5CP1A

Crystal structure of c239s mutant of a novel disulfide oxidoreductase from deinococcus radiodurans
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
245
structure length
245
Chain Sequence
LAPANSEKIRVDIWSDIACPWCYIGKRRFESALGQFPQRDQVEVVWHSFELDPSARPLNPIAMRDGLAMKYSISPAQAQGSLDHMTQTAAQEGLEYHFDRVKLANTFLAHQLIHYAAEQGQGDAMKERLLRAYMSEGQNVNDLDTLQKLAAEVGLDAGAARAALEAGTYAQAVRYDEAQAQQLGITGVPFFVLGGKYGVSGAQAPETLLGALSQVWAEQHPAPLTMLGQDAPAEGSEDGQCAVPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords FrnE protein
publication title Crystal structure of a novel disulfide oxidoreductase from Deinococcus radiodurans
rcsb
source organism Deinococcus radiodurans (strain atcc 13939 / dsm 20539 / jcm 16871 / lmg 4051 /
total genus 85
structure length 245
sequence length 245
ec nomenclature
pdb deposition date 2015-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01323 DSBA DSBA-like thioredoxin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5cp1A00
3TB2A 2CVKA 6GSUA 4OFMA 1GSDA 1VRSD 3RPPA 1GUHA 2H72A 3HKRA 5J9CA 1T4YA 4RI6A 2B3SA 1JZDA 3ME7A 1VF4A 3BCKA 1SL1B 4GCIA 3GA4A 1X0RA 2FHEA 1JLWA 5HR3A 4BPYA 2R37A 3VLNA 5ECHB 4TR4A 1PA3A 4FO5A 1XIYA 4KCEA 1TKDB 2B7KA 4BWSA 1XFLA 3G7IA 1GTAA 3VI7A 2V41A 3EE2A 1LBKA 3JCML 1WJKA 1C72A 3OR5A 3M9KA 1PD21 3QFAC 1M2AA 4J57E 2IPAA 4PUAA 5ENUA 5GAPD 3HHVA 4TOPA 1G7OA 1E2YA 3TKQA 2CAQA 4RUVA 2QSIA 3HVXA 3M3MA 4ZL9A 2C80A 2C0FA 4ML1A 3CTFA 1TOFA 3ZZXA 5CRWA 3H79A 2E2GA 4TR1B 4I6XA 5IM9A 1U88A 5HQPA 2GZZA 4KCAA 1UA5A 3ZREA 3L9UA 5G5FA 3GKMA 3KP8A 2AJQB 5DALB 3H1NA 2GVPA 4V2MA 4V2LA 1I5GA 2C0EA 3VWUA 4K9ZA 2GSQA 3KGKA 4DSQA 2LUSA 3Q18A 2ZNMA 5J5NA 4WR4A 3KH7A 6GSSA 2MYGA 4IJIA 4KDUA 4K7OA 1KBNA 1J08A 5B8AA 3LQ7A 1ILOA 4FH8A 5DVBA 3EMPA 1Q98A 1EOGA 1WIKA 5G5EA 3J7Yb 3PH9A 4ZXGA 3WGEA 2R4VA 2HYXA 3IXRA 4KE3A 2RUEA 3ZVJD 2YJ7A 5JCGA 3VI5A 2P31A 4ZIJA 4IP6A 4OCEA 1GTIA 2YN1A 3RHCA 2YWOA 4K1FA 4YAPA 2LS5A 2VO4A 4MZWA 3F4SA 3P8WA 2YANA 4MPGA 2WJUA 1ZL9A 1TU7A 1U3AA 2MMZA 3N5OA 6GSYA 3EU4A 10GSA 4J56E 5IPGA 3LJRA 5FHIA 3BD2A 5LNKe 5CRGA 1AQVA 3E9JB 5FT3A 3BOAA 3HDCA 1S3CA 3GNJA 5AN1A 1AQXA 2Z9SA 2B5EA 5ECOB 2PVOC 2DIZA 1GULA 1PSQA 2OKAA 2B1LA 2OBKA 4YQMA 3DGQA 4I2UA 3FK8A 2BJXA 4LMWA 1OC8A 2C0GA 4AJ8A 4KH7A 2TRCP 2YCDA 5DCGA 4GXZA 3GH6A 1ERVA 3GX8A 2IFQA 1XW6A 1SJZA 1FB6A 2DJKA 5DDLA 1OC3A 3FZ4A 1TW9A 3KMNA 1GNWA 1OAZA 3FR3A 2FWGA 2RM6A 2REMA 2PN8A 1N8JA 2K6VA 4ILFA 4MH2A 3D4TA 5JCUA 4EF0A 1U3IA 1XWBA 4KGIA 3TKSC 2KOKA 1O73A 4OFTA 2HLSA 2VUPA 3PINA 2PPTA 4F03A 3DVWA 3TOTA 4MA9A 2ZCTA 1QMVA 5F06A 4KW6A 3PGTA 6GSVA 3CTGA 3LORA 1TK5B 2H0HA 3FZAA 5ECQB 1M7TA 3ZFBA 3ME8A 4F9ZA 2H71A 2XBQA 18GSA 1A2MA 4NHZA 1B9YC 2LNTA 4IGJA 5ABRA 2RIIA 3UARA 4DSSA 3IV4A 4RQRA 2IN3A 3FEUA 3GKKA 1PGTA 1QFNA 1AAZA 1GSUA 5KN1A 1SU9A 2N5FA 5E59A 2JZRA 1WPIA 2VLTA 2OADA 2C0DA 2XPEA 4L0UA 1AW9A 5LD0A 1TK0B 1K3LA 1SD8A 2NBSA 1MD3A 3IDVA 3TGZA 3IC4A 2XC2A 1MTCA 3Q19A 4FYCA 2GQLA 4WBRD 3I69A 4D73A 2FWHA 4XRDA 3IRAA 3F0IA 3GKNA 2HXKA 2VM2A 3DVXA 4OMVA 5IMAA 1WP0A 1XWCA 4G19A 3DKSA 3VURA 14GSA 4JE1A 1T00A 1H4OA 2IMDA 2H74A 4EC0A 1X5EA 4ZBBA 1MDJA 1THXA 2I3YA 3GH9A 3FYGA 2K8SA 4HQSA 4K2DA 2IMFA 4EVMA 1YQ1A 4TVEA 4I97A 2CAIA 4TXOA 2HSYA 5LCZA 1GLQA 1TU8A 2PWJA 5IMFA 3M0FA 2DJ2A 4IN0A 3FR6A 4K6XA 12GSA 2OE1A 2C4JA 1GSFA 3GL5A 3CSIA 2NTOA 3TJBA 1PX7A 4J2FA 4OWYA 2WULA 4EKZA 2B6MA 4ZL8A 4FYUA 2X8HA 2C3NA 5DJLA 4PQIA 1MEKA 2KP2A 3U6VA 1T3BA 5INYA 5IQYA 3DMLA 2MMOA 2OA7A 2WDUA 1O8XA 1BAYA 4IBPA 4N0VA 4YQUA 4EE0A 4JR4A 5C00A 4NXIA 4MABA 2JSYA 2LQQA 3UVTA 1EZKA 5KEJA 1PMTA 5E4WA 4GQFA 3KM6A 3IAS2 4IP1A 3UIWA 1OKTA 4K7IA 1EOHA 2HSHA 4H86A 3HD5A 4EDYA 1K0BA 2JU5A 3ZLPA 3CBUA 5B7CA 4WBJA 5DQSA 1Z9HA 4V1Ap 2HZEA 3HVVA 2LSTA 3ZVJA 1NHYA 1YF0A 2EIOA 1K0AA 3P2AA 4V1Ag 1GL8A 1TRVA 4TN8A 3TKPA 1FAAA 1G6WA 1JZWA 1V57A 1XWGA 1GTBA 1T8EB 2WS2A 2FNOA 4NWYA 4OO5A 1XPVA 3WT1A 1XW5A 2GZPA 1S3DA 5HR2A 2OBIA 3DD3A 5IMCA 1V2AA 1K0CA 2RLIA 2O85A 3IE3A 5EL8A 1YEXA 3FZ5A 3QAWA 3NIVA 2ON7A 4MJCA 1AC1A 2L6DA 1X9MB 1X5DA 4HDEA 2H0IA 2H19A 1CQHA 3KXOA 4POKA 3V1WA 2C1YA 1G7EA 4HU7A 2ES7A 4CHSA 3L0HA 2P5QA 4RQXA 1I9DA 2CVBA 1NM3A 3PR8A 2IMEA 4CDOA 1ACVA 1A8YA 1ZYEA 3LG6A 5ECNB 1FW1A 2JADA 4HI7A 4BA7A 3FY7A 4TR3A 4TR1A 4QL9A 2HE3A 1SL2B 2X8CA 5CYYA 4BVXA 1Z3EA 4QL7A 3EURA 1A23A 1EV9A 2H6XA 1R5PA 5DALA 2LJKA 4KAEA 4AGSA 2FGXA 2H66A 4Z7XA 4Q5QA 2FD3A 1GSSA 4PNFA 2M46A 2AUVA 3MWHA 3Q74A 5D9TA 4NMUA 2H1BA 1PX6A 1ERUA 3TUEA 3ZFLA 1YKAA 4XIHA 2CA8A 1O81A 1TRUA 5EVOA 2L5LA 2A2SA 3GL3A 5DQYA 2H1GA 6GSWA 5G1LA 7GSSA 2GSRA 1XVQA 1BX9A 1Z6MA 2XHFA 4L5LA 5KN3A 1B9XC 2LRTA 3KIJA 3ZYWA 1N2AA 1O7UA 2F51A 3WYWA 4IKHA 1DSBA 2QC7A 2YV9A 1GLPA 1G0TA 4F0BA 5CREA 2YWIA 2TIRA 5GZZB 4XHMA 1HQOA 5CRDA 16GSA 4X0XA 4MK3A 3EYTA 3BCIA 4NHWA 1TP9A 1YF1A 3NOFA 4GWRA 2NVLA 1A2JA 3VK9A 3KEBA 1SKWB 1W4VA 2TRXA 2H1DA 3QOUA 5ECKB 1R4WA 5L71A 1UN2A 4NV2A 4XCSA 5IMVA 1F3AA 5G31A 3WT2A 1UC7A 2LJRA 1URMA 5AISA 1GP1A 3F4TA 3F63A 1B48A 4POMA 1NSWA 1TRWA 4K0NA 4WF5A 1DE1A 2KUCA 2LV3A 4POBA 3SBCA 4WF4A 1QQ2A 3F8UA 3CRUA 4G2EA 2LNSA 2FA4A 3C1RA 4PNGA 4L8EA 5B8BA 4MLYA 1Z5YE 2L57A 6GSXA 2V6OA 2YJHA 3I6AA 3QD9A 1K3OA 1XCCA 2RM5A 4PX1A 3TKRA 2DJJA 3IOSA 5DAKA 2DJ0A 5JWQB 2DC5A 5IOWA 1HNBA 3TKSE 4GQCA 4KSOA 3ISOA 2HT9A 3D5JA 1EP8A 3APOA 1FO5A 4QQ7A 4ECCA 2H6ZA 4HOJA 3QR6A 2ON5A 2XBIA 1OE8A 1GWCA 1OVNA 2IJYA 1O6JA 3FRCA 3G7YA 2DJ1A 2DLXA 1JZRA 1SK1A 2PMTA 1TRSA 1ZZYA 1H75A 2R5GA 5DBQA 1YKCA 3M9JA 4KB3A 1U87A 3GFKA 2C3QA 1K0NA 3IAM2 1JZOA 2VLVA 3HXSA 3HJPA 2VCQA 4XRAA 3IHQA 3KJYA 4F82A 2LRCA 2X64A 4KDYA 5ELAA 3DEXA 5ID2A 2MMNA 2VD0A 5ECIB 2H8LA 3KCMA 2VL3A 1AIUA 5CP1A 5A5KA 1K3YA 1J0FA 1V40A 3RPNA 3GURA 3L9VA 3A2VA 3BBYA 1M2BA 4O92A 4XS6A 4GSNA 5J9BA 3LYKA 2GLRA 3TJKA 5H5RA 4N10A 2FA8A 4JU5A 5H5SA 1SYRA 5D9WA 1YDKA 3GRXA 1K0OA 3LGCA 2O87A 3GIXA 1TI3A 1ERTA 3HJMA 2CT6A 5KN2A 2WZ9A 1M9BA 5B6NA 4HEA2 4V2NA 3HYPA 4N30A 4NAXA 2H76A 3KTLA 2CQ9A 2K9FA 4WXTA 3GSTA 5D93A 2YP6A 3C7MA 5D73A 5IOXA 3KZQA 4MMMA 4MF7A 2FWEA 3HCZA 2H75A 5HFIA 1GUKA 1WMJA 4KX4A 2H0GA 1ABAA 1CQGA 5J4UA 1XVWA 2WCIA 3QDNA 1XWAA 1IYHA 1A8LA 4DSRA 4ZB6A 1GUMA 2FY6A 3GV1A 1S3AA 2KP1A 1RW1A 3CSJA 4L5OA 5JWOB 2CX3A 1WWJA 1MD4A 4AJ7A 1ZMAA 5GSTA 1EEMA 1FOVA 4E8EA 3FW2A 3MSZA 5CNWA 4IHUA 3S9FA 1ZYQB 1XOAA 1OKDA 1F6MC 2H70A 5GAND 2HI7A 1A0FA 4YH2A 2EIRA 3WGDA 4IELA 3D22A 5FWGA 1PRXA 3QMXA 3MNGA 2HNLA 1PQNA 1FG4A 3IBHA 3L78A 1MDKA 1X5CA 4WR5A 1QUWA 1FB0A 13GSA 1UVZA 1GH2A 1RK4A 3ERFA 1T4ZA 3U5RE 2C3TA 4G10A 4E8HA 2JACA 1WRYA 1XBSA 2V1MA 3F6DA 4KA0A 4ZBDA 2VCWA 2DMMA 2VOCA 4I8BA 1J9BA 2V6KA 2YZHA 4IS0A 2OE3A 1WOUA 4DEJA 1E6BA 4LMVA 2D2ZA 2VD1A 3LEFA 1T7PB 1TXXA 1ON4A 2PERA 1AUCA 4D73B 3C8EA 2LJAA 5HR0A 2GGTA 4IQAA 2AYTA 3DXBA 8GSSA 1WE0A 2B5YA 3HZ8A 3P90A 3GTUB 3O6TA 2FLSA 4TKYA 4OCFA 4EO3A 2OACA 3H8QA 5J41A 1X9WB 4JRRA 1OYJA 1EGRA 3APSA 1YEPA 3O76A 1B4QA 1THOA 3IR4A 1PKZA 11GSA 4EDZA 2R2JA 4HU9A 4AF2A 3WGXA 4PUFC 2YWMA 3LWAA 3E3EA 5IPHA 4MZCA 1B8XA 2V32A 5ECMB 1SK2A 1M9AA 1O8WA 3TRPA 3ZMKA 4ECJA 3RBTA 3P7XA 2L4QA 4AJ6A 2HFDA 2CX4A 2L4CA 5AIVA 3CYNA 3EC3A 1SKSB 1B4PA 3F9UA 2H1AA 5HFGA 5DJMA 1EGOA 2YWNA 2LTKA 1KNGA 4ID0A 2FCHA 1Z7PA 3HZ4A 4MZBA 2YNXA 1T1VA 2GT5A 3FZ9A 4XTSA 3VPTA 3TDGA 2VAFA 3D21A 4I2TA 2GSSA 5KN0A 1MDIA 1XWKA 2H73A 4MP4A 2MZCA 2L6CA 4IJ3A 3ZMLA 4EUYA 1YJ6A 4TR0A 3VFIA 2R3XA 4OFNA 1GRXA 2AV4A 1ERWA 2HZEB 1F9MA 2M72A 3EU3A 3F4RA 3QFBC 4JBBA 3GX0A 2BTOT 1ZCPA 1DUGA 3F3QA 2A2RA 3G9BA 2J23A 3LYPA 1VGLA 4KSMA 4MF5A 5A4UA 4ZB9A 3DRNA 1XXUA 5F0GA 2F8AA 2VM1A 22GSA 3UJ1A 1O85A 4TRXA 1G6YA 2IWTA 1PKWA 4XS4B 1V58A 2X99A 4MJAA 1W89A 5C04A 1PL2A 3IPZA 2M80A 5J3RA 4BVYA 4O7HA 3MAKA 3DYRA 1GSQA 4NPBA 4PQ1A 5DCHA 1ML6A 3EWLA 4PXOA 3D4MA 1GSEA 1OC9B 3CXGA 3H93A 4OO4A 3TOUA 4ZILA 5F07A 2PUKC 3TCOA 2PBJA 2CZ2A 1FVKA 2CVDA 19GSA 2WB9A 4O32A 2GTUA 4MCUA 1VF2A 2H30A 3VWXA 4WEYA 5CAXA 5JCWA 1HYUA 3LSZA 4JR6A 2EC4A 3R2QA 3ERWA 2PU9C 2CV4A 1A0RP 3KP9A 4MF6A 4ISDA 2P0GA 2BMXA 4MPFA 2DJ3A 1HD2A 1NW2A 3G7JA 1AQWA 1X9SB 4IQ1A 1SENA 3FHKA 4KNDA 2B1KA 2DBCA 2B7JA 1OE7A 1ZGNA 4IVFA 3LFLA 3O3TA 2VL9A 2AAWA 2JL4A 2PVQA 2R6KA 5IMZA 1KEBA 4PGTA 4GSTA 5JWRB 3TJJA 1YZXA 3TJGA 4PURA 2VL2A 3EVIA 5F05A 1KTEA 3HJOA 6GSTA 4JEDA 1XOBA 1Y6EA 4ML6A 1FHEA 4WKWA 2E2MA 4ZBAA 3CMIA 4O5RA 5D9XA 4LL4B 3ERGA 3FR9A 3ZIJA 5IO0A 2YV7A 4OD7A 1TK8B 2VCTA 2GS3A 1HNCA 4YQVA 1F2EA 5ECPB 4PQHA 4RI7A 4GF0A 1VF3A 3IK7A 3CSHA 5G1KA 2MBSA 1QXHA 1DE2A 3GN3A 2N5AA 2KHPA 2MBTA 4MJBA 4I5QA 3UBKA 4ZL7A 1EWXA 3ZTLA 4BWQA 1M99A 2FUG2 5G30A 2LKUA 5CRHA 5D8IA 2LRNA 4FIWA 1EEJA 4NV5A 5B6MA 2I9HA 2ALBA 3J7Yk 3C1SA 1ZOFA 3KMOA 4JZQA 4Q5NA 2KLXA 1V98A 4MDCA 2NPBA 4Q5RA 2CZ3A 3KH9A 3QAVA 3BJ5A 3QAGA 1TDIA 1V9WA 4X1UA 3H4KA 9GSSA 2WFCA 1ST9A 3M1GA 1VF1A 3NZNA 4LLRA 5ECRB 3I43A 3A5WA 4FYBA 1Q4JA 4P3YB 3I9V2 3F6FA 4CW9A 2F8FA 2VCZA 2C8UA 4HJMA 5GSSA 2HZFA 5DAKB 3DIEA 3ED3A 3D6IA 2I81A 1SJ6A 3ZIVA 4TW5A 3VWVA 3GYKA 2K8VA 1TJDA 3AY8A 3F3RA 3ZITA 1BJXA 4L0WA 5COHA 2E0QA 1TI1A 2IL3A 1RQMA 3IA1A 4DVCA 1LJRA 2I1UA 2OJLA 5CO3A 3UOMA 4GSSA 4GLTA 2IMKA 17GSA 1M0UA 2VCVA 2MMAA 20GSA 1PL1A 2B5XA 5IMDA 4G9HA 3UBLA 1YY7A 2E7PA 1M2DA 3TRXA 3MDKA 4HS1A 2IFQB 3A2XA 2L59A 3HY2A 5ID2B 2G0FA 1F37A 1Y25A 1SYXA 2H01A 3APQA 1U6TA 4ULXA 3UL3A 2V2GA 3E0UA 1JFUA 2VCXA 4KUNA 1BG5A 3L9SA 3UMAA 1BEDA 1DBYA 1R5AA 3SWLA 1BQ7A 3LXTA 2LEGA 2P5RA 3TJFA 1BYEA 2HRNA 3GKXA 2F3MA 2X8GA 3VPQA 3GTUA 1EP7A 1QK8A 4XS1A 4ECIA 2VL2C 5A4VA 2IMIA 1GTUA 3LXZA 3UEMA 1AXDA 3CRTA 3UAPA 3GSSA 4DSSB 1JLVA 5AIXA 1SKRB 3WD6A 3UVHA 1NHOA 3C73A 4WETA 3EMXA 2O89A 1SJIA 1LU4A 2DSAA 1XZOA 2ZUPA 2JZSA 1HNAA 2AHEA 3QCPA 2VLUA 5IO2A 3Q6OA 2NDOA 3D0ZA 3RHBA 2GZYA 3A3TA 4HUAA 4BL7A 3W8JA 3EINA 3K8NA 2VIMA 2QGVA 4K7NA 1SL0B 1R7HA 3GUSA 2GDRA 4GRFA 2PGTA 2DIYA 3US3A 2GT6A 4MJEA 2RUFA 5D96A 1F3BA 3A2WA 5ELGA 4KDXA 1A2LA 1TTZA 4X43A 2N5BA 5HR1A 4HJ2A 5IIZA 4HZ4A 2J9HA 5F8BA 4LA1A 4F0CA 3HA9A 2WRTA 3IK9A 4K8MA 2JSZA 5HFKA 1GSYA 3N9JA 3VWWA 2OE0A 4TXOB 3W6GA 5EY6A 2G2QA 1R26A 2AB6A 2YPMA 4F2IA 4ACSA 4HQZA 4LL1B 3GHAA 1EV4A 1JHBA 3ZL5A 5EPFA 2O8VB 4YAVA 3RAZA 2FWFA 4GTUA 5G2ZA 1SK0A 2K18A 4K0GA 2I4AA 4ECBA 4EL1A 1XW9A 2HRFA 3L4NA 2GSTA 1USBA 2GQMA 1PN9A 2H6YA 4N0ZA 2LQOA 4XS4A 1GNEA 2JZTA 4ZB8A 4TXVA 2GQKA 5ECSA 5H5QA 1Z7RA 5A4WA 4POLA 3HVSA 1A24A 3ZRDA 3DWVA 5AGYA 2F9SA 3C71A 1OC9A 3KD0A 4MH3A 2YOIA 3QPMA 4EXJA 3KTBA 3W8SA 1SD9A 1IYIA 1K0DA 1QGVA 5ECLB 4Q5FA 1Z6NA 2EIQA 3FKFA 2A4VA 2O7KA 4N11A 4IW9A 2WGRA 2IIYA 2DMLA 1FVJA 2L5OA 2YZUA 3RDWA 1K0MA 3TRQA 4HZ2A 3TKSA 2QKEA 2XPDA 3GMFA 5D9VA 3M8NA
