3RHCA

Crystal structure of the holo form of glutaredoxin c5 from arabidopsis thaliana
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
103
structure length
103
Chain Sequence
SFGSRMEESIRKTVTENTVVIYSKTWCSYCTEVKTLFKRLGVQPLVVELDQLGPQGPQLQKVLERLTGQHTVPNVFVCGKHIGGCTDTVKLNRKGDLELMLAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Glutaredoxin-C5, chloroplastic
publication title Arabidopsis chloroplastic glutaredoxin c5 as a model to explore molecular determinants for iron-sulfur cluster binding into glutaredoxins.
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 33
structure length 103
sequence length 103
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00462 Glutaredoxin Glutaredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3rhcA00
3WYWA 2ZCTA 3M1GA 3BOAA 3IAS2 1GNWA 1T1VA 5CYYA 4RI6A 1XPVA 3KD0A 1A24A 5B8BA 2VLUA 1EZKA 5CRHA 1LBKA 3I6AA 2IMFA 3SBCA 2HRNA 2B1LA 2E2GA 2VL2A 3F4SA 2IL3A 3F3RA 5D9TA 1GTBA 1GTUA 1OC9A 4FO5A 2HZEB 2YZUA 2VL2C 2O8VB 1VF3A 1B4PA 2C1YA 1ZMAA 3A2VA 4MF6A 4KW6A 3RBTA 2H6XA 3D21A 3ERWA 2M46A 3IAM2 5HR3A 2PWJA 2H72A 4EL1A 2DLXA 3A3TA 4K1FA 1DBYA 3F4TA 4MF7A 2LRTA 1TU8A 1SJ6A 3P8WA 4GRFA 2TRXA 3APSA 4BWSA 1BEDA 2FLSA 5DALA 3HXSA 4ZB6A 2H73A 3UMAA 2PBJA 2YV7A 1ZGNA 2P5QA 1JZDA 2KUCA 3TJGA 1T4YA 1JLWA 1GUHA 2VM2A 1GUMA 2VOCA 2R4VA 4TR1A 1ERWA 2KHPA 3W6GA 3L78A 4Q5FA 5DCGA 3PGTA 3TCOA 4OMVA 2FA4A 1TRSA 5GZZB 2F3MA 1MD4A 4DSSB 3KTBA 5DAKB 4KX4A 2JSZA 1B8XA 1K3OA 5KN1A 1A0FA 2IFQA 3BD2A 3UARA 4CHSA 2AJQB 3TKQA 2AHEA 3VURA 5EL8A 2YANA 2PVQA 4JEDA 1ERVA 3KH7A 2MZCA 2GT5A 3TJKA 1A2JA 4WETA 2LUSA 2VAFA 2GZZA 1SU9A 5IO0A 2YCDA 2FWGA 4Q5NA 1XCCA 1OE8A 3CRUA 5CRGA 3LWAA 4F03A 3TRXA 3LXTA 2L4QA 3GN3A 4GWRA 4PUAA 5ECHB 4L5OA 4OFTA 5A4UA 5EY6A 4TN8A 4JE1A 5D9XA 1QGVA 1X5CA 20GSA 4Q5QA 3GURA 2R2JA 3RAZA 1VGLA 4I6XA 5GAND 3EC3A 4K7IA 3MAKA 3HVSA 4HZ2A 4O32A 5JCUA 4OO4A 1XOBA 1TK5B 1SK0A 2H1BA 5J41A 4DSRA 2FWHA 5H5QA 1A2MA 3KH9A 3TRPA 1ILOA 2PERA 3HZ8A 2YN1A 2HI7A 4OFMA 1ZYQB 2K9FA 4IN0A 3OR5A 4AJ8A 2K8SA 2NTOA 1OC8A 2C0GA 2FWFA 3VWVA 4V1Ap 1OC3A 5CP1A 2H1DA 3TKRA 1MDIA 2FUG2 5A5KA 1JLVA 4H86A 1WPIA 4IBPA 3UVTA 2OE0A 2YNXA 2F8FA 1WE0A 4WR5A 4HEA2 4MH3A 5HR2A 1V57A 1ON4A 2B5EA 3P7XA 3VFIA 1EGOA 3IOSA 2H01A 2JU5A 2FHEA 2YWNA 5D96A 1TRUA 3L9VA 1WP0A 4IP1A 3CXGA 5ENUA 4PUFC 2KP2A 4ID0A 4KCAA 6GSXA 1GSUA 2JACA 2FD3A 2OE1A 3M8NA 2P5RA 3DVWA 1EWXA 5IMAA 4YQUA 3TUEA 5KEJA 4ZB9A 5CAXA 5IIZA 3F0IA 5H5SA 1A23A 2VM1A 2FY6A 2WFCA 3FZAA 1GRXA 2DJJA 2KLXA 2XBIA 4X0XA 1NHYA 4V2LA 1M9BA 1G6YA 3VI7A 1GL8A 4E8EA 2GQKA 1OC9B 2MMOA 2WDUA 4BPYA 3A2XA 2H30A 5DBQA 4IELA 10GSA 5EPFA 3BBYA 1ST9A 3ED3A 5HFKA 2V1MA 5HR0A 3UL3A 2C0EA 3HA9A 1SKSB 4DEJA 3O76A 5HR1A 2VCZA 2H19A 2YZHA 3IHQA 4XS6A 3U6VA 4IVFA 5CNWA 1SENA 3QFBC 3KM6A 1FAAA 2TIRA 5GAPD 2YJHA 3QAGA 5DALB 2DMMA 5IMVA 3F9UA 1YJ6A 5LNKe 3GH9A 4FYUA 2D2ZA 2AV4A 2GLRA 1JZOA 3EE2A 2B7JA 4HJMA 3UJ1A 4WBRD 5LD0A 4TR1B 4CDOA 1QK8A 3O6TA 2N5FA 5GSSA 1FW1A 3J7Yb 2PU9C 4Z7XA 1RK4A 2EIRA 2YWMA 5CO3A 5AISA 1EV4A 2MBTA 5ECQB 2L4CA 1VF2A 2IFQB 1GNEA 2JADA 3F63A 5D73A 4QL7A 2F8AA 3APQA 4TR3A 3IV4A 2IMIA 5DDLA 3QR6A 1WRYA 5AGYA 5IMCA 2X64A 4K2DA 1TJDA 2VIMA 1XWAA 4MP4A 1A0RP 4IJIA 4HOJA 2H70A 2OACA 3MNGA 2CX3A 2PUKC 2YPMA 1N2AA 3IE3A 1G0TA 1O73A 4TOPA 4GTUA 3LSZA 3ZFBA 5A4WA 3Q19A 3ME7A 2RUEA 4IHUA 2B1KA 4YAVA 1O81A 1AC1A 1K0CA 4WXTA 2DIZA 4KDUA 2VUPA 1B9XC 3GTUA 5G2ZA 1U87A 1A2LA 2DJ0A 3ZIJA 1BYEA 2CZ3A 2HNLA 3VLNA 1Z6MA 1O8XA 3CRTA 2CT6A 3LFLA 1K0AA 4L0UA 2JZRA 1Z9HA 5IOXA 1FOVA 4KDYA 2WJUA 1AXDA 2OADA 2X8CA 3GL3A 3FR3A 3VWUA 2VD0A 2JL4A 3VWWA 5IPGA 2GS3A 1S3CA 2L5OA 4MPFA 3HDCA 5J3RA 3VI5A 5D8IA 3HJMA 3IPZA 2E2MA 2ZNMA 1F3AA 1PKWA 4POMA 4XRDA 3UBLA 3HVVA 2HSYA 3D6IA 4LMWA 3Q6OA 1B48A 1TOFA 4RQRA 1YF0A 2QGVA 3FW2A 1PQNA 4TRXA 3JCML 1O85A 1V40A 2PMTA 3QPMA 3L9UA 3TJBA 3G7YA 3IDVA 3DKSA 6GSVA 1CQGA 1VF4A 2RM5A 1XVQA 1OE7A 4PURA 5DQSA 1GTIA 2DJ2A 3HD5A 2XBQA 2IJYA 1K0BA 3D22A 5A4VA 4EXJA 3IR4A 4RQXA 1WOUA 1EOGA 4NV5A 4BVYA 4POBA 1H4OA 2X8GA 2M80A 1SK1A 2GSQA 4YAPA 1Z7RA 3EMXA 1QFNA 2ON7A 1GULA 2HSHA 1GSYA 1I9DA 3M9JA 3LG6A 5ECNB 1BG5A 1GP1A 5ECLB 1S3DA 3A5WA 3QAVA 3GL5A 1YY7A 2YOIA 3FEUA 8GSSA 4MH2A 3TKSA 2LV3A 4YH2A 3FKFA 2LEGA 2GGTA 3KP9A 3FZ4A 6GSTA 1GSQA 5D93A 3TKSC 1KTEA 2A2SA 2OE3A 2O89A 5J9BA 3P2AA 1PL1A 1NSWA 3G7IA 5CREA 2NPBA 11GSA 4GSSA 3CBUA 1ML6A 6GSUA 4K0NA 2VL9A 4K7NA 1MDJA 1XWKA 2GZYA 4K9ZA 2WRTA 3GKKA 2LJRA 2I3YA 3KMOA 1EP8A 2HRFA 3L9SA 3WGEA 2H8LA 2GZPA 3Q74A 2HXKA 4MJCA 5FT3A 1U88A 3EYTA 5AIVA 3N5OA 2VL3A 2OBIA 3E9JB 2JSYA 1ZCPA 2FA8A 2HZFA 3PINA 1LU4A 4WF5A 1F3BA 1M2AA 2H0HA 3C71A 3DXBA 5HQPA 3L4NA 1V9WA 2KP1A 3DEXA 2WULA 17GSA 5DQYA 5AIXA 4J2FA 2LS5A 3H1NA 2LRNA 3FZ9A 4RI7A 1EEJA 3TJJA 5E59A 1MD3A 3ERGA 1YEXA 1C72A 4MZBA 4HU7A 1NW2A 1N8JA 2H76A 4N30A 1G6WA 5G31A 1PGTA 3HJPA 4YQMA 2F51A 1M9AA 3FZ5A 3UEMA 1THXA 3EWLA 3KZQA 3EINA 4XS1A 4J56E 1SYRA 3QDNA 5IMDA 2K6VA 2L6DA 5J5NA 1M99A 5IO2A 1R7HA 2CX4A 4WBJA 5J4UA 1K0MA 3US3A 1ABAA 3ME8A 1XIYA 1G7OA 5F07A 3DD3A 3ZTLA 1SJIA 4EDYA 2ES7A 2VLTA 2YJ7A 2JZSA 3I69A 3N9JA 4MA9A 3KP8A 4FH8A 4ECCA 2O7KA 12GSA 3GTUB 2C0FA 5ECPB 4ZBBA 3WT2A 16GSA 2AUVA 4N10A 4MJAA 1U3AA 2P31A 3HVXA 3UIWA 4G9HA 4O5RA 4G10A 5JWQB 5J9CA 4KA0A 1T3BA 4PNFA 4HQSA 1M2BA 3K8NA 2GSTA 4HUAA 3QOUA 4OD7A 1R5AA 4K6XA 3EURA 4OCFA 2LKUA 1RW1A 4N0ZA 1J0FA 4MPGA 5ELGA 3VPTA 3HHVA 1T7PB 2GDRA 2H1AA 1NHOA 3KTLA 4KH7A 4XCSA 1SYXA 1URMA 3HYPA 5F05A 3S9FA 3QFAC 7GSSA 4G2EA 4FYBA 1DE2A 1RQMA 4X43A 2ON5A 5G5FA 1Y25A 2LTKA 2AAWA 3E0UA 3ZITA 2H1GA 1TI3A 2R5GA 1HNCA 2JZTA 3CYNA 3ERFA 1Z3EA 1E2YA 4OCEA 4AF2A 1FG4A 4N11A 4V1Ag 4D73A 3C8EA 1XFLA 2YV9A 4FIWA 4PQ1A 2P0GA 4LL1B 2IWTA 4MMMA 2EC4A 5JCWA 4ML6A 3IBHA 3IRAA 3FK8A 5ELAA 4F82A 5ECOB 3DVXA 2LNSA 1WMJA 1YF1A 4ZB8A 3ZYWA 4ZILA 4LLRA 3LQ7A 9GSSA 1TRVA 1XW6A 1QXHA 1X5DA 3TGZA 2K8VA 5G30A 3RHBA 4TR4A 1AIUA 3GSTA 5F06A 2PPTA 5F0GA 4V2NA 1TRWA 2YWOA 5IQYA 2R6KA 1GSDA 2FNOA 2HLSA 4NV2A 2H71A 2KOKA 4GQCA 4PGTA 4KAEA 5DJLA 1XW5A 2B6MA 1V58A 3LXZA 4YQVA 2NBSA 3HJOA 3CSIA 3ZZXA 2GQMA 4I97A 2LNTA 4ZL7A 4HZ4A 4MCUA 1A8LA 4KCEA 1O6JA 1X9MB 1R4WA 1SK2A 4WR4A 2GSRA 1B4QA 4TXVA 4AJ7A 3GNJA 4OO5A 1GH2A 4FYCA 1YKAA 1PX7A 5ID2A 3M9KA 4GQFA 3FHKA 2PN8A 3GHAA 2XPDA 3MSZA 5KN3A 1IYHA 2BTOT 2YWIA 5C04A 1AAZA 4MK3A 4JRRA 1R26A 2MBSA 6GSWA 2A2RA 4F2IA 4DVCA 1B9YC 4POLA 3H79A 3CSHA 3F8UA 1TW9A 1VRSD 3PR8A 2I1UA 3HCZA 4ACSA 1T8EB 3LGCA 1K0DA 4EKZA 1BQ7A 2WCIA 4PXOA 1OKDA 4KE3A 3HZ4A 4BVXA 1ZZYA 1G7EA 1QQ2A 1OVNA 1UC7A 3DWVA 5ABRA 1PRXA 3BCIA 4JR4A 2EIQA 2B5XA 3CTGA 1TI1A 3TJFA 1UA5A 3QD9A 2E0QA 4K7OA 3GV1A 2C3QA 3CTFA 4GLTA 2H6YA 4PNGA 4PQIA 3DYRA 1JFUA 1XVWA 4PX1A 3UBKA 3C7MA 1F37A 1TKDB 1HNAA 3TKSE 1ZYEA 5H5RA 3H8QA 2N5AA 4MDCA 1SKRB 1IYIA 2MMZA 1JZRA 1T00A 1KEBA 1F9MA 1PN9A 3F6DA 2CQ9A 1UN2A 1X9WB 3LYPA 2OBKA 1M7TA 4EDZA 1QUWA 3SWLA 4IQAA 1KBNA 3ZL5A 2N5BA 3NOFA 3G7JA 1AQWA 1Y6EA 4IQ1A 4NHWA 3FR6A 2IMKA 1EEMA 4POKA 2GT6A 3FYGA 1FVKA 3VWXA 3IK7A 1BAYA 3WGDA 2CVDA 1K3LA 1ACVA 4JR6A 4EC0A 1Z7PA 6GSYA 2ZUPA 2CVBA 4TR0A 2H6ZA 2VD1A 2G0FA 3TB2A 1O8WA 1T4ZA 4CW9A 4BA7A 4K0GA 1HD2A 3KMNA 2XC2A 2L59A 1V2AA 4KSMA 4QL9A 2NVLA 5G1LA 2B7KA 4XHMA 4BL7A 3GA4A 5EVOA 5IPHA 3H4KA 1YZXA 4D73B 3ZMLA 4IJ3A 1MEKA 1PMTA 2H66A 3GH6A 1ZL9A 4IP6A 4Q5RA 1OKTA 2CAIA 1AW9A 1WWJA 5ECSA 3RDWA 1EV9A 4L5LA 4LMVA 5B6MA 4ZBDA 5FWGA 1NM3A 2LSTA 1CQHA 2GQLA 2V2GA 5DVBA 2WS2A 1WJKA 3O3TA 2CA8A 4RUVA 2K18A 1SKWB 2QSIA 3TOUA 2YP6A 4HU9A 2WZ9A 1TP9A 2M72A 1PA3A 3C73A 4MZCA 2R37A 3IXRA 1XWGA 2IMDA 4HS1A 2LRCA 2E7PA 4TW5A 1GWCA 3TDGA 1GLPA 5DJMA 5JCGA 3UVHA 3CSJA 3EMPA 3RHCA 4NPBA 3F6FA 3APOA 1TXXA 2VCTA 3GFKA 4KB3A 2X8HA 4KSOA 2FWEA 3ZVJA 4NHZA 2OA7A 1O7UA 2VCQA 5ID2B 19GSA 1USBA 1Z6NA 2O87A 5ECRB 2L5LA 2J23A 3KGKA 4EO3A 3ZLPA 1DE1A 5ECIB 3V1WA 3ZREA 3WD6A 4ILFA 4WKWA 2VCVA 1TDIA 2TRCP 2BJXA 3A2WA 1X0RA 1Z5YE 3LEFA 5KN0A 4NWYA 4ECJA 4NAXA 1TK0B 3W8SA 4E8HA 5LCZA 3FR9A 3KEBA 3M0FA 3IA1A 1PD21 3ZRDA 1QMVA 1S3AA 3QMXA 1GUKA 2DJ1A 1OYJA 4EUYA 2IIYA 4IKHA 3RPPA 1EOHA 5B6NA 3GUSA 1AQXA 4L8EA 4MABA 4KDXA 4AGSA 2IPAA 2ALBA 5CRWA 3HY2A 4BWQA 1J08A 2RUFA 4JZQA 3F4RA 1ERTA 1V98A 2DBCA 2C8UA 2I81A 2LQOA 2B5YA 1PX6A 5E4WA 1F2EA 1SJZA 1M0UA 2C3TA 2AB6A 1F6MC 2DJ3A 1BJXA 2PGTA 4IW9A 3Q18A 5INYA 4MJEA 4XIHA 2XPEA 5IMFA 4O7HA 1SD9A 3GKMA 2WGRA 1U6TA 4G19A 1R5PA 3R2QA 1FVJA 4P3YB 4GSTA 4MLYA 3GSSA 3BJ5A 2GVPA 1FO5A 1GSSA 2H0GA 1VF1A 2CZ2A 3BCKA 5B7CA 5FHIA 1GSFA 2RLIA 1THOA 4MJBA 3NIVA 2B3SA 2V6KA 4GSNA 3VPQA 3MDKA 3KIJA 2CAQA 1FHEA 3MWHA 5G5EA 3TKPA 4KNDA 1Q98A 2L57A 2MMNA 1W4VA 2NDOA 2H0IA 3D0ZA 4XS4A 1U3IA 2HT9A 2DJKA 5HFIA 5F8BA 4JBBA 2OKAA 4TXOA 3ZFLA 4HI7A 3UAPA 3D4TA 4QQ7A 4F0BA 2RM6A 2G2QA 2LJKA 3FRCA 2DIYA 1K3YA 3LORA 1K0OA 4N0VA 4TKYA 5HFGA 5AN1A 2F9SA 2R3XA 1ERUA 2QC7A 6GSSA 2C3NA 4ZIJA 1X9SB 1SL1B 3M3MA 5COHA 1PL2A 2FGXA 3GYKA 1GLQA 3E3EA 4ECBA 3I43A 5ECKB 2J9HA 2V6OA 2VCXA 5ECMB 4MF5A 2L6CA 4O92A 3KJYA 5IOWA 4PQHA 3IC4A 2HZEA 18GSA 3VK9A 4GXZA 3TOTA 4ZL9A 4ULXA 2WB9A 1SL2B 1FB0A 4HDEA 4ML1A 5KN2A 3J7Yk 5D9WA 1GTAA 2VO4A 1SL0B 3P90A 2A4VA 2OJLA 2I4AA 1UVZA 1AQVA 3PH9A 5C00A 2AYTA 4ZL8A 2IMEA 1EP7A 4ZXGA 4X1UA 3EU3A 3GKNA 4IS0A 3ZMKA 2QKEA 1TU7A 1HYUA 1XZOA 2BMXA 3RPNA 4HJ2A 4WF4A 4KUNA 4OWYA 4NMUA 2CV4A 3W8JA 4F9ZA 2LQQA 13GSA 2C80A 1A8YA 2XHFA 2GSSA 2REMA 5GSTA 1W89A 4I2TA 2I9HA 3GIXA 4J57E 1OAZA 1YKCA 4LA1A 1PKZA 1SD8A 4DSSA 5DAKA 5L71A 4KGIA 2MYGA 4WEYA 3FY7A 2Z9SA 3UOMA 3H93A 1H75A 5JWRB 1JHBA 1Q4JA 2MMAA 1HQOA 3NZNA 2HE3A 3LJRA 3D5JA 2IN3A 4I2UA 4JU5A 1X5EA 3QAWA 1FB6A 1JZWA 1XWBA 1TK8B 2C4JA 1XXUA 2VCWA 3F3QA 2GTUA 4GCIA 5IM9A 5JWOB 1I5GA 3TRQA 5G1KA 3ZVJD 1M2DA 2DC5A 1MDKA 4I5QA 3DMLA 3KCMA 3WT1A 3U5RE 1E6BA 1EGRA 4I8BA 2LJAA 3HKRA 3C1RA 4LL4B 1BX9A 1MTCA 4ECIA 3EU4A 5IMZA 3GMFA 1WIKA 1TTZA 14GSA 2EIOA 3DGQA 3DRNA 1XOAA 1YDKA 4F0CA 5CRDA 1KNGA 2H74A 1DSBA 3KXOA 1XW9A 1ZOFA 2V41A 1HNBA 2DSAA 4XRAA 3IK9A 1YEPA 1XBSA 3L0HA 2H75A 2PVOC 1GSEA 4EF0A 3EVIA 1K0NA 3D4MA 1XWCA 1PSQA 5D9VA 1YQ1A 3C1SA 4V2MA 4XTSA 3G9BA 3GX0A 2HFDA 4NXIA 3GKXA 2X99A 3ZIVA 1DUGA 4IGJA 3DIEA 4ISDA 3AY8A 2V32A 4K8MA 1J9BA 4MZWA 2O85A 3LYKA 4DSQA 3ISOA 22GSA 3QCPA 5B8AA 3I9V2 4ZBAA 3GX8A 5DCHA 4EE0A 4AJ6A 2C0DA 4OFNA 3GRXA 2RIIA 4XS4B 4EVMA 2VLVA 2FCHA 4TXOB 2CVKA 4HQZA 2DMLA 4L0WA 1AUCA 2HYXA 1LJRA 4TVEA 4GF0A 3CMIA 3WGXA
