3OR5A

Crystal structure of thiol:disulfide interchange protein, thioredoxin family protein from chlorobium tepidum tls
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
145
structure length
145
Chain Sequence
ADARPTPAPSFSGVTVDGKPFSSASLKGKAYIVNFFATWCPPCRSEIPDMVQVQKTWASRGFTFVGIAVNEQLPNVKNYMKTQGIIYPVMMATPELIRAFNGYIDGGITGIPTSFVIDASGNVSGVIVGPRSKADFDRIVKMALG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thiol:disulfide interchange protein, thioredoxin family prot
publication title Crystal structure of thiol:disulfide interchange protein, thioredoxin family protein from Chlorobium tepidum TLS
rcsb
source organism Chlorobaculum tepidum
molecule tags Oxidoreductase
total genus 33
structure length 145
sequence length 145
ec nomenclature
pdb deposition date 2010-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08534 Redoxin Redoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3or5A00
2MMOA 1USBA 1PL1A 5GSTA 2I9HA 1O6JA 5B7CA 5COHA 3L9UA 5KN0A 3ZRDA 1TXXA 1UN2A 3Q6OA 5E4WA 3EE2A 1PKZA 3U6VA 5IMCA 1Y25A 2FWHA 3M8NA 5ABRA 2EC4A 2GZPA 4IHUA 4BA7A 2E7PA 2A2SA 1PX7A 3QD9A 5F05A 2L5LA 3LXZA 16GSA 4GCIA 4NPBA 2V6KA 4FO5A 5ELGA 1NSWA 5JWOB 1XVWA 5IIZA 1Z6MA 2IMKA 2K9FA 1MEKA 3P2AA 2CAIA 1BJXA 5LNKe 3M3MA 4XS4A 1GSSA 2GDRA 1U3IA 2IMDA 3ZVJA 1SYRA 1BAYA 1UA5A 2XPDA 3ZYWA 5EVOA 2H70A 2DJ1A 4BVYA 20GSA 3HYPA 3IC4A 1SL0B 3HVXA 3L4NA 3QAGA 1C72A 3TJGA 1AQVA 1OVNA 1OE7A 1VGLA 5ECHB 1AIUA 3A2XA 2OACA 1TOFA 1ML6A 2LRCA 1K0AA 2FLSA 2KP1A 2L57A 2P0GA 3ZIVA 5B6NA 1M0UA 2C0FA 2VL3A 1A23A 2KLXA 7GSSA 2GVPA 3GURA 4QL7A 3IA1A 3G7YA 5IPGA 4TR4A 2ALBA 2B1LA 2MZCA 2AUVA 2DJ2A 4EDZA 1JHBA 2RUEA 4MZWA 4KSMA 1WIKA 2YJ7A 5ELAA 4O32A 1XXUA 2BMXA 1OC3A 1R26A 1ERWA 5LCZA 5KN3A 4YQVA 1R7HA 3GA4A 3IRAA 4E8EA 4OO5A 5AGYA 3LWAA 1SJ6A 5EY6A 3EURA 1ACVA 1PSQA 2MBTA 2HZEB 5J41A 3E9JB 3G7JA 2H8LA 3WGEA 3CTGA 2GQMA 2CZ3A 4GSSA 1AQWA 4IBPA 2L6CA 1ZOFA 3HJPA 4DVCA 1R4WA 2PUKC 1GSDA 4EE0A 2X64A 5D9XA 4V2NA 4H86A 4N11A 4NHZA 1WPIA 2LTKA 1M99A 4XTSA 2FNOA 1PQNA 4GQFA 3TRQA 2QC7A 2ON5A 4I8BA 4X43A 1F3AA 4MH2A 3KJYA 3CBUA 3QFBC 1T4YA 4XS6A 1FB6A 4KAEA 5B6MA 2IFQB 3QOUA 4F9ZA 4POBA 2GS3A 3D0ZA 2WULA 3EC3A 2AV4A 5H5SA 4F82A 2VD1A 3H1NA 5JCGA 3GTUA 17GSA 1JZWA 4DSQA 4ECCA 3GUSA 2IMFA 1QMVA 1FHEA 4OD7A 5H5RA 5F8BA 3S9FA 3FZ4A 1TKDB 1BQ7A 2YNXA 1BYEA 1JZDA 4LA1A 2IMIA 1V40A 2H76A 4AGSA 1XWBA 3HZ8A 2VIMA 3A2VA 3LORA 2H71A 2B7JA 4IP6A 3IAS2 5J5NA 3TUEA 3LJRA 2C0DA 3IPZA 2WB9A 4JR6A 1O73A 1TRWA 4ECBA 4HZ2A 3WYWA 4D73B 3F3QA 2YANA 2V6OA 3MDKA 1AC1A 2VCTA 1UVZA 2AYTA 5CRHA 3VI5A 5AN1A 2JSZA 4KH7A 3RPNA 1SJIA 1B8XA 5C00A 1W89A 5DJMA 2OBIA 4TXOA 5G5FA 5CREA 2ON7A 1MD4A 4PGTA 5L71A 1SL2B 2HYXA 5F0GA 2HSHA 1QUWA 4GQCA 2HLSA 3AY8A 4LMWA 1S3AA 3HVVA 2WS2A 4PURA 3GFKA 3TKSA 1B48A 2LRNA 4JEDA 2DBCA 2FY6A 3IR4A 2VCQA 4XHMA 2YV9A 1GLPA 1XWKA 4TR3A 5HR3A 1K0CA 3K8NA 3KD0A 4EVMA 3UJ1A 5HQPA 2X99A 2F9SA 3KIJA 2L5OA 3HY2A 1OC9B 2NDOA 1OYJA 4ACSA 6GSWA 5DALA 4PQIA 4BL7A 2DJ3A 2FHEA 5GZZB 3ZTLA 1Z7PA 2VM2A 1DUGA 3M9JA 3RPPA 4JRRA 1CQHA 4JBBA 4N30A 3DWVA 4PX1A 3VFIA 2B5YA 1QQ2A 1G0TA 3IK7A 1LU4A 3G9BA 4KGIA 1XOBA 5G5EA 2F3MA 2YWIA 3D4MA 5DAKB 6GSUA 2KP2A 2FUG2 3APQA 3HVSA 4AF2A 1W4VA 5ECMB 4KSOA 3LFLA 5G31A 3KH7A 3G7IA 4MH3A 2H19A 13GSA 2B5XA 2CAQA 3GL3A 4GF0A 4MP4A 3TKSE 3IHQA 2R37A 3UIWA 4NV2A 2CT6A 1RW1A 4NWYA 1GUKA 4WF4A 2CQ9A 3GV1A 3KH9A 3VURA 3CSIA 5CYYA 3LYKA 4TR1A 2GZYA 1SKRB 4N0ZA 4POLA 4LL1B 2LUSA 2X8HA 3M9KA 4AJ7A 1A24A 3PH9A 2H74A 1DBYA 3I9V2 1ON4A 1GTAA 4K7IA 4KUNA 3ME8A 3BCIA 2YV7A 1QFNA 1V2AA 3FRCA 2P31A 2M80A 2GQKA 1E6BA 1YF0A 4WR4A 1H75A 4OFNA 4ULXA 5IPHA 3APOA 4CW9A 3IOSA 5ENUA 5LD0A 1DE2A 1XBSA 1YJ6A 2PPTA 2FCHA 2XC2A 2IMEA 1K0BA 2DLXA 2HE3A 1U6TA 3CYNA 4OCFA 1ILOA 1TK0B 1OKDA 1K3OA 1V98A 3HDCA 2PGTA 3MWHA 2B3SA 1FG4A 2H1BA 3LXTA 3KCMA 3FYGA 2LQQA 1TP9A 4IQAA 1ZGNA 5J9BA 2LQOA 4EF0A 3US3A 4YQMA 1HQOA 3FKFA 1AQXA 1GUMA 2GT5A 1TW9A 2JZRA 2LEGA 3Q18A 3IAM2 1SENA 2PBJA 2L4CA 2ZNMA 1YY7A 2HSYA 4I97A 1TRUA 2FA8A 2JADA 3GSSA 5EPFA 3FHKA 5DCGA 3BOAA 4EC0A 3J7Yk 3PGTA 4RI6A 4K0NA 4ZB9A 2DMMA 1K0NA 3VWUA 1K0DA 2PERA 2LRTA 8GSSA 3VWWA 3KZQA 5G1LA 2GSRA 2BTOT 2J9HA 5IMAA 3KP8A 2H0IA 5D93A 3UVHA 3ZFBA 3D21A 3ZIJA 4ECJA 5ID2A 4F2IA 1PL2A 2O8VB 3D22A 2WFCA 1KEBA 4YH2A 1EEMA 6GSXA 3IV4A 2OJLA 1YF1A 1SD8A 1GUHA 2R5GA 2X8CA 19GSA 1YKCA 4GRFA 5HFKA 2C3TA 2KUCA 3VLNA 2K18A 3QPMA 4JU5A 1KNGA 1XWAA 4HOJA 2H30A 4KB3A 3FZAA 3ZLPA 1PA3A 4K6XA 1XVQA 1TRVA 1SJZA 1TK8B 2KHPA 2NPBA 4OMVA 2B6MA 2H0HA 5ECLB 1GRXA 1F2EA 2B5EA 2G0FA 3QAVA 3SBCA 2B7KA 1M2DA 2GLRA 3UL3A 4Z7XA 4NHWA 2DMLA 3C71A 4HUAA 3WD6A 2L6DA 3FK8A 2H6XA 4F0BA 3ZITA 4XRAA 3LSZA 1GSFA 2VUPA 4PXOA 3FZ9A 4ZB8A 3FZ5A 2H73A 3ERFA 3KXOA 3KGKA 3WGXA 1GSQA 5EL8A 1GTIA 4WXTA 1ZL9A 5IOWA 1SK0A 1FW1A 3HJOA 5J9CA 1KBNA 1TU8A 4Q5NA 2H72A 1PRXA 4TN8A 4MCUA 2I1UA 3VPTA 5G2ZA 3V1WA 3EVIA 2CX3A 6GSYA 4LMVA 1X5DA 1SU9A 2JSYA 3N5OA 4CDOA 1O7UA 5IMVA 3TKSC 4BVXA 3L0HA 1TK5B 4K7OA 1MTCA 3IK9A 2LNTA 2A2RA 4YAVA 2YZUA 3UBKA 2FWEA 4J2FA 2QSIA 1B4PA 2PWJA 2LJRA 1WWJA 5D9VA 4GWRA 4L8EA 4IN0A 1WRYA 3DD3A 2MMZA 1PD21 1XW6A 4O7HA 2IL3A 3D5JA 1CQGA 3H79A 1GL8A 2H75A 1OC8A 5JWQB 4TXVA 5B8AA 2V41A 1Q4JA 3VWXA 3IDVA 3FW2A 3ZL5A 2WDUA 1EWXA 3I6AA 5C04A 4MF6A 4K9ZA 4FYBA 3F9UA 2H0GA 4AJ8A 5A4WA 1I9DA 1EP7A 3DGQA 2JL4A 2DJ0A 1VF1A 2YZHA 2X8GA 4L5OA 4IQ1A 3GKMA 3QMXA 3H93A 2VL9A 1F9MA 3FR3A 1N8JA 3VI7A 4F0CA 2YWNA 5ECNB 1O81A 1GNWA 1N2AA 1NHOA 1XIYA 2PMTA 5CRWA 18GSA 4MZBA 2MYGA 3WT1A 2IWTA 1HNCA 2HZEA 4E8HA 1J08A 2HZFA 4DSSB 4YQUA 3C73A 1WOUA 3CSJA 2VO4A 12GSA 4IKHA 4MJEA 4WKWA 1MDIA 2CVKA 1R5PA 2R2JA 1YZXA 5ECQB 3J7Yb 1VF4A 5JCWA 4GTUA 1YEXA 1PMTA 1Z9HA 1XW9A 4GLTA 4KDXA 3RHCA 3WGDA 4X0XA 3CMIA 1G7EA 4HJ2A 2YWMA 2GSTA 2RLIA 4OFTA 2GTUA 4V1Ag 4HU7A 3ZMKA 1U3AA 3EMXA 3LGCA 3D6IA 4MA9A 1EEJA 4OWYA 1J0FA 2EIQA 2IFQA 1A8YA 1RK4A 2R4VA 3F6DA 1WJKA 3ME7A 3DXBA 3UAPA 1Z6NA 1F6MC 3GX8A 5DCHA 3F8UA 2TIRA 4MJCA 4IELA 3WT2A 3LG6A 2WGRA 5HR1A 6GSSA 4ECIA 2P5QA 1LJRA 2A4VA 3A5WA 2DIZA 3UARA 3MNGA 4WF5A 5HFGA 1XWGA 3KM6A 2I3YA 3TKRA 2MMAA 1ZZYA 4MK3A 1DSBA 1EV9A 3U5RE 4IVFA 3M0FA 3APSA 4JE1A 5DBQA 5J4UA 3O6TA 4XIHA 4J57E 3DRNA 4HQSA 4GSTA 1TTZA 3FY7A 1O8XA 1X9WB 2XBQA 4I6XA 5D9TA 1BX9A 1Z7RA 2OADA 1AAZA 3KMNA 1ERVA 4EO3A 4HZ4A 3TOUA 2N5AA 3P90A 4P3YB 1A0RP 3IBHA 1ZYEA 1V57A 2OA7A 1AUCA 2F51A 3TJBA 14GSA 2GZZA 2I81A 3F63A 3L9SA 1TJDA 1T1VA 1XFLA 1GWCA 3EU4A 3QR6A 3ZVJD 4POMA 3Q19A 5IOXA 2FA4A 22GSA 4Q5QA 2E2GA 4JR4A 2PU9C 3A3TA 3EMPA 5D73A 2RM5A 5CRGA 3UMAA 1U88A 2ZUPA 3F3RA 1YEPA 1PN9A 2HI7A 5F06A 4MABA 2TRCP 1XWCA 1M7TA 5G30A 1B9YC 3F4RA 2NVLA 2YP6A 3JCML 1A2JA 4DSRA 2QGVA 2YOIA 5CAXA 3P8WA 4DEJA 1OC9A 2L4QA 2HNLA 2CVDA 2I4AA 3ZFLA 2JU5A 1H4OA 3PR8A 3VWVA 4NAXA 2CV4A 2HRFA 4G9HA 4QQ7A 1AXDA 4LLRA 5ECIB 3KTBA 1GNEA 1THOA 2H6ZA 3GL5A 5G1KA 2C4JA 5GAND 2F8AA 5GAPD 1T00A 2OE1A 4WEYA 4AJ6A 3HZ4A 4TKYA 2VCZA 1TI1A 2E0QA 4GXZA 2K6VA 5DQYA 1GTBA 1V58A 2DJJA 5DAKA 1MDJA 4YAPA 3GSTA 4PQ1A 4ZILA 3GH9A 5DDLA 4PNGA 2V2GA 6GSTA 4L0UA 3CSHA 1X5CA 3QFAC 1BEDA 4I2TA 1EP8A 4ISDA 1QK8A 4MZCA 2YCDA 3RHBA 1GLQA 5IMFA 1EZKA 5ID2B 2VAFA 3R2QA 5AIXA 2LJKA 2IN3A 3TDGA 2GT6A 2REMA 5DJLA 4FIWA 1JZRA 2NTOA 3EYTA 1M9BA 4WBJA 2JZSA 1EV4A 1SD9A 4ZBBA 2VL2A 3KMOA 1F37A 1THXA 3ERWA 5IMDA 11GSA 4XS4B 4MPFA 4MJBA 4HQZA 3KEBA 5HR0A 2VOCA 2M46A 2IPAA 1SYXA 5IO2A 3HHVA 4FH8A 3F4TA 1M9AA 1XW5A 1X0RA 3GRXA 2ZCTA 3VK9A 2QKEA 4V1Ap 2LV3A 1DE1A 4ZL9A 2OE0A 2FWGA 2O89A 2YJHA 2H1DA 1QGVA 3CRTA 3PINA 5IO0A 5FWGA 2BJXA 4ID0A 1BG5A 3GKKA 3TB2A 4XCSA 1XCCA 4X1UA 4Q5RA 3FR6A 4RUVA 1K0OA 4FYUA 1WP0A 3ED3A 5F07A 1XOAA 2DJKA 1F3BA 3E0UA 1ABAA 3LEFA 1PKWA 3P7XA 10GSA 1WMJA 2VLTA 4L5LA 3EU3A 2GQLA 1TU7A 5J3RA 2Z9SA 1I5GA 2MMNA 1YKAA 1GH2A 2N5FA 4IW9A 4ZBDA 2O85A 4N10A 3TRPA 4EKZA 3C1SA 1GP1A 2LS5A 4ZB6A 5DQSA 2F8FA 2P5RA 4MLYA 4Q5FA 4WR5A 2RM6A 4RQXA 2C80A 3GIXA 2OKAA 2VLVA 4O92A 2VCWA 3EWLA 1VF2A 3H8QA 4OO4A 2J23A 3C7MA 2XPEA 4O5RA 5A4UA 3NZNA 5IQYA 2RIIA 5FT3A 3RAZA 2YWOA 4EXJA 1LBKA 4KCAA 1X9SB 3GHAA 4WETA 4G19A 4MF5A 3IXRA 1NHYA 4G2EA 2DC5A 4HEA2 2ES7A 1XZOA 4EUYA 3LYPA 2LNSA 1GSUA 2RUFA 1ERTA 3LQ7A 3N9JA 2K8SA 1WE0A 4FYCA 3HXSA 2K8VA 4QL9A 4ZL8A 5A4VA 3GTUB 4HS1A 2DSAA 5KN1A 1HNBA 4IS0A 4EDYA 1EGRA 4K8MA 1R5AA 1SKWB 4ZL7A 1SK2A 3O76A 2HXKA 4K2DA 5FHIA 4KW6A 3Q74A 4MF7A 2AB6A 1VRSD 3M1GA 3IE3A 3HKRA 4MMMA 1V9WA 3GNJA 3W6GA 4MJAA 3UBLA 4K7NA 1JZOA 5D9WA 1M2AA 3I69A 5JWRB 1SKSB 2IJYA 2H66A 2E2MA 3GN3A 3ZREA 1X9MB 4ZIJA 3DYRA 1B4QA 3I43A 3ISOA 4F03A 1T8EB 2G2QA 1TRSA 1T4ZA 2WZ9A 5ECSA 5ECPB 4RQRA 5HFIA 4KA0A 3RDWA 2C1YA 4V2LA 3F4SA 2PN8A 2XBIA 4ML6A 5D96A 5CNWA 5KEJA 4TXOB 1M2BA 4K0GA 3QAWA 3UOMA 1K0MA 3CXGA 1FO5A 3MAKA 4IJ3A 4KCEA 3TOTA 4J56E 2MBSA 2YPMA 1O85A 3E3EA 3DMLA 2VCVA 1K3LA 1GULA 3TRXA 2EIOA 1URMA 2LSTA 1JFUA 2PVOC 3UEMA 5AIVA 2C0GA 3F6FA 2IIYA 4L0WA 2JACA 1G6WA 1GSYA 2L59A 4ML1A 4CHSA 3L9VA 4TVEA 3ZZXA 2VM1A 4KX4A 1FVJA 4K1FA 1YDKA 3TKQA 9GSSA 5DALB 1G6YA 2H1GA 5CP1A 2H1AA 4WBRD 4ZBAA 1HYUA 3DVWA 2PVQA 2V32A 1B9XC 3HA9A 1X5EA 4GSNA 1FAAA 4NMUA 4TW5A 3TCOA 1ERUA 2R3XA 3CTFA 2FGXA 4TOPA 3NIVA 3CRUA 1S3CA 3BBYA 2O7KA 1SK1A 4PNFA 2H01A 1PX6A 1O8WA 2TRXA 3L78A 1IYHA 3DKSA 2V1MA 2H6YA 3OR5A 3NOFA 1SL1B 5H5QA 2VD0A 1G7OA 5HR2A 1XPVA 1NW2A 1FVKA 1MDKA 1OKTA 4DSSA 2JZTA 3EINA 3ZMLA 3HCZA 4PUAA 4IJIA 1T3BA 1NM3A 1J9BA 1ZMAA 3VPQA 3MSZA 1JLVA 2R6KA 5CO3A 2VL2C 2LJAA 2HFDA 1Q98A 4TR1B 4PUFC 4D73A 2M72A 4KDUA 6GSVA 3A2WA 2YN1A 2AAWA 2DIYA 1T7PB 1A2MA 4G10A 1QXHA 3TJFA 4BWQA 4TRXA 4JZQA 4EL1A 1A0FA 1GTUA 4BPYA 2OE3A 3BD2A 4HI7A 3TJJA 1GSEA 1ST9A 4KE3A 2AHEA 1A2LA 2C0EA 3FR9A 1HNAA 3KTLA 3HD5A 5CRDA 2N5BA 3DIEA 2WJUA 3GX0A 3HJMA 3D4TA 1EOHA 1A8LA 1FB0A 5IMZA 5IM9A 5ECOB 1Z5YE 1VF3A 3TKPA 5E59A 2XHFA 4HDEA 1TDIA 1K3YA 1KTEA 4I2UA 2CA8A 1ZCPA 4PQHA 5JCUA 3SWLA 1EOGA 4KNDA 1E2YA 2CZ2A 3F0IA 3QDNA 2GSQA 2LKUA 3C8EA 3GKNA 2CX4A 4IP1A 1PGTA 4MDCA 4ILFA 2HT9A 3W8JA 1YQ1A 1FOVA 3DEXA 3GYKA 3DVXA 4NV5A 3O3TA 3GH6A 1Y6EA 5GSSA 2VCXA 2GSSA 2C3QA 3C1RA 2CVBA 4RI7A 1OE8A 2O87A 2WCIA 5D8IA 1HD2A 1U87A 3GMFA 2FD3A 3KP9A 4V2MA 2B1KA 2AJQB 1MD3A 3QCPA 3BCKA 4POKA 5B8BA 1Z3EA 2C8UA 2D2ZA 2FWFA 4NXIA 5KN2A 5ECKB 3H4KA 5AISA 3FEUA 4XS1A 4ZXGA 3BJ5A 2GGTA 2OBKA 4MPGA 5A5KA 2C3NA 4OCEA 4KDYA 4HJMA 4TR0A 4IGJA 3TJKA 3W8SA 3GKXA 2HRNA 1OAZA 4I5QA 3UVTA 1UC7A 5DVBA 2VLUA 1RQMA 1S3DA 2WRTA 1AW9A 2NBSA 3RBTA 5ECRB 4N0VA 4BWSA 2EIRA 4LL4B 4XRDA 2KOKA 4HU9A 1IYIA 3ERGA 5INYA 4OFMA 1TI3A 3TGZA 1JLWA 1EGOA 1ZYQB
