2B1LA

Crystal structure of n-terminal 57 residue deletion mutant of e. coli ccmg protein(residues 58-185)
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
128
structure length
128
Chain Sequence
MQFYQADVLTQGKPVLLNVWATWCPTCRAEHQYLNQLSAQGIRVVGMNYKDDRQKAISWLKELGNPYALSLFDGDGMLGLDLGVYGAPETFLIDGNGIIRYRHAGDLNPRVWEEEIKPLWEKYSKEAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thiol:disulfide interchange protein dsbE
publication title Crystal structures of E. coli CcmG and its mutants reveal key roles of the N-terminal beta-sheet and the fingerprint region
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 38
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-09-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2b1lA00
2AYTA 3UARA 3KCMA 4OMVA 4AJ8A 1Q4JA 2K6VA 3GA4A 3RPPA 4IGJA 1SK0A 3W8SA 4P3YB 13GSA 4ZL8A 3G9BA 4XIHA 11GSA 3FKFA 3HCZA 3TJJA 3IR4A 1J9BA 1PX6A 1MDIA 3TOTA 4IN0A 1H4OA 4GTUA 4AJ6A 4MCUA 4KSOA 5CREA 5CAXA 1PN9A 2PBJA 1GSYA 6GSWA 2H6ZA 1BAYA 2YPMA 3EU4A 5KN0A 1G0TA 22GSA 2GS3A 2EC4A 2LUSA 4IJ3A 3I43A 4OFMA 1OE7A 1GL8A 3FK8A 1EP7A 3VPQA 1SU9A 4JE1A 3MNGA 2O85A 3IDVA 2H74A 2X8CA 4TR4A 3TCOA 1O81A 1JFUA 1A8YA 4MDCA 3D4TA 3GL5A 4J56E 3HVVA 4KB3A 1WWJA 2K18A 4GWRA 2LQQA 4TR0A 3GSSA 4MJCA 1HNCA 2OBIA 3IA1A 1U3IA 5B6MA 1F37A 4POBA 2MMNA 2MMAA 3D5JA 4NWYA 4KE3A 3US3A 1EOGA 5IPGA 2R2JA 2O8VB 4GLTA 4GSSA 2GZYA 1R26A 1QQ2A 2B5YA 1TI3A 3QAGA 3APQA 2K8VA 5CRDA 1VF3A 2H01A 5H5SA 3ED3A 4LL1B 5F07A 4MZWA 5GZZB 1O6JA 1ON4A 4IBPA 2OADA 2H0HA 4IQ1A 2JZRA 5F0GA 4V2LA 2NBSA 3HVXA 6GSYA 2YJHA 2FWEA 1ABAA 1GWCA 3GKMA 3KMOA 1XVWA 3G7IA 1YZXA 4DSQA 2FWGA 5G1LA 3WGDA 1XW5A 3F3QA 2M72A 1T1VA 1K0OA 2CZ3A 4PUFC 1YKAA 4K0GA 3DD3A 4YH2A 2DJJA 2QKEA 4XS4B 1V2AA 5ABRA 2H75A 1GUKA 5DVBA 3GX8A 1K0NA 3TKSC 1N8JA 4ECIA 3ME8A 1PKWA 2N5AA 4KDXA 4D73A 3P7XA 3IHQA 3EYTA 1OC3A 2R3XA 1QGVA 3P8WA 5KN1A 2A2RA 2F3MA 4OD7A 4I2TA 5JCUA 2QC7A 2L59A 4ULXA 3A3TA 2H70A 4NPBA 5JWQB 2GQLA 4XRDA 3HJOA 3QD9A 5D73A 2CX4A 4ML1A 5ECRB 2FLSA 4XTSA 5ELAA 1MTCA 3GNJA 1Z6NA 2H1DA 2A2SA 1OYJA 1WP0A 1XWBA 4IELA 1R5AA 1TK8B 2O7KA 3UVTA 1URMA 5A4VA 1MDJA 2L5LA 3ZTLA 5INYA 3FR9A 3V1WA 2WS2A 4NAXA 5AISA 1EOHA 4IP6A 2H73A 3TKRA 1M9BA 3M8NA 3GN3A 2CQ9A 1XWGA 3BCKA 1GSQA 2FNOA 3ZRDA 3L0HA 1A2JA 4YAPA 9GSSA 4K6XA 6GSUA 5DBQA 4K9ZA 1DE1A 3O3TA 2WCIA 3F0IA 2PVQA 4WR4A 1GNEA 4TR3A 4F0BA 1B4PA 3KIJA 1VRSD 4ZILA 1SD9A 2CT6A 4X1UA 2KUCA 3H4KA 2YANA 2VUPA 2YCDA 2F8AA 5DCHA 2JZSA 2IFQA 1SJIA 3UBKA 1GNWA 1KTEA 2N5BA 3KP9A 4GSTA 4F82A 5ECKB 2H1GA 3Q18A 1W4VA 5DQSA 1X5DA 2JU5A 1EWXA 4NHZA 4MA9A 3RHBA 2HFDA 5HFKA 3UMAA 3ZIVA 2LTKA 2NTOA 5G5EA 5B8AA 2LKUA 1SJZA 1Z6MA 1FB0A 1RK4A 3KTLA 4H86A 4OFTA 2C3TA 2VCWA 2CVBA 3HZ8A 3KTBA 1TRVA 5ECMB 2PN8A 2GVPA 1YEPA 1A2MA 2C1YA 2AHEA 4YQVA 3IPZA 2X99A 3TUEA 2LJAA 3EE2A 3Q6OA 5ID2B 5ECSA 2WRTA 3L4NA 4V2NA 4EE0A 4IKHA 3FR3A 1TJDA 1VGLA 2VLUA 3KP8A 5IMCA 1K0DA 1K3OA 2R37A 18GSA 1EEMA 1PL1A 1UN2A 1WJKA 2DJKA 5D96A 3LYPA 2QGVA 5IMAA 4TR1A 2C0EA 3HZ4A 1MD4A 2DC5A 3J7Yb 4K7NA 2NVLA 2G0FA 3M0FA 4FYCA 4O92A 3O6TA 3ERGA 5EVOA 1AXDA 1LU4A 3EINA 4YQUA 4F0CA 2XPEA 5HFGA 3DGQA 2B5EA 5IMVA 1OKDA 3EURA 3CTFA 2R6KA 1WRYA 1AQVA 3GMFA 3VLNA 1KEBA 3BCIA 2RIIA 2E2MA 3TJBA 3GX0A 4HZ4A 3UAPA 1A23A 4MLYA 2KP2A 4QL9A 2WDUA 1K0BA 1ZZYA 5CYYA 1ZYEA 5HR0A 1XXUA 2YWNA 1HNAA 2YOIA 2PU9C 3ZFBA 4EXJA 3HJMA 1QXHA 1TU7A 3H93A 4TRXA 4TXOB 2IL3A 2XBQA 1K0MA 1OC8A 4GXZA 2HRNA 2FCHA 5ECPB 1GTBA 1AQWA 1THXA 4G2EA 2TIRA 2YNXA 1HNBA 2R5GA 4TW5A 1QK8A 1YY7A 3CSHA 3LXZA 3EU3A 1XWAA 3P90A 1T3BA 4PQHA 1HQOA 4RI7A 2F8FA 2KLXA 3HD5A 5JCWA 4XS4A 4KX4A 1UC7A 3HYPA 4BL7A 1DUGA 3L9UA 5D9WA 4MF7A 1O85A 3TRPA 4BA7A 5ECOB 1ERTA 5G1KA 1AC1A 1LBKA 1IYHA 3KZQA 4JRRA 1GSDA 3DIEA 1TU8A 1FB6A 3CMIA 1K0CA 3IOSA 2HE3A 3GKXA 3KJYA 5DALA 3SBCA 3NZNA 3KMNA 5IO2A 4PURA 2GQKA 3IK7A 4KA0A 2FA4A 4FIWA 1ERWA 5COHA 5DAKA 1X9SB 3F3RA 1RW1A 2CVKA 4HEA2 4N11A 4NV5A 1USBA 3G7JA 1YF0A 3EMPA 1JHBA 2RLIA 1NW2A 4HU7A 5HFIA 3VI5A 1A24A 3LFLA 1GLQA 4RQRA 5FHIA 2VIMA 4I6XA 1TTZA 2L5OA 4KAEA 2X8GA 4IS0A 3C71A 1HD2A 2GSSA 4J57E 3F4TA 1PSQA 2H30A 4L0UA 2D2ZA 5J4UA 4E8EA 4N10A 3FZ9A 3LORA 3GKKA 4BWSA 1BG5A 5HR2A 3QPMA 2VL3A 3N5OA 2CV4A 5IMZA 1WPIA 3MSZA 1GSEA 4IP1A 5KN3A 3LJRA 3LEFA 3M9JA 3GH9A 4N30A 2LV3A 3EC3A 5F8BA 2OKAA 1OE8A 2HSHA 3FYGA 4JZQA 4V2MA 4JR4A 3TJFA 1G6WA 3APOA 1TOFA 4KUNA 2PPTA 5D9VA 1OC9B 2YWIA 2YWOA 1YKCA 1J0FA 4PGTA 1ML6A 3DEXA 2X64A 3FRCA 5JWRB 3DMLA 1EV4A 2HNLA 4CDOA 1EEJA 3RBTA 2I4AA 4MH3A 5G5FA 4NXIA 1OVNA 3VWUA 1Z7RA 3FHKA 3MAKA 6GSSA 3BBYA 4IVFA 4ZBBA 5ID2A 1PL2A 4ZXGA 1GUHA 4F2IA 4DSRA 2K8SA 1XOAA 4RI6A 2DJ3A 1GP1A 1W89A 4MJBA 3ZMLA 4KH7A 1SENA 3ZREA 2IMDA 4XRAA 2IN3A 1PD21 2NDOA 5D9XA 2H71A 1TDIA 5D9TA 1M2BA 2L6DA 3W6GA 4KCEA 4ZB8A 1O73A 5J9BA 2CX3A 5LNKe 5B8BA 4OCEA 2LS5A 3PGTA 4LA1A 1HYUA 2H0GA 2HZEB 5JCGA 3QAVA 5C04A 1B9YC 4DVCA 2DIZA 1BX9A 3W8JA 3C1SA 2XPDA 2X8HA 3QMXA 4ML6A 3VI7A 5CRWA 3CYNA 3GIXA 4I8BA 2B7KA 3C73A 4JR6A 3HXSA 2LRCA 2MYGA 4MF5A 3J7Yk 3A2VA 5D8IA 1MEKA 3U6VA 1WE0A 2QSIA 1ZOFA 3QCPA 1ZL9A 4FO5A 1GTAA 3F4SA 3A5WA 4F03A 4IHUA 4V1Ap 4O5RA 3EWLA 3M3MA 20GSA 2IMIA 3KGKA 4DSSB 5IOWA 4TXVA 5HQPA 1YDKA 5IM9A 4HS1A 3GTUA 4MJEA 4L8EA 4PQ1A 1XVQA 3M1GA 5J9CA 3TOUA 1T4ZA 2HZFA 1VF4A 4Q5QA 5IO0A 4K8MA 5C00A 1FAAA 5DQYA 1QMVA 3C8EA 2KP1A 3WGEA 4TOPA 2VM2A 2GZPA 1SKWB 2RUEA 2JSZA 3SWLA 2H66A 4L0WA 1MD3A 1XBSA 10GSA 1TRUA 4O32A 2VLTA 3VPTA 2JSYA 2OA7A 2VL2C 4NHWA 3MWHA 1JLVA 4HJ2A 17GSA 1BEDA 3FY7A 4EVMA 2L4CA 4MABA 2KOKA 5G2ZA 4ECCA 1Z9HA 1SKRB 3CSIA 2DJ1A 4WF4A 3A2XA 2I9HA 2JL4A 3G7YA 3TKQA 4WETA 5KN2A 5LCZA 3TKSA 1XW6A 2IWTA 1UVZA 1ZYQB 2A4VA 3CRUA 2M80A 4O7HA 4QQ7A 2AV4A 1YEXA 2B6MA 1AUCA 3E0UA 3ZLPA 2C3QA 2IPAA 3GSTA 3QAWA 1R7HA 2OACA 2GSRA 1MDKA 2XC2A 3HJPA 3UJ1A 3NOFA 3BOAA 1Q98A 3UOMA 4IJIA 2WZ9A 4PUAA 4K2DA 5DJMA 3RPNA 5J41A 4HI7A 3H8QA 2WJUA 1ZGNA 4ZBDA 2RUFA 3GFKA 3WD6A 2V32A 5FT3A 1OKTA 4KGIA 1EZKA 2GSQA 2HYXA 1A2LA 3Q19A 1SK1A 3TRQA 2KHPA 2RM6A 3E3EA 1EGRA 4F9ZA 2LRNA 2P0GA 2EIRA 2YN1A 4L5OA 5IOXA 3DWVA 2DMMA 4KCAA 2EIOA 2ON7A 1Y6EA 3RDWA 3FR6A 4WBRD 4HDEA 1F2EA 4LLRA 1OC9A 3ERWA 5G31A 3ME7A 4X0XA 3UBLA 1IYIA 3DRNA 2AUVA 5B6NA 3I69A 5ECIB 3TJGA 3LXTA 4PQIA 2REMA 5CRHA 3WYWA 4ZB6A 1GTIA 4JEDA 2HRFA 2PGTA 2YZHA 4LMWA 2EIQA 2OJLA 2VO4A 3RHCA 3KH9A 3GKNA 3WGXA 2PWJA 5EY6A 3LYKA 1OAZA 2RM5A 2V6KA 2V1MA 3CTGA 3D4MA 2H19A 4GF0A 2J23A 2FD3A 2DMLA 2F9SA 1SD8A 1YF1A 1KNGA 4D73B 4ZL9A 2DSAA 2I1UA 1H75A 4MP4A 2LEGA 3GV1A 4HU9A 1XWKA 3UEMA 3D6IA 3D21A 2YZUA 4ACSA 2HLSA 1E2YA 2IMEA 1K3LA 1E6BA 2OE0A 4HJMA 5GAPD 2O89A 1A8LA 4IW9A 4K1FA 1XFLA 2ZCTA 3GRXA 2VD1A 2TRCP 4MMMA 2VOCA 4RUVA 2HZEA 2HSYA 3TDGA 3ZZXA 5JWOB 5IIZA 3AY8A 5CP1A 4HUAA 3FW2A 3CBUA 2ZUPA 4GQCA 1M2DA 2H72A 3IBHA 3VWWA 2CA8A 5J5NA 4ZBAA 3HY2A 7GSSA 1V9WA 1M7TA 3MDKA 1U87A 4MZBA 1T7PB 4G19A 1FG4A 3HDCA 4POLA 1XCCA 2MBTA 1GH2A 2GTUA 3GYKA 4Q5RA 4I97A 1O8WA 4BVYA 1O7UA 4OWYA 3VURA 2C0GA 3DXBA 2Z9SA 2VCVA 1PMTA 5E4WA 1SJ6A 4BPYA 1K0AA 4PXOA 3R2QA 4KDUA 3IXRA 1FW1A 4WR5A 2GZZA 4FYUA 4NMUA 1B8XA 1B9XC 4WKWA 3TGZA 2C8UA 3D22A 1KBNA 3HA9A 3ZMKA 2P5RA 2C3NA 3K8NA 3LGCA 5F06A 3WT2A 2H1AA 2DJ2A 2XHFA 2IFQB 2H8LA 1TP9A 4EL1A 4QL7A 3KD0A 1N2AA 3IK9A 3UL3A 3VFIA 3FEUA 1TW9A 3TJKA 2ES7A 3ZVJA 3IE3A 1A0FA 4GRFA 1GSSA 1RQMA 4K7IA 4OFNA 4K7OA 4KNDA 3L9SA 2IMFA 2H0IA 1TK0B 4HOJA 4I5QA 2FUG2 3H1NA 5H5RA 1C72A 3TKPA 2L6CA 1VF1A 6GSXA 1WOUA 2WB9A 3F6DA 1T8EB 2B3SA 3ZFLA 2VCTA 1Y25A 3CRTA 3LG6A 1V58A 2CAQA 3VWVA 2VCQA 1G7OA 1XWCA 2V6OA 1F3BA 4EKZA 4TR1B 4TVEA 5CO3A 4N0VA 4ECBA 12GSA 1EP8A 3ERFA 1WIKA 2B7JA 3CXGA 1PA3A 5E59A 5HR3A 3N9JA 1J08A 2JACA 1VF2A 2J9HA 4HQZA 4WBJA 1T00A 2LJRA 1NHOA 4G10A 4X43A 1SYXA 5ECHB 1S3CA 1X0RA 2MZCA 3IV4A 1AQXA 1YJ6A 2CZ2A 4CHSA 4NV2A 2E2GA 4TKYA 3UVHA 4K0NA 5CRGA 1T4YA 5GSTA 1PKZA 2E7PA 5AIVA 3C1RA 1U6TA 2LQOA 6GSTA 2GT6A 2YJ7A 5H5QA 3KXOA 3TRXA 2B1KA 4POKA 3M9KA 1GSFA 1FVJA 4OO5A 1V98A 1G7EA 3U5RE 2C0DA 8GSSA 3ZYWA 1DBYA 3IAS2 3TKSE 1WMJA 3F6FA 1FVKA 4EUYA 1XZOA 1BQ7A 3P2AA 5EPFA 3F9UA 1X5EA 3L78A 2HXKA 2VAFA 4EDYA 2R4VA 5GSSA 1EGOA 1GLPA 4JU5A 2V41A 2ZNMA 2E0QA 2H6XA 5ELGA 4WF5A 2DIYA 3IRAA 2MMOA 3DVWA 3I6AA 2BTOT 2DLXA 4XCSA 3ZITA 19GSA 2FHEA 1NHYA 4XS6A 2G2QA 3QOUA 4FH8A 5EL8A 4TXOA 1O8XA 2DBCA 2NPBA 4OCFA 1AIUA 1ST9A 1ZCPA 1THOA 2F51A 2IMKA 3IC4A 1SL1B 3PH9A 5DALB 2HI7A 3IAM2 5L71A 3Q74A 4G9HA 2TRXA 2YP6A 5A5KA 1V57A 1R5PA 4E8HA 3KM6A 2FGXA 4PX1A 2MBSA 5DAKB 3F63A 2I81A 1A0RP 4ISDA 4MH2A 4ILFA 1UA5A 4MPFA 2B5XA 5A4WA 1ERVA 5FWGA 2H1BA 4ZIJA 5CNWA 4MPGA 2OE3A 2WGRA 2GDRA 2H6YA 3RAZA 1JLWA 3CSJA 3F4RA 2P5QA 4HZ2A 4POMA 4LMVA 4V1Ag 2YV7A 