chains in the Genus database with same CATH superfamily
3LW9A 3WYWA 2ZCTA 3M1GA 3BOAA 3IAS2 1GNWA 4K2XA 1T1VA 5CYYA 4RI6A 1XPVA 3KD0A 1A24A 5B8BA 2VLUA 1EZKA 5CRHA 1LBKA 3I6AA 2IMFA 3SBCA 2HRNA 2B1LA 2E2GA 2VL2A 3F4SA 2IL3A 3F3RA 5D9TA 1GTBA 1GTUA 1OC9A 4FO5A 2HZEB 2YZUA 2VL2C 2O8VB 1VF3A 1B4PA 2C1YA 1ZMAA 3A2VA 4MF6A 4KW6A 3RBTA 2H6XA 3D21A 3ERWA 2M46A 3IAM2 5HR3A 2PWJA 2H72A 4EL1A 2DLXA 3A3TA 4K1FA 1DBYA 3F4TA 4MF7A 2LRTA 1TU8A 1SJ6A 3P8WA 4GRFA 2TRXA 3APSA 4BWSA 1BEDA 2FLSA 5DALA 3HXSA 4ZB6A 2H73A 3UMAA 2PBJA 2YV7A 1ZGNA 2P5QA 1PN0A 1JZDA 2KUCA 3TJGA 1T4YA 1JLWA 1GUHA 2VM2A 1GUMA 2VOCA 2R4VA 4TR1A 1ERWA 2KHPA 3W6GA 3L78A 4Q5FA 5DCGA 3PGTA 3TCOA 4OMVA 2FA4A 1TRSA 5GZZB 2F3MA 1MD4A 4DSSB 3KTBA 5DAKB 4KX4A 4X4JA 2JSZA 1B8XA 1K3OA 5KN1A 1A0FA 2IFQA 3BD2A 3UARA 4CHSA 2AJQB 3TKQA 2AHEA 3VURA 5EL8A 2YANA 2PVQA 4JEDA 1ERVA 3KH7A 2MZCA 2GT5A 3TJKA 1A2JA 4WETA 2LUSA 2VAFA 2GZZA 1SU9A 5IO0A 2YCDA 2FWGA 4Q5NA 1XCCA 2A2PA 1OE8A 3CRUA 5CRGA 1S3RA 3LWAA 4F03A 3TRXA 3LXTA 2L4QA 3GN3A 4GWRA 4PUAA 5ECHB 4L5OA 4OFTA 5A4UA 5EY6A 4TN8A 4JE1A 5D9XA 1QGVA 1X5CA 20GSA 4Q5QA 3GURA 2R2JA 3IHGA 3RAZA 1VGLA 4I6XA 5GAND 3EC3A 4K7IA 2DKHA 3MAKA 3HVSA 4HZ2A 4O32A 5JCUA 4OO4A 1XOBA 1TK5B 1SK0A 2H1BA 5J41A 4DSRA 2FWHA 5H5QA 1A2MA 3KH9A 3TRPA 1ILOA 2PERA 3HZ8A 2YN1A 2HI7A 4OFMA 1ZYQB 2K9FA 4IN0A 3OR5A 4AJ8A 2K8SA 2NTOA 1OC8A 2C0GA 2FWFA 3VWVA 4V1Ap 1OC3A 5CP1A 2H1DA 3TKRA 1MDIA 2FUG2 5A5KA 1JLVA 4H86A 1WPIA 4IBPA 3UVTA 2OE0A 2YNXA 2F8FA 1WE0A 4WR5A 4HEA2 4MH3A 5HR2A 1V57A 1ON4A 2B5EA 3P7XA 3VFIA 1EGOA 3IOSA 2H01A 2JU5A 2FHEA 2YWNA 5D96A 1TRUA 3L9VA 1WP0A 4IP1A 3CXGA 5ENUA 4PUFC 2KP2A 1M3IA 4ID0A 4KCAA 6GSXA 1GSUA 2JACA 2FD3A 2OE1A 3M8NA 4YKFA 2P5RA 3DVWA 1EWXA 5IMAA 4YQUA 3TUEA 5KEJA 4ZB9A 5CAXA 5IIZA 3F0IA 5H5SA 1A23A 2VM1A 2FY6A 2WFCA 3FZAA 1GRXA 4MNNA 2DJJA 2KLXA 2XBIA 4X0XA 1NHYA 4V2LA 1M9BA 1G6YA 3VI7A 1GL8A 4E8EA 2GQKA 1OC9B 2MMOA 2WDUA 4BPYA 4FQUA 3A2XA 2H30A 5DBQA 4IELA 10GSA 5EPFA 3BBYA 1ST9A 3ED3A 5HFKA 2V1MA 5HR0A 3UL3A 2C0EA 3HA9A 1SKSB 4DEJA 3O76A 5HR1A 2VCZA 2H19A 2YZHA 3IHQA 4XS6A 3U6VA 4IVFA 5CNWA 1SENA 4CY8A 3QFBC 3KM6A 1FAAA 2TIRA 5GAPD 2YJHA 3QAGA 5DALB 2DMMA 5IMVA 3F9UA 1YJ6A 5LNKe 3GH9A 4FYUA 3CQFA 2D2ZA 2AV4A 2GLRA 1JZOA 3EE2A 2B7JA 4HJMA 3UJ1A 2X49A 4WBRD 5LD0A 4TR1B 4CDOA 1QK8A 3O6TA 2N5FA 5GSSA 1FW1A 3J7Yb 2PU9C 4Z7XA 1RK4A 2EIRA 2YWMA 5CO3A 5AISA 1EV4A 2MBTA 3FMWA 5ECQB 2L4CA 1VF2A 4BIKA 2IFQB 1GNEA 2JADA 3F63A 5D73A 4QL7A 2F8AA 3APQA 4TR3A 3IV4A 2IMIA 5DDLA 3QR6A 1WRYA 5AGYA 5IMCA 2X64A 4K2DA 1TJDA 2VIMA 1XWAA 4MP4A 1A0RP 4IJIA 4HOJA 2H70A 2OACA 3MNGA 2CX3A 2PUKC 2YPMA 1N2AA 3IE3A 1G0TA 1O73A 2HSMA 4TOPA 4GTUA 3LSZA 3ZFBA 5A4WA 3Q19A 3ME7A 2RUEA 4IHUA 2B1KA 4YAVA 1O81A 1AC1A 1K0CA 4WXTA 2DIZA 4KDUA 2VUPA 1B9XC 3GTUA 5G2ZA 1U87A 1A2LA 2DJ0A 3ZIJA 1BYEA 2CZ3A 2HNLA 3VLNA 1Z6MA 1ZYPA 1O8XA 3CRTA 2CT6A 3LFLA 1K0AA 2HRKA 4L0UA 2JZRA 3MIXA 1Z9HA 5IOXA 1FOVA 4KDYA 2WJUA 1AXDA 2OADA 2X8CA 3GL3A 3FR3A 3VWUA 2VD0A 2JL4A 4USSA 3VWWA 5IPGA 2GS3A 1S3CA 2L5OA 4MPFA 3HDCA 5J3RA 3VI5A 5D8IA 3HJMA 3IPZA 2E2MA 2ZNMA 1F3AA 1PKWA 4POMA 4XRDA 3UBLA 3HVVA 2HSYA 3D6IA 4LMWA 3Q6OA 1B48A 1TOFA 4RQRA 1YF0A 2QGVA 3FW2A 1PQNA 4TRXA 3JCML 1O85A 1V40A 2PMTA 3QPMA 3L9UA 2R0CA 3TJBA 3G7YA 3IDVA 3DKSA 6GSVA 1CQGA 1VF4A 2RM5A 1XVQA 1OE7A 4PURA 5DQSA 1GTIA 2DJ2A 3HD5A 2XBQA 2IJYA 1K0BA 3D22A 5A4VA 4EXJA 3IR4A 4RQXA 1WOUA 1EOGA 4NV5A 4BVYA 4POBA 1H4OA 2X8GA 2M80A 1SK1A 2GSQA 4YAPA 1Z7RA 3EMXA 1QFNA 2ON7A 1GULA 2HSHA 1GSYA 1I9DA 3M9JA 3LG6A 5ECNB 1BG5A 1GP1A 5ECLB 1S3DA 3A5WA 3QAVA 3GL5A 1YY7A 2YOIA 3FEUA 8GSSA 4MH2A 3TKSA 2LV3A 4YH2A 3FKFA 2LEGA 2GGTA 3KP9A 3FZ4A 6GSTA 1GSQA 5D93A 3TKSC 1KTEA 2A2SA 2OE3A 2O89A 5J9BA 3P2AA 1PL1A 1NSWA 3G7IA 5CREA 2NPBA 11GSA 4GSSA 3CBUA 1ML6A 6GSUA 4K0NA 2VL9A 4K7NA 1MDJA 1XWKA 2GZYA 4K9ZA 2WRTA 3GKKA 2LJRA 2I3YA 4HSCX 3KMOA 1EP8A 2HRFA 3L9SA 3WGEA 2H8LA 2GZPA 3Q74A 4EIPA 2HXKA 4ICYA 4MJCA 5FT3A 1U88A 3EYTA 5AIVA 3N5OA 2X4AA 2VL3A 2OBIA 3E9JB 2JSYA 1ZCPA 2FA8A 2HZFA 3PINA 1LU4A 4WF5A 1F3BA 1M2AA 2H0HA 3C71A 3DXBA 5HQPA 3L4NA 1V9WA 2KP1A 3DEXA 2WULA 17GSA 5DQYA 5AIXA 4J2FA 2LS5A 3H1NA 2LRNA 3FZ9A 4RI7A 1EEJA 3TJJA 5E59A 1MD3A 3ERGA 1YEXA 1C72A 4MZBA 4HU7A 1NW2A 1N8JA 4K5SA 2H76A 4N30A 1G6WA 5G31A 1PGTA 3HJPA 4YQMA 2F51A 1M9AA 3FZ5A 3UEMA 1THXA 3EWLA 3KZQA 3EINA 4XS1A 4J56E 1SYRA 3QDNA 5IMDA 2K6VA 2L6DA 2HRAA 5J5NA 1M99A 5IO2A 1R7HA 2CX4A 4WBJA 5J4UA 1K0MA 3US3A 1ABAA 3ME8A 1XIYA 1G7OA 5F07A 3DD3A 3ZTLA 1SJIA 4EDYA 2ES7A 2VLTA 2YJ7A 2JZSA 3I69A 3N9JA 4MA9A 3KP8A 4FH8A 4ECCA 2O7KA 12GSA 3GTUB 2C0FA 5ECPB 4ZBBA 3WT2A 16GSA 2AUVA 4N10A 4MJAA 1U3AA 2P31A 3HVXA 3UIWA 4G9HA 4O5RA 4G10A 5JWQB 5J9CA 4KA0A 1T3BA 4PNFA 4HQSA 1M2BA 3K8NA 2GSTA 4HUAA 3QOUA 4OD7A 1R5AA 4K6XA 3EURA 4OCFA 2LKUA 1RW1A 4N0ZA 1J0FA 4MPGA 5ELGA 3VPTA 3HHVA 1T7PB 2GDRA 2H1AA 4K5RA 1NHOA 2A4HA 3KTLA 4KH7A 4XCSA 1SYXA 1URMA 3HYPA 5F05A 4Z2UA 3S9FA 3QFAC 7GSSA 4G2EA 4FYBA 1DE2A 1RQMA 5KOWA 4X43A 2ON5A 5G5FA 1Y25A 2LTKA 2AAWA 3E0UA 3ZITA 2H1GA 1TI3A 2R5GA 1HNCA 2JZTA 3CYNA 3ERFA 1Z3EA 4G0KA 1E2YA 4OCEA 4AF2A 1FG4A 4N11A 4V1Ag 4D73A 5KOXA 3C8EA 1XFLA 2YV9A 4FIWA 4PQ1A 2P0GA 4LL1B 2IWTA 4MMMA 2EC4A 5JCWA 4BVYB 4ML6A 3IBHA 3IRAA 3FK8A 5ELAA 4F82A 5ECOB 3DVXA 2LNSA 1WMJA 1YF1A 4ZB8A 3ZYWA 4ZILA 4LLRA 3LQ7A 9GSSA 1TRVA 1XW6A 1QXHA 1X5DA 3TGZA 2K8VA 5G30A 3RHBA 4TR4A 1AIUA 3GSTA 5F06A 2PPTA 5F0GA 4V2NA 1TRWA 2YWOA 5IQYA 2R6KA 1GSDA 2FNOA 2HLSA 4NV2A 2H71A 3A5IA 2KOKA 4GQCA 4PGTA 4KAEA 5DJLA 1XW5A 2B6MA 1V58A 3LXZA 4YQVA 2NBSA 3HJOA 3CSIA 4G0IA 3ZZXA 2GQMA 4I97A 2LNTA 4ZL7A 4HZ4A 4MCUA 1A8LA 4KCEA 1O6JA 1X9MB 1R4WA 1SK2A 4WR4A 2GSRA 2DKIA 1B4QA 4TXVA 4AJ7A 3GNJA 4OO5A 1GH2A 4FYCA 1YKAA 1PX7A 5ID2A 3M9KA 4GQFA 3FHKA 2PN8A 3GHAA 2XPDA 3MSZA 5KN3A 1IYHA 2BTOT 2YWIA 3HVNA 5C04A 1AAZA 4MK3A 4JRRA 1R26A 4Z2TA 2MBSA 6GSWA 2A2RA 4F2IA 4DVCA 1B9YC 4POLA 3H79A 3CSHA 3F8UA 1TW9A 1VRSD 3PR8A 2I1UA 3HCZA 4ACSA 1T8EB 3LGCA 1K0DA 3IC8A 4EKZA 1BQ7A 2WCIA 4PXOA 1OKDA 4KE3A 3HZ4A 4BVXA 1ZZYA 1G7EA 1QQ2A 1OVNA 1UC7A 3DWVA 5ABRA 1PRXA 3BCIA 4JR4A 2EIQA 3R3EA 2B5XA 3CTGA 1TI1A 3TJFA 1UA5A 3QD9A 2E0QA 4K7OA 3GV1A 2C3QA 3CTFA 4GLTA 2H6YA 4PNGA 4PQIA 3DYRA 1JFUA 1XVWA 4PX1A 3UBKA 3C7MA 1F37A 1TKDB 4YKGA 1HNAA 3TKSE 1ZYEA 5H5RA 3H8QA 2N5AA 4MDCA 1SKRB 1IYIA 2MMZA 1JZRA 1T00A 1KEBA 1F9MA 1PN9A 3F6DA 2CQ9A 1UN2A 1X9WB 3LYPA 2OBKA 1M7TA 4EDZA 1QUWA 3SWLA 4IQAA 1KBNA 3ZL5A 2N5BA 3NOFA 3G7JA 1AQWA 1Y6EA 4IQ1A 4NHWA 3FR6A 2IMKA 1EEMA 4POKA 2GT6A 3FYGA 1FVKA 3VWXA 3IK7A 1BAYA 3WGDA 2CVDA 1K3LA 1ACVA 4JR6A 4EC0A 1Z7PA 6GSYA 2ZUPA 2CVBA 4TR0A 2H6ZA 2VD1A 2G0FA 3TB2A 1O8WA 1T4ZA 4CW9A 4BA7A 4K0GA 1HD2A 3KMNA 2XC2A 2L59A 1V2AA 4KSMA 4QL9A 2NVLA 5G1LA 2B7KA 4XHMA 4BL7A 3GA4A 5EVOA 5IPHA 3H4KA 1YZXA 4D73B 3ZMLA 4IJ3A 1MEKA 1PMTA 2H66A 3GH6A 1ZL9A 4IP6A 4Q5RA 1OKTA 2CAIA 1AW9A 1WWJA 5ECSA 3RDWA 1EV9A 4L5LA 4LMVA 5B6MA 4ZBDA 5FWGA 1NM3A 2LSTA 1CQHA 2GQLA 2V2GA 5DVBA 2WS2A 1WJKA 3O3TA 2CA8A 4RUVA 2K18A 1SKWB 2QSIA 3TOUA 2YP6A 4HU9A 2WZ9A 1TP9A 2M72A 1PA3A 3C73A 4MZCA 1FOHA 2R37A 3IXRA 1XWGA 2IMDA 4HS1A 2LRCA 2E7PA 4TW5A 1GWCA 3TDGA 1GLPA 5DJMA 5JCGA 3UVHA 3CSJA 3EMPA 3RHCA 4NPBA 3F6FA 3APOA 1TXXA 2VCTA 3GFKA 4KB3A 2X8HA 4KSOA 1M3JA 2FWEA 3ZVJA 4NHZA 2OA7A 1O7UA 2VCQA 5ID2B 19GSA 1USBA 1Z6NA 2O87A 5ECRB 2L5LA 2J23A 3KGKA 4EO3A 3ZLPA 1DE1A 5ECIB 3V1WA 3ZREA 3WD6A 4ILFA 4WKWA 2VCVA 1TDIA 2TRCP 2BJXA 3A2WA 1X0RA 1Z5YE 3LEFA 5KN0A 4NWYA 4ECJA 4NAXA 1TK0B 3W8SA 4E8HA 5LCZA 3FR9A 3KEBA 3M0FA 3IA1A 1PD21 3ZRDA 1QMVA 1S3AA 3QMXA 1GUKA 2DJ1A 1OYJA 4EUYA 2IIYA 4IKHA 3RPPA 1EOHA 5B6NA 3GUSA 1AQXA 4L8EA 4BVXB 4MABA 4KDXA 4AGSA 2IPAA 2ALBA 5CRWA 3HY2A 4BWQA 1J08A 2RUFA 4JZQA 3F4RA 1ERTA 1V98A 2DBCA 2C8UA 2I81A 2LQOA 2B5YA 1PX6A 5E4WA 1F2EA 1SJZA 1M0UA 2C3TA 2AB6A 1F6MC 2DJ3A 1BJXA 2PGTA 4IW9A 3Q18A 5INYA 4MJEA 4XIHA 2XPEA 5IMFA 4O7HA 1SD9A 3GKMA 2WGRA 1U6TA 4G19A 1R5PA 3R2QA 1FVJA 4P3YB 4GSTA 4MLYA 1PFOA 3GSSA 3BJ5A 2GVPA 1FO5A 1GSSA 2H0GA 1VF1A 2CZ2A 3BCKA 5B7CA 5FHIA 1GSFA 2RLIA 1THOA 4MJBA 3NIVA 2B3SA 2V6KA 4GSNA 2QA1A 3VPQA 3MDKA 3KIJA 2CAQA 1FHEA 3MWHA 5G5EA 3TKPA 4KNDA 1Q98A 2L57A 2MMNA 1W4VA 2NDOA 3MYDA 2H0IA 3D0ZA 5BRTA 4XS4A 1U3IA 2HT9A 2DJKA 5HFIA 5F8BA 4JBBA 4O5QA 2OKAA 4TXOA 3ZFLA 4HI7A 3UAPA 4A5PA 3D4TA 4QQ7A 4F0BA 2RM6A 2G2QA 2LJKA 3FRCA 2DIYA 1K3YA 3LORA 1K0OA 