5CP1A

Crystal structure of c239s mutant of a novel disulfide oxidoreductase from deinococcus radiodurans
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
245
structure length
245
Chain Sequence
LAPANSEKIRVDIWSDIACPWCYIGKRRFESALGQFPQRDQVEVVWHSFELDPSARPLNPIAMRDGLAMKYSISPAQAQGSLDHMTQTAAQEGLEYHFDRVKLANTFLAHQLIHYAAEQGQGDAMKERLLRAYMSEGQNVNDLDTLQKLAAEVGLDAGAARAALEAGTYAQAVRYDEAQAQQLGITGVPFFVLGGKYGVSGAQAPETLLGALSQVWAEQHPAPLTMLGQDAPAEGSEDGQCAVPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FrnE protein
publication title Crystal structure of a novel disulfide oxidoreductase from Deinococcus radiodurans
rcsb
source organism Deinococcus radiodurans (strain atcc 13939 / dsm 20539 / jcm 16871 / lmg 4051 /
molecule tags Oxidoreductase
total genus 85
structure length 245
sequence length 245
ec nomenclature
pdb deposition date 2015-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01323 DSBA DSBA-like thioredoxin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5cp1A00
4JRRA 2HFDA 20GSA 4HU7A 3GL3A 3WGEA 5DJMA 1XW9A 2HZFA 3ZITA 2E2MA 5ECLB 2P5QA 3QPMA 1UC7A 2REMA 1ERTA 2LNTA 4NV5A 1Z7PA 2A4VA 3RAZA 2V6KA 3VURA 2NVLA 3CXGA 1YF0A 5CP1A 2V6OA 3O6TA 3IK7A 5IMAA 2FWFA 3HJMA 2P5RA 3Q74A 2GLRA 3LYPA 1SL0B 3N9JA 2TRCP 1HD2A 3CBUA 4EDZA 2FWGA 1NHYA 4IP6A 1TRSA 2CA8A 4K0NA 3VPTA 2VL2A 5F06A 3GTUA 2VAFA 1MDJA 2IMIA 2OBIA 1CQGA 1LJRA 3WT2A 4I2TA 1GSQA 4L5OA 4K2DA 5DJLA 2JADA 2N5FA 1F6MC 4LL1B 4NAXA 2Z9SA 4D73B 3A2VA 1X0RA 2VOCA 3N5OA 1ZL9A 4ID0A 4RI7A 2R3XA 1TK0B 1TK5B 1GH2A 3F6DA 2EIOA 3GUSA 3GKKA 3HJOA 3VWUA 4BWSA 2PVQA 3VI7A 3FZAA 3A5WA 1PD21 2L4CA 2L6DA 3KH9A 2HNLA 4FYCA 4KAEA 1T3BA 1ZCPA 3F4SA 1XXUA 2BTOT 4KX4A 2LRTA 5D8IA 4JE1A 4TW5A 2L5OA 4GSTA 4EC0A 3ZRDA 3CSIA 3D5JA 2VLVA 1T4ZA 2WJUA 2RM6A 1HYUA 2OA7A 3TKSC 18GSA 2KUCA 1GULA 5B6NA 5C04A 2VCXA 3FHKA 4E8EA 1M0UA 4KSOA 4ZIJA 1ABAA 3HYPA 3IOSA 4IW9A 3U5RE 1C72A 2FWHA 2GGTA 1XWCA 1O73A 2ALBA 3KXOA 2QC7A 3VLNA 1AXDA 3GV1A 3FK8A 4ISDA 1GUHA 2R6KA 3EURA 1XWAA 3CSJA 1HNCA 1B8XA 2PPTA 2L4QA 6GSWA 3HVXA 5D96A 1OC9B 2C0DA 1EV4A 2E7PA 2VM1A 2HSHA 3QAWA 2GQLA 4XRAA 5AISA 3UOMA 4PUFC 3VPQA 3HZ8A 1FO5A 5ECIB 1I5GA 2L57A 1X5DA 4NHWA 2CZ2A 1ZOFA 5JWQB 3OR5A 2H19A 4K6XA 3KP8A 5JWOB 3E0UA 4I5QA 1TU7A 3W8JA 4DSSA 1NHOA 5A4UA 3UJ1A 5J9BA 1GL8A 2IL3A 2VCZA 1QQ2A 4GCIA 1ACVA 2R37A 2H0HA 4WEYA 5G1KA 1RW1A 5ECNB 3HDCA 1YEPA 1O81A 3DKSA 2DIZA 1XCCA 3UMAA 2HRNA 4HZ2A 1TI1A 4IJIA 4L0UA 4HJ2A 4GWRA 3D0ZA 1ON4A 1SJZA 4MF5A 4ZBAA 4N11A 4K7NA 5IIZA 2H6XA 1TRWA 1UVZA 1X5EA 5DVBA 3F6FA 3AY8A 3TKSE 2P0GA 3M3MA 3EYTA 5J5NA 3Q6OA 1QXHA 4YQVA 3PH9A 3TB2A 3WGXA 1U88A 5C00A 3L9SA 4I8BA 3EINA 3I6AA 1OAZA 5KN2A 2M46A 3GHAA 1TK8B 4BVXA 5AIVA 2C3NA 4I97A 3TKRA 3J7Yb 2R4VA 4KCAA 2A2RA 1PRXA 3DGQA 5ECSA 2L59A 3RDWA 1WWJA 2YNXA 4CHSA 3IDVA 4ECBA 4KE3A 4JEDA 1YDKA 5J9CA 4GSSA 2R2JA 4KSMA 3FR3A 4ULXA 1XOBA 2YJHA 2CX3A 5B7CA 3TKPA 1MD4A 2VCVA 1XVWA 4YH2A 3ZIJA 4OFMA 2B3SA 3O76A 2FNOA 5GSTA 5ECMB 1TJDA 1U3AA 3IV4A 1FG4A 4HJMA 1J08A 1VGLA 2GDRA 3LXZA 2FUG2 2RIIA 3V1WA 2DLXA 2YV7A 1YKAA 5B6MA 1PX6A 2JACA 3KM6A 2IMEA 3GFKA 1QK8A 2TRXA 2IIYA 2V32A 4JR6A 4LMVA 5IPHA 3LXTA 4TR0A 2B5EA 2PUKC 4IELA 3W8SA 1V9WA 3ERGA 3QMXA 3UBKA 1NSWA 1MDKA 1KBNA 2CAIA 3C71A 3GTUB 1AQXA 4KUNA 1SYRA 3I9V2 2PU9C 5J3RA 4DSRA 4I2UA 4TR4A 1LBKA 2TIRA 4EXJA 1WOUA 5HFGA 2XBIA 2H1AA 1X9SB 4ZBBA 2GZZA 22GSA 3TJBA 3H93A 4MABA 5CNWA 3GKMA 3CTGA 3F9UA 1M2DA 4WKWA 1EEJA 4NHZA 2GVPA 1O8WA 1S3DA 1O8XA 2VM2A 5D73A 3TJKA 5DCHA 6GSVA 3DEXA 3P8WA 2LKUA 3VWXA 3ZFLA 3ZVJD 2VO4A 3IAS2 3M8NA 4FO5A 5E4WA 1EV9A 5IQYA 1ERVA 4ML6A 1JZWA 3GN3A 3KMNA 4WETA 1S3AA 5EY6A 3D21A 1URMA 2DMMA 2MZCA 2HZEA 2OADA 5HFKA 1Y6EA 3QOUA 3FEUA 3VWVA 1ERWA 3C73A 4OCEA 1XPVA 1M2BA 2B1LA 1B4QA 2C0GA 5ABRA 4ZL9A 1VF2A 1VF1A 2L5LA 1A2JA 4ZL7A 4EUYA 5F0GA 1AC1A 4HEA2 1G0TA 1R5AA 6GSXA 4TXOA 5AN1A 4EO3A 1R4WA 4F0BA 4BA7A 1XW6A 5B8BA 3APQA 2K8SA 4FH8A 5HR2A 1JFUA 1T7PB 2OE1A 4ZILA 4IJ3A 3TGZA 3IHQA 1EZKA 3US3A 4G9HA 1K0CA 2IPAA 2FLSA 3D4MA 2CVDA 1J0FA 2LEGA 3U6VA 5D9XA 1DE1A 4O32A 3C1SA 2LNSA 14GSA 3F3QA 4DSSB 2AHEA 2WRTA 4EVMA 2X8CA 3GA4A 2WB9A 4XIHA 1THOA 1H75A 1GLQA 1SENA 1G6WA 5COHA 5CRGA 1TKDB 1Z3EA 2K9FA 1B48A 2IN3A 3FRCA 1TW9A 2YJ7A 2PGTA 2DBCA 1H4OA 4MJBA 2A2SA 3ZMKA 1S3CA 3DMLA 2VCWA 2H1DA 1JZDA 3WGDA 2IFQA 3HHVA 4GSNA 4MZCA 3TCOA 4K9ZA 1G6YA 3BBYA 1Z6MA 4GQCA 5J4UA 1XWKA 4YAPA 4HS1A 4LA1A 4DEJA 3BOAA 3KTBA 6GSUA 1PL1A 1MD3A 2B6MA 1ML6A 4XS4A 3ZFBA 2WGRA 4GQFA 3SBCA 3FR9A 3GURA 1QMVA 3CTFA 5CO3A 4TRXA 1WIKA 1TRVA 2JSZA 5AIXA 3RHBA 5ECRB 4RQRA 3BCKA 1R7HA 1FVKA 1TOFA 5CREA 5G2ZA 3KP9A 2JSYA 1GLPA 1GP1A 3WT1A 5FWGA 4ECIA 5IM9A 4MP4A 3ISOA 4GTUA 1FW1A 2DJ2A 5L71A 2LSTA 3KZQA 1WE0A 3EWLA 2K8VA 4AJ7A 1Z9HA 3LSZA 4KH7A 1FHEA 5DALA 2F3MA 2PMTA 5DQYA 2JZSA 4JBBA 3EU3A 1R26A 3ZIVA 1K0MA 5KN1A 1Z7RA 4OWYA 4IBPA 1RQMA 3CYNA 1N2AA 2AV4A 4BPYA 1A2MA 1HQOA 2VCQA 1X5CA 3DVXA 4ACSA 2IMDA 4MH2A 2OBKA 2MMOA 5ECQB 3LFLA 1VF3A 3JCML 3IAM2 1ZGNA 2MMZA 4MJAA 3Q19A 3KEBA 4PNFA 5JWRB 4L5LA 5CAXA 2AJQB 1YKCA 2IMFA 4MDCA 5ECHB 2RUEA 2GT6A 2LQOA 5B8AA 4L0WA 3J7Yk 2WDUA 5ELAA 3MDKA 3RHCA 4JU5A 3VK9A 5IMDA 4TVEA 2O87A 3GSTA 4OO5A 1EGRA 3P7XA 5F07A 1F37A 5HQPA 1Q98A 1BQ7A 5EL8A 4IVFA 1SJ6A 3TOTA 4PURA 2M72A 1FB6A 2FHEA 3UL3A 3KTLA 5IMVA 1BYEA 1JLWA 2JU5A 2FA4A 1ZMAA 2I1UA 5F05A 3F0IA 4MJEA 2H71A 4O7HA 4TR3A 1B9XC 2VLTA 1GSUA 2H30A 1M9BA 3ZYWA 2YCDA 1A24A 1GUMA 2DJ1A 4WBJA 1YF1A 2YPMA 2DJ3A 2HSYA 4KCEA 5ELGA 10GSA 2E2GA 3QAVA 3UBLA 1LU4A 1JHBA 3MSZA 4MJCA 2HZEB 3FYGA 2VL2C 4N0VA 1R5PA 5IO2A 4AGSA 3LQ7A 2YN1A 4MLYA 1QGVA 4DSQA 5DAKB 4HOJA 2DC5A 3H1NA 3G9BA 4OD7A 1BAYA 4EDYA 3HD5A 1K0AA 4TXOB 3HVSA 19GSA 4OCFA 1YZXA 1OC3A 1TXXA 4H86A 2B5YA 4WF5A 1ILOA 4KGIA 4KB3A 3HXSA 4XCSA 1GTUA 4NXIA 2CX4A 4K1FA 1O6JA 1XW5A 3GX8A 2O7KA 2YWMA 1SK2A 3HVVA 3E3EA 3FW2A 3VWWA 4IS0A 2FY6A 1A23A 1GUKA 1TTZA 5GAND 4KNDA 1SD9A 4G2EA 1AW9A 3KJYA 2NPBA 5AGYA 4OFNA 2X99A 1K0NA 1A8LA 4QL7A 2KP2A 2AB6A 1GSEA 5A4WA 5KEJA 5JCWA 1FVJA 4XRDA 4XS1A 2GTUA 3IBHA 2QSIA 2CVBA 4CW9A 4MF6A 3GYKA 2EIQA 11GSA 2VL3A 2IFQB 4GXZA 2H1BA 4LMWA 4POMA 2ZNMA 3LORA 4YQMA 1U87A 2QKEA 1Y25A 4ZBDA 3TDGA 3H8QA 3TJGA 3UARA 2H66A 2JZTA 5ECKB 4G10A 2LUSA 4E8HA 3DWVA 1USBA 3A2XA 2C4JA 3UVTA 3WYWA 4OMVA 2O85A 4QQ7A 4WXTA 4EE0A 1ZYQB 2C80A 1B4PA 4XS4B 2GQKA 5CRDA 3SWLA 1TU8A 2LQQA 4FYUA 1TRUA 3BCIA 2N5AA 1GWCA 2OJLA 3Q18A 1MTCA 1QFNA 2FGXA 4WF4A 4YQUA 4PX1A 3W6GA 4F9ZA 4CDOA 3F8UA 4EL1A 3LWAA 2C3TA 4ZB6A 1PQNA 1XBSA 4DVCA 2LS5A 2LJRA 5IOWA 7GSSA 1M7TA 2F51A 3UIWA 1JZRA 5GAPD 2H72A 1GSYA 6GSTA 3F63A 1SJIA 3HZ4A 4ECJA 2NBSA 5DALB 2H01A 4KDYA 4WBRD 3ERFA 2CQ9A 2FD3A 3O3TA 3CSHA 4TOPA 3QR6A 2LJKA 3MWHA 2VD1A 2AAWA 1BJXA 4MPFA 3IK9A 1GTIA 3L4NA 3L9UA 2M80A 5HR0A 3L9VA 4HZ4A 3QDNA 2DJ0A 2XHFA 1VF4A 1OC9A 3DXBA 1TI3A 2WULA 3I69A 5A5KA 2AYTA 4EKZA 3GMFA 2VLUA 4V2NA 5EVOA 3EMPA 1XFLA 5H5QA 5DQSA 2VCTA 3IXRA 5H5RA 4POBA 4AF2A 4XHMA 2FWEA 4IQ1A 2ON7A 1PL2A 3QAGA 2KHPA 4PGTA 2H70A 3MAKA 4ZB9A 1SL1B 1MDIA 3GH6A 3PR8A 4LLRA 3EC3A 2X8HA 2HXKA 13GSA 1GSDA 4NPBA 1K3OA 1V98A 2HT9A 4V2MA 1X9MB 1OE7A 3DVWA 3HKRA 4XTSA 1EEMA 5FHIA 4P3YB 4Q5FA 1CQHA 2FCHA 3NZNA 4ML1A 3CRTA 3H79A 3KCMA 1YJ6A 5ID2A 2JZRA 1AAZA 1GTBA 1F3BA 1NM3A 1SKSB 1A0RP 2O8VB 2GSQA 1PKZA 2MMNA 1EP8A 2F9SA 1PKWA 2D2ZA 2V1MA 2V2GA 5JCGA 3HJPA 1OYJA 1SKWB 5J41A 4PQIA 1SD8A 1XOAA 2DSAA 1DSBA 1DUGA 1ZZYA 1AQWA 1YQ1A 1UN2A 2I3YA 4EF0A 2CZ3A 3TKSA 1TP9A 3EE2A 4N0ZA 4OFTA 4K7IA 1T1VA 6GSYA 5A4VA 3PGTA 2OACA 1DE2A 3BD2A 3D6IA 1AIUA 1OVNA 3KD0A 1FAAA 2V41A 3L0HA 4I6XA 3ZL5A 3QFBC 1DBYA 3ZMLA 1WPIA 3M9KA 4V1Ag 3ME8A 1EOGA 2GSTA 4X43A 2LTKA 2J9HA 3ZTLA 5KN0A 3S9FA 3HCZA 4FIWA 4G19A 1OE8A 1EOHA 1A8YA 1WRYA 4BL7A 3WD6A 4N30A 4HI7A 1WJKA 3FZ9A 5ENUA 4WR5A 1SKRB 2PN8A 4J2FA 3G7JA 5D9WA 4OO4A 2YWOA 4HQSA 4O92A 1UA5A 2HLSA 1NW2A 5H5SA 3GRXA 2XBQA 5HFIA 3FZ4A 1V58A 4Q5QA 4FYBA 2B5XA 4PUAA 3C7MA 4BVYA 1ZYEA 2XPDA 2VD0A 2GSSA 2YANA 3APSA 1FB0A 5IO0A 3LYKA 3P90A 3GL5A 4L8EA 4POKA 4TR1A 5D93A 1W4VA 2DJKA 2WZ9A 1SL2B 1PA3A 3APOA 2WCIA 3IR4A 3TJJA 1B9YC 2PVOC 2FA8A 4WR4A 4MF7A 2QGVA 3PINA 4IHUA 5GZZB 3IPZA 1KNGA 4IN0A 1G7EA 1HNBA 2L6CA 2IMKA 5FT3A 1K0OA 4IP1A 2H76A 5G31A 1TDIA 5LNKe 3TJFA 5INYA 2K18A 2YWNA 3IC4A 1X9WB 4PXOA 1PMTA 2IWTA 3P2AA 1M9AA 2O89A 4ILFA 1K0DA 1GSFA 4AJ8A 2OE0A 2XC2A 1WP0A 2GT5A 1O7UA 5G5FA 2YP6A 1U6TA 3MNGA 1V57A 1ST9A 1W89A 1O85A 5IMZA 5DCGA 2G0FA 2ES7A 3LGCA 4TXVA 2OE3A 1WMJA 16GSA 4F03A 1XWBA 2GS3A 3LG6A 3GH9A 4JZQA 3GX0A 4K7OA 4MZBA 2I4AA 4JR4A 3TUEA 1E2YA 1GTAA 3TRQA 3RPPA 3ZLPA 2WFCA 3UAPA 1MEKA 2YV9A 4PQHA 3R2QA 1U3IA 4MZWA 3TOUA 4HU9A 2CVKA 1SYXA 1EP7A 3GSSA 2NTOA 1HNAA 4TKYA 4Q5RA 2RUFA 3FY7A 2VIMA 3LJRA 1F3AA 3QD9A 3DYRA 3VFIA 3EVIA 5G5EA 1JZOA 1G7OA 1YY7A 2N5BA 2E0QA 2H1GA 3DRNA 1T00A 3UEMA 5G30A 4PQ1A 4MMMA 2HYXA 5HR3A 4KA0A 3H4KA 4BWQA 5GSSA 2MYGA 3DD3A 4NWYA 4KDUA 4GF0A 1Z6NA 4QL9A 2JL4A 1THXA 3D22A 5ID2B 3ERWA 4GLTA 1SU9A 5E59A 1GNEA 1SK0A 3KH7A 2LJAA 4IQAA 3ZVJA 2C0EA 1EGOA 4Q5NA 1F2EA 2AUVA 3M9JA 3KGKA 4TN8A 3ZREA 1AUCA 1GSSA 5HR1A 4YAVA 1SK1A 3ME7A 5CRWA 2H73A 2X8GA 2P31A 3KMOA 1V2AA 2VUPA 1IYIA 1XZOA 9GSSA 3ZZXA 2HRFA 5G1LA 3A3TA 2H6YA 3FR6A 2EC4A 2H8LA 2LRCA 2YZUA 1QUWA 4ZXGA 1PN9A 3CRUA 2J23A 3A2WA 4O5RA 3EMXA 2GQMA 3F3RA 2GSRA 4IKHA 2PERA 4D73A 3QCPA 5EPFA 3FKFA 1T4YA 2R5GA 5IOXA 2K6VA 4F2IA 4X1UA 2GZPA 1I9DA 3IE3A 4HDEA 5CRHA 3L78A 2RLIA 1T8EB 2LRNA 4MA9A 3FZ5A 3LEFA 2YOIA 3I43A 5D9VA 3IA1A 2LV3A 2EIRA 1IYHA 2GZYA 1KEBA 1K3LA 1E6BA 3UVHA 3HY2A 4ZB8A 2YWIA 1PX7A 2XPEA 4RI6A 3IRAA 2DIYA 5LCZA 3GKNA 2G2QA 1J9BA 2H0IA 5F8BA 3QFAC 2H74A 5D9TA 2OKAA 1OKTA 3TRPA 1M99A 2H6ZA 1XVQA 4TR1B 5ECOB 2PWJA 2H75A 2B7JA 2I9HA 1Q4JA 3HA9A 4HUAA 2MBSA 2C0FA 4V1Ap 4K0GA 4MK3A 5JCUA 5IMCA 1OKDA 5KN3A 4HQZA 4V2LA 2HI7A 4KW6A 5DBQA 1XWGA 2KLXA 4NV2A 5CYYA 4Z7XA 4MPGA 5IMFA 2BMXA 12GSA 2ON5A 3TKQA 2H0GA 1ERUA 4GRFA 2F8AA 1PGTA 4XS6A 3RBTA 3KIJA 3ED3A 3C8EA 1GRXA 3NOFA 3D4TA 2I81A 1EWXA 2NDOA 1XIYA 3VI5A 3G7YA 3DIEA 1M2AA 4POLA 4RQXA 5LD0A 4K8MA 5DAKA 17GSA 4N10A 4J57E 1F9MA 2CAQA 2CV4A 5DDLA 3GKXA 3M0FA 3BJ5A 2DMLA 2HE3A 8GSSA 1KTEA 4PNGA 2BJXA 2MBTA 1A2LA 4J56E 1K3YA 4RUVA 2YZHA 2ZUPA 3RPNA 4LL4B 3G7IA 4MH3A 3M1GA 3TRXA 1FOVA 3E9JB 2C8UA 1BG5A 1Z5YE 2IJYA 1BX9A 2X64A 4ECCA 1A0FA 2VL9A 2B7KA 3GIXA 1GNWA 1PSQA 2PBJA 2WS2A 1N8JA 2C1YA 4NMUA 1JLVA 2KOKA 5ECPB 1V40A 3F4RA 4ZL8A 1YEXA 2DJJA 3NIVA 3K8NA 4KDXA 3CMIA 1OC8A 2C3QA 2B1KA 4F82A 2F8FA 1K0BA 1BEDA 3GNJA 2CT6A 2RM5A 3F4TA 2KP1A 4X0XA 4F0CA 4IGJA 1VRSD 1RK4A 2ZCTA 4AJ6A 3C1RA 5IPGA 3EU4A 1AQVA 4MCUA 2MMAA 6GSSA