1TK5B 2B1LA 2YWMA 4JBBA 1ERUA 3OR5A 4Q5NA 3ISOA 2OE1A 4MF6A 1TKDB 3GURA 4IQAA 5LD0A 2LSTA 3C7MA 2N5FA 1I5GA 5AGYA 1XIYA 1PRXA 1PQNA 3APSA 4GQFA 1B4QA 1AW9A 1TRWA 1B48A 5ENUA 1CQGA 4FYBA 2CAIA 2JZTA 4Z7XA 3ZVJD 1AAZA 2MMZA 1Z7PA 1CQHA 2GLRA 1NSWA 1FO5A 6GSVA 4KW6A 5ECLB 1LJRA 2VCXA 1X5CA 2OBKA 5B7CA 2C80A 4EF0A 4WXTA 4MK3A 2LNSA 2FY6A 5F05A 1NM3A 4KSMA 2VD0A 3EMXA 3DVXA 5AN1A 3PINA 2WFCA 1GULA 5IQYA 2BMXA 1U88A 1YQ1A 16GSA 1TI1A 3JCML 1I9DA 1JZRA 5D93A 4MZCA 2HT9A 1Z3EA 1DE2A 3GHAA 4EDZA 2PERA 4GSNA 3LWAA 4L5LA 4YAVA 1JZDA 3DKSA 4EO3A 5IPHA 1M9AA 4RQXA 2PMTA 2C0FA 4ECJA 5HR1A 1M0UA 5AIXA 4BVXA 3QDNA 5IMDA 2ALBA 3BD2A 4MJAA 5DCGA 3I9V2 4J2FA 3GL3A 1SYRA 3LSZA 1S3AA 1F6MC 4YQMA 2PUKC 2V2GA 3F8UA 1GTUA 1QFNA 1M99A 4HQSA 4KDYA 2VL2A 3HVSA 2GGTA 1X9WB 2GQMA 2DJ0A 1M2AA 1V40A 2P31A 3E9JB 1TRSA 4Q5FA 3S9FA 2IIYA 1ACVA 3FZAA 1BYEA 4CW9A 4ZL7A 3QFBC 5DJLA 1PX7A 1S3DA 3H79A 4WEYA 5IMFA 3BJ5A 1SL0B 2AAWA 1DSBA 4ID0A 1GUMA 2WULA 2AB6A 1XW9A 1ZMAA 4PNGA 2XBIA 2LRTA 5KEJA 5ECNB 3PR8A 1EV9A 3HKRA 3LQ7A 3ZL5A 4I2UA 4GCIA 2L4QA 3VK9A 1GRXA 1QUWA 2GSTA 3GH6A 2PVOC 4PNFA 3A2WA 1XPVA 3VWXA 3L9VA 3QFAC 1X9MB 3FZ5A 5J3RA 2C4JA 4ZB9A 3KH7A 2IJYA 1JZWA 3TB2A 2FWFA 2GT5A 5DDLA 3GTUB 1PGTA 4N0ZA 1JZOA 3UIWA 5GAND 5ECQB 1XOBA 1SL2B 3D0ZA 2H76A 4AF2A 1G6YA 2YV9A 3HHVA 2BJXA 2L57A 2LJKA 2FWHA 3NIVA 1FOVA 3KEBA 1R4WA 1F9MA 2CVDA 1K3YA 1BJXA 4XS1A 2O87A 3QR6A 2JADA 2K9FA 2LNTA 4OO4A 3ZIJA 1ILOA 4XHMA 1U3AA 3DYRA 2M46A 4DSSA 2ON5A 2VCZA 3GUSA 2FA8A 2AJQB 4DEJA 1FHEA 1Z5YE 4AJ7A 3O76A 2I3YA 4BWQA 2VLVA 5A4UA 3WT1A 1SKSB 2VM1A 4TN8A 1SK2A 4AGSA 3FZ4A 4LL4B 5G30A 4EC0A 1F3AA 1TXXA 14GSA 1GSUA 3EVIA 2VL9A
chains in the Genus database with same CATH superfamily
2AYTA 4CY8A 3UARA 3KCMA 4OMVA 4AJ8A 1Q4JA 2K6VA 3GA4A 3RPPA 4IGJA 1SK0A 3W8SA 4P3YB 13GSA 4ZL8A 3G9BA 4XIHA 11GSA 3FKFA 3HCZA 3TJJA 3IR4A 1J9BA 1PX6A 1MDIA 3TOTA 4IN0A 1H4OA 4GTUA 4AJ6A 4MCUA 4KSOA 5CREA 5CAXA 1PN9A 2PBJA 1GSYA 6GSWA 2H6ZA 1BAYA 2YPMA 3EU4A 1PN0A 5KN0A 1G0TA 22GSA 2GS3A 2EC4A 2LUSA 4IJ3A 3I43A 4OFMA 1OE7A 1GL8A 3FK8A 1EP7A 3IC8A 3VPQA 1SU9A 4JE1A 3MNGA 2O85A 3IDVA 2H74A 2X8CA 4TR4A 3TCOA 1O81A 1JFUA 1A8YA 4MDCA 3D4TA 3GL5A 4J56E 3HVVA 4KB3A 1WWJA 2K18A 4GWRA 2LQQA 4TR0A 3GSSA 4MJCA 1HNCA 2OBIA 3IA1A 1U3IA 5B6MA 1F37A 4POBA 2MMNA 2MMAA 3D5JA 4NWYA 4KE3A 3US3A 1EOGA 5IPGA 2R2JA 2O8VB 4GLTA 4GSSA 2GZYA 1R26A 1QQ2A 2B5YA 1TI3A 3QAGA 3APQA 2K8VA 5CRDA 1VF3A 2H01A 5H5SA 3ED3A 4LL1B 3R3EA 5F07A 4MZWA 5GZZB 1O6JA 1ON4A 4IBPA 2OADA 2H0HA 4IQ1A 2JZRA 2DKHA 4V2LA 5F0GA 2NBSA 3HVXA 6GSYA 2YJHA 2FWEA 1ABAA 1GWCA 3GKMA 3KMOA 1XVWA 3G7IA 1YZXA 4DSQA 2FWGA 5G1LA 3WGDA 1XW5A 3F3QA 2M72A 1T1VA 1K0OA 2CZ3A 4PUFC 1YKAA 4K0GA 3DD3A 4YH2A 2DJJA 2QKEA 4XS4B 1V2AA 5ABRA 2H75A 1GUKA 5DVBA 3GX8A 1K0NA 3TKSC 1N8JA 4ECIA 3ME8A 1PKWA 2N5AA 4KDXA 4D73A 3P7XA 3IHQA 3EYTA 1OC3A 2R3XA 1QGVA 3P8WA 5KN1A 2A2RA 2F3MA 4OD7A 4I2TA 5JCUA 2QC7A 2L59A 4ULXA 3A3TA 2H70A 4NPBA 5JWQB 2GQLA 3HVNA 4XRDA 4BVYB 3HJOA 3QD9A 5D73A 2CX4A 4ML1A 5ECRB 2FLSA 4XTSA 5ELAA 1MTCA 3GNJA 1Z6NA 2H1DA 2A2SA 1OYJA 1WP0A 1XWBA 4IELA 1R5AA 3MIXA 1TK8B 2O7KA 3UVTA 1URMA 5A4VA 1MDJA 2L5LA 3ZTLA 5INYA 3FR9A 3V1WA 2WS2A 4NAXA 5AISA 1EOHA 4IP6A 2H73A 3TKRA 1M9BA 3M8NA 3GN3A 2CQ9A 1XWGA 3BCKA 1GSQA 2FNOA 3ZRDA 3L0HA 1A2JA 4YAPA 9GSSA 4K6XA 6GSUA 4YKGA 5DBQA 4K9ZA 1DE1A 3O3TA 2WCIA 3F0IA 2PVQA 4WR4A 1GNEA 4TR3A 4F0BA 1B4PA 3KIJA 1VRSD 4ZILA 1SD9A 2CT6A 4X1UA 2KUCA 3H4KA 2YANA 2VUPA 2YCDA 2F8AA 5DCHA 2JZSA 2IFQA 1SJIA 3UBKA 1GNWA 1KTEA 2N5BA 3KP9A 4GSTA 4F82A 5ECKB 2H1GA 3Q18A 1W4VA 5DQSA 1X5DA 2JU5A 1EWXA 4NHZA 4MA9A 3RHBA 2HFDA 5HFKA 3UMAA 3ZIVA 2LTKA 2NTOA 5G5EA 5B8AA 2LKUA 1SJZA 1Z6MA 1FB0A 1M3IA 1RK4A 3KTLA 4H86A 4OFTA 2C3TA 2VCWA 2CVBA 3HZ8A 3KTBA 1TRVA 5ECMB 2PN8A 2GVPA 1YEPA 1A2MA 2C1YA 2AHEA 4YQVA 3IPZA 2X99A 3TUEA 2LJAA 3EE2A 3Q6OA 5ID2B 5ECSA 2WRTA 3L4NA 4V2NA 4EE0A 4IKHA 3FR3A 1VGLA 1TJDA 2VLUA 3KP8A 5IMCA 1K0DA 1K3OA 2R37A 18GSA 1EEMA 1PL1A 1UN2A 1WJKA 2DJKA 5D96A 3LYPA 2QGVA 5IMAA 4TR1A 2C0EA 3HZ4A 1MD4A 2DC5A 3J7Yb 4K7NA 2NVLA 2G0FA 3M0FA 4FYCA 4O92A 3O6TA 3ERGA 5EVOA 1AXDA 1LU4A 3EINA 4YQUA 4F0CA 2XPEA 5HFGA 3DGQA 2B5EA 5IMVA 1OKDA 3EURA 3CTFA 2R6KA 1WRYA 1AQVA 3GMFA 3VLNA 1KEBA 3BCIA 2RIIA 2E2MA 3TJBA 3GX0A 1ZYNA 4MNNA 4HZ4A 3UAPA 1A23A 4MLYA 2KP2A 4QL9A 2WDUA 1K0BA 5BRTA 1ZZYA 5CYYA 1ZYEA 4G0KA 5HR0A 1XXUA 2YWNA 1HNAA 2YOIA 2PU9C 3ZFBA 4EXJA 3HJMA 1QXHA 1TU7A 3H93A 4TRXA 4TXOB 2IL3A 2XBQA 1K0MA 1OC8A 4GXZA 2HRNA 2FCHA 5ECPB 1GTBA 1AQWA 1THXA 4G2EA 2TIRA 5KOXA 2YNXA 1HNBA 4Z2RA 2R5GA 4TW5A 1QK8A 1YY7A 3CSHA 4EIPA 3LXZA 3EU3A 1XWAA 3P90A 1T3BA 4PQHA 1HQOA 4RI7A 2F8FA 2KLXA 3HD5A 5JCWA 4XS4A 4KX4A 1UC7A 3HYPA 4BL7A 1DUGA 3L9UA 5D9WA 4MF7A 1O85A 3TRPA 4BA7A 5ECOB 1ERTA 5G1KA 1AC1A 1LBKA 1IYHA 3KZQA 4JRRA 1GSDA 3DIEA 1TU8A 1FB6A 3CMIA 1K0CA 3IOSA 2HE3A 4G0LA 3GKXA 3KJYA 5DALA 3SBCA 3NZNA 3KMNA 5IO2A 4PURA 2GQKA 3IK7A 4KA0A 2FA4A 4FIWA 1ERWA 5COHA 5DAKA 1X9SB 3F3RA 1RW1A 2CVKA 4HEA2 4N11A 4NV5A 1USBA 3G7JA 1YF0A 3EMPA 1JHBA 2RLIA 2X49A 1NW2A 4HU7A 5HFIA 3VI5A 1A24A 3LFLA 1GLQA 4RQRA 5FHIA 2VIMA 4I6XA 1TTZA 2L5OA 4ICYA 4KAEA 2X8GA 4IS0A 3C71A 4J57E 1HD2A 2GSSA 3F4TA 1PSQA 2H30A 4L0UA 1M3JA 2D2ZA 5J4UA 4E8EA 4N10A 3FZ9A 3LORA 3GKKA 4BWSA 1BG5A 4G0IA 5HR2A 3QPMA 2VL3A 3N5OA 2CV4A 5IMZA 1WPIA 3MSZA 1GSEA 4IP1A 5KN3A 3LJRA 3LEFA 3M9JA 3GH9A 4N30A 2LV3A 3EC3A 5F8BA 2OKAA 1OE8A 2HSHA 3FYGA 4JZQA 4V2MA 4JR4A 3TJFA 1G6WA 1XG8A 3APOA 4BVXB 1TOFA 4KUNA 2PPTA 5D9VA 1FOHA 1OC9B 2YWIA 2YWOA 1YKCA 1J0FA 4PGTA 1ML6A 3DEXA 2X64A 3FRCA 5JWRB 3DMLA 1EV4A 2HNLA 4CDOA 1EEJA 3RBTA 2I4AA 4MH3A 5G5FA 4NXIA 1OVNA 3VWUA 1Z7RA 3FHKA 3MAKA 6GSSA 3BBYA 4IVFA 4ZBBA 5ID2A 1PL2A 4ZXGA 1GUHA 4F2IA 4DSRA 2K8SA 1XOAA 4RI6A 2DJ3A 1GP1A 1W89A 4MJBA 4CY6A 3ZMLA 4KH7A 1SENA 3ZREA 2IMDA 4XRAA 2IN3A 1PD21 2NDOA 5D9XA 2H71A 1TDIA 5D9TA 1M2BA 2L6DA 3W6GA 4KCEA 4ZB8A 1O73A 2HSMA 5J9BA 2HRAA 2CX3A 5LNKe 5B8BA 4OCEA 2LS5A 3PGTA 4LA1A 1HYUA 2H0GA 2HZEB 4K5RA 5JCGA 3QAVA 5C04A 1B9YC 4DVCA 2DIZA 1BX9A 3W8JA 3C1SA 2XPDA 2X8HA 3QMXA 4ML6A 3VI7A 5CRWA 3CYNA 3GIXA 4I8BA 2B7KA 3C73A 4JR6A 3HXSA 2LRCA 2MYGA 5BMUA 4MF5A 3J7Yk 3A2VA 5D8IA 1MEKA 3U6VA 1WE0A 2QSIA 1ZOFA 3QCPA 1ZL9A 4FO5A 1GTAA 3F4SA 3A5WA 4F03A 4IHUA 2R0PA 4V1Ap 4O5RA 3EWLA 3M3MA 20GSA 2IMIA 3KGKA 4DSSB 5IOWA 4TXVA 5HQPA 1YDKA 4Z2UA 5IM9A 4HS1A 1S3RA 3GTUA 4MJEA 4L8EA 4PQ1A 1XVQA 3M1GA 5J9CA 3TOUA 1T4ZA 2HZFA 1VF4A 4Q5QA 5IO0A 4K8MA 5C00A 1FAAA 5DQYA 1QMVA 3C8EA 2KP1A 3WGEA 4TOPA 2VM2A 2GZPA 1SKWB 2RUEA 2JSZA 3SWLA 2H66A 4L0WA 1MD3A 1XBSA 10GSA 1TRUA 4O32A 2VLTA 3VPTA 3EPTA 2JSYA 2OA7A 2VL2C 4NHWA 3MWHA 1JLVA 4HJ2A 17GSA 1BEDA 3FY7A 4EVMA 2L4CA 4MABA 2KOKA 5G2ZA 4ECCA 1Z9HA 1SKRB 3CSIA 2DJ1A 4WF4A 3A2XA 2I9HA 2JL4A 3G7YA 3TKQA 4WETA 5KN2A 5LCZA 3TKSA 1XW6A 2IWTA 1UVZA 1ZYQB 2A4VA 3CRUA 2M80A 4O7HA 4QQ7A 2AV4A 1YEXA 2B6MA 1AUCA 3E0UA 3ZLPA 2C3QA 2IPAA 3GSTA 3QAWA 1R7HA 2OACA 2GSRA 1MDKA 2XC2A 3HJPA 3UJ1A 3NOFA 3BOAA 1Q98A 3UOMA 4IJIA 2WZ9A 4PUAA 4K2DA 5DJMA 3RPNA 5J41A 4HI7A 3H8QA 2WJUA 1ZGNA 4ZBDA 2RUFA 3GFKA 3WD6A 2V32A 5FT3A 1OKTA 4KGIA 1EZKA 2GSQA 2HYXA 1A2LA 3Q19A 1SK1A 3TRQA 2KHPA 2RM6A 3E3EA 1EGRA 4F9ZA 2LRNA 2P0GA 2EIRA 2YN1A 4L5OA 5IOXA 3DWVA 2DMMA 4KCAA 2EIOA 2ON7A 1Y6EA 3RDWA 3FR6A 4WBRD 4HDEA 1F2EA 4LLRA 1OC9A 3ERWA 3A5IA 5G31A 2HRKA 4EIQA 3ME7A 4X0XA 3UBLA 1IYIA 3DRNA 2AUVA 5B6NA 3I69A 5ECIB 3TJGA 3LXTA 4PQIA 2REMA 5CRHA 3WYWA 4ZB6A 1GTIA 4JEDA 2HRFA 2PGTA 2YZHA 4LMWA 2EIQA 2OJLA 2VO4A 3RHCA 3KH9A 3GKNA 3WGXA 2PWJA 3LYKA 5EY6A 1OAZA 2RM5A 2V6KA 2V1MA 3CTGA 3D4MA 2H19A 4GF0A 2J23A 2FD3A 2DMLA 2F9SA 1SD8A 1YF1A 1KNGA 4D73B 4ZL9A 2DSAA 2I1UA 1H75A 4MP4A 2LEGA 3GV1A 4HU9A 1XWKA 3UEMA 3D6IA 3D21A 2YZUA 4ACSA 2HLSA 1E2YA 2IMEA 1K3LA 1E6BA 2OE0A 4HJMA 5GAPD 2O89A 1A8LA 4IW9A 4K1FA 1XFLA 2ZCTA 3GRXA 2VD1A 2TRCP 4MMMA 2VOCA 4RUVA 2QA1A 2HZEA 2HSYA 3TDGA 3ZZXA 5JWOB 5IIZA 2R0GA 3AY8A 5CP1A 4HUAA 3FW2A 3CBUA 2ZUPA 4GQCA 1M2DA 2H72A 3IBHA 3VWWA 2CA8A 5J5NA 4ZBAA 3HY2A 7GSSA 1V9WA 1M7TA 3MDKA 1U87A 4MZBA 1T7PB 4G19A 1FG4A 3HDCA 4POLA 1XCCA 2MBTA 1GH2A 2GTUA 3GYKA 4Q5RA 4I97A 1O8WA 4BVYA 1O7UA 4OWYA 3VURA 2C0GA 5KOWA 3DXBA 2Z9SA 2VCVA 3MYDA 1PMTA 5E4WA 1SJ6A 4BPYA 1K0AA 4PXOA 3R2QA 4KDUA 3IXRA 1FW1A 4WR5A 2GZZA 4FYUA 4NMUA 1B8XA 1B9XC 4WKWA 3TGZA 2C8UA 3D22A 1KBNA 3HA9A 3ZMKA 2P5RA 2C3NA 3K8NA 3LGCA 5F06A 3WT2A 2H1AA 2DJ2A 2XHFA 2IFQB 2H8LA 1TP9A 4EL1A 4QL7A 3KD0A 1N2AA 3IK9A 3UL3A 3VFIA 3FEUA 1TW9A 3TJKA 2A2PA 2ES7A 3ZVJA 4A5PA 3IE3A 1A0FA 4GRFA 2R0CA 1GSSA 1RQMA 4K7IA 4OFNA 4K7OA 4KNDA 3L9SA 2IMFA 4Z2TA 2H0IA 1TK0B 4HOJA 4I5QA 2FUG2 3H1NA 5H5RA 