4N0VA 4TKYA 3PPUA 5HFGA 5AN1A 2F9SA 4KF9A 4BL7B 2R3XA 1ERUA 2QC7A 6GSSA 2C3NA 4ZIJA 1X9SB 1SL1B 3M3MA 5COHA 1PL2A 2FGXA 3GYKA 1GLQA 3E3EA 4ECBA 3I43A 5ECKB 2J9HA 2V6OA 2VCXA 5ECMB 4MF5A 2L6CA 2QA2A 4O92A 3KJYA 5IOWA 4PQHA 3IC4A 2HZEA 18GSA 3VK9A 4GXZA 3TOTA 4ZL9A 4ULXA 2WB9A 1SL2B 4PTSA 1FB0A 4HDEA 4ML1A 5KN2A 5BMUA 3J7Yk 4Z2RA 5D9WA 1GTAA 2VO4A 1SL0B 3P90A 2A4VA 2OJLA 4O5UA 2I4AA 1UVZA 1AQVA 3PH9A 5C00A 2AYTA 4ZL8A 2IMEA 4CY6A 1EP7A 4ZXGA 4X1UA 3EU3A 3GKNA 4IS0A 3ZMKA 2QKEA 1TU7A 1HYUA 1XZOA 2BMXA 3RPNA 4HJ2A 4WF4A 4KUNA 4OWYA 4NMUA 2CV4A 3W8JA 4F9ZA 2LQQA 13GSA 2C80A 1A8YA 2XHFA 2GSSA 2UZ8A 2REMA 5GSTA 1W89A 1ZYNA 4I2TA 2I9HA 3GIXA 4J57E 1OAZA 1YKCA 4LA1A 1PKZA 1SD8A 4DSSA 5DAKA 5L71A 4KGIA 2MYGA 4WEYA 3FY7A 2Z9SA 3UOMA 3H93A 1H75A 5JWRB 1JHBA 1Q4JA 2MMAA 1HQOA 3NZNA 2HE3A 3LJRA 3D5JA 2IN3A 4I2UA 4JU5A 1X5EA 3QAWA 1FB6A 1JZWA 1XWBA 1TK8B 1XG8A 2C4JA 1XXUA 2VCWA 3F3QA 3EPTA 2GTUA 4GCIA 5IM9A 5JWOB 1I5GA 3TRQA 5G1KA 3ZVJD 1M2DA 2DC5A 1MDKA 4I5QA 3DMLA 3KCMA 3WT1A 3U5RE 1E6BA 1EGRA 4I8BA 2LJAA 3HKRA 2R0PA 3C1RA 4LL4B 1BX9A 1MTCA 4ECIA 3EU4A 5IMZA 3GMFA 1WIKA 2R0GA 1TTZA 14GSA 2EIOA 3DGQA 3DRNA 1XOAA 1YDKA 4F0CA 5CRDA 1KNGA 2H74A 1DSBA 3KXOA 1XW9A 1ZOFA 2V41A 1HNBA 2DSAA 4XRAA 3IK9A 1YEPA 1XBSA 3L0HA 2H75A 2PVOC 1GSEA 4EF0A 3EVIA 1K0NA 3D4MA 1XWCA 1PSQA 5D9VA 1YQ1A 3C1SA 4EIQA 4V2MA 4XTSA 3G9BA 3GX0A 2HFDA 4NXIA 3GKXA 2X99A 3ZIVA 1DUGA 4IGJA 3DIEA 4ISDA 3AY8A 2V32A 4K8MA 1J9BA 4MZWA 2O85A 3LYKA 4DSQA 3ISOA 22GSA 3QCPA 5B8AA 3I9V2 4ZBAA 3GX8A 5DCHA 4EE0A 4AJ6A 2C0DA 4OFNA 3GRXA 2RIIA 4G0LA 4XS4B 4EVMA 2VLVA 2FCHA 4TXOB 2CVKA 4HQZA 2DMLA 4L0WA 1AUCA 2HYXA 1LJRA 4TVEA 4GF0A 3CMIA 3WGXA
chains in the Genus database with same CATH topology
3LW9A 3WYWA 2ZCTA 3M1GA 3BOAA 3IAS2 1GNWA 4K2XA 1T1VA 5CYYA 4RI6A 1XPVA 3KD0A 1A24A 5B8BA 2VLUA 1EZKA 5CRHA 1LBKA 3I6AA 2IMFA 3SBCA 2HRNA 2B1LA 2E2GA 2VL2A 3F4SA 2IL3A 3F3RA 5D9TA 1GTBA 1GTUA 1OC9A 4FO5A 2HZEB 2YZUA 2VL2C 2O8VB 1VF3A 1B4PA 2C1YA 1ZMAA 3A2VA 4MF6A 4KW6A 3RBTA 2H6XA 3D21A 3ERWA 2M46A 3IAM2 5HR3A 2PWJA 2H72A 4EL1A 2DLXA 3A3TA 4K1FA 1DBYA 3F4TA 4MF7A 2LRTA 1TU8A 1SJ6A 3P8WA 4GRFA 2TRXA 3APSA 4BWSA 1BEDA 2FLSA 5DALA 3HXSA 4ZB6A 2H73A 3UMAA 2PBJA 2YV7A 1ZGNA 2P5QA 1PN0A 1JZDA 2KUCA 3TJGA 1T4YA 1JLWA 1GUHA 2VM2A 1GUMA 2VOCA 2R4VA 4TR1A 1ERWA 2KHPA 3W6GA 3L78A 4Q5FA 5DCGA 3PGTA 3TCOA 4OMVA 2FA4A 1TRSA 5GZZB 2F3MA 1MD4A 4DSSB 3KTBA 5DAKB 4KX4A 4X4JA 2JSZA 1B8XA 1K3OA 5KN1A 1A0FA 2IFQA 3BD2A 3UARA 4CHSA 2AJQB 3TKQA 2AHEA 3VURA 5EL8A 2YANA 2PVQA 4JEDA 1ERVA 3KH7A 2MZCA 2GT5A 3TJKA 1A2JA 4WETA 2LUSA 2VAFA 2GZZA 1SU9A 5IO0A 2YCDA 2FWGA 4Q5NA 1XCCA 2A2PA 1OE8A 3CRUA 5CRGA 3LWAA 4F03A 3TRXA 3LXTA 2L4QA 3GN3A 4GWRA 4PUAA 5ECHB 4L5OA 4OFTA 5A4UA 5EY6A 4TN8A 4JE1A 5D9XA 1QGVA 1X5CA 20GSA 4Q5QA 3GURA 2R2JA 3IHGA 3RAZA 1VGLA 4I6XA 5GAND 3EC3A 4K7IA 2DKHA 3MAKA 3HVSA 4HZ2A 4O32A 5JCUA 4OO4A 1XOBA 1TK5B 1SK0A 2H1BA 5J41A 4DSRA 2FWHA 5H5QA 1A2MA 3KH9A 3TRPA 1ILOA 2PERA 3HZ8A 2YN1A 2HI7A 4OFMA 1ZYQB 2K9FA 4IN0A 3OR5A 4AJ8A 2K8SA 2NTOA 1OC8A 2C0GA 2FWFA 3VWVA 4V1Ap 1OC3A 5CP1A 2H1DA 3TKRA 1MDIA 2FUG2 5A5KA 1JLVA 4H86A 1WPIA 4IBPA 3UVTA 2OE0A 2YNXA 2F8FA 1WE0A 4WR5A 4HEA2 4MH3A 5HR2A 1V57A 1ON4A 2B5EA 3P7XA 3VFIA 1EGOA 3IOSA 2H01A 2JU5A 2FHEA 2YWNA 5D96A 1TRUA 3L9VA 1WP0A 4IP1A 3CXGA 5ENUA 4PUFC 2KP2A 4ID0A 4KCAA 6GSXA 1GSUA 2JACA 2FD3A 2OE1A 3M8NA 4YKFA 2P5RA 3DVWA 1EWXA 5IMAA 4YQUA 3TUEA 5KEJA 4ZB9A 5CAXA 5IIZA 3F0IA 5H5SA 1A23A 2VM1A 2FY6A 2WFCA 3FZAA 1GRXA 4MNNA 2DJJA 2KLXA 2XBIA 4X0XA 1NHYA 4V2LA 1M9BA 1G6YA 3VI7A 1GL8A 4E8EA 2GQKA 1OC9B 2MMOA 2WDUA 4BPYA 4FQUA 3A2XA 2H30A 5DBQA 4IELA 10GSA 5EPFA 3BBYA 1ST9A 3ED3A 5HFKA 2V1MA 5HR0A 3UL3A 2C0EA 3HA9A 1SKSB 4DEJA 3O76A 5HR1A 2VCZA 2H19A 2YZHA 3IHQA 4XS6A 3U6VA 4IVFA 5CNWA 1SENA 4CY8A 3QFBC 3KM6A 1FAAA 2TIRA 5GAPD 2YJHA 3QAGA 5DALB 2DMMA 5IMVA 3F9UA 1YJ6A 5LNKe 3GH9A 4FYUA 2D2ZA 2AV4A 2GLRA 1JZOA 3EE2A 2B7JA 4HJMA 3UJ1A 2X49A 4WBRD 5LD0A 4TR1B 4CDOA 1QK8A 3O6TA 2N5FA 5GSSA 1FW1A 3J7Yb 2PU9C 4Z7XA 1RK4A 2EIRA 2YWMA 5CO3A 5AISA 1EV4A 2MBTA 3FMWA 5ECQB 2L4CA 1VF2A 2IFQB 1GNEA 2JADA 3F63A 5D73A 4QL7A 2F8AA 3APQA 4TR3A 3IV4A 2IMIA 5DDLA 3QR6A 1WRYA 5AGYA 5IMCA 2X64A 4K2DA 1TJDA 2VIMA 1XWAA 4MP4A 1A0RP 4IJIA 4HOJA 2H70A 2OACA 3MNGA 2CX3A 2PUKC 2YPMA 1N2AA 3IE3A 1G0TA 1O73A 2HSMA 4TOPA 4GTUA 3LSZA 3ZFBA 5A4WA 3Q19A 3ME7A 2RUEA 4IHUA 2B1KA 4YAVA 1O81A 1AC1A 1K0CA 4WXTA 2DIZA 4KDUA 2VUPA 1B9XC 3GTUA 5G2ZA 1U87A 1A2LA 2DJ0A 3ZIJA 1BYEA 2CZ3A 2HNLA 3VLNA 1Z6MA 1ZYPA 1O8XA 3CRTA 2CT6A 3LFLA 1K0AA 2HRKA 4L0UA 2JZRA 3MIXA 1Z9HA 5IOXA 1FOVA 4KDYA 2WJUA 1AXDA 2OADA 2X8CA 3GL3A 3FR3A 3VWUA 2VD0A 2JL4A 4USSA 3VWWA 5IPGA 2GS3A 1S3CA 2L5OA 4MPFA 3HDCA 5J3RA 3VI5A 5D8IA 3HJMA 3IPZA 2E2MA 2ZNMA 1F3AA 1PKWA 4POMA 4XRDA 3UBLA 3HVVA 2HSYA 3D6IA 4LMWA 3Q6OA 1B48A 1TOFA 4RQRA 1YF0A 2QGVA 3FW2A 1PQNA 4TRXA 3JCML 1O85A 1V40A 2PMTA 3QPMA 3L9UA 2R0CA 3TJBA 3G7YA 3IDVA 3DKSA 6GSVA 1CQGA 1VF4A 2RM5A 1XVQA 1OE7A 4PURA 5DQSA 1GTIA 2DJ2A 3HD5A 2XBQA 2IJYA 1K0BA 3D22A 5A4VA 4EXJA 3IR4A 4RQXA 1WOUA 1EOGA 4NV5A 4BVYA 4POBA 1H4OA 2X8GA 2M80A 1SK1A 2GSQA 4YAPA 1Z7RA 3EMXA 1QFNA 2ON7A 1GULA 2HSHA 1GSYA 1I9DA 3M9JA 3LG6A 5ECNB 1BG5A 1GP1A 5ECLB 1S3DA 3A5WA 3QAVA 3GL5A 1YY7A 2YOIA 3FEUA 8GSSA 4MH2A 3TKSA 2LV3A 4YH2A 3FKFA 2LEGA 2GGTA 3KP9A 3FZ4A 6GSTA 1GSQA 5D93A 3TKSC 1KTEA 2A2SA 2OE3A 2O89A 5J9BA 3P2AA 1PL1A 1NSWA 3G7IA 5CREA 2NPBA 11GSA 4GSSA 3CBUA 1ML6A 6GSUA 4K0NA 2VL9A 4K7NA 1MDJA 1XWKA 2GZYA 4K9ZA 2WRTA 3GKKA 2LJRA 2I3YA 3KMOA 1EP8A 2HRFA 3L9SA 3WGEA 2H8LA 2GZPA 3Q74A 4EIPA 2HXKA 4ICYA 4MJCA 5FT3A 1U88A 3EYTA 5AIVA 3N5OA 2X4AA 2VL3A 2OBIA 3E9JB 2JSYA 1ZCPA 2FA8A 2HZFA 3PINA 1LU4A 4WF5A 1F3BA 1M2AA 2H0HA 3C71A 3DXBA 5HQPA 3L4NA 1V9WA 2KP1A 3DEXA 2WULA 17GSA 5DQYA 5AIXA 4J2FA 2LS5A 3H1NA 2LRNA 3FZ9A 4RI7A 1EEJA 3TJJA 5E59A 1MD3A 3ERGA 1YEXA 1C72A 4MZBA 4HU7A 1NW2A 1N8JA 4K5SA 2H76A 4N30A 1G6WA 5G31A 1PGTA 3HJPA 4YQMA 2F51A 1M9AA 3FZ5A 3UEMA 1THXA 3EWLA 3KZQA 3EINA 4XS1A 4J56E 1SYRA 3QDNA 5IMDA 2K6VA 2L6DA 2HRAA 5J5NA 1M99A 5IO2A 1R7HA 2CX4A 4WBJA 5J4UA 1K0MA 3US3A 1ABAA 3ME8A 1XIYA 1G7OA 5F07A 3DD3A 3ZTLA 1SJIA 4EDYA 2ES7A 2VLTA 2YJ7A 2JZSA 3I69A 3N9JA 4MA9A 3KP8A 4FH8A 4ECCA 2O7KA 12GSA 3GTUB 2C0FA 5ECPB 4ZBBA 3WT2A 16GSA 2AUVA 4N10A 4MJAA 1U3AA 2P31A 3HVXA 3UIWA 4G9HA 4O5RA 4G10A 5JWQB 5J9CA 4KA0A 1T3BA 4PNFA 4HQSA 1M2BA 3K8NA 2GSTA 4HUAA 3QOUA 4OD7A 1R5AA 4K6XA 3EURA 4OCFA 2LKUA 1RW1A 4N0ZA 1J0FA 4MPGA 5ELGA 3VPTA 3HHVA 1T7PB 2GDRA 2H1AA 4K5RA 1NHOA 2A4HA 3KTLA 4KH7A 4XCSA 1SYXA 1URMA 3HYPA 5F05A 4Z2UA 3S9FA 3QFAC 7GSSA 4G2EA 4FYBA 1DE2A 1RQMA 5KOWA 4X43A 2ON5A 5G5FA 1Y25A 2LTKA 2AAWA 3E0UA 3ZITA 2H1GA 1TI3A 2R5GA 1HNCA 2JZTA 3CYNA 3ERFA 1Z3EA 4G0KA 1E2YA 4OCEA 4AF2A 1FG4A 4N11A 4V1Ag 4D73A 5KOXA 3C8EA 1XFLA 2YV9A 4FIWA 4PQ1A 2P0GA 4LL1B 2IWTA 4MMMA 2EC4A 5JCWA 4BVYB 4ML6A 3IBHA 3IRAA 3FK8A 5ELAA 4F82A 5ECOB 3DVXA 2LNSA 1WMJA 1YF1A 4ZB8A 3ZYWA 4ZILA 4LLRA 3LQ7A 9GSSA 1TRVA 1XW6A 1QXHA 1X5DA 3TGZA 2K8VA 5G30A 3RHBA 4TR4A 1AIUA 3GSTA 5F06A 2PPTA 5F0GA 4V2NA 1TRWA 2YWOA 5IQYA 2R6KA 1GSDA 2FNOA 2HLSA 4NV2A 2H71A 3A5IA 2KOKA 4GQCA 4PGTA 4KAEA 5DJLA 1XW5A 2B6MA 1V58A 3LXZA 4YQVA 2NBSA 3HJOA 3CSIA 4G0IA 3ZZXA 2GQMA 4I97A 2LNTA 4ZL7A 4HZ4A 4MCUA 1A8LA 4KCEA 1O6JA 1X9MB 1R4WA 1SK2A 4WR4A 2GSRA 2DKIA 1B4QA 4TXVA 4AJ7A 3GNJA 4OO5A 1GH2A 4FYCA 1YKAA 1PX7A 5ID2A 3M9KA 4GQFA 3FHKA 2PN8A 3GHAA 2XPDA 3MSZA 5KN3A 1IYHA 2BTOT 2YWIA 5C04A 1AAZA 4MK3A 4JRRA 1R26A 4Z2TA 2MBSA 6GSWA 2A2RA 4F2IA 4DVCA 1B9YC 4POLA 3H79A 3CSHA 3F8UA 1TW9A 1VRSD 3PR8A 2I1UA 3HCZA 4ACSA 1T8EB 3LGCA 1K0DA 3IC8A 4EKZA 1BQ7A 2WCIA 4PXOA 1OKDA 4KE3A 3HZ4A 4BVXA 1ZZYA 1G7EA 1QQ2A 1OVNA 1UC7A 3DWVA 5ABRA 1PRXA 3BCIA 4JR4A 2EIQA 3R3EA 2B5XA 3CTGA 1TI1A 3TJFA 1UA5A 3QD9A 2E0QA 4K7OA 3GV1A 2C3QA 3CTFA 4GLTA 2H6YA 4PNGA 4PQIA 3DYRA 1JFUA 1XVWA 4PX1A 3UBKA 3C7MA 1F37A 1TKDB 4YKGA 1HNAA 3TKSE 1ZYEA 5H5RA 3H8QA 2N5AA 4MDCA 1SKRB 1IYIA 2MMZA 1JZRA 1T00A 1KEBA 1F9MA 1PN9A 3F6DA 2CQ9A 1UN2A 1X9WB 3LYPA 2OBKA 1M7TA 4EDZA 1QUWA 3SWLA 4IQAA 1KBNA 3ZL5A 2N5BA 3NOFA 3G7JA 1AQWA 1Y6EA 4IQ1A 4NHWA 3FR6A 2IMKA 1EEMA 4POKA 2GT6A 3FYGA 1FVKA 3VWXA 3IK7A 1BAYA 3WGDA 2CVDA 1K3LA 1ACVA 4JR6A 4EC0A 1Z7PA 6GSYA 2ZUPA 2CVBA 4TR0A 2H6ZA 2VD1A 2G0FA 3TB2A 1O8WA 1T4ZA 4CW9A 4BA7A 4K0GA 1HD2A 3KMNA 2XC2A 2L59A 1V2AA 4KSMA 4QL9A 2NVLA 5G1LA 2B7KA 4XHMA 4BL7A 3GA4A 5EVOA 5IPHA 3H4KA 1YZXA 4D73B 3ZMLA 4IJ3A 1MEKA 1PMTA 2H66A 3GH6A 1ZL9A 4IP6A 4Q5RA 1OKTA 2CAIA 1AW9A 1WWJA 5ECSA 3RDWA 1EV9A 4L5LA 4LMVA 5B6MA 4ZBDA 5FWGA 1NM3A 2LSTA 1CQHA 2GQLA 2V2GA 5DVBA 2WS2A 1WJKA 3O3TA 2CA8A 4RUVA 2K18A 1SKWB 2QSIA 3TOUA 2YP6A 4HU9A 2WZ9A 1TP9A 2M72A 1PA3A 3C73A 4MZCA 1FOHA 2R37A 3IXRA 1XWGA 2IMDA 4HS1A 2LRCA 2E7PA 4TW5A 1GWCA 3TDGA 1GLPA 5DJMA 5JCGA 3UVHA 3CSJA 3EMPA 3RHCA 4NPBA 3F6FA 3APOA 1TXXA 2VCTA 3GFKA 4KB3A 2X8HA 4KSOA 2FWEA 3ZVJA 4NHZA 2OA7A 1O7UA 2VCQA 5ID2B 19GSA 1USBA 1Z6NA 2O87A 5ECRB 2L5LA 2J23A 3KGKA 4EO3A 3ZLPA 1DE1A 5ECIB 3V1WA 3ZREA 3WD6A 4ILFA 4WKWA 2VCVA 1TDIA 2TRCP 2BJXA 3A2WA 1X0RA 1Z5YE 3LEFA 5KN0A 4NWYA 4ECJA 4NAXA 1TK0B 3W8SA 4E8HA 5LCZA 3FR9A 3KEBA 3M0FA 3IA1A 1PD21 3ZRDA 1QMVA 1S3AA 3QMXA 1GUKA 2DJ1A 1OYJA 4EUYA 2IIYA 4IKHA 3RPPA 1EOHA 5B6NA 3GUSA 1AQXA 4L8EA 4BVXB 4MABA 4KDXA 4AGSA 2IPAA 2ALBA 5CRWA 3HY2A 4BWQA 1J08A 2RUFA 