chains in the Genus database with same CATH superfamily
2MMOA 1USBA 3R3EA 1PL1A 5GSTA 2I9HA 1O6JA 5B7CA 5COHA 3L9UA 5KN0A 3ZRDA 1TXXA 1UN2A 3Q6OA 5E4WA 3EE2A 1PKZA 3U6VA 5IMCA 1Y25A 2FWHA 1ZYPA 3M8NA 5ABRA 2EC4A 2GZPA 4IHUA 4BA7A 2HSMA 2E7PA 2A2SA 1PX7A 3QD9A 5F05A 4CY8A 2L5LA 3LXZA 16GSA 4GCIA 4NPBA 2V6KA 4FO5A 5ELGA 1NSWA 5JWOB 1XVWA 5IIZA 1Z6MA 2IMKA 2K9FA 1MEKA 3P2AA 2CAIA 1BJXA 5LNKe 3M3MA 1M3JA 4XS4A 1GSSA 2GDRA 1U3IA 2IMDA 4BVXB 3ZVJA 1SYRA 1BAYA 1UA5A 2XPDA 3ZYWA 5EVOA 2H70A 2DJ1A 4BVYA 20GSA 3HYPA 3IC4A 1SL0B 3HVXA 3L4NA 3QAGA 1C72A 3TJGA 1AQVA 1OVNA 1OE7A 1VGLA 5ECHB 1AIUA 3A2XA 2OACA 1TOFA 1ML6A 2LRCA 1K0AA 2FLSA 2KP1A 2L57A 2P0GA 3ZIVA 5B6NA 1M0UA 2C0FA 2VL3A 1A23A 2KLXA 7GSSA 2GVPA 3GURA 4QL7A 3IA1A 3G7YA 5IPGA 4TR4A 2ALBA 2B1LA 2MZCA 2AUVA 2DJ2A 4EDZA 1JHBA 2RUEA 4MZWA 4KSMA 1WIKA 2YJ7A 5ELAA 4O32A 1XXUA 2BMXA 1OC3A 1R26A 1ERWA 5LCZA 5KN3A 4YQVA 1R7HA 3GA4A 3IRAA 4E8EA 4OO5A 5AGYA 3LWAA 1SJ6A 5EY6A 3EURA 1ACVA 1PSQA 2MBTA 2HZEB 5J41A 3E9JB 3G7JA 2H8LA 3WGEA 3CTGA 2GQMA 2CZ3A 4GSSA 1AQWA 4IBPA 2L6CA 1ZOFA 3HJPA 4DVCA 1R4WA 2PUKC 1GSDA 4EE0A 2X64A 5D9XA 4V2NA 4H86A 4N11A 4NHZA 1WPIA 2LTKA 1M99A 4XTSA 2FNOA 1PQNA 4GQFA 3TRQA 2QC7A 2ON5A 4I8BA 4X43A 1F3AA 4MH2A 3KJYA 3CBUA 3QFBC 1T4YA 4XS6A 1FB6A 4KAEA 5B6MA 2IFQB 3QOUA 4F9ZA 4POBA 2GS3A 3D0ZA 2WULA 3EC3A 2AV4A 5H5SA 4F82A 2VD1A 3H1NA 5JCGA 3GTUA 17GSA 1JZWA 4DSQA 4ECCA 3GUSA 2IMFA 1QMVA 1FHEA 4OD7A 5H5RA 2DKHA 5F8BA 3S9FA 3FZ4A 1TKDB 1BQ7A 2YNXA 1BYEA 1JZDA 4LA1A 2IMIA 1V40A 2H76A 4AGSA 1XWBA 3HZ8A 2VIMA 3A2VA 3LORA 2H71A 2B7JA 1M3IA 4IP6A 3PPUA 3IAS2 5J5NA 3TUEA 3LJRA 2C0DA 3IPZA 2WB9A 4JR6A 1O73A 1TRWA 4ECBA 4HZ2A 3WYWA 4D73B 3F3QA 2YANA 2UZ8A 2V6OA 3MDKA 1AC1A 2VCTA 1UVZA 2AYTA 5CRHA 3VI5A 5AN1A 2JSZA 4KH7A 3RPNA 1SJIA 1B8XA 3A5IA 5C00A 1W89A 5DJMA 2OBIA 4TXOA 5G5FA 5CREA 2ON7A 1MD4A 4PGTA 5L71A 1SL2B 2HYXA 5F0GA 2HSHA 1QUWA 4GQCA 2HLSA 3AY8A 4LMWA 1S3AA 3HVVA 2WS2A 4PURA 3GFKA 3TKSA 1B48A 2LRNA 4JEDA 2DBCA 2FY6A 3IR4A 2VCQA 4XHMA 2YV9A 1GLPA 1XWKA 4TR3A 5HR3A 1K0CA 3K8NA 3KD0A 4EVMA 3UJ1A 5KOWA 1PN0A 5HQPA 2X99A 2HRAA 2F9SA 3KIJA 2L5OA 3HY2A 1OC9B 2NDOA 1OYJA 4ACSA 6GSWA 5DALA 4PQIA 4BL7A 2DJ3A 4EIPA 2FHEA 5GZZB 3ZTLA 1Z7PA 2VM2A 1DUGA 3M9JA 3RPPA 4JRRA 1CQHA 4JBBA 4N30A 3IHGA 3DWVA 4PX1A 3VFIA 2B5YA 1QQ2A 1G0TA 3IK7A 1LU4A 2DKIA 3G9BA 4KGIA 1XOBA 5G5EA 2F3MA 2YWIA 3D4MA 5DAKB 6GSUA 2KP2A 2FUG2 3APQA 3HVSA 4AF2A 1W4VA 5ECMB 4KSOA 3LFLA 5G31A 3KH7A 3G7IA 4MH3A 2H19A 13GSA 2B5XA 2CAQA 4PTSA 3GL3A 4GF0A 4MP4A 3TKSE 3IHQA 2R37A 3UIWA 4NV2A 2CT6A 1RW1A 4NWYA 1GUKA 4WF4A 2CQ9A 3GV1A 3KH9A 3VURA 3CSIA 5CYYA 3LYKA 4TR1A 2GZYA 1SKRB 4N0ZA 4POLA 4LL1B 2LUSA 2X8HA 3M9KA 4AJ7A 1A24A 3MYDA 3PH9A 2H74A 1DBYA 3I9V2 1ON4A 1GTAA 4K7IA 4KUNA 3ME8A 3BCIA 2YV7A 1QFNA 1V2AA 3FRCA 2P31A 2M80A 1PFOA 2GQKA 1E6BA 1YF0A 4WR4A 1H75A 4OFNA 4ULXA 5IPHA 3APOA 4CW9A 3IOSA 5ENUA 5LD0A 1DE2A 1XBSA 1YJ6A 2PPTA 2FCHA 2XC2A 2IMEA 1K0BA 2DLXA 2HE3A 1U6TA 3CYNA 4OCFA 1ILOA 1TK0B 1OKDA 4X4JA 1K3OA 4BIKA 1V98A 3HDCA 2PGTA 3MWHA 2B3SA 1FG4A 2H1BA 3LXTA 4Z2TA 3KCMA 3FYGA 4FQUA 2LQQA 1TP9A 4IQAA 1ZGNA 5J9BA 2LQOA 4K2XA 4EF0A 3US3A 4YQMA 1HQOA 3FKFA 1AQXA 1GUMA 2GT5A 1TW9A 2JZRA 2LEGA 3Q18A 3IAM2 1SENA 2PBJA 2L4CA 2ZNMA 1YY7A 2HSYA 4I97A 1TRUA 2FA8A 4K5RA 2JADA 3GSSA 5EPFA 3FHKA 5DCGA 3BOAA 4EC0A 4Z2RA 3J7Yk 3PGTA 4RI6A 4K0NA 4ZB9A 2DMMA 1K0NA 3VWUA 1K0DA 2PERA 2LRTA 8GSSA 3VWWA 3KZQA 5G1LA 2GSRA 2BTOT 2J9HA 5IMAA 3KP8A 2H0IA 5D93A 3UVHA 3ZFBA 3D21A 3ZIJA 4ECJA 5ID2A 4F2IA 1PL2A 2O8VB 3D22A 2WFCA 1KEBA 4YH2A 1EEMA 6GSXA 3IV4A 2OJLA 1YF1A 1SD8A 4CY6A 1GUHA 2R5GA 2X8CA 19GSA 1YKCA 4GRFA 5HFKA 2C3TA 4EIQA 2KUCA 3VLNA 2K18A 3QPMA 4JU5A 1KNGA 1XWAA 4HOJA 2H30A 4KB3A 3FZAA 3ZLPA 1PA3A 4K6XA 1XVQA 1TRVA 1SJZA 1TK8B 2KHPA 2NPBA 4OMVA 2B6MA 2H0HA 5ECLB 1GRXA 1F2EA 2B5EA 2G0FA 3QAVA 3SBCA 2B7KA 1M2DA 2GLRA 3UL3A 4Z7XA 4NHWA 2DMLA 3C71A 4HUAA 3WD6A 2L6DA 3FK8A 2H6XA 4F0BA 3ZITA 4XRAA 3LSZA 1GSFA 2VUPA 4PXOA 3FZ9A 4ZB8A 3FZ5A 4O5QA 2H73A 3ERFA 3KXOA 3KGKA 3WGXA 1GSQA 5EL8A 1GTIA 4WXTA 1ZL9A 5IOWA 1SK0A 1FW1A 3HJOA 5J9CA 1KBNA 1TU8A 4Q5NA 2QA2A 2H72A 1PRXA 4TN8A 4MCUA 2I1UA 3VPTA 5G2ZA 3V1WA 3EVIA 2CX3A 6GSYA 4LMVA 1X5DA 1SU9A 2JSYA 3N5OA 4CDOA 1O7UA 5IMVA 3TKSC 4BVXA 3L0HA 1TK5B 4K7OA 1MTCA 3IK9A 2LNTA 2A2RA 4YAVA 3EPTA 2YZUA 3UBKA 2FWEA 4J2FA 2QSIA 1B4PA 2PWJA 2LJRA 1WWJA 5D9VA 4GWRA 4L8EA 4IN0A 1WRYA 3DD3A 2MMZA 1PD21 1XW6A 4O7HA 2IL3A 3D5JA 1CQGA 3H79A 1GL8A 2H75A 1OC8A 4ICYA 5JWQB 4TXVA 5B8AA 2V41A 1Q4JA 3VWXA 3IDVA 3FW2A 3ZL5A 2WDUA 1EWXA 3I6AA 5C04A 4MF6A 4K9ZA 4FYBA 3F9UA 2H0GA 4AJ8A 5A4WA 1I9DA 1EP7A 3DGQA 2JL4A 2DJ0A 1VF1A 2YZHA 2X8GA 4L5OA 4IQ1A 3GKMA 3QMXA 3H93A 2VL9A 1F9MA 3FR3A 1N8JA 3VI7A 4F0CA 2YWNA 5ECNB 1O81A 1GNWA 1N2AA 1NHOA 1XIYA 2PMTA 5CRWA 18GSA 4MZBA 2MYGA 3WT1A 1ZYNA 2IWTA 1HNCA 4YKFA 2HZEA 4E8HA 1J08A 2HZFA 4DSSB 4YQUA 3C73A 1WOUA 3CSJA 2VO4A 12GSA 4IKHA 4MJEA 4WKWA 1MDIA 2CVKA 1R5PA 2R2JA 1YZXA 5ECQB 3J7Yb 1VF4A 5JCWA 4GTUA 1YEXA 1PMTA 1Z9HA 1XW9A 4GLTA 4KDXA 4A5PA 3RHCA 3WGDA 4X0XA 3CMIA 1G7EA 4HJ2A 2YWMA 2GSTA 4G0IA 2RLIA 4OFTA 2GTUA 4V1Ag 4HU7A 3ZMKA 1U3AA 3EMXA 3LGCA 3D6IA 4MA9A 1EEJA 4OWYA 1J0FA 2EIQA 2IFQA 1A8YA 1RK4A 2R4VA 3F6DA 1WJKA 3ME7A 3DXBA 3UAPA 1Z6NA 1F6MC 3GX8A 5DCHA 3F8UA 2TIRA 4MJCA 4IELA 3WT2A 3LG6A 2WGRA 5HR1A 6GSSA 4ECIA 2P5QA 1LJRA 2A4VA 3A5WA 2DIZA 3UARA 3MNGA 4WF5A 5HFGA 1XWGA 3KM6A 2I3YA 3TKRA 2MMAA 1ZZYA 4MK3A 1DSBA 1EV9A 3U5RE 4IVFA 3M0FA 2R0CA 3APSA 4JE1A 5DBQA 5J4UA 3O6TA 4XIHA 4J57E 3DRNA 4HQSA 2X49A 1TTZA 4GSTA 3FY7A 4G0LA 1O8XA 1X9WB 2XBQA 4I6XA 5D9TA 1BX9A 1Z7RA 2OADA 1AAZA 3KMNA 1ERVA 4EO3A 4HZ4A 3TOUA 2N5AA 3P90A 4P3YB 1A0RP 3IBHA 1ZYEA 1V57A 2OA7A 1AUCA 2F51A 3TJBA 14GSA 2GZZA 2I81A 3F63A 3L9SA 1TJDA 1T1VA 1XFLA 1GWCA 2X4AA 3EU4A 3QR6A 3ZVJD 4POMA 3Q19A 5IOXA 2FA4A 22GSA 4Q5QA 2E2GA 4JR4A 2PU9C 3A3TA 3EMPA 5D73A 2RM5A 5CRGA 3UMAA 1U88A 2ZUPA 3F3RA 1YEPA 1PN9A 2HI7A 5F06A 4MABA 2TRCP 1XWCA 1M7TA 5G30A 1B9YC 3F4RA 2NVLA 2YP6A 3JCML 1A2JA 4DSRA 2QGVA 2YOIA 5CAXA 3P8WA 4DEJA 1OC9A 2L4QA 4O5UA 2HNLA 2CVDA 2I4AA 3ZFLA 2JU5A 1H4OA 3PR8A 3VWVA 4NAXA 2CV4A 2HRFA 4G9HA 4QQ7A 1AXDA 4LLRA 5ECIB 3KTBA 1GNEA 1THOA 2H6ZA 3GL5A 5G1KA 2C4JA 5GAND 2F8AA 5GAPD 1T00A 2OE1A 4WEYA 4AJ6A 2QA1A 3HZ4A 4TKYA 2VCZA 1TI1A 2E0QA 4GXZA 2K6VA 5DQYA 4Z2UA 1GTBA 1V58A 2DJJA 5DAKA 1MDJA 4YAPA 3GSTA 4PQ1A 4ZILA 3GH9A 5DDLA 4PNGA 2V2GA 6GSTA 4L0UA 3CSHA 1X5CA 3QFAC 1BEDA 4I2TA 1EP8A 4ISDA 1QK8A 4MZCA 2YCDA 3RHBA 1GLQA 5IMFA 1EZKA 5ID2B 2VAFA 3R2QA 5AIXA 2LJKA 2IN3A 3TDGA 2GT6A 4HSCX 2REMA 5DJLA 4FIWA 1JZRA 2NTOA 3EYTA 1M9BA 4WBJA 2JZSA 1S3RA 4YKGA 1EV4A 1SD9A 4ZBBA 2VL2A 3KMOA 1F37A 1THXA 3ERWA 5IMDA 11GSA 4XS4B 4MPFA 4MJBA 4HQZA 3KEBA 5HR0A 4BVYB 2VOCA 2M46A 2IPAA 1SYXA 5IO2A 3HHVA 4FH8A 3F4TA 1M9AA 1XW5A 1X0RA 3GRXA 2ZCTA 3VK9A 2QKEA 4V1Ap 2LV3A 1DE1A 4ZL9A 2OE0A 2FWGA 2O89A 2R0GA 2YJHA 2H1DA 1QGVA 3CRTA 3PINA 5IO0A 5FWGA 2BJXA 4ID0A 1BG5A 3GKKA 3TB2A 4XCSA 1XCCA 4X1UA 4Q5RA 3FR6A 4RUVA 1K0OA 4FYUA 3HVNA 1WP0A 3ED3A 5F07A 1XOAA 2DJKA 1F3BA 3E0UA 1ABAA 3LEFA 1PKWA 3P7XA 10GSA 1WMJA 2VLTA 4L5LA 3EU3A 2GQLA 1TU7A 5J3RA 2Z9SA 1I5GA 4K5SA 2MMNA 1YKAA 1GH2A 2N5FA 4IW9A 4MNNA 4ZBDA 2O85A 4N10A 3TRPA 4EKZA 3C1SA 1GP1A 2LS5A 4ZB6A 5DQSA 2F8FA 2P5RA 4MLYA 4Q5FA 4WR5A 2RM6A 4RQXA 3MIXA 2C80A 3GIXA 2OKAA 2VLVA 4O92A 2VCWA 3EWLA 1VF2A 3H8QA 4OO4A 2J23A 3C7MA 2XPEA 4O5RA 5A4UA 3NZNA 5IQYA 2RIIA 5FT3A 3RAZA 2YWOA 4EXJA 1LBKA 4KCAA 1X9SB 3GHAA 4WETA 4G19A 4MF5A 3IXRA 1NHYA 4G2EA 2DC5A 4HEA2 2ES7A 1XZOA 4EUYA 3LYPA 2LNSA 1GSUA 2RUFA 1ERTA 3LQ7A 3N9JA 2K8SA 1WE0A 4FYCA 3HXSA 2K8VA 4QL9A 4ZL8A 5A4VA 3GTUB 4KF9A 4HS1A 2DSAA 5KN1A 1HNBA 4IS0A 4EDYA 1EGRA 4K8MA 1R5AA 1SKWB 4ZL7A 1SK2A 3O76A 2HXKA 4K2DA 5FHIA 4KW6A 3Q74A 4MF7A 2AB6A 1VRSD 3M1GA 3IE3A 3HKRA 4MMMA 1V9WA 3GNJA 3W6GA 4MJAA 3UBLA 4K7NA 1JZOA 5D9WA 1M2AA 3I69A 5JWRB 1SKSB 2IJYA 2H66A 2E2MA 3GN3A 3ZREA 1X9MB 4ZIJA 3DYRA 1B4QA 4USSA 3I43A 3ISOA 4F03A 1T8EB 2G2QA 1TRSA 1T4ZA 2WZ9A 5ECSA 5ECPB 4RQRA 5HFIA 4KA0A 3RDWA 1FOHA 2C1YA 4V2LA 3F4SA 2PN8A 2XBIA 3LW9A 4ML6A 5D96A 5CNWA 5KEJA 4TXOB 1M2BA 4K0GA 3QAWA 3UOMA 1K0MA 3CXGA 1FO5A 3MAKA 4IJ3A 4KCEA 3TOTA 4J56E 2MBSA 2YPMA 1O85A 3E3EA 3DMLA 