1C72A 3TKPA 2L6CA 1VF1A 6GSXA 1WOUA 2WB9A 3F6DA 1T8EB 2B3SA 3ZFLA 2VCTA 1Y25A 3CRTA 3LG6A 1V58A 2CAQA 3VWVA 2VCQA 3IHGA 1G7OA 1XWCA 2V6OA 1F3BA 4EKZA 4TR1B 4TVEA 5CO3A 4N0VA 4ECBA 12GSA 1EP8A 3ERFA 1WIKA 2B7JA 3CXGA 1PA3A 5E59A 5HR3A 3CQFA 3N9JA 1J08A 2JACA 1VF2A 2J9HA 4HQZA 4WBJA 1T00A 2LJRA 1NHOA 4G10A 4X43A 1SYXA 5ECHB 1S3CA 1X0RA 2MZCA 3IV4A 1AQXA 1YJ6A 2CZ2A 4CHSA 4NV2A 2E2GA 4TKYA 3UVHA 4K0NA 5CRGA 1T4YA 5GSTA 1PKZA 2E7PA 5AIVA 3C1RA 1U6TA 2LQOA 6GSTA 2GT6A 2YJ7A 5H5QA 3KXOA 2A4HA 3TRXA 2B1KA 4POKA 3M9KA 1GSFA 1FVJA 4OO5A 1V98A 1G7EA 3U5RE 2C0DA 8GSSA 3ZYWA 1DBYA 4FQUA 3IAS2 3TKSE 1WMJA 3F6FA 1FVKA 4EUYA 1XZOA 1BQ7A 3P2AA 5EPFA 3F9UA 1X5EA 3L78A 2HXKA 2VAFA 4EDYA 2R4VA 5GSSA 1EGOA 1GLPA 4JU5A 4BIKA 2V41A 2ZNMA 2E0QA 2H6XA 5ELGA 4WF5A 2DIYA 3IRAA 2MMOA 3DVWA 3I6AA 2BTOT 2DLXA 4XCSA 3ZITA 19GSA 4BL7B 2FHEA 1NHYA 4XS6A 2G2QA 3QOUA 4FH8A 5EL8A 4TXOA 1O8XA 4PTSA 2DBCA 2NPBA 4OCFA 1AIUA 1ST9A 1ZCPA 1THOA 2F51A 2IMKA 3IC4A 1SL1B 3PH9A 5DALB 2HI7A 3IAM2 5L71A 3Q74A 1ZYPA 4G9HA 2TRXA 2YP6A 5A5KA 1V57A 1R5PA 4E8HA 3KM6A 2FGXA 4PX1A 2MBSA 5DAKB 3F63A 2I81A 1A0RP 4K2XA 4ISDA 4MH2A 4ILFA 1UA5A 4MPFA 2B5XA 5A4WA 1ERVA 5FWGA 2H1BA 4YKFA 4ZIJA 5CNWA 4MPGA 2OE3A 2WGRA 2GDRA 2H6YA 3RAZA 1JLWA 2DKIA 3CSJA 3F4RA 2P5QA 4HZ2A 4POMA 4LMVA 4V1Ag 2YV7A 1TK5B 2B1LA 2YWMA 4JBBA 1ERUA 3OR5A 4Q5NA 3ISOA 2OE1A 4MF6A 1TKDB 3GURA 4IQAA 5LD0A 2LSTA 3C7MA 2N5FA 1I5GA 5AGYA 1XIYA 1PRXA 1PQNA 3APSA 4GQFA 1B4QA 1AW9A 1TRWA 1B48A 5ENUA 1CQGA 4FYBA 2CAIA 2JZTA 4Z7XA 3ZVJD 1AAZA 2MMZA 1Z7PA 1CQHA 2GLRA 1NSWA 1FO5A 6GSVA 4KW6A 5ECLB 1LJRA 2VCXA 1X5CA 2OBKA 5B7CA 2C80A 4EF0A 4WXTA 4MK3A 2LNSA 2FY6A 5F05A 1NM3A 4KSMA 2VD0A 3EMXA 3DVXA 5AN1A 3PINA 2WFCA 1GULA 5IQYA 2BMXA 1U88A 1YQ1A 4O5UA 16GSA 1TI1A 3JCML 1I9DA 1JZRA 4O5QA 5D93A 4MZCA 2HT9A 1Z3EA 4HSCX 1DE2A 3GHAA 4EDZA 2PERA 4GSNA 3LWAA 4L5LA 4YAVA 1JZDA 3DKSA 4EO3A 5IPHA 1M9AA 4RQXA 2PMTA 2C0FA 4ECJA 5HR1A 1M0UA 5AIXA 4BVXA 3QDNA 5IMDA 2ALBA 3BD2A 4MJAA 5DCGA 3I9V2 4J2FA 3GL3A 1SYRA 3LSZA 1S3AA 1F6MC 4YQMA 2PUKC 2V2GA 3F8UA 1GTUA 1PFOA 1QFNA 1M99A 4HQSA 4KDYA 2VL2A 3HVSA 2GGTA 1X9WB 2GQMA 2DJ0A 1M2AA 1V40A 2P31A 3E9JB 1TRSA 4Q5FA 3S9FA 2IIYA 1ACVA 3FZAA 1BYEA 4CW9A 4ZL7A 3QFBC 5DJLA 1PX7A 1S3DA 3H79A 4WEYA 5IMFA 3BJ5A 1SL0B 2AAWA 1DSBA 4ID0A 1GUMA 4X4JA 2WULA 2AB6A 1XW9A 1ZMAA 4PNGA 2XBIA 2LRTA 5KEJA 5ECNB 3PR8A 1EV9A 3HKRA 3LQ7A 3ZL5A 4I2UA 2UZ8A 2L4QA 4GCIA 3VK9A 1GRXA 1QUWA 2GSTA 3GH6A 2PVOC 4PNFA 3A2WA 1XPVA 3VWXA 3L9VA 3QFAC 4USSA 1X9MB 3FZ5A 5J3RA 2C4JA 4ZB9A 3KH7A 3FMWA 2IJYA 1JZWA 3TB2A 2FWFA 2GT5A 5DDLA 3GTUB 1PGTA 4N0ZA 1JZOA 3UIWA 5GAND 5ECQB 1XOBA 1SL2B 3D0ZA 2H76A 4AF2A 1G6YA 2YV9A 3HHVA 2BJXA 4KF9A 2L57A 2QA2A 2LJKA 2FWHA 3NIVA 1FOVA 3KEBA 1R4WA 1F9MA 2CVDA 1K3YA 1BJXA 4XS1A 2O87A 3QR6A 2JADA 2K9FA 2LNTA 4OO4A 3ZIJA 1ILOA 4XHMA 1U3AA 3DYRA 2M46A 4DSSA 2ON5A 2VCZA 3GUSA 2FA8A 2AJQB 4DEJA 1FHEA 1Z5YE 4AJ7A 3O76A 2I3YA 4BWQA 2VLVA 5A4UA 3WT1A 1SKSB 2VM1A 4TN8A 1SK2A 4AGSA 4K5SA 3FZ4A 4LL4B 5G30A 4EC0A 1F3AA 1TXXA 14GSA 1GSUA 2X4AA 3PPUA 3EVIA 2VL9A 3LW9A
chains in the Genus database with same CATH topology
2AYTA 4CY8A 3UARA 3KCMA 4OMVA 4AJ8A 1Q4JA 2K6VA 3GA4A 3RPPA 4IGJA 1SK0A 3W8SA 4P3YB 13GSA 4ZL8A 3G9BA 4XIHA 11GSA 3FKFA 3HCZA 3TJJA 3IR4A 1J9BA 1PX6A 1MDIA 3TOTA 4IN0A 1H4OA 4GTUA 4AJ6A 4MCUA 4KSOA 5CREA 5CAXA 1PN9A 2PBJA 1GSYA 6GSWA 2H6ZA 1BAYA 2YPMA 3EU4A 1PN0A 5KN0A 1G0TA 22GSA 2GS3A 2EC4A 2LUSA 4IJ3A 3I43A 4OFMA 1OE7A 1GL8A 3FK8A 1EP7A 3IC8A 3VPQA 1SU9A 4JE1A 3MNGA 2O85A 3IDVA 2H74A 2X8CA 4TR4A 3TCOA 1O81A 1JFUA 1A8YA 4MDCA 3D4TA 3GL5A 4J56E 3HVVA 4KB3A 1WWJA 2K18A 4GWRA 2LQQA 4TR0A 3GSSA 4MJCA 1HNCA 2OBIA 3IA1A 1U3IA 5B6MA 1F37A 4POBA 2MMNA 2MMAA 3D5JA 4NWYA 4KE3A 3US3A 1EOGA 5IPGA 2R2JA 2O8VB 4GLTA 4GSSA 2GZYA 1R26A 1QQ2A 2B5YA 1TI3A 3QAGA 3APQA 2K8VA 5CRDA 1VF3A 2H01A 5H5SA 3ED3A 4LL1B 3R3EA 5F07A 4MZWA 5GZZB 1O6JA 1ON4A 4IBPA 2OADA 2H0HA 4IQ1A 2JZRA 2DKHA 4V2LA 5F0GA 2NBSA 3HVXA 6GSYA 2YJHA 2FWEA 1ABAA 1GWCA 3GKMA 3KMOA 1XVWA 3G7IA 1YZXA 4DSQA 2FWGA 5G1LA 3WGDA 1XW5A 3F3QA 2M72A 1T1VA 1K0OA 2CZ3A 4PUFC 1YKAA 4K0GA 3DD3A 4YH2A 2DJJA 2QKEA 4XS4B 1V2AA 5ABRA 2H75A 1GUKA 5DVBA 3GX8A 1K0NA 3TKSC 1N8JA 4ECIA 3ME8A 1PKWA 2N5AA 4KDXA 4D73A 3P7XA 3IHQA 3EYTA 1OC3A 2R3XA 1QGVA 3P8WA 5KN1A 2A2RA 2F3MA 4OD7A 4I2TA 5JCUA 2QC7A 2L59A 4ULXA 3A3TA 2H70A 4NPBA 5JWQB 2GQLA 4XRDA 4BVYB 3HJOA 3QD9A 5D73A 2CX4A 4ML1A 5ECRB 2FLSA 4XTSA 5ELAA 1MTCA 3GNJA 1Z6NA 2H1DA 2A2SA 1OYJA 1WP0A 1XWBA 4IELA 1R5AA 3MIXA 1TK8B 2O7KA 3UVTA 1URMA 5A4VA 1MDJA 2L5LA 3ZTLA 5INYA 3FR9A 3V1WA 2WS2A 4NAXA 5AISA 1EOHA 4IP6A 2H73A 3TKRA 1M9BA 3M8NA 3GN3A 2CQ9A 1XWGA 3BCKA 1GSQA 2FNOA 3ZRDA 3L0HA 1A2JA 4YAPA 9GSSA 4K6XA 6GSUA 4YKGA 5DBQA 4K9ZA 1DE1A 3O3TA 2WCIA 3F0IA 2PVQA 4WR4A 1GNEA 4TR3A 4F0BA 1B4PA 3KIJA 1VRSD 4ZILA 1SD9A 2CT6A 4X1UA 2KUCA 3H4KA 2YANA 2VUPA 2YCDA 2F8AA 5DCHA 2JZSA 2IFQA 1SJIA 3UBKA 1GNWA 1KTEA 2N5BA 3KP9A 4GSTA 4F82A 5ECKB 2H1GA 3Q18A 1W4VA 5DQSA 1X5DA 2JU5A 1EWXA 4NHZA 4MA9A 3RHBA 2HFDA 5HFKA 3UMAA 3ZIVA 2LTKA 2NTOA 5G5EA 5B8AA 2LKUA 1SJZA 1Z6MA 1FB0A 1RK4A 3KTLA 4H86A 4OFTA 2C3TA 2VCWA 2CVBA 3HZ8A 3KTBA 1TRVA 5ECMB 2PN8A 2GVPA 1YEPA 1A2MA 2C1YA 2AHEA 4YQVA 3IPZA 2X99A 3TUEA 2LJAA 3EE2A 3Q6OA 5ID2B 5ECSA 2WRTA 3L4NA 4V2NA 4EE0A 4IKHA 3FR3A 1TJDA 1VGLA 2VLUA 3KP8A 5IMCA 1K0DA 1K3OA 2R37A 18GSA 1EEMA 1PL1A 1UN2A 1WJKA 2DJKA 5D96A 3LYPA 2QGVA 5IMAA 4TR1A 2C0EA 3HZ4A 1MD4A 2DC5A 3J7Yb 4K7NA 2NVLA 2G0FA 3M0FA 4FYCA 4O92A 3O6TA 3ERGA 5EVOA 1AXDA 1LU4A 3EINA 4YQUA 4F0CA 2XPEA 5HFGA 3DGQA 2B5EA 5IMVA 1OKDA 3EURA 3CTFA 2R6KA 1WRYA 1AQVA 3GMFA 3VLNA 1KEBA 3BCIA 2RIIA 2E2MA 3TJBA 3GX0A 1ZYNA 4MNNA 4HZ4A 3UAPA 1A23A 4MLYA 2KP2A 4QL9A 2WDUA 1K0BA 5BRTA 1ZZYA 5CYYA 1ZYEA 4G0KA 5HR0A 1XXUA 2YWNA 1HNAA 2YOIA 2PU9C 3ZFBA 4EXJA 3HJMA 1QXHA 1TU7A 3H93A 4TRXA 4TXOB 2IL3A 2XBQA 1K0MA 1OC8A 4GXZA 2HRNA 2FCHA 5ECPB 1GTBA 1AQWA 1THXA 4G2EA 2TIRA 5KOXA 2YNXA 1HNBA 4Z2RA 2R5GA 4TW5A 1QK8A 1YY7A 3CSHA 4EIPA 3LXZA 3EU3A 1XWAA 3P90A 1T3BA 4PQHA 1HQOA 4RI7A 2F8FA 2KLXA 3HD5A 5JCWA 4XS4A 4KX4A 1UC7A 3HYPA 4BL7A 1DUGA 3L9UA 5D9WA 4MF7A 1O85A 3TRPA 4BA7A 5ECOB 1ERTA 5G1KA 1AC1A 1LBKA 1IYHA 3KZQA 4JRRA 1GSDA 3DIEA 1TU8A 1FB6A 3CMIA 1K0CA 3IOSA 2HE3A 4G0LA 3GKXA 3KJYA 5DALA 3SBCA 3NZNA 3KMNA 5IO2A 4PURA 2GQKA 3IK7A 4KA0A 2FA4A 4FIWA 1ERWA 5COHA 5DAKA 1X9SB 3F3RA 1RW1A 2CVKA 4HEA2 4N11A 4NV5A 1USBA 3G7JA 1YF0A 3EMPA 1JHBA 2RLIA 2X49A 1NW2A 4HU7A 5HFIA 3VI5A 1A24A 3LFLA 1GLQA 4RQRA 5FHIA 2VIMA 4I6XA 1TTZA 2L5OA 4ICYA 4KAEA 2X8GA 4IS0A 3C71A 4J57E 1HD2A 2GSSA 3F4TA 1PSQA 2H30A 4L0UA 2D2ZA 5J4UA 4E8EA 4N10A 3FZ9A 3LORA 3GKKA 4BWSA 1BG5A 4G0IA 5HR2A 3QPMA 2VL3A 3N5OA 2CV4A 5IMZA 1WPIA 3MSZA 1GSEA 4IP1A 5KN3A 3LJRA 3LEFA 3M9JA 3GH9A 4N30A 2LV3A 3EC3A 5F8BA 2OKAA 1OE8A 2HSHA 3FYGA 4JZQA 4V2MA 4JR4A 3TJFA 1G6WA 3APOA 4BVXB 1TOFA 4KUNA 2PPTA 5D9VA 1FOHA 1OC9B 2YWIA 2YWOA 1YKCA 1J0FA 4PGTA 1ML6A 3DEXA 2X64A 3FRCA 5JWRB 3DMLA 1EV4A 2HNLA 4CDOA 1EEJA 3RBTA 2I4AA 4MH3A 5G5FA 4NXIA 1OVNA 3VWUA 1Z7RA 3FHKA 3MAKA 6GSSA 3BBYA 4IVFA 4ZBBA 5ID2A 1PL2A 4ZXGA 1GUHA 4F2IA 4DSRA 2K8SA 1XOAA 4RI6A 2DJ3A 1GP1A 1W89A 4MJBA 4CY6A 3ZMLA 4KH7A 1SENA 3ZREA 2IMDA 4XRAA 2IN3A 1PD21 2NDOA 5D9XA 2H71A 1TDIA 5D9TA 1M2BA 2L6DA 3W6GA 4KCEA 4ZB8A 1O73A 2HSMA 5J9BA 2HRAA 2CX3A 5LNKe 5B8BA 4OCEA 2LS5A 3PGTA 4LA1A 1HYUA 2H0GA 2HZEB 4K5RA 5JCGA 3QAVA 5C04A 1B9YC 4DVCA 2DIZA 1BX9A 3W8JA 3C1SA 2XPDA 2X8HA 3QMXA 4ML6A 3VI7A 5CRWA 3CYNA 3GIXA 4I8BA 2B7KA 3C73A 4JR6A 3HXSA 2LRCA 2MYGA 5BMUA 4MF5A 3J7Yk 3A2VA 5D8IA 1MEKA 3U6VA 1WE0A 2QSIA 1ZOFA 3QCPA 1ZL9A 4FO5A 1GTAA 3F4SA 3A5WA 4F03A 4IHUA 2R0PA 4V1Ap 4O5RA 3EWLA 3M3MA 20GSA 2IMIA 3KGKA 4DSSB 5IOWA 4TXVA 5HQPA 1YDKA 4Z2UA 5IM9A 4HS1A 3GTUA 4MJEA 4L8EA 4PQ1A 1XVQA 3M1GA 5J9CA 3TOUA 1T4ZA 2HZFA 1VF4A 4Q5QA 5IO0A 4K8MA 5C00A 1FAAA 5DQYA 1QMVA 3C8EA 2KP1A 3WGEA 4TOPA 2VM2A 2GZPA 1SKWB 2RUEA 2JSZA 3SWLA 2H66A 4L0WA 1MD3A 1XBSA 10GSA 1TRUA 4O32A 2VLTA 3VPTA 3EPTA 2JSYA 2OA7A 2VL2C 4NHWA 3MWHA 1JLVA 4HJ2A 17GSA 1BEDA 3FY7A 4EVMA 2L4CA 4MABA 2KOKA 5G2ZA 4ECCA 1Z9HA 1SKRB 3CSIA 2DJ1A 4WF4A 3A2XA 2I9HA 2JL4A 3G7YA 3TKQA 4WETA 5KN2A 5LCZA 3TKSA 1XW6A 2IWTA 1UVZA 1ZYQB 2A4VA 3CRUA 2M80A 4O7HA 4QQ7A 2AV4A 1YEXA 2B6MA 1AUCA 3E0UA 3ZLPA 2C3QA 2IPAA 3GSTA 3QAWA 1R7HA 2OACA 2GSRA 1MDKA 2XC2A 3HJPA 3UJ1A 3NOFA 3BOAA 1Q98A 3UOMA 4IJIA 2WZ9A 4PUAA 4K2DA 5DJMA 3RPNA 5J41A 4HI7A 3H8QA 2WJUA 1ZGNA 4ZBDA 2RUFA 3GFKA 3WD6A 2V32A 5FT3A 1OKTA 4KGIA 1EZKA 2GSQA 2HYXA 1A2LA 3Q19A 1SK1A 3TRQA 2KHPA 2RM6A 3E3EA 1EGRA 4F9ZA 2LRNA 2P0GA 2EIRA 2YN1A 4L5OA 5IOXA 3DWVA 2DMMA 4KCAA 2EIOA 