chains in the Genus database with same CATH superfamily
4JRRA 2HFDA 20GSA 4HU7A 3GL3A 3WGEA 5DJMA 1XW9A 2HZFA 3ZITA 2E2MA 5ECLB 2P5QA 3QPMA 1UC7A 2REMA 1ERTA 2LNTA 4NV5A 1Z7PA 2A4VA 3RAZA 2V6KA 3VURA 2NVLA 3CXGA 1YF0A 5CP1A 2V6OA 3O6TA 3IK7A 5IMAA 2FWFA 3HJMA 2P5RA 3Q74A 2GLRA 3LYPA 1SL0B 3N9JA 2TRCP 1HD2A 3CBUA 4EDZA 4YKFA 2FWGA 1NHYA 4IP6A 1TRSA 2CA8A 4K0NA 3VPTA 2VL2A 5F06A 3GTUA 2VAFA 1MDJA 2IMIA 2OBIA 1CQGA 1LJRA 3WT2A 4I2TA 1GSQA 4L5OA 4K2DA 5DJLA 2JADA 2N5FA 1F6MC 4LL1B 4NAXA 2Z9SA 4D73B 3A2VA 1X0RA 2VOCA 3N5OA 1ZL9A 4Z2UA 4ID0A 4RI7A 2R3XA 1TK0B 1TK5B 1GH2A 3F6DA 2EIOA 3GUSA 3GKKA 3HJOA 3VWUA 4BWSA 2PVQA 3VI7A 3FZAA 3A5WA 1PD21 2L4CA 2L6DA 3KH9A 2HNLA 4FYCA 4KAEA 1T3BA 1ZCPA 3F4SA 1XXUA 2BTOT 4KX4A 2LRTA 5D8IA 4JE1A 4TW5A 2L5OA 4GSTA 4EC0A 3ZRDA 3CSIA 3D5JA 4A5PA 2VLVA 1T4ZA 2WJUA 2RM6A 1HYUA 2OA7A 3TKSC 18GSA 2KUCA 1GULA 5B6NA 5C04A 2VCXA 3FHKA 4E8EA 1M0UA 4KSOA 4ZIJA 2DKHA 1ABAA 3HYPA 3IOSA 4IW9A 3U5RE 1C72A 2FWHA 2GGTA 1XWCA 1O73A 2ALBA 3KXOA 2QC7A 3VLNA 1AXDA 3GV1A 3FK8A 4ISDA 1GUHA 2R6KA 3EURA 1XWAA 3CSJA 1HNCA 1B8XA 2PPTA 2L4QA 6GSWA 3HVXA 5D96A 1OC9B 2C0DA 1EV4A 4CY6A 2E7PA 2VM1A 2HSHA 3QAWA 2GQLA 4XRAA 5AISA 3UOMA 4PUFC 3VPQA 3HZ8A 1FO5A 5ECIB 1I5GA 2L57A 1X5DA 4NHWA 2CZ2A 1ZOFA 5JWQB 3OR5A 2H19A 4K6XA 3KP8A 5JWOB 3E0UA 4I5QA 1TU7A 3W8JA 4DSSA 1NHOA 5A4UA 3UJ1A 5J9BA 1GL8A 2IL3A 2VCZA 1QQ2A 4GCIA 1ACVA 2R37A 2H0HA 4WEYA 5G1KA 1RW1A 5ECNB 3HDCA 1YEPA 1O81A 3DKSA 2DIZA 1XCCA 3UMAA 2HRNA 4HZ2A 1TI1A 1M3JA 4IJIA 4L0UA 4HJ2A 4GWRA 3D0ZA 1ON4A 1SJZA 4MF5A 4ZBAA 4N11A 4K7NA 5IIZA 2H6XA 1TRWA 1UVZA 1X5EA 5DVBA 3F6FA 3AY8A 3TKSE 2P0GA 3M3MA 3EYTA 5J5NA 3Q6OA 1QXHA 4YQVA 3PH9A 3TB2A 3WGXA 1U88A 5C00A 3L9SA 4I8BA 3EINA 4KF9A 3I6AA 1OAZA 2DKIA 5KN2A 2M46A 3GHAA 1TK8B 4BVXA 5AIVA 2C3NA 4I97A 3TKRA 3J7Yb 2R4VA 4KCAA 2A2RA 1PRXA 3DGQA 5ECSA 2L59A 3RDWA 1WWJA 2YNXA 4CHSA 3IDVA 4ECBA 4KE3A 4JEDA 1YDKA 5J9CA 1ZYNA 4GSSA 2R2JA 4KSMA 3FR3A 4ULXA 1XOBA 2YJHA 2CX3A 5B7CA 3TKPA 1MD4A 2VCVA 1XVWA 4YH2A 3ZIJA 4OFMA 2B3SA 3O76A 2FNOA 5GSTA 5ECMB 1TJDA 1U3AA 3IV4A 1FG4A 4HJMA 1J08A 1VGLA 2GDRA 3LXZA 2FUG2 2RIIA 3V1WA 2DLXA 2YV7A 1YKAA 5B6MA 1PX6A 3IHGA 2JACA 3KM6A 2IMEA 3GFKA 1QK8A 2TRXA 2IIYA 3PPUA 2V32A 4JR6A 4LMVA 2QA2A 5IPHA 3LXTA 4TR0A 2B5EA 2PUKC 4IELA 3W8SA 1V9WA 3ERGA 3QMXA 3UBKA 1NSWA 1MDKA 1KBNA 2CAIA 3C71A 3GTUB 1AQXA 4KUNA 1SYRA 3I9V2 5BMUA 2PU9C 5J3RA 4DSRA 4I2UA 4TR4A 1LBKA 2TIRA 4EXJA 1WOUA 5HFGA 2XBIA 2H1AA 1X9SB 4ZBBA 2GZZA 22GSA 3TJBA 3H93A 4MABA 5CNWA 3GKMA 3CTGA 3F9UA 1M2DA 4WKWA 1EEJA 4NHZA 2GVPA 1O8WA 1S3DA 1O8XA 2VM2A 5D73A 3TJKA 5DCHA 4Z2TA 6GSVA 3DEXA 3P8WA 2LKUA 3VWXA 3ZFLA 3ZVJD 2VO4A 3IAS2 3M8NA 4FO5A 5E4WA 1EV9A 5IQYA 1ERVA 4ML6A 1JZWA 3GN3A 4CY8A 3KMNA 4WETA 1S3AA 5EY6A 3D21A 1URMA 2DMMA 2MZCA 2HZEA 2OADA 5HFKA 1Y6EA 3QOUA 3FEUA 3VWVA 1ERWA 3C73A 4OCEA 1XPVA 1M2BA 2B1LA 1B4QA 2C0GA 5ABRA 4ZL9A 1VF2A 1VF1A 2L5LA 1A2JA 4ZL7A 4EUYA 5F0GA 1AC1A 4HEA2 3MIXA 1G0TA 1R5AA 6GSXA 4TXOA 5AN1A 4EO3A 1R4WA 4F0BA 4BA7A 1XW6A 5B8BA 3APQA 2K8SA 4FH8A 5HR2A 1JFUA 1T7PB 2OE1A 4ZILA 4IJ3A 3TGZA 3IHQA 1EZKA 3US3A 4G9HA 1K0CA 2IPAA 2FLSA 3D4MA 2CVDA 1J0FA 2LEGA 3U6VA 5D9XA 1DE1A 4O32A 3C1SA 2LNSA 14GSA 3F3QA 4DSSB 2AHEA 2WRTA 4EVMA 2X8CA 3GA4A 2WB9A 4XIHA 1THOA 1H75A 1GLQA 1SENA 1G6WA 5COHA 1XG8A 5CRGA 1TKDB 1Z3EA 2K9FA 1B48A 2IN3A 3FRCA 1TW9A 2YJ7A 2PGTA 2DBCA 1H4OA 4MJBA 2A2SA 3ZMKA 1S3CA 3DMLA 2VCWA 2H1DA 1JZDA 3WGDA 2IFQA 3HHVA 4GSNA 4MZCA 3TCOA 4K9ZA 1G6YA 2UZ8A 3BBYA 1Z6MA 4GQCA 5J4UA 1XWKA 4YAPA 4HS1A 4LA1A 4DEJA 3BOAA 3KTBA 6GSUA 1PN0A 1PL1A 1MD3A 2B6MA 1ML6A 2HRAA 4XS4A 4BVXB 3ZFBA 2WGRA 4GQFA 3SBCA 3FR9A 3GURA 1QMVA 3CTFA 5CO3A 4TRXA 1WIKA 1TRVA 2JSZA 5AIXA 3RHBA 5ECRB 4RQRA 3BCKA 1R7HA 1FVKA 1TOFA 5CREA 5G2ZA 3KP9A 2JSYA 1GLPA 1GP1A 3WT1A 5FWGA 4ECIA 5IM9A 4MP4A 3ISOA 4GTUA 1FW1A 2DJ2A 5L71A 2LSTA 3KZQA 1WE0A 3EWLA 2K8VA 4AJ7A 1Z9HA 3LSZA 4KH7A 1FHEA 5DALA 2F3MA 2PMTA 5DQYA 2JZSA 4JBBA 3EU3A 1R26A 3ZIVA 1K0MA 5KN1A 1Z7RA 4OWYA 4IBPA 1RQMA 3CYNA 1N2AA 2AV4A 4BPYA 1A2MA 1HQOA 2VCQA 1X5CA 3DVXA 4ACSA 2IMDA 4MH2A 2OBKA 2MMOA 5ECQB 3LFLA 1VF3A 3JCML 3IAM2 1ZGNA 2MMZA 4MJAA 3Q19A 3KEBA 4PNFA 5JWRB 4L5LA 5CAXA 2AJQB 1YKCA 2IMFA 4MDCA 5ECHB 2RUEA 2GT6A 2LQOA 5B8AA 4L0WA 3J7Yk 2WDUA 5ELAA 3MDKA 3RHCA 4JU5A 3VK9A 5IMDA 4TVEA 2O87A 3GSTA 4OO5A 1EGRA 3P7XA 5F07A 1F37A 5HQPA 1Q98A 1BQ7A 5EL8A 4IVFA 1M3IA 1SJ6A 3TOTA 4PURA 2M72A 1FB6A 2FHEA 3UL3A 3KTLA 5IMVA 1BYEA 1JLWA 2JU5A 2FA4A 1ZMAA 2I1UA 5F05A 3F0IA 4MJEA 2H71A 4O7HA 4TR3A 1B9XC 2VLTA 1GSUA 2H30A 1M9BA 3ZYWA 2YCDA 1A24A 1GUMA 2DJ1A 4WBJA 1YF1A 2YPMA 2DJ3A 2HSYA 4KCEA 2X49A 5ELGA 10GSA 2E2GA 3QAVA 3UBLA 1LU4A 1JHBA 3MSZA 4MJCA 2HZEB 3FYGA 2VL2C 4N0VA 1R5PA 5IO2A 4AGSA 3LQ7A 2YN1A 4MLYA 1QGVA 4DSQA 5DAKB 4HOJA 2DC5A 3H1NA 3G9BA 4OD7A 1BAYA 4EDYA 3HD5A 1K0AA 4TXOB 3HVSA 19GSA 4OCFA 1YZXA 1OC3A 1TXXA 4H86A 2B5YA 4WF5A 1ILOA 4KGIA 4KB3A 3HXSA 4XCSA 1GTUA 4NXIA 2CX4A 4K1FA 1O6JA 1XW5A 3GX8A 2O7KA 2YWMA 1SK2A 3HVVA 3E3EA 3FW2A 5BRTA 3VWWA 4IS0A 2FY6A 1A23A 1GUKA 1TTZA 5GAND 4KNDA 1SD9A 4G2EA 1AW9A 3KJYA 2NPBA 5AGYA 4OFNA 2X99A 4G0IA 1K0NA 1A8LA 4QL7A 2KP2A 2AB6A 1GSEA 5A4WA 5KEJA 5JCWA 1FVJA 4XRDA 4XS1A 4G0LA 2GTUA 3IBHA 2QSIA 2CVBA 4CW9A 4Z2RA 4MF6A 3GYKA 2EIQA 11GSA 2VL3A 2IFQB 4GXZA 2H1BA 4LMWA 4POMA 4YKGA 2ZNMA 3LORA 4YQMA 1U87A 2QKEA 1Y25A 4ZBDA 3TDGA 3H8QA 3TJGA 3UARA 2H66A 2JZTA 5ECKB 4G10A 2LUSA 4E8HA 3DWVA 4EIPA 1USBA 3A2XA 2C4JA 3UVTA 4X4JA 2A2PA 3WYWA 4OMVA 2R0PA 2O85A 4QQ7A 4WXTA 4EE0A 1ZYQB 2C80A 1B4PA 4XS4B 2GQKA 5CRDA 3SWLA 1TU8A 2LQQA 4FYUA 1TRUA 3BCIA 2N5AA 1GWCA 2OJLA 3Q18A 1MTCA 1QFNA 2FGXA 4WF4A 4YQUA 4PX1A 3W6GA 4F9ZA 4CDOA 3F8UA 4EL1A 3LWAA 2C3TA 4ZB6A 1PQNA 1XBSA 4DVCA 2LS5A 2LJRA 5IOWA 7GSSA 1M7TA 2F51A 3UIWA 1JZRA 5GAPD 2H72A 1GSYA 6GSTA 3F63A 1ZYPA 1SJIA 3HZ4A 4ECJA 2NBSA 5DALB 2H01A 4KDYA 4WBRD 3ERFA 2CQ9A 2FD3A 3O3TA 3CSHA 4TOPA 3QR6A 2LJKA 3MWHA 2VD1A 2AAWA 1BJXA 4MPFA 3IK9A 1GTIA 3L4NA 3L9UA 2M80A 5HR0A 3L9VA 4HZ4A 5KOXA 3QDNA 2DJ0A 2XHFA 1VF4A 1OC9A 3DXBA 1TI3A 2WULA 3I69A 5A5KA 2AYTA 4EKZA 3GMFA 2VLUA 4V2NA 5EVOA 3EMPA 1XFLA 5H5QA 5DQSA 2VCTA 3IXRA 5H5RA 4POBA 4AF2A 4XHMA 2FWEA 4IQ1A 2ON7A 1PL2A 4MNNA 3QAGA 2KHPA 4PGTA 2H70A 3MAKA 4ZB9A 1SL1B 4K5SA 1MDIA 3GH6A 3PR8A 4LLRA 3EC3A 2X8HA 2HXKA 13GSA 1GSDA 4NPBA 1K3OA 1V98A 2HT9A 4V2MA 1X9MB 1OE7A 3DVWA 3HKRA 4XTSA 1EEMA 5FHIA 4P3YB 4Q5FA 1CQHA 4O5UA 2FCHA 3NZNA 4ML1A 3CRTA 3H79A 3KCMA 1YJ6A 2R0CA 5ID2A 4ICYA 2JZRA 1AAZA 1GTBA 1F3BA 1NM3A 1SKSB 1A0RP 2O8VB 2GSQA 1PKZA 2MMNA 1EP8A 2F9SA 1PKWA 2D2ZA 2V1MA 2V2GA 5JCGA 3HJPA 1OYJA 1SKWB 5J41A 4PQIA 1SD8A 1XOAA 2DSAA 1DSBA 4FQUA 1DUGA 1ZZYA 1AQWA 1YQ1A 1UN2A 2I3YA 4EF0A 3FMWA 2CZ3A 2HRKA 3TKSA 1TP9A 3EE2A 4N0ZA 4OFTA 4K7IA 1T1VA 6GSYA 5A4VA 3PGTA 2OACA 1DE2A 3BD2A 3D6IA 1AIUA 1OVNA 3KD0A 1FAAA 2V41A 3L0HA 1PFOA 4I6XA 3ZL5A 1S3RA 3QFBC 1DBYA 3ZMLA 1WPIA 3M9KA 4V1Ag 3ME8A 1EOGA 2GSTA 4X43A 2LTKA 2J9HA 3ZTLA 5KN0A 3S9FA 4O5QA 3HCZA 4FIWA 5KOWA 4G19A 1OE8A 1EOHA 1A8YA 1WRYA 4BL7A 3WD6A 4N30A 4HI7A 1WJKA 3FZ9A 5ENUA 4WR5A 1SKRB 2PN8A 4J2FA 3G7JA 5D9WA 4OO4A 2YWOA 4HQSA 4O92A 1UA5A 2HLSA 1NW2A 5H5SA 3GRXA 2XBQA 5HFIA 3FZ4A 1V58A 4Q5QA 4FYBA 2B5XA 4PUAA 3C7MA 4BVYA 1ZYEA 2XPDA 2VD0A 2GSSA 3A5IA 2YANA 3APSA 1FB0A 5IO0A 3LYKA 3P90A 3GL5A 4L8EA 4POKA 4TR1A 5D93A 1W4VA 2DJKA 2WZ9A 1SL2B 1PA3A 2X4AA 3APOA 2WCIA 3HVNA 3IR4A 3TJJA 1B9YC 2PVOC 2FA8A 4WR4A 4MF7A 2QGVA 3PINA 4IHUA 5GZZB 3IPZA 1KNGA 4IN0A 1G7EA 1HNBA 2L6CA 2IMKA 5FT3A 1K0OA 4IP1A 2H76A 5G31A 1TDIA 5LNKe 3TJFA 5INYA 2K18A 2YWNA 3IC4A 1X9WB 4PXOA 1PMTA 2IWTA 3P2AA 1M9AA 2O89A 4ILFA 1K0DA 1GSFA 4AJ8A 2OE0A 2XC2A 1WP0A 2GT5A 1O7UA 5G5FA 2YP6A 1U6TA 3MNGA 1V57A 1ST9A 1W89A 1O85A 5IMZA 5DCGA 2G0FA 2ES7A 3LGCA 4TXVA 2OE3A 1WMJA 16GSA 4F03A 1XWBA 2GS3A 3LG6A 3GH9A 4JZQA 3GX0A 4K7OA 4MZBA 2I4AA 4JR4A 3TUEA 1E2YA 1GTAA 3TRQA 3RPPA 3ZLPA 2WFCA 3UAPA 1MEKA 2YV9A 4PQHA 3R2QA 1U3IA 4MZWA 3TOUA 4HU9A 4K2XA 4G0KA 2CVKA 1SYXA 1EP7A 3GSSA 2NTOA 1HNAA 4TKYA 4Q5RA 2RUFA 3FY7A 2VIMA 3LJRA 1F3AA 3QD9A 3DYRA 3VFIA 3EVIA 5G5EA 1JZOA 1G7OA 1YY7A 2N5BA 2E0QA 2H1GA 3DRNA 1T00A 3UEMA 5G30A 4PQ1A 4MMMA 2HYXA 5HR3A 