chains in the Genus database with same CATH superfamily
3TB2A 2CVKA 6GSUA 4OFMA 1GSDA 1VRSD 3RPPA 1GUHA 2H72A 3HKRA 5J9CA 1T4YA 4RI6A 2B3SA 1JZDA 3ME7A 1VF4A 3BCKA 1SL1B 4GCIA 3GA4A 1X0RA 2FHEA 1JLWA 5HR3A 4BPYA 2R37A 3VLNA 5ECHB 4TR4A 1PA3A 4FO5A 1XIYA 4KCEA 1TKDB 2B7KA 4BWSA 1XFLA 3G7IA 1GTAA 3VI7A 2V41A 3EE2A 1LBKA 3JCML 1WJKA 1C72A 3OR5A 3M9KA 1PD21 3QFAC 1M2AA 4J57E 2IPAA 4PUAA 5ENUA 5GAPD 3HHVA 4TOPA 1G7OA 1E2YA 3TKQA 2CAQA 4RUVA 2QSIA 3HVXA 3M3MA 4ZL9A 2C80A 2C0FA 4ML1A 3CTFA 1TOFA 3ZZXA 5CRWA 3H79A 2E2GA 4TR1B 4I6XA 5IM9A 1U88A 5HQPA 2GZZA 4KCAA 1UA5A 3ZREA 4BVXB 3L9UA 5G5FA 3GKMA 3KP8A 2AJQB 5DALB 3H1NA 2GVPA 4V2MA 4O5UA 4V2LA 1I5GA 2C0EA 3VWUA 4K9ZA 2GSQA 3KGKA 4DSQA 2LUSA 3Q18A 2ZNMA 5J5NA 4WR4A 3KH7A 6GSSA 2MYGA 3MYDA 4IJIA 4KDUA 4K7OA 1KBNA 1J08A 5B8AA 3LQ7A 1ILOA 4FH8A 5DVBA 3EMPA 1Q98A 1EOGA 1WIKA 5G5EA 3J7Yb 3PH9A 4ZXGA 3WGEA 2R4VA 2HYXA 3IXRA 4KE3A 2RUEA 3ZVJD 2YJ7A 2DKIA 5JCGA 3VI5A 2P31A 4Z2UA 4ZIJA 4IP6A 4OCEA 1GTIA 2YN1A 3RHCA 2YWOA 4K1FA 4YAPA 2LS5A 2VO4A 4MZWA 3F4SA 3P8WA 2YANA 4MPGA 2WJUA 1ZL9A 1TU7A 1U3AA 2MMZA 3N5OA 6GSYA 3EU4A 10GSA 4J56E 5IPGA 3LJRA 5FHIA 3BD2A 5LNKe 5CRGA 2HSMA 1AQVA 3E9JB 5FT3A 3BOAA 3HDCA 3IHGA 1S3CA 3GNJA 5AN1A 1AQXA 2Z9SA 2B5EA 5ECOB 2PVOC 2DIZA 1GULA 1PSQA 2OKAA 2B1LA 2OBKA 4YQMA 3DGQA 4I2UA 3FK8A 2BJXA 4LMWA 1OC8A 2C0GA 4AJ8A 4KH7A 2TRCP 2YCDA 5DCGA 4GXZA 3GH6A 1ERVA 3GX8A 2IFQA 1XW6A 1SJZA 1FB6A 2DJKA 1OC3A 3FZ4A 5DDLA 1TW9A 3KMNA 1GNWA 1OAZA 3FR3A 2FWGA 2RM6A 2HRAA 2REMA 2PN8A 1N8JA 2K6VA 4ILFA 4MH2A 3D4TA 5JCUA 1PFOA 4EF0A 1U3IA 1XWBA 4KGIA 3TKSC 2KOKA 1O73A 4OFTA 2HLSA 2VUPA 3PINA 2PPTA 4F03A 3DVWA 3TOTA 4MA9A 2ZCTA 1QMVA 5F06A 4KW6A 3PGTA 6GSVA 3CTGA 3LORA 1TK5B 2H0HA 3FZAA 5ECQB 1M7TA 3ZFBA 3ME8A 4F9ZA 2H71A 2UZ8A 2XBQA 18GSA 1A2MA 4NHZA 1B9YC 2LNTA 4IGJA 5ABRA 2RIIA 3UARA 4DSSA 3IV4A 4RQRA 2IN3A 3FEUA 3GKKA 4BIKA 1PGTA 1QFNA 1AAZA 1GSUA 5KN1A 1SU9A 2N5FA 5E59A 2JZRA 1WPIA 4YKGA 2VLTA 2OADA 2C0DA 2XPEA 4L0UA 4ICYA 1AW9A 4Z2TA 1PN0A 5LD0A 1TK0B 1K3LA 1SD8A 2NBSA 1MD3A 3IDVA 3TGZA 3IC4A 2XC2A 1MTCA 3Q19A 4FYCA 2GQLA 4WBRD 3I69A 4D73A 1FOHA 2FWHA 4XRDA 3IRAA 3F0IA 3GKNA 2HXKA 2VM2A 3DVXA 4OMVA 5IMAA 1WP0A 1XWCA 4G19A 3DKSA 3VURA 14GSA 4JE1A 1T00A 1H4OA 2IMDA 2H74A 4EC0A 1X5EA 4ZBBA 1MDJA 1THXA 2I3YA 3GH9A 3FYGA 2K8SA 4HQSA 4K2DA 2IMFA 4EVMA 1YQ1A 4TVEA 4I97A 2CAIA 4TXOA 2HSYA 5LCZA 1GLQA 1TU8A 2PWJA 5IMFA 4MNNA 3M0FA 2DJ2A 4IN0A 4YKFA 3FR6A 4K6XA 12GSA 2OE1A 2C4JA 1GSFA 3GL5A 3CSIA 2NTOA 3TJBA 1PX7A 4J2FA 4OWYA 2WULA 4EKZA 2B6MA 4ZL8A 4FYUA 2X8HA 4G0IA 2C3NA 5DJLA 4PQIA 1MEKA 2KP2A 3U6VA 1T3BA 2R0PA 5INYA 5IQYA 3DMLA 2MMOA 2OA7A 2WDUA 1O8XA 1BAYA 4IBPA 4N0VA 4YQUA 4EE0A 4JR4A 4G0KA 5C00A 4NXIA 4MABA 2JSYA 2LQQA 3UVTA 1EZKA 5KEJA 1PMTA 5E4WA 4GQFA 3KM6A 3IAS2 4IP1A 3UIWA 1OKTA 4K7IA 1EOHA 2HSHA 4H86A 3HD5A 4EDYA 1K0BA 2JU5A 3ZLPA 3CBUA 5B7CA 4WBJA 5DQSA 4FQUA 1Z9HA 4V1Ap 2HZEA 3HVVA 2LSTA 3ZVJA 1NHYA 2A4HA 1YF0A 2EIOA 1K0AA 3P2AA 4V1Ag 1GL8A 1TRVA 4TN8A 3TKPA 1FAAA 1G6WA 3R3EA 1JZWA 1V57A 1XWGA 5KOXA 1GTBA 1T8EB 2WS2A 4K5RA 2FNOA 4NWYA 4OO5A 1XPVA 3WT1A 1XW5A 2GZPA 1S3DA 5HR2A 2OBIA 3DD3A 5IMCA 1V2AA 1K0CA 2RLIA 2O85A 3IE3A 5EL8A 1YEXA 3FZ5A 3QAWA 3NIVA 2ON7A 4MJCA 1AC1A 2L6DA 1X9MB 1X5DA 4HDEA 2H0IA 2H19A 1CQHA 3KXOA 4POKA 3V1WA 2C1YA 1G7EA 4HU7A 2ES7A 4CHSA 3L0HA 2P5QA 4RQXA 1I9DA 2CVBA 1NM3A 3PR8A 2IMEA 4CDOA 1ACVA 1A8YA 1ZYEA 3LG6A 5ECNB 1FW1A 2JADA 4HI7A 4BA7A 1M3IA 3FY7A 4TR3A 4TR1A 4QL9A 2HE3A 1SL2B 2X8CA 5CYYA 4BVXA 1Z3EA 4QL7A 3EURA 1A23A 1EV9A 2H6XA 1R5PA 5DALA 2LJKA 4KAEA 4AGSA 2FGXA 2H66A 4Z7XA 4Q5QA 2FD3A 1GSSA 4PNFA 2M46A 2AUVA 3MWHA 3Q74A 5D9TA 4NMUA 2H1BA 1PX6A 4USSA 1ERUA 3TUEA 3ZFLA 1YKAA 4XIHA 2CA8A 1O81A 1TRUA 2L5LA 5DQYA 2A2SA 3GL3A 5EVOA 2H1GA 6GSWA 5G1LA 7GSSA 2GSRA 1XVQA 1BX9A 1Z6MA 2XHFA 4L5LA 5KN3A 1B9XC 2LRTA 3KIJA 3ZYWA 1N2AA 1O7UA 2F51A 3WYWA 4IKHA 1DSBA 2QC7A 2YV9A 1GLPA 1G0TA 4F0BA 2R0GA 5CREA 2YWIA 2TIRA 5GZZB 4XHMA 1HQOA 4K5SA 5CRDA 16GSA 4X0XA 4MK3A 3EYTA 3BCIA 4NHWA 1TP9A 1YF1A 3NOFA 4GWRA 2NVLA 1A2JA 3VK9A 3KEBA 1SKWB 1W4VA 2TRXA 2H1DA 3QOUA 5ECKB 1R4WA 5L71A 1UN2A 4NV2A 4XCSA 3PPUA 5IMVA 1F3AA 5G31A 3WT2A 1UC7A 2LJRA 1URMA 5AISA 1GP1A 3F4TA 3F63A 1B48A 4POMA 1NSWA 1TRWA 4K0NA 4WF5A 1DE1A 2KUCA 2LV3A 4POBA 3SBCA 4WF4A 1QQ2A 4EIPA 5BMUA 3F8UA 3CRUA 4G2EA 2LNSA 2FA4A 3C1RA 4PNGA 4L8EA 5B8BA 4MLYA 1Z5YE 2L57A 6GSXA 2V6OA 2YJHA 3I6AA 3QD9A 1K3OA 3A5IA 1XCCA 2RM5A 4PX1A 4BVYB 3TKRA 2DJJA 3IOSA 5DAKA 2DJ0A 5JWQB 2DC5A 5IOWA 1HNBA 3TKSE 4GQCA 4KSOA 3ISOA 2HT9A 3D5JA 1EP8A 3FMWA 3APOA 1FO5A 4QQ7A 4ECCA 2H6ZA 4HOJA 3QR6A 2ON5A 2XBIA 1OE8A 1GWCA 4CY6A 1OVNA 2IJYA 1O6JA 3FRCA 3G7YA 2DJ1A 2DLXA 1XG8A 1JZRA 1SK1A 2PMTA 1TRSA 2DKHA 1ZZYA 1H75A 2R5GA 5DBQA 1YKCA 3M9JA 4KB3A 1U87A 3GFKA 2C3QA 1K0NA 3IAM2 1JZOA 2VLVA 3HXSA 3HJPA 2VCQA 4XRAA 3IHQA 3KJYA 4F82A 2LRCA 2X64A 4KDYA 5ELAA 3DEXA 5ID2A 2MMNA 2VD0A 5ECIB 2H8LA 3KCMA 2VL3A 1AIUA 5CP1A 5A5KA 1K3YA 1J0FA 1V40A 3RPNA 3GURA 3L9VA 3A2VA 3BBYA 1M2BA 4O92A 4XS6A 4GSNA 5J9BA 3LYKA 2GLRA 3TJKA 5H5RA 4N10A 2FA8A 4JU5A 5H5SA 1SYRA 5D9WA 1YDKA 3GRXA 2QA2A 1K0OA 3LGCA 2O87A 3CQFA 1TI3A 3GIXA 1ERTA 3HJMA 2CT6A 5KN2A 2WZ9A 1M9BA 5B6NA 4HEA2 4V2NA 3HYPA 4N30A 4NAXA 2H76A 3KTLA 2CQ9A 4PTSA 2K9FA 4WXTA 3GSTA 5D93A 2YP6A 3C7MA 5D73A 5IOXA 3KZQA 4MMMA 4MF7A 2FWEA 3HCZA 2H75A 5HFIA 1GUKA 1WMJA 4KX4A 2H0GA 1ABAA 1CQGA 5J4UA 1XVWA 2WCIA 3QDNA 1XWAA 3MIXA 1IYHA 1A8LA 4DSRA 4ZB6A 1GUMA 2FY6A 3GV1A 1S3AA 2KP1A 1RW1A 3CSJA 4L5OA 5JWOB 2CX3A 1WWJA 1MD4A 4AJ7A 1ZMAA 5GSTA 1EEMA 1FOVA 4E8EA 3FW2A 3MSZA 5CNWA 4IHUA 3S9FA 1ZYQB 1XOAA 1OKDA 1F6MC 2H70A 5GAND 2HI7A 1A0FA 4YH2A 2EIRA 3WGDA 4IELA 3D22A 5FWGA 1PRXA 3QMXA 3MNGA 2HNLA 1PQNA 1FG4A 3IBHA 3L78A 1MDKA 1X5CA 4WR5A 1QUWA 1FB0A 13GSA 1UVZA 1GH2A 1RK4A 3ERFA 1T4ZA 3U5RE 2C3TA 2X4AA 4G10A 4E8HA 2JACA 1WRYA 1XBSA 2V1MA 3F6DA 4KA0A 4ZBDA 2VCWA 2DMMA 2VOCA 4I8BA 1J9BA 2V6KA 2YZHA 4IS0A 2OE3A 1WOUA 4DEJA 4G0LA 1E6BA 4LMVA 2D2ZA 2VD1A 3LEFA 1T7PB 1TXXA 1ON4A 2PERA 1AUCA 4D73B 3C8EA 2LJAA 5HR0A 2GGTA 4IQAA 2AYTA 3DXBA 8GSSA 1WE0A 2B5YA 3HZ8A 3P90A 3GTUB 3O6TA 2FLSA 4TKYA 4OCFA 4EO3A 2OACA 3H8QA 5J41A 1X9WB 4JRRA 1OYJA 1EGRA 3APSA 1YEPA 3O76A 1B4QA 1THOA 3IR4A 1PKZA 11GSA 4EDZA 2R2JA 4HU9A 4AF2A 3WGXA 4PUFC 2YWMA 3LWAA 3E3EA 5IPHA 4MZCA 1B8XA 2V32A 5ECMB 1SK2A 1M9AA 1O8WA 3TRPA 3ZMKA 4ECJA 3RBTA 3P7XA 2L4QA 4AJ6A 2HFDA 2CX4A 2L4CA 4K2XA 5AIVA 3CYNA 3EC3A 1SKSB 1B4PA 3F9UA 2H1AA 5HFGA 5DJMA 4BL7B 1EGOA 2YWNA 2LTKA 1KNGA 4ID0A 2FCHA 1Z7PA 3HZ4A 4MZBA 2YNXA 1T1VA 2GT5A 3FZ9A 4XTSA 3VPTA 3TDGA 2VAFA 3D21A 4I2TA 2GSSA 5KN0A 1MDIA 1XWKA 2H73A 4MP4A 2MZCA 2L6CA 4IJ3A 3ZMLA 4EUYA 1YJ6A 4TR0A 4Z2RA 3VFIA 2R3XA 4OFNA 1GRXA 2AV4A 1ERWA 2HZEB 1F9MA 2M72A 3EU3A 3F4RA 3QFBC 4JBBA 3GX0A 2BTOT 1ZCPA 1DUGA 3F3QA 2X49A 4X4JA 2A2RA 3G9BA 2J23A 3LYPA 1VGLA 4KSMA 4MF5A 5A4UA 4ZB9A 3DRNA 1XXUA 5F0GA 2F8AA 2VM1A 22GSA 3UJ1A 3IC8A 1O85A 4TRXA 1G6YA 2IWTA 1PKWA 4XS4B 1V58A 2X99A 4MJAA 1W89A 5C04A 1PL2A 3IPZA 2M80A 5J3RA 4BVYA 4O7HA 3MAKA 3DYRA 1GSQA 4NPBA 4PQ1A 5DCHA 1ML6A 3EWLA 4PXOA 3D4MA 1GSEA 1OC9B 3CXGA 3H93A 4OO4A 3TOUA 4ZILA 5F07A 2PUKC 3TCOA 2PBJA 2CZ2A 1FVKA 2CVDA 19GSA 2WB9A 4O32A 2GTUA 4MCUA 1VF2A 2H30A 3VWXA 4WEYA 5CAXA 5JCWA 1HYUA 3LSZA 4JR6A 2EC4A 3R2QA 3ERWA 2PU9C 2CV4A 1A0RP 3KP9A 4MF6A 4ISDA 2P0GA 2BMXA 4MPFA 2DJ3A 1HD2A 1NW2A 3G7JA 1AQWA 1X9SB 4IQ1A 1SENA 3FHKA 4KNDA 2B1KA 2DBCA 2B7JA 1OE7A 1ZGNA 4IVFA 3LFLA 3O3TA 2VL9A 2AAWA 2JL4A 2PVQA 2R6KA 5IMZA 1KEBA 4PGTA 4GSTA 5JWRB 3TJJA 1YZXA 3TJGA 4PURA 2VL2A 3EVIA 5F05A 1KTEA 3HJOA 6GSTA 4JEDA 1XOBA 1Y6EA 4ML6A 1FHEA 4WKWA 2E2MA 4ZBAA 3CMIA 4O5RA 5D9XA 4LL4B 3ERGA 3FR9A 3ZIJA 4O5QA 5IO0A 2YV7A 4OD7A 1TK8B 2VCTA 2GS3A 1HNCA 4YQVA 1F2EA 5ECPB 4PQHA 4RI7A 4GF0A 1VF3A 3IK7A 3CSHA 5G1KA 2MBSA 1QXHA 1DE2A 3GN3A 2N5AA 2KHPA 2MBTA 4MJBA 4I5QA 3UBKA 4ZL7A 1EWXA 3ZTLA 4BWQA 1M99A 2FUG2 5G30A 2LKUA 5CRHA 5D8IA 2LRNA 4FIWA 1EEJA 4NV5A 5B6MA 2I9HA 2ALBA 1M3JA 3J7Yk 3C1SA 1ZOFA 3KMOA 4JZQA 4Q5NA 2KLXA 1V98A 4MDCA 2NPBA 4Q5RA 2CZ3A 3KH9A 3QAVA 1ZYNA 3BJ5A 5KOWA 3QAGA 1TDIA 1V9WA 4X1UA 3H4KA 9GSSA 2WFCA 1ST9A 4KF9A 3M1GA 1VF1A 3NZNA 4LLRA 5ECRB 3I43A 3A5WA 