2ON7A 1Y6EA 3RDWA 3FR6A 4WBRD 4HDEA 1F2EA 4LLRA 1OC9A 3ERWA 3A5IA 5G31A 2HRKA 4EIQA 3ME7A 4X0XA 3UBLA 1IYIA 3DRNA 2AUVA 5B6NA 3I69A 5ECIB 3TJGA 3LXTA 4PQIA 2REMA 5CRHA 3WYWA 4ZB6A 1GTIA 4JEDA 2HRFA 2PGTA 2YZHA 4LMWA 2EIQA 2OJLA 2VO4A 3RHCA 3KH9A 3GKNA 3WGXA 2PWJA 3LYKA 5EY6A 1OAZA 2RM5A 2V6KA 2V1MA 3CTGA 3D4MA 2H19A 4GF0A 2J23A 2FD3A 2DMLA 2F9SA 1SD8A 1YF1A 1KNGA 4D73B 4ZL9A 2DSAA 2I1UA 1H75A 4MP4A 2LEGA 3GV1A 4HU9A 1XWKA 3UEMA 3D6IA 3D21A 2YZUA 4ACSA 2HLSA 1E2YA 2IMEA 1K3LA 1E6BA 2OE0A 4HJMA 5GAPD 2O89A 1A8LA 4IW9A 4K1FA 1XFLA 2ZCTA 3GRXA 2VD1A 2TRCP 4MMMA 2VOCA 4RUVA 2QA1A 2HZEA 2HSYA 3TDGA 3ZZXA 5JWOB 5IIZA 2R0GA 3AY8A 5CP1A 4HUAA 3FW2A 3CBUA 2ZUPA 4GQCA 1M2DA 2H72A 3IBHA 3VWWA 2CA8A 5J5NA 4ZBAA 3HY2A 7GSSA 1V9WA 1M7TA 3MDKA 1U87A 4MZBA 1T7PB 4G19A 1FG4A 3HDCA 4POLA 1XCCA 2MBTA 1GH2A 2GTUA 3GYKA 4Q5RA 4I97A 1O8WA 4BVYA 1O7UA 4OWYA 3VURA 2C0GA 5KOWA 3DXBA 2Z9SA 2VCVA 3MYDA 1PMTA 5E4WA 1SJ6A 4BPYA 1K0AA 4PXOA 3R2QA 4KDUA 3IXRA 1FW1A 4WR5A 2GZZA 4FYUA 4NMUA 1B8XA 1B9XC 4WKWA 3TGZA 2C8UA 3D22A 1KBNA 3HA9A 3ZMKA 2P5RA 2C3NA 3K8NA 3LGCA 5F06A 3WT2A 2H1AA 2DJ2A 2XHFA 2IFQB 2H8LA 1TP9A 4EL1A 4QL7A 3KD0A 1N2AA 3IK9A 3UL3A 3VFIA 3FEUA 1TW9A 3TJKA 2A2PA 2ES7A 3ZVJA 4A5PA 3IE3A 1A0FA 4GRFA 2R0CA 1GSSA 1RQMA 4K7IA 4OFNA 4K7OA 4KNDA 3L9SA 2IMFA 4Z2TA 2H0IA 1TK0B 4HOJA 4I5QA 2FUG2 3H1NA 5H5RA 1C72A 3TKPA 2L6CA 1VF1A 6GSXA 1WOUA 2WB9A 3F6DA 1T8EB 2B3SA 3ZFLA 2VCTA 1Y25A 3CRTA 3LG6A 1V58A 2CAQA 3VWVA 2VCQA 3IHGA 1G7OA 1XWCA 2V6OA 1F3BA 4EKZA 4TR1B 4TVEA 5CO3A 4N0VA 4ECBA 12GSA 1EP8A 3ERFA 1WIKA 2B7JA 3CXGA 1PA3A 5E59A 5HR3A 3N9JA 1J08A 2JACA 1VF2A 2J9HA 4HQZA 4WBJA 1T00A 2LJRA 1NHOA 4G10A 4X43A 1SYXA 5ECHB 1S3CA 1X0RA 2MZCA 3IV4A 1AQXA 1YJ6A 2CZ2A 4CHSA 4NV2A 2E2GA 4TKYA 3UVHA 4K0NA 5CRGA 1T4YA 5GSTA 1PKZA 2E7PA 5AIVA 3C1RA 1U6TA 2LQOA 6GSTA 2GT6A 2YJ7A 5H5QA 3KXOA 2A4HA 3TRXA 2B1KA 4POKA 3M9KA 1GSFA 1FVJA 4OO5A 1V98A 1G7EA 3U5RE 2C0DA 8GSSA 3ZYWA 1DBYA 4FQUA 3IAS2 3TKSE 1WMJA 3F6FA 1FVKA 4EUYA 1XZOA 1BQ7A 3P2AA 5EPFA 3F9UA 1X5EA 3L78A 2HXKA 2VAFA 4EDYA 2R4VA 5GSSA 1EGOA 1GLPA 4JU5A 2V41A 2ZNMA 2E0QA 2H6XA 5ELGA 4WF5A 2DIYA 3IRAA 2MMOA 3DVWA 3I6AA 2BTOT 2DLXA 4XCSA 3ZITA 19GSA 4BL7B 2FHEA 1NHYA 4XS6A 2G2QA 3QOUA 4FH8A 5EL8A 4TXOA 1O8XA 4PTSA 2DBCA 2NPBA 4OCFA 1AIUA 1ST9A 1ZCPA 1THOA 2F51A 2IMKA 3IC4A 1SL1B 3PH9A 5DALB 2HI7A 3IAM2 5L71A 3Q74A 1ZYPA 4G9HA 2TRXA 2YP6A 5A5KA 1V57A 1R5PA 4E8HA 3KM6A 2FGXA 4PX1A 2MBSA 5DAKB 3F63A 2I81A 1A0RP 4K2XA 4ISDA 4MH2A 4ILFA 1UA5A 4MPFA 2B5XA 5A4WA 1ERVA 5FWGA 2H1BA 4YKFA 4ZIJA 5CNWA 4MPGA 2OE3A 2WGRA 2GDRA 2H6YA 3RAZA 1JLWA 2DKIA 3CSJA 3F4RA 2P5QA 4HZ2A 4POMA 4LMVA 4V1Ag 2YV7A 1TK5B 2B1LA 2YWMA 4JBBA 1ERUA 3OR5A 4Q5NA 3ISOA 2OE1A 4MF6A 1TKDB 3GURA 4IQAA 5LD0A 2LSTA 3C7MA 2N5FA 1I5GA 5AGYA 1XIYA 1PRXA 1PQNA 3APSA 4GQFA 1B4QA 1AW9A 1TRWA 1B48A 5ENUA 1CQGA 4FYBA 2CAIA 2JZTA 4Z7XA 3ZVJD 1AAZA 2MMZA 1Z7PA 1CQHA 2GLRA 1NSWA 1FO5A 6GSVA 4KW6A 5ECLB 1LJRA 2VCXA 1X5CA 2OBKA 5B7CA 2C80A 4EF0A 4WXTA 4MK3A 2LNSA 2FY6A 5F05A 1NM3A 4KSMA 2VD0A 3EMXA 3DVXA 5AN1A 3PINA 2WFCA 1GULA 5IQYA 2BMXA 1U88A 1YQ1A 4O5UA 16GSA 1TI1A 3JCML 1I9DA 1JZRA 4O5QA 5D93A 4MZCA 2HT9A 1Z3EA 1DE2A 3GHAA 4EDZA 2PERA 4GSNA 3LWAA 4L5LA 4YAVA 1JZDA 3DKSA 4EO3A 5IPHA 1M9AA 4RQXA 2PMTA 2C0FA 4ECJA 5HR1A 1M0UA 5AIXA 4BVXA 3QDNA 5IMDA 2ALBA 3BD2A 4MJAA 5DCGA 3I9V2 4J2FA 3GL3A 1SYRA 3LSZA 1S3AA 1F6MC 4YQMA 2PUKC 2V2GA 3F8UA 1GTUA 1QFNA 1M99A 4HQSA 4KDYA 2VL2A 3HVSA 2GGTA 1X9WB 2GQMA 2DJ0A 1M2AA 1V40A 2P31A 3E9JB 1TRSA 4Q5FA 3S9FA 2IIYA 1ACVA 3FZAA 1BYEA 4CW9A 4ZL7A 3QFBC 5DJLA 1PX7A 1S3DA 3H79A 4WEYA 5IMFA 3BJ5A 1SL0B 2AAWA 1DSBA 4ID0A 1GUMA 4X4JA 2WULA 2AB6A 1XW9A 1ZMAA 4PNGA 2XBIA 2LRTA 5KEJA 5ECNB 3PR8A 1EV9A 3HKRA 3LQ7A 3ZL5A 4I2UA 2UZ8A 2L4QA 4GCIA 3VK9A 1GRXA 1QUWA 2GSTA 3GH6A 2PVOC 4PNFA 3A2WA 1XPVA 3VWXA 3L9VA 3QFAC 4USSA 1X9MB 3FZ5A 5J3RA 2C4JA 4ZB9A 3KH7A 3FMWA 2IJYA 1JZWA 3TB2A 2FWFA 2GT5A 5DDLA 3GTUB 1PGTA 4N0ZA 1JZOA 3UIWA 5GAND 5ECQB 1XOBA 1SL2B 3D0ZA 2H76A 4AF2A 1G6YA 2YV9A 3HHVA 2BJXA 4KF9A 2L57A 2QA2A 2LJKA 2FWHA 3NIVA 1FOVA 3KEBA 1R4WA 1F9MA 2CVDA 1K3YA 1BJXA 4XS1A 2O87A 3QR6A 2JADA 2K9FA 2LNTA 4OO4A 3ZIJA 1ILOA 4XHMA 1U3AA 3DYRA 2M46A 4DSSA 2ON5A 2VCZA 3GUSA 2FA8A 2AJQB 4DEJA 1FHEA 1Z5YE 4AJ7A 3O76A 2I3YA 4BWQA 2VLVA 5A4UA 3WT1A 1SKSB 2VM1A 4TN8A 1SK2A 4AGSA 4K5SA 3FZ4A 4LL4B 5G30A 4EC0A 1F3AA 1TXXA 14GSA 1GSUA 2X4AA 3PPUA 3EVIA 2VL9A 3LW9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AYT A;  3UAR A;  3KCM A;  4OMV A;  4AJ8 A;  1Q4J A;  2K6V A;  3GA4 A;  3RPP A;  4IGJ A;  1SK0 A;  3W8S A;  4P3Y B;  13GS A;  4ZL8 A;  3G9B A;  4XIH A;  11GS A;  3FKF A;  3HCZ A;  3TJJ A;  3IR4 A;  1J9B A;  1PX6 A;  1MDI A;  3TOT A;  4IN0 A;  1H4O A;  4GTU A;  4AJ6 A;  4MCU A;  4KSO A;  5CRE A;  5CAX A;  1PN9 A;  2PBJ A;  1GSY A;  6GSW A;  2H6Z A;  1BAY A;  2YPM A;  3EU4 A;  5KN0 A;  1G0T A;  22GS A;  2GS3 A;  2EC4 A;  2LUS A;  4IJ3 A;  3I43 A;  4OFM A;  1OE7 A;  1GL8 A;  3FK8 A;  1EP7 A;  3VPQ A;  1SU9 A;  4JE1 A;  3MNG A;  2O85 A;  3IDV A;  2H74 A;  2X8C A;  4TR4 A;  3TCO A;  1O81 A;  1JFU A;  1A8Y A;  4MDC A;  3D4T A;  3GL5 A;  4J56 E;  3HVV A;  4KB3 A;  1WWJ A;  2K18 A;  4GWR A;  2LQQ A;  4TR0 A;  3GSS A;  4MJC A;  1HNC A;  2OBI A;  3IA1 A;  1U3I A;  5B6M A;  1F37 A;  4POB A;  2MMN A;  2MMA A;  3D5J A;  4NWY A;  4KE3 A;  3US3 A;  1EOG A;  5IPG A;  2R2J A;  2O8V B;  4GLT A;  4GSS A;  2GZY A;  1R26 A;  1QQ2 A;  2B5Y A;  1TI3 A;  3QAG A;  3APQ A;  2K8V A;  5CRD A;  1VF3 A;  2H01 A;  5H5S A;  3ED3 A;  4LL1 B;  5F07 A;  4MZW A;  5GZZ B;  1O6J A;  1ON4 A;  4IBP A;  2OAD A;  2H0H A;  4IQ1 A;  2JZR A;  5F0G A;  4V2L A;  2NBS A;  3HVX A;  6GSY A;  2YJH A;  2FWE A;  1ABA A;  1GWC A;  3GKM A;  3KMO A;  1XVW A;  3G7I A;  1YZX A;  4DSQ A;  2FWG A;  5G1L A;  3WGD A;  1XW5 A;  3F3Q A;  2M72 A;  1T1V A;  1K0O A;  2CZ3 A;  4PUF C;  1YKA A;  4K0G A;  3DD3 A;  4YH2 A;  2DJJ A;  2QKE A;  4XS4 B;  1V2A A;  5ABR A;  2H75 A;  1GUK A;  5DVB A;  3GX8 A;  1K0N A;  3TKS C;  1N8J A;  4ECI A;  3ME8 A;  1PKW A;  2N5A A;  4KDX A;  4D73 A;  3P7X A;  3IHQ A;  3EYT A;  1OC3 A;  2R3X A;  1QGV A;  3P8W A;  5KN1 A;  2A2R A;  2F3M A;  4OD7 A;  4I2T A;  5JCU A;  2QC7 A;  2L59 A;  4ULX A;  3A3T A;  2H70 A;  4NPB A;  5JWQ B;  2GQL A;  4XRD A;  3HJO A;  3QD9 A;  5D73 A;  2CX4 A;  4ML1 A;  5ECR B;  2FLS A;  4XTS A;  5ELA A;  1MTC A;  3GNJ A;  1Z6N A;  2H1D A;  2A2S A;  1OYJ A;  1WP0 A;  1XWB A;  4IEL A;  1R5A A;  1TK8 B;  2O7K A;  3UVT A;  1URM A;  5A4V A;  1MDJ A;  2L5L A;  3ZTL A;  5INY A;  3FR9 A;  3V1W A;  2WS2 A;  4NAX A;  5AIS A;  1EOH A;  4IP6 A;  2H73 A;  3TKR A;  1M9B A;  3M8N A;  3GN3 A;  2CQ9 A;  1XWG A;  3BCK A;  1GSQ A;  2FNO A;  3ZRD A;  3L0H A;  1A2J A;  4YAP A;  9GSS A;  4K6X A;  6GSU A;  5DBQ A;  4K9Z A;  1DE1 A;  3O3T A;  2WCI A;  3F0I A;  2PVQ A;  4WR4 A;  1GNE A;  4TR3 A;  4F0B A;  1B4P A;  3KIJ A;  1VRS D;  4ZIL A;  1SD9 A;  2CT6 A;  4X1U A;  2KUC A;  3H4K A;  2YAN A;  2VUP A;  2YCD A;  2F8A A;  5DCH A;  2JZS A;  2IFQ A;  1SJI A;  3UBK A;  1GNW A;  1KTE A;  2N5B A;  3KP9 A;  4GST A;  4F82 A;  5ECK B;  2H1G A;  3Q18 A;  1W4V A;  5DQS A;  1X5D A;  2JU5 A;  1EWX A;  4NHZ A;  4MA9 A;  3RHB A;  2HFD A;  5HFK A;  3UMA A;  3ZIV A;  2LTK A;  2NTO A;  5G5E A;  5B8A A;  2LKU A;  1SJZ A;  1Z6M A;  1FB0 A;  1RK4 A;  3KTL A;  4H86 A;  4OFT A;  2C3T A;  2VCW A;  2CVB A;  3HZ8 A;  3KTB A;  1TRV A;  5ECM B;  2PN8 A;  2GVP A;  1YEP A;  1A2M A;  2C1Y A;  2AHE A;  4YQV A;  3IPZ A;  2X99 A;  3TUE A;  2LJA A;  3EE2 A;  3Q6O A;  5ID2 B;  5ECS A;  2WRT A;  3L4N A;  4V2N A;  4EE0 A;  4IKH A;  3FR3 A;  1TJD A;  1VGL A;  2VLU A;  3KP8 A;  5IMC A;  1K0D A;  1K3O A;  2R37 A;  18GS A;  1EEM A;  1PL1 A;  1UN2 A;  1WJK A;  2DJK A;  5D96 A;  3LYP A;  2QGV A;  5IMA A;  4TR1 A;  2C0E A;  3HZ4 A;  1MD4 A;  2DC5 A;  3J7Y b;  4K7N A;  2NVL A;  2G0F A;  3M0F A;  4FYC A;  4O92 A;  3O6T A;  3ERG A;  5EVO A;  1AXD A;  1LU4 A;  3EIN A;  4YQU A;  4F0C A;  2XPE A;  5HFG A;  3DGQ A;  2B5E A;  5IMV A;  1OKD A;  3EUR A;  3CTF A;  2R6K A;  1WRY A;  1AQV A;  3GMF A;  3VLN A;  1KEB A;  3BCI A;  2RII A;  2E2M A;  3TJB A;  3GX0 A;  4HZ4 A;  3UAP A;  1A23 A;  4MLY A;  2KP2 A;  4QL9 A;  2WDU A;  1K0B A;  1ZZY A;  5CYY A;  1ZYE A;  5HR0 A;  1XXU A;  2YWN A;  1HNA A;  2YOI A;  2PU9 C;  3ZFB A;  4EXJ A;  3HJM A;  1QXH A;  1TU7 A;  3H93 A;  4TRX A;  4TXO B;  2IL3 A;  2XBQ A;  1K0M A;  1OC8 A;  4GXZ A;  2HRN A;  2FCH A;  5ECP B;  1GTB A;  1AQW A;  1THX A;  4G2E A;  2TIR A;  2YNX A;  1HNB A;  2R5G A;  4TW5 A;  1QK8 A;  1YY7 A;  