4JZQA 3F4RA 1ERTA 1V98A 2DBCA 2C8UA 2I81A 2LQOA 2B5YA 1PX6A 5E4WA 1F2EA 1SJZA 1M0UA 2C3TA 2AB6A 1F6MC 2DJ3A 1BJXA 2PGTA 4IW9A 3Q18A 5INYA 4MJEA 4XIHA 2XPEA 5IMFA 4O7HA 1SD9A 3GKMA 2WGRA 1U6TA 4G19A 1R5PA 3R2QA 1FVJA 4P3YB 4GSTA 4MLYA 3GSSA 3BJ5A 2GVPA 1FO5A 1GSSA 2H0GA 1VF1A 2CZ2A 3BCKA 5B7CA 5FHIA 1GSFA 2RLIA 1THOA 4MJBA 3NIVA 2B3SA 2V6KA 4GSNA 2QA1A 3VPQA 3MDKA 3KIJA 2CAQA 1FHEA 3MWHA 5G5EA 3TKPA 4KNDA 1Q98A 2L57A 2MMNA 1W4VA 2NDOA 3MYDA 2H0IA 3D0ZA 5BRTA 4XS4A 1U3IA 2HT9A 2DJKA 5HFIA 5F8BA 4JBBA 4O5QA 2OKAA 4TXOA 3ZFLA 4HI7A 3UAPA 4A5PA 3D4TA 4QQ7A 4F0BA 2RM6A 2G2QA 2LJKA 3FRCA 2DIYA 1K3YA 3LORA 1K0OA 4N0VA 4TKYA 3PPUA 5HFGA 5AN1A 2F9SA 4KF9A 4BL7B 2R3XA 1ERUA 2QC7A 6GSSA 2C3NA 4ZIJA 1X9SB 1SL1B 3M3MA 5COHA 1PL2A 2FGXA 3GYKA 1GLQA 3E3EA 4ECBA 3I43A 5ECKB 2J9HA 2V6OA 2VCXA 5ECMB 4MF5A 2L6CA 2QA2A 4O92A 3KJYA 5IOWA 4PQHA 3IC4A 2HZEA 18GSA 3VK9A 4GXZA 3TOTA 4ZL9A 4ULXA 2WB9A 1SL2B 4PTSA 1FB0A 4HDEA 4ML1A 5KN2A 5BMUA 3J7Yk 4Z2RA 5D9WA 1GTAA 2VO4A 1SL0B 3P90A 2A4VA 2OJLA 4O5UA 2I4AA 1UVZA 1AQVA 3PH9A 5C00A 2AYTA 4ZL8A 2IMEA 4CY6A 1EP7A 4ZXGA 4X1UA 3EU3A 3GKNA 4IS0A 3ZMKA 2QKEA 1TU7A 1HYUA 1XZOA 2BMXA 3RPNA 4HJ2A 4WF4A 4KUNA 4OWYA 4NMUA 2CV4A 3W8JA 4F9ZA 2LQQA 13GSA 2C80A 1A8YA 2XHFA 2GSSA 2UZ8A 2REMA 5GSTA 1W89A 1ZYNA 4I2TA 2I9HA 3GIXA 4J57E 1OAZA 1YKCA 4LA1A 1PKZA 1SD8A 4DSSA 5DAKA 5L71A 4KGIA 2MYGA 4WEYA 3FY7A 2Z9SA 3UOMA 3H93A 1H75A 5JWRB 1JHBA 1Q4JA 2MMAA 1HQOA 3NZNA 2HE3A 3LJRA 3D5JA 2IN3A 4I2UA 4JU5A 1X5EA 3QAWA 1FB6A 1JZWA 1XWBA 1TK8B 2C4JA 1XXUA 2VCWA 3F3QA 3EPTA 2GTUA 4GCIA 5IM9A 5JWOB 1I5GA 3TRQA 5G1KA 3ZVJD 1M2DA 2DC5A 1MDKA 4I5QA 3DMLA 3KCMA 3WT1A 3U5RE 1E6BA 1EGRA 4I8BA 2LJAA 3HKRA 2R0PA 3C1RA 4LL4B 1BX9A 1MTCA 4ECIA 3EU4A 5IMZA 3GMFA 1WIKA 2R0GA 1TTZA 14GSA 2EIOA 3DGQA 3DRNA 1XOAA 1YDKA 4F0CA 5CRDA 1KNGA 2H74A 1DSBA 3KXOA 1XW9A 1ZOFA 2V41A 1HNBA 2DSAA 4XRAA 3IK9A 1YEPA 1XBSA 3L0HA 2H75A 2PVOC 1GSEA 4EF0A 3EVIA 1K0NA 3D4MA 1XWCA 1PSQA 5D9VA 1YQ1A 3C1SA 4EIQA 4V2MA 4XTSA 3G9BA 3GX0A 2HFDA 4NXIA 3GKXA 2X99A 3ZIVA 1DUGA 4IGJA 3DIEA 4ISDA 3AY8A 2V32A 4K8MA 1J9BA 4MZWA 2O85A 3LYKA 4DSQA 3ISOA 22GSA 3QCPA 5B8AA 3I9V2 4ZBAA 3GX8A 5DCHA 4EE0A 4AJ6A 2C0DA 4OFNA 3GRXA 2RIIA 4G0LA 4XS4B 4EVMA 2VLVA 2FCHA 4TXOB 2CVKA 4HQZA 2DMLA 4L0WA 1AUCA 2HYXA 1LJRA 4TVEA 4GF0A 3CMIA 3WGXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WYW A;  2ZCT A;  3M1G A;  3BOA A;  3IAS 2;  1GNW A;  1T1V A;  5CYY A;  4RI6 A;  1XPV A;  3KD0 A;  1A24 A;  5B8B A;  2VLU A;  1EZK A;  5CRH A;  1LBK A;  3I6A A;  2IMF A;  3SBC A;  2HRN A;  2B1L A;  2E2G A;  2VL2 A;  3F4S A;  2IL3 A;  3F3R A;  5D9T A;  1GTB A;  1GTU A;  1OC9 A;  4FO5 A;  2HZE B;  2YZU A;  2VL2 C;  2O8V B;  1VF3 A;  1B4P A;  2C1Y A;  1ZMA A;  3A2V A;  4MF6 A;  4KW6 A;  3RBT A;  2H6X A;  3D21 A;  3ERW A;  2M46 A;  3IAM 2;  5HR3 A;  2PWJ A;  2H72 A;  4EL1 A;  2DLX A;  3A3T A;  4K1F A;  1DBY A;  3F4T A;  4MF7 A;  2LRT A;  1TU8 A;  1SJ6 A;  3P8W A;  4GRF A;  2TRX A;  3APS A;  4BWS A;  1BED A;  2FLS A;  5DAL A;  3HXS A;  4ZB6 A;  2H73 A;  3UMA A;  2PBJ A;  2YV7 A;  1ZGN A;  2P5Q A;  1JZD A;  2KUC A;  3TJG A;  1T4Y A;  1JLW A;  1GUH A;  2VM2 A;  1GUM A;  2VOC A;  2R4V A;  4TR1 A;  1ERW A;  2KHP A;  3W6G A;  3L78 A;  4Q5F A;  5DCG A;  3PGT A;  3TCO A;  4OMV A;  2FA4 A;  1TRS A;  5GZZ B;  2F3M A;  1MD4 A;  4DSS B;  3KTB A;  5DAK B;  4KX4 A;  2JSZ A;  1B8X A;  1K3O A;  5KN1 A;  1A0F A;  2IFQ A;  3BD2 A;  3UAR A;  4CHS A;  2AJQ B;  3TKQ A;  2AHE A;  3VUR A;  5EL8 A;  2YAN A;  2PVQ A;  4JED A;  1ERV A;  3KH7 A;  2MZC A;  2GT5 A;  3TJK A;  1A2J A;  4WET A;  2LUS A;  2VAF A;  2GZZ A;  1SU9 A;  5IO0 A;  2YCD A;  2FWG A;  4Q5N A;  1XCC A;  1OE8 A;  3CRU A;  5CRG A;  3LWA A;  4F03 A;  3TRX A;  3LXT A;  2L4Q A;  3GN3 A;  4GWR A;  4PUA A;  5ECH B;  4L5O A;  4OFT A;  5A4U A;  5EY6 A;  4TN8 A;  4JE1 A;  5D9X A;  1QGV A;  1X5C A;  20GS A;  4Q5Q A;  3GUR A;  2R2J A;  3RAZ A;  1VGL A;  4I6X A;  5GAN D;  3EC3 A;  4K7I A;  3MAK A;  3HVS A;  4HZ2 A;  4O32 A;  5JCU A;  4OO4 A;  1XOB A;  1TK5 B;  1SK0 A;  2H1B A;  5J41 A;  4DSR A;  2FWH A;  5H5Q A;  1A2M A;  3KH9 A;  3TRP A;  1ILO A;  2PER A;  3HZ8 A;  2YN1 A;  2HI7 A;  4OFM A;  1ZYQ B;  2K9F A;  4IN0 A;  3OR5 A;  4AJ8 A;  2K8S A;  2NTO A;  1OC8 A;  2C0G A;  2FWF A;  3VWV A;  4V1A p;  1OC3 A;  5CP1 A;  2H1D A;  3TKR A;  1MDI A;  2FUG 2;  5A5K A;  1JLV A;  4H86 A;  1WPI A;  4IBP A;  3UVT A;  2OE0 A;  2YNX A;  2F8F A;  1WE0 A;  4WR5 A;  4HEA 2;  4MH3 A;  5HR2 A;  1V57 A;  1ON4 A;  2B5E A;  3P7X A;  3VFI A;  1EGO A;  3IOS A;  2H01 A;  2JU5 A;  2FHE A;  2YWN A;  5D96 A;  1TRU A;  3L9V A;  1WP0 A;  4IP1 A;  3CXG A;  5ENU A;  4PUF C;  2KP2 A;  4ID0 A;  4KCA A;  6GSX A;  1GSU A;  2JAC A;  2FD3 A;  2OE1 A;  3M8N A;  2P5R A;  3DVW A;  1EWX A;  5IMA A;  4YQU A;  3TUE A;  5KEJ A;  4ZB9 A;  5CAX A;  5IIZ A;  3F0I A;  5H5S A;  1A23 A;  2VM1 A;  2FY6 A;  2WFC A;  3FZA A;  1GRX A;  2DJJ A;  2KLX A;  2XBI A;  4X0X A;  1NHY A;  4V2L A;  1M9B A;  1G6Y A;  3VI7 A;  1GL8 A;  4E8E A;  2GQK A;  1OC9 B;  2MMO A;  2WDU A;  4BPY A;  3A2X A;  2H30 A;  5DBQ A;  4IEL A;  10GS A;  5EPF A;  3BBY A;  1ST9 A;  3ED3 A;  5HFK A;  2V1M A;  5HR0 A;  3UL3 A;  2C0E A;  3HA9 A;  1SKS B;  4DEJ A;  3O76 A;  5HR1 A;  2VCZ A;  2H19 A;  2YZH A;  3IHQ A;  4XS6 A;  3U6V A;  4IVF A;  5CNW A;  1SEN A;  3QFB C;  3KM6 A;  1FAA A;  2TIR A;  5GAP D;  2YJH A;  3QAG A;  5DAL B;  2DMM A;  5IMV A;  3F9U A;  1YJ6 A;  5LNK e;  3GH9 A;  4FYU A;  2D2Z A;  2AV4 A;  2GLR A;  1JZO A;  3EE2 A;  2B7J A;  4HJM A;  3UJ1 A;  4WBR D;  5LD0 A;  4TR1 B;  4CDO A;  1QK8 A;  3O6T A;  2N5F A;  5GSS A;  1FW1 A;  3J7Y b;  2PU9 C;  4Z7X A;  1RK4 A;  2EIR A;  2YWM A;  5CO3 A;  5AIS A;  1EV4 A;  2MBT A;  5ECQ B;  2L4C A;  1VF2 A;  2IFQ B;  1GNE A;  2JAD A;  3F63 A;  5D73 A;  4QL7 A;  2F8A A;  3APQ A;  4TR3 A;  3IV4 A;  2IMI A;  5DDL A;  3QR6 A;  1WRY A;  5AGY A;  5IMC A;  2X64 A;  4K2D A;  1TJD A;  2VIM A;  1XWA A;  4MP4 A;  1A0R P;  4IJI A;  4HOJ A;  2H70 A;  2OAC A;  3MNG A;  2CX3 A;  2PUK C;  2YPM A;  1N2A A;  3IE3 A;  1G0T A;  1O73 A;  4TOP A;  4GTU A;  3LSZ A;  3ZFB A;  5A4W A;  3Q19 A;  3ME7 A;  2RUE A;  4IHU A;  2B1K A;  4YAV A;  1O81 A;  1AC1 A;  1K0C A;  4WXT A;  2DIZ A;  4KDU A;  2VUP A;  1B9X C;  3GTU A;  5G2Z A;  1U87 A;  1A2L A;  2DJ0 A;  3ZIJ A;  1BYE A;  2CZ3 A;  2HNL A;  3VLN A;  1Z6M A;  1O8X A;  3CRT A;  2CT6 A;  3LFL A;  1K0A A;  4L0U A;  2JZR A;  1Z9H A;  5IOX A;  1FOV A;  4KDY A;  2WJU A;  1AXD A;  2OAD A;  2X8C A;  3GL3 A;  3FR3 A;  3VWU A;  2VD0 A;  2JL4 A;  3VWW A;  5IPG A;  2GS3 A;  1S3C A;  2L5O A;  4MPF A;  3HDC A;  5J3R A;  3VI5 A;  5D8I A;  3HJM A;  3IPZ A;  2E2M A;  2ZNM A;  1F3A A;  1PKW A;  4POM A;  4XRD A;  3UBL A;  3HVV A;  2HSY A;  3D6I A;  4LMW A;  3Q6O A;  1B48 A;  1TOF A;  4RQR A;  1YF0 A;  2QGV A;  3FW2 A;  1PQN A;  4TRX A;  3JCM L;  1O85 A;  1V40 A;  2PMT A;  3QPM A;  3L9U A;  3TJB A;  3G7Y A;  3IDV A;  3DKS A;  6GSV A;  1CQG A;  1VF4 A;  2RM5 A;  1XVQ A;  1OE7 A;  4PUR A;  5DQS A;  1GTI A;  2DJ2 A;  3HD5 A;  2XBQ A;  2IJY A;  1K0B A;  3D22 A;  5A4V A;  4EXJ A;  3IR4 A;  4RQX A;  1WOU A;  1EOG A;  4NV5 A;  4BVY A;  4POB A;  1H4O A;  2X8G A;  2M80 A;  1SK1 A;  2GSQ A;  4YAP A;  1Z7R A;  3EMX A;  1QFN A;  2ON7 A;  1GUL A;  2HSH A;  1GSY A;  1I9D A;  3M9J A;  3LG6 A;  5ECN B;  1BG5 A;  1GP1 A;  5ECL B;  1S3D A;  3A5W A;  3QAV A;  3GL5 A;  1YY7 A;  2YOI A;  3FEU A;  8GSS A;  4MH2 A;  3TKS A;  2LV3 A;  4YH2 A;  3FKF A;  2LEG A;  2GGT A;  3KP9 A;  3FZ4 A;  6GST A;  1GSQ A;  5D93 A;  3TKS C;  1KTE A;  2A2S A;  2OE3 A;  2O89 A;  5J9B A;  3P2A A;  1PL1 A;  1NSW A;  3G7I A;  5CRE A;  2NPB A;  11GS A;  4GSS A;  3CBU A;  1ML6 A;  6GSU A;  4K0N A;  2VL9 A;  4K7N A;  1MDJ A;  1XWK A;  2GZY A;  4K9Z A;  2WRT A;  3GKK A;  2LJR A;  2I3Y A;  3KMO A;  1EP8 A;  2HRF A;  3L9S A;  3WGE A;  2H8L A;  2GZP A;  3Q74 A;  2HXK A;  4MJC A;  5FT3 A;  1U88 A;  3EYT A;  5AIV A;  3N5O A;  2VL3 A;  2OBI A;  3E9J B;  2JSY A;  1ZCP A;  2FA8 A;  2HZF A;  3PIN A;  1LU4 A;  4WF5 A;  1F3B A;  1M2A A;  2H0H A;  3C71 A;  3DXB A;  5HQP A;  3L4N A;  1V9W A;  2KP1 A;  3DEX A;  2WUL A;  17GS A;  5DQY A;  5AIX A;  4J2F A;  2LS5 A;  3H1N A;  2LRN A;  3FZ9 A;  4RI7 A;  1EEJ A;  3TJJ A;  5E59 A;  1MD3 A;  3ERG A;  1YEX A;  1C72 A;  4MZB A;  4HU7 A;  1NW2 A;  1N8J A;  2H76 A;  4N30 A;  1G6W A;  5G31 A;  1PGT A;  3HJP A;  4YQM A;  2F51 A;  1M9A A;  3FZ5 A;  3UEM A;  1THX A;  3EWL A;  3KZQ A;  3EIN A;  4XS1 A;  4J56 E;  1SYR A;  3QDN A;  5IMD A;  2K6V A;  2L6D A;  5J5N A;  1M99 A;  5IO2 A;  1R7H A;  2CX4 A;  4WBJ A;  5J4U A;  1K0M A;  3US3 A;  1ABA A;  3ME8 A;  1XIY A;  1G7O A;  5F07 A;  3DD3 A;  3ZTL A;  1SJI A;  4EDY A;  2ES7 A;  2VLT A;  2YJ7 A;  2JZS A;  3I69 A;  3N9J A;  4MA9 A;  3KP8 A;  4FH8 A;  4ECC A;  2O7K A;  12GS A;  3GTU B;  2C0F A;  5ECP B;  4ZBB A;  3WT2 A;  16GS A;  2AUV A;  4N10 A;  4MJA A;  1U3A A;  2P31 A;  3HVX A;  3UIW A;  4G9H A;  4O5R A;  4G10 A;  5JWQ B;  5J9C A;  4KA0 A;  1T3B A;  4PNF A;  4HQS A;  1M2B A;  3K8N A;  2GST A;  4HUA A;  3QOU A;  4OD7 A;  1R5A A;  4K6X A;  3EUR A;  4OCF A;  2LKU A;  1RW1 A;  4N0Z A;  1J0F A;  4MPG A;  5ELG A;  3VPT A;  3HHV A;  1T7P B;  2GDR A;  2H1A A;  1NHO A;  3KTL A;  4KH7 