2VCVA 1K3LA 1GULA 3TRXA 2EIOA 1URMA 2LSTA 1JFUA 2PVOC 3UEMA 5AIVA 2C0GA 3F6FA 2IIYA 4L0WA 2JACA 1G6WA 1GSYA 2L59A 4ML1A 4CHSA 3L9VA 4TVEA 3ZZXA 2VM1A 4KX4A 1FVJA 4K1FA 1YDKA 3TKQA 9GSSA 5DALB 1G6YA 2H1GA 2A2PA 5CP1A 4BL7B 2H1AA 4WBRD 4ZBAA 1HYUA 3DVWA 2PVQA 2V32A 1B9XC 3HA9A 1X5EA 3CQFA 4GSNA 1FAAA 4NMUA 4TW5A 3TCOA 1ERUA 2R3XA 3CTFA 2FGXA 4TOPA 3NIVA 3CRUA 1S3CA 3BBYA 2O7KA 1SK1A 4PNFA 2H01A 1PX6A 1O8WA 2TRXA 3L78A 1IYHA 3DKSA 2V1MA 2H6YA 3OR5A 3NOFA 1SL1B 5H5QA 2VD0A 1G7OA 5HR2A 1XPVA 1NW2A 1FVKA 1MDKA 1OKTA 4DSSA 2JZTA 3EINA 3ZMLA 3HCZA 4PUAA 4IJIA 1T3BA 1NM3A 1J9BA 1ZMAA 3VPQA 3MSZA 1JLVA 2R6KA 5CO3A 2VL2C 2LJAA 2HFDA 1Q98A 4TR1B 4PUFC 4D73A 2M72A 4KDUA 6GSVA 3A2WA 3FMWA 1XG8A 2YN1A 2AAWA 2DIYA 1T7PB 1A2MA 4G10A 1QXHA 5KOXA 3TJFA 4BWQA 4TRXA 4JZQA 4EL1A 1A0FA 1GTUA 4BPYA 2OE3A 3BD2A 4HI7A 3TJJA 1GSEA 1ST9A 4KE3A 2AHEA 1A2LA 2C0EA 3FR9A 1HNAA 3KTLA 3HD5A 5CRDA 2N5BA 3DIEA 2WJUA 3GX0A 3HJMA 3D4TA 1EOHA 1A8LA 4G0KA 1FB0A 5IMZA 5IM9A 5ECOB 1Z5YE 1VF3A 3TKPA 5E59A 2XHFA 4HDEA 1TDIA 1K3YA 1KTEA 4I2UA 2CA8A 1ZCPA 4PQHA 5JCUA 3SWLA 1EOGA 4KNDA 1E2YA 2CZ2A 3F0IA 3QDNA 2GSQA 2LKUA 3C8EA 3GKNA 2CX4A 4IP1A 1PGTA 4MDCA 4ILFA 2HT9A 3W8JA 1YQ1A 1FOVA 3DEXA 3GYKA 3DVXA 4NV5A 3O3TA 3GH6A 1Y6EA 5GSSA 2VCXA 2GSSA 2C3QA 3C1RA 2CVBA 4RI7A 1OE8A 2O87A 2WCIA 1HD2A 5D8IA 1U87A 3GMFA 2FD3A 3KP9A 2HRKA 4V2MA 2B1KA 2AJQB 1MD3A 3QCPA 3BCKA 4POKA 5B8BA 1Z3EA 2C8UA 2D2ZA 2FWFA 4NXIA 5KN2A 5ECKB 3H4KA 5AISA 3FEUA 4XS1A 4ZXGA 3BJ5A 2GGTA 2OBKA 4MPGA 5A5KA 2C3NA 5BMUA 4OCEA 4KDYA 4HJMA 4TR0A 4IGJA 3TJKA 2A4HA 3W8SA 3GKXA 2HRNA 5BRTA 1OAZA 4I5QA 3UVTA 1UC7A 5DVBA 2VLUA 1RQMA 1S3DA 2WRTA 1AW9A 2NBSA 3RBTA 2R0PA 5ECRB 4N0VA 4BWSA 2EIRA 4LL4B 4XRDA 2KOKA 3IC8A 4HU9A 1IYIA 3ERGA 5INYA 4OFMA 1TI3A 3TGZA 1JLWA 1EGOA 1ZYQB
chains in the Genus database with same CATH topology
2MMOA 1USBA 3R3EA 1PL1A 5GSTA 2I9HA 1O6JA 5B7CA 5COHA 3L9UA 5KN0A 3ZRDA 1TXXA 1UN2A 3Q6OA 5E4WA 3EE2A 1PKZA 3U6VA 5IMCA 1Y25A 2FWHA 1ZYPA 3M8NA 5ABRA 2EC4A 2GZPA 4IHUA 4BA7A 2HSMA 2E7PA 2A2SA 1PX7A 3QD9A 5F05A 4CY8A 2L5LA 3LXZA 16GSA 4GCIA 4NPBA 2V6KA 4FO5A 5ELGA 1NSWA 5JWOB 1XVWA 5IIZA 1Z6MA 2IMKA 2K9FA 1MEKA 3P2AA 2CAIA 1BJXA 5LNKe 3M3MA 4XS4A 1GSSA 2GDRA 1U3IA 2IMDA 4BVXB 3ZVJA 1SYRA 1BAYA 1UA5A 2XPDA 3ZYWA 5EVOA 2H70A 2DJ1A 4BVYA 20GSA 3HYPA 3IC4A 1SL0B 3HVXA 3L4NA 3QAGA 1C72A 3TJGA 1AQVA 1OVNA 1OE7A 1VGLA 5ECHB 1AIUA 3A2XA 2OACA 1TOFA 1ML6A 2LRCA 1K0AA 2FLSA 2KP1A 2L57A 2P0GA 3ZIVA 5B6NA 1M0UA 2C0FA 2VL3A 1A23A 2KLXA 7GSSA 2GVPA 3GURA 4QL7A 3IA1A 3G7YA 5IPGA 4TR4A 2ALBA 2B1LA 2MZCA 2AUVA 2DJ2A 4EDZA 1JHBA 2RUEA 4MZWA 4KSMA 1WIKA 2YJ7A 5ELAA 4O32A 1XXUA 2BMXA 1OC3A 1R26A 1ERWA 5LCZA 5KN3A 4YQVA 1R7HA 3GA4A 3IRAA 4E8EA 4OO5A 5AGYA 3LWAA 1SJ6A 5EY6A 3EURA 1ACVA 1PSQA 2MBTA 2HZEB 5J41A 3E9JB 3G7JA 2H8LA 3WGEA 3CTGA 2GQMA 2CZ3A 4GSSA 1AQWA 4IBPA 2L6CA 1ZOFA 3HJPA 4DVCA 1R4WA 2PUKC 1GSDA 4EE0A 2X64A 5D9XA 4V2NA 4H86A 4N11A 4NHZA 1WPIA 2LTKA 1M99A 4XTSA 2FNOA 1PQNA 4GQFA 3TRQA 2QC7A 2ON5A 4I8BA 4X43A 1F3AA 4MH2A 3KJYA 3CBUA 3QFBC 1T4YA 4XS6A 1FB6A 4KAEA 5B6MA 2IFQB 3QOUA 4F9ZA 4POBA 2GS3A 3D0ZA 2WULA 3EC3A 2AV4A 5H5SA 4F82A 2VD1A 3H1NA 5JCGA 3GTUA 17GSA 1JZWA 4DSQA 4ECCA 3GUSA 2IMFA 1QMVA 1FHEA 4OD7A 5H5RA 2DKHA 5F8BA 3S9FA 3FZ4A 1TKDB 1BQ7A 2YNXA 1BYEA 1JZDA 4LA1A 2IMIA 1V40A 2H76A 4AGSA 1XWBA 3HZ8A 2VIMA 3A2VA 3LORA 2H71A 2B7JA 4IP6A 3PPUA 3IAS2 5J5NA 3TUEA 3LJRA 2C0DA 3IPZA 2WB9A 4JR6A 1O73A 1TRWA 4ECBA 4HZ2A 3WYWA 4D73B 3F3QA 2YANA 2UZ8A 2V6OA 3MDKA 1AC1A 2VCTA 1UVZA 2AYTA 5CRHA 3VI5A 5AN1A 2JSZA 4KH7A 3RPNA 1SJIA 1B8XA 3A5IA 5C00A 1W89A 5DJMA 2OBIA 4TXOA 5G5FA 5CREA 2ON7A 1MD4A 4PGTA 5L71A 1SL2B 2HYXA 5F0GA 2HSHA 1QUWA 4GQCA 2HLSA 3AY8A 4LMWA 1S3AA 3HVVA 2WS2A 4PURA 3GFKA 3TKSA 1B48A 2LRNA 4JEDA 2DBCA 2FY6A 3IR4A 2VCQA 4XHMA 2YV9A 1GLPA 1XWKA 4TR3A 5HR3A 1K0CA 3K8NA 3KD0A 4EVMA 3UJ1A 5KOWA 1PN0A 5HQPA 2X99A 2HRAA 2F9SA 3KIJA 2L5OA 3HY2A 1OC9B 2NDOA 1OYJA 4ACSA 6GSWA 5DALA 4PQIA 4BL7A 2DJ3A 4EIPA 2FHEA 5GZZB 3ZTLA 1Z7PA 2VM2A 1DUGA 3M9JA 3RPPA 4JRRA 1CQHA 4JBBA 4N30A 3IHGA 3DWVA 4PX1A 3VFIA 2B5YA 1QQ2A 1G0TA 3IK7A 1LU4A 2DKIA 3G9BA 4KGIA 1XOBA 5G5EA 2F3MA 2YWIA 3D4MA 5DAKB 6GSUA 2KP2A 2FUG2 3APQA 3HVSA 4AF2A 1W4VA 5ECMB 4KSOA 3LFLA 5G31A 3KH7A 3G7IA 4MH3A 2H19A 13GSA 2B5XA 2CAQA 4PTSA 3GL3A 4GF0A 4MP4A 3TKSE 3IHQA 2R37A 3UIWA 4NV2A 2CT6A 1RW1A 4NWYA 1GUKA 4WF4A 2CQ9A 3GV1A 3KH9A 3VURA 3CSIA 5CYYA 3LYKA 4TR1A 2GZYA 1SKRB 4N0ZA 4POLA 4LL1B 2LUSA 2X8HA 3M9KA 4AJ7A 1A24A 3MYDA 3PH9A 2H74A 1DBYA 3I9V2 1ON4A 1GTAA 4K7IA 4KUNA 3ME8A 3BCIA 2YV7A 1QFNA 1V2AA 3FRCA 2P31A 2M80A 2GQKA 1E6BA 1YF0A 4WR4A 1H75A 4OFNA 4ULXA 5IPHA 3APOA 4CW9A 3IOSA 5ENUA 5LD0A 1DE2A 1XBSA 1YJ6A 2PPTA 2FCHA 2XC2A 2IMEA 1K0BA 2DLXA 2HE3A 1U6TA 3CYNA 4OCFA 1ILOA 1TK0B 1OKDA 4X4JA 1K3OA 1V98A 3HDCA 2PGTA 3MWHA 2B3SA 1FG4A 2H1BA 3LXTA 4Z2TA 3KCMA 3FYGA 4FQUA 2LQQA 1TP9A 4IQAA 1ZGNA 5J9BA 2LQOA 4K2XA 4EF0A 3US3A 4YQMA 1HQOA 3FKFA 1AQXA 1GUMA 2GT5A 1TW9A 2JZRA 2LEGA 3Q18A 3IAM2 1SENA 2PBJA 2L4CA 2ZNMA 1YY7A 2HSYA 4I97A 1TRUA 2FA8A 4K5RA 2JADA 3GSSA 5EPFA 3FHKA 5DCGA 3BOAA 4EC0A 4Z2RA 3J7Yk 3PGTA 4RI6A 4K0NA 4ZB9A 2DMMA 1K0NA 3VWUA 1K0DA 2PERA 2LRTA 8GSSA 3VWWA 3KZQA 5G1LA 2GSRA 2BTOT 2J9HA 5IMAA 3KP8A 2H0IA 5D93A 3UVHA 3ZFBA 3D21A 3ZIJA 4ECJA 5ID2A 4F2IA 1PL2A 2O8VB 3D22A 2WFCA 1KEBA 4YH2A 1EEMA 6GSXA 3IV4A 2OJLA 1YF1A 1SD8A 4CY6A 1GUHA 2R5GA 2X8CA 19GSA 1YKCA 4GRFA 5HFKA 2C3TA 4EIQA 2KUCA 3VLNA 2K18A 3QPMA 4JU5A 1KNGA 1XWAA 4HOJA 2H30A 4KB3A 3FZAA 3ZLPA 1PA3A 4K6XA 1XVQA 1TRVA 1SJZA 1TK8B 2KHPA 2NPBA 4OMVA 2B6MA 2H0HA 5ECLB 1GRXA 1F2EA 2B5EA 2G0FA 3QAVA 3SBCA 2B7KA 1M2DA 2GLRA 3UL3A 4Z7XA 4NHWA 2DMLA 3C71A 4HUAA 3WD6A 2L6DA 3FK8A 2H6XA 4F0BA 3ZITA 4XRAA 3LSZA 1GSFA 2VUPA 4PXOA 3FZ9A 4ZB8A 3FZ5A 4O5QA 2H73A 3ERFA 3KXOA 3KGKA 3WGXA 1GSQA 5EL8A 1GTIA 4WXTA 1ZL9A 5IOWA 1SK0A 1FW1A 3HJOA 5J9CA 1KBNA 1TU8A 4Q5NA 2QA2A 2H72A 1PRXA 4TN8A 4MCUA 2I1UA 3VPTA 5G2ZA 3V1WA 3EVIA 2CX3A 6GSYA 4LMVA 1X5DA 1SU9A 2JSYA 3N5OA 4CDOA 1O7UA 5IMVA 3TKSC 4BVXA 3L0HA 1TK5B 4K7OA 1MTCA 3IK9A 2LNTA 2A2RA 4YAVA 3EPTA 2YZUA 3UBKA 2FWEA 4J2FA 2QSIA 1B4PA 2PWJA 2LJRA 1WWJA 5D9VA 4GWRA 4L8EA 4IN0A 1WRYA 3DD3A 2MMZA 1PD21 1XW6A 4O7HA 2IL3A 3D5JA 1CQGA 3H79A 1GL8A 2H75A 1OC8A 4ICYA 5JWQB 4TXVA 5B8AA 2V41A 1Q4JA 3VWXA 3IDVA 3FW2A 3ZL5A 2WDUA 1EWXA 3I6AA 5C04A 4MF6A 4K9ZA 4FYBA 3F9UA 2H0GA 4AJ8A 5A4WA 1I9DA 1EP7A 3DGQA 2JL4A 2DJ0A 1VF1A 2YZHA 2X8GA 4L5OA 4IQ1A 3GKMA 3QMXA 3H93A 2VL9A 1F9MA 3FR3A 1N8JA 3VI7A 4F0CA 2YWNA 5ECNB 1O81A 1GNWA 1N2AA 1NHOA 1XIYA 2PMTA 5CRWA 18GSA 4MZBA 2MYGA 3WT1A 1ZYNA 2IWTA 1HNCA 4YKFA 2HZEA 4E8HA 1J08A 2HZFA 4DSSB 4YQUA 3C73A 1WOUA 3CSJA 2VO4A 12GSA 4IKHA 4MJEA 4WKWA 1MDIA 2CVKA 1R5PA 2R2JA 1YZXA 5ECQB 3J7Yb 1VF4A 5JCWA 4GTUA 1YEXA 1PMTA 1Z9HA 1XW9A 4GLTA 4KDXA 4A5PA 3RHCA 3WGDA 4X0XA 3CMIA 1G7EA 4HJ2A 2YWMA 2GSTA 4G0IA 2RLIA 4OFTA 2GTUA 4V1Ag 4HU7A 3ZMKA 1U3AA 3EMXA 3LGCA 3D6IA 4MA9A 1EEJA 4OWYA 1J0FA 2EIQA 2IFQA 1A8YA 1RK4A 2R4VA 3F6DA 1WJKA 3ME7A 3DXBA 3UAPA 1Z6NA 1F6MC 3GX8A 5DCHA 3F8UA 2TIRA 4MJCA 4IELA 3WT2A 3LG6A 2WGRA 5HR1A 6GSSA 4ECIA 2P5QA 1LJRA 2A4VA 3A5WA 2DIZA 3UARA 3MNGA 4WF5A 5HFGA 1XWGA 3KM6A 2I3YA 3TKRA 2MMAA 1ZZYA 4MK3A 1DSBA 1EV9A 3U5RE 4IVFA 3M0FA 2R0CA 3APSA 4JE1A 5DBQA 5J4UA 3O6TA 4XIHA 4J57E 3DRNA 4HQSA 2X49A 1TTZA 4GSTA 3FY7A 4G0LA 1O8XA 1X9WB 2XBQA 4I6XA 5D9TA 1BX9A 1Z7RA 2OADA 1AAZA 3KMNA 1ERVA 4EO3A 4HZ4A 3TOUA 2N5AA 3P90A 4P3YB 1A0RP 3IBHA 1ZYEA 1V57A 2OA7A 1AUCA 2F51A 3TJBA 14GSA 2GZZA 2I81A 3F63A 3L9SA 1TJDA 1T1VA 1XFLA 1GWCA 2X4AA 3EU4A 3QR6A 3ZVJD 4POMA 3Q19A 5IOXA 2FA4A 22GSA 4Q5QA 2E2GA 4JR4A 2PU9C 3A3TA 3EMPA 5D73A 2RM5A 5CRGA 3UMAA 1U88A 2ZUPA 3F3RA 1YEPA 1PN9A 2HI7A 5F06A 4MABA 2TRCP 1XWCA 1M7TA 5G30A 1B9YC 3F4RA 2NVLA 2YP6A 3JCML 1A2JA 4DSRA 2QGVA 2YOIA 5CAXA 3P8WA 4DEJA 1OC9A 2L4QA 4O5UA 2HNLA 2CVDA 2I4AA 3ZFLA 2JU5A 1H4OA 3PR8A 3VWVA 4NAXA 2CV4A 2HRFA 4G9HA 4QQ7A 1AXDA 4LLRA 5ECIB 3KTBA 1GNEA 1THOA 2H6ZA 3GL5A 5G1KA 2C4JA 5GAND 2F8AA 5GAPD 1T00A 2OE1A 4WEYA 4AJ6A 2QA1A 3HZ4A 4TKYA 2VCZA 1TI1A 2E0QA 4GXZA 2K6VA 5DQYA 4Z2UA 1GTBA 1V58A 2DJJA 5DAKA 1MDJA 4YAPA 3GSTA 4PQ1A 4ZILA 3GH9A 5DDLA 4PNGA 2V2GA 6GSTA 4L0UA 3CSHA 1X5CA 3QFAC 1BEDA 4I2TA 1EP8A 4ISDA 1QK8A 4MZCA 2YCDA 3RHBA 1GLQA 5IMFA 1EZKA 5ID2B 2VAFA 3R2QA 5AIXA 2LJKA 2IN3A 3TDGA 2GT6A 2REMA 5DJLA 4FIWA 1JZRA 2NTOA 3EYTA 1M9BA 4WBJA 2JZSA 4YKGA 1EV4A 1SD9A 4ZBBA 2VL2A 3KMOA 1F37A 1THXA 3ERWA 5IMDA 11GSA 4XS4B 4MPFA 4MJBA 4HQZA 3KEBA 5HR0A 4BVYB 2VOCA 2M46A 2IPAA 1SYXA 5IO2A 3HHVA 4FH8A 3F4TA 1M9AA 1XW5A 1X0RA 3GRXA 2ZCTA 3VK9A 2QKEA 4V1Ap 2LV3A 1DE1A 4ZL9A 2OE0A 2FWGA 2O89A 2R0GA 2YJHA 2H1DA 1QGVA 3CRTA 3PINA 5IO0A 5FWGA 2BJXA 4ID0A 1BG5A 3GKKA 3TB2A 4XCSA 1XCCA 4X1UA 4Q5RA 3FR6A 4RUVA 1K0OA 4FYUA 1WP0A 3ED3A 5F07A 1XOAA 2DJKA 1F3BA 3E0UA 1ABAA 3LEFA 1PKWA 3P7XA 10GSA 1WMJA 2VLTA 4L5LA 3EU3A 2GQLA 1TU7A 5J3RA 2Z9SA 1I5GA 4K5SA 2MMNA 1YKAA 1GH2A 2N5FA 4IW9A 4MNNA 4ZBDA 2O85A 4N10A 3TRPA 4EKZA 3C1SA 1GP1A 2LS5A 4ZB6A 5DQSA 2F8FA 2P5RA 4MLYA 4Q5FA 4WR5A 2RM6A 4RQXA 3MIXA 2C80A 3GIXA 2OKAA 2VLVA 4O92A 2VCWA 3EWLA 1VF2A 3H8QA 4OO4A 2J23A 3C7MA 2XPEA 4O5RA 5A4UA 3NZNA 5IQYA 2RIIA 5FT3A 3RAZA 2YWOA 4EXJA 1LBKA 4KCAA 1X9SB 3GHAA 4WETA 4G19A 4MF5A 3IXRA 1NHYA 4G2EA 2DC5A 4HEA2 2ES7A 1XZOA 4EUYA 3LYPA 2LNSA 1GSUA 2RUFA 1ERTA 3LQ7A 3N9JA 2K8SA 