3CSH A;  3LXZ A;  3EU3 A;  1XWA A;  3P90 A;  1T3B A;  4PQH A;  1HQO A;  4RI7 A;  2F8F A;  2KLX A;  3HD5 A;  5JCW A;  4XS4 A;  4KX4 A;  1UC7 A;  3HYP A;  4BL7 A;  1DUG A;  3L9U A;  5D9W A;  4MF7 A;  1O85 A;  3TRP A;  4BA7 A;  5ECO B;  1ERT A;  5G1K A;  1AC1 A;  1LBK A;  1IYH A;  3KZQ A;  4JRR A;  1GSD A;  3DIE A;  1TU8 A;  1FB6 A;  3CMI A;  1K0C A;  3IOS A;  2HE3 A;  3GKX A;  3KJY A;  5DAL A;  3SBC A;  3NZN A;  3KMN A;  5IO2 A;  4PUR A;  2GQK A;  3IK7 A;  4KA0 A;  2FA4 A;  4FIW A;  1ERW A;  5COH A;  5DAK A;  1X9S B;  3F3R A;  1RW1 A;  2CVK A;  4HEA 2;  4N11 A;  4NV5 A;  1USB A;  3G7J A;  1YF0 A;  3EMP A;  1JHB A;  2RLI A;  1NW2 A;  4HU7 A;  5HFI A;  3VI5 A;  1A24 A;  3LFL A;  1GLQ A;  4RQR A;  5FHI A;  2VIM A;  4I6X A;  1TTZ A;  2L5O A;  4KAE A;  2X8G A;  4IS0 A;  3C71 A;  1HD2 A;  2GSS A;  4J57 E;  3F4T A;  1PSQ A;  2H30 A;  4L0U A;  2D2Z A;  5J4U A;  4E8E A;  4N10 A;  3FZ9 A;  3LOR A;  3GKK A;  4BWS A;  1BG5 A;  5HR2 A;  3QPM A;  2VL3 A;  3N5O A;  2CV4 A;  5IMZ A;  1WPI A;  3MSZ A;  1GSE A;  4IP1 A;  5KN3 A;  3LJR A;  3LEF A;  3M9J A;  3GH9 A;  4N30 A;  2LV3 A;  3EC3 A;  5F8B A;  2OKA A;  1OE8 A;  2HSH A;  3FYG A;  4JZQ A;  4V2M A;  4JR4 A;  3TJF A;  1G6W A;  3APO A;  1TOF A;  4KUN A;  2PPT A;  5D9V A;  1OC9 B;  2YWI A;  2YWO A;  1YKC A;  1J0F A;  4PGT A;  1ML6 A;  3DEX A;  2X64 A;  3FRC A;  5JWR B;  3DML A;  1EV4 A;  2HNL A;  4CDO A;  1EEJ A;  3RBT A;  2I4A A;  4MH3 A;  5G5F A;  4NXI A;  1OVN A;  3VWU A;  1Z7R A;  3FHK A;  3MAK A;  6GSS A;  3BBY A;  4IVF A;  4ZBB A;  5ID2 A;  1PL2 A;  4ZXG A;  1GUH A;  4F2I A;  4DSR A;  2K8S A;  1XOA A;  4RI6 A;  2DJ3 A;  1GP1 A;  1W89 A;  4MJB A;  3ZML A;  4KH7 A;  1SEN A;  3ZRE A;  2IMD A;  4XRA A;  2IN3 A;  1PD2 1;  2NDO A;  5D9X A;  2H71 A;  1TDI A;  5D9T A;  1M2B A;  2L6D A;  3W6G A;  4KCE A;  4ZB8 A;  1O73 A;  5J9B A;  2CX3 A;  5LNK e;  5B8B A;  4OCE A;  2LS5 A;  3PGT A;  4LA1 A;  1HYU A;  2H0G A;  2HZE B;  5JCG A;  3QAV A;  5C04 A;  1B9Y C;  4DVC A;  2DIZ A;  1BX9 A;  3W8J A;  3C1S A;  2XPD A;  2X8H A;  3QMX A;  4ML6 A;  3VI7 A;  5CRW A;  3CYN A;  3GIX A;  4I8B A;  2B7K A;  3C73 A;  4JR6 A;  3HXS A;  2LRC A;  2MYG A;  4MF5 A;  3J7Y k;  3A2V A;  5D8I A;  1MEK A;  3U6V A;  1WE0 A;  2QSI A;  1ZOF A;  3QCP A;  1ZL9 A;  4FO5 A;  1GTA A;  3F4S A;  3A5W A;  4F03 A;  4IHU A;  4V1A p;  4O5R A;  3EWL A;  3M3M A;  20GS A;  2IMI A;  3KGK A;  4DSS B;  5IOW A;  4TXV A;  5HQP A;  1YDK A;  5IM9 A;  4HS1 A;  3GTU A;  4MJE A;  4L8E A;  4PQ1 A;  1XVQ A;  3M1G A;  5J9C A;  3TOU A;  1T4Z A;  2HZF A;  1VF4 A;  4Q5Q A;  5IO0 A;  4K8M A;  5C00 A;  1FAA A;  5DQY A;  1QMV A;  3C8E A;  2KP1 A;  3WGE A;  4TOP A;  2VM2 A;  2GZP A;  1SKW B;  2RUE A;  2JSZ A;  3SWL A;  2H66 A;  4L0W A;  1MD3 A;  1XBS A;  10GS A;  1TRU A;  4O32 A;  2VLT A;  3VPT A;  2JSY A;  2OA7 A;  2VL2 C;  4NHW A;  3MWH A;  1JLV A;  4HJ2 A;  17GS A;  1BED A;  3FY7 A;  4EVM A;  2L4C A;  4MAB A;  2KOK A;  5G2Z A;  4ECC A;  1Z9H A;  1SKR B;  3CSI A;  2DJ1 A;  4WF4 A;  3A2X A;  2I9H A;  2JL4 A;  3G7Y A;  3TKQ A;  4WET A;  5KN2 A;  5LCZ A;  3TKS A;  1XW6 A;  2IWT A;  1UVZ A;  1ZYQ B;  2A4V A;  3CRU A;  2M80 A;  4O7H A;  4QQ7 A;  2AV4 A;  1YEX A;  2B6M A;  1AUC A;  3E0U A;  3ZLP A;  2C3Q A;  2IPA A;  3GST A;  3QAW A;  1R7H A;  2OAC A;  2GSR A;  1MDK A;  2XC2 A;  3HJP A;  3UJ1 A;  3NOF A;  3BOA A;  1Q98 A;  3UOM A;  4IJI A;  2WZ9 A;  4PUA A;  4K2D A;  5DJM A;  3RPN A;  5J41 A;  4HI7 A;  3H8Q A;  2WJU A;  1ZGN A;  4ZBD A;  2RUF A;  3GFK A;  3WD6 A;  2V32 A;  5FT3 A;  1OKT A;  4KGI A;  1EZK A;  2GSQ A;  2HYX A;  1A2L A;  3Q19 A;  1SK1 A;  3TRQ A;  2KHP A;  2RM6 A;  3E3E A;  1EGR A;  4F9Z A;  2LRN A;  2P0G A;  2EIR A;  2YN1 A;  4L5O A;  5IOX A;  3DWV A;  2DMM A;  4KCA A;  2EIO A;  2ON7 A;  1Y6E A;  3RDW A;  3FR6 A;  4WBR D;  4HDE A;  1F2E A;  4LLR A;  1OC9 A;  3ERW A;  5G31 A;  3ME7 A;  4X0X A;  3UBL A;  1IYI A;  3DRN A;  2AUV A;  5B6N A;  3I69 A;  5ECI B;  3TJG A;  3LXT A;  4PQI A;  2REM A;  5CRH A;  3WYW A;  4ZB6 A;  1GTI A;  4JED A;  2HRF A;  2PGT A;  2YZH A;  4LMW A;  2EIQ A;  2OJL A;  2VO4 A;  3RHC A;  3KH9 A;  3GKN A;  3WGX A;  2PWJ A;  5EY6 A;  3LYK A;  1OAZ A;  2RM5 A;  2V6K A;  2V1M A;  3CTG A;  3D4M A;  2H19 A;  4GF0 A;  2J23 A;  2FD3 A;  2DML A;  2F9S A;  1SD8 A;  1YF1 A;  1KNG A;  4D73 B;  4ZL9 A;  2DSA A;  2I1U A;  1H75 A;  4MP4 A;  2LEG A;  3GV1 A;  4HU9 A;  1XWK A;  3UEM A;  3D6I A;  3D21 A;  2YZU A;  4ACS A;  2HLS A;  1E2Y A;  2IME A;  1K3L A;  1E6B A;  2OE0 A;  4HJM A;  5GAP D;  2O89 A;  1A8L A;  4IW9 A;  4K1F A;  1XFL A;  2ZCT A;  3GRX A;  2VD1 A;  2TRC P;  4MMM A;  2VOC A;  4RUV A;  2HZE A;  2HSY A;  3TDG A;  3ZZX A;  5JWO B;  5IIZ A;  3AY8 A;  5CP1 A;  4HUA A;  3FW2 A;  3CBU A;  2ZUP A;  4GQC A;  1M2D A;  2H72 A;  3IBH A;  3VWW A;  2CA8 A;  5J5N A;  4ZBA A;  3HY2 A;  7GSS A;  1V9W A;  1M7T A;  3MDK A;  1U87 A;  4MZB A;  1T7P B;  4G19 A;  1FG4 A;  3HDC A;  4POL A;  1XCC A;  2MBT A;  1GH2 A;  2GTU A;  3GYK A;  4Q5R A;  4I97 A;  1O8W A;  4BVY A;  1O7U A;  4OWY A;  3VUR A;  2C0G A;  3DXB A;  2Z9S A;  2VCV A;  1PMT A;  5E4W A;  1SJ6 A;  4BPY A;  1K0A A;  4PXO A;  3R2Q A;  4KDU A;  3IXR A;  1FW1 A;  4WR5 A;  2GZZ A;  4FYU A;  4NMU A;  1B8X A;  1B9X C;  4WKW A;  3TGZ A;  2C8U A;  3D22 A;  1KBN A;  3HA9 A;  3ZMK A;  2P5R A;  2C3N A;  3K8N A;  3LGC A;  5F06 A;  3WT2 A;  2H1A A;  2DJ2 A;  2XHF A;  2IFQ B;  2H8L A;  1TP9 A;  4EL1 A;  4QL7 A;  3KD0 A;  1N2A A;  3IK9 A;  3UL3 A;  3VFI A;  3FEU A;  1TW9 A;  3TJK A;  2ES7 A;  3ZVJ A;  3IE3 A;  1A0F A;  4GRF A;  1GSS A;  1RQM A;  4K7I A;  4OFN A;  4K7O A;  4KND A;  3L9S A;  2IMF A;  2H0I A;  1TK0 B;  4HOJ A;  4I5Q A;  2FUG 2;  3H1N A;  5H5R A;  1C72 A;  3TKP A;  2L6C A;  1VF1 A;  6GSX A;  1WOU A;  2WB9 A;  3F6D A;  1T8E B;  2B3S A;  3ZFL A;  2VCT A;  1Y25 A;  3CRT A;  3LG6 A;  1V58 A;  2CAQ A;  3VWV A;  2VCQ A;  1G7O A;  1XWC A;  2V6O A;  1F3B A;  4EKZ A;  4TR1 B;  4TVE A;  5CO3 A;  4N0V A;  4ECB A;  12GS A;  1EP8 A;  3ERF A;  1WIK A;  2B7J A;  3CXG A;  1PA3 A;  5E59 A;  5HR3 A;  3N9J A;  1J08 A;  2JAC A;  1VF2 A;  2J9H A;  4HQZ A;  4WBJ A;  1T00 A;  2LJR A;  1NHO A;  4G10 A;  4X43 A;  1SYX A;  5ECH B;  1S3C A;  1X0R A;  2MZC A;  3IV4 A;  1AQX A;  1YJ6 A;  2CZ2 A;  4CHS A;  4NV2 A;  2E2G A;  4TKY A;  3UVH A;  4K0N A;  5CRG A;  1T4Y A;  5GST A;  1PKZ A;  2E7P A;  5AIV A;  3C1R A;  1U6T A;  2LQO A;  6GST A;  2GT6 A;  2YJ7 A;  5H5Q A;  3KXO A;  3TRX A;  2B1K A;  4POK A;  3M9K A;  1GSF A;  1FVJ A;  4OO5 A;  1V98 A;  1G7E A;  3U5R E;  2C0D A;  8GSS A;  3ZYW A;  1DBY A;  3IAS 2;  3TKS E;  1WMJ A;  3F6F A;  1FVK A;  4EUY A;  1XZO A;  1BQ7 A;  3P2A A;  5EPF A;  3F9U A;  1X5E A;  3L78 A;  2HXK A;  2VAF A;  4EDY A;  2R4V A;  5GSS A;  1EGO A;  1GLP A;  4JU5 A;  2V41 A;  2ZNM A;  2E0Q A;  2H6X A;  5ELG A;  4WF5 A;  2DIY A;  3IRA A;  2MMO A;  3DVW A;  3I6A A;  2BTO T;  2DLX A;  4XCS A;  3ZIT A;  19GS A;  2FHE A;  1NHY A;  4XS6 A;  2G2Q A;  3QOU A;  4FH8 A;  5EL8 A;  4TXO A;  1O8X A;  2DBC A;  2NPB A;  4OCF A;  1AIU A;  1ST9 A;  1ZCP A;  1THO A;  2F51 A;  2IMK A;  3IC4 A;  1SL1 B;  3PH9 A;  5DAL B;  2HI7 A;  3IAM 2;  5L71 A;  3Q74 A;  4G9H A;  2TRX A;  2YP6 A;  5A5K A;  1V57 A;  1R5P A;  4E8H A;  3KM6 A;  2FGX A;  4PX1 A;  2MBS A;  5DAK B;  3F63 A;  2I81 A;  1A0R P;  4ISD A;  4MH2 A;  4ILF A;  1UA5 A;  4MPF A;  2B5X A;  5A4W A;  1ERV A;  5FWG A;  2H1B A;  4ZIJ A;  5CNW A;  4MPG A;  2OE3 A;  2WGR A;  2GDR A;  2H6Y A;  3RAZ A;  1JLW A;  3CSJ A;  3F4R A;  2P5Q A;  4HZ2 A;  4POM A;  4LMV A;  4V1A g;  2YV7 A;  1TK5 B;  2B1L A;  2YWM A;  4JBB A;  1ERU A;  3OR5 A;  4Q5N A;  3ISO A;  2OE1 A;  4MF6 A;  1TKD B;  3GUR A;  4IQA A;  5LD0 A;  2LST A;  3C7M A;  2N5F A;  1I5G A;  5AGY A;  1XIY A;  1PRX A;  1PQN A;  3APS A;  4GQF A;  1B4Q A;  1AW9 A;  1TRW A;  1B48 A;  5ENU A;  1CQG A;  4FYB A;  2CAI A;  2JZT A;  4Z7X A;  3ZVJ D;  1AAZ A;  2MMZ A;  1Z7P A;  1CQH A;  2GLR A;  1NSW A;  1FO5 A;  6GSV A;  4KW6 A;  5ECL B;  1LJR A;  2VCX A;  1X5C A;  2OBK A;  5B7C A;  2C80 A;  4EF0 A;  4WXT A;  4MK3 A;  2LNS A;  2FY6 A;  5F05 A;  1NM3 A;  4KSM A;  2VD0 A;  3EMX A;  3DVX A;  5AN1 A;  3PIN A;  2WFC A;  1GUL A;  5IQY A;  2BMX A;  1U88 A;  1YQ1 A;  16GS A;  1TI1 A;  3JCM L;  1I9D A;  1JZR A;  5D93 A;  4MZC A;  2HT9 A;  1Z3E A;  1DE2 A;  3GHA A;  4EDZ A;  2PER A;  4GSN A;  3LWA A;  4L5L A;  4YAV A;  1JZD A;  3DKS A;  4EO3 A;  5IPH A;  1M9A A;  4RQX A;  2PMT A;  2C0F A;  4ECJ A;  5HR1 A;  1M0U A;  5AIX A;  4BVX A;  3QDN A;  5IMD A;  2ALB A;  3BD2 A;  