 A;  1A8L A;  2HSM A;  2PVO C;  1JHB A;  1Z3E A;  4EKZ A;  1ON4 A;  2IJY A;  2WCI A;  3GKX A;  3RPN A;  1PN0 A;  3O3T A;  1XFL A;  3LYK A;  4WR5 A;  4HDE A;  2HRA A;  1W89 A;  3QPM A;  2H1G A;  4JED A;  5IO2 A;  3MAK A;  2VL2 A;  1T8E B;  3DML A;  5EL8 A;  2E0Q A;  5CYY A;  2QA2 A;  3BJ5 A;  2HLS A;  3CTG A;  1XWG A;  4QL9 A;  2GQL A;  3UBL A;  2A4V A;  3GN3 A;  3EU3 A;  2RII A;  1F2E A;  3Q6O A;  3DWV A;  4MJB A;  2C0D A;  3IOS A;  2IN3 A;  4HQS A;  4N11 A;  16GS A;  1EEM A;  3DEX A;  3DGQ A;  2CT6 A;  5IMD A;  1SKS B;  3CXG A;  3D5J A;  4TKY A;  2GQM A;  4RI6 A;  3FR6 A;  2C8U A;  2IMD A;  1HNC A;  2DLX A;  1F9M A;  1EP7 A;  3EMP A;  4WF4 A;  4V2L A;  5B8A A;  1XOB A;  1AQW A;  2YPM A;  1EOG A;  2VM2 A;  1K0D A;  4KAE A;  1OC9 B;  2ZNM A;  5FWG A;  4MCU A;  4AF2 A;  1A0R P;  5KN2 A;  2L4Q A;  5AIX A;  3KTB A;  1GP1 A;  2VUP A;  4ID0 A;  2LS5 A;  2YJ7 A;  4L5L A;  1RQM A;  4FYC A;  3KIJ A;  3QCP A;  1BJX A;  5J9C A;  2GGT A;  3FZ4 A;  4AGS A;  3K8N A;  4IBP A;  2REM A;  2LQO A;  3ZTL A;  5IMZ A;  4GLT A;  4XTS A;  1FOV A;  5G5F A;  4F2I A;  1NM3 A;  3VWV A;  4JZQ A;  4MPG A;  2OAC A;  3GTU B;  2C3T A;  1O6J A;  2IMI A;  2CVB A;  1JZW A;  2WJU A;  3GKM A;  4ULX A;  4POM A;  3APS A;  2P0G A;  2Z9S A;  5EVO A;  2EC4 A;  1B48 A;  4X4J A;  2R0P A;  4KND A;  2VD0 A;  2OBK A;  3LQ7 A;  3FY7 A;  3QR6 A;  2R3X A;  2OJL A;  1O8X A;  3C71 A;  3TKR A;  5GAP D;  4K7I A;  5D9W A;  3M0F A;  3ZIJ A;  2XHF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...