5BRTA 4FYBA 1Q4JA 4P3YB 3I9V2 3F6FA 4CW9A 4CY8A 2F8FA 2VCZA 2C8UA 4HJMA 5GSSA 2HZFA 5DAKB 2HRKA 3DIEA 3ED3A 3D6IA 2I81A 1SJ6A 3ZIVA 4TW5A 3VWVA 3GYKA 2K8VA 1TJDA 3AY8A 3F3RA 3ZITA 1BJXA 4L0WA 5COHA 2E0QA 1TI1A 2IL3A 1RQMA 3IA1A 4DVCA 1LJRA 4EIQA 2I1UA 2OJLA 5CO3A 3UOMA 4GSSA 4GLTA 2IMKA 17GSA 1M0UA 2VCVA 2MMAA 20GSA 1PL1A 2A2PA 2B5XA 2QA1A 4G9HA 5IMDA 3UBLA 1YY7A 2E7PA 1M2DA 3TRXA 3MDKA 4HS1A 2IFQB 3A2XA 2L59A 3HY2A 5ID2B 2G0FA 1F37A 1Y25A 1SYXA 2H01A 3APQA 1U6TA 4HSCX 4ULXA 3UL3A 2V2GA 3E0UA 1JFUA 2VCXA 4KUNA 1BG5A 3L9SA 3UMAA 1BEDA 1DBYA 1R5AA 3SWLA 1BQ7A 3LXTA 2LEGA 2P5RA 3TJFA 1S3RA 1BYEA 2HRNA 3GKXA 2F3MA 2X8GA 3VPQA 3GTUA 3HVNA 1EP7A 1QK8A 4XS1A 4ECIA 2VL2C 5A4VA 2IMIA 1GTUA 3LXZA 3UEMA 1AXDA 3CRTA 3UAPA 3GSSA 4DSSB 1JLVA 5AIXA 2R0CA 1SKRB 3WD6A 3UVHA 1NHOA 3C73A 4WETA 3EMXA 2O89A 1SJIA 1LU4A 2DSAA 1XZOA 2ZUPA 2JZSA 1HNAA 2AHEA 3LW9A 3QCPA 2VLUA 5IO2A 3EPTA 3Q6OA 2NDOA 3D0ZA 3RHBA 2GZYA 3A3TA 4HUAA 4BL7A 3W8JA 3EINA 3K8NA 2VIMA 2QGVA 4K7NA 1SL0B 1R7HA 3GUSA 2GDRA 1ZYPA 4GRFA 2PGTA 2DIYA 3US3A 2GT6A 4MJEA 2RUFA 5D96A 1F3BA 3A2WA 5ELGA 4KDXA 1A2LA 1TTZA 4X43A 2N5BA 5HR1A 4HJ2A 5IIZA 4HZ4A 4A5PA 2J9HA 5F8BA 4LA1A 4F0CA 3HA9A 2WRTA 3IK9A 4K8MA 2JSZA 5HFKA 1GSYA 3N9JA 3VWWA 2OE0A 4TXOB 3W6GA 5EY6A 2G2QA 1R26A 2AB6A 2YPMA 4F2IA 4ACSA 4HQZA 4LL1B 3GHAA 1EV4A 1JHBA 3ZL5A 5EPFA 2O8VB 4YAVA 3RAZA 2FWFA 4GTUA 5G2ZA 1SK0A 2K18A 4K0GA 2I4AA 4ECBA 4EL1A 1XW9A 2HRFA 3L4NA 2GSTA 1USBA 2GQMA 1PN9A 2H6YA 4N0ZA 2LQOA 4XS4A 1GNEA 2JZTA 4ZB8A 4TXVA 2GQKA 5ECSA 5H5QA 1Z7RA 5A4WA 4POLA 3HVSA 1A24A 3ZRDA 3DWVA 5AGYA 2F9SA 3C71A 1OC9A 3KD0A 4MH3A 2YOIA 3QPMA 4EXJA 3KTBA 3W8SA 1SD9A 1IYIA 1K0DA 1QGVA 5ECLB 4Q5FA 1Z6NA 2EIQA 3FKFA 2A4VA 2O7KA 4N11A 4IW9A 2WGRA 2IIYA 2DMLA 1FVJA 2L5OA 2YZUA 3RDWA 1K0MA 3TRQA 4HZ2A 3TKSA 2QKEA 2XPDA 3GMFA 5D9VA 3M8NA
chains in the Genus database with same CATH topology
3TB2A 2CVKA 6GSUA 4OFMA 1GSDA 1VRSD 3RPPA 1GUHA 2H72A 3HKRA 5J9CA 1T4YA 4RI6A 2B3SA 1JZDA 3ME7A 1VF4A 3BCKA 1SL1B 4GCIA 3GA4A 1X0RA 2FHEA 1JLWA 5HR3A 4BPYA 2R37A 3VLNA 5ECHB 4TR4A 1PA3A 4FO5A 1XIYA 4KCEA 1TKDB 2B7KA 4BWSA 1XFLA 3G7IA 1GTAA 3VI7A 2V41A 3EE2A 1LBKA 3JCML 1WJKA 1C72A 3OR5A 3M9KA 1PD21 3QFAC 1M2AA 4J57E 2IPAA 4PUAA 5ENUA 5GAPD 3HHVA 4TOPA 1G7OA 1E2YA 3TKQA 2CAQA 4RUVA 2QSIA 3HVXA 3M3MA 4ZL9A 2C80A 2C0FA 4ML1A 3CTFA 1TOFA 3ZZXA 5CRWA 3H79A 2E2GA 4TR1B 4I6XA 5IM9A 1U88A 5HQPA 2GZZA 4KCAA 1UA5A 3ZREA 4BVXB 3L9UA 5G5FA 3GKMA 3KP8A 2AJQB 5DALB 3H1NA 2GVPA 4V2MA 4O5UA 4V2LA 1I5GA 2C0EA 3VWUA 4K9ZA 2GSQA 3KGKA 4DSQA 2LUSA 3Q18A 2ZNMA 5J5NA 4WR4A 3KH7A 6GSSA 2MYGA 3MYDA 4IJIA 4KDUA 4K7OA 1KBNA 1J08A 5B8AA 3LQ7A 1ILOA 4FH8A 5DVBA 3EMPA 1Q98A 1EOGA 1WIKA 5G5EA 3J7Yb 3PH9A 4ZXGA 3WGEA 2R4VA 2HYXA 3IXRA 4KE3A 2RUEA 3ZVJD 2YJ7A 2DKIA 5JCGA 3VI5A 2P31A 4Z2UA 4ZIJA 4IP6A 4OCEA 1GTIA 2YN1A 3RHCA 2YWOA 4K1FA 4YAPA 2LS5A 2VO4A 4MZWA 3F4SA 3P8WA 2YANA 4MPGA 2WJUA 1ZL9A 1TU7A 1U3AA 2MMZA 3N5OA 6GSYA 3EU4A 10GSA 4J56E 5IPGA 3LJRA 5FHIA 3BD2A 5LNKe 5CRGA 2HSMA 1AQVA 3E9JB 5FT3A 3BOAA 3HDCA 3IHGA 1S3CA 3GNJA 5AN1A 1AQXA 2Z9SA 2B5EA 5ECOB 2PVOC 2DIZA 1GULA 1PSQA 2OKAA 2B1LA 2OBKA 4YQMA 3DGQA 4I2UA 3FK8A 2BJXA 4LMWA 1OC8A 2C0GA 4AJ8A 4KH7A 2TRCP 2YCDA 5DCGA 4GXZA 3GH6A 1ERVA 3GX8A 2IFQA 1XW6A 1SJZA 1FB6A 2DJKA 1OC3A 3FZ4A 5DDLA 1TW9A 3KMNA 1GNWA 1OAZA 3FR3A 2FWGA 2RM6A 2HRAA 2REMA 2PN8A 1N8JA 2K6VA 4ILFA 4MH2A 3D4TA 5JCUA 4EF0A 1U3IA 1XWBA 4KGIA 3TKSC 2KOKA 1O73A 4OFTA 2HLSA 2VUPA 3PINA 2PPTA 4F03A 3DVWA 3TOTA 4MA9A 2ZCTA 1QMVA 5F06A 4KW6A 3PGTA 6GSVA 3CTGA 3LORA 1TK5B 2H0HA 3FZAA 5ECQB 1M7TA 3ZFBA 3ME8A 4F9ZA 2H71A 2UZ8A 2XBQA 18GSA 1A2MA 4NHZA 1B9YC 2LNTA 4IGJA 5ABRA 2RIIA 3UARA 4DSSA 3IV4A 4RQRA 2IN3A 3FEUA 3GKKA 1PGTA 1QFNA 1AAZA 1GSUA 5KN1A 1SU9A 2N5FA 5E59A 2JZRA 1WPIA 4YKGA 2VLTA 2OADA 2C0DA 2XPEA 4L0UA 4ICYA 1AW9A 4Z2TA 1PN0A 5LD0A 1TK0B 1K3LA 1SD8A 2NBSA 1MD3A 3IDVA 3TGZA 3IC4A 2XC2A 1MTCA 3Q19A 4FYCA 2GQLA 4WBRD 3I69A 4D73A 1FOHA 2FWHA 4XRDA 3IRAA 3F0IA 3GKNA 2HXKA 2VM2A 3DVXA 4OMVA 5IMAA 1WP0A 1XWCA 4G19A 3DKSA 3VURA 14GSA 4JE1A 1T00A 1H4OA 2IMDA 2H74A 4EC0A 1X5EA 4ZBBA 1MDJA 1THXA 2I3YA 3GH9A 3FYGA 2K8SA 4HQSA 4K2DA 2IMFA 4EVMA 1YQ1A 4TVEA 4I97A 2CAIA 4TXOA 2HSYA 5LCZA 1GLQA 1TU8A 2PWJA 5IMFA 4MNNA 3M0FA 2DJ2A 4IN0A 4YKFA 3FR6A 4K6XA 12GSA 2OE1A 2C4JA 1GSFA 3GL5A 3CSIA 2NTOA 3TJBA 1PX7A 4J2FA 4OWYA 2WULA 4EKZA 2B6MA 4ZL8A 4FYUA 2X8HA 4G0IA 2C3NA 5DJLA 4PQIA 1MEKA 2KP2A 3U6VA 1T3BA 2R0PA 5INYA 5IQYA 3DMLA 2MMOA 2OA7A 2WDUA 1O8XA 1BAYA 4IBPA 4N0VA 4YQUA 4EE0A 4JR4A 4G0KA 5C00A 4NXIA 4MABA 2JSYA 2LQQA 3UVTA 1EZKA 5KEJA 1PMTA 5E4WA 4GQFA 3KM6A 3IAS2 4IP1A 3UIWA 1OKTA 4K7IA 1EOHA 2HSHA 4H86A 3HD5A 4EDYA 1K0BA 2JU5A 3ZLPA 3CBUA 5B7CA 4WBJA 5DQSA 4FQUA 1Z9HA 4V1Ap 2HZEA 3HVVA 2LSTA 3ZVJA 1NHYA 2A4HA 1YF0A 2EIOA 1K0AA 3P2AA 4V1Ag 1GL8A 1TRVA 4TN8A 3TKPA 1FAAA 1G6WA 3R3EA 1JZWA 1V57A 1XWGA 5KOXA 1GTBA 1T8EB 2WS2A 4K5RA 2FNOA 4NWYA 4OO5A 1XPVA 3WT1A 1XW5A 2GZPA 1S3DA 5HR2A 2OBIA 3DD3A 5IMCA 1V2AA 1K0CA 2RLIA 2O85A 3IE3A 5EL8A 1YEXA 3FZ5A 3QAWA 3NIVA 2ON7A 4MJCA 1AC1A 2L6DA 1X9MB 1X5DA 4HDEA 2H0IA 2H19A 1CQHA 3KXOA 4POKA 3V1WA 2C1YA 1G7EA 4HU7A 2ES7A 4CHSA 3L0HA 2P5QA 4RQXA 1I9DA 2CVBA 1NM3A 3PR8A 2IMEA 4CDOA 1ACVA 1A8YA 1ZYEA 3LG6A 5ECNB 1FW1A 2JADA 4HI7A 4BA7A 3FY7A 4TR3A 4TR1A 4QL9A 2HE3A 1SL2B 2X8CA 5CYYA 4BVXA 1Z3EA 4QL7A 3EURA 1A23A 1EV9A 2H6XA 1R5PA 5DALA 2LJKA 4KAEA 4AGSA 2FGXA 2H66A 4Z7XA 4Q5QA 2FD3A 1GSSA 4PNFA 2M46A 2AUVA 3MWHA 3Q74A 5D9TA 4NMUA 2H1BA 1PX6A 4USSA 1ERUA 3TUEA 3ZFLA 1YKAA 4XIHA 2CA8A 1O81A 1TRUA 2L5LA 5DQYA 2A2SA 3GL3A 5EVOA 2H1GA 6GSWA 5G1LA 7GSSA 2GSRA 1XVQA 1BX9A 1Z6MA 2XHFA 4L5LA 5KN3A 1B9XC 2LRTA 3KIJA 3ZYWA 1N2AA 1O7UA 2F51A 3WYWA 4IKHA 1DSBA 2QC7A 2YV9A 1GLPA 1G0TA 4F0BA 2R0GA 5CREA 2YWIA 2TIRA 5GZZB 4XHMA 1HQOA 4K5SA 5CRDA 16GSA 4X0XA 4MK3A 3EYTA 3BCIA 4NHWA 1TP9A 1YF1A 3NOFA 4GWRA 2NVLA 1A2JA 3VK9A 3KEBA 1SKWB 1W4VA 2TRXA 2H1DA 3QOUA 5ECKB 1R4WA 5L71A 1UN2A 4NV2A 4XCSA 3PPUA 5IMVA 1F3AA 5G31A 3WT2A 1UC7A 2LJRA 1URMA 5AISA 1GP1A 3F4TA 3F63A 1B48A 4POMA 1NSWA 1TRWA 4K0NA 4WF5A 1DE1A 2KUCA 2LV3A 4POBA 3SBCA 4WF4A 1QQ2A 4EIPA 5BMUA 3F8UA 3CRUA 4G2EA 2LNSA 2FA4A 3C1RA 4PNGA 4L8EA 5B8BA 4MLYA 1Z5YE 2L57A 6GSXA 2V6OA 2YJHA 3I6AA 3QD9A 1K3OA 3A5IA 1XCCA 2RM5A 4PX1A 4BVYB 3TKRA 2DJJA 3IOSA 5DAKA 2DJ0A 5JWQB 2DC5A 5IOWA 1HNBA 3TKSE 4GQCA 4KSOA 3ISOA 2HT9A 3D5JA 1EP8A 3FMWA 3APOA 1FO5A 4QQ7A 4ECCA 2H6ZA 4HOJA 3QR6A 2ON5A 2XBIA 1OE8A 1GWCA 4CY6A 1OVNA 2IJYA 1O6JA 3FRCA 3G7YA 2DJ1A 2DLXA 1JZRA 1SK1A 2PMTA 1TRSA 2DKHA 1ZZYA 1H75A 2R5GA 5DBQA 1YKCA 3M9JA 4KB3A 1U87A 3GFKA 2C3QA 1K0NA 3IAM2 1JZOA 2VLVA 3HXSA 3HJPA 2VCQA 4XRAA 3IHQA 3KJYA 4F82A 2LRCA 2X64A 4KDYA 5ELAA 3DEXA 5ID2A 2MMNA 2VD0A 5ECIB 2H8LA 3KCMA 2VL3A 1AIUA 5CP1A 5A5KA 1K3YA 1J0FA 1V40A 3RPNA 3GURA 3L9VA 3A2VA 3BBYA 1M2BA 4O92A 4XS6A 4GSNA 5J9BA 3LYKA 2GLRA 3TJKA 5H5RA 4N10A 2FA8A 4JU5A 5H5SA 1SYRA 5D9WA 1YDKA 3GRXA 2QA2A 1K0OA 3LGCA 2O87A 3GIXA 1TI3A 1ERTA 3HJMA 2CT6A 5KN2A 2WZ9A 1M9BA 5B6NA 4HEA2 4V2NA 3HYPA 4N30A 4NAXA 2H76A 3KTLA 2CQ9A 4PTSA 2K9FA 4WXTA 3GSTA 5D93A 2YP6A 3C7MA 5D73A 5IOXA 3KZQA 4MMMA 4MF7A 2FWEA 3HCZA 2H75A 5HFIA 1GUKA 1WMJA 4KX4A 2H0GA 1ABAA 1CQGA 5J4UA 1XVWA 2WCIA 3QDNA 1XWAA 3MIXA 1IYHA 1A8LA 4DSRA 4ZB6A 1GUMA 2FY6A 3GV1A 1S3AA 2KP1A 1RW1A 3CSJA 4L5OA 5JWOB 2CX3A 1WWJA 1MD4A 4AJ7A 1ZMAA 5GSTA 1EEMA 1FOVA 4E8EA 3FW2A 3MSZA 5CNWA 4IHUA 3S9FA 1ZYQB 1XOAA 1OKDA 1F6MC 2H70A 5GAND 2HI7A 1A0FA 4YH2A 2EIRA 3WGDA 4IELA 3D22A 5FWGA 1PRXA 3QMXA 3MNGA 2HNLA 1PQNA 1FG4A 3IBHA 3L78A 1MDKA 1X5CA 4WR5A 1QUWA 1FB0A 13GSA 1UVZA 1GH2A 1RK4A 3ERFA 1T4ZA 3U5RE 2C3TA 2X4AA 4G10A 4E8HA 2JACA 1WRYA 1XBSA 2V1MA 3F6DA 4KA0A 4ZBDA 2VCWA 2DMMA 2VOCA 4I8BA 1J9BA 2V6KA 2YZHA 4IS0A 2OE3A 1WOUA 4DEJA 4G0LA 1E6BA 4LMVA 2D2ZA 2VD1A 3LEFA 1T7PB 1TXXA 1ON4A 2PERA 1AUCA 4D73B 3C8EA 2LJAA 5HR0A 2GGTA 4IQAA 2AYTA 3DXBA 8GSSA 1WE0A 2B5YA 3HZ8A 3P90A 3GTUB 3O6TA 2FLSA 4TKYA 4OCFA 4EO3A 2OACA 3H8QA 5J41A 1X9WB 4JRRA 1OYJA 1EGRA 3APSA 1YEPA 3O76A 1B4QA 1THOA 3IR4A 1PKZA 11GSA 4EDZA 2R2JA 4HU9A 4AF2A 3WGXA 4PUFC 2YWMA 3LWAA 3E3EA 5IPHA 4MZCA 1B8XA 2V32A 5ECMB 1SK2A 1M9AA 1O8WA 3TRPA 3ZMKA 4ECJA 3RBTA 3P7XA 2L4QA 4AJ6A 2HFDA 2CX4A 2L4CA 4K2XA 5AIVA 3CYNA 3EC3A 1SKSB 1B4PA 3F9UA 2H1AA 5HFGA 5DJMA 4BL7B 1EGOA 2YWNA 2LTKA 1KNGA 4ID0A 2FCHA 1Z7PA 3HZ4A 4MZBA 2YNXA 1T1VA 2GT5A 3FZ9A 4XTSA 3VPTA 3TDGA 2VAFA 3D21A 4I2TA 2GSSA 5KN0A 1MDIA 1XWKA 2H73A 4MP4A 2MZCA 2L6CA 4IJ3A 3ZMLA 4EUYA 1YJ6A 4TR0A 4Z2RA 3VFIA 2R3XA 4OFNA 1GRXA 2AV4A 1ERWA 2HZEB 1F9MA 2M72A 3EU3A 3F4RA 3QFBC 4JBBA 3GX0A 2BTOT 1ZCPA 1DUGA 3F3QA 2X49A 4X4JA 2A2RA 3G9BA 2J23A 3LYPA 1VGLA 4KSMA 4MF5A 5A4UA 4ZB9A 3DRNA 1XXUA 5F0GA 2F8AA 2VM1A 22GSA 3UJ1A 3IC8A 1O85A 4TRXA 1G6YA 2IWTA 1PKWA 4XS4B 1V58A 2X99A 4MJAA 1W89A 5C04A 1PL2A 3IPZA 2M80A 5J3RA 4BVYA 4O7HA 3MAKA 3DYRA 1GSQA 4NPBA 4PQ1A 5DCHA 1ML6A 3EWLA 4PXOA 3D4MA 1GSEA 1OC9B 3CXGA 3H93A 4OO4A 3TOUA 4ZILA 5F07A 2PUKC 3TCOA 2PBJA 2CZ2A 1FVKA 2CVDA 19GSA 2WB9A 4O32A 2GTUA 4MCUA 1VF2A 2H30A 3VWXA 4WEYA 5CAXA 5JCWA 1HYUA 3LSZA 4JR6A 2EC4A 3R2QA 3ERWA 2PU9C 2CV4A 1A0RP 3KP9A 4MF6A 4ISDA 2P0GA 2BMXA 4MPFA 2DJ3A 1HD2A 1NW2A 3G7JA 1AQWA 1X9SB 4IQ1A 1SENA 3FHKA 4KNDA 2B1KA 2DBCA 2B7JA 1OE7A 1ZGNA 4IVFA 3LFLA 3O3TA 2VL9A 2AAWA 2JL4A 2PVQA 2R6KA 5IMZA 1KEBA 4PGTA 4GSTA 5JWRB 3TJJA 1YZXA 3TJGA 4PURA 