4MJA A;  5DCG A;  3I9V 2;  4J2F A;  3GL3 A;  1SYR A;  3LSZ A;  1S3A A;  1F6M C;  4YQM A;  2PUK C;  2V2G A;  3F8U A;  1GTU A;  1QFN A;  1M99 A;  4HQS A;  4KDY A;  2VL2 A;  3HVS A;  2GGT A;  1X9W B;  2GQM A;  2DJ0 A;  1M2A A;  1V40 A;  2P31 A;  3E9J B;  1TRS A;  4Q5F A;  3S9F A;  2IIY A;  1ACV A;  3FZA A;  1BYE A;  4CW9 A;  4ZL7 A;  3QFB C;  5DJL A;  1PX7 A;  1S3D A;  3H79 A;  4WEY A;  5IMF A;  3BJ5 A;  1SL0 B;  2AAW A;  1DSB A;  4ID0 A;  1GUM A;  2WUL A;  2AB6 A;  1XW9 A;  1ZMA A;  4PNG A;  2XBI A;  2LRT A;  5KEJ A;  5ECN B;  3PR8 A;  1EV9 A;  3HKR A;  3LQ7 A;  3ZL5 A;  4I2U A;  4GCI A;  2L4Q A;  3VK9 A;  1GRX A;  1QUW A;  2GST A;  3GH6 A;  2PVO C;  4PNF A;  3A2W A;  1XPV A;  3VWX A;  3L9V A;  3QFA C;  1X9M B;  3FZ5 A;  5J3R A;  2C4J A;  4ZB9 A;  3KH7 A;  2IJY A;  1JZW A;  3TB2 A;  2FWF A;  2GT5 A;  5DDL A;  3GTU B;  1PGT A;  4N0Z A;  1JZO A;  3UIW A;  5GAN D;  5ECQ B;  1XOB A;  1SL2 B;  3D0Z A;  2H76 A;  4AF2 A;  1G6Y A;  2YV9 A;  3HHV A;  2BJX A;  2L57 A;  2LJK A;  2FWH A;  3NIV A;  1FOV A;  3KEB A;  1R4W A;  1F9M A;  2CVD A;  1K3Y A;  1BJX A;  4XS1 A;  2O87 A;  3QR6 A;  2JAD A;  2K9F A;  2LNT A;  4OO4 A;  3ZIJ A;  1ILO A;  4XHM A;  1U3A A;  3DYR A;  2M46 A;  4DSS A;  2ON5 A;  2VCZ A;  3GUS A;  2FA8 A;  2AJQ B;  4DEJ A;  1FHE A;  1Z5Y E;  4AJ7 A;  3O76 A;  2I3Y A;  4BWQ A;  2VLV A;  5A4U A;  3WT1 A;  1SKS B;  2VM1 A;  4TN8 A;  1SK2 A;  4AGS A;  3FZ4 A;  4LL4 B;  5G30 A;  4EC0 A;  1F3A A;  1TXX A;  14GS A;  1GSU A;  3EVI A;  2VL9 A; 
#chains in the Genus database with same CATH topology
 2AYT A;  4CY8 A;  3UAR A;  3KCM A;  4OMV A;  4AJ8 A;  1Q4J A;  2K6V A;  3GA4 A;  3RPP A;  4IGJ A;  1SK0 A;  3W8S A;  4P3Y B;  13GS A;  4ZL8 A;  3G9B A;  4XIH A;  11GS A;  3FKF A;  3HCZ A;  3TJJ A;  3IR4 A;  1J9B A;  1PX6 A;  1MDI A;  3TOT A;  4IN0 A;  1H4O A;  4GTU A;  4AJ6 A;  4MCU A;  4KSO A;  5CRE A;  5CAX A;  1PN9 A;  2PBJ A;  1GSY A;  6GSW A;  2H6Z A;  1BAY A;  2YPM A;  3EU4 A;  1PN0 A;  5KN0 A;  1G0T A;  22GS A;  2GS3 A;  2EC4 A;  2LUS A;  4IJ3 A;  3I43 A;  4OFM A;  1OE7 A;  1GL8 A;  3FK8 A;  1EP7 A;  3IC8 A;  3VPQ A;  1SU9 A;  4JE1 A;  3MNG A;  2O85 A;  3IDV A;  2H74 A;  2X8C A;  4TR4 A;  3TCO A;  1O81 A;  1JFU A;  1A8Y A;  4MDC A;  3D4T A;  3GL5 A;  4J56 E;  3HVV A;  4KB3 A;  1WWJ A;  2K18 A;  4GWR A;  2LQQ A;  4TR0 A;  3GSS A;  4MJC A;  1HNC A;  2OBI A;  3IA1 A;  1U3I A;  5B6M A;  1F37 A;  4POB A;  2MMN A;  2MMA A;  3D5J A;  4NWY A;  4KE3 A;  3US3 A;  1EOG A;  5IPG A;  2R2J A;  2O8V B;  4GLT A;  4GSS A;  2GZY A;  1R26 A;  1QQ2 A;  2B5Y A;  1TI3 A;  3QAG A;  3APQ A;  2K8V A;  5CRD A;  1VF3 A;  2H01 A;  5H5S A;  3ED3 A;  4LL1 B;  3R3E A;  5F07 A;  4MZW A;  5GZZ B;  1O6J A;  1ON4 A;  4IBP A;  2OAD A;  2H0H A;  4IQ1 A;  2JZR A;  2DKH A;  4V2L A;  5F0G A;  2NBS A;  3HVX A;  6GSY A;  2YJH A;  2FWE A;  1ABA A;  1GWC A;  3GKM A;  3KMO A;  1XVW A;  3G7I A;  1YZX A;  4DSQ A;  2FWG A;  5G1L A;  3WGD A;  1XW5 A;  3F3Q A;  2M72 A;  1T1V A;  1K0O A;  2CZ3 A;  4PUF C;  1YKA A;  4K0G A;  3DD3 A;  4YH2 A;  2DJJ A;  2QKE A;  4XS4 B;  1V2A A;  5ABR A;  2H75 A;  1GUK A;  5DVB A;  3GX8 A;  1K0N A;  3TKS C;  1N8J A;  4ECI A;  3ME8 A;  1PKW A;  2N5A A;  4KDX A;  4D73 A;  3P7X A;  3IHQ A;  3EYT A;  1OC3 A;  2R3X A;  1QGV A;  3P8W A;  5KN1 A;  2A2R A;  2F3M A;  4OD7 A;  4I2T A;  5JCU A;  2QC7 A;  2L59 A;  4ULX A;  3A3T A;  2H70 A;  4NPB A;  5JWQ B;  2GQL A;  3HVN A;  4XRD A;  4BVY B;  3HJO A;  3QD9 A;  5D73 A;  2CX4 A;  4ML1 A;  5ECR B;  2FLS A;  4XTS A;  5ELA A;  1MTC A;  3GNJ A;  1Z6N A;  2H1D A;  2A2S A;  1OYJ A;  1WP0 A;  1XWB A;  4IEL A;  1R5A A;  3MIX A;  1TK8 B;  2O7K A;  3UVT A;  1URM A;  5A4V A;  1MDJ A;  2L5L A;  3ZTL A;  5INY A;  3FR9 A;  3V1W A;  2WS2 A;  4NAX A;  5AIS A;  1EOH A;  4IP6 A;  2H73 A;  3TKR A;  1M9B A;  3M8N A;  3GN3 A;  2CQ9 A;  1XWG A;  3BCK A;  1GSQ A;  2FNO A;  3ZRD A;  3L0H A;  1A2J A;  4YAP A;  9GSS A;  4K6X A;  6GSU A;  4YKG A;  5DBQ A;  4K9Z A;  1DE1 A;  3O3T A;  2WCI A;  3F0I A;  2PVQ A;  4WR4 A;  1GNE A;  4TR3 A;  4F0B A;  1B4P A;  3KIJ A;  1VRS D;  4ZIL A;  1SD9 A;  2CT6 A;  4X1U A;  2KUC A;  3H4K A;  2YAN A;  2VUP A;  2YCD A;  2F8A A;  5DCH A;  2JZS A;  2IFQ A;  1SJI A;  3UBK A;  1GNW A;  1KTE A;  2N5B A;  3KP9 A;  4GST A;  4F82 A;  5ECK B;  2H1G A;  3Q18 A;  1W4V A;  5DQS A;  1X5D A;  2JU5 A;  1EWX A;  4NHZ A;  4MA9 A;  3RHB A;  2HFD A;  5HFK A;  3UMA A;  3ZIV A;  2LTK A;  2NTO A;  5G5E A;  5B8A A;  2LKU A;  1SJZ A;  1Z6M A;  1FB0 A;  1M3I A;  1RK4 A;  3KTL A;  4H86 A;  4OFT A;  2C3T A;  2VCW A;  2CVB A;  3HZ8 A;  3KTB A;  1TRV A;  5ECM B;  2PN8 A;  2GVP A;  1YEP A;  1A2M A;  2C1Y A;  2AHE A;  4YQV A;  3IPZ A;  2X99 A;  3TUE A;  2LJA A;  3EE2 A;  3Q6O A;  5ID2 B;  5ECS A;  2WRT A;  3L4N A;  4V2N A;  4EE0 A;  4IKH A;  3FR3 A;  1VGL A;  1TJD A;  2VLU A;  3KP8 A;  5IMC A;  1K0D A;  1K3O A;  2R37 A;  18GS A;  1EEM A;  1PL1 A;  1UN2 A;  1WJK A;  2DJK A;  5D96 A;  3LYP A;  2QGV A;  5IMA A;  4TR1 A;  2C0E A;  3HZ4 A;  1MD4 A;  2DC5 A;  3J7Y b;  4K7N A;  2NVL A;  2G0F A;  3M0F A;  4FYC A;  4O92 A;  3O6T A;  3ERG A;  5EVO A;  1AXD A;  1LU4 A;  3EIN A;  4YQU A;  4F0C A;  2XPE A;  5HFG A;  3DGQ A;  2B5E A;  5IMV A;  1OKD A;  3EUR A;  3CTF A;  2R6K A;  1WRY A;  1AQV A;  3GMF A;  3VLN A;  1KEB A;  3BCI A;  2RII A;  2E2M A;  3TJB A;  3GX0 A;  1ZYN A;  4MNN A;  4HZ4 A;  3UAP A;  1A23 A;  4MLY A;  2KP2 A;  4QL9 A;  2WDU A;  1K0B A;  5BRT A;  1ZZY A;  5CYY A;  1ZYE A;  4G0K A;  5HR0 A;  1XXU A;  2YWN A;  1HNA A;  2YOI A;  2PU9 C;  3ZFB A;  4EXJ A;  3HJM A;  1QXH A;  1TU7 A;  3H93 A;  4TRX A;  4TXO B;  2IL3 A;  2XBQ A;  1K0M A;  1OC8 A;  4GXZ A;  2HRN A;  2FCH A;  5ECP B;  1GTB A;  1AQW A;  1THX A;  4G2E A;  2TIR A;  5KOX A;  2YNX A;  1HNB A;  4Z2R A;  2R5G A;  4TW5 A;  1QK8 A;  1YY7 A;  3CSH A;  4EIP A;  3LXZ A;  3EU3 A;  1XWA A;  3P90 A;  1T3B A;  4PQH A;  1HQO A;  4RI7 A;  2F8F A;  2KLX A;  3HD5 A;  5JCW A;  4XS4 A;  4KX4 A;  1UC7 A;  3HYP A;  4BL7 A;  1DUG A;  3L9U A;  5D9W A;  4MF7 A;  1O85 A;  3TRP A;  4BA7 A;  5ECO B;  1ERT A;  5G1K A;  1AC1 A;  1LBK A;  1IYH A;  3KZQ A;  4JRR A;  1GSD A;  3DIE A;  1TU8 A;  1FB6 A;  3CMI A;  1K0C A;  3IOS A;  2HE3 A;  4G0L A;  3GKX A;  3KJY A;  5DAL A;  3SBC A;  3NZN A;  3KMN A;  5IO2 A;  4PUR A;  2GQK A;  3IK7 A;  4KA0 A;  2FA4 A;  4FIW A;  1ERW A;  5COH A;  5DAK A;  1X9S B;  3F3R A;  1RW1 A;  2CVK A;  4HEA 2;  4N11 A;  4NV5 A;  1USB A;  3G7J A;  1YF0 A;  3EMP A;  1JHB A;  2RLI A;  2X49 A;  1NW2 A;  4HU7 A;  5HFI A;  3VI5 A;  1A24 A;  3LFL A;  1GLQ A;  4RQR A;  5FHI A;  2VIM A;  4I6X A;  1TTZ A;  2L5O A;  4ICY A;  4KAE A;  2X8G A;  4IS0 A;  3C71 A;  4J57 E;  1HD2 A;  2GSS A;  3F4T A;  1PSQ A;  2H30 A;  4L0U A;  1M3J A;  2D2Z A;  5J4U A;  4E8E A;  4N10 A;  3FZ9 A;  3LOR A;  3GKK A;  4BWS A;  1BG5 A;  4G0I A;  5HR2 A;  3QPM A;  2VL3 A;  3N5O A;  2CV4 A;  5IMZ A;  1WPI A;  3MSZ A;  1GSE A;  4IP1 A;  5KN3 A;  3LJR A;  3LEF A;  3M9J A;  3GH9 A;  4N30 A;  2LV3 A;  3EC3 A;  5F8B A;  2OKA A;  1OE8 A;  2HSH A;  3FYG A;  4JZQ A;  4V2M A;  4JR4 A;  3TJF A;  1G6W A;  1XG8 A;  3APO A;  4BVX B;  1TOF A;  4KUN A;  2PPT A;  5D9V A;  1FOH A;  1OC9 B;  2YWI A;  2YWO A;  1YKC A;  1J0F A;  4PGT A;  1ML6 A;  3DEX A;  2X64 A;  3FRC A;  5JWR B;  3DML A;  1EV4 A;  2HNL A;  4CDO A;  1EEJ A;  3RBT A;  2I4A A;  4MH3 A;  5G5F A;  4NXI A;  1OVN A;  3VWU A;  1Z7R A;  3FHK A;  3MAK A;  6GSS A;  3BBY A;  4IVF A;  4ZBB A;  5ID2 A;  1PL2 A;  4ZXG A;  1GUH A;  4F2I A;  4DSR A;  2K8S A;  1XOA A;  4RI6 A;  2DJ3 A;  1GP1 A;  1W89 A;  4MJB A;  4CY6 A;  3ZML A;  4KH7 A;  1SEN A;  3ZRE A;  2IMD A;  4XRA A;  2IN3 A;  1PD2 1;  2NDO A;  5D9X A;  2H71 A;  1TDI A;  5D9T A;  1M2B A;  2L6D A;  3W6G A;  4KCE A;  4ZB8 A;  1O73 A;  2HSM A;  5J9B A;  2HRA A;  2CX3 A;  5LNK e;  5B8B A;  4OCE A;  2LS5 A;  3PGT A;  4LA1 A;  1HYU A;  2H0G A;  2HZE B;  4K5R A;  5JCG A;  3QAV A;  5C04 A;  1B9Y C;  4DVC A;  2DIZ A;  1BX9 A;  3W8J A;  3C1S A;  2XPD A;  2X8H A;  3QMX A;  4ML6 A;  3VI7 A;  5CRW A;  3CYN A;  3GIX A;  4I8B A;  2B7K A;  3C73 A;  4JR6 A;  3HXS A;  2LRC A;  2MYG A;  5BMU A;  4MF5 A;  3J7Y k;  3A2V A;  5D8I A;  1MEK A;  3U6V A;  1WE0 A;  2QSI A;  1ZOF A;  3QCP A;  1ZL9 A;  4FO5 A;  1GTA A;  3F4S A;  3A5W A;  4F03 A;  4IHU A;  2R0P A;  4V1A p;  4O5R A;  3EWL A;  3M3M A;  20GS A;  2IMI A;  3KGK A;  4DSS B;  5IOW A;  4TXV A;  5HQP A;  1YDK A;  4Z2U A;  5IM9 A;  4HS1 A;  1S3R A;  3GTU A;  4MJE A;  4L8E A;  4PQ1 A;  1XVQ A;  3M1G A;  5J9C A;  3TOU A;  1T4Z