4KA0A 3H4KA 4BWQA 5GSSA 2MYGA 3DD3A 4NWYA 4K5RA 4KDUA 4GF0A 1Z6NA 4QL9A 2JL4A 1THXA 3D22A 5ID2B 3ERWA 4GLTA 1SU9A 5E59A 1GNEA 1SK0A 3KH7A 2LJAA 4IQAA 3ZVJA 2C0EA 1EGOA 4Q5NA 1F2EA 2AUVA 3M9JA 3KGKA 4TN8A 3ZREA 1AUCA 1GSSA 5HR1A 4YAVA 1SK1A 3ME7A 5CRWA 2H73A 2X8GA 3R3EA 2P31A 3KMOA 1V2AA 2VUPA 1IYIA 1XZOA 9GSSA 3ZZXA 2HRFA 5G1LA 3A3TA 2H6YA 3FR6A 2R0GA 2EC4A 2H8LA 2LRCA 2YZUA 1QUWA 4ZXGA 1PN9A 3CRUA 2J23A 3A2WA 4O5RA 3EMXA 2GQMA 3F3RA 2GSRA 4IKHA 4BIKA 1FOHA 2PERA 4D73A 3QCPA 5EPFA 3FKFA 1T4YA 2R5GA 5IOXA 2K6VA 4F2IA 4X1UA 2GZPA 1I9DA 3IE3A 4HDEA 4BL7B 5CRHA 3L78A 2RLIA 1T8EB 2LRNA 4MA9A 3FZ5A 3LEFA 2YOIA 3I43A 5D9VA 3IA1A 2LV3A 2EIRA 1IYHA 2GZYA 1KEBA 1K3LA 1E6BA 3UVHA 3HY2A 4ZB8A 2YWIA 1PX7A 2XPEA 4RI6A 3IRAA 2DIYA 5LCZA 3GKNA 2G2QA 1J9BA 2H0IA 5F8BA 4BVYB 3QFAC 2H74A 3IC8A 5D9TA 2OKAA 1OKTA 3TRPA 1M99A 2H6ZA 1XVQA 4TR1B 5ECOB 2PWJA 2H75A 2B7JA 2I9HA 1Q4JA 3HA9A 4HUAA 2MBSA 2C0FA 4V1Ap 4K0GA 4MK3A 5JCUA 5IMCA 1OKDA 5KN3A 4USSA 4HQZA 4V2LA 2HI7A 4HSCX 4KW6A 5DBQA 1XWGA 2KLXA 4NV2A 5CYYA 4Z7XA 4MPGA 5IMFA 2HSMA 2BMXA 12GSA 2ON5A 3TKQA 2H0GA 3MYDA 1ERUA 4GRFA 2F8AA 1PGTA 4XS6A 3RBTA 3KIJA 3ED3A 3C8EA 1GRXA 3NOFA 3D4TA 2I81A 1EWXA 2NDOA 1XIYA 3CQFA 3VI5A 3G7YA 3DIEA 1M2AA 4POLA 4RQXA 5LD0A 4K8MA 5DAKA 17GSA 4N10A 4J57E 1F9MA 2CAQA 2CV4A 5DDLA 3GKXA 3M0FA 3BJ5A 2DMLA 2HE3A 8GSSA 1KTEA 4PNGA 2BJXA 2MBTA 4J56E 1A2LA 1K3YA 2QA1A 4RUVA 4EIQA 2YZHA 2ZUPA 3RPNA 4LL4B 3G7IA 4MH3A 3M1GA 3TRXA 1FOVA 3E9JB 2C8UA 1BG5A 3LW9A 1Z5YE 2IJYA 1BX9A 2X64A 4ECCA 2A4HA 1A0FA 2VL9A 2B7KA 3GIXA 1GNWA 1PSQA 2PBJA 2WS2A 1N8JA 2C1YA 4NMUA 1JLVA 2KOKA 5ECPB 1V40A 3F4RA 4ZL8A 1YEXA 2DJJA 3NIVA 3K8NA 4KDXA 3CMIA 1OC8A 2C3QA 2B1KA 4F82A 2F8FA 1K0BA 1BEDA 3GNJA 2CT6A 2RM5A 3F4TA 2KP1A 4X0XA 4F0CA 4IGJA 4PTSA 3EPTA 1VRSD 1RK4A 2ZCTA 4AJ6A 3C1RA 5IPGA 3EU4A 1AQVA 4MCUA 2MMAA 6GSSA
chains in the Genus database with same CATH topology
4JRRA 2HFDA 20GSA 4HU7A 3GL3A 3WGEA 5DJMA 1XW9A 2HZFA 3ZITA 2E2MA 5ECLB 2P5QA 3QPMA 1UC7A 2REMA 1ERTA 2LNTA 4NV5A 1Z7PA 2A4VA 3RAZA 2V6KA 3VURA 2NVLA 3CXGA 1YF0A 5CP1A 2V6OA 3O6TA 3IK7A 5IMAA 2FWFA 3HJMA 2P5RA 3Q74A 2GLRA 3LYPA 1SL0B 3N9JA 2TRCP 1HD2A 3CBUA 4EDZA 4YKFA 2FWGA 1NHYA 4IP6A 1TRSA 2CA8A 4K0NA 3VPTA 2VL2A 5F06A 3GTUA 2VAFA 1MDJA 2IMIA 2OBIA 1CQGA 1LJRA 3WT2A 4I2TA 1GSQA 4L5OA 4K2DA 5DJLA 2JADA 2N5FA 1F6MC 4LL1B 4NAXA 2Z9SA 4D73B 3A2VA 1X0RA 2VOCA 3N5OA 1ZL9A 4Z2UA 4ID0A 4RI7A 2R3XA 1TK0B 1TK5B 1GH2A 3F6DA 2EIOA 3GUSA 3GKKA 3HJOA 3VWUA 4BWSA 2PVQA 3VI7A 3FZAA 3A5WA 1PD21 2L4CA 2L6DA 3KH9A 2HNLA 4FYCA 4KAEA 1T3BA 1ZCPA 3F4SA 1XXUA 2BTOT 4KX4A 2LRTA 5D8IA 4JE1A 4TW5A 2L5OA 4GSTA 4EC0A 3ZRDA 3CSIA 3D5JA 4A5PA 2VLVA 1T4ZA 2WJUA 2RM6A 1HYUA 2OA7A 3TKSC 18GSA 2KUCA 1GULA 5B6NA 5C04A 2VCXA 3FHKA 4E8EA 1M0UA 4KSOA 4ZIJA 2DKHA 1ABAA 3HYPA 3IOSA 4IW9A 3U5RE 1C72A 2FWHA 2GGTA 1XWCA 1O73A 2ALBA 3KXOA 2QC7A 3VLNA 1AXDA 3GV1A 3FK8A 4ISDA 1GUHA 2R6KA 3EURA 1XWAA 3CSJA 1HNCA 1B8XA 2PPTA 2L4QA 6GSWA 3HVXA 5D96A 1OC9B 2C0DA 1EV4A 4CY6A 2E7PA 2VM1A 2HSHA 3QAWA 2GQLA 4XRAA 5AISA 3UOMA 4PUFC 3VPQA 3HZ8A 1FO5A 5ECIB 1I5GA 2L57A 1X5DA 4NHWA 2CZ2A 1ZOFA 5JWQB 3OR5A 2H19A 4K6XA 3KP8A 5JWOB 3E0UA 4I5QA 1TU7A 3W8JA 4DSSA 1NHOA 5A4UA 3UJ1A 5J9BA 1GL8A 2IL3A 2VCZA 1QQ2A 4GCIA 1ACVA 2R37A 2H0HA 4WEYA 5G1KA 1RW1A 5ECNB 3HDCA 1YEPA 1O81A 3DKSA 2DIZA 1XCCA 3UMAA 2HRNA 4HZ2A 1TI1A 4IJIA 4L0UA 4HJ2A 4GWRA 3D0ZA 1ON4A 1SJZA 4MF5A 4ZBAA 4N11A 4K7NA 5IIZA 2H6XA 1TRWA 1UVZA 1X5EA 5DVBA 3F6FA 3AY8A 3TKSE 2P0GA 3M3MA 3EYTA 5J5NA 3Q6OA 1QXHA 4YQVA 3PH9A 3TB2A 3WGXA 1U88A 5C00A 3L9SA 4I8BA 3EINA 4KF9A 3I6AA 1OAZA 2DKIA 5KN2A 2M46A 3GHAA 1TK8B 4BVXA 5AIVA 2C3NA 4I97A 3TKRA 3J7Yb 2R4VA 4KCAA 2A2RA 1PRXA 3DGQA 5ECSA 2L59A 3RDWA 1WWJA 2YNXA 4CHSA 3IDVA 4ECBA 4KE3A 4JEDA 1YDKA 5J9CA 1ZYNA 4GSSA 2R2JA 4KSMA 3FR3A 4ULXA 1XOBA 2YJHA 2CX3A 5B7CA 3TKPA 1MD4A 2VCVA 1XVWA 4YH2A 3ZIJA 4OFMA 2B3SA 3O76A 2FNOA 5GSTA 5ECMB 1TJDA 1U3AA 3IV4A 1FG4A 4HJMA 1J08A 1VGLA 2GDRA 3LXZA 2FUG2 2RIIA 3V1WA 2DLXA 2YV7A 1YKAA 5B6MA 1PX6A 3IHGA 2JACA 3KM6A 2IMEA 3GFKA 1QK8A 2TRXA 2IIYA 3PPUA 2V32A 4JR6A 4LMVA 2QA2A 5IPHA 3LXTA 4TR0A 2B5EA 2PUKC 4IELA 3W8SA 1V9WA 3ERGA 3QMXA 3UBKA 1NSWA 1MDKA 1KBNA 2CAIA 3C71A 3GTUB 1AQXA 4KUNA 1SYRA 3I9V2 5BMUA 2PU9C 5J3RA 4DSRA 4I2UA 4TR4A 1LBKA 2TIRA 4EXJA 1WOUA 5HFGA 2XBIA 2H1AA 1X9SB 4ZBBA 2GZZA 22GSA 3TJBA 3H93A 4MABA 5CNWA 3GKMA 3CTGA 3F9UA 1M2DA 4WKWA 1EEJA 4NHZA 2GVPA 1O8WA 1S3DA 1O8XA 2VM2A 5D73A 3TJKA 5DCHA 4Z2TA 6GSVA 3DEXA 3P8WA 2LKUA 3VWXA 3ZFLA 3ZVJD 2VO4A 3IAS2 3M8NA 4FO5A 5E4WA 1EV9A 5IQYA 1ERVA 4ML6A 1JZWA 3GN3A 4CY8A 3KMNA 4WETA 1S3AA 5EY6A 3D21A 1URMA 2DMMA 2MZCA 2HZEA 2OADA 5HFKA 1Y6EA 3QOUA 3FEUA 3VWVA 1ERWA 3C73A 4OCEA 1XPVA 1M2BA 2B1LA 1B4QA 2C0GA 5ABRA 4ZL9A 1VF2A 1VF1A 2L5LA 1A2JA 4ZL7A 4EUYA 5F0GA 1AC1A 4HEA2 3MIXA 1G0TA 1R5AA 6GSXA 4TXOA 5AN1A 4EO3A 1R4WA 4F0BA 4BA7A 1XW6A 5B8BA 3APQA 2K8SA 4FH8A 5HR2A 1JFUA 1T7PB 2OE1A 4ZILA 4IJ3A 3TGZA 3IHQA 1EZKA 3US3A 4G9HA 1K0CA 2IPAA 2FLSA 3D4MA 2CVDA 1J0FA 2LEGA 3U6VA 5D9XA 1DE1A 4O32A 3C1SA 2LNSA 14GSA 3F3QA 4DSSB 2AHEA 2WRTA 4EVMA 2X8CA 3GA4A 2WB9A 4XIHA 1THOA 1H75A 1GLQA 1SENA 1G6WA 5COHA 5CRGA 1TKDB 1Z3EA 2K9FA 1B48A 2IN3A 3FRCA 1TW9A 2YJ7A 2PGTA 2DBCA 1H4OA 4MJBA 2A2SA 3ZMKA 1S3CA 3DMLA 2VCWA 2H1DA 1JZDA 3WGDA 2IFQA 3HHVA 4GSNA 4MZCA 3TCOA 4K9ZA 1G6YA 2UZ8A 3BBYA 1Z6MA 4GQCA 5J4UA 1XWKA 4YAPA 4HS1A 4LA1A 4DEJA 3BOAA 3KTBA 6GSUA 1PN0A 1PL1A 1MD3A 2B6MA 1ML6A 2HRAA 4XS4A 4BVXB 3ZFBA 2WGRA 4GQFA 3SBCA 3FR9A 3GURA 1QMVA 3CTFA 5CO3A 4TRXA 1WIKA 1TRVA 2JSZA 5AIXA 3RHBA 5ECRB 4RQRA 3BCKA 1R7HA 1FVKA 1TOFA 5CREA 5G2ZA 3KP9A 2JSYA 1GLPA 1GP1A 3WT1A 5FWGA 4ECIA 5IM9A 4MP4A 3ISOA 4GTUA 1FW1A 2DJ2A 5L71A 2LSTA 3KZQA 1WE0A 3EWLA 2K8VA 4AJ7A 1Z9HA 3LSZA 4KH7A 1FHEA 5DALA 2F3MA 2PMTA 5DQYA 2JZSA 4JBBA 3EU3A 1R26A 3ZIVA 1K0MA 5KN1A 1Z7RA 4OWYA 4IBPA 1RQMA 3CYNA 1N2AA 2AV4A 4BPYA 1A2MA 1HQOA 2VCQA 1X5CA 3DVXA 4ACSA 2IMDA 4MH2A 2OBKA 2MMOA 5ECQB 3LFLA 1VF3A 3JCML 3IAM2 1ZGNA 2MMZA 4MJAA 3Q19A 3KEBA 4PNFA 5JWRB 4L5LA 5CAXA 2AJQB 1YKCA 2IMFA 4MDCA 5ECHB 2RUEA 2GT6A 2LQOA 5B8AA 4L0WA 3J7Yk 2WDUA 5ELAA 3MDKA 3RHCA 4JU5A 3VK9A 5IMDA 4TVEA 2O87A 3GSTA 4OO5A 1EGRA 3P7XA 5F07A 1F37A 5HQPA 1Q98A 1BQ7A 5EL8A 4IVFA 1SJ6A 3TOTA 4PURA 2M72A 1FB6A 2FHEA 3UL3A 3KTLA 5IMVA 1BYEA 1JLWA 2JU5A 2FA4A 1ZMAA 2I1UA 5F05A 3F0IA 4MJEA 2H71A 4O7HA 4TR3A 1B9XC 2VLTA 1GSUA 2H30A 1M9BA 3ZYWA 2YCDA 1A24A 1GUMA 2DJ1A 4WBJA 1YF1A 2YPMA 2DJ3A 2HSYA 4KCEA 2X49A 5ELGA 10GSA 2E2GA 3QAVA 3UBLA 1LU4A 1JHBA 3MSZA 4MJCA 2HZEB 3FYGA 2VL2C 4N0VA 1R5PA 5IO2A 4AGSA 3LQ7A 2YN1A 4MLYA 1QGVA 4DSQA 5DAKB 4HOJA 2DC5A 3H1NA 3G9BA 4OD7A 1BAYA 4EDYA 3HD5A 1K0AA 4TXOB 3HVSA 19GSA 4OCFA 1YZXA 1OC3A 1TXXA 4H86A 2B5YA 4WF5A 1ILOA 4KGIA 4KB3A 3HXSA 4XCSA 1GTUA 4NXIA 2CX4A 4K1FA 1O6JA 1XW5A 3GX8A 2O7KA 2YWMA 1SK2A 3HVVA 3E3EA 3FW2A 5BRTA 3VWWA 4IS0A 2FY6A 1A23A 1GUKA 1TTZA 5GAND 4KNDA 1SD9A 4G2EA 1AW9A 3KJYA 2NPBA 5AGYA 4OFNA 2X99A 4G0IA 1K0NA 1A8LA 4QL7A 2KP2A 2AB6A 1GSEA 5A4WA 5KEJA 5JCWA 1FVJA 4XRDA 4XS1A 4G0LA 2GTUA 3IBHA 2QSIA 2CVBA 4CW9A 4Z2RA 4MF6A 3GYKA 2EIQA 11GSA 2VL3A 2IFQB 4GXZA 2H1BA 4LMWA 4POMA 4YKGA 2ZNMA 3LORA 4YQMA 1U87A 2QKEA 1Y25A 4ZBDA 3TDGA 3H8QA 3TJGA 3UARA 2H66A 2JZTA 5ECKB 4G10A 2LUSA 4E8HA 3DWVA 4EIPA 1USBA 3A2XA 2C4JA 3UVTA 4X4JA 2A2PA 3WYWA 4OMVA 2R0PA 2O85A 4QQ7A 4WXTA 4EE0A 1ZYQB 2C80A 1B4PA 4XS4B 2GQKA 5CRDA 3SWLA 1TU8A 2LQQA 4FYUA 1TRUA 3BCIA 2N5AA 1GWCA 2OJLA 3Q18A 1MTCA 1QFNA 2FGXA 4WF4A 4YQUA 4PX1A 3W6GA 4F9ZA 4CDOA 3F8UA 4EL1A 3LWAA 2C3TA 4ZB6A 1PQNA 1XBSA 4DVCA 2LS5A 2LJRA 5IOWA 7GSSA 1M7TA 2F51A 3UIWA 1JZRA 5GAPD 2H72A 1GSYA 6GSTA 3F63A 1ZYPA 1SJIA 3HZ4A 4ECJA 2NBSA 5DALB 2H01A 4KDYA 4WBRD 3ERFA 2CQ9A 2FD3A 3O3TA 3CSHA 4TOPA 3QR6A 2LJKA 3MWHA 2VD1A 2AAWA 1BJXA 4MPFA 3IK9A 1GTIA 3L4NA 3L9UA 2M80A 5HR0A 3L9VA 4HZ4A 5KOXA 3QDNA 2DJ0A 2XHFA 1VF4A 1OC9A 3DXBA 1TI3A 2WULA 3I69A 5A5KA 2AYTA 4EKZA 3GMFA 2VLUA 4V2NA 5EVOA 3EMPA 1XFLA 5H5QA 5DQSA 2VCTA 3IXRA 5H5RA 4POBA 4AF2A 4XHMA 2FWEA 4IQ1A 2ON7A 1PL2A 4MNNA 3QAGA 2KHPA 4PGTA 2H70A 3MAKA 4ZB9A 1SL1B 4K5SA 1MDIA 3GH6A 3PR8A 4LLRA 3EC3A 2X8HA 2HXKA 13GSA 1GSDA 4NPBA 1K3OA 1V98A 2HT9A 4V2MA 1X9MB 1OE7A 3DVWA 3HKRA 4XTSA 1EEMA 5FHIA 4P3YB 4Q5FA 1CQHA 4O5UA 2FCHA 3NZNA 4ML1A 3CRTA 3H79A 3KCMA 1YJ6A 2R0CA 5ID2A 4ICYA 2JZRA 1AAZA 1GTBA 1F3BA 1NM3A 1SKSB 1A0RP 2O8VB 2GSQA 1PKZA 2MMNA 1EP8A 2F9SA 1PKWA 2D2ZA 2V1MA 2V2GA 5JCGA 3HJPA 1OYJA 1SKWB 5J41A 4PQIA 1SD8A 1XOAA 2DSAA 1DSBA 4FQUA 1DUGA 1ZZYA 1AQWA 1YQ1A 1UN2A 2I3YA 4EF0A 3FMWA 2CZ3A 2HRKA 3TKSA 1TP9A 3EE2A 4N0ZA 4OFTA 4K7IA 1T1VA 6GSYA 5A4VA 3PGTA 2OACA 1DE2A 3BD2A 3D6IA 1AIUA 1OVNA 3KD0A 1FAAA 2V41A 3L0HA 4I6XA 3ZL5A 3QFBC 1DBYA 3ZMLA 1WPIA 3M9KA 4V1Ag 3ME8A 1EOGA 2GSTA 4X43A 2LTKA 2J9HA 3ZTLA 5KN0A 3S9FA 4O5QA 3HCZA 4FIWA 5KOWA 4G19A 1OE8A 1EOHA 1A8YA 1WRYA 4BL7A 3WD6A 4N30A 4HI7A 1WJKA 3FZ9A 5ENUA 4WR5A 1SKRB 2PN8A 4J2FA 3G7JA 5D9WA 4OO4A 2YWOA 4HQSA 4O92A 1UA5A 2HLSA 1NW2A 5H5SA 3GRXA 2XBQA 5HFIA 3FZ4A 1V58A 4Q5QA 4FYBA 2B5XA 4PUAA 3C7MA 4BVYA 1ZYEA 2XPDA 2VD0A 2GSSA 3A5IA 2YANA 3APSA 1FB0A 5IO0A 3LYKA 3P90A 3GL5A 4L8EA 4POKA 4TR1A 5D93A 1W4VA 2DJKA 2WZ9A 1SL2B 1PA3A 2X4AA 3APOA 2WCIA 3IR4A 3TJJA 1B9YC 2PVOC 2FA8A 4WR4A 4MF7A 2QGVA 3PINA 4IHUA 5GZZB 3IPZA 1KNGA 4IN0A 1G7EA 1HNBA 2L6CA 2IMKA 5FT3A 1K0OA 4IP1A 2H76A 5G31A 1TDIA 5LNKe 