2VL2A 3EVIA 5F05A 1KTEA 3HJOA 6GSTA 4JEDA 1XOBA 1Y6EA 4ML6A 1FHEA 4WKWA 2E2MA 4ZBAA 3CMIA 4O5RA 5D9XA 4LL4B 3ERGA 3FR9A 3ZIJA 4O5QA 5IO0A 2YV7A 4OD7A 1TK8B 2VCTA 2GS3A 1HNCA 4YQVA 1F2EA 5ECPB 4PQHA 4RI7A 4GF0A 1VF3A 3IK7A 3CSHA 5G1KA 2MBSA 1QXHA 1DE2A 3GN3A 2N5AA 2KHPA 2MBTA 4MJBA 4I5QA 3UBKA 4ZL7A 1EWXA 3ZTLA 4BWQA 1M99A 2FUG2 5G30A 2LKUA 5CRHA 5D8IA 2LRNA 4FIWA 1EEJA 4NV5A 5B6MA 2I9HA 2ALBA 3J7Yk 3C1SA 1ZOFA 3KMOA 4JZQA 4Q5NA 2KLXA 1V98A 4MDCA 2NPBA 4Q5RA 2CZ3A 3KH9A 3QAVA 1ZYNA 3BJ5A 5KOWA 3QAGA 1TDIA 1V9WA 4X1UA 3H4KA 9GSSA 2WFCA 1ST9A 4KF9A 3M1GA 1VF1A 3NZNA 4LLRA 5ECRB 3I43A 3A5WA 5BRTA 4FYBA 1Q4JA 4P3YB 3I9V2 3F6FA 4CW9A 4CY8A 2F8FA 2VCZA 2C8UA 4HJMA 5GSSA 2HZFA 5DAKB 2HRKA 3DIEA 3ED3A 3D6IA 2I81A 1SJ6A 3ZIVA 4TW5A 3VWVA 3GYKA 2K8VA 1TJDA 3AY8A 3F3RA 3ZITA 1BJXA 4L0WA 5COHA 2E0QA 1TI1A 2IL3A 1RQMA 3IA1A 4DVCA 1LJRA 4EIQA 2I1UA 2OJLA 5CO3A 3UOMA 4GSSA 4GLTA 2IMKA 17GSA 1M0UA 2VCVA 2MMAA 20GSA 1PL1A 2A2PA 2B5XA 2QA1A 4G9HA 5IMDA 3UBLA 1YY7A 2E7PA 1M2DA 3TRXA 3MDKA 4HS1A 2IFQB 3A2XA 2L59A 3HY2A 5ID2B 2G0FA 1F37A 1Y25A 1SYXA 2H01A 3APQA 1U6TA 4ULXA 3UL3A 2V2GA 3E0UA 1JFUA 2VCXA 4KUNA 1BG5A 3L9SA 3UMAA 1BEDA 1DBYA 1R5AA 3SWLA 1BQ7A 3LXTA 2LEGA 2P5RA 3TJFA 1BYEA 2HRNA 3GKXA 2F3MA 2X8GA 3VPQA 3GTUA 1EP7A 1QK8A 4XS1A 4ECIA 2VL2C 5A4VA 2IMIA 1GTUA 3LXZA 3UEMA 1AXDA 3CRTA 3UAPA 3GSSA 4DSSB 1JLVA 5AIXA 2R0CA 1SKRB 3WD6A 3UVHA 1NHOA 3C73A 4WETA 3EMXA 2O89A 1SJIA 1LU4A 2DSAA 1XZOA 2ZUPA 2JZSA 1HNAA 2AHEA 3LW9A 3QCPA 2VLUA 5IO2A 3EPTA 3Q6OA 2NDOA 3D0ZA 3RHBA 2GZYA 3A3TA 4HUAA 4BL7A 3W8JA 3EINA 3K8NA 2VIMA 2QGVA 4K7NA 1SL0B 1R7HA 3GUSA 2GDRA 1ZYPA 4GRFA 2PGTA 2DIYA 3US3A 2GT6A 4MJEA 2RUFA 5D96A 1F3BA 3A2WA 5ELGA 4KDXA 1A2LA 1TTZA 4X43A 2N5BA 5HR1A 4HJ2A 5IIZA 4HZ4A 4A5PA 2J9HA 5F8BA 4LA1A 4F0CA 3HA9A 2WRTA 3IK9A 4K8MA 2JSZA 5HFKA 1GSYA 3N9JA 3VWWA 2OE0A 4TXOB 3W6GA 5EY6A 2G2QA 1R26A 2AB6A 2YPMA 4F2IA 4ACSA 4HQZA 4LL1B 3GHAA 1EV4A 1JHBA 3ZL5A 5EPFA 2O8VB 4YAVA 3RAZA 2FWFA 4GTUA 5G2ZA 1SK0A 2K18A 4K0GA 2I4AA 4ECBA 4EL1A 1XW9A 2HRFA 3L4NA 2GSTA 1USBA 2GQMA 1PN9A 2H6YA 4N0ZA 2LQOA 4XS4A 1GNEA 2JZTA 4ZB8A 4TXVA 2GQKA 5ECSA 5H5QA 1Z7RA 5A4WA 4POLA 3HVSA 1A24A 3ZRDA 3DWVA 5AGYA 2F9SA 3C71A 1OC9A 3KD0A 4MH3A 2YOIA 3QPMA 4EXJA 3KTBA 3W8SA 1SD9A 1IYIA 1K0DA 1QGVA 5ECLB 4Q5FA 1Z6NA 2EIQA 3FKFA 2A4VA 2O7KA 4N11A 4IW9A 2WGRA 2IIYA 2DMLA 1FVJA 2L5OA 2YZUA 3RDWA 1K0MA 3TRQA 4HZ2A 3TKSA 2QKEA 2XPDA 3GMFA 5D9VA 3M8NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TB2 A;  2CVK A;  6GSU A;  4OFM A;  1GSD A;  1VRS D;  3RPP A;  1GUH A;  2H72 A;  3HKR A;  5J9C A;  1T4Y A;  4RI6 A;  2B3S A;  1JZD A;  3ME7 A;  1VF4 A;  3BCK A;  1SL1 B;  4GCI A;  3GA4 A;  1X0R A;  2FHE A;  1JLW A;  5HR3 A;  4BPY A;  2R37 A;  3VLN A;  5ECH B;  4TR4 A;  1PA3 A;  4FO5 A;  1XIY A;  4KCE A;  1TKD B;  2B7K A;  4BWS A;  1XFL A;  3G7I A;  1GTA A;  3VI7 A;  2V41 A;  3EE2 A;  1LBK A;  3JCM L;  1WJK A;  1C72 A;  3OR5 A;  3M9K A;  1PD2 1;  3QFA C;  1M2A A;  4J57 E;  2IPA A;  4PUA A;  5ENU A;  5GAP D;  3HHV A;  4TOP A;  1G7O A;  1E2Y A;  3TKQ A;  2CAQ A;  4RUV A;  2QSI A;  3HVX A;  3M3M A;  4ZL9 A;  2C80 A;  2C0F A;  4ML1 A;  3CTF A;  1TOF A;  3ZZX A;  5CRW A;  3H79 A;  2E2G A;  4TR1 B;  4I6X A;  5IM9 A;  1U88 A;  5HQP A;  2GZZ A;  4KCA A;  1UA5 A;  3ZRE A;  3L9U A;  5G5F A;  3GKM A;  3KP8 A;  2AJQ B;  5DAL B;  3H1N A;  2GVP A;  4V2M A;  4V2L A;  1I5G A;  2C0E A;  3VWU A;  4K9Z A;  2GSQ A;  3KGK A;  4DSQ A;  2LUS A;  3Q18 A;  2ZNM A;  5J5N A;  4WR4 A;  3KH7 A;  6GSS A;  2MYG A;  4IJI A;  4KDU A;  4K7O A;  1KBN A;  1J08 A;  5B8A A;  3LQ7 A;  1ILO A;  4FH8 A;  5DVB A;  3EMP A;  1Q98 A;  1EOG A;  1WIK A;  5G5E A;  3J7Y b;  3PH9 A;  4ZXG A;  3WGE A;  2R4V A;  2HYX A;  3IXR A;  4KE3 A;  2RUE A;  3ZVJ D;  2YJ7 A;  5JCG A;  3VI5 A;  2P31 A;  4ZIJ A;  4IP6 A;  4OCE A;  1GTI A;  2YN1 A;  3RHC A;  2YWO A;  4K1F A;  4YAP A;  2LS5 A;  2VO4 A;  4MZW A;  3F4S A;  3P8W A;  2YAN A;  4MPG A;  2WJU A;  1ZL9 A;  1TU7 A;  1U3A A;  2MMZ A;  3N5O A;  6GSY A;  3EU4 A;  10GS A;  4J56 E;  5IPG A;  3LJR A;  5FHI A;  3BD2 A;  5LNK e;  5CRG A;  1AQV A;  3E9J B;  5FT3 A;  3BOA A;  3HDC A;  1S3C A;  3GNJ A;  5AN1 A;  1AQX A;  2Z9S A;  2B5E A;  5ECO B;  2PVO C;  2DIZ A;  1GUL A;  1PSQ A;  2OKA A;  2B1L A;  2OBK A;  4YQM A;  3DGQ A;  4I2U A;  3FK8 A;  2BJX A;  4LMW A;  1OC8 A;  2C0G A;  4AJ8 A;  4KH7 A;  2TRC P;  2YCD A;  5DCG A;  4GXZ A;  3GH6 A;  1ERV A;  3GX8 A;  2IFQ A;  1XW6 A;  1SJZ A;  1FB6 A;  2DJK A;  5DDL A;  1OC3 A;  3FZ4 A;  1TW9 A;  3KMN A;  1GNW A;  1OAZ A;  3FR3 A;  2FWG A;  2RM6 A;  2REM A;  2PN8 A;  1N8J A;  2K6V A;  4ILF A;  4MH2 A;  3D4T A;  5JCU A;  4EF0 A;  1U3I A;  1XWB A;  4KGI A;  3TKS C;  2KOK A;  1O73 A;  4OFT A;  2HLS A;  2VUP A;  3PIN A;  2PPT A;  4F03 A;  3DVW A;  3TOT A;  4MA9 A;  2ZCT A;  1QMV A;  5F06 A;  4KW6 A;  3PGT A;  6GSV A;  3CTG A;  3LOR A;  1TK5 B;  2H0H A;  3FZA A;  5ECQ B;  1M7T A;  3ZFB A;  3ME8 A;  4F9Z A;  2H71 A;  2XBQ A;  18GS A;  1A2M A;  4NHZ A;  1B9Y C;  2LNT A;  4IGJ A;  5ABR A;  2RII A;  3UAR A;  4DSS A;  3IV4 A;  4RQR A;  2IN3 A;  3FEU A;  3GKK A;  1PGT A;  1QFN A;  1AAZ A;  1GSU A;  5KN1 A;  1SU9 A;  2N5F A;  5E59 A;  2JZR A;  1WPI A;  2VLT A;  2OAD A;  2C0D A;  2XPE A;  4L0U A;  1AW9 A;  5LD0 A;  1TK0 B;  1K3L A;  1SD8 A;  2NBS A;  1MD3 A;  3IDV A;  3TGZ A;  3IC4 A;  2XC2 A;  1MTC A;  3Q19 A;  4FYC A;  2GQL A;  4WBR D;  3I69 A;  4D73 A;  2FWH A;  4XRD A;  3IRA A;  3F0I A;  3GKN A;  2HXK A;  2VM2 A;  3DVX A;  4OMV A;  5IMA A;  1WP0 A;  1XWC A;  4G19 A;  3DKS A;  3VUR A;  14GS A;  4JE1 A;  1T00 A;  1H4O A;  2IMD A;  2H74 A;  4EC0 A;  1X5E A;  4ZBB A;  1MDJ A;  1THX A;  2I3Y A;  3GH9 A;  3FYG A;  2K8S A;  4HQS A;  4K2D A;  2IMF A;  4EVM A;  1YQ1 A;  4TVE A;  4I97 A;  2CAI A;  4TXO A;  2HSY A;  5LCZ A;  1GLQ A;  1TU8 A;  2PWJ A;  5IMF A;  3M0F A;  2DJ2 A;  4IN0 A;  3FR6 A;  4K6X A;  12GS A;  2OE1 A;  2C4J A;  1GSF A;  3GL5 A;  3CSI A;  2NTO A;  3TJB A;  1PX7 A;  4J2F A;  4OWY A;  2WUL A;  4EKZ A;  2B6M A;  4ZL8 A;  4FYU A;  2X8H A;  2C3N A;  5DJL A;  4PQI A;  1MEK A;  2KP2 A;  3U6V A;  1T3B A;  5INY A;  5IQY A;  3DML A;  2MMO A;  2OA7 A;  2WDU A;  1O8X A;  1BAY A;  4IBP A;  4N0V A;  4YQU A;  4EE0 A;  4JR4 A;  5C00 A;  4NXI A;  4MAB A;  2JSY A;  2LQQ A;  3UVT A;  1EZK A;  5KEJ A;  1PMT A;  5E4W A;  4GQF A;  3KM6 A;  3IAS 2;  4IP1 A;  3UIW A;  1OKT A;  4K7I A;  1EOH A;  2HSH A;  4H86 A;  3HD5 A;  4EDY A;  1K0B A;  2JU5 A;  3ZLP A;  3CBU A;  5B7C A;  4WBJ A;  5DQS A;  1Z9H A;  4V1A p;  2HZE A;  3HVV A;  2LST A;  3ZVJ A;  1NHY A;  1YF0 A;  2EIO A;  1K0A A;  3P2A A;  4V1A g;  1GL8 A;  1TRV A;  4TN8 A;  3TKP A;  1FAA A;  1G6W A;  1JZW A;  1V57 A;  1XWG A;  1GTB A;  1T8E B;  2WS2 A;  2FNO A;  4NWY A;  4OO5 A;  1XPV A;  3WT1 A;  1XW5 A;  2GZP A;  1S3D A;  5HR2 A;  2OBI A;  3DD3 A;  5IMC A;  1V2A A;  1K0C A;  2RLI A;  2O85 A;  3IE3 A;  5EL8 A;  1YEX A;  3FZ5 A;  3QAW A;  3NIV A;  2ON7 A;  4MJC A;  1AC1 A;  2L6D A;  1X9M B;  1X5D A;  4HDE A;  2H0I A;  2H19 A;  1CQH A;  3KXO A;  4POK A;  3V1W A;  2C1Y A;  1G7E A;  4HU7 A;  2ES7 A;  4CHS A;  3L0H A;  2P5Q A;  4RQX A;  1I9D A;  2CVB A;  1NM3 A;  3PR8 A;  2IME A;  4CDO A;  1ACV A;  1A8Y A;  1ZYE A;  3LG6 A;  5ECN B;  1FW1 A;  2JAD A;  4HI7 A;  4BA7 A;  3FY7 A;  4TR3 A;  4TR1 A;  4QL9 A;  2HE3 A;  1SL2 B;  2X8C A;  5CYY A;  4BVX A;  1Z3E A;  4QL7 A;  3EUR A;  1A23 A;  1EV9 A;  2H6X A;  1R5P A;  5DAL A;  2LJK A;  4KAE A;  4AGS A;  2FGX A;  2H66 A;  4Z7X A;  4Q5Q A;  2FD3 A;  1GSS A;  4PNF A;  2M46 A;  2AUV A;  3MWH A;  3Q74 A;  5D9T A;  4NMU A;  2H1B A;  1PX6 A;  1ERU A;  3TUE A;  3ZFL A;  1YKA A;  4XIH A;  2CA8 A;  1O81 A;  1TRU A;  5EVO A;  2L5L A;  2A2S A;  3GL3 A;  5DQY A;  2H1G A;  6GSW A;  5G1L A;  7GSS A;  2GSR A;  1XVQ A;  1BX9 A;  1Z6M A;  2XHF A;  4L5L A;  5KN3 A;  1B9X C;  2LRT A;  3KIJ A;  3ZYW A;  1N2A A;  1O7U A;  2F51 A;  3WYW A;  4IKH A;  1DSB A;  2QC7 A;  2YV9 A;  1GLP A;  1G0T A;  4F0B A;  5CRE A;  2YWI A;  2TIR A;  5GZZ B;  4XHM A;  1HQO A;  5CRD A;  16GS A;  4X0X A;  4MK3 A;  3EYT A;  3BCI A;  4NHW A;  1TP9 A;  1YF1 A;  3NOF A;  4GWR A;  2NVL A;  1A2J A;  3VK9 A;  3KEB A;  1SKW B;  1W4V A;  2TRX A;  2H1D A;  3QOU A;  5ECK B;  1R4W A;  5L71 A;  1UN2 A;  4NV2 A;  4XCS A;  5IMV A;  1F3A A;  5G31 A;  3WT2 A;  1UC7 A;  2LJR A;  1URM A;  5AIS A;  1GP1 A;  3F4T A;  3F63 A;  1B48 A;  4POM A;  1NSW A;  1TRW A;  4K0N A;  4WF5 A;  1DE1 A;  2KUC A;  2LV3 A;  4POB A;  3SBC A;  4WF4 A;  1QQ2 A;  3F8U A;  3CRU A;  4G2E A;  2LNS A;  2FA4 A;  3C1R A;  4PNG A;  4L8E A;  5B8B A;  4MLY A;  1Z5Y E;  2L57 A;  6GSX A;  2V6O A;  2YJH A;  3I6A A;  3QD9 A;  1K3O A;  1XCC A;  2RM5 A;  4PX1 A;  3TKR A;  2DJJ A;  3IOS A;  5DAK A;  2DJ0 A;  5JWQ B;  2DC5 A;  5IOW A;  1HNB A;  3TKS E;  4GQC A;  4KSO A;  3ISO A;  2HT9 A;  3D5J A;  1EP8 A;  3APO A;  1FO5 A;  4QQ7 A;  4ECC A;  2H6Z A;  4HOJ A;  3QR6 A;  2ON5 A;  2XBI A;  1OE8 A;  1GWC A;  1OVN A;  2IJY A;  1O6J A;  3FRC A;  3G7Y A;  2DJ1 A;  2DLX A;  1JZR A;  1SK1 A;  2PMT A;  1TRS A;  1ZZY A;  1H75 A;  2R5G A;  5DBQ A;  1YKC A;  3M9J A;  4KB3 A;  1U87 A;  3GFK A;  2C3Q A;  1K0N A;  3IAM 2;  1JZO A;  2VLV A;  3HXS A;  3HJP A;  2VCQ A;  4XRA A;  3IHQ A;  3KJY A;  4F82 A;  2LRC A;  2X64 