A;  4XCS A;  1SYX A;  1URM A;  3HYP A;  5F05 A;  3S9F A;  3QFA C;  7GSS A;  4G2E A;  4FYB A;  1DE2 A;  1RQM A;  4X43 A;  2ON5 A;  5G5F A;  1Y25 A;  2LTK A;  2AAW A;  3E0U A;  3ZIT A;  2H1G A;  1TI3 A;  2R5G A;  1HNC A;  2JZT A;  3CYN A;  3ERF A;  1Z3E A;  1E2Y A;  4OCE A;  4AF2 A;  1FG4 A;  4N11 A;  4V1A g;  4D73 A;  3C8E A;  1XFL A;  2YV9 A;  4FIW A;  4PQ1 A;  2P0G A;  4LL1 B;  2IWT A;  4MMM A;  2EC4 A;  5JCW A;  4ML6 A;  3IBH A;  3IRA A;  3FK8 A;  5ELA A;  4F82 A;  5ECO B;  3DVX A;  2LNS A;  1WMJ A;  1YF1 A;  4ZB8 A;  3ZYW A;  4ZIL A;  4LLR A;  3LQ7 A;  9GSS A;  1TRV A;  1XW6 A;  1QXH A;  1X5D A;  3TGZ A;  2K8V A;  5G30 A;  3RHB A;  4TR4 A;  1AIU A;  3GST A;  5F06 A;  2PPT A;  5F0G A;  4V2N A;  1TRW A;  2YWO A;  5IQY A;  2R6K A;  1GSD A;  2FNO A;  2HLS A;  4NV2 A;  2H71 A;  2KOK A;  4GQC A;  4PGT A;  4KAE A;  5DJL A;  1XW5 A;  2B6M A;  1V58 A;  3LXZ A;  4YQV A;  2NBS A;  3HJO A;  3CSI A;  3ZZX A;  2GQM A;  4I97 A;  2LNT A;  4ZL7 A;  4HZ4 A;  4MCU A;  1A8L A;  4KCE A;  1O6J A;  1X9M B;  1R4W A;  1SK2 A;  4WR4 A;  2GSR A;  1B4Q A;  4TXV A;  4AJ7 A;  3GNJ A;  4OO5 A;  1GH2 A;  4FYC A;  1YKA A;  1PX7 A;  5ID2 A;  3M9K A;  4GQF A;  3FHK A;  2PN8 A;  3GHA A;  2XPD A;  3MSZ A;  5KN3 A;  1IYH A;  2BTO T;  2YWI A;  5C04 A;  1AAZ A;  4MK3 A;  4JRR A;  1R26 A;  2MBS A;  6GSW A;  2A2R A;  4F2I A;  4DVC A;  1B9Y C;  4POL A;  3H79 A;  3CSH A;  3F8U A;  1TW9 A;  1VRS D;  3PR8 A;  2I1U A;  3HCZ A;  4ACS A;  1T8E B;  3LGC A;  1K0D A;  4EKZ A;  1BQ7 A;  2WCI A;  4PXO A;  1OKD A;  4KE3 A;  3HZ4 A;  4BVX A;  1ZZY A;  1G7E A;  1QQ2 A;  1OVN A;  1UC7 A;  3DWV A;  5ABR A;  1PRX A;  3BCI A;  4JR4 A;  2EIQ A;  2B5X A;  3CTG A;  1TI1 A;  3TJF A;  1UA5 A;  3QD9 A;  2E0Q A;  4K7O A;  3GV1 A;  2C3Q A;  3CTF A;  4GLT A;  2H6Y A;  4PNG A;  4PQI A;  3DYR A;  1JFU A;  1XVW A;  4PX1 A;  3UBK A;  3C7M A;  1F37 A;  1TKD B;  1HNA A;  3TKS E;  1ZYE A;  5H5R A;  3H8Q A;  2N5A A;  4MDC A;  1SKR B;  1IYI A;  2MMZ A;  1JZR A;  1T00 A;  1KEB A;  1F9M A;  1PN9 A;  3F6D A;  2CQ9 A;  1UN2 A;  1X9W B;  3LYP A;  2OBK A;  1M7T A;  4EDZ A;  1QUW A;  3SWL A;  4IQA A;  1KBN A;  3ZL5 A;  2N5B A;  3NOF A;  3G7J A;  1AQW A;  1Y6E A;  4IQ1 A;  4NHW A;  3FR6 A;  2IMK A;  1EEM A;  4POK A;  2GT6 A;  3FYG A;  1FVK A;  3VWX A;  3IK7 A;  1BAY A;  3WGD A;  2CVD A;  1K3L A;  1ACV A;  4JR6 A;  4EC0 A;  1Z7P A;  6GSY A;  2ZUP A;  2CVB A;  4TR0 A;  2H6Z A;  2VD1 A;  2G0F A;  3TB2 A;  1O8W A;  1T4Z A;  4CW9 A;  4BA7 A;  4K0G A;  1HD2 A;  3KMN A;  2XC2 A;  2L59 A;  1V2A A;  4KSM A;  4QL9 A;  2NVL A;  5G1L A;  2B7K A;  4XHM A;  4BL7 A;  3GA4 A;  5EVO A;  5IPH A;  3H4K A;  1YZX A;  4D73 B;  3ZML A;  4IJ3 A;  1MEK A;  1PMT A;  2H66 A;  3GH6 A;  1ZL9 A;  4IP6 A;  4Q5R A;  1OKT A;  2CAI A;  1AW9 A;  1WWJ A;  5ECS A;  3RDW A;  1EV9 A;  4L5L A;  4LMV A;  5B6M A;  4ZBD A;  5FWG A;  1NM3 A;  2LST A;  1CQH A;  2GQL A;  2V2G A;  5DVB A;  2WS2 A;  1WJK A;  3O3T A;  2CA8 A;  4RUV A;  2K18 A;  1SKW B;  2QSI A;  3TOU A;  2YP6 A;  4HU9 A;  2WZ9 A;  1TP9 A;  2M72 A;  1PA3 A;  3C73 A;  4MZC A;  2R37 A;  3IXR A;  1XWG A;  2IMD A;  4HS1 A;  2LRC A;  2E7P A;  4TW5 A;  1GWC A;  3TDG A;  1GLP A;  5DJM A;  5JCG A;  3UVH A;  3CSJ A;  3EMP A;  3RHC A;  4NPB A;  3F6F A;  3APO A;  1TXX A;  2VCT A;  3GFK A;  4KB3 A;  2X8H A;  4KSO A;  2FWE A;  3ZVJ A;  4NHZ A;  2OA7 A;  1O7U A;  2VCQ A;  5ID2 B;  19GS A;  1USB A;  1Z6N A;  2O87 A;  5ECR B;  2L5L A;  2J23 A;  3KGK A;  4EO3 A;  3ZLP A;  1DE1 A;  5ECI B;  3V1W A;  3ZRE A;  3WD6 A;  4ILF A;  4WKW A;  2VCV A;  1TDI A;  2TRC P;  2BJX A;  3A2W A;  1X0R A;  1Z5Y E;  3LEF A;  5KN0 A;  4NWY A;  4ECJ A;  4NAX A;  1TK0 B;  3W8S A;  4E8H A;  5LCZ A;  3FR9 A;  3KEB A;  3M0F A;  3IA1 A;  1PD2 1;  3ZRD A;  1QMV A;  1S3A A;  3QMX A;  1GUK A;  2DJ1 A;  1OYJ A;  4EUY A;  2IIY A;  4IKH A;  3RPP A;  1EOH A;  5B6N A;  3GUS A;  1AQX A;  4L8E A;  4MAB A;  4KDX A;  4AGS A;  2IPA A;  2ALB A;  5CRW A;  3HY2 A;  4BWQ A;  1J08 A;  2RUF A;  4JZQ A;  3F4R A;  1ERT A;  1V98 A;  2DBC A;  2C8U A;  2I81 A;  2LQO A;  2B5Y A;  1PX6 A;  5E4W A;  1F2E A;  1SJZ A;  1M0U A;  2C3T A;  2AB6 A;  1F6M C;  2DJ3 A;  1BJX A;  2PGT A;  4IW9 A;  3Q18 A;  5INY A;  4MJE A;  4XIH A;  2XPE A;  5IMF A;  4O7H A;  1SD9 A;  3GKM A;  2WGR A;  1U6T A;  4G19 A;  1R5P A;  3R2Q A;  1FVJ A;  4P3Y B;  4GST A;  4MLY A;  3GSS A;  3BJ5 A;  2GVP A;  1FO5 A;  1GSS A;  2H0G A;  1VF1 A;  2CZ2 A;  3BCK A;  5B7C A;  5FHI A;  1GSF A;  2RLI A;  1THO A;  4MJB A;  3NIV A;  2B3S A;  2V6K A;  4GSN A;  3VPQ A;  3MDK A;  3KIJ A;  2CAQ A;  1FHE A;  3MWH A;  5G5E A;  3TKP A;  4KND A;  1Q98 A;  2L57 A;  2MMN A;  1W4V A;  2NDO A;  2H0I A;  3D0Z A;  4XS4 A;  1U3I A;  2HT9 A;  2DJK A;  5HFI A;  5F8B A;  4JBB A;  2OKA A;  4TXO A;  3ZFL A;  4HI7 A;  3UAP A;  3D4T A;  4QQ7 A;  4F0B A;  2RM6 A;  2G2Q A;  2LJK A;  3FRC A;  2DIY A;  1K3Y A;  3LOR A;  1K0O A;  4N0V A;  4TKY A;  5HFG A;  5AN1 A;  2F9S A;  2R3X A;  1ERU A;  2QC7 A;  6GSS A;  2C3N A;  4ZIJ A;  1X9S B;  1SL1 B;  3M3M A;  5COH A;  1PL2 A;  2FGX A;  3GYK A;  1GLQ A;  3E3E A;  4ECB A;  3I43 A;  5ECK B;  2J9H A;  2V6O A;  2VCX A;  5ECM B;  4MF5 A;  2L6C A;  4O92 A;  3KJY A;  5IOW A;  4PQH A;  3IC4 A;  2HZE A;  18GS A;  3VK9 A;  4GXZ A;  3TOT A;  4ZL9 A;  4ULX A;  2WB9 A;  1SL2 B;  1FB0 A;  4HDE A;  4ML1 A;  5KN2 A;  3J7Y k;  5D9W A;  1GTA A;  2VO4 A;  1SL0 B;  3P90 A;  2A4V A;  2OJL A;  2I4A A;  1UVZ A;  1AQV A;  3PH9 A;  5C00 A;  2AYT A;  4ZL8 A;  2IME A;  1EP7 A;  4ZXG A;  4X1U A;  3EU3 A;  3GKN A;  4IS0 A;  3ZMK A;  2QKE A;  1TU7 A;  1HYU A;  1XZO A;  2BMX A;  3RPN A;  4HJ2 A;  4WF4 A;  4KUN A;  4OWY A;  4NMU A;  2CV4 A;  3W8J A;  4F9Z A;  2LQQ A;  13GS A;  2C80 A;  1A8Y A;  2XHF A;  2GSS A;  2REM A;  5GST A;  1W89 A;  4I2T A;  2I9H A;  3GIX A;  4J57 E;  1OAZ A;  1YKC A;  4LA1 A;  1PKZ A;  1SD8 A;  4DSS A;  5DAK A;  5L71 A;  4KGI A;  2MYG A;  4WEY A;  3FY7 A;  2Z9S A;  3UOM A;  3H93 A;  1H75 A;  5JWR B;  1JHB A;  1Q4J A;  2MMA A;  1HQO A;  3NZN A;  2HE3 A;  3LJR A;  3D5J A;  2IN3 A;  4I2U A;  4JU5 A;  1X5E A;  3QAW A;  1FB6 A;  1JZW A;  1XWB A;  1TK8 B;  2C4J A;  1XXU A;  2VCW A;  3F3Q A;  2GTU A;  4GCI A;  5IM9 A;  5JWO B;  1I5G A;  3TRQ A;  5G1K A;  3ZVJ D;  1M2D A;  2DC5 A;  1MDK A;  4I5Q A;  3DML A;  3KCM A;  3WT1 A;  3U5R E;  1E6B A;  1EGR A;  4I8B A;  2LJA A;  3HKR A;  3C1R A;  4LL4 B;  1BX9 A;  1MTC A;  4ECI A;  3EU4 A;  5IMZ A;  3GMF A;  1WIK A;  1TTZ A;  14GS A;  2EIO A;  3DGQ A;  3DRN A;  1XOA A;  1YDK A;  4F0C A;  5CRD A;  1KNG A;  2H74 A;  1DSB A;  3KXO A;  1XW9 A;  1ZOF A;  2V41 A;  1HNB A;  2DSA A;  4XRA A;  3IK9 A;  1YEP A;  1XBS A;  3L0H A;  2H75 A;  2PVO C;  1GSE A;  4EF0 A;  3EVI A;  1K0N A;  3D4M A;  1XWC A;  1PSQ A;  5D9V A;  1YQ1 A;  3C1S A;  4V2M A;  4XTS A;  3G9B A;  3GX0 A;  2HFD A;  4NXI A;  3GKX A;  2X99 A;  3ZIV A;  1DUG A;  4IGJ A;  3DIE A;  4ISD A;  3AY8 A;  2V32 A;  4K8M A;  1J9B A;  4MZW A;  2O85 A;  3LYK A;  4DSQ A;  3ISO A;  22GS A;  3QCP A;  5B8A A;  3I9V 2;  4ZBA A;  3GX8 A;  5DCH A;  4EE0 A;  4AJ6 A;  2C0D A;  4OFN A;  3GRX A;  2RII A;  4XS4 B;  4EVM A;  2VLV A;  2FCH A;  4TXO B;  2CVK A;  4HQZ A;  2DML A;  4L0W A;  1AUC A;  2HYX A;  1LJR A;  4TVE A;  4GF0 A;  3CMI A;  3WGX A; 
#chains in the Genus database with same CATH topology
 3LW9 A;  3WYW A;  2ZCT A;  3M1G A;  3BOA A;  3IAS 2;  1GNW A;  4K2X A;  1T1V A;  5CYY A;  4RI6 A;  1XPV A;  3KD0 A;  1A24 A;  5B8B A;  2VLU A;  1EZK A;  5CRH A;  1LBK A;  3I6A A;  2IMF A;  3SBC A;  2HRN A;  2B1L A;  2E2G A;  2VL2 A;  3F4S A;  2IL3 A;  3F3R A;  5D9T A;  1GTB A;  1GTU A;  1OC9 A;  4FO5 A;  2HZE B;  2YZU A;  2VL2 C;  2O8V B;  1VF3 A;  1B4P A;  2C1Y A;  1ZMA A;  3A2V A;  4MF6 A;  4KW6 A;  3RBT A;  2H6X A;  3D21 A;  3ERW A;  2M46 A;  3IAM 2;  5HR3 A;  2PWJ A;  2H72 A;  4EL1 A;  2DLX A;  3A3T A;  4K1F A;  1DBY A;  3F4T A;  4MF7 A;  2LRT A;  1TU8 A;  1SJ6 A;  3P8W A;  4GRF A;  2TRX A;  3APS A;  4BWS A;  1BED A;  2FLS A;  5DAL A;  3HXS A;  4ZB6 A;  2H73 A;  3UMA A;  2PBJ A;  2YV7 A;  1ZGN A;  2P5Q A;  1PN0 A;  1JZD A;  2KUC A;  3TJG A;  1T4Y A;  1JLW A;  1GUH A;  2VM2 A;  1GUM A;  2VOC A;  2R4V A;  4TR1 A;  1ERW A;  2KHP A;  3W6G A;  3L78 A;  4Q5F A;  5DCG A;  3PGT A;  3TCO A;  4OMV A;  2FA4 A;  1TRS A;  5GZZ B;  2F3M A;  1MD4 A;  4DSS B;  3KTB A;  5DAK B;  4KX4 A;  4X4J A;  2JSZ A;  1B8X A;  1K3O A;  5KN1 A;  1A0F A;  2IFQ A;  3BD2 A;  3UAR A;  4CHS A;  2AJQ B;  3TKQ A;  2AHE A;  3VUR A;  5EL8 A;  2YAN A;  2PVQ A;  4JED A;  1ERV A;  3KH7 A;  2MZC A;  2GT5 A;  3TJK A;  1A2J A;  4WET A;  2LUS A;  2VAF A;  2GZZ A;  1SU9 A;  5IO0 A;  2YCD A;  2FWG A;  4Q5N A;  1XCC A;  2A2P A;  1OE8 A;  3CRU A;  5CRG A;  1S3R A;  3LWA A;  4F03 A;  3TRX A;  3LXT A;  2L4Q A;  3GN3 A;  4GWR A;  4PUA A;  5ECH B;  4L5O A;  4OFT A;  5A4U A;  5EY6 A;  4TN8 A;  4JE1 A;  5D9X A;  1QGV A;  1X5C A;  20GS A;  4Q5Q A;  3GUR A;  2R2J A;  3IHG A;  3RAZ A;  1VGL A;  4I6X A;  5GAN D;  3EC3 A;  4K7I A;  2DKH A;  3MAK A;  3HVS A;  4HZ2 A;  4O32 A;  5JCU A;  4OO4 A;  1XOB A;  1TK5 B;  1SK0 A;  2H1B A;  5J41 A;  4DSR A;  2FWH A;  5H5Q A;  1A2M A;  3KH9 A;  3TRP A;  1ILO A;  2PER A;  3HZ8 A;  2YN1 A;  2HI7 A;  4OFM A;  1ZYQ B;  2K9F A;  