3TJFA 5INYA 2K18A 2YWNA 3IC4A 1X9WB 4PXOA 1PMTA 2IWTA 3P2AA 1M9AA 2O89A 4ILFA 1K0DA 1GSFA 4AJ8A 2OE0A 2XC2A 1WP0A 2GT5A 1O7UA 5G5FA 2YP6A 1U6TA 3MNGA 1V57A 1ST9A 1W89A 1O85A 5IMZA 5DCGA 2G0FA 2ES7A 3LGCA 4TXVA 2OE3A 1WMJA 16GSA 4F03A 1XWBA 2GS3A 3LG6A 3GH9A 4JZQA 3GX0A 4K7OA 4MZBA 2I4AA 4JR4A 3TUEA 1E2YA 1GTAA 3TRQA 3RPPA 3ZLPA 2WFCA 3UAPA 1MEKA 2YV9A 4PQHA 3R2QA 1U3IA 4MZWA 3TOUA 4HU9A 4K2XA 4G0KA 2CVKA 1SYXA 1EP7A 3GSSA 2NTOA 1HNAA 4TKYA 4Q5RA 2RUFA 3FY7A 2VIMA 3LJRA 1F3AA 3QD9A 3DYRA 3VFIA 3EVIA 5G5EA 1JZOA 1G7OA 1YY7A 2N5BA 2E0QA 2H1GA 3DRNA 1T00A 3UEMA 5G30A 4PQ1A 4MMMA 2HYXA 5HR3A 4KA0A 3H4KA 4BWQA 5GSSA 2MYGA 3DD3A 4NWYA 4K5RA 4KDUA 4GF0A 1Z6NA 4QL9A 2JL4A 1THXA 3D22A 5ID2B 3ERWA 4GLTA 1SU9A 5E59A 1GNEA 1SK0A 3KH7A 2LJAA 4IQAA 3ZVJA 2C0EA 1EGOA 4Q5NA 1F2EA 2AUVA 3M9JA 3KGKA 4TN8A 3ZREA 1AUCA 1GSSA 5HR1A 4YAVA 1SK1A 3ME7A 5CRWA 2H73A 2X8GA 3R3EA 2P31A 3KMOA 1V2AA 2VUPA 1IYIA 1XZOA 9GSSA 3ZZXA 2HRFA 5G1LA 3A3TA 2H6YA 3FR6A 2R0GA 2EC4A 2H8LA 2LRCA 2YZUA 1QUWA 4ZXGA 1PN9A 3CRUA 2J23A 3A2WA 4O5RA 3EMXA 2GQMA 3F3RA 2GSRA 4IKHA 1FOHA 2PERA 4D73A 3QCPA 5EPFA 3FKFA 1T4YA 2R5GA 5IOXA 2K6VA 4F2IA 4X1UA 2GZPA 1I9DA 3IE3A 4HDEA 4BL7B 5CRHA 3L78A 2RLIA 1T8EB 2LRNA 4MA9A 3FZ5A 3LEFA 2YOIA 3I43A 5D9VA 3IA1A 2LV3A 2EIRA 1IYHA 2GZYA 1KEBA 1K3LA 1E6BA 3UVHA 3HY2A 4ZB8A 2YWIA 1PX7A 2XPEA 4RI6A 3IRAA 2DIYA 5LCZA 3GKNA 2G2QA 1J9BA 2H0IA 5F8BA 4BVYB 3QFAC 2H74A 3IC8A 5D9TA 2OKAA 1OKTA 3TRPA 1M99A 2H6ZA 1XVQA 4TR1B 5ECOB 2PWJA 2H75A 2B7JA 2I9HA 1Q4JA 3HA9A 4HUAA 2MBSA 2C0FA 4V1Ap 4K0GA 4MK3A 5JCUA 5IMCA 1OKDA 5KN3A 4USSA 4HQZA 4V2LA 2HI7A 4KW6A 5DBQA 1XWGA 2KLXA 4NV2A 5CYYA 4Z7XA 4MPGA 5IMFA 2HSMA 2BMXA 12GSA 2ON5A 3TKQA 2H0GA 3MYDA 1ERUA 4GRFA 2F8AA 1PGTA 4XS6A 3RBTA 3KIJA 3ED3A 3C8EA 1GRXA 3NOFA 3D4TA 2I81A 1EWXA 2NDOA 1XIYA 3VI5A 3G7YA 3DIEA 1M2AA 4POLA 4RQXA 5LD0A 4K8MA 5DAKA 17GSA 4N10A 4J57E 1F9MA 2CAQA 2CV4A 5DDLA 3GKXA 3M0FA 3BJ5A 2DMLA 2HE3A 8GSSA 1KTEA 4PNGA 2BJXA 2MBTA 4J56E 1A2LA 1K3YA 2QA1A 4RUVA 4EIQA 2YZHA 2ZUPA 3RPNA 4LL4B 3G7IA 4MH3A 3M1GA 3TRXA 1FOVA 3E9JB 2C8UA 1BG5A 3LW9A 1Z5YE 2IJYA 1BX9A 2X64A 4ECCA 2A4HA 1A0FA 2VL9A 2B7KA 3GIXA 1GNWA 1PSQA 2PBJA 2WS2A 1N8JA 2C1YA 4NMUA 1JLVA 2KOKA 5ECPB 1V40A 3F4RA 4ZL8A 1YEXA 2DJJA 3NIVA 3K8NA 4KDXA 3CMIA 1OC8A 2C3QA 2B1KA 4F82A 2F8FA 1K0BA 1BEDA 3GNJA 2CT6A 2RM5A 3F4TA 2KP1A 4X0XA 4F0CA 4IGJA 4PTSA 3EPTA 1VRSD 1RK4A 2ZCTA 4AJ6A 3C1RA 5IPGA 3EU4A 1AQVA 4MCUA 2MMAA 6GSSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JRR A;  2HFD A;  20GS A;  4HU7 A;  3GL3 A;  3WGE A;  5DJM A;  1XW9 A;  2HZF A;  3ZIT A;  2E2M A;  5ECL B;  2P5Q A;  3QPM A;  1UC7 A;  2REM A;  1ERT A;  2LNT A;  4NV5 A;  1Z7P A;  2A4V A;  3RAZ A;  2V6K A;  3VUR A;  2NVL A;  3CXG A;  1YF0 A;  5CP1 A;  2V6O A;  3O6T A;  3IK7 A;  5IMA A;  2FWF A;  3HJM A;  2P5R A;  3Q74 A;  2GLR A;  3LYP A;  1SL0 B;  3N9J A;  2TRC P;  1HD2 A;  3CBU A;  4EDZ A;  2FWG A;  1NHY A;  4IP6 A;  1TRS A;  2CA8 A;  4K0N A;  3VPT A;  2VL2 A;  5F06 A;  3GTU A;  2VAF A;  1MDJ A;  2IMI A;  2OBI A;  1CQG A;  1LJR A;  3WT2 A;  4I2T A;  1GSQ A;  4L5O A;  4K2D A;  5DJL A;  2JAD A;  2N5F A;  1F6M C;  4LL1 B;  4NAX A;  2Z9S A;  4D73 B;  3A2V A;  1X0R A;  2VOC A;  3N5O A;  1ZL9 A;  4ID0 A;  4RI7 A;  2R3X A;  1TK0 B;  1TK5 B;  1GH2 A;  3F6D A;  2EIO A;  3GUS A;  3GKK A;  3HJO A;  3VWU A;  4BWS A;  2PVQ A;  3VI7 A;  3FZA A;  3A5W A;  1PD2 1;  2L4C A;  2L6D A;  3KH9 A;  2HNL A;  4FYC A;  4KAE A;  1T3B A;  1ZCP A;  3F4S A;  1XXU A;  2BTO T;  4KX4 A;  2LRT A;  5D8I A;  4JE1 A;  4TW5 A;  2L5O A;  4GST A;  4EC0 A;  3ZRD A;  3CSI A;  3D5J A;  2VLV A;  1T4Z A;  2WJU A;  2RM6 A;  1HYU A;  2OA7 A;  3TKS C;  18GS A;  2KUC A;  1GUL A;  5B6N A;  5C04 A;  2VCX A;  3FHK A;  4E8E A;  1M0U A;  4KSO A;  4ZIJ A;  1ABA A;  3HYP A;  3IOS A;  4IW9 A;  3U5R E;  1C72 A;  2FWH A;  2GGT A;  1XWC A;  1O73 A;  2ALB A;  3KXO A;  2QC7 A;  3VLN A;  1AXD A;  3GV1 A;  3FK8 A;  4ISD A;  1GUH A;  2R6K A;  3EUR A;  1XWA A;  3CSJ A;  1HNC A;  1B8X A;  2PPT A;  2L4Q A;  6GSW A;  3HVX A;  5D96 A;  1OC9 B;  2C0D A;  1EV4 A;  2E7P A;  2VM1 A;  2HSH A;  3QAW A;  2GQL A;  4XRA A;  5AIS A;  3UOM A;  4PUF C;  3VPQ A;  3HZ8 A;  1FO5 A;  5ECI B;  1I5G A;  2L57 A;  1X5D A;  4NHW A;  2CZ2 A;  1ZOF A;  5JWQ B;  3OR5 A;  2H19 A;  4K6X A;  3KP8 A;  5JWO B;  3E0U A;  4I5Q A;  1TU7 A;  3W8J A;  4DSS A;  1NHO A;  5A4U A;  3UJ1 A;  5J9B A;  1GL8 A;  2IL3 A;  2VCZ A;  1QQ2 A;  4GCI A;  1ACV A;  2R37 A;  2H0H A;  4WEY A;  5G1K A;  1RW1 A;  5ECN B;  3HDC A;  1YEP A;  1O81 A;  3DKS A;  2DIZ A;  1XCC A;  3UMA A;  2HRN A;  4HZ2 A;  1TI1 A;  4IJI A;  4L0U A;  4HJ2 A;  4GWR A;  3D0Z A;  1ON4 A;  1SJZ A;  4MF5 A;  4ZBA A;  4N11 A;  4K7N A;  5IIZ A;  2H6X A;  1TRW A;  1UVZ A;  1X5E A;  5DVB A;  3F6F A;  3AY8 A;  3TKS E;  2P0G A;  3M3M A;  3EYT A;  5J5N A;  3Q6O A;  1QXH A;  4YQV A;  3PH9 A;  3TB2 A;  3WGX A;  1U88 A;  5C00 A;  3L9S A;  4I8B A;  3EIN A;  3I6A A;  1OAZ A;  5KN2 A;  2M46 A;  3GHA A;  1TK8 B;  4BVX A;  5AIV A;  2C3N A;  4I97 A;  3TKR A;  3J7Y b;  2R4V A;  4KCA A;  2A2R A;  1PRX A;  3DGQ A;  5ECS A;  2L59 A;  3RDW A;  1WWJ A;  2YNX A;  4CHS A;  3IDV A;  4ECB A;  4KE3 A;  4JED A;  1YDK A;  5J9C A;  4GSS A;  2R2J A;  4KSM A;  3FR3 A;  4ULX A;  1XOB A;  2YJH A;  2CX3 A;  5B7C A;  3TKP A;  1MD4 A;  2VCV A;  1XVW A;  4YH2 A;  3ZIJ A;  4OFM A;  2B3S A;  3O76 A;  2FNO A;  5GST A;  5ECM B;  1TJD A;  1U3A A;  3IV4 A;  1FG4 A;  4HJM A;  1J08 A;  1VGL A;  2GDR A;  3LXZ A;  2FUG 2;  2RII A;  3V1W A;  2DLX A;  2YV7 A;  1YKA A;  5B6M A;  1PX6 A;  2JAC A;  3KM6 A;  2IME A;  3GFK A;  1QK8 A;  2TRX A;  2IIY A;  2V32 A;  4JR6 A;  4LMV A;  5IPH A;  3LXT A;  4TR0 A;  2B5E A;  2PUK C;  4IEL A;  3W8S A;  1V9W A;  3ERG A;  3QMX A;  3UBK A;  1NSW A;  1MDK A;  1KBN A;  2CAI A;  3C71 A;  3GTU B;  1AQX A;  4KUN A;  1SYR A;  3I9V 2;  2PU9 C;  5J3R A;  4DSR A;  4I2U A;  4TR4 A;  1LBK A;  2TIR A;  4EXJ A;  1WOU A;  5HFG A;  2XBI A;  2H1A A;  1X9S B;  4ZBB A;  2GZZ A;  22GS A;  3TJB A;  3H93 A;  4MAB A;  5CNW A;  3GKM A;  3CTG A;  3F9U A;  1M2D A;  4WKW A;  1EEJ A;  4NHZ A;  2GVP A;  1O8W A;  1S3D A;  1O8X A;  2VM2 A;  5D73 A;  3TJK A;  5DCH A;  6GSV A;  3DEX A;  3P8W A;  2LKU A;  3VWX A;  3ZFL A;  3ZVJ D;  2VO4 A;  3IAS 2;  3M8N A;  4FO5 A;  5E4W A;  1EV9 A;  5IQY A;  1ERV A;  4ML6 A;  1JZW A;  3GN3 A;  3KMN A;  4WET A;  1S3A A;  5EY6 A;  3D21 A;  1URM A;  2DMM A;  2MZC A;  2HZE A;  2OAD A;  5HFK A;  1Y6E A;  3QOU A;  3FEU A;  3VWV A;  1ERW A;  3C73 A;  4OCE A;  1XPV A;  1M2B A;  2B1L A;  1B4Q A;  2C0G A;  5ABR A;  4ZL9 A;  1VF2 A;  1VF1 A;  2L5L A;  1A2J A;  4ZL7 A;  4EUY A;  5F0G A;  1AC1 A;  4HEA 2;  1G0T A;  1R5A A;  6GSX A;  4TXO A;  5AN1 A;  4EO3 A;  1R4W A;  4F0B A;  4BA7 A;  1XW6 A;  5B8B A;  3APQ A;  2K8S A;  4FH8 A;  5HR2 A;  1JFU A;  1T7P B;  2OE1 A;  4ZIL A;  4IJ3 A;  3TGZ A;  3IHQ A;  1EZK A;  3US3 A;  4G9H A;  1K0C A;  2IPA A;  2FLS A;  3D4M A;  2CVD A;  1J0F A;  2LEG A;  3U6V A;  5D9X A;  1DE1 A;  4O32 A;  3C1S A;  2LNS A;  14GS A;  3F3Q A;  4DSS B;  2AHE A;  2WRT A;  4EVM A;  2X8C A;  3GA4 A;  2WB9 A;  4XIH A;  1THO A;  1H75 A;  1GLQ A;  1SEN A;  1G6W A;  5COH A;  5CRG A;  1TKD B;  1Z3E A;  2K9F A;  1B48 A;  2IN3 A;  3FRC A;  1TW9 A;  2YJ7 A;  2PGT A;  2DBC A;  1H4O A;  4MJB A;  2A2S A;  3ZMK A;  1S3C A;  3DML A;  2VCW A;  2H1D A;  1JZD A;  3WGD A;  2IFQ A;  3HHV A;  4GSN A;  4MZC A;  3TCO A;  4K9Z A;  1G6Y A;  3BBY A;  1Z6M A;  4GQC A;  5J4U A;  1XWK A;  4YAP A;  4HS1 A;  4LA1 A;  4DEJ A;  3BOA A;  3KTB A;  6GSU A;  1PL1 A;  1MD3 A;  2B6M A;  1ML6 A;  4XS4 A;  3ZFB A;  2WGR A;  4GQF A;  3SBC A;  3FR9 A;  3GUR A;  1QMV A;  3CTF A;  5CO3 A;  4TRX A;  1WIK A;  1TRV A;  2JSZ A;  5AIX A;  3RHB A;  5ECR B;  4RQR A;  3BCK A;  1R7H A;  1FVK A;  1TOF A;  5CRE A;  5G2Z A;  3KP9 A;  2JSY A;  1GLP A;  1GP1 A;  3WT1 A;  5FWG A;  4ECI A;  5IM9 A;  4MP4 A;  3ISO A;  4GTU A;  1FW1 A;  2DJ2 A;  5L71 A;  2LST A;  3KZQ A;  1WE0 A;  3EWL A;  2K8V A;  4AJ7 A;  1Z9H A;  3LSZ A;  4KH7 A;  1FHE A;  5DAL A;  2F3M A;  2PMT A;  5DQY A;  2JZS A;  4JBB A;  3EU3 A;  1R26 A;  3ZIV A;  1K0M A;  5KN1 A;  1Z7R A;  4OWY A;  4IBP A;  1RQM A;  3CYN A;  1N2A A;  2AV4 A;  4BPY A;  1A2M A;  1HQO A;  2VCQ A;  1X5C A;  3DVX A;  4ACS A;  2IMD A;  4MH2 A;  2OBK A;  2MMO A;  5ECQ B;  3LFL A;  1VF3 A;  3JCM L;  3IAM 2;  1ZGN A;  2MMZ A;  4MJA A;  3Q19 A;  3KEB A;  4PNF A;  5JWR B;  4L5L A;  5CAX A;  2AJQ B;  1YKC A;  2IMF A;  4MDC A;  5ECH B;  2RUE A;  2GT6 A;  2LQO A;  5B8A A;  4L0W A;  3J7Y k;  2WDU A;  5ELA A;  3MDK A;  3RHC A;  4JU5 A;  3VK9 A;  5IMD A;  4TVE A;  2O87 A;  3GST A;  4OO5 A;  1EGR A;  3P7X A;  5F07 A;  1F37 A;  5HQP A;  1Q98 A;  1BQ7 A;  5EL8 A;  4IVF A;  1SJ6 A;  3TOT A;  4PUR A;  2M72 A;  1FB6 A;  2FHE A;  3UL3 A;  3KTL A;  5IMV A;  1BYE A;  1JLW A;  2JU5 A;  2FA4 A;  1ZMA A;  2I1U A;  5F05 A;  3F0I A;  4MJE A;  2H71 A;  4O7H A;  4TR3 A;  1B9X C;  2VLT A;  1GSU A;  2H30 A;  1M9B A;  3ZYW A;  2YCD A;  1A24 A;  1GUM A;  2DJ1 A;  4WBJ A;  1YF1 A;  2YPM A;  2DJ3 A;  2HSY A;  4KCE A;  5ELG A;  10GS A;  2E2G A;  3QAV A;  3UBL A;  1LU4 A;  1JHB A;  3MSZ A;  4MJC A;  2HZE B;  3FYG A;  2VL2 C;  4N0V A;  1R5P A;  5IO2 A;  4AGS A;  3LQ7 A;  2YN1 A;  4MLY A;  