1WE0A 4FYCA 3HXSA 2K8VA 4QL9A 4ZL8A 5A4VA 3GTUB 4KF9A 4HS1A 2DSAA 5KN1A 1HNBA 4IS0A 4EDYA 1EGRA 4K8MA 1R5AA 1SKWB 4ZL7A 1SK2A 3O76A 2HXKA 4K2DA 5FHIA 4KW6A 3Q74A 4MF7A 2AB6A 1VRSD 3M1GA 3IE3A 3HKRA 4MMMA 1V9WA 3GNJA 3W6GA 4MJAA 3UBLA 4K7NA 1JZOA 5D9WA 1M2AA 3I69A 5JWRB 1SKSB 2IJYA 2H66A 2E2MA 3GN3A 3ZREA 1X9MB 4ZIJA 3DYRA 1B4QA 4USSA 3I43A 3ISOA 4F03A 1T8EB 2G2QA 1TRSA 1T4ZA 2WZ9A 5ECSA 5ECPB 4RQRA 5HFIA 4KA0A 3RDWA 1FOHA 2C1YA 4V2LA 3F4SA 2PN8A 2XBIA 3LW9A 4ML6A 5D96A 5CNWA 5KEJA 4TXOB 1M2BA 4K0GA 3QAWA 3UOMA 1K0MA 3CXGA 1FO5A 3MAKA 4IJ3A 4KCEA 3TOTA 4J56E 2MBSA 2YPMA 1O85A 3E3EA 3DMLA 2VCVA 1K3LA 1GULA 3TRXA 2EIOA 1URMA 2LSTA 1JFUA 2PVOC 3UEMA 5AIVA 2C0GA 3F6FA 2IIYA 4L0WA 2JACA 1G6WA 1GSYA 2L59A 4ML1A 4CHSA 3L9VA 4TVEA 3ZZXA 2VM1A 4KX4A 1FVJA 4K1FA 1YDKA 3TKQA 9GSSA 5DALB 1G6YA 2H1GA 2A2PA 5CP1A 4BL7B 2H1AA 4WBRD 4ZBAA 1HYUA 3DVWA 2PVQA 2V32A 1B9XC 3HA9A 1X5EA 4GSNA 1FAAA 4NMUA 4TW5A 3TCOA 1ERUA 2R3XA 3CTFA 2FGXA 4TOPA 3NIVA 3CRUA 1S3CA 3BBYA 2O7KA 1SK1A 4PNFA 2H01A 1PX6A 1O8WA 2TRXA 3L78A 1IYHA 3DKSA 2V1MA 2H6YA 3OR5A 3NOFA 1SL1B 5H5QA 2VD0A 1G7OA 5HR2A 1XPVA 1NW2A 1FVKA 1MDKA 1OKTA 4DSSA 2JZTA 3EINA 3ZMLA 3HCZA 4PUAA 4IJIA 1T3BA 1NM3A 1J9BA 1ZMAA 3VPQA 3MSZA 1JLVA 2R6KA 5CO3A 2VL2C 2LJAA 2HFDA 1Q98A 4TR1B 4PUFC 4D73A 2M72A 4KDUA 6GSVA 3A2WA 3FMWA 2YN1A 2AAWA 2DIYA 1T7PB 1A2MA 4G10A 1QXHA 5KOXA 3TJFA 4BWQA 4TRXA 4JZQA 4EL1A 1A0FA 1GTUA 4BPYA 2OE3A 3BD2A 4HI7A 3TJJA 1GSEA 1ST9A 4KE3A 2AHEA 1A2LA 2C0EA 3FR9A 1HNAA 3KTLA 3HD5A 5CRDA 2N5BA 3DIEA 2WJUA 3GX0A 3HJMA 3D4TA 1EOHA 1A8LA 4G0KA 1FB0A 5IMZA 5IM9A 5ECOB 1Z5YE 1VF3A 3TKPA 5E59A 2XHFA 4HDEA 1TDIA 1K3YA 1KTEA 4I2UA 2CA8A 1ZCPA 4PQHA 5JCUA 3SWLA 1EOGA 4KNDA 1E2YA 2CZ2A 3F0IA 3QDNA 2GSQA 2LKUA 3C8EA 3GKNA 2CX4A 4IP1A 1PGTA 4MDCA 4ILFA 2HT9A 3W8JA 1YQ1A 1FOVA 3DEXA 3GYKA 3DVXA 4NV5A 3O3TA 3GH6A 1Y6EA 5GSSA 2VCXA 2GSSA 2C3QA 3C1RA 2CVBA 4RI7A 1OE8A 2O87A 2WCIA 1HD2A 5D8IA 1U87A 3GMFA 2FD3A 3KP9A 2HRKA 4V2MA 2B1KA 2AJQB 1MD3A 3QCPA 3BCKA 4POKA 5B8BA 1Z3EA 2C8UA 2D2ZA 2FWFA 4NXIA 5KN2A 5ECKB 3H4KA 5AISA 3FEUA 4XS1A 4ZXGA 3BJ5A 2GGTA 2OBKA 4MPGA 5A5KA 2C3NA 5BMUA 4OCEA 4KDYA 4HJMA 4TR0A 4IGJA 3TJKA 2A4HA 3W8SA 3GKXA 2HRNA 5BRTA 1OAZA 4I5QA 3UVTA 1UC7A 5DVBA 2VLUA 1RQMA 1S3DA 2WRTA 1AW9A 2NBSA 3RBTA 2R0PA 5ECRB 4N0VA 4BWSA 2EIRA 4LL4B 4XRDA 2KOKA 3IC8A 4HU9A 1IYIA 3ERGA 5INYA 4OFMA 1TI3A 3TGZA 1JLWA 1EGOA 1ZYQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MMO A;  1USB A;  1PL1 A;  5GST A;  2I9H A;  1O6J A;  5B7C A;  5COH A;  3L9U A;  5KN0 A;  3ZRD A;  1TXX A;  1UN2 A;  3Q6O A;  5E4W A;  3EE2 A;  1PKZ A;  3U6V A;  5IMC A;  1Y25 A;  2FWH A;  3M8N A;  5ABR A;  2EC4 A;  2GZP A;  4IHU A;  4BA7 A;  2E7P A;  2A2S A;  1PX7 A;  3QD9 A;  5F05 A;  2L5L A;  3LXZ A;  16GS A;  4GCI A;  4NPB A;  2V6K A;  4FO5 A;  5ELG A;  1NSW A;  5JWO B;  1XVW A;  5IIZ A;  1Z6M A;  2IMK A;  2K9F A;  1MEK A;  3P2A A;  2CAI A;  1BJX A;  5LNK e;  3M3M A;  4XS4 A;  1GSS A;  2GDR A;  1U3I A;  2IMD A;  3ZVJ A;  1SYR A;  1BAY A;  1UA5 A;  2XPD A;  3ZYW A;  5EVO A;  2H70 A;  2DJ1 A;  4BVY A;  20GS A;  3HYP A;  3IC4 A;  1SL0 B;  3HVX A;  3L4N A;  3QAG A;  1C72 A;  3TJG A;  1AQV A;  1OVN A;  1OE7 A;  1VGL A;  5ECH B;  1AIU A;  3A2X A;  2OAC A;  1TOF A;  1ML6 A;  2LRC A;  1K0A A;  2FLS A;  2KP1 A;  2L57 A;  2P0G A;  3ZIV A;  5B6N A;  1M0U A;  2C0F A;  2VL3 A;  1A23 A;  2KLX A;  7GSS A;  2GVP A;  3GUR A;  4QL7 A;  3IA1 A;  3G7Y A;  5IPG A;  4TR4 A;  2ALB A;  2B1L A;  2MZC A;  2AUV A;  2DJ2 A;  4EDZ A;  1JHB A;  2RUE A;  4MZW A;  4KSM A;  1WIK A;  2YJ7 A;  5ELA A;  4O32 A;  1XXU A;  2BMX A;  1OC3 A;  1R26 A;  1ERW A;  5LCZ A;  5KN3 A;  4YQV A;  1R7H A;  3GA4 A;  3IRA A;  4E8E A;  4OO5 A;  5AGY A;  3LWA A;  1SJ6 A;  5EY6 A;  3EUR A;  1ACV A;  1PSQ A;  2MBT A;  2HZE B;  5J41 A;  3E9J B;  3G7J A;  2H8L A;  3WGE A;  3CTG A;  2GQM A;  2CZ3 A;  4GSS A;  1AQW A;  4IBP A;  2L6C A;  1ZOF A;  3HJP A;  4DVC A;  1R4W A;  2PUK C;  1GSD A;  4EE0 A;  2X64 A;  5D9X A;  4V2N A;  4H86 A;  4N11 A;  4NHZ A;  1WPI A;  2LTK A;  1M99 A;  4XTS A;  2FNO A;  1PQN A;  4GQF A;  3TRQ A;  2QC7 A;  2ON5 A;  4I8B A;  4X43 A;  1F3A A;  4MH2 A;  3KJY A;  3CBU A;  3QFB C;  1T4Y A;  4XS6 A;  1FB6 A;  4KAE A;  5B6M A;  2IFQ B;  3QOU A;  4F9Z A;  4POB A;  2GS3 A;  3D0Z A;  2WUL A;  3EC3 A;  2AV4 A;  5H5S A;  4F82 A;  2VD1 A;  3H1N A;  5JCG A;  3GTU A;  17GS A;  1JZW A;  4DSQ A;  4ECC A;  3GUS A;  2IMF A;  1QMV A;  1FHE A;  4OD7 A;  5H5R A;  5F8B A;  3S9F A;  3FZ4 A;  1TKD B;  1BQ7 A;  2YNX A;  1BYE A;  1JZD A;  4LA1 A;  2IMI A;  1V40 A;  2H76 A;  4AGS A;  1XWB A;  3HZ8 A;  2VIM A;  3A2V A;  3LOR A;  2H71 A;  2B7J A;  4IP6 A;  3IAS 2;  5J5N A;  3TUE A;  3LJR A;  2C0D A;  3IPZ A;  2WB9 A;  4JR6 A;  1O73 A;  1TRW A;  4ECB A;  4HZ2 A;  3WYW A;  4D73 B;  3F3Q A;  2YAN A;  2V6O A;  3MDK A;  1AC1 A;  2VCT A;  1UVZ A;  2AYT A;  5CRH A;  3VI5 A;  5AN1 A;  2JSZ A;  4KH7 A;  3RPN A;  1SJI A;  1B8X A;  5C00 A;  1W89 A;  5DJM A;  2OBI A;  4TXO A;  5G5F A;  5CRE A;  2ON7 A;  1MD4 A;  4PGT A;  5L71 A;  1SL2 B;  2HYX A;  5F0G A;  2HSH A;  1QUW A;  4GQC A;  2HLS A;  3AY8 A;  4LMW A;  1S3A A;  3HVV A;  2WS2 A;  4PUR A;  3GFK A;  3TKS A;  1B48 A;  2LRN A;  4JED A;  2DBC A;  2FY6 A;  3IR4 A;  2VCQ A;  4XHM A;  2YV9 A;  1GLP A;  1XWK A;  4TR3 A;  5HR3 A;  1K0C A;  3K8N A;  3KD0 A;  4EVM A;  3UJ1 A;  5HQP A;  2X99 A;  2F9S A;  3KIJ A;  2L5O A;  3HY2 A;  1OC9 B;  2NDO A;  1OYJ A;  4ACS A;  6GSW A;  5DAL A;  4PQI A;  4BL7 A;  2DJ3 A;  2FHE A;  5GZZ B;  3ZTL A;  1Z7P A;  2VM2 A;  1DUG A;  3M9J A;  3RPP A;  4JRR A;  1CQH A;  4JBB A;  4N30 A;  3DWV A;  4PX1 A;  3VFI A;  2B5Y A;  1QQ2 A;  1G0T A;  3IK7 A;  1LU4 A;  3G9B A;  4KGI A;  1XOB A;  5G5E A;  2F3M A;  2YWI A;  3D4M A;  5DAK B;  6GSU A;  2KP2 A;  2FUG 2;  3APQ A;  3HVS A;  4AF2 A;  1W4V A;  5ECM B;  4KSO A;  3LFL A;  5G31 A;  3KH7 A;  3G7I A;  4MH3 A;  2H19 A;  13GS A;  2B5X A;  2CAQ A;  3GL3 A;  4GF0 A;  4MP4 A;  3TKS E;  3IHQ A;  2R37 A;  3UIW A;  4NV2 A;  2CT6 A;  1RW1 A;  4NWY A;  1GUK A;  4WF4 A;  2CQ9 A;  3GV1 A;  3KH9 A;  3VUR A;  3CSI A;  5CYY A;  3LYK A;  4TR1 A;  2GZY A;  1SKR B;  4N0Z A;  4POL A;  4LL1 B;  2LUS A;  2X8H A;  3M9K A;  4AJ7 A;  1A24 A;  3PH9 A;  2H74 A;  1DBY A;  3I9V 2;  1ON4 A;  1GTA A;  4K7I A;  4KUN A;  3ME8 A;  3BCI A;  2YV7 A;  1QFN A;  1V2A A;  3FRC A;  2P31 A;  2M80 A;  2GQK A;  1E6B A;  1YF0 A;  4WR4 A;  1H75 A;  4OFN A;  4ULX A;  5IPH A;  3APO A;  4CW9 A;  3IOS A;  5ENU A;  5LD0 A;  1DE2 A;  1XBS A;  1YJ6 A;  2PPT A;  2FCH A;  2XC2 A;  2IME A;  1K0B A;  2DLX A;  2HE3 A;  1U6T A;  3CYN A;  4OCF A;  1ILO A;  1TK0 B;  1OKD A;  1K3O A;  1V98 A;  3HDC A;  2PGT A;  3MWH A;  2B3S A;  1FG4 A;  2H1B A;  3LXT A;  3KCM A;  3FYG A;  2LQQ A;  1TP9 A;  4IQA A;  1ZGN A;  5J9B A;  2LQO A;  4EF0 A;  3US3 A;  4YQM A;  1HQO A;  3FKF A;  1AQX A;  1GUM A;  2GT5 A;  1TW9 A;  2JZR A;  2LEG A;  3Q18 A;  3IAM 2;  1SEN A;  2PBJ A;  2L4C A;  2ZNM A;  1YY7 A;  2HSY A;  4I97 A;  1TRU A;  2FA8 A;  2JAD A;  3GSS A;  5EPF A;  3FHK A;  5DCG A;  3BOA A;  4EC0 A;  3J7Y k;  3PGT A;  4RI6 A;  4K0N A;  4ZB9 A;  2DMM A;  1K0N A;  3VWU A;  1K0D A;  2PER A;  2LRT A;  8GSS A;  3VWW A;  3KZQ A;  5G1L A;  2GSR A;  2BTO T;  2J9H A;  5IMA A;  3KP8 A;  2H0I A;  5D93 A;  3UVH A;  3ZFB A;  3D21 A;  3ZIJ A;  4ECJ A;  5ID2 A;  4F2I A;  1PL2 A;  2O8V B;  3D22 A;  2WFC A;  1KEB A;  4YH2 A;  1EEM A;  6GSX A;  3IV4 A;  2OJL A;  1YF1 A;  1SD8 A;  1GUH A;  2R5G A;  2X8C A;  19GS A;  1YKC A;  4GRF A;  5HFK A;  2C3T A;  2KUC A;  3VLN A;  2K18 A;  3QPM A;  4JU5 A;  1KNG A;  1XWA A;  4HOJ A;  2H30 A;  4KB3 A;  3FZA A;  3ZLP A;  1PA3 A;  4K6X A;  1XVQ A;  1TRV A;  1SJZ A;  1TK8 B;  2KHP A;  2NPB A;  4OMV A;  2B6M A;  2H0H A;  5ECL B;  1GRX A;  1F2E A;  2B5E A;  2G0F A;  3QAV A;  3SBC A;  2B7K A;  1M2D A;  2GLR A;  3UL3 A;  4Z7X A;  4NHW A;  2DML A;  3C71 A;  4HUA A;  3WD6 A;  2L6D A;  3FK8 A;  2H6X A;  4F0B A;  3ZIT A;  4XRA A;  3LSZ A;  1GSF A;  2VUP A;  4PXO A;  3FZ9 A;  4ZB8 A;  3FZ5 A;  2H73 A;  3ERF A;  3KXO A;  3KGK A;  3WGX A;  1GSQ A;  5EL8 A;  1GTI A;  4WXT A;  1ZL9 A;  5IOW A;  1SK0 A;  1FW1 A;  3HJO A;  5J9C A;  1KBN A;  1TU8 A;  4Q5N A;  2H72 A;  1PRX A;  4TN8 A;  4MCU A;  2I1U A;  3VPT A;  5G2Z A;  3V1W A;  3EVI A;  2CX3 A;  6GSY A;  4LMV A;  1X5D A;  1SU9 A;  2JSY A;  3N5O A;  4CDO A;  1O7U A;  5IMV A;  3TKS C;  4BVX A;  3L0H A;  1TK5 B;  4K7O A;  1MTC A;  3IK9 A;  2LNT A;  2A2R A;  4YAV A;  2YZU A;  3UBK A;  2FWE A;  4J2F A;  2QSI A;  1B4P A;  2PWJ A;  2LJR A;  1WWJ A;  5D9V A;  4GWR A;  4L8E A;  4IN0 A;  1WRY A;  3DD3 A;  2MMZ A;  1PD2 1;  1XW6 A;  4O7H A;  2IL3 A;  3D5J A;  1CQG A;  3H79 A;  1GL8 A;  2H75 A;  1OC8 A;  5JWQ B;  4TXV A;  5B8A A;  2V41 A;  1Q4J A;  3VWX A;  3IDV A;  3FW2 A;  3ZL5 A;  2WDU A;  1EWX A;  3I6A A;  5C04 A;  4MF6 A;  4K9Z A;  4FYB A;  3F9U A;  2H0G A;  4AJ8 A;  5A4W A;  1I9D A;  1EP7 A;  3DGQ A;  2JL4 A;  2DJ0 A;  1VF1 A;  2YZH A;  2X8G A;  4L5O A;  4IQ1 A;  3GKM A;  3QMX A;  3H93 A;  2VL9 A;  1F9M A;  3FR3 A;  1N8J A;  3VI7 A;  4F0C A;  2YWN A;  5ECN B;  1O81 A;  1GNW A;  1N2A A;  1NHO A;  1XIY A;  2PMT A;  5CRW A;  18GS A;  4MZB A;  2MYG A;  3WT1 A;  2IWT A;  1HNC A;  2HZE A;  4E8H A;  1J08 