A;  2HZF A;  1VF4 A;  4Q5Q A;  5IO0 A;  4K8M A;  5C00 A;  1FAA A;  5DQY A;  1QMV A;  3C8E A;  2KP1 A;  3WGE A;  4TOP A;  2VM2 A;  2GZP A;  1SKW B;  2RUE A;  2JSZ A;  3SWL A;  2H66 A;  4L0W A;  1MD3 A;  1XBS A;  10GS A;  1TRU A;  4O32 A;  2VLT A;  3VPT A;  3EPT A;  2JSY A;  2OA7 A;  2VL2 C;  4NHW A;  3MWH A;  1JLV A;  4HJ2 A;  17GS A;  1BED A;  3FY7 A;  4EVM A;  2L4C A;  4MAB A;  2KOK A;  5G2Z A;  4ECC A;  1Z9H A;  1SKR B;  3CSI A;  2DJ1 A;  4WF4 A;  3A2X A;  2I9H A;  2JL4 A;  3G7Y A;  3TKQ A;  4WET A;  5KN2 A;  5LCZ A;  3TKS A;  1XW6 A;  2IWT A;  1UVZ A;  1ZYQ B;  2A4V A;  3CRU A;  2M80 A;  4O7H A;  4QQ7 A;  2AV4 A;  1YEX A;  2B6M A;  1AUC A;  3E0U A;  3ZLP A;  2C3Q A;  2IPA A;  3GST A;  3QAW A;  1R7H A;  2OAC A;  2GSR A;  1MDK A;  2XC2 A;  3HJP A;  3UJ1 A;  3NOF A;  3BOA A;  1Q98 A;  3UOM A;  4IJI A;  2WZ9 A;  4PUA A;  4K2D A;  5DJM A;  3RPN A;  5J41 A;  4HI7 A;  3H8Q A;  2WJU A;  1ZGN A;  4ZBD A;  2RUF A;  3GFK A;  3WD6 A;  2V32 A;  5FT3 A;  1OKT A;  4KGI A;  1EZK A;  2GSQ A;  2HYX A;  1A2L A;  3Q19 A;  1SK1 A;  3TRQ A;  2KHP A;  2RM6 A;  3E3E A;  1EGR A;  4F9Z A;  2LRN A;  2P0G A;  2EIR A;  2YN1 A;  4L5O A;  5IOX A;  3DWV A;  2DMM A;  4KCA A;  2EIO A;  2ON7 A;  1Y6E A;  3RDW A;  3FR6 A;  4WBR D;  4HDE A;  1F2E A;  4LLR A;  1OC9 A;  3ERW A;  3A5I A;  5G31 A;  2HRK A;  4EIQ A;  3ME7 A;  4X0X A;  3UBL A;  1IYI A;  3DRN A;  2AUV A;  5B6N A;  3I69 A;  5ECI B;  3TJG A;  3LXT A;  4PQI A;  2REM A;  5CRH A;  3WYW A;  4ZB6 A;  1GTI A;  4JED A;  2HRF A;  2PGT A;  2YZH A;  4LMW A;  2EIQ A;  2OJL A;  2VO4 A;  3RHC A;  3KH9 A;  3GKN A;  3WGX A;  2PWJ A;  3LYK A;  5EY6 A;  1OAZ A;  2RM5 A;  2V6K A;  2V1M A;  3CTG A;  3D4M A;  2H19 A;  4GF0 A;  2J23 A;  2FD3 A;  2DML A;  2F9S A;  1SD8 A;  1YF1 A;  1KNG A;  4D73 B;  4ZL9 A;  2DSA A;  2I1U A;  1H75 A;  4MP4 A;  2LEG A;  3GV1 A;  4HU9 A;  1XWK A;  3UEM A;  3D6I A;  3D21 A;  2YZU A;  4ACS A;  2HLS A;  1E2Y A;  2IME A;  1K3L A;  1E6B A;  2OE0 A;  4HJM A;  5GAP D;  2O89 A;  1A8L A;  4IW9 A;  4K1F A;  1XFL A;  2ZCT A;  3GRX A;  2VD1 A;  2TRC P;  4MMM A;  2VOC A;  4RUV A;  2QA1 A;  2HZE A;  2HSY A;  3TDG A;  3ZZX A;  5JWO B;  5IIZ A;  2R0G A;  3AY8 A;  5CP1 A;  4HUA A;  3FW2 A;  3CBU A;  2ZUP A;  4GQC A;  1M2D A;  2H72 A;  3IBH A;  3VWW A;  2CA8 A;  5J5N A;  4ZBA A;  3HY2 A;  7GSS A;  1V9W A;  1M7T A;  3MDK A;  1U87 A;  4MZB A;  1T7P B;  4G19 A;  1FG4 A;  3HDC A;  4POL A;  1XCC A;  2MBT A;  1GH2 A;  2GTU A;  3GYK A;  4Q5R A;  4I97 A;  1O8W A;  4BVY A;  1O7U A;  4OWY A;  3VUR A;  2C0G A;  5KOW A;  3DXB A;  2Z9S A;  2VCV A;  3MYD A;  1PMT A;  5E4W A;  1SJ6 A;  4BPY A;  1K0A A;  4PXO A;  3R2Q A;  4KDU A;  3IXR A;  1FW1 A;  4WR5 A;  2GZZ A;  4FYU A;  4NMU A;  1B8X A;  1B9X C;  4WKW A;  3TGZ A;  2C8U A;  3D22 A;  1KBN A;  3HA9 A;  3ZMK A;  2P5R A;  2C3N A;  3K8N A;  3LGC A;  5F06 A;  3WT2 A;  2H1A A;  2DJ2 A;  2XHF A;  2IFQ B;  2H8L A;  1TP9 A;  4EL1 A;  4QL7 A;  3KD0 A;  1N2A A;  3IK9 A;  3UL3 A;  3VFI A;  3FEU A;  1TW9 A;  3TJK A;  2A2P A;  2ES7 A;  3ZVJ A;  4A5P A;  3IE3 A;  1A0F A;  4GRF A;  2R0C A;  1GSS A;  1RQM A;  4K7I A;  4OFN A;  4K7O A;  4KND A;  3L9S A;  2IMF A;  4Z2T A;  2H0I A;  1TK0 B;  4HOJ A;  4I5Q A;  2FUG 2;  3H1N A;  5H5R A;  1C72 A;  3TKP A;  2L6C A;  1VF1 A;  6GSX A;  1WOU A;  2WB9 A;  3F6D A;  1T8E B;  2B3S A;  3ZFL A;  2VCT A;  1Y25 A;  3CRT A;  3LG6 A;  1V58 A;  2CAQ A;  3VWV A;  2VCQ A;  3IHG A;  1G7O A;  1XWC A;  2V6O A;  1F3B A;  4EKZ A;  4TR1 B;  4TVE A;  5CO3 A;  4N0V A;  4ECB A;  12GS A;  1EP8 A;  3ERF A;  1WIK A;  2B7J A;  3CXG A;  1PA3 A;  5E59 A;  5HR3 A;  3CQF A;  3N9J A;  1J08 A;  2JAC A;  1VF2 A;  2J9H A;  4HQZ A;  4WBJ A;  1T00 A;  2LJR A;  1NHO A;  4G10 A;  4X43 A;  1SYX A;  5ECH B;  1S3C A;  1X0R A;  2MZC A;  3IV4 A;  1AQX A;  1YJ6 A;  2CZ2 A;  4CHS A;  4NV2 A;  2E2G A;  4TKY A;  3UVH A;  4K0N A;  5CRG A;  1T4Y A;  5GST A;  1PKZ A;  2E7P A;  5AIV A;  3C1R A;  1U6T A;  2LQO A;  6GST A;  2GT6 A;  2YJ7 A;  5H5Q A;  3KXO A;  2A4H A;  3TRX A;  2B1K A;  4POK A;  3M9K A;  1GSF A;  1FVJ A;  4OO5 A;  1V98 A;  1G7E A;  3U5R E;  2C0D A;  8GSS A;  3ZYW A;  1DBY A;  4FQU A;  3IAS 2;  3TKS E;  1WMJ A;  3F6F A;  1FVK A;  4EUY A;  1XZO A;  1BQ7 A;  3P2A A;  5EPF A;  3F9U A;  1X5E A;  3L78 A;  2HXK A;  2VAF A;  4EDY A;  2R4V A;  5GSS A;  1EGO A;  1GLP A;  4JU5 A;  4BIK A;  2V41 A;  2ZNM A;  2E0Q A;  2H6X A;  5ELG A;  4WF5 A;  2DIY A;  3IRA A;  2MMO A;  3DVW A;  3I6A A;  2BTO T;  2DLX A;  4XCS A;  3ZIT A;  19GS A;  4BL7 B;  2FHE A;  1NHY A;  4XS6 A;  2G2Q A;  3QOU A;  4FH8 A;  5EL8 A;  4TXO A;  1O8X A;  4PTS A;  2DBC A;  2NPB A;  4OCF A;  1AIU A;  1ST9 A;  1ZCP A;  1THO A;  2F51 A;  2IMK A;  3IC4 A;  1SL1 B;  3PH9 A;  5DAL B;  2HI7 A;  3IAM 2;  5L71 A;  3Q74 A;  1ZYP A;  4G9H A;  2TRX A;  2YP6 A;  5A5K A;  1V57 A;  1R5P A;  4E8H A;  3KM6 A;  2FGX A;  4PX1 A;  2MBS A;  5DAK B;  3F63 A;  2I81 A;  1A0R P;  4K2X A;  4ISD A;  4MH2 A;  4ILF A;  1UA5 A;  4MPF A;  2B5X A;  5A4W A;  1ERV A;  5FWG A;  2H1B A;  4YKF A;  4ZIJ A;  5CNW A;  4MPG A;  2OE3 A;  2WGR A;  2GDR A;  2H6Y A;  3RAZ A;  1JLW A;  2DKI A;  3CSJ A;  3F4R A;  2P5Q A;  4HZ2 A;  4POM A;  4LMV A;  4V1A g;  2YV7 A;  1TK5 B;  2B1L A;  2YWM A;  4JBB A;  1ERU A;  3OR5 A;  4Q5N A;  3ISO A;  2OE1 A;  4MF6 A;  1TKD B;  3GUR A;  4IQA A;  5LD0 A;  2LST A;  3C7M A;  2N5F A;  1I5G A;  5AGY A;  1XIY A;  1PRX A;  1PQN A;  3APS A;  4GQF A;  1B4Q A;  1AW9 A;  1TRW A;  1B48 A;  5ENU A;  1CQG A;  4FYB A;  2CAI A;  2JZT A;  4Z7X A;  3ZVJ D;  1AAZ A;  2MMZ A;  1Z7P A;  1CQH A;  2GLR A;  1NSW A;  1FO5 A;  6GSV A;  4KW6 A;  5ECL B;  1LJR A;  2VCX A;  1X5C A;  2OBK A;  5B7C A;  2C80 A;  4EF0 A;  4WXT A;  4MK3 A;  2LNS A;  2FY6 A;  5F05 A;  1NM3 A;  4KSM A;  2VD0 A;  3EMX A;  3DVX A;  5AN1 A;  3PIN A;  2WFC A;  1GUL A;  5IQY A;  2BMX A;  1U88 A;  1YQ1 A;  4O5U A;  16GS A;  1TI1 A;  3JCM L;  1I9D A;  1JZR A;  4O5Q A;  5D93 A;  4MZC A;  2HT9 A;  1Z3E A;  4HSC X;  1DE2 A;  3GHA A;  4EDZ A;  2PER A;  4GSN A;  3LWA A;  4L5L A;  4YAV A;  1JZD A;  3DKS A;  4EO3 A;  5IPH A;  1M9A A;  4RQX A;  2PMT A;  2C0F A;  4ECJ A;  5HR1 A;  1M0U A;  5AIX A;  4BVX A;  3QDN A;  5IMD A;  2ALB A;  3BD2 A;  4MJA A;  5DCG A;  3I9V 2;  4J2F A;  3GL3 A;  1SYR A;  3LSZ A;  1S3A A;  1F6M C;  4YQM A;  2PUK C;  2V2G A;  3F8U A;  1GTU A;  1PFO A;  1QFN A;  1M99 A;  4HQS A;  4KDY A;  2VL2 A;  3HVS A;  2GGT A;  1X9W B;  2GQM A;  2DJ0 A;  1M2A A;  1V40 A;  2P31 A;  3E9J B;  1TRS A;  4Q5F A;  3S9F A;  2IIY A;  1ACV A;  3FZA A;  1BYE A;  4CW9 A;  4ZL7 A;  3QFB C;  5DJL A;  1PX7 A;  1S3D A;  3H79 A;  4WEY A;  5IMF A;  3BJ5 A;  1SL0 B;  2AAW A;  1DSB A;  4ID0 A;  1GUM A;  4X4J A;  2WUL A;  2AB6 A;  1XW9 A;  1ZMA A;  4PNG A;  2XBI A;  2LRT A;  5KEJ A;  5ECN B;  3PR8 A;  1EV9 A;  3HKR A;  3LQ7 A;  3ZL5 A;  4I2U A;  2UZ8 A;  2L4Q A;  4GCI A;  3VK9 A;  1GRX A;  1QUW A;  2GST A;  3GH6 A;  2PVO C;  4PNF A;  3A2W A;  1XPV A;  3VWX A;  3L9V A;  3QFA C;  4USS A;  1X9M B;  3FZ5 A;  5J3R A;  2C4J A;  4ZB9 A;  3KH7 A;  3FMW A;  2IJY A;  1JZW A;  3TB2 A;  2FWF A;  2GT5 A;  5DDL A;  3GTU B;  1PGT A;  4N0Z A;  1JZO A;  3UIW A;  5GAN D;  5ECQ B;  1XOB A;  1SL2 B;  3D0Z A;  2H76 A;  4AF2 A;  1G6Y A;  2YV9 A;  3HHV A;  2BJX A;  4KF9 A;  2L57 A;  2QA2 A;  2LJK A;  2FWH A;  3NIV A;  1FOV A;  3KEB A;  1R4W A;  1F9M A;  2CVD A;  1K3Y A;  1BJX A;  4XS1 A;  2O87 A;  3QR6 A;  2JAD A;  2K9F A;  2LNT A;  4OO4 A;  3ZIJ A;  1ILO A;  4XHM A;  1U3A A;  3DYR A;  2M46 A;  4DSS A;  2ON5 A;  2VCZ A;  3GUS A;  2FA8 A;  2AJQ B;  4DEJ A;  1FHE A;  1Z5Y E;  4AJ7 A;  3O76 A;  2I3Y A;  4BWQ A;  2VLV A;  5A4U A;  3WT1 A;  1SKS B;  2VM1 A;  4TN8 A;  1SK2 A;  4AGS A;  4K5S A;  3FZ4 A;  4LL4 B;  5G30 A;  4EC0 A;  1F3A A;  1TXX A;  14GS A;  1GSU A;  2X4A A;  3PPU A;  3EVI A;  2VL9 A;  3LW9 A; 
#chains in the Genus database with same CATH homology