1QGV A;  4DSQ A;  5DAK B;  4HOJ A;  2DC5 A;  3H1N A;  3G9B A;  4OD7 A;  1BAY A;  4EDY A;  3HD5 A;  1K0A A;  4TXO B;  3HVS A;  19GS A;  4OCF A;  1YZX A;  1OC3 A;  1TXX A;  4H86 A;  2B5Y A;  4WF5 A;  1ILO A;  4KGI A;  4KB3 A;  3HXS A;  4XCS A;  1GTU A;  4NXI A;  2CX4 A;  4K1F A;  1O6J A;  1XW5 A;  3GX8 A;  2O7K A;  2YWM A;  1SK2 A;  3HVV A;  3E3E A;  3FW2 A;  3VWW A;  4IS0 A;  2FY6 A;  1A23 A;  1GUK A;  1TTZ A;  5GAN D;  4KND A;  1SD9 A;  4G2E A;  1AW9 A;  3KJY A;  2NPB A;  5AGY A;  4OFN A;  2X99 A;  1K0N A;  1A8L A;  4QL7 A;  2KP2 A;  2AB6 A;  1GSE A;  5A4W A;  5KEJ A;  5JCW A;  1FVJ A;  4XRD A;  4XS1 A;  2GTU A;  3IBH A;  2QSI A;  2CVB A;  4CW9 A;  4MF6 A;  3GYK A;  2EIQ A;  11GS A;  2VL3 A;  2IFQ B;  4GXZ A;  2H1B A;  4LMW A;  4POM A;  2ZNM A;  3LOR A;  4YQM A;  1U87 A;  2QKE A;  1Y25 A;  4ZBD A;  3TDG A;  3H8Q A;  3TJG A;  3UAR A;  2H66 A;  2JZT A;  5ECK B;  4G10 A;  2LUS A;  4E8H A;  3DWV A;  1USB A;  3A2X A;  2C4J A;  3UVT A;  3WYW A;  4OMV A;  2O85 A;  4QQ7 A;  4WXT A;  4EE0 A;  1ZYQ B;  2C80 A;  1B4P A;  4XS4 B;  2GQK A;  5CRD A;  3SWL A;  1TU8 A;  2LQQ A;  4FYU A;  1TRU A;  3BCI A;  2N5A A;  1GWC A;  2OJL A;  3Q18 A;  1MTC A;  1QFN A;  2FGX A;  4WF4 A;  4YQU A;  4PX1 A;  3W6G A;  4F9Z A;  4CDO A;  3F8U A;  4EL1 A;  3LWA A;  2C3T A;  4ZB6 A;  1PQN A;  1XBS A;  4DVC A;  2LS5 A;  2LJR A;  5IOW A;  7GSS A;  1M7T A;  2F51 A;  3UIW A;  1JZR A;  5GAP D;  2H72 A;  1GSY A;  6GST A;  3F63 A;  1SJI A;  3HZ4 A;  4ECJ A;  2NBS A;  5DAL B;  2H01 A;  4KDY A;  4WBR D;  3ERF A;  2CQ9 A;  2FD3 A;  3O3T A;  3CSH A;  4TOP A;  3QR6 A;  2LJK A;  3MWH A;  2VD1 A;  2AAW A;  1BJX A;  4MPF A;  3IK9 A;  1GTI A;  3L4N A;  3L9U A;  2M80 A;  5HR0 A;  3L9V A;  4HZ4 A;  3QDN A;  2DJ0 A;  2XHF A;  1VF4 A;  1OC9 A;  3DXB A;  1TI3 A;  2WUL A;  3I69 A;  5A5K A;  2AYT A;  4EKZ A;  3GMF A;  2VLU A;  4V2N A;  5EVO A;  3EMP A;  1XFL A;  5H5Q A;  5DQS A;  2VCT A;  3IXR A;  5H5R A;  4POB A;  4AF2 A;  4XHM A;  2FWE A;  4IQ1 A;  2ON7 A;  1PL2 A;  3QAG A;  2KHP A;  4PGT A;  2H70 A;  3MAK A;  4ZB9 A;  1SL1 B;  1MDI A;  3GH6 A;  3PR8 A;  4LLR A;  3EC3 A;  2X8H A;  2HXK A;  13GS A;  1GSD A;  4NPB A;  1K3O A;  1V98 A;  2HT9 A;  4V2M A;  1X9M B;  1OE7 A;  3DVW A;  3HKR A;  4XTS A;  1EEM A;  5FHI A;  4P3Y B;  4Q5F A;  1CQH A;  2FCH A;  3NZN A;  4ML1 A;  3CRT A;  3H79 A;  3KCM A;  1YJ6 A;  5ID2 A;  2JZR A;  1AAZ A;  1GTB A;  1F3B A;  1NM3 A;  1SKS B;  1A0R P;  2O8V B;  2GSQ A;  1PKZ A;  2MMN A;  1EP8 A;  2F9S A;  1PKW A;  2D2Z A;  2V1M A;  2V2G A;  5JCG A;  3HJP A;  1OYJ A;  1SKW B;  5J41 A;  4PQI A;  1SD8 A;  1XOA A;  2DSA A;  1DSB A;  1DUG A;  1ZZY A;  1AQW A;  1YQ1 A;  1UN2 A;  2I3Y A;  4EF0 A;  2CZ3 A;  3TKS A;  1TP9 A;  3EE2 A;  4N0Z A;  4OFT A;  4K7I A;  1T1V A;  6GSY A;  5A4V A;  3PGT A;  2OAC A;  1DE2 A;  3BD2 A;  3D6I A;  1AIU A;  1OVN A;  3KD0 A;  1FAA A;  2V41 A;  3L0H A;  4I6X A;  3ZL5 A;  3QFB C;  1DBY A;  3ZML A;  1WPI A;  3M9K A;  4V1A g;  3ME8 A;  1EOG A;  2GST A;  4X43 A;  2LTK A;  2J9H A;  3ZTL A;  5KN0 A;  3S9F A;  3HCZ A;  4FIW A;  4G19 A;  1OE8 A;  1EOH A;  1A8Y A;  1WRY A;  4BL7 A;  3WD6 A;  4N30 A;  4HI7 A;  1WJK A;  3FZ9 A;  5ENU A;  4WR5 A;  1SKR B;  2PN8 A;  4J2F A;  3G7J A;  5D9W A;  4OO4 A;  2YWO A;  4HQS A;  4O92 A;  1UA5 A;  2HLS A;  1NW2 A;  5H5S A;  3GRX A;  2XBQ A;  5HFI A;  3FZ4 A;  1V58 A;  4Q5Q A;  4FYB A;  2B5X A;  4PUA A;  3C7M A;  4BVY A;  1ZYE A;  2XPD A;  2VD0 A;  2GSS A;  2YAN A;  3APS A;  1FB0 A;  5IO0 A;  3LYK A;  3P90 A;  3GL5 A;  4L8E A;  4POK A;  4TR1 A;  5D93 A;  1W4V A;  2DJK A;  2WZ9 A;  1SL2 B;  1PA3 A;  3APO A;  2WCI A;  3IR4 A;  3TJJ A;  1B9Y C;  2PVO C;  2FA8 A;  4WR4 A;  4MF7 A;  2QGV A;  3PIN A;  4IHU A;  5GZZ B;  3IPZ A;  1KNG A;  4IN0 A;  1G7E A;  1HNB A;  2L6C A;  2IMK A;  5FT3 A;  1K0O A;  4IP1 A;  2H76 A;  5G31 A;  1TDI A;  5LNK e;  3TJF A;  5INY A;  2K18 A;  2YWN A;  3IC4 A;  1X9W B;  4PXO A;  1PMT A;  2IWT A;  3P2A A;  1M9A A;  2O89 A;  4ILF A;  1K0D A;  1GSF A;  4AJ8 A;  2OE0 A;  2XC2 A;  1WP0 A;  2GT5 A;  1O7U A;  5G5F A;  2YP6 A;  1U6T A;  3MNG A;  1V57 A;  1ST9 A;  1W89 A;  1O85 A;  5IMZ A;  5DCG A;  2G0F A;  2ES7 A;  3LGC A;  4TXV A;  2OE3 A;  1WMJ A;  16GS A;  4F03 A;  1XWB A;  2GS3 A;  3LG6 A;  3GH9 A;  4JZQ A;  3GX0 A;  4K7O A;  4MZB A;  2I4A A;  4JR4 A;  3TUE A;  1E2Y A;  1GTA A;  3TRQ A;  3RPP A;  3ZLP A;  2WFC A;  3UAP A;  1MEK A;  2YV9 A;  4PQH A;  3R2Q A;  1U3I A;  4MZW A;  3TOU A;  4HU9 A;  2CVK A;  1SYX A;  1EP7 A;  3GSS A;  2NTO A;  1HNA A;  4TKY A;  4Q5R A;  2RUF A;  3FY7 A;  2VIM A;  3LJR A;  1F3A A;  3QD9 A;  3DYR A;  3VFI A;  3EVI A;  5G5E A;  1JZO A;  1G7O A;  1YY7 A;  2N5B A;  2E0Q A;  2H1G A;  3DRN A;  1T00 A;  3UEM A;  5G30 A;  4PQ1 A;  4MMM A;  2HYX A;  5HR3 A;  4KA0 A;  3H4K A;  4BWQ A;  5GSS A;  2MYG A;  3DD3 A;  4NWY A;  4KDU A;  4GF0 A;  1Z6N A;  4QL9 A;  2JL4 A;  1THX A;  3D22 A;  5ID2 B;  3ERW A;  4GLT A;  1SU9 A;  5E59 A;  1GNE A;  1SK0 A;  3KH7 A;  2LJA A;  4IQA A;  3ZVJ A;  2C0E A;  1EGO A;  4Q5N A;  1F2E A;  2AUV A;  3M9J A;  3KGK A;  4TN8 A;  3ZRE A;  1AUC A;  1GSS A;  5HR1 A;  4YAV A;  1SK1 A;  3ME7 A;  5CRW A;  2H73 A;  2X8G A;  2P31 A;  3KMO A;  1V2A A;  2VUP A;  1IYI A;  1XZO A;  9GSS A;  3ZZX A;  2HRF A;  5G1L A;  3A3T A;  2H6Y A;  3FR6 A;  2EC4 A;  2H8L A;  2LRC A;  2YZU A;  1QUW A;  4ZXG A;  1PN9 A;  3CRU A;  2J23 A;  3A2W A;  4O5R A;  3EMX A;  2GQM A;  3F3R A;  2GSR A;  4IKH A;  2PER A;  4D73 A;  3QCP A;  5EPF A;  3FKF A;  1T4Y A;  2R5G A;  5IOX A;  2K6V A;  4F2I A;  4X1U A;  2GZP A;  1I9D A;  3IE3 A;  4HDE A;  5CRH A;  3L78 A;  2RLI A;  1T8E B;  2LRN A;  4MA9 A;  3FZ5 A;  3LEF A;  2YOI A;  3I43 A;  5D9V A;  3IA1 A;  2LV3 A;  2EIR A;  1IYH A;  2GZY A;  1KEB A;  1K3L A;  1E6B A;  3UVH A;  3HY2 A;  4ZB8 A;  2YWI A;  1PX7 A;  2XPE A;  4RI6 A;  3IRA A;  2DIY A;  5LCZ A;  3GKN A;  2G2Q A;  1J9B A;  2H0I A;  5F8B A;  3QFA C;  2H74 A;  5D9T A;  2OKA A;  1OKT A;  3TRP A;  1M99 A;  2H6Z A;  1XVQ A;  4TR1 B;  5ECO B;  2PWJ A;  2H75 A;  2B7J A;  2I9H A;  1Q4J A;  3HA9 A;  4HUA A;  2MBS A;  2C0F A;  4V1A p;  4K0G A;  4MK3 A;  5JCU A;  5IMC A;  1OKD A;  5KN3 A;  4HQZ A;  4V2L A;  2HI7 A;  4KW6 A;  5DBQ A;  1XWG A;  2KLX A;  4NV2 A;  5CYY A;  4Z7X A;  4MPG A;  5IMF A;  2BMX A;  12GS A;  2ON5 A;  3TKQ A;  2H0G A;  1ERU A;  4GRF A;  2F8A A;  1PGT A;  4XS6 A;  3RBT A;  3KIJ A;  3ED3 A;  3C8E A;  1GRX A;  3NOF A;  3D4T A;  2I81 A;  1EWX A;  2NDO A;  1XIY A;  3VI5 A;  3G7Y A;  3DIE A;  1M2A A;  4POL A;  4RQX A;  5LD0 A;  4K8M A;  5DAK A;  17GS A;  4N10 A;  4J57 E;  1F9M A;  2CAQ A;  2CV4 A;  5DDL A;  3GKX A;  3M0F A;  3BJ5 A;  2DML A;  2HE3 A;  8GSS A;  1KTE A;  4PNG A;  2BJX A;  2MBT A;  1A2L A;  4J56 E;  1K3Y A;  4RUV A;  2YZH A;  2ZUP A;  3RPN A;  4LL4 B;  3G7I A;  4MH3 A;  3M1G A;  3TRX A;  1FOV A;  3E9J B;  2C8U A;  1BG5 A;  1Z5Y E;  2IJY A;  1BX9 A;  2X64 A;  4ECC A;  1A0F A;  2VL9 A;  2B7K A;  3GIX A;  1GNW A;  1PSQ A;  2PBJ A;  2WS2 A;  1N8J A;  2C1Y A;  4NMU A;  1JLV A;  2KOK A;  5ECP B;  1V40 A;  3F4R A;  4ZL8 A;  1YEX A;  2DJJ A;  3NIV A;  3K8N A;  4KDX A;  3CMI A;  1OC8 A;  2C3Q A;  2B1K A;  4F82 A;  2F8F A;  1K0B A;  1BED A;  3GNJ A;  2CT6 A;  2RM5 A;  3F4T A;  2KP1 A;  4X0X A;  4F0C A;  4IGJ A;  1VRS D;  1RK4 A;  2ZCT A;  4AJ6 A;  3C1R A;  5IPG A;  3EU4 A;  1AQV A;  4MCU A;  2MMA A;  6GSS A; 
#chains in the Genus database with same CATH topology
 4JRR A;  2HFD A;  20GS A;  4HU7 A;  3GL3 A;  3WGE A;  5DJM A;  1XW9 A;  2HZF A;  3ZIT A;  2E2M A;  5ECL B;  2P5Q A;  3QPM A;  1UC7 A;  2REM A;  1ERT A;  2LNT A;  4NV5 A;  1Z7P A;  2A4V A;  3RAZ A;  2V6K A;  3VUR A;  2NVL A;  3CXG A;  1YF0 A;  5CP1 A;  2V6O A;  3O6T A;  3IK7 A;  5IMA A;  2FWF A;  3HJM A;  2P5R A;  3Q74 A;  2GLR A;  3LYP A;  1SL0 B;  3N9J A;  2TRC P;  1HD2 A;  3CBU A;  4EDZ A;  4YKF A;  2FWG A;  1NHY A;  4IP6 A;  1TRS A;  2CA8 A;  4K0N A;  3VPT A;  2VL2 A;  5F06 A;  3GTU A;  2VAF A;  1MDJ A;  2IMI A;  2OBI A;  1CQG A;  1LJR A;  3WT2 A;  4I2T A;  1GSQ A;  4L5O A;  4K2D A;  5DJL A;  2JAD A;  2N5F A;  1F6M C;  4LL1 B;  4NAX A;  2Z9S A;  4D73 B;  3A2V A;  1X0R A;  2VOC A;  3N5O A;  1ZL9 A;  4Z2U A;  4ID0 A;  4RI7 A;  2R3X A;  1TK0 B;  1TK5 B;  1GH2 A;  3F6D A;  2EIO A;  3GUS A;  3GKK A;  3HJO A;  3VWU A;  4BWS A;  2PVQ A;  3VI7 A;  3FZA A;  3A5W A;  1PD2 1;  2L4C A;  2L6D A;  3KH9 A;  2HNL A;  4FYC A;  4KAE A;  1T3B A;  1ZCP A;  3F4S A;  1XXU A;  2BTO T;  4KX4 A;  2LRT A;  5D8I A;  4JE1 A;  4TW5 A;  2L5O A;  4GST A;  4EC0 A;  3ZRD A;  3CSI A;  3D5J A;  4A5P A;  2VLV A;  1T4Z A;  2WJU A;  2RM6 A;  1HYU A;  2OA7 A;  3TKS C;  18GS A;  2KUC A;  1GUL A;  5B6N A;  5C04 A;  2VCX A;  3FHK A;  4E8E A;  1M0U A;  4KSO A;  4ZIJ A;  2DKH A;  1ABA A;  3HYP A;  3IOS A;  4IW9 A;  3U5R E;  1C72 A;  2FWH A;  2GGT A;  1XWC A;  1O73 A;  2ALB A;  3KXO A;  2QC7 A;  3VLN A;  1AXD A;  3GV1 A;  3FK8 A;  4ISD A;  1GUH A;  2R6K A;  3EUR A;  1XWA A;  3CSJ A;  1HNC A;  1B8X A;  2PPT A;  2L4Q A;  6GSW A;  3HVX A;  5D96 A;  1OC9 B;  2C0D A;  1EV4 A;  4CY6 A;  2E7P A;  2VM1 A;  2HSH A;  3QAW A;  2GQL A;  4XRA A;  5AIS A;  3UOM A;  4PUF C;  3VPQ A;  3HZ8 A;  1FO5 A;  5ECI B;  1I5G A;  2L57 A;  1X5D A;  4NHW A;  2CZ2 A;  1ZOF A;  5JWQ B;  3OR5 A;  