A;  2HZF A;  4DSS B;  4YQU A;  3C73 A;  1WOU A;  3CSJ A;  2VO4 A;  12GS A;  4IKH A;  4MJE A;  4WKW A;  1MDI A;  2CVK A;  1R5P A;  2R2J A;  1YZX A;  5ECQ B;  3J7Y b;  1VF4 A;  5JCW A;  4GTU A;  1YEX A;  1PMT A;  1Z9H A;  1XW9 A;  4GLT A;  4KDX A;  3RHC A;  3WGD A;  4X0X A;  3CMI A;  1G7E A;  4HJ2 A;  2YWM A;  2GST A;  2RLI A;  4OFT A;  2GTU A;  4V1A g;  4HU7 A;  3ZMK A;  1U3A A;  3EMX A;  3LGC A;  3D6I A;  4MA9 A;  1EEJ A;  4OWY A;  1J0F A;  2EIQ A;  2IFQ A;  1A8Y A;  1RK4 A;  2R4V A;  3F6D A;  1WJK A;  3ME7 A;  3DXB A;  3UAP A;  1Z6N A;  1F6M C;  3GX8 A;  5DCH A;  3F8U A;  2TIR A;  4MJC A;  4IEL A;  3WT2 A;  3LG6 A;  2WGR A;  5HR1 A;  6GSS A;  4ECI A;  2P5Q A;  1LJR A;  2A4V A;  3A5W A;  2DIZ A;  3UAR A;  3MNG A;  4WF5 A;  5HFG A;  1XWG A;  3KM6 A;  2I3Y A;  3TKR A;  2MMA A;  1ZZY A;  4MK3 A;  1DSB A;  1EV9 A;  3U5R E;  4IVF A;  3M0F A;  3APS A;  4JE1 A;  5DBQ A;  5J4U A;  3O6T A;  4XIH A;  4J57 E;  3DRN A;  4HQS A;  4GST A;  1TTZ A;  3FY7 A;  1O8X A;  1X9W B;  2XBQ A;  4I6X A;  5D9T A;  1BX9 A;  1Z7R A;  2OAD A;  1AAZ A;  3KMN A;  1ERV A;  4EO3 A;  4HZ4 A;  3TOU A;  2N5A A;  3P90 A;  4P3Y B;  1A0R P;  3IBH A;  1ZYE A;  1V57 A;  2OA7 A;  1AUC A;  2F51 A;  3TJB A;  14GS A;  2GZZ A;  2I81 A;  3F63 A;  3L9S A;  1TJD A;  1T1V A;  1XFL A;  1GWC A;  3EU4 A;  3QR6 A;  3ZVJ D;  4POM A;  3Q19 A;  5IOX A;  2FA4 A;  22GS A;  4Q5Q A;  2E2G A;  4JR4 A;  2PU9 C;  3A3T A;  3EMP A;  5D73 A;  2RM5 A;  5CRG A;  3UMA A;  1U88 A;  2ZUP A;  3F3R A;  1YEP A;  1PN9 A;  2HI7 A;  5F06 A;  4MAB A;  2TRC P;  1XWC A;  1M7T A;  5G30 A;  1B9Y C;  3F4R A;  2NVL A;  2YP6 A;  3JCM L;  1A2J A;  4DSR A;  2QGV A;  2YOI A;  5CAX A;  3P8W A;  4DEJ A;  1OC9 A;  2L4Q A;  2HNL A;  2CVD A;  2I4A A;  3ZFL A;  2JU5 A;  1H4O A;  3PR8 A;  3VWV A;  4NAX A;  2CV4 A;  2HRF A;  4G9H A;  4QQ7 A;  1AXD A;  4LLR A;  5ECI B;  3KTB A;  1GNE A;  1THO A;  2H6Z A;  3GL5 A;  5G1K A;  2C4J A;  5GAN D;  2F8A A;  5GAP D;  1T00 A;  2OE1 A;  4WEY A;  4AJ6 A;  3HZ4 A;  4TKY A;  2VCZ A;  1TI1 A;  2E0Q A;  4GXZ A;  2K6V A;  5DQY A;  1GTB A;  1V58 A;  2DJJ A;  5DAK A;  1MDJ A;  4YAP A;  3GST A;  4PQ1 A;  4ZIL A;  3GH9 A;  5DDL A;  4PNG A;  2V2G A;  6GST A;  4L0U A;  3CSH A;  1X5C A;  3QFA C;  1BED A;  4I2T A;  1EP8 A;  4ISD A;  1QK8 A;  4MZC A;  2YCD A;  3RHB A;  1GLQ A;  5IMF A;  1EZK A;  5ID2 B;  2VAF A;  3R2Q A;  5AIX A;  2LJK A;  2IN3 A;  3TDG A;  2GT6 A;  2REM A;  5DJL A;  4FIW A;  1JZR A;  2NTO A;  3EYT A;  1M9B A;  4WBJ A;  2JZS A;  1EV4 A;  1SD9 A;  4ZBB A;  2VL2 A;  3KMO A;  1F37 A;  1THX A;  3ERW A;  5IMD A;  11GS A;  4XS4 B;  4MPF A;  4MJB A;  4HQZ A;  3KEB A;  5HR0 A;  2VOC A;  2M46 A;  2IPA A;  1SYX A;  5IO2 A;  3HHV A;  4FH8 A;  3F4T A;  1M9A A;  1XW5 A;  1X0R A;  3GRX A;  2ZCT A;  3VK9 A;  2QKE A;  4V1A p;  2LV3 A;  1DE1 A;  4ZL9 A;  2OE0 A;  2FWG A;  2O89 A;  2YJH A;  2H1D A;  1QGV A;  3CRT A;  3PIN A;  5IO0 A;  5FWG A;  2BJX A;  4ID0 A;  1BG5 A;  3GKK A;  3TB2 A;  4XCS A;  1XCC A;  4X1U A;  4Q5R A;  3FR6 A;  4RUV A;  1K0O A;  4FYU A;  1WP0 A;  3ED3 A;  5F07 A;  1XOA A;  2DJK A;  1F3B A;  3E0U A;  1ABA A;  3LEF A;  1PKW A;  3P7X A;  10GS A;  1WMJ A;  2VLT A;  4L5L A;  3EU3 A;  2GQL A;  1TU7 A;  5J3R A;  2Z9S A;  1I5G A;  2MMN A;  1YKA A;  1GH2 A;  2N5F A;  4IW9 A;  4ZBD A;  2O85 A;  4N10 A;  3TRP A;  4EKZ A;  3C1S A;  1GP1 A;  2LS5 A;  4ZB6 A;  5DQS A;  2F8F A;  2P5R A;  4MLY A;  4Q5F A;  4WR5 A;  2RM6 A;  4RQX A;  2C80 A;  3GIX A;  2OKA A;  2VLV A;  4O92 A;  2VCW A;  3EWL A;  1VF2 A;  3H8Q A;  4OO4 A;  2J23 A;  3C7M A;  2XPE A;  4O5R A;  5A4U A;  3NZN A;  5IQY A;  2RII A;  5FT3 A;  3RAZ A;  2YWO A;  4EXJ A;  1LBK A;  4KCA A;  1X9S B;  3GHA A;  4WET A;  4G19 A;  4MF5 A;  3IXR A;  1NHY A;  4G2E A;  2DC5 A;  4HEA 2;  2ES7 A;  1XZO A;  4EUY A;  3LYP A;  2LNS A;  1GSU A;  2RUF A;  1ERT A;  3LQ7 A;  3N9J A;  2K8S A;  1WE0 A;  4FYC A;  3HXS A;  2K8V A;  4QL9 A;  4ZL8 A;  5A4V A;  3GTU B;  4HS1 A;  2DSA A;  5KN1 A;  1HNB A;  4IS0 A;  4EDY A;  1EGR A;  4K8M A;  1R5A A;  1SKW B;  4ZL7 A;  1SK2 A;  3O76 A;  2HXK A;  4K2D A;  5FHI A;  4KW6 A;  3Q74 A;  4MF7 A;  2AB6 A;  1VRS D;  3M1G A;  3IE3 A;  3HKR A;  4MMM A;  1V9W A;  3GNJ A;  3W6G A;  4MJA A;  3UBL A;  4K7N A;  1JZO A;  5D9W A;  1M2A A;  3I69 A;  5JWR B;  1SKS B;  2IJY A;  2H66 A;  2E2M A;  3GN3 A;  3ZRE A;  1X9M B;  4ZIJ A;  3DYR A;  1B4Q A;  3I43 A;  3ISO A;  4F03 A;  1T8E B;  2G2Q A;  1TRS A;  1T4Z A;  2WZ9 A;  5ECS A;  5ECP B;  4RQR A;  5HFI A;  4KA0 A;  3RDW A;  2C1Y A;  4V2L A;  3F4S A;  2PN8 A;  2XBI A;  4ML6 A;  5D96 A;  5CNW A;  5KEJ A;  4TXO B;  1M2B A;  4K0G A;  3QAW A;  3UOM A;  1K0M A;  3CXG A;  1FO5 A;  3MAK A;  4IJ3 A;  4KCE A;  3TOT A;  4J56 E;  2MBS A;  2YPM A;  1O85 A;  3E3E A;  3DML A;  2VCV A;  1K3L A;  1GUL A;  3TRX A;  2EIO A;  1URM A;  2LST A;  1JFU A;  2PVO C;  3UEM A;  5AIV A;  2C0G A;  3F6F A;  2IIY A;  4L0W A;  2JAC A;  1G6W A;  1GSY A;  2L59 A;  4ML1 A;  4CHS A;  3L9V A;  4TVE A;  3ZZX A;  2VM1 A;  4KX4 A;  1FVJ A;  4K1F A;  1YDK A;  3TKQ A;  9GSS A;  5DAL B;  1G6Y A;  2H1G A;  5CP1 A;  2H1A A;  4WBR D;  4ZBA A;  1HYU A;  3DVW A;  2PVQ A;  2V32 A;  1B9X C;  3HA9 A;  1X5E A;  4GSN A;  1FAA A;  4NMU A;  4TW5 A;  3TCO A;  1ERU A;  2R3X A;  3CTF A;  2FGX A;  4TOP A;  3NIV A;  3CRU A;  1S3C A;  3BBY A;  2O7K A;  1SK1 A;  4PNF A;  2H01 A;  1PX6 A;  1O8W A;  2TRX A;  3L78 A;  1IYH A;  3DKS A;  2V1M A;  2H6Y A;  3OR5 A;  3NOF A;  1SL1 B;  5H5Q A;  2VD0 A;  1G7O A;  5HR2 A;  1XPV A;  1NW2 A;  1FVK A;  1MDK A;  1OKT A;  4DSS A;  2JZT A;  3EIN A;  3ZML A;  3HCZ A;  4PUA A;  4IJI A;  1T3B A;  1NM3 A;  1J9B A;  1ZMA A;  3VPQ A;  3MSZ A;  1JLV A;  2R6K A;  5CO3 A;  2VL2 C;  2LJA A;  2HFD A;  1Q98 A;  4TR1 B;  4PUF C;  4D73 A;  2M72 A;  4KDU A;  6GSV A;  3A2W A;  2YN1 A;  2AAW A;  2DIY A;  1T7P B;  1A2M A;  4G10 A;  1QXH A;  3TJF A;  4BWQ A;  4TRX A;  4JZQ A;  4EL1 A;  1A0F A;  1GTU A;  4BPY A;  2OE3 A;  3BD2 A;  4HI7 A;  3TJJ A;  1GSE A;  1ST9 A;  4KE3 A;  2AHE A;  1A2L A;  2C0E A;  3FR9 A;  1HNA A;  3KTL A;  3HD5 A;  5CRD A;  2N5B A;  3DIE A;  2WJU A;  3GX0 A;  3HJM A;  3D4T A;  1EOH A;  1A8L A;  1FB0 A;  5IMZ A;  5IM9 A;  5ECO B;  1Z5Y E;  1VF3 A;  3TKP A;  5E59 A;  2XHF A;  4HDE A;  1TDI A;  1K3Y A;  1KTE A;  4I2U A;  2CA8 A;  1ZCP A;  4PQH A;  5JCU A;  3SWL A;  1EOG A;  4KND A;  1E2Y A;  2CZ2 A;  3F0I A;  3QDN A;  2GSQ A;  2LKU A;  3C8E A;  3GKN A;  2CX4 A;  4IP1 A;  1PGT A;  4MDC A;  4ILF A;  2HT9 A;  3W8J A;  1YQ1 A;  1FOV A;  3DEX A;  3GYK A;  3DVX A;  4NV5 A;  3O3T A;  3GH6 A;  1Y6E A;  5GSS A;  2VCX A;  2GSS A;  2C3Q A;  3C1R A;  2CVB A;  4RI7 A;  1OE8 A;  2O87 A;  2WCI A;  5D8I A;  1HD2 A;  1U87 A;  3GMF A;  2FD3 A;  3KP9 A;  4V2M A;  2B1K A;  2AJQ B;  1MD3 A;  3QCP A;  3BCK A;  4POK A;  5B8B A;  1Z3E A;  2C8U A;  2D2Z A;  2FWF A;  4NXI A;  5KN2 A;  5ECK B;  3H4K A;  5AIS A;  3FEU A;  4XS1 A;  4ZXG A;  3BJ5 A;  2GGT A;  2OBK A;  4MPG A;  5A5K A;  2C3N A;  4OCE A;  4KDY A;  4HJM A;  4TR0 A;  4IGJ A;  3TJK A;  3W8S A;  3GKX A;  2HRN A;  1OAZ A;  4I5Q A;  3UVT A;  1UC7 A;  5DVB A;  2VLU A;  1RQM A;  1S3D A;  2WRT A;  1AW9 A;  2NBS A;  3RBT A;  5ECR B;  4N0V A;  4BWS A;  2EIR A;  4LL4 B;  4XRD A;  2KOK A;  4HU9 A;  1IYI A;  3ERG A;  5INY A;  4OFM A;  1TI3 A;  3TGZ A;  1JLW A;  1EGO A;  1ZYQ B; 
#chains in the Genus database with same CATH topology
 2MMO A;  1USB A;  3R3E A;  1PL1 A;  5GST A;  2I9H A;  1O6J A;  5B7C A;  5COH A;  3L9U A;  5KN0 A;  3ZRD A;  1TXX A;  1UN2 A;  3Q6O A;  5E4W A;  3EE2 A;  1PKZ A;  3U6V A;  5IMC A;  1Y25 A;  2FWH A;  1ZYP A;  3M8N A;  5ABR A;  2EC4 A;  2GZP A;  4IHU A;  4BA7 A;  2HSM A;  2E7P A;  2A2S A;  1PX7 A;  3QD9 A;  5F05 A;  4CY8 A;  2L5L A;  3LXZ A;  16GS A;  4GCI A;  4NPB A;  2V6K A;  4FO5 A;  5ELG A;  1NSW A;  5JWO B;  1XVW A;  5IIZ A;  1Z6M A;  2IMK A;  2K9F A;  1MEK A;  3P2A A;  2CAI A;  1BJX A;  5LNK e;  3M3M A;  1M3J A;  4XS4 A;  1GSS A;  2GDR A;  1U3I A;  2IMD A;  4BVX B;  3ZVJ A;  1SYR A;  1BAY A;  1UA5 A;  2XPD A;  3ZYW A;  5EVO A;  2H70 A;  2DJ1 A;  4BVY A;  20GS A;  3HYP A;  3IC4 A;  1SL0 B;  3HVX A;  3L4N A;  3QAG A;  1C72 A;  3TJG A;  1AQV A;  1OVN A;  1OE7 A;  1VGL A;  5ECH B;  1AIU A;  3A2X A;  2OAC A;  1TOF A;  1ML6 A;  2LRC A;  1K0A A;  2FLS A;  2KP1 A;  2L57 A;  2P0G A;  3ZIV A;  5B6N A;  1M0U A;  2C0F A;  2VL3 A;  1A23 A;  2KLX A;  7GSS A;  2GVP A;  3GUR A;  4QL7 A;  3IA1 A;  3G7Y A;  5IPG A;  4TR4 A;  2ALB A;  2B1L A;  2MZC A;  2AUV A;  2DJ2 A;  4EDZ A;  1JHB A;  2RUE A;  4MZW A;  4KSM A;  1WIK A;  2YJ7 A;  5ELA A;  4O32 A;  1XXU A;  2BMX A;  1OC3 A;  1R26 A;  1ERW A;  5LCZ A;  5KN3 A;  4YQV A;  1R7H A;  3GA4 A;  3IRA A;  4E8E A;  4OO5 A;  5AGY A;  3LWA A;  1SJ6 A;  5EY6 A;  3EUR A;  1ACV A;  1PSQ A;  2MBT A;  2HZE B;  5J41 A;  3E9J B;  3G7J A;  2H8L A;  3WGE A;  3CTG A;  2GQM A;  2CZ3 A;  4GSS A;  1AQW A;  4IBP A;  2L6C A;  1ZOF A;  3HJP A;  4DVC A;  1R4W A;  2PUK C;  1GSD A;  4EE0 A;  2X64 A;  5D9X A;  4V2N A;  4H86 A;  4N11 A;  4NHZ A;  1WPI A;  2LTK A;  1M99 A;  4XTS A;  2FNO A;  1PQN A;  4GQF A;  3TRQ A;  2QC7 A;  2ON5 A;  4I8B A;  4X43 A;  1F3A A;  4MH2 A;  3KJY A;  3CBU A;  3QFB C;  1T4Y A;  4XS6 A;  1FB6 A;  4KAE A;  5B6M A;  2IFQ B;  3QOU