4IN0 A;  3OR5 A;  4AJ8 A;  2K8S A;  2NTO A;  1OC8 A;  2C0G A;  2FWF A;  3VWV A;  4V1A p;  1OC3 A;  5CP1 A;  2H1D A;  3TKR A;  1MDI A;  2FUG 2;  5A5K A;  1JLV A;  4H86 A;  1WPI A;  4IBP A;  3UVT A;  2OE0 A;  2YNX A;  2F8F A;  1WE0 A;  4WR5 A;  4HEA 2;  4MH3 A;  5HR2 A;  1V57 A;  1ON4 A;  2B5E A;  3P7X A;  3VFI A;  1EGO A;  3IOS A;  2H01 A;  2JU5 A;  2FHE A;  2YWN A;  5D96 A;  1TRU A;  3L9V A;  1WP0 A;  4IP1 A;  3CXG A;  5ENU A;  4PUF C;  2KP2 A;  1M3I A;  4ID0 A;  4KCA A;  6GSX A;  1GSU A;  2JAC A;  2FD3 A;  2OE1 A;  3M8N A;  4YKF A;  2P5R A;  3DVW A;  1EWX A;  5IMA A;  4YQU A;  3TUE A;  5KEJ A;  4ZB9 A;  5CAX A;  5IIZ A;  3F0I A;  5H5S A;  1A23 A;  2VM1 A;  2FY6 A;  2WFC A;  3FZA A;  1GRX A;  4MNN A;  2DJJ A;  2KLX A;  2XBI A;  4X0X A;  1NHY A;  4V2L A;  1M9B A;  1G6Y A;  3VI7 A;  1GL8 A;  4E8E A;  2GQK A;  1OC9 B;  2MMO A;  2WDU A;  4BPY A;  4FQU A;  3A2X A;  2H30 A;  5DBQ A;  4IEL A;  10GS A;  5EPF A;  3BBY A;  1ST9 A;  3ED3 A;  5HFK A;  2V1M A;  5HR0 A;  3UL3 A;  2C0E A;  3HA9 A;  1SKS B;  4DEJ A;  3O76 A;  5HR1 A;  2VCZ A;  2H19 A;  2YZH A;  3IHQ A;  4XS6 A;  3U6V A;  4IVF A;  5CNW A;  1SEN A;  4CY8 A;  3QFB C;  3KM6 A;  1FAA A;  2TIR A;  5GAP D;  2YJH A;  3QAG A;  5DAL B;  2DMM A;  5IMV A;  3F9U A;  1YJ6 A;  5LNK e;  3GH9 A;  4FYU A;  3CQF A;  2D2Z A;  2AV4 A;  2GLR A;  1JZO A;  3EE2 A;  2B7J A;  4HJM A;  3UJ1 A;  2X49 A;  4WBR D;  5LD0 A;  4TR1 B;  4CDO A;  1QK8 A;  3O6T A;  2N5F A;  5GSS A;  1FW1 A;  3J7Y b;  2PU9 C;  4Z7X A;  1RK4 A;  2EIR A;  2YWM A;  5CO3 A;  5AIS A;  1EV4 A;  2MBT A;  3FMW A;  5ECQ B;  2L4C A;  1VF2 A;  4BIK A;  2IFQ B;  1GNE A;  2JAD A;  3F63 A;  5D73 A;  4QL7 A;  2F8A A;  3APQ A;  4TR3 A;  3IV4 A;  2IMI A;  5DDL A;  3QR6 A;  1WRY A;  5AGY A;  5IMC A;  2X64 A;  4K2D A;  1TJD A;  2VIM A;  1XWA A;  4MP4 A;  1A0R P;  4IJI A;  4HOJ A;  2H70 A;  2OAC A;  3MNG A;  2CX3 A;  2PUK C;  2YPM A;  1N2A A;  3IE3 A;  1G0T A;  1O73 A;  2HSM A;  4TOP A;  4GTU A;  3LSZ A;  3ZFB A;  5A4W A;  3Q19 A;  3ME7 A;  2RUE A;  4IHU A;  2B1K A;  4YAV A;  1O81 A;  1AC1 A;  1K0C A;  4WXT A;  2DIZ A;  4KDU A;  2VUP A;  1B9X C;  3GTU A;  5G2Z A;  1U87 A;  1A2L A;  2DJ0 A;  3ZIJ A;  1BYE A;  2CZ3 A;  2HNL A;  3VLN A;  1Z6M A;  1ZYP A;  1O8X A;  3CRT A;  2CT6 A;  3LFL A;  1K0A A;  2HRK A;  4L0U A;  2JZR A;  3MIX A;  1Z9H A;  5IOX A;  1FOV A;  4KDY A;  2WJU A;  1AXD A;  2OAD A;  2X8C A;  3GL3 A;  3FR3 A;  3VWU A;  2VD0 A;  2JL4 A;  4USS A;  3VWW A;  5IPG A;  2GS3 A;  1S3C A;  2L5O A;  4MPF A;  3HDC A;  5J3R A;  3VI5 A;  5D8I A;  3HJM A;  3IPZ A;  2E2M A;  2ZNM A;  1F3A A;  1PKW A;  4POM A;  4XRD A;  3UBL A;  3HVV A;  2HSY A;  3D6I A;  4LMW A;  3Q6O A;  1B48 A;  1TOF A;  4RQR A;  1YF0 A;  2QGV A;  3FW2 A;  1PQN A;  4TRX A;  3JCM L;  1O85 A;  1V40 A;  2PMT A;  3QPM A;  3L9U A;  2R0C A;  3TJB A;  3G7Y A;  3IDV A;  3DKS A;  6GSV A;  1CQG A;  1VF4 A;  2RM5 A;  1XVQ A;  1OE7 A;  4PUR A;  5DQS A;  1GTI A;  2DJ2 A;  3HD5 A;  2XBQ A;  2IJY A;  1K0B A;  3D22 A;  5A4V A;  4EXJ A;  3IR4 A;  4RQX A;  1WOU A;  1EOG A;  4NV5 A;  4BVY A;  4POB A;  1H4O A;  2X8G A;  2M80 A;  1SK1 A;  2GSQ A;  4YAP A;  1Z7R A;  3EMX A;  1QFN A;  2ON7 A;  1GUL A;  2HSH A;  1GSY A;  1I9D A;  3M9J A;  3LG6 A;  5ECN B;  1BG5 A;  1GP1 A;  5ECL B;  1S3D A;  3A5W A;  3QAV A;  3GL5 A;  1YY7 A;  2YOI A;  3FEU A;  8GSS A;  4MH2 A;  3TKS A;  2LV3 A;  4YH2 A;  3FKF A;  2LEG A;  2GGT A;  3KP9 A;  3FZ4 A;  6GST A;  1GSQ A;  5D93 A;  3TKS C;  1KTE A;  2A2S A;  2OE3 A;  2O89 A;  5J9B A;  3P2A A;  1PL1 A;  1NSW A;  3G7I A;  5CRE A;  2NPB A;  11GS A;  4GSS A;  3CBU A;  1ML6 A;  6GSU A;  4K0N A;  2VL9 A;  4K7N A;  1MDJ A;  1XWK A;  2GZY A;  4K9Z A;  2WRT A;  3GKK A;  2LJR A;  2I3Y A;  4HSC X;  3KMO A;  1EP8 A;  2HRF A;  3L9S A;  3WGE A;  2H8L A;  2GZP A;  3Q74 A;  4EIP A;  2HXK A;  4ICY A;  4MJC A;  5FT3 A;  1U88 A;  3EYT A;  5AIV A;  3N5O A;  2X4A A;  2VL3 A;  2OBI A;  3E9J B;  2JSY A;  1ZCP A;  2FA8 A;  2HZF A;  3PIN A;  1LU4 A;  4WF5 A;  1F3B A;  1M2A A;  2H0H A;  3C71 A;  3DXB A;  5HQP A;  3L4N A;  1V9W A;  2KP1 A;  3DEX A;  2WUL A;  17GS A;  5DQY A;  5AIX A;  4J2F A;  2LS5 A;  3H1N A;  2LRN A;  3FZ9 A;  4RI7 A;  1EEJ A;  3TJJ A;  5E59 A;  1MD3 A;  3ERG A;  1YEX A;  1C72 A;  4MZB A;  4HU7 A;  1NW2 A;  1N8J A;  4K5S A;  2H76 A;  4N30 A;  1G6W A;  5G31 A;  1PGT A;  3HJP A;  4YQM A;  2F51 A;  1M9A A;  3FZ5 A;  3UEM A;  1THX A;  3EWL A;  3KZQ A;  3EIN A;  4XS1 A;  4J56 E;  1SYR A;  3QDN A;  5IMD A;  2K6V A;  2L6D A;  2HRA A;  5J5N A;  1M99 A;  5IO2 A;  1R7H A;  2CX4 A;  4WBJ A;  5J4U A;  1K0M A;  3US3 A;  1ABA A;  3ME8 A;  1XIY A;  1G7O A;  5F07 A;  3DD3 A;  3ZTL A;  1SJI A;  4EDY A;  2ES7 A;  2VLT A;  2YJ7 A;  2JZS A;  3I69 A;  3N9J A;  4MA9 A;  3KP8 A;  4FH8 A;  4ECC A;  2O7K A;  12GS A;  3GTU B;  2C0F A;  5ECP B;  4ZBB A;  3WT2 A;  16GS A;  2AUV A;  4N10 A;  4MJA A;  1U3A A;  2P31 A;  3HVX A;  3UIW A;  4G9H A;  4O5R A;  4G10 A;  5JWQ B;  5J9C A;  4KA0 A;  1T3B A;  4PNF A;  4HQS A;  1M2B A;  3K8N A;  2GST A;  4HUA A;  3QOU A;  4OD7 A;  1R5A A;  4K6X A;  3EUR A;  4OCF A;  2LKU A;  1RW1 A;  4N0Z A;  1J0F A;  4MPG A;  5ELG A;  3VPT A;  3HHV A;  1T7P B;  2GDR A;  2H1A A;  4K5R A;  1NHO A;  2A4H A;  3KTL A;  4KH7 A;  4XCS A;  1SYX A;  1URM A;  3HYP A;  5F05 A;  4Z2U A;  3S9F A;  3QFA C;  7GSS A;  4G2E A;  4FYB A;  1DE2 A;  1RQM A;  5KOW A;  4X43 A;  2ON5 A;  5G5F A;  1Y25 A;  2LTK A;  2AAW A;  3E0U A;  3ZIT A;  2H1G A;  1TI3 A;  2R5G A;  1HNC A;  2JZT A;  3CYN A;  3ERF A;  1Z3E A;  4G0K A;  1E2Y A;  4OCE A;  4AF2 A;  1FG4 A;  4N11 A;  4V1A g;  4D73 A;  5KOX A;  3C8E A;  1XFL A;  2YV9 A;  4FIW A;  4PQ1 A;  2P0G A;  4LL1 B;  2IWT A;  4MMM A;  2EC4 A;  5JCW A;  4BVY B;  4ML6 A;  3IBH A;  3IRA A;  3FK8 A;  5ELA A;  4F82 A;  5ECO B;  3DVX A;  2LNS A;  1WMJ A;  1YF1 A;  4ZB8 A;  3ZYW A;  4ZIL A;  4LLR A;  3LQ7 A;  9GSS A;  1TRV A;  1XW6 A;  1QXH A;  1X5D A;  3TGZ A;  2K8V A;  5G30 A;  3RHB A;  4TR4 A;  1AIU A;  3GST A;  5F06 A;  2PPT A;  5F0G A;  4V2N A;  1TRW A;  2YWO A;  5IQY A;  2R6K A;  1GSD A;  2FNO A;  2HLS A;  4NV2 A;  2H71 A;  3A5I A;  2KOK A;  4GQC A;  4PGT A;  4KAE A;  5DJL A;  1XW5 A;  2B6M A;  1V58 A;  3LXZ A;  4YQV A;  2NBS A;  3HJO A;  3CSI A;  4G0I A;  3ZZX A;  2GQM A;  4I97 A;  2LNT A;  4ZL7 A;  4HZ4 A;  4MCU A;  1A8L A;  4KCE A;  1O6J A;  1X9M B;  1R4W A;  1SK2 A;  4WR4 A;  2GSR A;  2DKI A;  1B4Q A;  4TXV A;  4AJ7 A;  3GNJ A;  4OO5 A;  1GH2 A;  4FYC A;  1YKA A;  1PX7 A;  5ID2 A;  3M9K A;  4GQF A;  3FHK A;  2PN8 A;  3GHA A;  2XPD A;  3MSZ A;  5KN3 A;  1IYH A;  2BTO T;  2YWI A;  3HVN A;  5C04 A;  1AAZ A;  4MK3 A;  4JRR A;  1R26 A;  4Z2T A;  2MBS A;  6GSW A;  2A2R A;  4F2I A;  4DVC A;  1B9Y C;  4POL A;  3H79 A;  3CSH A;  3F8U A;  1TW9 A;  1VRS D;  3PR8 A;  2I1U A;  3HCZ A;  4ACS A;  1T8E B;  3LGC A;  1K0D A;  3IC8 A;  4EKZ A;  1BQ7 A;  2WCI A;  4PXO A;  1OKD A;  4KE3 A;  3HZ4 A;  4BVX A;  1ZZY A;  1G7E A;  1QQ2 A;  1OVN A;  1UC7 A;  3DWV A;  5ABR A;  1PRX A;  3BCI A;  4JR4 A;  2EIQ A;  3R3E A;  2B5X A;  3CTG A;  1TI1 A;  3TJF A;  1UA5 A;  3QD9 A;  2E0Q A;  4K7O A;  3GV1 A;  2C3Q A;  3CTF A;  4GLT A;  2H6Y A;  4PNG A;  4PQI A;  3DYR A;  1JFU A;  1XVW A;  4PX1 A;  3UBK A;  3C7M A;  1F37 A;  1TKD B;  4YKG A;  1HNA A;  3TKS E;  1ZYE A;  5H5R A;  3H8Q A;  2N5A A;  4MDC A;  1SKR B;  1IYI A;  2MMZ A;  1JZR A;  1T00 A;  1KEB A;  1F9M A;  1PN9 A;  3F6D A;  2CQ9 A;  1UN2 A;  1X9W B;  3LYP A;  2OBK A;  1M7T A;  4EDZ A;  1QUW A;  3SWL A;  4IQA A;  1KBN A;  3ZL5 A;  2N5B A;  3NOF A;  3G7J A;  1AQW A;  1Y6E A;  4IQ1 A;  4NHW A;  3FR6 A;  2IMK A;  1EEM A;  4POK A;  2GT6 A;  3FYG A;  1FVK A;  3VWX A;  3IK7 A;  1BAY A;  3WGD A;  2CVD A;  1K3L A;  1ACV A;  4JR6 A;  4EC0 A;  1Z7P A;  6GSY A;  2ZUP A;  2CVB A;  4TR0 A;  2H6Z A;  2VD1 A;  2G0F A;  3TB2 A;  1O8W A;  1T4Z A;  4CW9 A;  4BA7 A;  4K0G A;  1HD2 A;  3KMN A;  2XC2 A;  2L59 A;  1V2A A;  4KSM A;  4QL9 A;  2NVL A;  5G1L A;  2B7K A;  4XHM A;  4BL7 A;  3GA4 A;  5EVO A;  5IPH A;  3H4K A;  1YZX A;  4D73 B;  3ZML A;  4IJ3 A;  1MEK A;  1PMT A;  2H66 A;  3GH6 A;  1ZL9 A;  4IP6 A;  4Q5R A;  1OKT A;  2CAI A;  1AW9 A;  1WWJ A;  5ECS A;  3RDW A;  1EV9 A;  4L5L A;  4LMV A;  5B6M A;  4ZBD A;  5FWG A;  1NM3 A;  2LST A;  1CQH A;  2GQL A;  2V2G A;  5DVB A;  2WS2 A;  1WJK A;  3O3T A;  2CA8 A;  4RUV A;  2K18 A;  1SKW B;  2QSI A;  3TOU A;  2YP6 A;  4HU9 A;  2WZ9 A;  1TP9 A;  2M72 A;  1PA3 A;  3C73 A;  4MZC A;  1FOH A;  2R37 A;  3IXR A;  1XWG A;  2IMD A;  4HS1 A;  2LRC A;  2E7P A;  4TW5 A;  1GWC A;  3TDG A;  1GLP A;  5DJM A;  5JCG A;  3UVH A;  3CSJ A;  3EMP A;  3RHC A;  4NPB A;  3F6F A;  3APO A;  1TXX A;  2VCT A;  3GFK A;  4KB3 A;  2X8H A;  4KSO A;  1M3J A;  2FWE A;  3ZVJ A;  4NHZ A;  2OA7 A;  1O7U A;  2VCQ A;  5ID2 B;  19GS A;  1USB A;  1Z6N A;  2O87 A;  5ECR B;  2L5L A;  2J23 A;  3KGK A;  4EO3 A;  3ZLP A;  1DE1 A;  5ECI B;  3V1W A;  3ZRE A;  3WD6 A;  4ILF A;  4WKW A;  2VCV A;  1TDI A;  2TRC P;  2BJX A;  3A2W A;  1X0R A;  1Z5Y E;  3LEF A;  5KN0 A;  4NWY A;  4ECJ A;  4NAX A;  1TK0 B;  3W8S A;  4E8H A;  5LCZ A;  3FR9 A;  3KEB A;  3M0F A;  3IA1 A;  1PD2 1;  3ZRD A;  1QMV A;  1S3A A;  3QMX A;  1GUK A;  2DJ1 A;  1OYJ A;  4EUY A;  2IIY A;  