2H19 A;  4K6X A;  3KP8 A;  5JWO B;  3E0U A;  4I5Q A;  1TU7 A;  3W8J A;  4DSS A;  1NHO A;  5A4U A;  3UJ1 A;  5J9B A;  1GL8 A;  2IL3 A;  2VCZ A;  1QQ2 A;  4GCI A;  1ACV A;  2R37 A;  2H0H A;  4WEY A;  5G1K A;  1RW1 A;  5ECN B;  3HDC A;  1YEP A;  1O81 A;  3DKS A;  2DIZ A;  1XCC A;  3UMA A;  2HRN A;  4HZ2 A;  1TI1 A;  1M3J A;  4IJI A;  4L0U A;  4HJ2 A;  4GWR A;  3D0Z A;  1ON4 A;  1SJZ A;  4MF5 A;  4ZBA A;  4N11 A;  4K7N A;  5IIZ A;  2H6X A;  1TRW A;  1UVZ A;  1X5E A;  5DVB A;  3F6F A;  3AY8 A;  3TKS E;  2P0G A;  3M3M A;  3EYT A;  5J5N A;  3Q6O A;  1QXH A;  4YQV A;  3PH9 A;  3TB2 A;  3WGX A;  1U88 A;  5C00 A;  3L9S A;  4I8B A;  3EIN A;  4KF9 A;  3I6A A;  1OAZ A;  2DKI A;  5KN2 A;  2M46 A;  3GHA A;  1TK8 B;  4BVX A;  5AIV A;  2C3N A;  4I97 A;  3TKR A;  3J7Y b;  2R4V A;  4KCA A;  2A2R A;  1PRX A;  3DGQ A;  5ECS A;  2L59 A;  3RDW A;  1WWJ A;  2YNX A;  4CHS A;  3IDV A;  4ECB A;  4KE3 A;  4JED A;  1YDK A;  5J9C A;  1ZYN A;  4GSS A;  2R2J A;  4KSM A;  3FR3 A;  4ULX A;  1XOB A;  2YJH A;  2CX3 A;  5B7C A;  3TKP A;  1MD4 A;  2VCV A;  1XVW A;  4YH2 A;  3ZIJ A;  4OFM A;  2B3S A;  3O76 A;  2FNO A;  5GST A;  5ECM B;  1TJD A;  1U3A A;  3IV4 A;  1FG4 A;  4HJM A;  1J08 A;  1VGL A;  2GDR A;  3LXZ A;  2FUG 2;  2RII A;  3V1W A;  2DLX A;  2YV7 A;  1YKA A;  5B6M A;  1PX6 A;  3IHG A;  2JAC A;  3KM6 A;  2IME A;  3GFK A;  1QK8 A;  2TRX A;  2IIY A;  3PPU A;  2V32 A;  4JR6 A;  4LMV A;  2QA2 A;  5IPH A;  3LXT A;  4TR0 A;  2B5E A;  2PUK C;  4IEL A;  3W8S A;  1V9W A;  3ERG A;  3QMX A;  3UBK A;  1NSW A;  1MDK A;  1KBN A;  2CAI A;  3C71 A;  3GTU B;  1AQX A;  4KUN A;  1SYR A;  3I9V 2;  5BMU A;  2PU9 C;  5J3R A;  4DSR A;  4I2U A;  4TR4 A;  1LBK A;  2TIR A;  4EXJ A;  1WOU A;  5HFG A;  2XBI A;  2H1A A;  1X9S B;  4ZBB A;  2GZZ A;  22GS A;  3TJB A;  3H93 A;  4MAB A;  5CNW A;  3GKM A;  3CTG A;  3F9U A;  1M2D A;  4WKW A;  1EEJ A;  4NHZ A;  2GVP A;  1O8W A;  1S3D A;  1O8X A;  2VM2 A;  5D73 A;  3TJK A;  5DCH A;  4Z2T A;  6GSV A;  3DEX A;  3P8W A;  2LKU A;  3VWX A;  3ZFL A;  3ZVJ D;  2VO4 A;  3IAS 2;  3M8N A;  4FO5 A;  5E4W A;  1EV9 A;  5IQY A;  1ERV A;  4ML6 A;  1JZW A;  3GN3 A;  4CY8 A;  3KMN A;  4WET A;  1S3A A;  5EY6 A;  3D21 A;  1URM A;  2DMM A;  2MZC A;  2HZE A;  2OAD A;  5HFK A;  1Y6E A;  3QOU A;  3FEU A;  3VWV A;  1ERW A;  3C73 A;  4OCE A;  1XPV A;  1M2B A;  2B1L A;  1B4Q A;  2C0G A;  5ABR A;  4ZL9 A;  1VF2 A;  1VF1 A;  2L5L A;  1A2J A;  4ZL7 A;  4EUY A;  5F0G A;  1AC1 A;  4HEA 2;  3MIX A;  1G0T A;  1R5A A;  6GSX A;  4TXO A;  5AN1 A;  4EO3 A;  1R4W A;  4F0B A;  4BA7 A;  1XW6 A;  5B8B A;  3APQ A;  2K8S A;  4FH8 A;  5HR2 A;  1JFU A;  1T7P B;  2OE1 A;  4ZIL A;  4IJ3 A;  3TGZ A;  3IHQ A;  1EZK A;  3US3 A;  4G9H A;  1K0C A;  2IPA A;  2FLS A;  3D4M A;  2CVD A;  1J0F A;  2LEG A;  3U6V A;  5D9X A;  1DE1 A;  4O32 A;  3C1S A;  2LNS A;  14GS A;  3F3Q A;  4DSS B;  2AHE A;  2WRT A;  4EVM A;  2X8C A;  3GA4 A;  2WB9 A;  4XIH A;  1THO A;  1H75 A;  1GLQ A;  1SEN A;  1G6W A;  5COH A;  1XG8 A;  5CRG A;  1TKD B;  1Z3E A;  2K9F A;  1B48 A;  2IN3 A;  3FRC A;  1TW9 A;  2YJ7 A;  2PGT A;  2DBC A;  1H4O A;  4MJB A;  2A2S A;  3ZMK A;  1S3C A;  3DML A;  2VCW A;  2H1D A;  1JZD A;  3WGD A;  2IFQ A;  3HHV A;  4GSN A;  4MZC A;  3TCO A;  4K9Z A;  1G6Y A;  2UZ8 A;  3BBY A;  1Z6M A;  4GQC A;  5J4U A;  1XWK A;  4YAP A;  4HS1 A;  4LA1 A;  4DEJ A;  3BOA A;  3KTB A;  6GSU A;  1PN0 A;  1PL1 A;  1MD3 A;  2B6M A;  1ML6 A;  2HRA A;  4XS4 A;  4BVX B;  3ZFB A;  2WGR A;  4GQF A;  3SBC A;  3FR9 A;  3GUR A;  1QMV A;  3CTF A;  5CO3 A;  4TRX A;  1WIK A;  1TRV A;  2JSZ A;  5AIX A;  3RHB A;  5ECR B;  4RQR A;  3BCK A;  1R7H A;  1FVK A;  1TOF A;  5CRE A;  5G2Z A;  3KP9 A;  2JSY A;  1GLP A;  1GP1 A;  3WT1 A;  5FWG A;  4ECI A;  5IM9 A;  4MP4 A;  3ISO A;  4GTU A;  1FW1 A;  2DJ2 A;  5L71 A;  2LST A;  3KZQ A;  1WE0 A;  3EWL A;  2K8V A;  4AJ7 A;  1Z9H A;  3LSZ A;  4KH7 A;  1FHE A;  5DAL A;  2F3M A;  2PMT A;  5DQY A;  2JZS A;  4JBB A;  3EU3 A;  1R26 A;  3ZIV A;  1K0M A;  5KN1 A;  1Z7R A;  4OWY A;  4IBP A;  1RQM A;  3CYN A;  1N2A A;  2AV4 A;  4BPY A;  1A2M A;  1HQO A;  2VCQ A;  1X5C A;  3DVX A;  4ACS A;  2IMD A;  4MH2 A;  2OBK A;  2MMO A;  5ECQ B;  3LFL A;  1VF3 A;  3JCM L;  3IAM 2;  1ZGN A;  2MMZ A;  4MJA A;  3Q19 A;  3KEB A;  4PNF A;  5JWR B;  4L5L A;  5CAX A;  2AJQ B;  1YKC A;  2IMF A;  4MDC A;  5ECH B;  2RUE A;  2GT6 A;  2LQO A;  5B8A A;  4L0W A;  3J7Y k;  2WDU A;  5ELA A;  3MDK A;  3RHC A;  4JU5 A;  3VK9 A;  5IMD A;  4TVE A;  2O87 A;  3GST A;  4OO5 A;  1EGR A;  3P7X A;  5F07 A;  1F37 A;  5HQP A;  1Q98 A;  1BQ7 A;  5EL8 A;  4IVF A;  1M3I A;  1SJ6 A;  3TOT A;  4PUR A;  2M72 A;  1FB6 A;  2FHE A;  3UL3 A;  3KTL A;  5IMV A;  1BYE A;  1JLW A;  2JU5 A;  2FA4 A;  1ZMA A;  2I1U A;  5F05 A;  3F0I A;  4MJE A;  2H71 A;  4O7H A;  4TR3 A;  1B9X C;  2VLT A;  1GSU A;  2H30 A;  1M9B A;  3ZYW A;  2YCD A;  1A24 A;  1GUM A;  2DJ1 A;  4WBJ A;  1YF1 A;  2YPM A;  2DJ3 A;  2HSY A;  4KCE A;  2X49 A;  5ELG A;  10GS A;  2E2G A;  3QAV A;  3UBL A;  1LU4 A;  1JHB A;  3MSZ A;  4MJC A;  2HZE B;  3FYG A;  2VL2 C;  4N0V A;  1R5P A;  5IO2 A;  4AGS A;  3LQ7 A;  2YN1 A;  4MLY A;  1QGV A;  4DSQ A;  5DAK B;  4HOJ A;  2DC5 A;  3H1N A;  3G9B A;  4OD7 A;  1BAY A;  4EDY A;  3HD5 A;  1K0A A;  4TXO B;  3HVS A;  19GS A;  4OCF A;  1YZX A;  1OC3 A;  1TXX A;  4H86 A;  2B5Y A;  4WF5 A;  1ILO A;  4KGI A;  4KB3 A;  3HXS A;  4XCS A;  1GTU A;  4NXI A;  2CX4 A;  4K1F A;  1O6J A;  1XW5 A;  3GX8 A;  2O7K A;  2YWM A;  1SK2 A;  3HVV A;  3E3E A;  3FW2 A;  5BRT A;  3VWW A;  4IS0 A;  2FY6 A;  1A23 A;  1GUK A;  1TTZ A;  5GAN D;  4KND A;  1SD9 A;  4G2E A;  1AW9 A;  3KJY A;  2NPB A;  5AGY A;  4OFN A;  2X99 A;  4G0I A;  1K0N A;  1A8L A;  4QL7 A;  2KP2 A;  2AB6 A;  1GSE A;  5A4W A;  5KEJ A;  5JCW A;  1FVJ A;  4XRD A;  4XS1 A;  4G0L A;  2GTU A;  3IBH A;  2QSI A;  2CVB A;  4CW9 A;  4Z2R A;  4MF6 A;  3GYK A;  2EIQ A;  11GS A;  2VL3 A;  2IFQ B;  4GXZ A;  2H1B A;  4LMW A;  4POM A;  4YKG A;  2ZNM A;  3LOR A;  4YQM A;  1U87 A;  2QKE A;  1Y25 A;  4ZBD A;  3TDG A;  3H8Q A;  3TJG A;  3UAR A;  2H66 A;  2JZT A;  5ECK B;  4G10 A;  2LUS A;  4E8H A;  3DWV A;  4EIP A;  1USB A;  3A2X A;  2C4J A;  3UVT A;  4X4J A;  2A2P A;  3WYW A;  4OMV A;  2R0P A;  2O85 A;  4QQ7 A;  4WXT A;  4EE0 A;  1ZYQ B;  2C80 A;  1B4P A;  4XS4 B;  2GQK A;  5CRD A;  3SWL A;  1TU8 A;  2LQQ A;  4FYU A;  1TRU A;  3BCI A;  2N5A A;  1GWC A;  2OJL A;  3Q18 A;  1MTC A;  1QFN A;  2FGX A;  4WF4 A;  4YQU A;  4PX1 A;  3W6G A;  4F9Z A;  4CDO A;  3F8U A;  4EL1 A;  3LWA A;  2C3T A;  4ZB6 A;  1PQN A;  1XBS A;  4DVC A;  2LS5 A;  2LJR A;  5IOW A;  7GSS A;  1M7T A;  2F51 A;  3UIW A;  1JZR A;  5GAP D;  2H72 A;  1GSY A;  6GST A;  3F63 A;  1ZYP A;  1SJI A;  3HZ4 A;  4ECJ A;  2NBS A;  5DAL B;  2H01 A;  4KDY A;  4WBR D;  3ERF A;  2CQ9 A;  2FD3 A;  3O3T A;  3CSH A;  4TOP A;  3QR6 A;  2LJK A;  3MWH A;  2VD1 A;  2AAW A;  1BJX A;  4MPF A;  3IK9 A;  1GTI A;  3L4N A;  3L9U A;  2M80 A;  5HR0 A;  3L9V A;  4HZ4 A;  5KOX A;  3QDN A;  2DJ0 A;  2XHF A;  1VF4 A;  1OC9 A;  3DXB A;  1TI3 A;  2WUL A;  3I69 A;  5A5K A;  2AYT A;  4EKZ A;  3GMF A;  2VLU A;  4V2N A;  5EVO A;  3EMP A;  1XFL A;  5H5Q A;  5DQS A;  2VCT A;  3IXR A;  5H5R A;  4POB A;  4AF2 A;  4XHM A;  2FWE A;  4IQ1 A;  2ON7 A;  1PL2 A;  4MNN A;  3QAG A;  2KHP A;  4PGT A;  2H70 A;  3MAK A;  4ZB9 A;  1SL1 B;  4K5S A;  1MDI A;  3GH6 A;  3PR8 A;  4LLR A;  3EC3 A;  2X8H A;  2HXK A;  13GS A;  1GSD A;  4NPB A;  1K3O A;  1V98 A;  2HT9 A;  4V2M A;  1X9M B;  1OE7 A;  3DVW A;  3HKR A;  4XTS A;  1EEM A;  5FHI A;  4P3Y B;  4Q5F A;  1CQH A;  4O5U A;  2FCH A;  3NZN A;  4ML1 A;  3CRT A;  3H79 A;  3KCM A;  1YJ6 A;  2R0C A;  5ID2 A;  4ICY A;  2JZR A;  1AAZ A;  1GTB A;  1F3B A;  1NM3 A;  1SKS B;  1A0R P;  2O8V B;  2GSQ A;  1PKZ A;  2MMN A;  1EP8 A;  2F9S A;  1PKW A;  2D2Z A;  2V1M A;  2V2G A;  5JCG A;  3HJP A;  1OYJ A;  1SKW B;  5J41 A;  4PQI A;  1SD8 A;  1XOA A;  2DSA A;  1DSB A;  4FQU A;  1DUG A;  1ZZY A;  1AQW A;  1YQ1 A;  1UN2 A;  2I3Y A;  4EF0 A;  3FMW A;  2CZ3 A;  2HRK A;  3TKS A;  1TP9 A;  3EE2 A;  4N0Z A;  4OFT A;  4K7I A;  1T1V A;  6GSY A;  5A4V A;  3PGT A;  2OAC A;  1DE2 A;  3BD2 A;  3D6I A;  1AIU A;  1OVN A;  3KD0 A;  1FAA A;  2V41 A;  3L0H A;  1PFO A;  4I6X A;  3ZL5 A;  1S3R A;  3QFB C;  1DBY A;  3ZML A;  1WPI A;  3M9K A;  4V1A g;  3ME8 A;  1EOG A;  2GST A;  4X43 A;  2LTK A;  2J9H A;  3ZTL A;  5KN0 A;  3S9F A;  4O5Q A;  3HCZ A;  4FIW A;  5KOW A;  4G19 A;  1OE8 A;  1EOH A;  1A8Y A;  1WRY A;  4BL7 A;  3WD6 A;  4N30 A;  4HI7 A;  1WJK A;  3FZ9 A;  5ENU A;  4WR5 A;  1SKR B;  2PN8 A;  4J2F A;  3G7J A;  5D9W A;  4OO4 A;  2YWO A;  4HQS A;  4O92 A;  1UA5 A;  2HLS A;  1NW2 A;  5H5S A;  3GRX A;  2XBQ A;  5HFI A;  3FZ4 A;  1V58 A;  4Q5Q A;  4FYB A;  2B5X A;  4PUA A;  3C7M A;  4BVY A;  1ZYE A;  2XPD A;  2VD0 A;  2GSS A;  3A5I A;  2YAN A;  3APS A;  1FB0 A;  5IO0 A;  3LYK A;  3P90 A;  3GL5 A;  4L8E A;  4POK A;  4TR1 A;  5D93 A;  1W4V A;  2DJK A;  2WZ9 A;  1SL2 B;  1PA3 A;  2X4A A;  3APO A;  2WCI A;  3HVN A;  3IR4 A;  3TJJ A;  1B9Y C;  2PVO C;  2FA8 A;  4WR4 A;  4MF7 A;  2QGV A;  3PIN A;  4IHU A;  5GZZ B;  3IPZ A;  1KNG A;  4IN0 A;  1G7E A;  1HNB A;  2L6C A;  2IMK A;  5FT3 A;  1K0O A;  4IP1 A;  2H76 A;  5G31 A;  1TDI A;  5LNK e;  