A;  4KDY A;  5ELA A;  3DEX A;  5ID2 A;  2MMN A;  2VD0 A;  5ECI B;  2H8L A;  3KCM A;  2VL3 A;  1AIU A;  5CP1 A;  5A5K A;  1K3Y A;  1J0F A;  1V40 A;  3RPN A;  3GUR A;  3L9V A;  3A2V A;  3BBY A;  1M2B A;  4O92 A;  4XS6 A;  4GSN A;  5J9B A;  3LYK A;  2GLR A;  3TJK A;  5H5R A;  4N10 A;  2FA8 A;  4JU5 A;  5H5S A;  1SYR A;  5D9W A;  1YDK A;  3GRX A;  1K0O A;  3LGC A;  2O87 A;  3GIX A;  1TI3 A;  1ERT A;  3HJM A;  2CT6 A;  5KN2 A;  2WZ9 A;  1M9B A;  5B6N A;  4HEA 2;  4V2N A;  3HYP A;  4N30 A;  4NAX A;  2H76 A;  3KTL A;  2CQ9 A;  2K9F A;  4WXT A;  3GST A;  5D93 A;  2YP6 A;  3C7M A;  5D73 A;  5IOX A;  3KZQ A;  4MMM A;  4MF7 A;  2FWE A;  3HCZ A;  2H75 A;  5HFI A;  1GUK A;  1WMJ A;  4KX4 A;  2H0G A;  1ABA A;  1CQG A;  5J4U A;  1XVW A;  2WCI A;  3QDN A;  1XWA A;  1IYH A;  1A8L A;  4DSR A;  4ZB6 A;  1GUM A;  2FY6 A;  3GV1 A;  1S3A A;  2KP1 A;  1RW1 A;  3CSJ A;  4L5O A;  5JWO B;  2CX3 A;  1WWJ A;  1MD4 A;  4AJ7 A;  1ZMA A;  5GST A;  1EEM A;  1FOV A;  4E8E A;  3FW2 A;  3MSZ A;  5CNW A;  4IHU A;  3S9F A;  1ZYQ B;  1XOA A;  1OKD A;  1F6M C;  2H70 A;  5GAN D;  2HI7 A;  1A0F A;  4YH2 A;  2EIR A;  3WGD A;  4IEL A;  3D22 A;  5FWG A;  1PRX A;  3QMX A;  3MNG A;  2HNL A;  1PQN A;  1FG4 A;  3IBH A;  3L78 A;  1MDK A;  1X5C A;  4WR5 A;  1QUW A;  1FB0 A;  13GS A;  1UVZ A;  1GH2 A;  1RK4 A;  3ERF A;  1T4Z A;  3U5R E;  2C3T A;  4G10 A;  4E8H A;  2JAC A;  1WRY A;  1XBS A;  2V1M A;  3F6D A;  4KA0 A;  4ZBD A;  2VCW A;  2DMM A;  2VOC A;  4I8B A;  1J9B A;  2V6K A;  2YZH A;  4IS0 A;  2OE3 A;  1WOU A;  4DEJ A;  1E6B A;  4LMV A;  2D2Z A;  2VD1 A;  3LEF A;  1T7P B;  1TXX A;  1ON4 A;  2PER A;  1AUC A;  4D73 B;  3C8E A;  2LJA A;  5HR0 A;  2GGT A;  4IQA A;  2AYT A;  3DXB A;  8GSS A;  1WE0 A;  2B5Y A;  3HZ8 A;  3P90 A;  3GTU B;  3O6T A;  2FLS A;  4TKY A;  4OCF A;  4EO3 A;  2OAC A;  3H8Q A;  5J41 A;  1X9W B;  4JRR A;  1OYJ A;  1EGR A;  3APS A;  1YEP A;  3O76 A;  1B4Q A;  1THO A;  3IR4 A;  1PKZ A;  11GS A;  4EDZ A;  2R2J A;  4HU9 A;  4AF2 A;  3WGX A;  4PUF C;  2YWM A;  3LWA A;  3E3E A;  5IPH A;  4MZC A;  1B8X A;  2V32 A;  5ECM B;  1SK2 A;  1M9A A;  1O8W A;  3TRP A;  3ZMK A;  4ECJ A;  3RBT A;  3P7X A;  2L4Q A;  4AJ6 A;  2HFD A;  2CX4 A;  2L4C A;  5AIV A;  3CYN A;  3EC3 A;  1SKS B;  1B4P A;  3F9U A;  2H1A A;  5HFG A;  5DJM A;  1EGO A;  2YWN A;  2LTK A;  1KNG A;  4ID0 A;  2FCH A;  1Z7P A;  3HZ4 A;  4MZB A;  2YNX A;  1T1V A;  2GT5 A;  3FZ9 A;  4XTS A;  3VPT A;  3TDG A;  2VAF A;  3D21 A;  4I2T A;  2GSS A;  5KN0 A;  1MDI A;  1XWK A;  2H73 A;  4MP4 A;  2MZC A;  2L6C A;  4IJ3 A;  3ZML A;  4EUY A;  1YJ6 A;  4TR0 A;  3VFI A;  2R3X A;  4OFN A;  1GRX A;  2AV4 A;  1ERW A;  2HZE B;  1F9M A;  2M72 A;  3EU3 A;  3F4R A;  3QFB C;  4JBB A;  3GX0 A;  2BTO T;  1ZCP A;  1DUG A;  3F3Q A;  2A2R A;  3G9B A;  2J23 A;  3LYP A;  1VGL A;  4KSM A;  4MF5 A;  5A4U A;  4ZB9 A;  3DRN A;  1XXU A;  5F0G A;  2F8A A;  2VM1 A;  22GS A;  3UJ1 A;  1O85 A;  4TRX A;  1G6Y A;  2IWT A;  1PKW A;  4XS4 B;  1V58 A;  2X99 A;  4MJA A;  1W89 A;  5C04 A;  1PL2 A;  3IPZ A;  2M80 A;  5J3R A;  4BVY A;  4O7H A;  3MAK A;  3DYR A;  1GSQ A;  4NPB A;  4PQ1 A;  5DCH A;  1ML6 A;  3EWL A;  4PXO A;  3D4M A;  1GSE A;  1OC9 B;  3CXG A;  3H93 A;  4OO4 A;  3TOU A;  4ZIL A;  5F07 A;  2PUK C;  3TCO A;  2PBJ A;  2CZ2 A;  1FVK A;  2CVD A;  19GS A;  2WB9 A;  4O32 A;  2GTU A;  4MCU A;  1VF2 A;  2H30 A;  3VWX A;  4WEY A;  5CAX A;  5JCW A;  1HYU A;  3LSZ A;  4JR6 A;  2EC4 A;  3R2Q A;  3ERW A;  2PU9 C;  2CV4 A;  1A0R P;  3KP9 A;  4MF6 A;  4ISD A;  2P0G A;  2BMX A;  4MPF A;  2DJ3 A;  1HD2 A;  1NW2 A;  3G7J A;  1AQW A;  1X9S B;  4IQ1 A;  1SEN A;  3FHK A;  4KND A;  2B1K A;  2DBC A;  2B7J A;  1OE7 A;  1ZGN A;  4IVF A;  3LFL A;  3O3T A;  2VL9 A;  2AAW A;  2JL4 A;  2PVQ A;  2R6K A;  5IMZ A;  1KEB A;  4PGT A;  4GST A;  5JWR B;  3TJJ A;  1YZX A;  3TJG A;  4PUR A;  2VL2 A;  3EVI A;  5F05 A;  1KTE A;  3HJO A;  6GST A;  4JED A;  1XOB A;  1Y6E A;  4ML6 A;  1FHE A;  4WKW A;  2E2M A;  4ZBA A;  3CMI A;  4O5R A;  5D9X A;  4LL4 B;  3ERG A;  3FR9 A;  3ZIJ A;  5IO0 A;  2YV7 A;  4OD7 A;  1TK8 B;  2VCT A;  2GS3 A;  1HNC A;  4YQV A;  1F2E A;  5ECP B;  4PQH A;  4RI7 A;  4GF0 A;  1VF3 A;  3IK7 A;  3CSH A;  5G1K A;  2MBS A;  1QXH A;  1DE2 A;  3GN3 A;  2N5A A;  2KHP A;  2MBT A;  4MJB A;  4I5Q A;  3UBK A;  4ZL7 A;  1EWX A;  3ZTL A;  4BWQ A;  1M99 A;  2FUG 2;  5G30 A;  2LKU A;  5CRH A;  5D8I A;  2LRN A;  4FIW A;  1EEJ A;  4NV5 A;  5B6M A;  2I9H A;  2ALB A;  3J7Y k;  3C1S A;  1ZOF A;  3KMO A;  4JZQ A;  4Q5N A;  2KLX A;  1V98 A;  4MDC A;  2NPB A;  4Q5R A;  2CZ3 A;  3KH9 A;  3QAV A;  3BJ5 A;  3QAG A;  1TDI A;  1V9W A;  4X1U A;  3H4K A;  9GSS A;  2WFC A;  1ST9 A;  3M1G A;  1VF1 A;  3NZN A;  4LLR A;  5ECR B;  3I43 A;  3A5W A;  4FYB A;  1Q4J A;  4P3Y B;  3I9V 2;  3F6F A;  4CW9 A;  2F8F A;  2VCZ A;  2C8U A;  4HJM A;  5GSS A;  2HZF A;  5DAK B;  3DIE A;  3ED3 A;  3D6I A;  2I81 A;  1SJ6 A;  3ZIV A;  4TW5 A;  3VWV A;  3GYK A;  2K8V A;  1TJD A;  3AY8 A;  3F3R A;  3ZIT A;  1BJX A;  4L0W A;  5COH A;  2E0Q A;  1TI1 A;  2IL3 A;  1RQM A;  3IA1 A;  4DVC A;  1LJR A;  2I1U A;  2OJL A;  5CO3 A;  3UOM A;  4GSS A;  4GLT A;  2IMK A;  17GS A;  1M0U A;  2VCV A;  2MMA A;  20GS A;  1PL1 A;  2B5X A;  5IMD A;  4G9H A;  3UBL A;  1YY7 A;  2E7P A;  1M2D A;  3TRX A;  3MDK A;  4HS1 A;  2IFQ B;  3A2X A;  2L59 A;  3HY2 A;  5ID2 B;  2G0F A;  1F37 A;  1Y25 A;  1SYX A;  2H01 A;  3APQ A;  1U6T A;  4ULX A;  3UL3 A;  2V2G A;  3E0U A;  1JFU A;  2VCX A;  4KUN A;  1BG5 A;  3L9S A;  3UMA A;  1BED A;  1DBY A;  1R5A A;  3SWL A;  1BQ7 A;  3LXT A;  2LEG A;  2P5R A;  3TJF A;  1BYE A;  2HRN A;  3GKX A;  2F3M A;  2X8G A;  3VPQ A;  3GTU A;  1EP7 A;  1QK8 A;  4XS1 A;  4ECI A;  2VL2 C;  5A4V A;  2IMI A;  1GTU A;  3LXZ A;  3UEM A;  1AXD A;  3CRT A;  3UAP A;  3GSS A;  4DSS B;  1JLV A;  5AIX A;  1SKR B;  3WD6 A;  3UVH A;  1NHO A;  3C73 A;  4WET A;  3EMX A;  2O89 A;  1SJI A;  1LU4 A;  2DSA A;  1XZO A;  2ZUP A;  2JZS A;  1HNA A;  2AHE A;  3QCP A;  2VLU A;  5IO2 A;  3Q6O A;  2NDO A;  3D0Z A;  3RHB A;  2GZY A;  3A3T A;  4HUA A;  4BL7 A;  3W8J A;  3EIN A;  3K8N A;  2VIM A;  2QGV A;  4K7N A;  1SL0 B;  1R7H A;  3GUS A;  2GDR A;  4GRF A;  2PGT A;  2DIY A;  3US3 A;  2GT6 A;  4MJE A;  2RUF A;  5D96 A;  1F3B A;  3A2W A;  5ELG A;  4KDX A;  1A2L A;  1TTZ A;  4X43 A;  2N5B A;  5HR1 A;  4HJ2 A;  5IIZ A;  4HZ4 A;  2J9H A;  5F8B A;  4LA1 A;  4F0C A;  3HA9 A;  2WRT A;  3IK9 A;  4K8M A;  2JSZ A;  5HFK A;  1GSY A;  3N9J A;  3VWW A;  2OE0 A;  4TXO B;  3W6G A;  5EY6 A;  2G2Q A;  1R26 A;  2AB6 A;  2YPM A;  4F2I A;  4ACS A;  4HQZ A;  4LL1 B;  3GHA A;  1EV4 A;  1JHB A;  3ZL5 A;  5EPF A;  2O8V B;  4YAV A;  3RAZ A;  2FWF A;  4GTU A;  5G2Z A;  1SK0 A;  2K18 A;  4K0G A;  2I4A A;  4ECB A;  4EL1 A;  1XW9 A;  2HRF A;  3L4N A;  2GST A;  1USB A;  2GQM A;  1PN9 A;  2H6Y A;  4N0Z A;  2LQO A;  4XS4 A;  1GNE A;  2JZT A;  4ZB8 A;  4TXV A;  2GQK A;  5ECS A;  5H5Q A;  1Z7R A;  5A4W A;  4POL A;  3HVS A;  1A24 A;  3ZRD A;  3DWV A;  5AGY A;  2F9S A;  3C71 A;  1OC9 A;  3KD0 A;  4MH3 A;  2YOI A;  3QPM A;  4EXJ A;  3KTB A;  3W8S A;  1SD9 A;  1IYI A;  1K0D A;  1QGV A;  5ECL B;  4Q5F A;  1Z6N A;  2EIQ A;  3FKF A;  2A4V A;  2O7K A;  4N11 A;  4IW9 A;  2WGR A;  2IIY A;  2DML A;  1FVJ A;  2L5O A;  2YZU A;  3RDW A;  1K0M A;  3TRQ A;  4HZ2 A;  3TKS A;  2QKE A;  2XPD A;  3GMF A;  5D9V A;  3M8N A; 
#chains in the Genus database with same CATH topology
 3TB2 A;  2CVK A;  6GSU A;  4OFM A;  1GSD A;  1VRS D;  3RPP A;  1GUH A;  2H72 A;  3HKR A;  5J9C A;  1T4Y A;  4RI6 A;  2B3S A;  1JZD A;  3ME7 A;  1VF4 A;  3BCK A;  1SL1 B;  4GCI A;  3GA4 A;  1X0R A;  2FHE A;  1JLW A;  5HR3 A;  4BPY A;  2R37 A;  3VLN A;  5ECH B;  4TR4 A;  1PA3 A;  4FO5 A;  1XIY A;  4KCE A;  1TKD B;  2B7K A;  4BWS A;  1XFL A;  3G7I A;  1GTA A;  3VI7 A;  2V41 A;  3EE2 A;  1LBK A;  3JCM L;  1WJK A;  1C72 A;  3OR5 A;  3M9K A;  1PD2 1;  3QFA C;  1M2A A;  4J57 E;  2IPA A;  4PUA A;  5ENU A;  5GAP D;  3HHV A;  4TOP A;  1G7O A;  1E2Y A;  3TKQ A;  2CAQ A;  4RUV A;  2QSI A;  3HVX A;  3M3M A;  4ZL9 A;  2C80 A;  2C0F A;  4ML1 A;  3CTF A;  1TOF A;  3ZZX A;  5CRW A;  3H79 A;  2E2G A;  4TR1 B;  4I6X A;  5IM9 A;  1U88 A;  5HQP A;  2GZZ A;  4KCA A;  1UA5 A;  3ZRE A;  4BVX B;  3L9U A;  5G5F A;  3GKM A;  3KP8 A;  2AJQ B;  5DAL B;  3H1N A;  2GVP A;  4V2M A;  4O5U A;  4V2L A;  1I5G A;  2C0E A;  3VWU A;  4K9Z A;  2GSQ A;  3KGK A;  4DSQ A;  2LUS A;  3Q18 A;  2ZNM A;  5J5N A;  4WR4 A;  3KH7 A;  6GSS A;  2MYG A;  3MYD A;  4IJI A;  4KDU A;  4K7O A;  1KBN A;  1J08 A;  5B8A A;  3LQ7 A;  1ILO A;  4FH8 A;  5DVB A;  3EMP A;  1Q98 A;  1EOG A;  1WIK A;  5G5E A;  3J7Y b;  3PH9 A;  4ZXG A;  3WGE A;  2R4V A;  2HYX A;  3IXR A;  4KE3 A;  2RUE A;  3ZVJ D;  2YJ7 A;  2DKI A;  5JCG A;  3VI5 A;  2P31 A;  4Z2U A;  4ZIJ A;  4IP6 A;  4OCE A;  1GTI A;  2YN1 A;  3RHC A;  2YWO A;  4K1F A;  4YAP A;  2LS5 A;  2VO4 A;  4MZW A;  3F4S A;  3P8W A;  2YAN A;  4MPG A;  2WJU A;  1ZL9 A;  1TU7 A;  1U3A A;  2MMZ A;  3N5O A;  6GSY A;  3EU4 A;  10GS A;  4J56 E;  5IPG A;  3LJR A;  5FHI A;  3BD2 A;  5LNK e;  5CRG A;  2HSM A;  1AQV A;  3E9J B;  5FT3 A;  3BOA A;  3HDC A;  3IHG A;  1S3C A;  3GNJ A;  5AN1 A;  1AQX A;  2Z9S A;  2B5E A;  5ECO B;  2PVO C;  2DIZ A;  1GUL A;  1PSQ A;  2OKA A;  