4IKH A;  3RPP A;  1EOH A;  5B6N A;  3GUS A;  1AQX A;  4L8E A;  4BVX B;  4MAB A;  4KDX A;  4AGS A;  2IPA A;  2ALB A;  5CRW A;  3HY2 A;  4BWQ A;  1J08 A;  2RUF A;  4JZQ A;  3F4R A;  1ERT A;  1V98 A;  2DBC A;  2C8U A;  2I81 A;  2LQO A;  2B5Y A;  1PX6 A;  5E4W A;  1F2E A;  1SJZ A;  1M0U A;  2C3T A;  2AB6 A;  1F6M C;  2DJ3 A;  1BJX A;  2PGT A;  4IW9 A;  3Q18 A;  5INY A;  4MJE A;  4XIH A;  2XPE A;  5IMF A;  4O7H A;  1SD9 A;  3GKM A;  2WGR A;  1U6T A;  4G19 A;  1R5P A;  3R2Q A;  1FVJ A;  4P3Y B;  4GST A;  4MLY A;  1PFO A;  3GSS A;  3BJ5 A;  2GVP A;  1FO5 A;  1GSS A;  2H0G A;  1VF1 A;  2CZ2 A;  3BCK A;  5B7C A;  5FHI A;  1GSF A;  2RLI A;  1THO A;  4MJB A;  3NIV A;  2B3S A;  2V6K A;  4GSN A;  2QA1 A;  3VPQ A;  3MDK A;  3KIJ A;  2CAQ A;  1FHE A;  3MWH A;  5G5E A;  3TKP A;  4KND A;  1Q98 A;  2L57 A;  2MMN A;  1W4V A;  2NDO A;  3MYD A;  2H0I A;  3D0Z A;  5BRT A;  4XS4 A;  1U3I A;  2HT9 A;  2DJK A;  5HFI A;  5F8B A;  4JBB A;  4O5Q A;  2OKA A;  4TXO A;  3ZFL A;  4HI7 A;  3UAP A;  4A5P A;  3D4T A;  4QQ7 A;  4F0B A;  2RM6 A;  2G2Q A;  2LJK A;  3FRC A;  2DIY A;  1K3Y A;  3LOR A;  1K0O A;  4N0V A;  4TKY A;  3PPU A;  5HFG A;  5AN1 A;  2F9S A;  4KF9 A;  4BL7 B;  2R3X A;  1ERU A;  2QC7 A;  6GSS A;  2C3N A;  4ZIJ A;  1X9S B;  1SL1 B;  3M3M A;  5COH A;  1PL2 A;  2FGX A;  3GYK A;  1GLQ A;  3E3E A;  4ECB A;  3I43 A;  5ECK B;  2J9H A;  2V6O A;  2VCX A;  5ECM B;  4MF5 A;  2L6C A;  2QA2 A;  4O92 A;  3KJY A;  5IOW A;  4PQH A;  3IC4 A;  2HZE A;  18GS A;  3VK9 A;  4GXZ A;  3TOT A;  4ZL9 A;  4ULX A;  2WB9 A;  1SL2 B;  4PTS A;  1FB0 A;  4HDE A;  4ML1 A;  5KN2 A;  5BMU A;  3J7Y k;  4Z2R A;  5D9W A;  1GTA A;  2VO4 A;  1SL0 B;  3P90 A;  2A4V A;  2OJL A;  4O5U A;  2I4A A;  1UVZ A;  1AQV A;  3PH9 A;  5C00 A;  2AYT A;  4ZL8 A;  2IME A;  4CY6 A;  1EP7 A;  4ZXG A;  4X1U A;  3EU3 A;  3GKN A;  4IS0 A;  3ZMK A;  2QKE A;  1TU7 A;  1HYU A;  1XZO A;  2BMX A;  3RPN A;  4HJ2 A;  4WF4 A;  4KUN A;  4OWY A;  4NMU A;  2CV4 A;  3W8J A;  4F9Z A;  2LQQ A;  13GS A;  2C80 A;  1A8Y A;  2XHF A;  2GSS A;  2UZ8 A;  2REM A;  5GST A;  1W89 A;  1ZYN A;  4I2T A;  2I9H A;  3GIX A;  4J57 E;  1OAZ A;  1YKC A;  4LA1 A;  1PKZ A;  1SD8 A;  4DSS A;  5DAK A;  5L71 A;  4KGI A;  2MYG A;  4WEY A;  3FY7 A;  2Z9S A;  3UOM A;  3H93 A;  1H75 A;  5JWR B;  1JHB A;  1Q4J A;  2MMA A;  1HQO A;  3NZN A;  2HE3 A;  3LJR A;  3D5J A;  2IN3 A;  4I2U A;  4JU5 A;  1X5E A;  3QAW A;  1FB6 A;  1JZW A;  1XWB A;  1TK8 B;  1XG8 A;  2C4J A;  1XXU A;  2VCW A;  3F3Q A;  3EPT A;  2GTU A;  4GCI A;  5IM9 A;  5JWO B;  1I5G A;  3TRQ A;  5G1K A;  3ZVJ D;  1M2D A;  2DC5 A;  1MDK A;  4I5Q A;  3DML A;  3KCM A;  3WT1 A;  3U5R E;  1E6B A;  1EGR A;  4I8B A;  2LJA A;  3HKR A;  2R0P A;  3C1R A;  4LL4 B;  1BX9 A;  1MTC A;  4ECI A;  3EU4 A;  5IMZ A;  3GMF A;  1WIK A;  2R0G A;  1TTZ A;  14GS A;  2EIO A;  3DGQ A;  3DRN A;  1XOA A;  1YDK A;  4F0C A;  5CRD A;  1KNG A;  2H74 A;  1DSB A;  3KXO A;  1XW9 A;  1ZOF A;  2V41 A;  1HNB A;  2DSA A;  4XRA A;  3IK9 A;  1YEP A;  1XBS A;  3L0H A;  2H75 A;  2PVO C;  1GSE A;  4EF0 A;  3EVI A;  1K0N A;  3D4M A;  1XWC A;  1PSQ A;  5D9V A;  1YQ1 A;  3C1S A;  4EIQ A;  4V2M A;  4XTS A;  3G9B A;  3GX0 A;  2HFD A;  4NXI A;  3GKX A;  2X99 A;  3ZIV A;  1DUG A;  4IGJ A;  3DIE A;  4ISD A;  3AY8 A;  2V32 A;  4K8M A;  1J9B A;  4MZW A;  2O85 A;  3LYK A;  4DSQ A;  3ISO A;  22GS A;  3QCP A;  5B8A A;  3I9V 2;  4ZBA A;  3GX8 A;  5DCH A;  4EE0 A;  4AJ6 A;  2C0D A;  4OFN A;  3GRX A;  2RII A;  4G0L A;  4XS4 B;  4EVM A;  2VLV A;  2FCH A;  4TXO B;  2CVK A;  4HQZ A;  2DML A;  4L0W A;  1AUC A;  2HYX A;  1LJR A;  4TVE A;  4GF0 A;  3CMI A;  3WGX A; 
#chains in the Genus database with same CATH homology
 3LW9 A;  3WYW A;  2ZCT A;  3M1G A;  3BOA A;  3IAS 2;  1GNW A;  4K2X A;  1T1V A;  5CYY A;  4RI6 A;  1XPV A;  3KD0 A;  1A24 A;  5B8B A;  2VLU A;  1EZK A;  5CRH A;  1LBK A;  3I6A A;  2IMF A;  3SBC A;  2HRN A;  2B1L A;  2E2G A;  2VL2 A;  3F4S A;  2IL3 A;  3F3R A;  5D9T A;  1GTB A;  1GTU A;  1OC9 A;  4FO5 A;  2HZE B;  2YZU A;  2VL2 C;  2O8V B;  1VF3 A;  1B4P A;  2C1Y A;  1ZMA A;  3A2V A;  4MF6 A;  4KW6 A;  3RBT A;  2H6X A;  3D21 A;  3ERW A;  2M46 A;  3IAM 2;  5HR3 A;  2PWJ A;  2H72 A;  4EL1 A;  2DLX A;  3A3T A;  4K1F A;  1DBY A;  3F4T A;  4MF7 A;  2LRT A;  1TU8 A;  1SJ6 A;  3P8W A;  4GRF A;  2TRX A;  3APS A;  4BWS A;  1BED A;  2FLS A;  5DAL A;  3HXS A;  4ZB6 A;  2H73 A;  3UMA A;  2PBJ A;  2YV7 A;  1ZGN A;  2P5Q A;  1PN0 A;  1JZD A;  2KUC A;  3TJG A;  1T4Y A;  1JLW A;  1GUH A;  2VM2 A;  1GUM A;  2VOC A;  2R4V A;  4TR1 A;  1ERW A;  2KHP A;  3W6G A;  3L78 A;  4Q5F A;  5DCG A;  3PGT A;  3TCO A;  4OMV A;  2FA4 A;  1TRS A;  5GZZ B;  2F3M A;  1MD4 A;  4DSS B;  3KTB A;  5DAK B;  4KX4 A;  4X4J A;  2JSZ A;  1B8X A;  1K3O A;  5KN1 A;  1A0F A;  2IFQ A;  3BD2 A;  3UAR A;  4CHS A;  2AJQ B;  3TKQ A;  2AHE A;  3VUR A;  5EL8 A;  2YAN A;  2PVQ A;  4JED A;  1ERV A;  3KH7 A;  2MZC A;  2GT5 A;  3TJK A;  1A2J A;  4WET A;  2LUS A;  2VAF A;  2GZZ A;  1SU9 A;  5IO0 A;  2YCD A;  2FWG A;  4Q5N A;  1XCC A;  2A2P A;  1OE8 A;  3CRU A;  5CRG A;  3LWA A;  4F03 A;  3TRX A;  3LXT A;  2L4Q A;  3GN3 A;  4GWR A;  4PUA A;  5ECH B;  4L5O A;  4OFT A;  5A4U A;  5EY6 A;  4TN8 A;  4JE1 A;  5D9X A;  1QGV A;  1X5C A;  20GS A;  4Q5Q A;  3GUR A;  2R2J A;  3IHG A;  3RAZ A;  1VGL A;  4I6X A;  5GAN D;  3EC3 A;  4K7I A;  2DKH A;  3MAK A;  3HVS A;  4HZ2 A;  4O32 A;  5JCU A;  4OO4 A;  1XOB A;  1TK5 B;  1SK0 A;  2H1B A;  5J41 A;  4DSR A;  2FWH A;  5H5Q A;  1A2M A;  3KH9 A;  3TRP A;  1ILO A;  2PER A;  3HZ8 A;  2YN1 A;  2HI7 A;  4OFM A;  1ZYQ B;  2K9F A;  4IN0 A;  3OR5 A;  4AJ8 A;  2K8S A;  2NTO A;  1OC8 A;  2C0G A;  2FWF A;  3VWV A;  4V1A p;  1OC3 A;  5CP1 A;  2H1D A;  3TKR A;  1MDI A;  2FUG 2;  5A5K A;  1JLV A;  4H86 A;  1WPI A;  4IBP A;  3UVT A;  2OE0 A;  2YNX A;  2F8F A;  1WE0 A;  4WR5 A;  4HEA 2;  4MH3 A;  5HR2 A;  1V57 A;  1ON4 A;  2B5E A;  3P7X A;  3VFI A;  1EGO A;  3IOS A;  2H01 A;  2JU5 A;  2FHE A;  2YWN A;  5D96 A;  1TRU A;  3L9V A;  1WP0 A;  4IP1 A;  3CXG A;  5ENU A;  4PUF C;  2KP2 A;  4ID0 A;  4KCA A;  6GSX A;  1GSU A;  2JAC A;  2FD3 A;  2OE1 A;  3M8N A;  4YKF A;  2P5R A;  3DVW A;  1EWX A;  5IMA A;  4YQU A;  3TUE A;  5KEJ A;  4ZB9 A;  5CAX A;  5IIZ A;  3F0I A;  5H5S A;  1A23 A;  2VM1 A;  2FY6 A;  2WFC A;  3FZA A;  1GRX A;  4MNN A;  2DJJ A;  2KLX A;  2XBI A;  4X0X A;  1NHY A;  4V2L A;  1M9B A;  1G6Y A;  3VI7 A;  1GL8 A;  4E8E A;  2GQK A;  1OC9 B;  2MMO A;  2WDU A;  4BPY A;  4FQU A;  3A2X A;  2H30 A;  5DBQ A;  4IEL A;  10GS A;  5EPF A;  3BBY A;  1ST9 A;  3ED3 A;  5HFK A;  2V1M A;  5HR0 A;  3UL3 A;  2C0E A;  3HA9 A;  1SKS B;  4DEJ A;  3O76 A;  5HR1 A;  2VCZ A;  2H19 A;  2YZH A;  3IHQ A;  4XS6 A;  3U6V A;  4IVF A;  5CNW A;  1SEN A;  4CY8 A;  3QFB C;  3KM6 A;  1FAA A;  2TIR A;  5GAP D;  2YJH A;  3QAG A;  5DAL B;  2DMM A;  5IMV A;  3F9U A;  1YJ6 A;  5LNK e;  3GH9 A;  4FYU A;  2D2Z A;  2AV4 A;  2GLR A;  1JZO A;  3EE2 A;  2B7J A;  4HJM A;  3UJ1 A;  2X49 A;  4WBR D;  5LD0 A;  4TR1 B;  4CDO A;  1QK8 A;  3O6T A;  2N5F A;  5GSS A;  1FW1 A;  3J7Y b;  2PU9 C;  4Z7X A;  1RK4 A;  2EIR A;  2YWM A;  5CO3 A;  5AIS A;  1EV4 A;  2MBT A;  3FMW A;  5ECQ B;  2L4C A;  1VF2 A;  2IFQ B;  1GNE A;  2JAD A;  3F63 A;  5D73 A;  4QL7 A;  2F8A A;  3APQ A;  4TR3 A;  3IV4 A;  2IMI A;  5DDL A;  3QR6 A;  1WRY A;  5AGY A;  5IMC A;  2X64 A;  4K2D A;  1TJD A;  2VIM A;  1XWA A;  4MP4 A;  1A0R P;  4IJI A;  4HOJ A;  2H70 A;  2OAC A;  3MNG A;  2CX3 A;  2PUK C;  2YPM A;  1N2A A;  3IE3 A;  1G0T A;  1O73 A;  2HSM A;  4TOP A;  4GTU A;  3LSZ A;  3ZFB A;  5A4W A;  3Q19 A;  3ME7 A;  2RUE A;  4IHU A;  2B1K A;  4YAV A;  1O81 A;  1AC1 A;  1K0C A;  4WXT A;  2DIZ A;  4KDU A;  2VUP A;  1B9X C;  3GTU A;  5G2Z A;  1U87 A;  1A2L A;  2DJ0 A;  3ZIJ A;  1BYE A;  2CZ3 A;  2HNL A;  3VLN A;  1Z6M A;  1ZYP A;  1O8X A;  3CRT A;  2CT6 A;  3LFL A;  1K0A A;  2HRK A;  4L0U A;  2JZR A;  3MIX A;  1Z9H A;  5IOX A;  1FOV A;  4KDY A;  2WJU A;  1AXD A;  2OAD A;  2X8C A;  3GL3 A;  3FR3 A;  3VWU A;  2VD0 A;  2JL4 A;  4USS A;  3VWW A;  5IPG A;  2GS3 A;  1S3C A;  2L5O A;  4MPF A;  3HDC A;  5J3R A;  3VI5 A;  5D8I A;  3HJM A;  3IPZ A;  2E2M A;  2ZNM A;  1F3A A;  1PKW A;  4POM A;  4XRD A;  3UBL A;  3HVV A;  2HSY A;  3D6I A;  4LMW A;  3Q6O A;  1B48 A;  1TOF A;  4RQR A;  1YF0 A;  2QGV A;  3FW2 A;  1PQN A;  4TRX A;  3JCM L;  1O85 A;  1V40 A;  2PMT A;  3QPM A;  3L9U A;  2R0C A;  3TJB A;  3G7Y A;  3IDV A;  3DKS A;  6GSV A;  1CQG A;  1VF4 A;  2RM5 A;  1XVQ A;  1OE7 A;  4PUR A;  5DQS A;  1GTI A;  2DJ2 A;  3HD5 A;  2XBQ A;  2IJY A;  1K0B A;  3D22 A;  5A4V A;  4EXJ A;  3IR4 A;  4RQX A;  1WOU A;  1EOG A;  4NV5 A;  4BVY A;  4POB A;  1H4O A;  2X8G A;  2M80 A;  1SK1 A;  2GSQ A;  4YAP A;  1Z7R A;  3EMX A;  1QFN A;  2ON7 A;  1GUL A;  2HSH A;  1GSY A;  1I9D A;  3M9J A;  3LG6 A;  5ECN B;  1BG5 A;  1GP1 A;  5ECL B;  1S3D A;  3A5W A;  3QAV A;  3GL5 A;  1YY7 A;  2YOI A;  3FEU A;  8GSS A;  4MH2 A;  3TKS A;  2LV3 A;  4YH2 A;  3FKF A;  2LEG A;  2GGT A;  3KP9 A;  3FZ4 A;  6GST A;  1GSQ A;  5D93 A;  3TKS C;  1KTE A;  2A2S A;  2OE3 A;  2O89 A;  5J9B A;  3P2A A;  1PL1 A;  1NSW A;  3G7I A;  5CRE A;  2NPB A;  11GS A;  4GSS A;  3CBU A;  1ML6 A;  6GSU A;  4K0N A;  2VL9 A;  