A;  4F9Z A;  4POB A;  2GS3 A;  3D0Z A;  2WUL A;  3EC3 A;  2AV4 A;  5H5S A;  4F82 A;  2VD1 A;  3H1N A;  5JCG A;  3GTU A;  17GS A;  1JZW A;  4DSQ A;  4ECC A;  3GUS A;  2IMF A;  1QMV A;  1FHE A;  4OD7 A;  5H5R A;  2DKH A;  5F8B A;  3S9F A;  3FZ4 A;  1TKD B;  1BQ7 A;  2YNX A;  1BYE A;  1JZD A;  4LA1 A;  2IMI A;  1V40 A;  2H76 A;  4AGS A;  1XWB A;  3HZ8 A;  2VIM A;  3A2V A;  3LOR A;  2H71 A;  2B7J A;  1M3I A;  4IP6 A;  3PPU A;  3IAS 2;  5J5N A;  3TUE A;  3LJR A;  2C0D A;  3IPZ A;  2WB9 A;  4JR6 A;  1O73 A;  1TRW A;  4ECB A;  4HZ2 A;  3WYW A;  4D73 B;  3F3Q A;  2YAN A;  2UZ8 A;  2V6O A;  3MDK A;  1AC1 A;  2VCT A;  1UVZ A;  2AYT A;  5CRH A;  3VI5 A;  5AN1 A;  2JSZ A;  4KH7 A;  3RPN A;  1SJI A;  1B8X A;  3A5I A;  5C00 A;  1W89 A;  5DJM A;  2OBI A;  4TXO A;  5G5F A;  5CRE A;  2ON7 A;  1MD4 A;  4PGT A;  5L71 A;  1SL2 B;  2HYX A;  5F0G A;  2HSH A;  1QUW A;  4GQC A;  2HLS A;  3AY8 A;  4LMW A;  1S3A A;  3HVV A;  2WS2 A;  4PUR A;  3GFK A;  3TKS A;  1B48 A;  2LRN A;  4JED A;  2DBC A;  2FY6 A;  3IR4 A;  2VCQ A;  4XHM A;  2YV9 A;  1GLP A;  1XWK A;  4TR3 A;  5HR3 A;  1K0C A;  3K8N A;  3KD0 A;  4EVM A;  3UJ1 A;  5KOW A;  1PN0 A;  5HQP A;  2X99 A;  2HRA A;  2F9S A;  3KIJ A;  2L5O A;  3HY2 A;  1OC9 B;  2NDO A;  1OYJ A;  4ACS A;  6GSW A;  5DAL A;  4PQI A;  4BL7 A;  2DJ3 A;  4EIP A;  2FHE A;  5GZZ B;  3ZTL A;  1Z7P A;  2VM2 A;  1DUG A;  3M9J A;  3RPP A;  4JRR A;  1CQH A;  4JBB A;  4N30 A;  3IHG A;  3DWV A;  4PX1 A;  3VFI A;  2B5Y A;  1QQ2 A;  1G0T A;  3IK7 A;  1LU4 A;  2DKI A;  3G9B A;  4KGI A;  1XOB A;  5G5E A;  2F3M A;  2YWI A;  3D4M A;  5DAK B;  6GSU A;  2KP2 A;  2FUG 2;  3APQ A;  3HVS A;  4AF2 A;  1W4V A;  5ECM B;  4KSO A;  3LFL A;  5G31 A;  3KH7 A;  3G7I A;  4MH3 A;  2H19 A;  13GS A;  2B5X A;  2CAQ A;  4PTS A;  3GL3 A;  4GF0 A;  4MP4 A;  3TKS E;  3IHQ A;  2R37 A;  3UIW A;  4NV2 A;  2CT6 A;  1RW1 A;  4NWY A;  1GUK A;  4WF4 A;  2CQ9 A;  3GV1 A;  3KH9 A;  3VUR A;  3CSI A;  5CYY A;  3LYK A;  4TR1 A;  2GZY A;  1SKR B;  4N0Z A;  4POL A;  4LL1 B;  2LUS A;  2X8H A;  3M9K A;  4AJ7 A;  1A24 A;  3MYD A;  3PH9 A;  2H74 A;  1DBY A;  3I9V 2;  1ON4 A;  1GTA A;  4K7I A;  4KUN A;  3ME8 A;  3BCI A;  2YV7 A;  1QFN A;  1V2A A;  3FRC A;  2P31 A;  2M80 A;  1PFO A;  2GQK A;  1E6B A;  1YF0 A;  4WR4 A;  1H75 A;  4OFN A;  4ULX A;  5IPH A;  3APO A;  4CW9 A;  3IOS A;  5ENU A;  5LD0 A;  1DE2 A;  1XBS A;  1YJ6 A;  2PPT A;  2FCH A;  2XC2 A;  2IME A;  1K0B A;  2DLX A;  2HE3 A;  1U6T A;  3CYN A;  4OCF A;  1ILO A;  1TK0 B;  1OKD A;  4X4J A;  1K3O A;  4BIK A;  1V98 A;  3HDC A;  2PGT A;  3MWH A;  2B3S A;  1FG4 A;  2H1B A;  3LXT A;  4Z2T A;  3KCM A;  3FYG A;  4FQU A;  2LQQ A;  1TP9 A;  4IQA A;  1ZGN A;  5J9B A;  2LQO A;  4K2X A;  4EF0 A;  3US3 A;  4YQM A;  1HQO A;  3FKF A;  1AQX A;  1GUM A;  2GT5 A;  1TW9 A;  2JZR A;  2LEG A;  3Q18 A;  3IAM 2;  1SEN A;  2PBJ A;  2L4C A;  2ZNM A;  1YY7 A;  2HSY A;  4I97 A;  1TRU A;  2FA8 A;  4K5R A;  2JAD A;  3GSS A;  5EPF A;  3FHK A;  5DCG A;  3BOA A;  4EC0 A;  4Z2R A;  3J7Y k;  3PGT A;  4RI6 A;  4K0N A;  4ZB9 A;  2DMM A;  1K0N A;  3VWU A;  1K0D A;  2PER A;  2LRT A;  8GSS A;  3VWW A;  3KZQ A;  5G1L A;  2GSR A;  2BTO T;  2J9H A;  5IMA A;  3KP8 A;  2H0I A;  5D93 A;  3UVH A;  3ZFB A;  3D21 A;  3ZIJ A;  4ECJ A;  5ID2 A;  4F2I A;  1PL2 A;  2O8V B;  3D22 A;  2WFC A;  1KEB A;  4YH2 A;  1EEM A;  6GSX A;  3IV4 A;  2OJL A;  1YF1 A;  1SD8 A;  4CY6 A;  1GUH A;  2R5G A;  2X8C A;  19GS A;  1YKC A;  4GRF A;  5HFK A;  2C3T A;  4EIQ A;  2KUC A;  3VLN A;  2K18 A;  3QPM A;  4JU5 A;  1KNG A;  1XWA A;  4HOJ A;  2H30 A;  4KB3 A;  3FZA A;  3ZLP A;  1PA3 A;  4K6X A;  1XVQ A;  1TRV A;  1SJZ A;  1TK8 B;  2KHP A;  2NPB A;  4OMV A;  2B6M A;  2H0H A;  5ECL B;  1GRX A;  1F2E A;  2B5E A;  2G0F A;  3QAV A;  3SBC A;  2B7K A;  1M2D A;  2GLR A;  3UL3 A;  4Z7X A;  4NHW A;  2DML A;  3C71 A;  4HUA A;  3WD6 A;  2L6D A;  3FK8 A;  2H6X A;  4F0B A;  3ZIT A;  4XRA A;  3LSZ A;  1GSF A;  2VUP A;  4PXO A;  3FZ9 A;  4ZB8 A;  3FZ5 A;  4O5Q A;  2H73 A;  3ERF A;  3KXO A;  3KGK A;  3WGX A;  1GSQ A;  5EL8 A;  1GTI A;  4WXT A;  1ZL9 A;  5IOW A;  1SK0 A;  1FW1 A;  3HJO A;  5J9C A;  1KBN A;  1TU8 A;  4Q5N A;  2QA2 A;  2H72 A;  1PRX A;  4TN8 A;  4MCU A;  2I1U A;  3VPT A;  5G2Z A;  3V1W A;  3EVI A;  2CX3 A;  6GSY A;  4LMV A;  1X5D A;  1SU9 A;  2JSY A;  3N5O A;  4CDO A;  1O7U A;  5IMV A;  3TKS C;  4BVX A;  3L0H A;  1TK5 B;  4K7O A;  1MTC A;  3IK9 A;  2LNT A;  2A2R A;  4YAV A;  3EPT A;  2YZU A;  3UBK A;  2FWE A;  4J2F A;  2QSI A;  1B4P A;  2PWJ A;  2LJR A;  1WWJ A;  5D9V A;  4GWR A;  4L8E A;  4IN0 A;  1WRY A;  3DD3 A;  2MMZ A;  1PD2 1;  1XW6 A;  4O7H A;  2IL3 A;  3D5J A;  1CQG A;  3H79 A;  1GL8 A;  2H75 A;  1OC8 A;  4ICY A;  5JWQ B;  4TXV A;  5B8A A;  2V41 A;  1Q4J A;  3VWX A;  3IDV A;  3FW2 A;  3ZL5 A;  2WDU A;  1EWX A;  3I6A A;  5C04 A;  4MF6 A;  4K9Z A;  4FYB A;  3F9U A;  2H0G A;  4AJ8 A;  5A4W A;  1I9D A;  1EP7 A;  3DGQ A;  2JL4 A;  2DJ0 A;  1VF1 A;  2YZH A;  2X8G A;  4L5O A;  4IQ1 A;  3GKM A;  3QMX A;  3H93 A;  2VL9 A;  1F9M A;  3FR3 A;  1N8J A;  3VI7 A;  4F0C A;  2YWN A;  5ECN B;  1O81 A;  1GNW A;  1N2A A;  1NHO A;  1XIY A;  2PMT A;  5CRW A;  18GS A;  4MZB A;  2MYG A;  3WT1 A;  1ZYN A;  2IWT A;  1HNC A;  4YKF A;  2HZE A;  4E8H A;  1J08 A;  2HZF A;  4DSS B;  4YQU A;  3C73 A;  1WOU A;  3CSJ A;  2VO4 A;  12GS A;  4IKH A;  4MJE A;  4WKW A;  1MDI A;  2CVK A;  1R5P A;  2R2J A;  1YZX A;  5ECQ B;  3J7Y b;  1VF4 A;  5JCW A;  4GTU A;  1YEX A;  1PMT A;  1Z9H A;  1XW9 A;  4GLT A;  4KDX A;  4A5P A;  3RHC A;  3WGD A;  4X0X A;  3CMI A;  1G7E A;  4HJ2 A;  2YWM A;  2GST A;  4G0I A;  2RLI A;  4OFT A;  2GTU A;  4V1A g;  4HU7 A;  3ZMK A;  1U3A A;  3EMX A;  3LGC A;  3D6I A;  4MA9 A;  1EEJ A;  4OWY A;  1J0F A;  2EIQ A;  2IFQ A;  1A8Y A;  1RK4 A;  2R4V A;  3F6D A;  1WJK A;  3ME7 A;  3DXB A;  3UAP A;  1Z6N A;  1F6M C;  3GX8 A;  5DCH A;  3F8U A;  2TIR A;  4MJC A;  4IEL A;  3WT2 A;  3LG6 A;  2WGR A;  5HR1 A;  6GSS A;  4ECI A;  2P5Q A;  1LJR A;  2A4V A;  3A5W A;  2DIZ A;  3UAR A;  3MNG A;  4WF5 A;  5HFG A;  1XWG A;  3KM6 A;  2I3Y A;  3TKR A;  2MMA A;  1ZZY A;  4MK3 A;  1DSB A;  1EV9 A;  3U5R E;  4IVF A;  3M0F A;  2R0C A;  3APS A;  4JE1 A;  5DBQ A;  5J4U A;  3O6T A;  4XIH A;  4J57 E;  3DRN A;  4HQS A;  2X49 A;  1TTZ A;  4GST A;  3FY7 A;  4G0L A;  1O8X A;  1X9W B;  2XBQ A;  4I6X A;  5D9T A;  1BX9 A;  1Z7R A;  2OAD A;  1AAZ A;  3KMN A;  1ERV A;  4EO3 A;  4HZ4 A;  3TOU A;  2N5A A;  3P90 A;  4P3Y B;  1A0R P;  3IBH A;  1ZYE A;  1V57 A;  2OA7 A;  1AUC A;  2F51 A;  3TJB A;  14GS A;  2GZZ A;  2I81 A;  3F63 A;  3L9S A;  1TJD A;  1T1V A;  1XFL A;  1GWC A;  2X4A A;  3EU4 A;  3QR6 A;  3ZVJ D;  4POM A;  3Q19 A;  5IOX A;  2FA4 A;  22GS A;  4Q5Q A;  2E2G A;  4JR4 A;  2PU9 C;  3A3T A;  3EMP A;  5D73 A;  2RM5 A;  5CRG A;  3UMA A;  1U88 A;  2ZUP A;  3F3R A;  1YEP A;  1PN9 A;  2HI7 A;  5F06 A;  4MAB A;  2TRC P;  1XWC A;  1M7T A;  5G30 A;  1B9Y C;  3F4R A;  2NVL A;  2YP6 A;  3JCM L;  1A2J A;  4DSR A;  2QGV A;  2YOI A;  5CAX A;  3P8W A;  4DEJ A;  1OC9 A;  2L4Q A;  4O5U A;  2HNL A;  2CVD A;  2I4A A;  3ZFL A;  2JU5 A;  1H4O A;  3PR8 A;  3VWV A;  4NAX A;  2CV4 A;  2HRF A;  4G9H A;  4QQ7 A;  1AXD A;  4LLR A;  5ECI B;  3KTB A;  1GNE A;  1THO A;  2H6Z A;  3GL5 A;  5G1K A;  2C4J A;  5GAN D;  2F8A A;  5GAP D;  1T00 A;  2OE1 A;  4WEY A;  4AJ6 A;  2QA1 A;  3HZ4 A;  4TKY A;  2VCZ A;  1TI1 A;  2E0Q A;  4GXZ A;  2K6V A;  5DQY A;  4Z2U A;  1GTB A;  1V58 A;  2DJJ A;  5DAK A;  1MDJ A;  4YAP A;  3GST A;  4PQ1 A;  4ZIL A;  3GH9 A;  5DDL A;  4PNG A;  2V2G A;  6GST A;  4L0U A;  3CSH A;  1X5C A;  3QFA C;  1BED A;  4I2T A;  1EP8 A;  4ISD A;  1QK8 A;  4MZC A;  2YCD A;  3RHB A;  1GLQ A;  5IMF A;  1EZK A;  5ID2 B;  2VAF A;  3R2Q A;  5AIX A;  2LJK A;  2IN3 A;  3TDG A;  2GT6 A;  4HSC X;  2REM A;  5DJL A;  4FIW A;  1JZR A;  2NTO A;  3EYT A;  1M9B A;  4WBJ A;  2JZS A;  1S3R A;  4YKG A;  1EV4 A;  1SD9 A;  4ZBB A;  2VL2 A;  3KMO A;  1F37 A;  1THX A;  3ERW A;  5IMD A;  11GS A;  4XS4 B;  4MPF A;  4MJB A;  4HQZ A;  3KEB A;  5HR0 A;  4BVY B;  2VOC A;  2M46 A;  2IPA A;  1SYX A;  5IO2 A;  3HHV A;  4FH8 A;  3F4T A;  1M9A A;  1XW5 A;  1X0R A;  3GRX A;  2ZCT A;  3VK9 A;  2QKE A;  4V1A p;  2LV3 A;  1DE1 A;  4ZL9 A;  2OE0 A;  2FWG A;  2O89 A;  2R0G A;  2YJH A;  2H1D A;  1QGV A;  3CRT A;  3PIN A;  5IO0 A;  5FWG A;  2BJX A;  4ID0 A;  1BG5 A;  3GKK A;  3TB2 A;  4XCS A;  1XCC A;  4X1U A;  4Q5R A;  3FR6 A;  4RUV A;  1K0O A;  4FYU A;  3HVN A;  1WP0 A;  3ED3 A;  5F07 A;  1XOA A;  2DJK A;  1F3B A;  3E0U A;  1ABA A;  3LEF A;  1PKW A;  3P7X A;  10GS A;  1WMJ A;  2VLT A;  4L5L A;  3EU3 A;  2GQL A;  1TU7 A;  5J3R A;  2Z9S A;  1I5G A;  4K5S A;  2MMN A;  1YKA A;  1GH2 A;  2N5F A;  4IW9 A;  4MNN A;  4ZBD A;  2O85 A;  4N10 A;  3TRP A;  4EKZ A;  3C1S A;  1GP1 A;  2LS5 A;  4ZB6 A;  5DQS A;  2F8F A;  2P5R A;  4MLY A;  4Q5F A;  4WR5 A;  2RM6 A;  4RQX A;  3MIX A;  2C80 A;  3GIX A;  2OKA A;  2VLV A;  4O92 A;  2VCW A;  3EWL A;  1VF2 A;  3H8Q A;  4OO4 A;  2J23 A;  3C7M A;  2XPE A;  4O5R A;  5A4U A;  3NZN A;  5IQY A;  2RII A;  5FT3 A;  3RAZ A;  2YWO A;  4EXJ A;  1LBK A;  4KCA A;  1X9S B;  3GHA A;  4WET A;  4G19 A;  4MF5 A;  3IXR A;  1NHY A;  4G2E A;  2DC5 A;  4HEA 2;  2ES7 A;  1XZO A;  4EUY A;  