2B1L A;  2OBK A;  4YQM A;  3DGQ A;  4I2U A;  3FK8 A;  2BJX A;  4LMW A;  1OC8 A;  2C0G A;  4AJ8 A;  4KH7 A;  2TRC P;  2YCD A;  5DCG A;  4GXZ A;  3GH6 A;  1ERV A;  3GX8 A;  2IFQ A;  1XW6 A;  1SJZ A;  1FB6 A;  2DJK A;  1OC3 A;  3FZ4 A;  5DDL A;  1TW9 A;  3KMN A;  1GNW A;  1OAZ A;  3FR3 A;  2FWG A;  2RM6 A;  2HRA A;  2REM A;  2PN8 A;  1N8J A;  2K6V A;  4ILF A;  4MH2 A;  3D4T A;  5JCU A;  1PFO A;  4EF0 A;  1U3I A;  1XWB A;  4KGI A;  3TKS C;  2KOK A;  1O73 A;  4OFT A;  2HLS A;  2VUP A;  3PIN A;  2PPT A;  4F03 A;  3DVW A;  3TOT A;  4MA9 A;  2ZCT A;  1QMV A;  5F06 A;  4KW6 A;  3PGT A;  6GSV A;  3CTG A;  3LOR A;  1TK5 B;  2H0H A;  3FZA A;  5ECQ B;  1M7T A;  3ZFB A;  3ME8 A;  4F9Z A;  2H71 A;  2UZ8 A;  2XBQ A;  18GS A;  1A2M A;  4NHZ A;  1B9Y C;  2LNT A;  4IGJ A;  5ABR A;  2RII A;  3UAR A;  4DSS A;  3IV4 A;  4RQR A;  2IN3 A;  3FEU A;  3GKK A;  4BIK A;  1PGT A;  1QFN A;  1AAZ A;  1GSU A;  5KN1 A;  1SU9 A;  2N5F A;  5E59 A;  2JZR A;  1WPI A;  4YKG A;  2VLT A;  2OAD A;  2C0D A;  2XPE A;  4L0U A;  4ICY A;  1AW9 A;  4Z2T A;  1PN0 A;  5LD0 A;  1TK0 B;  1K3L A;  1SD8 A;  2NBS A;  1MD3 A;  3IDV A;  3TGZ A;  3IC4 A;  2XC2 A;  1MTC A;  3Q19 A;  4FYC A;  2GQL A;  4WBR D;  3I69 A;  4D73 A;  1FOH A;  2FWH A;  4XRD A;  3IRA A;  3F0I A;  3GKN A;  2HXK A;  2VM2 A;  3DVX A;  4OMV A;  5IMA A;  1WP0 A;  1XWC A;  4G19 A;  3DKS A;  3VUR A;  14GS A;  4JE1 A;  1T00 A;  1H4O A;  2IMD A;  2H74 A;  4EC0 A;  1X5E A;  4ZBB A;  1MDJ A;  1THX A;  2I3Y A;  3GH9 A;  3FYG A;  2K8S A;  4HQS A;  4K2D A;  2IMF A;  4EVM A;  1YQ1 A;  4TVE A;  4I97 A;  2CAI A;  4TXO A;  2HSY A;  5LCZ A;  1GLQ A;  1TU8 A;  2PWJ A;  5IMF A;  4MNN A;  3M0F A;  2DJ2 A;  4IN0 A;  4YKF A;  3FR6 A;  4K6X A;  12GS A;  2OE1 A;  2C4J A;  1GSF A;  3GL5 A;  3CSI A;  2NTO A;  3TJB A;  1PX7 A;  4J2F A;  4OWY A;  2WUL A;  4EKZ A;  2B6M A;  4ZL8 A;  4FYU A;  2X8H A;  4G0I A;  2C3N A;  5DJL A;  4PQI A;  1MEK A;  2KP2 A;  3U6V A;  1T3B A;  2R0P A;  5INY A;  5IQY A;  3DML A;  2MMO A;  2OA7 A;  2WDU A;  1O8X A;  1BAY A;  4IBP A;  4N0V A;  4YQU A;  4EE0 A;  4JR4 A;  4G0K A;  5C00 A;  4NXI A;  4MAB A;  2JSY A;  2LQQ A;  3UVT A;  1EZK A;  5KEJ A;  1PMT A;  5E4W A;  4GQF A;  3KM6 A;  3IAS 2;  4IP1 A;  3UIW A;  1OKT A;  4K7I A;  1EOH A;  2HSH A;  4H86 A;  3HD5 A;  4EDY A;  1K0B A;  2JU5 A;  3ZLP A;  3CBU A;  5B7C A;  4WBJ A;  5DQS A;  4FQU A;  1Z9H A;  4V1A p;  2HZE A;  3HVV A;  2LST A;  3ZVJ A;  1NHY A;  2A4H A;  1YF0 A;  2EIO A;  1K0A A;  3P2A A;  4V1A g;  1GL8 A;  1TRV A;  4TN8 A;  3TKP A;  1FAA A;  1G6W A;  3R3E A;  1JZW A;  1V57 A;  1XWG A;  5KOX A;  1GTB A;  1T8E B;  2WS2 A;  4K5R A;  2FNO A;  4NWY A;  4OO5 A;  1XPV A;  3WT1 A;  1XW5 A;  2GZP A;  1S3D A;  5HR2 A;  2OBI A;  3DD3 A;  5IMC A;  1V2A A;  1K0C A;  2RLI A;  2O85 A;  3IE3 A;  5EL8 A;  1YEX A;  3FZ5 A;  3QAW A;  3NIV A;  2ON7 A;  4MJC A;  1AC1 A;  2L6D A;  1X9M B;  1X5D A;  4HDE A;  2H0I A;  2H19 A;  1CQH A;  3KXO A;  4POK A;  3V1W A;  2C1Y A;  1G7E A;  4HU7 A;  2ES7 A;  4CHS A;  3L0H A;  2P5Q A;  4RQX A;  1I9D A;  2CVB A;  1NM3 A;  3PR8 A;  2IME A;  4CDO A;  1ACV A;  1A8Y A;  1ZYE A;  3LG6 A;  5ECN B;  1FW1 A;  2JAD A;  4HI7 A;  4BA7 A;  1M3I A;  3FY7 A;  4TR3 A;  4TR1 A;  4QL9 A;  2HE3 A;  1SL2 B;  2X8C A;  5CYY A;  4BVX A;  1Z3E A;  4QL7 A;  3EUR A;  1A23 A;  1EV9 A;  2H6X A;  1R5P A;  5DAL A;  2LJK A;  4KAE A;  4AGS A;  2FGX A;  2H66 A;  4Z7X A;  4Q5Q A;  2FD3 A;  1GSS A;  4PNF A;  2M46 A;  2AUV A;  3MWH A;  3Q74 A;  5D9T A;  4NMU A;  2H1B A;  1PX6 A;  4USS A;  1ERU A;  3TUE A;  3ZFL A;  1YKA A;  4XIH A;  2CA8 A;  1O81 A;  1TRU A;  2L5L A;  5DQY A;  2A2S A;  3GL3 A;  5EVO A;  2H1G A;  6GSW A;  5G1L A;  7GSS A;  2GSR A;  1XVQ A;  1BX9 A;  1Z6M A;  2XHF A;  4L5L A;  5KN3 A;  1B9X C;  2LRT A;  3KIJ A;  3ZYW A;  1N2A A;  1O7U A;  2F51 A;  3WYW A;  4IKH A;  1DSB A;  2QC7 A;  2YV9 A;  1GLP A;  1G0T A;  4F0B A;  2R0G A;  5CRE A;  2YWI A;  2TIR A;  5GZZ B;  4XHM A;  1HQO A;  4K5S A;  5CRD A;  16GS A;  4X0X A;  4MK3 A;  3EYT A;  3BCI A;  4NHW A;  1TP9 A;  1YF1 A;  3NOF A;  4GWR A;  2NVL A;  1A2J A;  3VK9 A;  3KEB A;  1SKW B;  1W4V A;  2TRX A;  2H1D A;  3QOU A;  5ECK B;  1R4W A;  5L71 A;  1UN2 A;  4NV2 A;  4XCS A;  3PPU A;  5IMV A;  1F3A A;  5G31 A;  3WT2 A;  1UC7 A;  2LJR A;  1URM A;  5AIS A;  1GP1 A;  3F4T A;  3F63 A;  1B48 A;  4POM A;  1NSW A;  1TRW A;  4K0N A;  4WF5 A;  1DE1 A;  2KUC A;  2LV3 A;  4POB A;  3SBC A;  4WF4 A;  1QQ2 A;  4EIP A;  5BMU A;  3F8U A;  3CRU A;  4G2E A;  2LNS A;  2FA4 A;  3C1R A;  4PNG A;  4L8E A;  5B8B A;  4MLY A;  1Z5Y E;  2L57 A;  6GSX A;  2V6O A;  2YJH A;  3I6A A;  3QD9 A;  1K3O A;  3A5I A;  1XCC A;  2RM5 A;  4PX1 A;  4BVY B;  3TKR A;  2DJJ A;  3IOS A;  5DAK A;  2DJ0 A;  5JWQ B;  2DC5 A;  5IOW A;  1HNB A;  3TKS E;  4GQC A;  4KSO A;  3ISO A;  2HT9 A;  3D5J A;  1EP8 A;  3FMW A;  3APO A;  1FO5 A;  4QQ7 A;  4ECC A;  2H6Z A;  4HOJ A;  3QR6 A;  2ON5 A;  2XBI A;  1OE8 A;  1GWC A;  4CY6 A;  1OVN A;  2IJY A;  1O6J A;  3FRC A;  3G7Y A;  2DJ1 A;  2DLX A;  1XG8 A;  1JZR A;  1SK1 A;  2PMT A;  1TRS A;  2DKH A;  1ZZY A;  1H75 A;  2R5G A;  5DBQ A;  1YKC A;  3M9J A;  4KB3 A;  1U87 A;  3GFK A;  2C3Q A;  1K0N A;  3IAM 2;  1JZO A;  2VLV A;  3HXS A;  3HJP A;  2VCQ A;  4XRA A;  3IHQ A;  3KJY A;  4F82 A;  2LRC A;  2X64 A;  4KDY A;  5ELA A;  3DEX A;  5ID2 A;  2MMN A;  2VD0 A;  5ECI B;  2H8L A;  3KCM A;  2VL3 A;  1AIU A;  5CP1 A;  5A5K A;  1K3Y A;  1J0F A;  1V40 A;  3RPN A;  3GUR A;  3L9V A;  3A2V A;  3BBY A;  1M2B A;  4O92 A;  4XS6 A;  4GSN A;  5J9B A;  3LYK A;  2GLR A;  3TJK A;  5H5R A;  4N10 A;  2FA8 A;  4JU5 A;  5H5S A;  1SYR A;  5D9W A;  1YDK A;  3GRX A;  2QA2 A;  1K0O A;  3LGC A;  2O87 A;  3CQF A;  1TI3 A;  3GIX A;  1ERT A;  3HJM A;  2CT6 A;  5KN2 A;  2WZ9 A;  1M9B A;  5B6N A;  4HEA 2;  4V2N A;  3HYP A;  4N30 A;  4NAX A;  2H76 A;  3KTL A;  2CQ9 A;  4PTS A;  2K9F A;  4WXT A;  3GST A;  5D93 A;  2YP6 A;  3C7M A;  5D73 A;  5IOX A;  3KZQ A;  4MMM A;  4MF7 A;  2FWE A;  3HCZ A;  2H75 A;  5HFI A;  1GUK A;  1WMJ A;  4KX4 A;  2H0G A;  1ABA A;  1CQG A;  5J4U A;  1XVW A;  2WCI A;  3QDN A;  1XWA A;  3MIX A;  1IYH A;  1A8L A;  4DSR A;  4ZB6 A;  1GUM A;  2FY6 A;  3GV1 A;  1S3A A;  2KP1 A;  1RW1 A;  3CSJ A;  4L5O A;  5JWO B;  2CX3 A;  1WWJ A;  1MD4 A;  4AJ7 A;  1ZMA A;  5GST A;  1EEM A;  1FOV A;  4E8E A;  3FW2 A;  3MSZ A;  5CNW A;  4IHU A;  3S9F A;  1ZYQ B;  1XOA A;  1OKD A;  1F6M C;  2H70 A;  5GAN D;  2HI7 A;  1A0F A;  4YH2 A;  2EIR A;  3WGD A;  4IEL A;  3D22 A;  5FWG A;  1PRX A;  3QMX A;  3MNG A;  2HNL A;  1PQN A;  1FG4 A;  3IBH A;  3L78 A;  1MDK A;  1X5C A;  4WR5 A;  1QUW A;  1FB0 A;  13GS A;  1UVZ A;  1GH2 A;  1RK4 A;  3ERF A;  1T4Z A;  3U5R E;  2C3T A;  2X4A A;  4G10 A;  4E8H A;  2JAC A;  1WRY A;  1XBS A;  2V1M A;  3F6D A;  4KA0 A;  4ZBD A;  2VCW A;  2DMM A;  2VOC A;  4I8B A;  1J9B A;  2V6K A;  2YZH A;  4IS0 A;  2OE3 A;  1WOU A;  4DEJ A;  4G0L A;  1E6B A;  4LMV A;  2D2Z A;  2VD1 A;  3LEF A;  1T7P B;  1TXX A;  1ON4 A;  2PER A;  1AUC A;  4D73 B;  3C8E A;  2LJA A;  5HR0 A;  2GGT A;  4IQA A;  2AYT A;  3DXB A;  8GSS A;  1WE0 A;  2B5Y A;  3HZ8 A;  3P90 A;  3GTU B;  3O6T A;  2FLS A;  4TKY A;  4OCF A;  4EO3 A;  2OAC A;  3H8Q A;  5J41 A;  1X9W B;  4JRR A;  1OYJ A;  1EGR A;  3APS A;  1YEP A;  3O76 A;  1B4Q A;  1THO A;  3IR4 A;  1PKZ A;  11GS A;  4EDZ A;  2R2J A;  4HU9 A;  4AF2 A;  3WGX A;  4PUF C;  2YWM A;  3LWA A;  3E3E A;  5IPH A;  4MZC A;  1B8X A;  2V32 A;  5ECM B;  1SK2 A;  1M9A A;  1O8W A;  3TRP A;  3ZMK A;  4ECJ A;  3RBT A;  3P7X A;  2L4Q A;  4AJ6 A;  2HFD A;  2CX4 A;  2L4C A;  4K2X A;  5AIV A;  3CYN A;  3EC3 A;  1SKS B;  1B4P A;  3F9U A;  2H1A A;  5HFG A;  5DJM A;  4BL7 B;  1EGO A;  2YWN A;  2LTK A;  1KNG A;  4ID0 A;  2FCH A;  1Z7P A;  3HZ4 A;  4MZB A;  2YNX A;  1T1V A;  2GT5 A;  3FZ9 A;  4XTS A;  3VPT A;  3TDG A;  2VAF A;  3D21 A;  4I2T A;  2GSS A;  5KN0 A;  1MDI A;  1XWK A;  2H73 A;  4MP4 A;  2MZC A;  2L6C A;  4IJ3 A;  3ZML A;  4EUY A;  1YJ6 A;  4TR0 A;  4Z2R A;  3VFI A;  2R3X A;  4OFN A;  1GRX A;  2AV4 A;  1ERW A;  2HZE B;  1F9M A;  2M72 A;  3EU3 A;  3F4R A;  3QFB C;  4JBB A;  3GX0 A;  2BTO T;  1ZCP A;  1DUG A;  3F3Q A;  2X49 A;  4X4J A;  2A2R A;  3G9B A;  2J23 A;  3LYP A;  1VGL A;  4KSM A;  4MF5 A;  5A4U A;  4ZB9 A;  3DRN A;  1XXU A;  5F0G A;  2F8A A;  2VM1 A;  22GS A;  3UJ1 A;  3IC8 A;  1O85 A;  4TRX A;  1G6Y A;  2IWT A;  1PKW A;  4XS4 B;  1V58 A;  2X99 A;  4MJA A;  1W89 A;  5C04 A;  1PL2 A;  3IPZ A;  2M80 A;  5J3R A;  4BVY A;  4O7H A;  3MAK A;  3DYR A;  1GSQ A;  4NPB A;  4PQ1 A;  5DCH A;  1ML6 A;  3EWL A;  4PXO A;  3D4M A;  1GSE A;  1OC9 B;  3CXG A;  3H93 A;  4OO4 A;  3TOU A;  4ZIL A;  5F07 A;  2PUK C;  3TCO A;  2PBJ A;  2CZ2 A;  1FVK A;  2CVD A;  19GS A;  2WB9 A;  4O32 A;  2GTU A;  4MCU A;  1VF2 A;  2H30 A;  3VWX A;  4WEY A;  5CAX A;  5JCW A;  1HYU A;  3LSZ A;  4JR6 A;  2EC4 A;  3R2Q A;  3ERW A;  2PU9 C;  2CV4 A;  1A0R P;  3KP9 A;  4MF6 A;  4ISD A;  2P0G A;  2BMX A;  4MPF A;  2DJ3 A;  1HD2 A;  1NW2 A;  3G7J A;  1AQW A;  1X9S B;  4IQ1 A;  1SEN A;  3FHK A;  4KND A;  2B1K A;  2DBC A;  2B7J A;  1OE7 A;  1ZGN A;  4IVF A;  3LFL A;  3O3T A;  2VL9 A;  2AAW A;  2JL4 A;  2PVQ A;  2R6K A;  5IMZ A;  1KEB A;  4PGT A;  4GST A;  5JWR B;  3TJJ A;  1YZX A;  3TJG