3TJF A;  5INY A;  2K18 A;  2YWN A;  3IC4 A;  1X9W B;  4PXO A;  1PMT A;  2IWT A;  3P2A A;  1M9A A;  2O89 A;  4ILF A;  1K0D A;  1GSF A;  4AJ8 A;  2OE0 A;  2XC2 A;  1WP0 A;  2GT5 A;  1O7U A;  5G5F A;  2YP6 A;  1U6T A;  3MNG A;  1V57 A;  1ST9 A;  1W89 A;  1O85 A;  5IMZ A;  5DCG A;  2G0F A;  2ES7 A;  3LGC A;  4TXV A;  2OE3 A;  1WMJ A;  16GS A;  4F03 A;  1XWB A;  2GS3 A;  3LG6 A;  3GH9 A;  4JZQ A;  3GX0 A;  4K7O A;  4MZB A;  2I4A A;  4JR4 A;  3TUE A;  1E2Y A;  1GTA A;  3TRQ A;  3RPP A;  3ZLP A;  2WFC A;  3UAP A;  1MEK A;  2YV9 A;  4PQH A;  3R2Q A;  1U3I A;  4MZW A;  3TOU A;  4HU9 A;  4K2X A;  4G0K A;  2CVK A;  1SYX A;  1EP7 A;  3GSS A;  2NTO A;  1HNA A;  4TKY A;  4Q5R A;  2RUF A;  3FY7 A;  2VIM A;  3LJR A;  1F3A A;  3QD9 A;  3DYR A;  3VFI A;  3EVI A;  5G5E A;  1JZO A;  1G7O A;  1YY7 A;  2N5B A;  2E0Q A;  2H1G A;  3DRN A;  1T00 A;  3UEM A;  5G30 A;  4PQ1 A;  4MMM A;  2HYX A;  5HR3 A;  4KA0 A;  3H4K A;  4BWQ A;  5GSS A;  2MYG A;  3DD3 A;  4NWY A;  4K5R A;  4KDU A;  4GF0 A;  1Z6N A;  4QL9 A;  2JL4 A;  1THX A;  3D22 A;  5ID2 B;  3ERW A;  4GLT A;  1SU9 A;  5E59 A;  1GNE A;  1SK0 A;  3KH7 A;  2LJA A;  4IQA A;  3ZVJ A;  2C0E A;  1EGO A;  4Q5N A;  1F2E A;  2AUV A;  3M9J A;  3KGK A;  4TN8 A;  3ZRE A;  1AUC A;  1GSS A;  5HR1 A;  4YAV A;  1SK1 A;  3ME7 A;  5CRW A;  2H73 A;  2X8G A;  3R3E A;  2P31 A;  3KMO A;  1V2A A;  2VUP A;  1IYI A;  1XZO A;  9GSS A;  3ZZX A;  2HRF A;  5G1L A;  3A3T A;  2H6Y A;  3FR6 A;  2R0G A;  2EC4 A;  2H8L A;  2LRC A;  2YZU A;  1QUW A;  4ZXG A;  1PN9 A;  3CRU A;  2J23 A;  3A2W A;  4O5R A;  3EMX A;  2GQM A;  3F3R A;  2GSR A;  4IKH A;  4BIK A;  1FOH A;  2PER A;  4D73 A;  3QCP A;  5EPF A;  3FKF A;  1T4Y A;  2R5G A;  5IOX A;  2K6V A;  4F2I A;  4X1U A;  2GZP A;  1I9D A;  3IE3 A;  4HDE A;  4BL7 B;  5CRH A;  3L78 A;  2RLI A;  1T8E B;  2LRN A;  4MA9 A;  3FZ5 A;  3LEF A;  2YOI A;  3I43 A;  5D9V A;  3IA1 A;  2LV3 A;  2EIR A;  1IYH A;  2GZY A;  1KEB A;  1K3L A;  1E6B A;  3UVH A;  3HY2 A;  4ZB8 A;  2YWI A;  1PX7 A;  2XPE A;  4RI6 A;  3IRA A;  2DIY A;  5LCZ A;  3GKN A;  2G2Q A;  1J9B A;  2H0I A;  5F8B A;  4BVY B;  3QFA C;  2H74 A;  3IC8 A;  5D9T A;  2OKA A;  1OKT A;  3TRP A;  1M99 A;  2H6Z A;  1XVQ A;  4TR1 B;  5ECO B;  2PWJ A;  2H75 A;  2B7J A;  2I9H A;  1Q4J A;  3HA9 A;  4HUA A;  2MBS A;  2C0F A;  4V1A p;  4K0G A;  4MK3 A;  5JCU A;  5IMC A;  1OKD A;  5KN3 A;  4USS A;  4HQZ A;  4V2L A;  2HI7 A;  4HSC X;  4KW6 A;  5DBQ A;  1XWG A;  2KLX A;  4NV2 A;  5CYY A;  4Z7X A;  4MPG A;  5IMF A;  2HSM A;  2BMX A;  12GS A;  2ON5 A;  3TKQ A;  2H0G A;  3MYD A;  1ERU A;  4GRF A;  2F8A A;  1PGT A;  4XS6 A;  3RBT A;  3KIJ A;  3ED3 A;  3C8E A;  1GRX A;  3NOF A;  3D4T A;  2I81 A;  1EWX A;  2NDO A;  1XIY A;  3CQF A;  3VI5 A;  3G7Y A;  3DIE A;  1M2A A;  4POL A;  4RQX A;  5LD0 A;  4K8M A;  5DAK A;  17GS A;  4N10 A;  4J57 E;  1F9M A;  2CAQ A;  2CV4 A;  5DDL A;  3GKX A;  3M0F A;  3BJ5 A;  2DML A;  2HE3 A;  8GSS A;  1KTE A;  4PNG A;  2BJX A;  2MBT A;  4J56 E;  1A2L A;  1K3Y A;  2QA1 A;  4RUV A;  4EIQ A;  2YZH A;  2ZUP A;  3RPN A;  4LL4 B;  3G7I A;  4MH3 A;  3M1G A;  3TRX A;  1FOV A;  3E9J B;  2C8U A;  1BG5 A;  3LW9 A;  1Z5Y E;  2IJY A;  1BX9 A;  2X64 A;  4ECC A;  2A4H A;  1A0F A;  2VL9 A;  2B7K A;  3GIX A;  1GNW A;  1PSQ A;  2PBJ A;  2WS2 A;  1N8J A;  2C1Y A;  4NMU A;  1JLV A;  2KOK A;  5ECP B;  1V40 A;  3F4R A;  4ZL8 A;  1YEX A;  2DJJ A;  3NIV A;  3K8N A;  4KDX A;  3CMI A;  1OC8 A;  2C3Q A;  2B1K A;  4F82 A;  2F8F A;  1K0B A;  1BED A;  3GNJ A;  2CT6 A;  2RM5 A;  3F4T A;  2KP1 A;  4X0X A;  4F0C A;  4IGJ A;  4PTS A;  3EPT A;  1VRS D;  1RK4 A;  2ZCT A;  4AJ6 A;  3C1R A;  5IPG A;  3EU4 A;  1AQV A;  4MCU A;  2MMA A;  6GSS A; 
#chains in the Genus database with same CATH homology
 4JRR A;  2HFD A;  20GS A;  4HU7 A;  3GL3 A;  3WGE A;  5DJM A;  1XW9 A;  2HZF A;  3ZIT A;  2E2M A;  5ECL B;  2P5Q A;  3QPM A;  1UC7 A;  2REM A;  1ERT A;  2LNT A;  4NV5 A;  1Z7P A;  2A4V A;  3RAZ A;  2V6K A;  3VUR A;  2NVL A;  3CXG A;  1YF0 A;  5CP1 A;  2V6O A;  3O6T A;  3IK7 A;  5IMA A;  2FWF A;  3HJM A;  2P5R A;  3Q74 A;  2GLR A;  3LYP A;  1SL0 B;  3N9J A;  2TRC P;  1HD2 A;  3CBU A;  4EDZ A;  4YKF A;  2FWG A;  1NHY A;  4IP6 A;  1TRS A;  2CA8 A;  4K0N A;  3VPT A;  2VL2 A;  5F06 A;  3GTU A;  2VAF A;  1MDJ A;  2IMI A;  2OBI A;  1CQG A;  1LJR A;  3WT2 A;  4I2T A;  1GSQ A;  4L5O A;  4K2D A;  5DJL A;  2JAD A;  2N5F A;  1F6M C;  4LL1 B;  4NAX A;  2Z9S A;  4D73 B;  3A2V A;  1X0R A;  2VOC A;  3N5O A;  1ZL9 A;  4Z2U A;  4ID0 A;  4RI7 A;  2R3X A;  1TK0 B;  1TK5 B;  1GH2 A;  3F6D A;  2EIO A;  3GUS A;  3GKK A;  3HJO A;  3VWU A;  4BWS A;  2PVQ A;  3VI7 A;  3FZA A;  3A5W A;  1PD2 1;  2L4C A;  2L6D A;  3KH9 A;  2HNL A;  4FYC A;  4KAE A;  1T3B A;  1ZCP A;  3F4S A;  1XXU A;  2BTO T;  4KX4 A;  2LRT A;  5D8I A;  4JE1 A;  4TW5 A;  2L5O A;  4GST A;  4EC0 A;  3ZRD A;  3CSI A;  3D5J A;  4A5P A;  2VLV A;  1T4Z A;  2WJU A;  2RM6 A;  1HYU A;  2OA7 A;  3TKS C;  18GS A;  2KUC A;  1GUL A;  5B6N A;  5C04 A;  2VCX A;  3FHK A;  4E8E A;  1M0U A;  4KSO A;  4ZIJ A;  2DKH A;  1ABA A;  3HYP A;  3IOS A;  4IW9 A;  3U5R E;  1C72 A;  2FWH A;  2GGT A;  1XWC A;  1O73 A;  2ALB A;  3KXO A;  2QC7 A;  3VLN A;  1AXD A;  3GV1 A;  3FK8 A;  4ISD A;  1GUH A;  2R6K A;  3EUR A;  1XWA A;  3CSJ A;  1HNC A;  1B8X A;  2PPT A;  2L4Q A;  6GSW A;  3HVX A;  5D96 A;  1OC9 B;  2C0D A;  1EV4 A;  4CY6 A;  2E7P A;  2VM1 A;  2HSH A;  3QAW A;  2GQL A;  4XRA A;  5AIS A;  3UOM A;  4PUF C;  3VPQ A;  3HZ8 A;  1FO5 A;  5ECI B;  1I5G A;  2L57 A;  1X5D A;  4NHW A;  2CZ2 A;  1ZOF A;  5JWQ B;  3OR5 A;  2H19 A;  4K6X A;  3KP8 A;  5JWO B;  3E0U A;  4I5Q A;  1TU7 A;  3W8J A;  4DSS A;  1NHO A;  5A4U A;  3UJ1 A;  5J9B A;  1GL8 A;  2IL3 A;  2VCZ A;  1QQ2 A;  4GCI A;  1ACV A;  2R37 A;  2H0H A;  4WEY A;  5G1K A;  1RW1 A;  5ECN B;  3HDC A;  1YEP A;  1O81 A;  3DKS A;  2DIZ A;  1XCC A;  3UMA A;  2HRN A;  4HZ2 A;  1TI1 A;  4IJI A;  4L0U A;  4HJ2 A;  4GWR A;  3D0Z A;  1ON4 A;  1SJZ A;  4MF5 A;  4ZBA A;  4N11 A;  4K7N A;  5IIZ A;  2H6X A;  1TRW A;  1UVZ A;  1X5E A;  5DVB A;  3F6F A;  3AY8 A;  3TKS E;  2P0G A;  3M3M A;  3EYT A;  5J5N A;  3Q6O A;  1QXH A;  4YQV A;  3PH9 A;  3TB2 A;  3WGX A;  1U88 A;  5C00 A;  3L9S A;  4I8B A;  3EIN A;  4KF9 A;  3I6A A;  1OAZ A;  2DKI A;  5KN2 A;  2M46 A;  3GHA A;  1TK8 B;  4BVX A;  5AIV A;  2C3N A;  4I97 A;  3TKR A;  3J7Y b;  2R4V A;  4KCA A;  2A2R A;  1PRX A;  3DGQ A;  5ECS A;  2L59 A;  3RDW A;  1WWJ A;  2YNX A;  4CHS A;  3IDV A;  4ECB A;  4KE3 A;  4JED A;  1YDK A;  5J9C A;  1ZYN A;  4GSS A;  2R2J A;  4KSM A;  3FR3 A;  4ULX A;  1XOB A;  2YJH A;  2CX3 A;  5B7C A;  3TKP A;  1MD4 A;  2VCV A;  1XVW A;  4YH2 A;  3ZIJ A;  4OFM A;  2B3S A;  3O76 A;  2FNO A;  5GST A;  5ECM B;  1TJD A;  1U3A A;  3IV4 A;  1FG4 A;  4HJM A;  1J08 A;  1VGL A;  2GDR A;  3LXZ A;  2FUG 2;  2RII A;  3V1W A;  2DLX A;  2YV7 A;  1YKA A;  5B6M A;  1PX6 A;  3IHG A;  2JAC A;  3KM6 A;  2IME A;  3GFK A;  1QK8 A;  2TRX A;  2IIY A;  3PPU A;  2V32 A;  4JR6 A;  4LMV A;  2QA2 A;  5IPH A;  3LXT A;  4TR0 A;  2B5E A;  2PUK C;  4IEL A;  3W8S A;  1V9W A;  3ERG A;  3QMX A;  3UBK A;  1NSW A;  1MDK A;  1KBN A;  2CAI A;  3C71 A;  3GTU B;  1AQX A;  4KUN A;  1SYR A;  3I9V 2;  5BMU A;  2PU9 C;  5J3R A;  4DSR A;  4I2U A;  4TR4 A;  1LBK A;  2TIR A;  4EXJ A;  1WOU A;  5HFG A;  2XBI A;  2H1A A;  1X9S B;  4ZBB A;  2GZZ A;  22GS A;  3TJB A;  3H93 A;  4MAB A;  5CNW A;  3GKM A;  3CTG A;  3F9U A;  1M2D A;  4WKW A;  1EEJ A;  4NHZ A;  2GVP A;  1O8W A;  1S3D A;  1O8X A;  2VM2 A;  5D73 A;  3TJK A;  5DCH A;  4Z2T A;  6GSV A;  3DEX A;  3P8W A;  2LKU A;  3VWX A;  3ZFL A;  3ZVJ D;  2VO4 A;  3IAS 2;  3M8N A;  4FO5 A;  5E4W A;  1EV9 A;  5IQY A;  1ERV A;  4ML6 A;  1JZW A;  3GN3 A;  4CY8 A;  3KMN A;  4WET A;  1S3A A;  5EY6 A;  3D21 A;  1URM A;  2DMM A;  2MZC A;  2HZE A;  2OAD A;  5HFK A;  1Y6E A;  3QOU A;  3FEU A;  3VWV A;  1ERW A;  3C73 A;  4OCE A;  1XPV A;  1M2B A;  2B1L A;  1B4Q A;  2C0G A;  5ABR A;  4ZL9 A;  1VF2 A;  1VF1 A;  2L5L A;  1A2J A;  4ZL7 A;  4EUY A;  5F0G A;  1AC1 A;  4HEA 2;  3MIX A;  1G0T A;  1R5A A;  6GSX A;  4TXO A;  5AN1 A;  4EO3 A;  1R4W A;  4F0B A;  4BA7 A;  1XW6 A;  5B8B A;  3APQ A;  2K8S A;  4FH8 A;  5HR2 A;  1JFU A;  1T7P B;  2OE1 A;  4ZIL A;  4IJ3 A;  3TGZ A;  3IHQ A;  1EZK A;  3US3 A;  4G9H A;  1K0C A;  2IPA A;  2FLS A;  3D4M A;  2CVD A;  1J0F A;  2LEG A;  3U6V A;  5D9X A;  1DE1 A;  4O32 A;  3C1S A;  2LNS A;  14GS A;  3F3Q A;  4DSS B;  2AHE A;  2WRT A;  4EVM A;  2X8C A;  3GA4 A;  2WB9 A;  4XIH A;  1THO A;  1H75 A;  1GLQ A;  1SEN A;  1G6W A;  5COH A;  5CRG A;  1TKD B;  1Z3E A;  2K9F A;  1B48 A;  2IN3 A;  3FRC A;  1TW9 A;  2YJ7 A;  2PGT A;  2DBC A;  1H4O A;  4MJB A;  2A2S A;  3ZMK A;  1S3C A;  3DML A;  2VCW A;  2H1D A;  1JZD A;  3WGD A;  2IFQ A;  3HHV A;  4GSN A;  4MZC A;  3TCO A;  4K9Z A;  1G6Y A;  2UZ8 A;  3BBY A;  1Z6M A;  4GQC A;  5J4U A;  1XWK A;  4YAP A;  4HS1 A;  4LA1 A;  4DEJ A;  3BOA A;  3KTB A;  6GSU A;  1PN0 A;  1PL1 A;  1MD3 A;  2B6M A;  1ML6 A;  2HRA A;  4XS4 A;  4BVX B;  3ZFB A;  2WGR A;  4GQF A;  3SBC A;  3FR9 A;  3GUR A;  1QMV A;  3CTF A;  5CO3 A;  4TRX A;  1WIK A;  1TRV A;  2JSZ A;  5AIX A;  3RHB A;  5ECR B;  4RQR A;  3BCK A;  1R7H A;  1FVK A;  1TOF A;  5CRE A;  5G2Z A;  3KP9 