3LYP A;  2LNS A;  1GSU A;  2RUF A;  1ERT A;  3LQ7 A;  3N9J A;  2K8S A;  1WE0 A;  4FYC A;  3HXS A;  2K8V A;  4QL9 A;  4ZL8 A;  5A4V A;  3GTU B;  4KF9 A;  4HS1 A;  2DSA A;  5KN1 A;  1HNB A;  4IS0 A;  4EDY A;  1EGR A;  4K8M A;  1R5A A;  1SKW B;  4ZL7 A;  1SK2 A;  3O76 A;  2HXK A;  4K2D A;  5FHI A;  4KW6 A;  3Q74 A;  4MF7 A;  2AB6 A;  1VRS D;  3M1G A;  3IE3 A;  3HKR A;  4MMM A;  1V9W A;  3GNJ A;  3W6G A;  4MJA A;  3UBL A;  4K7N A;  1JZO A;  5D9W A;  1M2A A;  3I69 A;  5JWR B;  1SKS B;  2IJY A;  2H66 A;  2E2M A;  3GN3 A;  3ZRE A;  1X9M B;  4ZIJ A;  3DYR A;  1B4Q A;  4USS A;  3I43 A;  3ISO A;  4F03 A;  1T8E B;  2G2Q A;  1TRS A;  1T4Z A;  2WZ9 A;  5ECS A;  5ECP B;  4RQR A;  5HFI A;  4KA0 A;  3RDW A;  1FOH A;  2C1Y A;  4V2L A;  3F4S A;  2PN8 A;  2XBI A;  3LW9 A;  4ML6 A;  5D96 A;  5CNW A;  5KEJ A;  4TXO B;  1M2B A;  4K0G A;  3QAW A;  3UOM A;  1K0M A;  3CXG A;  1FO5 A;  3MAK A;  4IJ3 A;  4KCE A;  3TOT A;  4J56 E;  2MBS A;  2YPM A;  1O85 A;  3E3E A;  3DML A;  2VCV A;  1K3L A;  1GUL A;  3TRX A;  2EIO A;  1URM A;  2LST A;  1JFU A;  2PVO C;  3UEM A;  5AIV A;  2C0G A;  3F6F A;  2IIY A;  4L0W A;  2JAC A;  1G6W A;  1GSY A;  2L59 A;  4ML1 A;  4CHS A;  3L9V A;  4TVE A;  3ZZX A;  2VM1 A;  4KX4 A;  1FVJ A;  4K1F A;  1YDK A;  3TKQ A;  9GSS A;  5DAL B;  1G6Y A;  2H1G A;  2A2P A;  5CP1 A;  4BL7 B;  2H1A A;  4WBR D;  4ZBA A;  1HYU A;  3DVW A;  2PVQ A;  2V32 A;  1B9X C;  3HA9 A;  1X5E A;  3CQF A;  4GSN A;  1FAA A;  4NMU A;  4TW5 A;  3TCO A;  1ERU A;  2R3X A;  3CTF A;  2FGX A;  4TOP A;  3NIV A;  3CRU A;  1S3C A;  3BBY A;  2O7K A;  1SK1 A;  4PNF A;  2H01 A;  1PX6 A;  1O8W A;  2TRX A;  3L78 A;  1IYH A;  3DKS A;  2V1M A;  2H6Y A;  3OR5 A;  3NOF A;  1SL1 B;  5H5Q A;  2VD0 A;  1G7O A;  5HR2 A;  1XPV A;  1NW2 A;  1FVK A;  1MDK A;  1OKT A;  4DSS A;  2JZT A;  3EIN A;  3ZML A;  3HCZ A;  4PUA A;  4IJI A;  1T3B A;  1NM3 A;  1J9B A;  1ZMA A;  3VPQ A;  3MSZ A;  1JLV A;  2R6K A;  5CO3 A;  2VL2 C;  2LJA A;  2HFD A;  1Q98 A;  4TR1 B;  4PUF C;  4D73 A;  2M72 A;  4KDU A;  6GSV A;  3A2W A;  3FMW A;  1XG8 A;  2YN1 A;  2AAW A;  2DIY A;  1T7P B;  1A2M A;  4G10 A;  1QXH A;  5KOX A;  3TJF A;  4BWQ A;  4TRX A;  4JZQ A;  4EL1 A;  1A0F A;  1GTU A;  4BPY A;  2OE3 A;  3BD2 A;  4HI7 A;  3TJJ A;  1GSE A;  1ST9 A;  4KE3 A;  2AHE A;  1A2L A;  2C0E A;  3FR9 A;  1HNA A;  3KTL A;  3HD5 A;  5CRD A;  2N5B A;  3DIE A;  2WJU A;  3GX0 A;  3HJM A;  3D4T A;  1EOH A;  1A8L A;  4G0K A;  1FB0 A;  5IMZ A;  5IM9 A;  5ECO B;  1Z5Y E;  1VF3 A;  3TKP A;  5E59 A;  2XHF A;  4HDE A;  1TDI A;  1K3Y A;  1KTE A;  4I2U A;  2CA8 A;  1ZCP A;  4PQH A;  5JCU A;  3SWL A;  1EOG A;  4KND A;  1E2Y A;  2CZ2 A;  3F0I A;  3QDN A;  2GSQ A;  2LKU A;  3C8E A;  3GKN A;  2CX4 A;  4IP1 A;  1PGT A;  4MDC A;  4ILF A;  2HT9 A;  3W8J A;  1YQ1 A;  1FOV A;  3DEX A;  3GYK A;  3DVX A;  4NV5 A;  3O3T A;  3GH6 A;  1Y6E A;  5GSS A;  2VCX A;  2GSS A;  2C3Q A;  3C1R A;  2CVB A;  4RI7 A;  1OE8 A;  2O87 A;  2WCI A;  1HD2 A;  5D8I A;  1U87 A;  3GMF A;  2FD3 A;  3KP9 A;  2HRK A;  4V2M A;  2B1K A;  2AJQ B;  1MD3 A;  3QCP A;  3BCK A;  4POK A;  5B8B A;  1Z3E A;  2C8U A;  2D2Z A;  2FWF A;  4NXI A;  5KN2 A;  5ECK B;  3H4K A;  5AIS A;  3FEU A;  4XS1 A;  4ZXG A;  3BJ5 A;  2GGT A;  2OBK A;  4MPG A;  5A5K A;  2C3N A;  5BMU A;  4OCE A;  4KDY A;  4HJM A;  4TR0 A;  4IGJ A;  3TJK A;  2A4H A;  3W8S A;  3GKX A;  2HRN A;  5BRT A;  1OAZ A;  4I5Q A;  3UVT A;  1UC7 A;  5DVB A;  2VLU A;  1RQM A;  1S3D A;  2WRT A;  1AW9 A;  2NBS A;  3RBT A;  2R0P A;  5ECR B;  4N0V A;  4BWS A;  2EIR A;  4LL4 B;  4XRD A;  2KOK A;  3IC8 A;  4HU9 A;  1IYI A;  3ERG A;  5INY A;  4OFM A;  1TI3 A;  3TGZ A;  1JLW A;  1EGO A;  1ZYQ B; 
#chains in the Genus database with same CATH homology
 2MMO A;  1USB A;  3R3E A;  1PL1 A;  5GST A;  2I9H A;  1O6J A;  5B7C A;  5COH A;  3L9U A;  5KN0 A;  3ZRD A;  1TXX A;  1UN2 A;  3Q6O A;  5E4W A;  3EE2 A;  1PKZ A;  3U6V A;  5IMC A;  1Y25 A;  2FWH A;  1ZYP A;  3M8N A;  5ABR A;  2EC4 A;  2GZP A;  4IHU A;  4BA7 A;  2HSM A;  2E7P A;  2A2S A;  1PX7 A;  3QD9 A;  5F05 A;  4CY8 A;  2L5L A;  3LXZ A;  16GS A;  4GCI A;  4NPB A;  2V6K A;  4FO5 A;  5ELG A;  1NSW A;  5JWO B;  1XVW A;  5IIZ A;  1Z6M A;  2IMK A;  2K9F A;  1MEK A;  3P2A A;  2CAI A;  1BJX A;  5LNK e;  3M3M A;  4XS4 A;  1GSS A;  2GDR A;  1U3I A;  2IMD A;  4BVX B;  3ZVJ A;  1SYR A;  1BAY A;  1UA5 A;  2XPD A;  3ZYW A;  5EVO A;  2H70 A;  2DJ1 A;  4BVY A;  20GS A;  3HYP A;  3IC4 A;  1SL0 B;  3HVX A;  3L4N A;  3QAG A;  1C72 A;  3TJG A;  1AQV A;  1OVN A;  1OE7 A;  1VGL A;  5ECH B;  1AIU A;  3A2X A;  2OAC A;  1TOF A;  1ML6 A;  2LRC A;  1K0A A;  2FLS A;  2KP1 A;  2L57 A;  2P0G A;  3ZIV A;  5B6N A;  1M0U A;  2C0F A;  2VL3 A;  1A23 A;  2KLX A;  7GSS A;  2GVP A;  3GUR A;  4QL7 A;  3IA1 A;  3G7Y A;  5IPG A;  4TR4 A;  2ALB A;  2B1L A;  2MZC A;  2AUV A;  2DJ2 A;  4EDZ A;  1JHB A;  2RUE A;  4MZW A;  4KSM A;  1WIK A;  2YJ7 A;  5ELA A;  4O32 A;  1XXU A;  2BMX A;  1OC3 A;  1R26 A;  1ERW A;  5LCZ A;  5KN3 A;  4YQV A;  1R7H A;  3GA4 A;  3IRA A;  4E8E A;  4OO5 A;  5AGY A;  3LWA A;  1SJ6 A;  5EY6 A;  3EUR A;  1ACV A;  1PSQ A;  2MBT A;  2HZE B;  5J41 A;  3E9J B;  3G7J A;  2H8L A;  3WGE A;  3CTG A;  2GQM A;  2CZ3 A;  4GSS A;  1AQW A;  4IBP A;  2L6C A;  1ZOF A;  3HJP A;  4DVC A;  1R4W A;  2PUK C;  1GSD A;  4EE0 A;  2X64 A;  5D9X A;  4V2N A;  4H86 A;  4N11 A;  4NHZ A;  1WPI A;  2LTK A;  1M99 A;  4XTS A;  2FNO A;  1PQN A;  4GQF A;  3TRQ A;  2QC7 A;  2ON5 A;  4I8B A;  4X43 A;  1F3A A;  4MH2 A;  3KJY A;  3CBU A;  3QFB C;  1T4Y A;  4XS6 A;  1FB6 A;  4KAE A;  5B6M A;  2IFQ B;  3QOU A;  4F9Z A;  4POB A;  2GS3 A;  3D0Z A;  2WUL A;  3EC3 A;  2AV4 A;  5H5S A;  4F82 A;  2VD1 A;  3H1N A;  5JCG A;  3GTU A;  17GS A;  1JZW A;  4DSQ A;  4ECC A;  3GUS A;  2IMF A;  1QMV A;  1FHE A;  4OD7 A;  5H5R A;  2DKH A;  5F8B A;  3S9F A;  3FZ4 A;  1TKD B;  1BQ7 A;  2YNX A;  1BYE A;  1JZD A;  4LA1 A;  2IMI A;  1V40 A;  2H76 A;  4AGS A;  1XWB A;  3HZ8 A;  2VIM A;  3A2V A;  3LOR A;  2H71 A;  2B7J A;  4IP6 A;  3PPU A;  3IAS 2;  5J5N A;  3TUE A;  3LJR A;  2C0D A;  3IPZ A;  2WB9 A;  4JR6 A;  1O73 A;  1TRW A;  4ECB A;  4HZ2 A;  3WYW A;  4D73 B;  3F3Q A;  2YAN A;  2UZ8 A;  2V6O A;  3MDK A;  1AC1 A;  2VCT A;  1UVZ A;  2AYT A;  5CRH A;  3VI5 A;  5AN1 A;  2JSZ A;  4KH7 A;  3RPN A;  1SJI A;  1B8X A;  3A5I A;  5C00 A;  1W89 A;  5DJM A;  2OBI A;  4TXO A;  5G5F A;  5CRE A;  2ON7 A;  1MD4 A;  4PGT A;  5L71 A;  1SL2 B;  2HYX A;  5F0G A;  2HSH A;  1QUW A;  4GQC A;  2HLS A;  3AY8 A;  4LMW A;  1S3A A;  3HVV A;  2WS2 A;  4PUR A;  3GFK A;  3TKS A;  1B48 A;  2LRN A;  4JED A;  2DBC A;  2FY6 A;  3IR4 A;  2VCQ A;  4XHM A;  2YV9 A;  1GLP A;  1XWK A;  4TR3 A;  5HR3 A;  1K0C A;  3K8N A;  3KD0 A;  4EVM A;  3UJ1 A;  5KOW A;  1PN0 A;  5HQP A;  2X99 A;  2HRA A;  2F9S A;  3KIJ A;  2L5O A;  3HY2 A;  1OC9 B;  2NDO A;  1OYJ A;  4ACS A;  6GSW A;  5DAL A;  4PQI A;  4BL7 A;  2DJ3 A;  4EIP A;  2FHE A;  5GZZ B;  3ZTL A;  1Z7P A;  2VM2 A;  1DUG A;  3M9J A;  3RPP A;  4JRR A;  1CQH A;  4JBB A;  4N30 A;  3IHG A;  3DWV A;  4PX1 A;  3VFI A;  2B5Y A;  1QQ2 A;  1G0T A;  3IK7 A;  1LU4 A;  2DKI A;  3G9B A;  4KGI A;  1XOB A;  5G5E A;  2F3M A;  2YWI A;  3D4M A;  5DAK B;  6GSU A;  2KP2 A;  2FUG 2;  3APQ A;  3HVS A;  4AF2 A;  1W4V A;  5ECM B;  4KSO A;  3LFL A;  5G31 A;  3KH7 A;  3G7I A;  4MH3 A;  2H19 A;  13GS A;  2B5X A;  2CAQ A;  4PTS A;  3GL3 A;  4GF0 A;  4MP4 A;  3TKS E;  3IHQ A;  2R37 A;  3UIW A;  4NV2 A;  2CT6 A;  1RW1 A;  4NWY A;  1GUK A;  4WF4 A;  2CQ9 A;  3GV1 A;  3KH9 A;  3VUR A;  3CSI A;  5CYY A;  3LYK A;  4TR1 A;  2GZY A;  1SKR B;  4N0Z A;  4POL A;  4LL1 B;  2LUS A;  2X8H A;  3M9K A;  4AJ7 A;  1A24 A;  3MYD A;  3PH9 A;  2H74 A;  1DBY A;  3I9V 2;  1ON4 A;  1GTA A;  4K7I A;  4KUN A;  3ME8 A;  3BCI A;  2YV7 A;  1QFN A;  1V2A A;  3FRC A;  2P31 A;  2M80 A;  2GQK A;  1E6B A;  1YF0 A;  4WR4 A;  1H75 A;  4OFN A;  4ULX A;  5IPH A;  3APO A;  4CW9 A;  3IOS A;  5ENU A;  5LD0 A;  1DE2 A;  1XBS A;  1YJ6 A;  2PPT A;  2FCH A;  2XC2 A;  2IME A;  1K0B A;  2DLX A;  2HE3 A;  1U6T A;  3CYN A;  4OCF A;  1ILO A;  1TK0 B;  1OKD A;  4X4J A;  1K3O A;  1V98 A;  3HDC A;  2PGT A;  3MWH A;  2B3S A;  1FG4 A;  2H1B A;  3LXT A;  4Z2T A;  3KCM A;  3FYG A;  4FQU A;  2LQQ A;  1TP9 A;  4IQA A;  1ZGN A;  5J9B A;  2LQO A;  4K2X A;  4EF0 A;  3US3 A;  4YQM A;  1HQO A;  3FKF A;  1AQX A;  1GUM A;  2GT5 A;  1TW9 A;  2JZR A;  2LEG A;  3Q18 A;  3IAM 2;  1SEN A;  2PBJ A;  2L4C A;  2ZNM A;  1YY7 A;  2HSY A;  4I97 A;  1TRU A;  2FA8 A;  4K5R A;  2JAD A;  3GSS A;  5EPF A;  3FHK A;  5DCG A;  3BOA A;  4EC0 A;  4Z2R A;  3J7Y k;  3PGT A;  4RI6 A;  4K0N A;  4ZB9 A;  2DMM A;  1K0N A;  3VWU A;  1K0D A;  2PER A;  2LRT A;  8GSS A;  3VWW A;  3KZQ A;  5G1L A;  2GSR A;  2BTO T;  2J9H A;  5IMA A;  3KP8 A;  2H0I A;  5D93 A;  3UVH A;  3ZFB A;  3D21 A;  3ZIJ A;  4ECJ A;  5ID2 A;  4F2I A;  1PL2 A;  2O8V B;  3D22 A;  2WFC A;  1KEB A;  4YH2 A;  1EEM A;  6GSX A;  3IV4 A;  2OJL A;  1YF1 A;  1SD8 A;  4CY6 A;  1GUH A;  2R5G A;  2X8C A;  19GS A;  1YKC A;  4GRF A;  5HFK A;  2C3T A;  4EIQ A;  2KUC A;  3VLN A;  2K18 A;  3QPM A;  4JU5 A;  1KNG A;  1XWA A;  4HOJ A;  2H30 A;  4KB3 A;  3FZA A;  3ZLP A;  1PA3 A;  4K6X A;  1XVQ A;  1TRV A;  1SJZ A;  1TK8 B;  2KHP A;  2NPB A;  