A;  4PUR A;  2VL2 A;  3EVI A;  5F05 A;  1KTE A;  3HJO A;  6GST A;  4JED A;  1XOB A;  1Y6E A;  4ML6 A;  1FHE A;  4WKW A;  2E2M A;  4ZBA A;  3CMI A;  4O5R A;  5D9X A;  4LL4 B;  3ERG A;  3FR9 A;  3ZIJ A;  4O5Q A;  5IO0 A;  2YV7 A;  4OD7 A;  1TK8 B;  2VCT A;  2GS3 A;  1HNC A;  4YQV A;  1F2E A;  5ECP B;  4PQH A;  4RI7 A;  4GF0 A;  1VF3 A;  3IK7 A;  3CSH A;  5G1K A;  2MBS A;  1QXH A;  1DE2 A;  3GN3 A;  2N5A A;  2KHP A;  2MBT A;  4MJB A;  4I5Q A;  3UBK A;  4ZL7 A;  1EWX A;  3ZTL A;  4BWQ A;  1M99 A;  2FUG 2;  5G30 A;  2LKU A;  5CRH A;  5D8I A;  2LRN A;  4FIW A;  1EEJ A;  4NV5 A;  5B6M A;  2I9H A;  2ALB A;  1M3J A;  3J7Y k;  3C1S A;  1ZOF A;  3KMO A;  4JZQ A;  4Q5N A;  2KLX A;  1V98 A;  4MDC A;  2NPB A;  4Q5R A;  2CZ3 A;  3KH9 A;  3QAV A;  1ZYN A;  3BJ5 A;  5KOW A;  3QAG A;  1TDI A;  1V9W A;  4X1U A;  3H4K A;  9GSS A;  2WFC A;  1ST9 A;  4KF9 A;  3M1G A;  1VF1 A;  3NZN A;  4LLR A;  5ECR B;  3I43 A;  3A5W A;  5BRT A;  4FYB A;  1Q4J A;  4P3Y B;  3I9V 2;  3F6F A;  4CW9 A;  4CY8 A;  2F8F A;  2VCZ A;  2C8U A;  4HJM A;  5GSS A;  2HZF A;  5DAK B;  2HRK A;  3DIE A;  3ED3 A;  3D6I A;  2I81 A;  1SJ6 A;  3ZIV A;  4TW5 A;  3VWV A;  3GYK A;  2K8V A;  1TJD A;  3AY8 A;  3F3R A;  3ZIT A;  1BJX A;  4L0W A;  5COH A;  2E0Q A;  1TI1 A;  2IL3 A;  1RQM A;  3IA1 A;  4DVC A;  1LJR A;  4EIQ A;  2I1U A;  2OJL A;  5CO3 A;  3UOM A;  4GSS A;  4GLT A;  2IMK A;  17GS A;  1M0U A;  2VCV A;  2MMA A;  20GS A;  1PL1 A;  2A2P A;  2B5X A;  2QA1 A;  4G9H A;  5IMD A;  3UBL A;  1YY7 A;  2E7P A;  1M2D A;  3TRX A;  3MDK A;  4HS1 A;  2IFQ B;  3A2X A;  2L59 A;  3HY2 A;  5ID2 B;  2G0F A;  1F37 A;  1Y25 A;  1SYX A;  2H01 A;  3APQ A;  1U6T A;  4HSC X;  4ULX A;  3UL3 A;  2V2G A;  3E0U A;  1JFU A;  2VCX A;  4KUN A;  1BG5 A;  3L9S A;  3UMA A;  1BED A;  1DBY A;  1R5A A;  3SWL A;  1BQ7 A;  3LXT A;  2LEG A;  2P5R A;  3TJF A;  1S3R A;  1BYE A;  2HRN A;  3GKX A;  2F3M A;  2X8G A;  3VPQ A;  3GTU A;  3HVN A;  1EP7 A;  1QK8 A;  4XS1 A;  4ECI A;  2VL2 C;  5A4V A;  2IMI A;  1GTU A;  3LXZ A;  3UEM A;  1AXD A;  3CRT A;  3UAP A;  3GSS A;  4DSS B;  1JLV A;  5AIX A;  2R0C A;  1SKR B;  3WD6 A;  3UVH A;  1NHO A;  3C73 A;  4WET A;  3EMX A;  2O89 A;  1SJI A;  1LU4 A;  2DSA A;  1XZO A;  2ZUP A;  2JZS A;  1HNA A;  2AHE A;  3LW9 A;  3QCP A;  2VLU A;  5IO2 A;  3EPT A;  3Q6O A;  2NDO A;  3D0Z A;  3RHB A;  2GZY A;  3A3T A;  4HUA A;  4BL7 A;  3W8J A;  3EIN A;  3K8N A;  2VIM A;  2QGV A;  4K7N A;  1SL0 B;  1R7H A;  3GUS A;  2GDR A;  1ZYP A;  4GRF A;  2PGT A;  2DIY A;  3US3 A;  2GT6 A;  4MJE A;  2RUF A;  5D96 A;  1F3B A;  3A2W A;  5ELG A;  4KDX A;  1A2L A;  1TTZ A;  4X43 A;  2N5B A;  5HR1 A;  4HJ2 A;  5IIZ A;  4HZ4 A;  4A5P A;  2J9H A;  5F8B A;  4LA1 A;  4F0C A;  3HA9 A;  2WRT A;  3IK9 A;  4K8M A;  2JSZ A;  5HFK A;  1GSY A;  3N9J A;  3VWW A;  2OE0 A;  4TXO B;  3W6G A;  5EY6 A;  2G2Q A;  1R26 A;  2AB6 A;  2YPM A;  4F2I A;  4ACS A;  4HQZ A;  4LL1 B;  3GHA A;  1EV4 A;  1JHB A;  3ZL5 A;  5EPF A;  2O8V B;  4YAV A;  3RAZ A;  2FWF A;  4GTU A;  5G2Z A;  1SK0 A;  2K18 A;  4K0G A;  2I4A A;  4ECB A;  4EL1 A;  1XW9 A;  2HRF A;  3L4N A;  2GST A;  1USB A;  2GQM A;  1PN9 A;  2H6Y A;  4N0Z A;  2LQO A;  4XS4 A;  1GNE A;  2JZT A;  4ZB8 A;  4TXV A;  2GQK A;  5ECS A;  5H5Q A;  1Z7R A;  5A4W A;  4POL A;  3HVS A;  1A24 A;  3ZRD A;  3DWV A;  5AGY A;  2F9S A;  3C71 A;  1OC9 A;  3KD0 A;  4MH3 A;  2YOI A;  3QPM A;  4EXJ A;  3KTB A;  3W8S A;  1SD9 A;  1IYI A;  1K0D A;  1QGV A;  5ECL B;  4Q5F A;  1Z6N A;  2EIQ A;  3FKF A;  2A4V A;  2O7K A;  4N11 A;  4IW9 A;  2WGR A;  2IIY A;  2DML A;  1FVJ A;  2L5O A;  2YZU A;  3RDW A;  1K0M A;  3TRQ A;  4HZ2 A;  3TKS A;  2QKE A;  2XPD A;  3GMF A;  5D9V A;  3M8N A; 
#chains in the Genus database with same CATH homology
 3TB2 A;  2CVK A;  6GSU A;  4OFM A;  1GSD A;  1VRS D;  3RPP A;  1GUH A;  2H72 A;  3HKR A;  5J9C A;  1T4Y A;  4RI6 A;  2B3S A;  1JZD A;  3ME7 A;  1VF4 A;  3BCK A;  1SL1 B;  4GCI A;  3GA4 A;  1X0R A;  2FHE A;  1JLW A;  5HR3 A;  4BPY A;  2R37 A;  3VLN A;  5ECH B;  4TR4 A;  1PA3 A;  4FO5 A;  1XIY A;  4KCE A;  1TKD B;  2B7K A;  4BWS A;  1XFL A;  3G7I A;  1GTA A;  3VI7 A;  2V41 A;  3EE2 A;  1LBK A;  3JCM L;  1WJK A;  1C72 A;  3OR5 A;  3M9K A;  1PD2 1;  3QFA C;  1M2A A;  4J57 E;  2IPA A;  4PUA A;  5ENU A;  5GAP D;  3HHV A;  4TOP A;  1G7O A;  1E2Y A;  3TKQ A;  2CAQ A;  4RUV A;  2QSI A;  3HVX A;  3M3M A;  4ZL9 A;  2C80 A;  2C0F A;  4ML1 A;  3CTF A;  1TOF A;  3ZZX A;  5CRW A;  3H79 A;  2E2G A;  4TR1 B;  4I6X A;  5IM9 A;  1U88 A;  5HQP A;  2GZZ A;  4KCA A;  1UA5 A;  3ZRE A;  4BVX B;  3L9U A;  5G5F A;  3GKM A;  3KP8 A;  2AJQ B;  5DAL B;  3H1N A;  2GVP A;  4V2M A;  4O5U A;  4V2L A;  1I5G A;  2C0E A;  3VWU A;  4K9Z A;  2GSQ A;  3KGK A;  4DSQ A;  2LUS A;  3Q18 A;  2ZNM A;  5J5N A;  4WR4 A;  3KH7 A;  6GSS A;  2MYG A;  3MYD A;  4IJI A;  4KDU A;  4K7O A;  1KBN A;  1J08 A;  5B8A A;  3LQ7 A;  1ILO A;  4FH8 A;  5DVB A;  3EMP A;  1Q98 A;  1EOG A;  1WIK A;  5G5E A;  3J7Y b;  3PH9 A;  4ZXG A;  3WGE A;  2R4V A;  2HYX A;  3IXR A;  4KE3 A;  2RUE A;  3ZVJ D;  2YJ7 A;  2DKI A;  5JCG A;  3VI5 A;  2P31 A;  4Z2U A;  4ZIJ A;  4IP6 A;  4OCE A;  1GTI A;  2YN1 A;  3RHC A;  2YWO A;  4K1F A;  4YAP A;  2LS5 A;  2VO4 A;  4MZW A;  3F4S A;  3P8W A;  2YAN A;  4MPG A;  2WJU A;  1ZL9 A;  1TU7 A;  1U3A A;  2MMZ A;  3N5O A;  6GSY A;  3EU4 A;  10GS A;  4J56 E;  5IPG A;  3LJR A;  5FHI A;  3BD2 A;  5LNK e;  5CRG A;  2HSM A;  1AQV A;  3E9J B;  5FT3 A;  3BOA A;  3HDC A;  3IHG A;  1S3C A;  3GNJ A;  5AN1 A;  1AQX A;  2Z9S A;  2B5E A;  5ECO B;  2PVO C;  2DIZ A;  1GUL A;  1PSQ A;  2OKA A;  2B1L A;  2OBK A;  4YQM A;  3DGQ A;  4I2U A;  3FK8 A;  2BJX A;  4LMW A;  1OC8 A;  2C0G A;  4AJ8 A;  4KH7 A;  2TRC P;  2YCD A;  5DCG A;  4GXZ A;  3GH6 A;  1ERV A;  3GX8 A;  2IFQ A;  1XW6 A;  1SJZ A;  1FB6 A;  2DJK A;  1OC3 A;  3FZ4 A;  5DDL A;  1TW9 A;  3KMN A;  1GNW A;  1OAZ A;  3FR3 A;  2FWG A;  2RM6 A;  2HRA A;  2REM A;  2PN8 A;  1N8J A;  2K6V A;  4ILF A;  4MH2 A;  3D4T A;  5JCU A;  4EF0 A;  1U3I A;  1XWB A;  4KGI A;  3TKS C;  2KOK A;  1O73 A;  4OFT A;  2HLS A;  2VUP A;  3PIN A;  2PPT A;  4F03 A;  3DVW A;  3TOT A;  4MA9 A;  2ZCT A;  1QMV A;  5F06 A;  4KW6 A;  3PGT A;  6GSV A;  3CTG A;  3LOR A;  1TK5 B;  2H0H A;  3FZA A;  5ECQ B;  1M7T A;  3ZFB A;  3ME8 A;  4F9Z A;  2H71 A;  2UZ8 A;  2XBQ A;  18GS A;  1A2M A;  4NHZ A;  1B9Y C;  2LNT A;  4IGJ A;  5ABR A;  2RII A;  3UAR A;  4DSS A;  3IV4 A;  4RQR A;  2IN3 A;  3FEU A;  3GKK A;  1PGT A;  1QFN A;  1AAZ A;  1GSU A;  5KN1 A;  1SU9 A;  2N5F A;  5E59 A;  2JZR A;  1WPI A;  4YKG A;  2VLT A;  2OAD A;  2C0D A;  2XPE A;  4L0U A;  4ICY A;  1AW9 A;  4Z2T A;  1PN0 A;  5LD0 A;  1TK0 B;  1K3L A;  1SD8 A;  2NBS A;  1MD3 A;  3IDV A;  3TGZ A;  3IC4 A;  2XC2 A;  1MTC A;  3Q19 A;  4FYC A;  2GQL A;  4WBR D;  3I69 A;  4D73 A;  1FOH A;  2FWH A;  4XRD A;  3IRA A;  3F0I A;  3GKN A;  2HXK A;  2VM2 A;  3DVX A;  4OMV A;  5IMA A;  1WP0 A;  1XWC A;  4G19 A;  3DKS A;  3VUR A;  14GS A;  4JE1 A;  1T00 A;  1H4O A;  2IMD A;  2H74 A;  4EC0 A;  1X5E A;  4ZBB A;  1MDJ A;  1THX A;  2I3Y A;  3GH9 A;  3FYG A;  2K8S A;  4HQS A;  4K2D A;  2IMF A;  4EVM A;  1YQ1 A;  4TVE A;  4I97 A;  2CAI A;  4TXO A;  2HSY A;  5LCZ A;  1GLQ A;  1TU8 A;  2PWJ A;  5IMF A;  4MNN A;  3M0F A;  2DJ2 A;  4IN0 A;  4YKF A;  3FR6 A;  4K6X A;  12GS A;  2OE1 A;  2C4J A;  1GSF A;  3GL5 A;  3CSI A;  2NTO A;  3TJB A;  1PX7 A;  4J2F A;  4OWY A;  2WUL A;  4EKZ A;  2B6M A;  4ZL8 A;  4FYU A;  2X8H A;  4G0I A;  2C3N A;  5DJL A;  4PQI A;  1MEK A;  2KP2 A;  3U6V A;  1T3B A;  2R0P A;  5INY A;  5IQY A;  3DML A;  2MMO A;  2OA7 A;  2WDU A;  1O8X A;  1BAY A;  4IBP A;  4N0V A;  4YQU A;  4EE0 A;  4JR4 A;  4G0K A;  5C00 A;  4NXI A;  4MAB A;  2JSY A;  2LQQ A;  3UVT A;  1EZK A;  5KEJ A;  1PMT A;  5E4W A;  4GQF A;  3KM6 A;  3IAS 2;  4IP1 A;  3UIW A;  1OKT A;  4K7I A;  1EOH A;  2HSH A;  4H86 A;  3HD5 A;  4EDY A;  1K0B A;  2JU5 A;  3ZLP A;  3CBU A;  5B7C A;  4WBJ A;  5DQS A;  4FQU A;  1Z9H A;  4V1A p;  2HZE A;  3HVV A;  2LST A;  3ZVJ A;  1NHY A;  2A4H A;  1YF0 A;  2EIO A;  1K0A A;  3P2A A;  4V1A g;  1GL8 A;  1TRV A;  4TN8 A;  3TKP A;  1FAA A;  1G6W A;  3R3E A;  1JZW A;  1V57 A;  1XWG A;  5KOX A;  1GTB A;  1T8E B;  2WS2 A;  4K5R A;  2FNO A;  4NWY A;  4OO5 A;  1XPV A;  3WT1 A;  1XW5 A;  2GZP A;  1S3D A;  5HR2 A;  2OBI A;  3DD3 A;  5IMC A;  1V2A A;  1K0C A;  2RLI A;  2O85 A;  3IE3 A;  5EL8 A;  1YEX A;  3FZ5 A;  3QAW A;  3NIV A;  2ON7 A;  4MJC A;  1AC1 A;  2L6D A;  1X9M B;  1X5D A;  4HDE A;  2H0I A;  2H19 A;  1CQH A;  3KXO A;  4POK A;  3V1W A;  2C1Y A;  1G7E A;  4HU7 A;  2ES7 A;  4CHS A;  3L0H A;  2P5Q A;  4RQX A;  1I9D A;  2CVB A;  1NM3 A;  3PR8 A;  2IME A;  4CDO A;  1ACV A;  1A8Y A;  1ZYE A;  3LG6 A;  5ECN B;  1FW1 A;  2JAD A;  4HI7 A;  4BA7 A;  3FY7 A;  4TR3 A;  4TR1 A;  4QL9 A;  2HE3 A;  1SL2 B;  2X8C A;  5CYY A;  4BVX A;  1Z3E A;  4QL7 A;  3EUR A;  1A23 A;  1EV9 A;  2H6X A;  1R5P A;  5DAL A;  2LJK A;  4KAE A;  4AGS A;  2FGX A;  2H66 A;  4Z7X A;  4Q5Q A;  2FD3 A;  1GSS A;  4PNF A;  2M46 A;  2AUV A;  3MWH A;  3Q74 A;  5D9T A;  4NMU A;  2H1B A;  1PX6 A;  4USS A;  1ERU A;  3TUE A;  3ZFL A;  1YKA A;  4XIH A;  2CA8 A;  1O81 A;  1TRU A;  2L5L A;  5DQY A;  2A2S A;  3GL3 A;  5EVO A;  2H1G A;  6GSW A;  5G1L A;  