A;  2JSY A;  1GLP A;  1GP1 A;  3WT1 A;  5FWG A;  4ECI A;  5IM9 A;  4MP4 A;  3ISO A;  4GTU A;  1FW1 A;  2DJ2 A;  5L71 A;  2LST A;  3KZQ A;  1WE0 A;  3EWL A;  2K8V A;  4AJ7 A;  1Z9H A;  3LSZ A;  4KH7 A;  1FHE A;  5DAL A;  2F3M A;  2PMT A;  5DQY A;  2JZS A;  4JBB A;  3EU3 A;  1R26 A;  3ZIV A;  1K0M A;  5KN1 A;  1Z7R A;  4OWY A;  4IBP A;  1RQM A;  3CYN A;  1N2A A;  2AV4 A;  4BPY A;  1A2M A;  1HQO A;  2VCQ A;  1X5C A;  3DVX A;  4ACS A;  2IMD A;  4MH2 A;  2OBK A;  2MMO A;  5ECQ B;  3LFL A;  1VF3 A;  3JCM L;  3IAM 2;  1ZGN A;  2MMZ A;  4MJA A;  3Q19 A;  3KEB A;  4PNF A;  5JWR B;  4L5L A;  5CAX A;  2AJQ B;  1YKC A;  2IMF A;  4MDC A;  5ECH B;  2RUE A;  2GT6 A;  2LQO A;  5B8A A;  4L0W A;  3J7Y k;  2WDU A;  5ELA A;  3MDK A;  3RHC A;  4JU5 A;  3VK9 A;  5IMD A;  4TVE A;  2O87 A;  3GST A;  4OO5 A;  1EGR A;  3P7X A;  5F07 A;  1F37 A;  5HQP A;  1Q98 A;  1BQ7 A;  5EL8 A;  4IVF A;  1SJ6 A;  3TOT A;  4PUR A;  2M72 A;  1FB6 A;  2FHE A;  3UL3 A;  3KTL A;  5IMV A;  1BYE A;  1JLW A;  2JU5 A;  2FA4 A;  1ZMA A;  2I1U A;  5F05 A;  3F0I A;  4MJE A;  2H71 A;  4O7H A;  4TR3 A;  1B9X C;  2VLT A;  1GSU A;  2H30 A;  1M9B A;  3ZYW A;  2YCD A;  1A24 A;  1GUM A;  2DJ1 A;  4WBJ A;  1YF1 A;  2YPM A;  2DJ3 A;  2HSY A;  4KCE A;  2X49 A;  5ELG A;  10GS A;  2E2G A;  3QAV A;  3UBL A;  1LU4 A;  1JHB A;  3MSZ A;  4MJC A;  2HZE B;  3FYG A;  2VL2 C;  4N0V A;  1R5P A;  5IO2 A;  4AGS A;  3LQ7 A;  2YN1 A;  4MLY A;  1QGV A;  4DSQ A;  5DAK B;  4HOJ A;  2DC5 A;  3H1N A;  3G9B A;  4OD7 A;  1BAY A;  4EDY A;  3HD5 A;  1K0A A;  4TXO B;  3HVS A;  19GS A;  4OCF A;  1YZX A;  1OC3 A;  1TXX A;  4H86 A;  2B5Y A;  4WF5 A;  1ILO A;  4KGI A;  4KB3 A;  3HXS A;  4XCS A;  1GTU A;  4NXI A;  2CX4 A;  4K1F A;  1O6J A;  1XW5 A;  3GX8 A;  2O7K A;  2YWM A;  1SK2 A;  3HVV A;  3E3E A;  3FW2 A;  5BRT A;  3VWW A;  4IS0 A;  2FY6 A;  1A23 A;  1GUK A;  1TTZ A;  5GAN D;  4KND A;  1SD9 A;  4G2E A;  1AW9 A;  3KJY A;  2NPB A;  5AGY A;  4OFN A;  2X99 A;  4G0I A;  1K0N A;  1A8L A;  4QL7 A;  2KP2 A;  2AB6 A;  1GSE A;  5A4W A;  5KEJ A;  5JCW A;  1FVJ A;  4XRD A;  4XS1 A;  4G0L A;  2GTU A;  3IBH A;  2QSI A;  2CVB A;  4CW9 A;  4Z2R A;  4MF6 A;  3GYK A;  2EIQ A;  11GS A;  2VL3 A;  2IFQ B;  4GXZ A;  2H1B A;  4LMW A;  4POM A;  4YKG A;  2ZNM A;  3LOR A;  4YQM A;  1U87 A;  2QKE A;  1Y25 A;  4ZBD A;  3TDG A;  3H8Q A;  3TJG A;  3UAR A;  2H66 A;  2JZT A;  5ECK B;  4G10 A;  2LUS A;  4E8H A;  3DWV A;  4EIP A;  1USB A;  3A2X A;  2C4J A;  3UVT A;  4X4J A;  2A2P A;  3WYW A;  4OMV A;  2R0P A;  2O85 A;  4QQ7 A;  4WXT A;  4EE0 A;  1ZYQ B;  2C80 A;  1B4P A;  4XS4 B;  2GQK A;  5CRD A;  3SWL A;  1TU8 A;  2LQQ A;  4FYU A;  1TRU A;  3BCI A;  2N5A A;  1GWC A;  2OJL A;  3Q18 A;  1MTC A;  1QFN A;  2FGX A;  4WF4 A;  4YQU A;  4PX1 A;  3W6G A;  4F9Z A;  4CDO A;  3F8U A;  4EL1 A;  3LWA A;  2C3T A;  4ZB6 A;  1PQN A;  1XBS A;  4DVC A;  2LS5 A;  2LJR A;  5IOW A;  7GSS A;  1M7T A;  2F51 A;  3UIW A;  1JZR A;  5GAP D;  2H72 A;  1GSY A;  6GST A;  3F63 A;  1ZYP A;  1SJI A;  3HZ4 A;  4ECJ A;  2NBS A;  5DAL B;  2H01 A;  4KDY A;  4WBR D;  3ERF A;  2CQ9 A;  2FD3 A;  3O3T A;  3CSH A;  4TOP A;  3QR6 A;  2LJK A;  3MWH A;  2VD1 A;  2AAW A;  1BJX A;  4MPF A;  3IK9 A;  1GTI A;  3L4N A;  3L9U A;  2M80 A;  5HR0 A;  3L9V A;  4HZ4 A;  5KOX A;  3QDN A;  2DJ0 A;  2XHF A;  1VF4 A;  1OC9 A;  3DXB A;  1TI3 A;  2WUL A;  3I69 A;  5A5K A;  2AYT A;  4EKZ A;  3GMF A;  2VLU A;  4V2N A;  5EVO A;  3EMP A;  1XFL A;  5H5Q A;  5DQS A;  2VCT A;  3IXR A;  5H5R A;  4POB A;  4AF2 A;  4XHM A;  2FWE A;  4IQ1 A;  2ON7 A;  1PL2 A;  4MNN A;  3QAG A;  2KHP A;  4PGT A;  2H70 A;  3MAK A;  4ZB9 A;  1SL1 B;  4K5S A;  1MDI A;  3GH6 A;  3PR8 A;  4LLR A;  3EC3 A;  2X8H A;  2HXK A;  13GS A;  1GSD A;  4NPB A;  1K3O A;  1V98 A;  2HT9 A;  4V2M A;  1X9M B;  1OE7 A;  3DVW A;  3HKR A;  4XTS A;  1EEM A;  5FHI A;  4P3Y B;  4Q5F A;  1CQH A;  4O5U A;  2FCH A;  3NZN A;  4ML1 A;  3CRT A;  3H79 A;  3KCM A;  1YJ6 A;  2R0C A;  5ID2 A;  4ICY A;  2JZR A;  1AAZ A;  1GTB A;  1F3B A;  1NM3 A;  1SKS B;  1A0R P;  2O8V B;  2GSQ A;  1PKZ A;  2MMN A;  1EP8 A;  2F9S A;  1PKW A;  2D2Z A;  2V1M A;  2V2G A;  5JCG A;  3HJP A;  1OYJ A;  1SKW B;  5J41 A;  4PQI A;  1SD8 A;  1XOA A;  2DSA A;  1DSB A;  4FQU A;  1DUG A;  1ZZY A;  1AQW A;  1YQ1 A;  1UN2 A;  2I3Y A;  4EF0 A;  3FMW A;  2CZ3 A;  2HRK A;  3TKS A;  1TP9 A;  3EE2 A;  4N0Z A;  4OFT A;  4K7I A;  1T1V A;  6GSY A;  5A4V A;  3PGT A;  2OAC A;  1DE2 A;  3BD2 A;  3D6I A;  1AIU A;  1OVN A;  3KD0 A;  1FAA A;  2V41 A;  3L0H A;  4I6X A;  3ZL5 A;  3QFB C;  1DBY A;  3ZML A;  1WPI A;  3M9K A;  4V1A g;  3ME8 A;  1EOG A;  2GST A;  4X43 A;  2LTK A;  2J9H A;  3ZTL A;  5KN0 A;  3S9F A;  4O5Q A;  3HCZ A;  4FIW A;  5KOW A;  4G19 A;  1OE8 A;  1EOH A;  1A8Y A;  1WRY A;  4BL7 A;  3WD6 A;  4N30 A;  4HI7 A;  1WJK A;  3FZ9 A;  5ENU A;  4WR5 A;  1SKR B;  2PN8 A;  4J2F A;  3G7J A;  5D9W A;  4OO4 A;  2YWO A;  4HQS A;  4O92 A;  1UA5 A;  2HLS A;  1NW2 A;  5H5S A;  3GRX A;  2XBQ A;  5HFI A;  3FZ4 A;  1V58 A;  4Q5Q A;  4FYB A;  2B5X A;  4PUA A;  3C7M A;  4BVY A;  1ZYE A;  2XPD A;  2VD0 A;  2GSS A;  3A5I A;  2YAN A;  3APS A;  1FB0 A;  5IO0 A;  3LYK A;  3P90 A;  3GL5 A;  4L8E A;  4POK A;  4TR1 A;  5D93 A;  1W4V A;  2DJK A;  2WZ9 A;  1SL2 B;  1PA3 A;  2X4A A;  3APO A;  2WCI A;  3IR4 A;  3TJJ A;  1B9Y C;  2PVO C;  2FA8 A;  4WR4 A;  4MF7 A;  2QGV A;  3PIN A;  4IHU A;  5GZZ B;  3IPZ A;  1KNG A;  4IN0 A;  1G7E A;  1HNB A;  2L6C A;  2IMK A;  5FT3 A;  1K0O A;  4IP1 A;  2H76 A;  5G31 A;  1TDI A;  5LNK e;  3TJF A;  5INY A;  2K18 A;  2YWN A;  3IC4 A;  1X9W B;  4PXO A;  1PMT A;  2IWT A;  3P2A A;  1M9A A;  2O89 A;  4ILF A;  1K0D A;  1GSF A;  4AJ8 A;  2OE0 A;  2XC2 A;  1WP0 A;  2GT5 A;  1O7U A;  5G5F A;  2YP6 A;  1U6T A;  3MNG A;  1V57 A;  1ST9 A;  1W89 A;  1O85 A;  5IMZ A;  5DCG A;  2G0F A;  2ES7 A;  3LGC A;  4TXV A;  2OE3 A;  1WMJ A;  16GS A;  4F03 A;  1XWB A;  2GS3 A;  3LG6 A;  3GH9 A;  4JZQ A;  3GX0 A;  4K7O A;  4MZB A;  2I4A A;  4JR4 A;  3TUE A;  1E2Y A;  1GTA A;  3TRQ A;  3RPP A;  3ZLP A;  2WFC A;  3UAP A;  1MEK A;  2YV9 A;  4PQH A;  3R2Q A;  1U3I A;  4MZW A;  3TOU A;  4HU9 A;  4K2X A;  4G0K A;  2CVK A;  1SYX A;  1EP7 A;  3GSS A;  2NTO A;  1HNA A;  4TKY A;  4Q5R A;  2RUF A;  3FY7 A;  2VIM A;  3LJR A;  1F3A A;  3QD9 A;  3DYR A;  3VFI A;  3EVI A;  5G5E A;  1JZO A;  1G7O A;  1YY7 A;  2N5B A;  2E0Q A;  2H1G A;  3DRN A;  1T00 A;  3UEM A;  5G30 A;  4PQ1 A;  4MMM A;  2HYX A;  5HR3 A;  4KA0 A;  3H4K A;  4BWQ A;  5GSS A;  2MYG A;  3DD3 A;  4NWY A;  4K5R A;  4KDU A;  4GF0 A;  1Z6N A;  4QL9 A;  2JL4 A;  1THX A;  3D22 A;  5ID2 B;  3ERW A;  4GLT A;  1SU9 A;  5E59 A;  1GNE A;  1SK0 A;  3KH7 A;  2LJA A;  4IQA A;  3ZVJ A;  2C0E A;  1EGO A;  4Q5N A;  1F2E A;  2AUV A;  3M9J A;  3KGK A;  4TN8 A;  3ZRE A;  1AUC A;  1GSS A;  5HR1 A;  4YAV A;  1SK1 A;  3ME7 A;  5CRW A;  2H73 A;  2X8G A;  3R3E A;  2P31 A;  3KMO A;  1V2A A;  2VUP A;  1IYI A;  1XZO A;  9GSS A;  3ZZX A;  2HRF A;  5G1L A;  3A3T A;  2H6Y A;  3FR6 A;  2R0G A;  2EC4 A;  2H8L A;  2LRC A;  2YZU A;  1QUW A;  4ZXG A;  1PN9 A;  3CRU A;  2J23 A;  3A2W A;  4O5R A;  3EMX A;  2GQM A;  3F3R A;  2GSR A;  4IKH A;  1FOH A;  2PER A;  4D73 A;  3QCP A;  5EPF A;  3FKF A;  1T4Y A;  2R5G A;  5IOX A;  2K6V A;  4F2I A;  4X1U A;  2GZP A;  1I9D A;  3IE3 A;  4HDE A;  4BL7 B;  5CRH A;  3L78 A;  2RLI A;  1T8E B;  2LRN A;  4MA9 A;  3FZ5 A;  3LEF A;  2YOI A;  3I43 A;  5D9V A;  3IA1 A;  2LV3 A;  2EIR A;  1IYH A;  2GZY A;  1KEB A;  1K3L A;  1E6B A;  3UVH A;  3HY2 A;  4ZB8 A;  2YWI A;  1PX7 A;  2XPE A;  4RI6 A;  3IRA A;  2DIY A;  5LCZ A;  3GKN A;  2G2Q A;  1J9B A;  2H0I A;  5F8B A;  4BVY B;  3QFA C;  2H74 A;  3IC8 A;  5D9T A;  2OKA A;  1OKT A;  3TRP A;  1M99 A;  2H6Z A;  1XVQ A;  4TR1 B;  5ECO B;  2PWJ A;  2H75 A;  2B7J A;  2I9H A;  1Q4J A;  3HA9 A;  4HUA A;  2MBS A;  2C0F A;  4V1A p;  4K0G A;  4MK3 A;  5JCU A;  5IMC A;  1OKD A;  5KN3 A;  4USS A;  4HQZ A;  4V2L A;  2HI7 A;  4KW6 A;  5DBQ A;  1XWG A;  2KLX A;  4NV2 A;  5CYY A;  4Z7X A;  4MPG A;  5IMF A;  2HSM A;  2BMX A;  12GS A;  2ON5 A;  3TKQ A;  2H0G A;  3MYD A;  1ERU A;  4GRF A;  2F8A A;  1PGT A;  4XS6 A;  3RBT A;  3KIJ A;  3ED3 A;  3C8E A;  1GRX A;  3NOF A;  3D4T A;  2I81 A;  1EWX A;  2NDO A;  1XIY A;  3VI5 A;  3G7Y A;  3DIE A;  1M2A A;  4POL A;  4RQX A;  5LD0 A;  4K8M A;  5DAK A;  17GS A;  4N10 A;  4J57 E;  1F9M A;  2CAQ A;  2CV4 A;  5DDL A;  3GKX A;  3M0F A;  3BJ5 A;  2DML A;  2HE3 A;  8GSS A;  1KTE A;  4PNG A;  2BJX A;  2MBT A;  4J56 E;  1A2L A;  1K3Y A;  2QA1 A;  4RUV A;  4EIQ A;  2YZH A;  2ZUP A;  3RPN A;  4LL4 B;  3G7I A;  4MH3 A;  3M1G A;  3TRX A;  1FOV A;  3E9J B;  2C8U A;  1BG5 A;  3LW9 A;  1Z5Y E;  2IJY A;  1BX9 A;  2X64 A;  4ECC A;  2A4H A;  1A0F A;  2VL9 A;  2B7K A;  3GIX A;  1GNW A;  1PSQ A;  2PBJ A;  2WS2 A;  1N8J A;  2C1Y A;  4NMU A;  1JLV A;  2KOK A;  5ECP B;  1V40 A;  3F4R A;  4ZL8 A;  1YEX A;  2DJJ A;  3NIV A;  3K8N A;  4KDX A;  3CMI A;  1OC8 A;  2C3Q A;  2B1K A;  4F82 A;  2F8F A;  1K0B A;  1BED A;  3GNJ A;  2CT6 A;  2RM5 A;  3F4T A;  2KP1 A;  4X0X A;  4F0C A;  4IGJ A;  4PTS A;  3EPT A;  1VRS D;  1RK4 A;  2ZCT A;  4AJ6 A;  3C1R A;  5IPG A;  3EU4 A;  1AQV A;  4MCU A;  2MMA A;  6GSS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...