4K7N A;  1MDJ A;  1XWK A;  2GZY A;  4K9Z A;  2WRT A;  3GKK A;  2LJR A;  2I3Y A;  3KMO A;  1EP8 A;  2HRF A;  3L9S A;  3WGE A;  2H8L A;  2GZP A;  3Q74 A;  4EIP A;  2HXK A;  4ICY A;  4MJC A;  5FT3 A;  1U88 A;  3EYT A;  5AIV A;  3N5O A;  2X4A A;  2VL3 A;  2OBI A;  3E9J B;  2JSY A;  1ZCP A;  2FA8 A;  2HZF A;  3PIN A;  1LU4 A;  4WF5 A;  1F3B A;  1M2A A;  2H0H A;  3C71 A;  3DXB A;  5HQP A;  3L4N A;  1V9W A;  2KP1 A;  3DEX A;  2WUL A;  17GS A;  5DQY A;  5AIX A;  4J2F A;  2LS5 A;  3H1N A;  2LRN A;  3FZ9 A;  4RI7 A;  1EEJ A;  3TJJ A;  5E59 A;  1MD3 A;  3ERG A;  1YEX A;  1C72 A;  4MZB A;  4HU7 A;  1NW2 A;  1N8J A;  4K5S A;  2H76 A;  4N30 A;  1G6W A;  5G31 A;  1PGT A;  3HJP A;  4YQM A;  2F51 A;  1M9A A;  3FZ5 A;  3UEM A;  1THX A;  3EWL A;  3KZQ A;  3EIN A;  4XS1 A;  4J56 E;  1SYR A;  3QDN A;  5IMD A;  2K6V A;  2L6D A;  2HRA A;  5J5N A;  1M99 A;  5IO2 A;  1R7H A;  2CX4 A;  4WBJ A;  5J4U A;  1K0M A;  3US3 A;  1ABA A;  3ME8 A;  1XIY A;  1G7O A;  5F07 A;  3DD3 A;  3ZTL A;  1SJI A;  4EDY A;  2ES7 A;  2VLT A;  2YJ7 A;  2JZS A;  3I69 A;  3N9J A;  4MA9 A;  3KP8 A;  4FH8 A;  4ECC A;  2O7K A;  12GS A;  3GTU B;  2C0F A;  5ECP B;  4ZBB A;  3WT2 A;  16GS A;  2AUV A;  4N10 A;  4MJA A;  1U3A A;  2P31 A;  3HVX A;  3UIW A;  4G9H A;  4O5R A;  4G10 A;  5JWQ B;  5J9C A;  4KA0 A;  1T3B A;  4PNF A;  4HQS A;  1M2B A;  3K8N A;  2GST A;  4HUA A;  3QOU A;  4OD7 A;  1R5A A;  4K6X A;  3EUR A;  4OCF A;  2LKU A;  1RW1 A;  4N0Z A;  1J0F A;  4MPG A;  5ELG A;  3VPT A;  3HHV A;  1T7P B;  2GDR A;  2H1A A;  4K5R A;  1NHO A;  2A4H A;  3KTL A;  4KH7 A;  4XCS A;  1SYX A;  1URM A;  3HYP A;  5F05 A;  4Z2U A;  3S9F A;  3QFA C;  7GSS A;  4G2E A;  4FYB A;  1DE2 A;  1RQM A;  5KOW A;  4X43 A;  2ON5 A;  5G5F A;  1Y25 A;  2LTK A;  2AAW A;  3E0U A;  3ZIT A;  2H1G A;  1TI3 A;  2R5G A;  1HNC A;  2JZT A;  3CYN A;  3ERF A;  1Z3E A;  4G0K A;  1E2Y A;  4OCE A;  4AF2 A;  1FG4 A;  4N11 A;  4V1A g;  4D73 A;  5KOX A;  3C8E A;  1XFL A;  2YV9 A;  4FIW A;  4PQ1 A;  2P0G A;  4LL1 B;  2IWT A;  4MMM A;  2EC4 A;  5JCW A;  4BVY B;  4ML6 A;  3IBH A;  3IRA A;  3FK8 A;  5ELA A;  4F82 A;  5ECO B;  3DVX A;  2LNS A;  1WMJ A;  1YF1 A;  4ZB8 A;  3ZYW A;  4ZIL A;  4LLR A;  3LQ7 A;  9GSS A;  1TRV A;  1XW6 A;  1QXH A;  1X5D A;  3TGZ A;  2K8V A;  5G30 A;  3RHB A;  4TR4 A;  1AIU A;  3GST A;  5F06 A;  2PPT A;  5F0G A;  4V2N A;  1TRW A;  2YWO A;  5IQY A;  2R6K A;  1GSD A;  2FNO A;  2HLS A;  4NV2 A;  2H71 A;  3A5I A;  2KOK A;  4GQC A;  4PGT A;  4KAE A;  5DJL A;  1XW5 A;  2B6M A;  1V58 A;  3LXZ A;  4YQV A;  2NBS A;  3HJO A;  3CSI A;  4G0I A;  3ZZX A;  2GQM A;  4I97 A;  2LNT A;  4ZL7 A;  4HZ4 A;  4MCU A;  1A8L A;  4KCE A;  1O6J A;  1X9M B;  1R4W A;  1SK2 A;  4WR4 A;  2GSR A;  2DKI A;  1B4Q A;  4TXV A;  4AJ7 A;  3GNJ A;  4OO5 A;  1GH2 A;  4FYC A;  1YKA A;  1PX7 A;  5ID2 A;  3M9K A;  4GQF A;  3FHK A;  2PN8 A;  3GHA A;  2XPD A;  3MSZ A;  5KN3 A;  1IYH A;  2BTO T;  2YWI A;  5C04 A;  1AAZ A;  4MK3 A;  4JRR A;  1R26 A;  4Z2T A;  2MBS A;  6GSW A;  2A2R A;  4F2I A;  4DVC A;  1B9Y C;  4POL A;  3H79 A;  3CSH A;  3F8U A;  1TW9 A;  1VRS D;  3PR8 A;  2I1U A;  3HCZ A;  4ACS A;  1T8E B;  3LGC A;  1K0D A;  3IC8 A;  4EKZ A;  1BQ7 A;  2WCI A;  4PXO A;  1OKD A;  4KE3 A;  3HZ4 A;  4BVX A;  1ZZY A;  1G7E A;  1QQ2 A;  1OVN A;  1UC7 A;  3DWV A;  5ABR A;  1PRX A;  3BCI A;  4JR4 A;  2EIQ A;  3R3E A;  2B5X A;  3CTG A;  1TI1 A;  3TJF A;  1UA5 A;  3QD9 A;  2E0Q A;  4K7O A;  3GV1 A;  2C3Q A;  3CTF A;  4GLT A;  2H6Y A;  4PNG A;  4PQI A;  3DYR A;  1JFU A;  1XVW A;  4PX1 A;  3UBK A;  3C7M A;  1F37 A;  1TKD B;  4YKG A;  1HNA A;  3TKS E;  1ZYE A;  5H5R A;  3H8Q A;  2N5A A;  4MDC A;  1SKR B;  1IYI A;  2MMZ A;  1JZR A;  1T00 A;  1KEB A;  1F9M A;  1PN9 A;  3F6D A;  2CQ9 A;  1UN2 A;  1X9W B;  3LYP A;  2OBK A;  1M7T A;  4EDZ A;  1QUW A;  3SWL A;  4IQA A;  1KBN A;  3ZL5 A;  2N5B A;  3NOF A;  3G7J A;  1AQW A;  1Y6E A;  4IQ1 A;  4NHW A;  3FR6 A;  2IMK A;  1EEM A;  4POK A;  2GT6 A;  3FYG A;  1FVK A;  3VWX A;  3IK7 A;  1BAY A;  3WGD A;  2CVD A;  1K3L A;  1ACV A;  4JR6 A;  4EC0 A;  1Z7P A;  6GSY A;  2ZUP A;  2CVB A;  4TR0 A;  2H6Z A;  2VD1 A;  2G0F A;  3TB2 A;  1O8W A;  1T4Z A;  4CW9 A;  4BA7 A;  4K0G A;  1HD2 A;  3KMN A;  2XC2 A;  2L59 A;  1V2A A;  4KSM A;  4QL9 A;  2NVL A;  5G1L A;  2B7K A;  4XHM A;  4BL7 A;  3GA4 A;  5EVO A;  5IPH A;  3H4K A;  1YZX A;  4D73 B;  3ZML A;  4IJ3 A;  1MEK A;  1PMT A;  2H66 A;  3GH6 A;  1ZL9 A;  4IP6 A;  4Q5R A;  1OKT A;  2CAI A;  1AW9 A;  1WWJ A;  5ECS A;  3RDW A;  1EV9 A;  4L5L A;  4LMV A;  5B6M A;  4ZBD A;  5FWG A;  1NM3 A;  2LST A;  1CQH A;  2GQL A;  2V2G A;  5DVB A;  2WS2 A;  1WJK A;  3O3T A;  2CA8 A;  4RUV A;  2K18 A;  1SKW B;  2QSI A;  3TOU A;  2YP6 A;  4HU9 A;  2WZ9 A;  1TP9 A;  2M72 A;  1PA3 A;  3C73 A;  4MZC A;  1FOH A;  2R37 A;  3IXR A;  1XWG A;  2IMD A;  4HS1 A;  2LRC A;  2E7P A;  4TW5 A;  1GWC A;  3TDG A;  1GLP A;  5DJM A;  5JCG A;  3UVH A;  3CSJ A;  3EMP A;  3RHC A;  4NPB A;  3F6F A;  3APO A;  1TXX A;  2VCT A;  3GFK A;  4KB3 A;  2X8H A;  4KSO A;  2FWE A;  3ZVJ A;  4NHZ A;  2OA7 A;  1O7U A;  2VCQ A;  5ID2 B;  19GS A;  1USB A;  1Z6N A;  2O87 A;  5ECR B;  2L5L A;  2J23 A;  3KGK A;  4EO3 A;  3ZLP A;  1DE1 A;  5ECI B;  3V1W A;  3ZRE A;  3WD6 A;  4ILF A;  4WKW A;  2VCV A;  1TDI A;  2TRC P;  2BJX A;  3A2W A;  1X0R A;  1Z5Y E;  3LEF A;  5KN0 A;  4NWY A;  4ECJ A;  4NAX A;  1TK0 B;  3W8S A;  4E8H A;  5LCZ A;  3FR9 A;  3KEB A;  3M0F A;  3IA1 A;  1PD2 1;  3ZRD A;  1QMV A;  1S3A A;  3QMX A;  1GUK A;  2DJ1 A;  1OYJ A;  4EUY A;  2IIY A;  4IKH A;  3RPP A;  1EOH A;  5B6N A;  3GUS A;  1AQX A;  4L8E A;  4BVX B;  4MAB A;  4KDX A;  4AGS A;  2IPA A;  2ALB A;  5CRW A;  3HY2 A;  4BWQ A;  1J08 A;  2RUF A;  4JZQ A;  3F4R A;  1ERT A;  1V98 A;  2DBC A;  2C8U A;  2I81 A;  2LQO A;  2B5Y A;  1PX6 A;  5E4W A;  1F2E A;  1SJZ A;  1M0U A;  2C3T A;  2AB6 A;  1F6M C;  2DJ3 A;  1BJX A;  2PGT A;  4IW9 A;  3Q18 A;  5INY A;  4MJE A;  4XIH A;  2XPE A;  5IMF A;  4O7H A;  1SD9 A;  3GKM A;  2WGR A;  1U6T A;  4G19 A;  1R5P A;  3R2Q A;  1FVJ A;  4P3Y B;  4GST A;  4MLY A;  3GSS A;  3BJ5 A;  2GVP A;  1FO5 A;  1GSS A;  2H0G A;  1VF1 A;  2CZ2 A;  3BCK A;  5B7C A;  5FHI A;  1GSF A;  2RLI A;  1THO A;  4MJB A;  3NIV A;  2B3S A;  2V6K A;  4GSN A;  2QA1 A;  3VPQ A;  3MDK A;  3KIJ A;  2CAQ A;  1FHE A;  3MWH A;  5G5E A;  3TKP A;  4KND A;  1Q98 A;  2L57 A;  2MMN A;  1W4V A;  2NDO A;  3MYD A;  2H0I A;  3D0Z A;  5BRT A;  4XS4 A;  1U3I A;  2HT9 A;  2DJK A;  5HFI A;  5F8B A;  4JBB A;  4O5Q A;  2OKA A;  4TXO A;  3ZFL A;  4HI7 A;  3UAP A;  4A5P A;  3D4T A;  4QQ7 A;  4F0B A;  2RM6 A;  2G2Q A;  2LJK A;  3FRC A;  2DIY A;  1K3Y A;  3LOR A;  1K0O A;  4N0V A;  4TKY A;  3PPU A;  5HFG A;  5AN1 A;  2F9S A;  4KF9 A;  4BL7 B;  2R3X A;  1ERU A;  2QC7 A;  6GSS A;  2C3N A;  4ZIJ A;  1X9S B;  1SL1 B;  3M3M A;  5COH A;  1PL2 A;  2FGX A;  3GYK A;  1GLQ A;  3E3E A;  4ECB A;  3I43 A;  5ECK B;  2J9H A;  2V6O A;  2VCX A;  5ECM B;  4MF5 A;  2L6C A;  2QA2 A;  4O92 A;  3KJY A;  5IOW A;  4PQH A;  3IC4 A;  2HZE A;  18GS A;  3VK9 A;  4GXZ A;  3TOT A;  4ZL9 A;  4ULX A;  2WB9 A;  1SL2 B;  4PTS A;  1FB0 A;  4HDE A;  4ML1 A;  5KN2 A;  5BMU A;  3J7Y k;  4Z2R A;  5D9W A;  1GTA A;  2VO4 A;  1SL0 B;  3P90 A;  2A4V A;  2OJL A;  4O5U A;  2I4A A;  1UVZ A;  1AQV A;  3PH9 A;  5C00 A;  2AYT A;  4ZL8 A;  2IME A;  4CY6 A;  1EP7 A;  4ZXG A;  4X1U A;  3EU3 A;  3GKN A;  4IS0 A;  3ZMK A;  2QKE A;  1TU7 A;  1HYU A;  1XZO A;  2BMX A;  3RPN A;  4HJ2 A;  4WF4 A;  4KUN A;  4OWY A;  4NMU A;  2CV4 A;  3W8J A;  4F9Z A;  2LQQ A;  13GS A;  2C80 A;  1A8Y A;  2XHF A;  2GSS A;  2UZ8 A;  2REM A;  5GST A;  1W89 A;  1ZYN A;  4I2T A;  2I9H A;  3GIX A;  4J57 E;  1OAZ A;  1YKC A;  4LA1 A;  1PKZ A;  1SD8 A;  4DSS A;  5DAK A;  5L71 A;  4KGI A;  2MYG A;  4WEY A;  3FY7 A;  2Z9S A;  3UOM A;  3H93 A;  1H75 A;  5JWR B;  1JHB A;  1Q4J A;  2MMA A;  1HQO A;  3NZN A;  2HE3 A;  3LJR A;  3D5J A;  2IN3 A;  4I2U A;  4JU5 A;  1X5E A;  3QAW A;  1FB6 A;  1JZW A;  1XWB A;  1TK8 B;  2C4J A;  1XXU A;  2VCW A;  3F3Q A;  3EPT A;  2GTU A;  4GCI A;  5IM9 A;  5JWO B;  1I5G A;  3TRQ A;  5G1K A;  3ZVJ D;  1M2D A;  2DC5 A;  1MDK A;  4I5Q A;  3DML A;  3KCM A;  3WT1 A;  3U5R E;  1E6B A;  1EGR A;  4I8B A;  2LJA A;  3HKR A;  2R0P A;  3C1R A;  4LL4 B;  1BX9 A;  1MTC A;  4ECI A;  3EU4 A;  5IMZ A;  3GMF A;  1WIK A;  2R0G A;  1TTZ A;  14GS A;  2EIO A;  3DGQ A;  3DRN A;  1XOA A;  1YDK A;  4F0C A;  5CRD A;  1KNG A;  2H74 A;  1DSB A;  3KXO A;  1XW9 A;  1ZOF A;  2V41 A;  1HNB A;  2DSA A;  4XRA A;  3IK9 A;  1YEP A;  1XBS A;  3L0H A;  2H75 A;  2PVO C;  1GSE A;  4EF0 A;  3EVI A;  1K0N A;  3D4M A;  1XWC A;  1PSQ A;  5D9V A;  1YQ1 A;  3C1S A;  4EIQ A;  4V2M A;  4XTS A;  3G9B A;  3GX0 A;  2HFD A;  4NXI A;  3GKX A;  2X99 A;  3ZIV A;  1DUG A;  4IGJ A;  3DIE A;  4ISD A;  3AY8 A;  2V32 A;  4K8M A;  1J9B A;  4MZW A;  2O85 A;  3LYK A;  4DSQ A;  3ISO A;  22GS A;  3QCP A;  5B8A A;  3I9V 2;  4ZBA A;  3GX8 A;  5DCH A;  4EE0 A;  4AJ6 A;  2C0D A;  4OFN A;  3GRX A;  2RII A;  4G0L A;  4XS4 B;  4EVM A;  2VLV A;  2FCH A;  4TXO B;  2CVK A;  4HQZ A;  2DML A;  4L0W A;  1AUC A;  2HYX A;  1LJR A;  4TVE A;  4GF0 A;  3CMI A;  3WGX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...