7GSS A;  2GSR A;  1XVQ A;  1BX9 A;  1Z6M A;  2XHF A;  4L5L A;  5KN3 A;  1B9X C;  2LRT A;  3KIJ A;  3ZYW A;  1N2A A;  1O7U A;  2F51 A;  3WYW A;  4IKH A;  1DSB A;  2QC7 A;  2YV9 A;  1GLP A;  1G0T A;  4F0B A;  2R0G A;  5CRE A;  2YWI A;  2TIR A;  5GZZ B;  4XHM A;  1HQO A;  4K5S A;  5CRD A;  16GS A;  4X0X A;  4MK3 A;  3EYT A;  3BCI A;  4NHW A;  1TP9 A;  1YF1 A;  3NOF A;  4GWR A;  2NVL A;  1A2J A;  3VK9 A;  3KEB A;  1SKW B;  1W4V A;  2TRX A;  2H1D A;  3QOU A;  5ECK B;  1R4W A;  5L71 A;  1UN2 A;  4NV2 A;  4XCS A;  3PPU A;  5IMV A;  1F3A A;  5G31 A;  3WT2 A;  1UC7 A;  2LJR A;  1URM A;  5AIS A;  1GP1 A;  3F4T A;  3F63 A;  1B48 A;  4POM A;  1NSW A;  1TRW A;  4K0N A;  4WF5 A;  1DE1 A;  2KUC A;  2LV3 A;  4POB A;  3SBC A;  4WF4 A;  1QQ2 A;  4EIP A;  5BMU A;  3F8U A;  3CRU A;  4G2E A;  2LNS A;  2FA4 A;  3C1R A;  4PNG A;  4L8E A;  5B8B A;  4MLY A;  1Z5Y E;  2L57 A;  6GSX A;  2V6O A;  2YJH A;  3I6A A;  3QD9 A;  1K3O A;  3A5I A;  1XCC A;  2RM5 A;  4PX1 A;  4BVY B;  3TKR A;  2DJJ A;  3IOS A;  5DAK A;  2DJ0 A;  5JWQ B;  2DC5 A;  5IOW A;  1HNB A;  3TKS E;  4GQC A;  4KSO A;  3ISO A;  2HT9 A;  3D5J A;  1EP8 A;  3FMW A;  3APO A;  1FO5 A;  4QQ7 A;  4ECC A;  2H6Z A;  4HOJ A;  3QR6 A;  2ON5 A;  2XBI A;  1OE8 A;  1GWC A;  4CY6 A;  1OVN A;  2IJY A;  1O6J A;  3FRC A;  3G7Y A;  2DJ1 A;  2DLX A;  1JZR A;  1SK1 A;  2PMT A;  1TRS A;  2DKH A;  1ZZY A;  1H75 A;  2R5G A;  5DBQ A;  1YKC A;  3M9J A;  4KB3 A;  1U87 A;  3GFK A;  2C3Q A;  1K0N A;  3IAM 2;  1JZO A;  2VLV A;  3HXS A;  3HJP A;  2VCQ A;  4XRA A;  3IHQ A;  3KJY A;  4F82 A;  2LRC A;  2X64 A;  4KDY A;  5ELA A;  3DEX A;  5ID2 A;  2MMN A;  2VD0 A;  5ECI B;  2H8L A;  3KCM A;  2VL3 A;  1AIU A;  5CP1 A;  5A5K A;  1K3Y A;  1J0F A;  1V40 A;  3RPN A;  3GUR A;  3L9V A;  3A2V A;  3BBY A;  1M2B A;  4O92 A;  4XS6 A;  4GSN A;  5J9B A;  3LYK A;  2GLR A;  3TJK A;  5H5R A;  4N10 A;  2FA8 A;  4JU5 A;  5H5S A;  1SYR A;  5D9W A;  1YDK A;  3GRX A;  2QA2 A;  1K0O A;  3LGC A;  2O87 A;  3GIX A;  1TI3 A;  1ERT A;  3HJM A;  2CT6 A;  5KN2 A;  2WZ9 A;  1M9B A;  5B6N A;  4HEA 2;  4V2N A;  3HYP A;  4N30 A;  4NAX A;  2H76 A;  3KTL A;  2CQ9 A;  4PTS A;  2K9F A;  4WXT A;  3GST A;  5D93 A;  2YP6 A;  3C7M A;  5D73 A;  5IOX A;  3KZQ A;  4MMM A;  4MF7 A;  2FWE A;  3HCZ A;  2H75 A;  5HFI A;  1GUK A;  1WMJ A;  4KX4 A;  2H0G A;  1ABA A;  1CQG A;  5J4U A;  1XVW A;  2WCI A;  3QDN A;  1XWA A;  3MIX A;  1IYH A;  1A8L A;  4DSR A;  4ZB6 A;  1GUM A;  2FY6 A;  3GV1 A;  1S3A A;  2KP1 A;  1RW1 A;  3CSJ A;  4L5O A;  5JWO B;  2CX3 A;  1WWJ A;  1MD4 A;  4AJ7 A;  1ZMA A;  5GST A;  1EEM A;  1FOV A;  4E8E A;  3FW2 A;  3MSZ A;  5CNW A;  4IHU A;  3S9F A;  1ZYQ B;  1XOA A;  1OKD A;  1F6M C;  2H70 A;  5GAN D;  2HI7 A;  1A0F A;  4YH2 A;  2EIR A;  3WGD A;  4IEL A;  3D22 A;  5FWG A;  1PRX A;  3QMX A;  3MNG A;  2HNL A;  1PQN A;  1FG4 A;  3IBH A;  3L78 A;  1MDK A;  1X5C A;  4WR5 A;  1QUW A;  1FB0 A;  13GS A;  1UVZ A;  1GH2 A;  1RK4 A;  3ERF A;  1T4Z A;  3U5R E;  2C3T A;  2X4A A;  4G10 A;  4E8H A;  2JAC A;  1WRY A;  1XBS A;  2V1M A;  3F6D A;  4KA0 A;  4ZBD A;  2VCW A;  2DMM A;  2VOC A;  4I8B A;  1J9B A;  2V6K A;  2YZH A;  4IS0 A;  2OE3 A;  1WOU A;  4DEJ A;  4G0L A;  1E6B A;  4LMV A;  2D2Z A;  2VD1 A;  3LEF A;  1T7P B;  1TXX A;  1ON4 A;  2PER A;  1AUC A;  4D73 B;  3C8E A;  2LJA A;  5HR0 A;  2GGT A;  4IQA A;  2AYT A;  3DXB A;  8GSS A;  1WE0 A;  2B5Y A;  3HZ8 A;  3P90 A;  3GTU B;  3O6T A;  2FLS A;  4TKY A;  4OCF A;  4EO3 A;  2OAC A;  3H8Q A;  5J41 A;  1X9W B;  4JRR A;  1OYJ A;  1EGR A;  3APS A;  1YEP A;  3O76 A;  1B4Q A;  1THO A;  3IR4 A;  1PKZ A;  11GS A;  4EDZ A;  2R2J A;  4HU9 A;  4AF2 A;  3WGX A;  4PUF C;  2YWM A;  3LWA A;  3E3E A;  5IPH A;  4MZC A;  1B8X A;  2V32 A;  5ECM B;  1SK2 A;  1M9A A;  1O8W A;  3TRP A;  3ZMK A;  4ECJ A;  3RBT A;  3P7X A;  2L4Q A;  4AJ6 A;  2HFD A;  2CX4 A;  2L4C A;  4K2X A;  5AIV A;  3CYN A;  3EC3 A;  1SKS B;  1B4P A;  3F9U A;  2H1A A;  5HFG A;  5DJM A;  4BL7 B;  1EGO A;  2YWN A;  2LTK A;  1KNG A;  4ID0 A;  2FCH A;  1Z7P A;  3HZ4 A;  4MZB A;  2YNX A;  1T1V A;  2GT5 A;  3FZ9 A;  4XTS A;  3VPT A;  3TDG A;  2VAF A;  3D21 A;  4I2T A;  2GSS A;  5KN0 A;  1MDI A;  1XWK A;  2H73 A;  4MP4 A;  2MZC A;  2L6C A;  4IJ3 A;  3ZML A;  4EUY A;  1YJ6 A;  4TR0 A;  4Z2R A;  3VFI A;  2R3X A;  4OFN A;  1GRX A;  2AV4 A;  1ERW A;  2HZE B;  1F9M A;  2M72 A;  3EU3 A;  3F4R A;  3QFB C;  4JBB A;  3GX0 A;  2BTO T;  1ZCP A;  1DUG A;  3F3Q A;  2X49 A;  4X4J A;  2A2R A;  3G9B A;  2J23 A;  3LYP A;  1VGL A;  4KSM A;  4MF5 A;  5A4U A;  4ZB9 A;  3DRN A;  1XXU A;  5F0G A;  2F8A A;  2VM1 A;  22GS A;  3UJ1 A;  3IC8 A;  1O85 A;  4TRX A;  1G6Y A;  2IWT A;  1PKW A;  4XS4 B;  1V58 A;  2X99 A;  4MJA A;  1W89 A;  5C04 A;  1PL2 A;  3IPZ A;  2M80 A;  5J3R A;  4BVY A;  4O7H A;  3MAK A;  3DYR A;  1GSQ A;  4NPB A;  4PQ1 A;  5DCH A;  1ML6 A;  3EWL A;  4PXO A;  3D4M A;  1GSE A;  1OC9 B;  3CXG A;  3H93 A;  4OO4 A;  3TOU A;  4ZIL A;  5F07 A;  2PUK C;  3TCO A;  2PBJ A;  2CZ2 A;  1FVK A;  2CVD A;  19GS A;  2WB9 A;  4O32 A;  2GTU A;  4MCU A;  1VF2 A;  2H30 A;  3VWX A;  4WEY A;  5CAX A;  5JCW A;  1HYU A;  3LSZ A;  4JR6 A;  2EC4 A;  3R2Q A;  3ERW A;  2PU9 C;  2CV4 A;  1A0R P;  3KP9 A;  4MF6 A;  4ISD A;  2P0G A;  2BMX A;  4MPF A;  2DJ3 A;  1HD2 A;  1NW2 A;  3G7J A;  1AQW A;  1X9S B;  4IQ1 A;  1SEN A;  3FHK A;  4KND A;  2B1K A;  2DBC A;  2B7J A;  1OE7 A;  1ZGN A;  4IVF A;  3LFL A;  3O3T A;  2VL9 A;  2AAW A;  2JL4 A;  2PVQ A;  2R6K A;  5IMZ A;  1KEB A;  4PGT A;  4GST A;  5JWR B;  3TJJ A;  1YZX A;  3TJG A;  4PUR A;  2VL2 A;  3EVI A;  5F05 A;  1KTE A;  3HJO A;  6GST A;  4JED A;  1XOB A;  1Y6E A;  4ML6 A;  1FHE A;  4WKW A;  2E2M A;  4ZBA A;  3CMI A;  4O5R A;  5D9X A;  4LL4 B;  3ERG A;  3FR9 A;  3ZIJ A;  4O5Q A;  5IO0 A;  2YV7 A;  4OD7 A;  1TK8 B;  2VCT A;  2GS3 A;  1HNC A;  4YQV A;  1F2E A;  5ECP B;  4PQH A;  4RI7 A;  4GF0 A;  1VF3 A;  3IK7 A;  3CSH A;  5G1K A;  2MBS A;  1QXH A;  1DE2 A;  3GN3 A;  2N5A A;  2KHP A;  2MBT A;  4MJB A;  4I5Q A;  3UBK A;  4ZL7 A;  1EWX A;  3ZTL A;  4BWQ A;  1M99 A;  2FUG 2;  5G30 A;  2LKU A;  5CRH A;  5D8I A;  2LRN A;  4FIW A;  1EEJ A;  4NV5 A;  5B6M A;  2I9H A;  2ALB A;  3J7Y k;  3C1S A;  1ZOF A;  3KMO A;  4JZQ A;  4Q5N A;  2KLX A;  1V98 A;  4MDC A;  2NPB A;  4Q5R A;  2CZ3 A;  3KH9 A;  3QAV A;  1ZYN A;  3BJ5 A;  5KOW A;  3QAG A;  1TDI A;  1V9W A;  4X1U A;  3H4K A;  9GSS A;  2WFC A;  1ST9 A;  4KF9 A;  3M1G A;  1VF1 A;  3NZN A;  4LLR A;  5ECR B;  3I43 A;  3A5W A;  5BRT A;  4FYB A;  1Q4J A;  4P3Y B;  3I9V 2;  3F6F A;  4CW9 A;  4CY8 A;  2F8F A;  2VCZ A;  2C8U A;  4HJM A;  5GSS A;  2HZF A;  5DAK B;  2HRK A;  3DIE A;  3ED3 A;  3D6I A;  2I81 A;  1SJ6 A;  3ZIV A;  4TW5 A;  3VWV A;  3GYK A;  2K8V A;  1TJD A;  3AY8 A;  3F3R A;  3ZIT A;  1BJX A;  4L0W A;  5COH A;  2E0Q A;  1TI1 A;  2IL3 A;  1RQM A;  3IA1 A;  4DVC A;  1LJR A;  4EIQ A;  2I1U A;  2OJL A;  5CO3 A;  3UOM A;  4GSS A;  4GLT A;  2IMK A;  17GS A;  1M0U A;  2VCV A;  2MMA A;  20GS A;  1PL1 A;  2A2P A;  2B5X A;  2QA1 A;  4G9H A;  5IMD A;  3UBL A;  1YY7 A;  2E7P A;  1M2D A;  3TRX A;  3MDK A;  4HS1 A;  2IFQ B;  3A2X A;  2L59 A;  3HY2 A;  5ID2 B;  2G0F A;  1F37 A;  1Y25 A;  1SYX A;  2H01 A;  3APQ A;  1U6T A;  4ULX A;  3UL3 A;  2V2G A;  3E0U A;  1JFU A;  2VCX A;  4KUN A;  1BG5 A;  3L9S A;  3UMA A;  1BED A;  1DBY A;  1R5A A;  3SWL A;  1BQ7 A;  3LXT A;  2LEG A;  2P5R A;  3TJF A;  1BYE A;  2HRN A;  3GKX A;  2F3M A;  2X8G A;  3VPQ A;  3GTU A;  1EP7 A;  1QK8 A;  4XS1 A;  4ECI A;  2VL2 C;  5A4V A;  2IMI A;  1GTU A;  3LXZ A;  3UEM A;  1AXD A;  3CRT A;  3UAP A;  3GSS A;  4DSS B;  1JLV A;  5AIX A;  2R0C A;  1SKR B;  3WD6 A;  3UVH A;  1NHO A;  3C73 A;  4WET A;  3EMX A;  2O89 A;  1SJI A;  1LU4 A;  2DSA A;  1XZO A;  2ZUP A;  2JZS A;  1HNA A;  2AHE A;  3LW9 A;  3QCP A;  2VLU A;  5IO2 A;  3EPT A;  3Q6O A;  2NDO A;  3D0Z A;  3RHB A;  2GZY A;  3A3T A;  4HUA A;  4BL7 A;  3W8J A;  3EIN A;  3K8N A;  2VIM A;  2QGV A;  4K7N A;  1SL0 B;  1R7H A;  3GUS A;  2GDR A;  1ZYP A;  4GRF A;  2PGT A;  2DIY A;  3US3 A;  2GT6 A;  4MJE A;  2RUF A;  5D96 A;  1F3B A;  3A2W A;  5ELG A;  4KDX A;  1A2L A;  1TTZ A;  4X43 A;  2N5B A;  5HR1 A;  4HJ2 A;  5IIZ A;  4HZ4 A;  4A5P A;  2J9H A;  5F8B A;  4LA1 A;  4F0C A;  3HA9 A;  2WRT A;  3IK9 A;  4K8M A;  2JSZ A;  5HFK A;  1GSY A;  3N9J A;  3VWW A;  2OE0 A;  4TXO B;  3W6G A;  5EY6 A;  2G2Q A;  1R26 A;  2AB6 A;  2YPM A;  4F2I A;  4ACS A;  4HQZ A;  4LL1 B;  3GHA A;  1EV4 A;  1JHB A;  3ZL5 A;  5EPF A;  2O8V B;  4YAV A;  3RAZ A;  2FWF A;  4GTU A;  5G2Z A;  1SK0 A;  2K18 A;  4K0G A;  2I4A A;  4ECB A;  4EL1 A;  1XW9 A;  2HRF A;  3L4N A;  2GST A;  1USB A;  2GQM A;  1PN9 A;  2H6Y A;  4N0Z A;  2LQO A;  4XS4 A;  1GNE A;  2JZT A;  4ZB8 A;  4TXV A;  2GQK A;  5ECS A;  5H5Q A;  1Z7R A;  5A4W A;  4POL A;  3HVS A;  1A24 A;  3ZRD A;  3DWV A;  5AGY A;  2F9S A;  3C71 A;  1OC9 A;  3KD0 A;  4MH3 A;  2YOI A;  3QPM A;  4EXJ A;  3KTB A;  3W8S A;  1SD9 A;  1IYI A;  1K0D A;  1QGV A;  5ECL B;  4Q5F A;  1Z6N A;  2EIQ A;  3FKF A;  2A4V A;  2O7K A;  4N11 A;  4IW9 A;  2WGR A;  2IIY A;  2DML A;  1FVJ A;  2L5O A;  2YZU A;  3RDW A;  1K0M A;  3TRQ A;  4HZ2 A;  3TKS A;  2QKE A;  2XPD A;  3GMF A;  5D9V A;  3M8N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...