4OMV A;  2B6M A;  2H0H A;  5ECL B;  1GRX A;  1F2E A;  2B5E A;  2G0F A;  3QAV A;  3SBC A;  2B7K A;  1M2D A;  2GLR A;  3UL3 A;  4Z7X A;  4NHW A;  2DML A;  3C71 A;  4HUA A;  3WD6 A;  2L6D A;  3FK8 A;  2H6X A;  4F0B A;  3ZIT A;  4XRA A;  3LSZ A;  1GSF A;  2VUP A;  4PXO A;  3FZ9 A;  4ZB8 A;  3FZ5 A;  4O5Q A;  2H73 A;  3ERF A;  3KXO A;  3KGK A;  3WGX A;  1GSQ A;  5EL8 A;  1GTI A;  4WXT A;  1ZL9 A;  5IOW A;  1SK0 A;  1FW1 A;  3HJO A;  5J9C A;  1KBN A;  1TU8 A;  4Q5N A;  2QA2 A;  2H72 A;  1PRX A;  4TN8 A;  4MCU A;  2I1U A;  3VPT A;  5G2Z A;  3V1W A;  3EVI A;  2CX3 A;  6GSY A;  4LMV A;  1X5D A;  1SU9 A;  2JSY A;  3N5O A;  4CDO A;  1O7U A;  5IMV A;  3TKS C;  4BVX A;  3L0H A;  1TK5 B;  4K7O A;  1MTC A;  3IK9 A;  2LNT A;  2A2R A;  4YAV A;  3EPT A;  2YZU A;  3UBK A;  2FWE A;  4J2F A;  2QSI A;  1B4P A;  2PWJ A;  2LJR A;  1WWJ A;  5D9V A;  4GWR A;  4L8E A;  4IN0 A;  1WRY A;  3DD3 A;  2MMZ A;  1PD2 1;  1XW6 A;  4O7H A;  2IL3 A;  3D5J A;  1CQG A;  3H79 A;  1GL8 A;  2H75 A;  1OC8 A;  4ICY A;  5JWQ B;  4TXV A;  5B8A A;  2V41 A;  1Q4J A;  3VWX A;  3IDV A;  3FW2 A;  3ZL5 A;  2WDU A;  1EWX A;  3I6A A;  5C04 A;  4MF6 A;  4K9Z A;  4FYB A;  3F9U A;  2H0G A;  4AJ8 A;  5A4W A;  1I9D A;  1EP7 A;  3DGQ A;  2JL4 A;  2DJ0 A;  1VF1 A;  2YZH A;  2X8G A;  4L5O A;  4IQ1 A;  3GKM A;  3QMX A;  3H93 A;  2VL9 A;  1F9M A;  3FR3 A;  1N8J A;  3VI7 A;  4F0C A;  2YWN A;  5ECN B;  1O81 A;  1GNW A;  1N2A A;  1NHO A;  1XIY A;  2PMT A;  5CRW A;  18GS A;  4MZB A;  2MYG A;  3WT1 A;  1ZYN A;  2IWT A;  1HNC A;  4YKF A;  2HZE A;  4E8H A;  1J08 A;  2HZF A;  4DSS B;  4YQU A;  3C73 A;  1WOU A;  3CSJ A;  2VO4 A;  12GS A;  4IKH A;  4MJE A;  4WKW A;  1MDI A;  2CVK A;  1R5P A;  2R2J A;  1YZX A;  5ECQ B;  3J7Y b;  1VF4 A;  5JCW A;  4GTU A;  1YEX A;  1PMT A;  1Z9H A;  1XW9 A;  4GLT A;  4KDX A;  4A5P A;  3RHC A;  3WGD A;  4X0X A;  3CMI A;  1G7E A;  4HJ2 A;  2YWM A;  2GST A;  4G0I A;  2RLI A;  4OFT A;  2GTU A;  4V1A g;  4HU7 A;  3ZMK A;  1U3A A;  3EMX A;  3LGC A;  3D6I A;  4MA9 A;  1EEJ A;  4OWY A;  1J0F A;  2EIQ A;  2IFQ A;  1A8Y A;  1RK4 A;  2R4V A;  3F6D A;  1WJK A;  3ME7 A;  3DXB A;  3UAP A;  1Z6N A;  1F6M C;  3GX8 A;  5DCH A;  3F8U A;  2TIR A;  4MJC A;  4IEL A;  3WT2 A;  3LG6 A;  2WGR A;  5HR1 A;  6GSS A;  4ECI A;  2P5Q A;  1LJR A;  2A4V A;  3A5W A;  2DIZ A;  3UAR A;  3MNG A;  4WF5 A;  5HFG A;  1XWG A;  3KM6 A;  2I3Y A;  3TKR A;  2MMA A;  1ZZY A;  4MK3 A;  1DSB A;  1EV9 A;  3U5R E;  4IVF A;  3M0F A;  2R0C A;  3APS A;  4JE1 A;  5DBQ A;  5J4U A;  3O6T A;  4XIH A;  4J57 E;  3DRN A;  4HQS A;  2X49 A;  1TTZ A;  4GST A;  3FY7 A;  4G0L A;  1O8X A;  1X9W B;  2XBQ A;  4I6X A;  5D9T A;  1BX9 A;  1Z7R A;  2OAD A;  1AAZ A;  3KMN A;  1ERV A;  4EO3 A;  4HZ4 A;  3TOU A;  2N5A A;  3P90 A;  4P3Y B;  1A0R P;  3IBH A;  1ZYE A;  1V57 A;  2OA7 A;  1AUC A;  2F51 A;  3TJB A;  14GS A;  2GZZ A;  2I81 A;  3F63 A;  3L9S A;  1TJD A;  1T1V A;  1XFL A;  1GWC A;  2X4A A;  3EU4 A;  3QR6 A;  3ZVJ D;  4POM A;  3Q19 A;  5IOX A;  2FA4 A;  22GS A;  4Q5Q A;  2E2G A;  4JR4 A;  2PU9 C;  3A3T A;  3EMP A;  5D73 A;  2RM5 A;  5CRG A;  3UMA A;  1U88 A;  2ZUP A;  3F3R A;  1YEP A;  1PN9 A;  2HI7 A;  5F06 A;  4MAB A;  2TRC P;  1XWC A;  1M7T A;  5G30 A;  1B9Y C;  3F4R A;  2NVL A;  2YP6 A;  3JCM L;  1A2J A;  4DSR A;  2QGV A;  2YOI A;  5CAX A;  3P8W A;  4DEJ A;  1OC9 A;  2L4Q A;  4O5U A;  2HNL A;  2CVD A;  2I4A A;  3ZFL A;  2JU5 A;  1H4O A;  3PR8 A;  3VWV A;  4NAX A;  2CV4 A;  2HRF A;  4G9H A;  4QQ7 A;  1AXD A;  4LLR A;  5ECI B;  3KTB A;  1GNE A;  1THO A;  2H6Z A;  3GL5 A;  5G1K A;  2C4J A;  5GAN D;  2F8A A;  5GAP D;  1T00 A;  2OE1 A;  4WEY A;  4AJ6 A;  2QA1 A;  3HZ4 A;  4TKY A;  2VCZ A;  1TI1 A;  2E0Q A;  4GXZ A;  2K6V A;  5DQY A;  4Z2U A;  1GTB A;  1V58 A;  2DJJ A;  5DAK A;  1MDJ A;  4YAP A;  3GST A;  4PQ1 A;  4ZIL A;  3GH9 A;  5DDL A;  4PNG A;  2V2G A;  6GST A;  4L0U A;  3CSH A;  1X5C A;  3QFA C;  1BED A;  4I2T A;  1EP8 A;  4ISD A;  1QK8 A;  4MZC A;  2YCD A;  3RHB A;  1GLQ A;  5IMF A;  1EZK A;  5ID2 B;  2VAF A;  3R2Q A;  5AIX A;  2LJK A;  2IN3 A;  3TDG A;  2GT6 A;  2REM A;  5DJL A;  4FIW A;  1JZR A;  2NTO A;  3EYT A;  1M9B A;  4WBJ A;  2JZS A;  4YKG A;  1EV4 A;  1SD9 A;  4ZBB A;  2VL2 A;  3KMO A;  1F37 A;  1THX A;  3ERW A;  5IMD A;  11GS A;  4XS4 B;  4MPF A;  4MJB A;  4HQZ A;  3KEB A;  5HR0 A;  4BVY B;  2VOC A;  2M46 A;  2IPA A;  1SYX A;  5IO2 A;  3HHV A;  4FH8 A;  3F4T A;  1M9A A;  1XW5 A;  1X0R A;  3GRX A;  2ZCT A;  3VK9 A;  2QKE A;  4V1A p;  2LV3 A;  1DE1 A;  4ZL9 A;  2OE0 A;  2FWG A;  2O89 A;  2R0G A;  2YJH A;  2H1D A;  1QGV A;  3CRT A;  3PIN A;  5IO0 A;  5FWG A;  2BJX A;  4ID0 A;  1BG5 A;  3GKK A;  3TB2 A;  4XCS A;  1XCC A;  4X1U A;  4Q5R A;  3FR6 A;  4RUV A;  1K0O A;  4FYU A;  1WP0 A;  3ED3 A;  5F07 A;  1XOA A;  2DJK A;  1F3B A;  3E0U A;  1ABA A;  3LEF A;  1PKW A;  3P7X A;  10GS A;  1WMJ A;  2VLT A;  4L5L A;  3EU3 A;  2GQL A;  1TU7 A;  5J3R A;  2Z9S A;  1I5G A;  4K5S A;  2MMN A;  1YKA A;  1GH2 A;  2N5F A;  4IW9 A;  4MNN A;  4ZBD A;  2O85 A;  4N10 A;  3TRP A;  4EKZ A;  3C1S A;  1GP1 A;  2LS5 A;  4ZB6 A;  5DQS A;  2F8F A;  2P5R A;  4MLY A;  4Q5F A;  4WR5 A;  2RM6 A;  4RQX A;  3MIX A;  2C80 A;  3GIX A;  2OKA A;  2VLV A;  4O92 A;  2VCW A;  3EWL A;  1VF2 A;  3H8Q A;  4OO4 A;  2J23 A;  3C7M A;  2XPE A;  4O5R A;  5A4U A;  3NZN A;  5IQY A;  2RII A;  5FT3 A;  3RAZ A;  2YWO A;  4EXJ A;  1LBK A;  4KCA A;  1X9S B;  3GHA A;  4WET A;  4G19 A;  4MF5 A;  3IXR A;  1NHY A;  4G2E A;  2DC5 A;  4HEA 2;  2ES7 A;  1XZO A;  4EUY A;  3LYP A;  2LNS A;  1GSU A;  2RUF A;  1ERT A;  3LQ7 A;  3N9J A;  2K8S A;  1WE0 A;  4FYC A;  3HXS A;  2K8V A;  4QL9 A;  4ZL8 A;  5A4V A;  3GTU B;  4KF9 A;  4HS1 A;  2DSA A;  5KN1 A;  1HNB A;  4IS0 A;  4EDY A;  1EGR A;  4K8M A;  1R5A A;  1SKW B;  4ZL7 A;  1SK2 A;  3O76 A;  2HXK A;  4K2D A;  5FHI A;  4KW6 A;  3Q74 A;  4MF7 A;  2AB6 A;  1VRS D;  3M1G A;  3IE3 A;  3HKR A;  4MMM A;  1V9W A;  3GNJ A;  3W6G A;  4MJA A;  3UBL A;  4K7N A;  1JZO A;  5D9W A;  1M2A A;  3I69 A;  5JWR B;  1SKS B;  2IJY A;  2H66 A;  2E2M A;  3GN3 A;  3ZRE A;  1X9M B;  4ZIJ A;  3DYR A;  1B4Q A;  4USS A;  3I43 A;  3ISO A;  4F03 A;  1T8E B;  2G2Q A;  1TRS A;  1T4Z A;  2WZ9 A;  5ECS A;  5ECP B;  4RQR A;  5HFI A;  4KA0 A;  3RDW A;  1FOH A;  2C1Y A;  4V2L A;  3F4S A;  2PN8 A;  2XBI A;  3LW9 A;  4ML6 A;  5D96 A;  5CNW A;  5KEJ A;  4TXO B;  1M2B A;  4K0G A;  3QAW A;  3UOM A;  1K0M A;  3CXG A;  1FO5 A;  3MAK A;  4IJ3 A;  4KCE A;  3TOT A;  4J56 E;  2MBS A;  2YPM A;  1O85 A;  3E3E A;  3DML A;  2VCV A;  1K3L A;  1GUL A;  3TRX A;  2EIO A;  1URM A;  2LST A;  1JFU A;  2PVO C;  3UEM A;  5AIV A;  2C0G A;  3F6F A;  2IIY A;  4L0W A;  2JAC A;  1G6W A;  1GSY A;  2L59 A;  4ML1 A;  4CHS A;  3L9V A;  4TVE A;  3ZZX A;  2VM1 A;  4KX4 A;  1FVJ A;  4K1F A;  1YDK A;  3TKQ A;  9GSS A;  5DAL B;  1G6Y A;  2H1G A;  2A2P A;  5CP1 A;  4BL7 B;  2H1A A;  4WBR D;  4ZBA A;  1HYU A;  3DVW A;  2PVQ A;  2V32 A;  1B9X C;  3HA9 A;  1X5E A;  4GSN A;  1FAA A;  4NMU A;  4TW5 A;  3TCO A;  1ERU A;  2R3X A;  3CTF A;  2FGX A;  4TOP A;  3NIV A;  3CRU A;  1S3C A;  3BBY A;  2O7K A;  1SK1 A;  4PNF A;  2H01 A;  1PX6 A;  1O8W A;  2TRX A;  3L78 A;  1IYH A;  3DKS A;  2V1M A;  2H6Y A;  3OR5 A;  3NOF A;  1SL1 B;  5H5Q A;  2VD0 A;  1G7O A;  5HR2 A;  1XPV A;  1NW2 A;  1FVK A;  1MDK A;  1OKT A;  4DSS A;  2JZT A;  3EIN A;  3ZML A;  3HCZ A;  4PUA A;  4IJI A;  1T3B A;  1NM3 A;  1J9B A;  1ZMA A;  3VPQ A;  3MSZ A;  1JLV A;  2R6K A;  5CO3 A;  2VL2 C;  2LJA A;  2HFD A;  1Q98 A;  4TR1 B;  4PUF C;  4D73 A;  2M72 A;  4KDU A;  6GSV A;  3A2W A;  3FMW A;  2YN1 A;  2AAW A;  2DIY A;  1T7P B;  1A2M A;  4G10 A;  1QXH A;  5KOX A;  3TJF A;  4BWQ A;  4TRX A;  4JZQ A;  4EL1 A;  1A0F A;  1GTU A;  4BPY A;  2OE3 A;  3BD2 A;  4HI7 A;  3TJJ A;  1GSE A;  1ST9 A;  4KE3 A;  2AHE A;  1A2L A;  2C0E A;  3FR9 A;  1HNA A;  3KTL A;  3HD5 A;  5CRD A;  2N5B A;  3DIE A;  2WJU A;  3GX0 A;  3HJM A;  3D4T A;  1EOH A;  1A8L A;  4G0K A;  1FB0 A;  5IMZ A;  5IM9 A;  5ECO B;  1Z5Y E;  1VF3 A;  3TKP A;  5E59 A;  2XHF A;  4HDE A;  1TDI A;  1K3Y A;  1KTE A;  4I2U A;  2CA8 A;  1ZCP A;  4PQH A;  5JCU A;  3SWL A;  1EOG A;  4KND A;  1E2Y A;  2CZ2 A;  3F0I A;  3QDN A;  2GSQ A;  2LKU A;  3C8E A;  3GKN A;  2CX4 A;  4IP1 A;  1PGT A;  4MDC A;  4ILF A;  2HT9 A;  3W8J A;  1YQ1 A;  1FOV A;  3DEX A;  3GYK A;  3DVX A;  4NV5 A;  3O3T A;  3GH6 A;  1Y6E A;  5GSS A;  2VCX A;  2GSS A;  2C3Q A;  3C1R A;  2CVB A;  4RI7 A;  1OE8 A;  2O87 A;  2WCI A;  1HD2 A;  5D8I A;  1U87 A;  3GMF A;  2FD3 A;  3KP9 A;  2HRK A;  4V2M A;  2B1K A;  2AJQ B;  1MD3 A;  3QCP A;  3BCK A;  4POK A;  5B8B A;  1Z3E A;  2C8U A;  2D2Z A;  2FWF A;  4NXI A;  5KN2 A;  5ECK B;  3H4K A;  5AIS A;  3FEU A;  4XS1 A;  4ZXG A;  3BJ5 A;  2GGT A;  2OBK A;  4MPG A;  5A5K A;  2C3N A;  5BMU A;  4OCE A;  4KDY A;  4HJM A;  4TR0 A;  4IGJ A;  3TJK A;  2A4H A;  3W8S A;  3GKX A;  2HRN A;  5BRT A;  1OAZ A;  4I5Q A;  3UVT A;  1UC7 A;  5DVB A;  2VLU A;  1RQM A;  1S3D A;  2WRT A;  1AW9 A;  2NBS A;  3RBT A;  2R0P A;  5ECR B;  4N0V A;  4BWS A;  2EIR A;  4LL4 B;  4XRD A;  2KOK A;  3IC8 A;  4HU9 A;  1IYI A;  3ERG A;  5INY A;  4OFM A;  1TI3 A;  3TGZ A;  1JLW A;  1EGO A;  1ZYQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...