 2AYT A;  4CY8 A;  3UAR A;  3KCM A;  4OMV A;  4AJ8 A;  1Q4J A;  2K6V A;  3GA4 A;  3RPP A;  4IGJ A;  1SK0 A;  3W8S A;  4P3Y B;  13GS A;  4ZL8 A;  3G9B A;  4XIH A;  11GS A;  3FKF A;  3HCZ A;  3TJJ A;  3IR4 A;  1J9B A;  1PX6 A;  1MDI A;  3TOT A;  4IN0 A;  1H4O A;  4GTU A;  4AJ6 A;  4MCU A;  4KSO A;  5CRE A;  5CAX A;  1PN9 A;  2PBJ A;  1GSY A;  6GSW A;  2H6Z A;  1BAY A;  2YPM A;  3EU4 A;  1PN0 A;  5KN0 A;  1G0T A;  22GS A;  2GS3 A;  2EC4 A;  2LUS A;  4IJ3 A;  3I43 A;  4OFM A;  1OE7 A;  1GL8 A;  3FK8 A;  1EP7 A;  3IC8 A;  3VPQ A;  1SU9 A;  4JE1 A;  3MNG A;  2O85 A;  3IDV A;  2H74 A;  2X8C A;  4TR4 A;  3TCO A;  1O81 A;  1JFU A;  1A8Y A;  4MDC A;  3D4T A;  3GL5 A;  4J56 E;  3HVV A;  4KB3 A;  1WWJ A;  2K18 A;  4GWR A;  2LQQ A;  4TR0 A;  3GSS A;  4MJC A;  1HNC A;  2OBI A;  3IA1 A;  1U3I A;  5B6M A;  1F37 A;  4POB A;  2MMN A;  2MMA A;  3D5J A;  4NWY A;  4KE3 A;  3US3 A;  1EOG A;  5IPG A;  2R2J A;  2O8V B;  4GLT A;  4GSS A;  2GZY A;  1R26 A;  1QQ2 A;  2B5Y A;  1TI3 A;  3QAG A;  3APQ A;  2K8V A;  5CRD A;  1VF3 A;  2H01 A;  5H5S A;  3ED3 A;  4LL1 B;  3R3E A;  5F07 A;  4MZW A;  5GZZ B;  1O6J A;  1ON4 A;  4IBP A;  2OAD A;  2H0H A;  4IQ1 A;  2JZR A;  2DKH A;  4V2L A;  5F0G A;  2NBS A;  3HVX A;  6GSY A;  2YJH A;  2FWE A;  1ABA A;  1GWC A;  3GKM A;  3KMO A;  1XVW A;  3G7I A;  1YZX A;  4DSQ A;  2FWG A;  5G1L A;  3WGD A;  1XW5 A;  3F3Q A;  2M72 A;  1T1V A;  1K0O A;  2CZ3 A;  4PUF C;  1YKA A;  4K0G A;  3DD3 A;  4YH2 A;  2DJJ A;  2QKE A;  4XS4 B;  1V2A A;  5ABR A;  2H75 A;  1GUK A;  5DVB A;  3GX8 A;  1K0N A;  3TKS C;  1N8J A;  4ECI A;  3ME8 A;  1PKW A;  2N5A A;  4KDX A;  4D73 A;  3P7X A;  3IHQ A;  3EYT A;  1OC3 A;  2R3X A;  1QGV A;  3P8W A;  5KN1 A;  2A2R A;  2F3M A;  4OD7 A;  4I2T A;  5JCU A;  2QC7 A;  2L59 A;  4ULX A;  3A3T A;  2H70 A;  4NPB A;  5JWQ B;  2GQL A;  4XRD A;  4BVY B;  3HJO A;  3QD9 A;  5D73 A;  2CX4 A;  4ML1 A;  5ECR B;  2FLS A;  4XTS A;  5ELA A;  1MTC A;  3GNJ A;  1Z6N A;  2H1D A;  2A2S A;  1OYJ A;  1WP0 A;  1XWB A;  4IEL A;  1R5A A;  3MIX A;  1TK8 B;  2O7K A;  3UVT A;  1URM A;  5A4V A;  1MDJ A;  2L5L A;  3ZTL A;  5INY A;  3FR9 A;  3V1W A;  2WS2 A;  4NAX A;  5AIS A;  1EOH A;  4IP6 A;  2H73 A;  3TKR A;  1M9B A;  3M8N A;  3GN3 A;  2CQ9 A;  1XWG A;  3BCK A;  1GSQ A;  2FNO A;  3ZRD A;  3L0H A;  1A2J A;  4YAP A;  9GSS A;  4K6X A;  6GSU A;  4YKG A;  5DBQ A;  4K9Z A;  1DE1 A;  3O3T A;  2WCI A;  3F0I A;  2PVQ A;  4WR4 A;  1GNE A;  4TR3 A;  4F0B A;  1B4P A;  3KIJ A;  1VRS D;  4ZIL A;  1SD9 A;  2CT6 A;  4X1U A;  2KUC A;  3H4K A;  2YAN A;  2VUP A;  2YCD A;  2F8A A;  5DCH A;  2JZS A;  2IFQ A;  1SJI A;  3UBK A;  1GNW A;  1KTE A;  2N5B A;  3KP9 A;  4GST A;  4F82 A;  5ECK B;  2H1G A;  3Q18 A;  1W4V A;  5DQS A;  1X5D A;  2JU5 A;  1EWX A;  4NHZ A;  4MA9 A;  3RHB A;  2HFD A;  5HFK A;  3UMA A;  3ZIV A;  2LTK A;  2NTO A;  5G5E A;  5B8A A;  2LKU A;  1SJZ A;  1Z6M A;  1FB0 A;  1RK4 A;  3KTL A;  4H86 A;  4OFT A;  2C3T A;  2VCW A;  2CVB A;  3HZ8 A;  3KTB A;  1TRV A;  5ECM B;  2PN8 A;  2GVP A;  1YEP A;  1A2M A;  2C1Y A;  2AHE A;  4YQV A;  3IPZ A;  2X99 A;  3TUE A;  2LJA A;  3EE2 A;  3Q6O A;  5ID2 B;  5ECS A;  2WRT A;  3L4N A;  4V2N A;  4EE0 A;  4IKH A;  3FR3 A;  1TJD A;  1VGL A;  2VLU A;  3KP8 A;  5IMC A;  1K0D A;  1K3O A;  2R37 A;  18GS A;  1EEM A;  1PL1 A;  1UN2 A;  1WJK A;  2DJK A;  5D96 A;  3LYP A;  2QGV A;  5IMA A;  4TR1 A;  2C0E A;  3HZ4 A;  1MD4 A;  2DC5 A;  3J7Y b;  4K7N A;  2NVL A;  2G0F A;  3M0F A;  4FYC A;  4O92 A;  3O6T A;  3ERG A;  5EVO A;  1AXD A;  1LU4 A;  3EIN A;  4YQU A;  4F0C A;  2XPE A;  5HFG A;  3DGQ A;  2B5E A;  5IMV A;  1OKD A;  3EUR A;  3CTF A;  2R6K A;  1WRY A;  1AQV A;  3GMF A;  3VLN A;  1KEB A;  3BCI A;  2RII A;  2E2M A;  3TJB A;  3GX0 A;  1ZYN A;  4MNN A;  4HZ4 A;  3UAP A;  1A23 A;  4MLY A;  2KP2 A;  4QL9 A;  2WDU A;  1K0B A;  5BRT A;  1ZZY A;  5CYY A;  1ZYE A;  4G0K A;  5HR0 A;  1XXU A;  2YWN A;  1HNA A;  2YOI A;  2PU9 C;  3ZFB A;  4EXJ A;  3HJM A;  1QXH A;  1TU7 A;  3H93 A;  4TRX A;  4TXO B;  2IL3 A;  2XBQ A;  1K0M A;  1OC8 A;  4GXZ A;  2HRN A;  2FCH A;  5ECP B;  1GTB A;  1AQW A;  1THX A;  4G2E A;  2TIR A;  5KOX A;  2YNX A;  1HNB A;  4Z2R A;  2R5G A;  4TW5 A;  1QK8 A;  1YY7 A;  3CSH A;  4EIP A;  3LXZ A;  3EU3 A;  1XWA A;  3P90 A;  1T3B A;  4PQH A;  1HQO A;  4RI7 A;  2F8F A;  2KLX A;  3HD5 A;  5JCW A;  4XS4 A;  4KX4 A;  1UC7 A;  3HYP A;  4BL7 A;  1DUG A;  3L9U A;  5D9W A;  4MF7 A;  1O85 A;  3TRP A;  4BA7 A;  5ECO B;  1ERT A;  5G1K A;  1AC1 A;  1LBK A;  1IYH A;  3KZQ A;  4JRR A;  1GSD A;  3DIE A;  1TU8 A;  1FB6 A;  3CMI A;  1K0C A;  3IOS A;  2HE3 A;  4G0L A;  3GKX A;  3KJY A;  5DAL A;  3SBC A;  3NZN A;  3KMN A;  5IO2 A;  4PUR A;  2GQK A;  3IK7 A;  4KA0 A;  2FA4 A;  4FIW A;  1ERW A;  5COH A;  5DAK A;  1X9S B;  3F3R A;  1RW1 A;  2CVK A;  4HEA 2;  4N11 A;  4NV5 A;  1USB A;  3G7J A;  1YF0 A;  3EMP A;  1JHB A;  2RLI A;  2X49 A;  1NW2 A;  4HU7 A;  5HFI A;  3VI5 A;  1A24 A;  3LFL A;  1GLQ A;  4RQR A;  5FHI A;  2VIM A;  4I6X A;  1TTZ A;  2L5O A;  4ICY A;  4KAE A;  2X8G A;  4IS0 A;  3C71 A;  4J57 E;  1HD2 A;  2GSS A;  3F4T A;  1PSQ A;  2H30 A;  4L0U A;  2D2Z A;  5J4U A;  4E8E A;  4N10 A;  3FZ9 A;  3LOR A;  3GKK A;  4BWS A;  1BG5 A;  4G0I A;  5HR2 A;  3QPM A;  2VL3 A;  3N5O A;  2CV4 A;  5IMZ A;  1WPI A;  3MSZ A;  1GSE A;  4IP1 A;  5KN3 A;  3LJR A;  3LEF A;  3M9J A;  3GH9 A;  4N30 A;  2LV3 A;  3EC3 A;  5F8B A;  2OKA A;  1OE8 A;  2HSH A;  3FYG A;  4JZQ A;  4V2M A;  4JR4 A;  3TJF A;  1G6W A;  3APO A;  4BVX B;  1TOF A;  4KUN A;  2PPT A;  5D9V A;  1FOH A;  1OC9 B;  2YWI A;  2YWO A;  1YKC A;  1J0F A;  4PGT A;  1ML6 A;  3DEX A;  2X64 A;  3FRC A;  5JWR B;  3DML A;  1EV4 A;  2HNL A;  4CDO A;  1EEJ A;  3RBT A;  2I4A A;  4MH3 A;  5G5F A;  4NXI A;  1OVN A;  3VWU A;  1Z7R A;  3FHK A;  3MAK A;  6GSS A;  3BBY A;  4IVF A;  4ZBB A;  5ID2 A;  1PL2 A;  4ZXG A;  1GUH A;  4F2I A;  4DSR A;  2K8S A;  1XOA A;  4RI6 A;  2DJ3 A;  1GP1 A;  1W89 A;  4MJB A;  4CY6 A;  3ZML A;  4KH7 A;  1SEN A;  3ZRE A;  2IMD A;  4XRA A;  2IN3 A;  1PD2 1;  2NDO A;  5D9X A;  2H71 A;  1TDI A;  5D9T A;  1M2B A;  2L6D A;  3W6G A;  4KCE A;  4ZB8 A;  1O73 A;  2HSM A;  5J9B A;  2HRA A;  2CX3 A;  5LNK e;  5B8B A;  4OCE A;  2LS5 A;  3PGT A;  4LA1 A;  1HYU A;  2H0G A;  2HZE B;  4K5R A;  5JCG A;  3QAV A;  5C04 A;  1B9Y C;  4DVC A;  2DIZ A;  1BX9 A;  3W8J A;  3C1S A;  2XPD A;  2X8H A;  3QMX A;  4ML6 A;  3VI7 A;  5CRW A;  3CYN A;  3GIX A;  4I8B A;  2B7K A;  3C73 A;  4JR6 A;  3HXS A;  2LRC A;  2MYG A;  5BMU A;  4MF5 A;  3J7Y k;  3A2V A;  5D8I A;  1MEK A;  3U6V A;  1WE0 A;  2QSI A;  1ZOF A;  3QCP A;  1ZL9 A;  4FO5 A;  1GTA A;  3F4S A;  3A5W A;  4F03 A;  4IHU A;  2R0P A;  4V1A p;  4O5R A;  3EWL A;  3M3M A;  20GS A;  2IMI A;  3KGK A;  4DSS B;  5IOW A;  4TXV A;  5HQP A;  1YDK A;  4Z2U A;  5IM9 A;  4HS1 A;  3GTU A;  4MJE A;  4L8E A;  4PQ1 A;  1XVQ A;  3M1G A;  5J9C A;  3TOU A;  1T4Z A;  2HZF A;  1VF4 A;  4Q5Q A;  5IO0 A;  4K8M A;  5C00 A;  1FAA A;  5DQY A;  1QMV A;  3C8E A;  2KP1 A;  3WGE A;  4TOP A;  2VM2 A;  2GZP A;  1SKW B;  2RUE A;  2JSZ A;  3SWL A;  2H66 A;  4L0W A;  1MD3 A;  1XBS A;  10GS A;  1TRU A;  4O32 A;  2VLT A;  3VPT A;  3EPT A;  2JSY A;  2OA7 A;  2VL2 C;  4NHW A;  3MWH A;  1JLV A;  4HJ2 A;  17GS A;  1BED A;  3FY7 A;  4EVM A;  2L4C A;  4MAB A;  2KOK A;  5G2Z A;  4ECC A;  1Z9H A;  1SKR B;  3CSI A;  2DJ1 A;  4WF4 A;  3A2X A;  2I9H A;  2JL4 A;  3G7Y A;  3TKQ A;  4WET A;  5KN2 A;  5LCZ A;  3TKS A;  1XW6 A;  2IWT A;  1UVZ A;  1ZYQ B;  2A4V A;  3CRU A;  2M80 A;  4O7H A;  4QQ7 A;  2AV4 A;  1YEX A;  2B6M A;  1AUC A;  3E0U A;  3ZLP A;  2C3Q A;  2IPA A;  3GST A;  3QAW A;  1R7H A;  2OAC A;  2GSR A;  1MDK A;  2XC2 A;  3HJP A;  3UJ1 A;  3NOF A;  3BOA A;  1Q98 A;  3UOM A;  4IJI A;  2WZ9 A;  4PUA A;  4K2D A;  5DJM A;  3RPN A;  5J41 A;  4HI7 A;  3H8Q A;  2WJU A;  1ZGN A;  4ZBD A;  2RUF A;  3GFK A;  3WD6 A;  2V32 A;  5FT3 A;  1OKT A;  4KGI A;  1EZK A;  2GSQ A;  2HYX A;  1A2L A;  3Q19 A;  1SK1 A;  3TRQ A;  2KHP A;  2RM6 A;  3E3E A;  1EGR A;  4F9Z A;  2LRN A;  2P0G A;  2EIR A;  2YN1 A;  4L5O A;  5IOX A;  3DWV A;  2DMM A;  4KCA A;  2EIO A;  2ON7 A;  1Y6E A;  3RDW A;  3FR6 A;  4WBR D;  4HDE A;  1F2E A;  4LLR A;  1OC9 A;  3ERW A;  3A5I A;  5G31 A;  2HRK A;  4EIQ A;  3ME7 A;  4X0X A;  3UBL A;  1IYI A;  3DRN A;  2AUV A;  5B6N A;  3I69 A;  5ECI B;  3TJG A;  3LXT A;  4PQI A;  2REM A;  5CRH A;  3WYW A;  4ZB6 A;  1GTI A;  4JED A;  2HRF A;  2PGT A;  2YZH A;  4LMW A;  2EIQ A;  2OJL A;  2VO4 A;  3RHC A;  3KH9 A;  3GKN A;  3WGX A;  2PWJ A;  3LYK A;  5EY6 A;  1OAZ A;  2RM5 A;  2V6K A;  2V1M A;  3CTG A;  3D4M A;  2H19 A;  4GF0 A;  2J23 A;  2FD3 A;  2DML A;  2F9S A;  1SD8 A;  1YF1 A;  1KNG A;  4D73 B;  4ZL9 A;  2DSA A;  2I1U A;  1H75 A;  4MP4 A;  2LEG A;  3GV1 A;  4HU9 A;  1XWK A;  3UEM A;  3D6I A;  3D21 A;  2YZU A;  4ACS A;  2HLS A;  1E2Y A;  2IME A;  1K3L A;  1E6B A;  2OE0 A;  4HJM A;  5GAP D;  2O89 A;  1A8L A;  4IW9 A;  4K1F A;  1XFL A;  2ZCT A;  3GRX A;  2VD1 A;  2TRC P;  4MMM A;  2VOC A;  4RUV A;  2QA1 A;  2HZE A;  2HSY A;  3TDG A;  3ZZX A;  5JWO B;  5IIZ A;  2R0G A;  3AY8 A;  5CP1 A;  4HUA A;  3FW2 A;  3CBU A;  2ZUP A;  4GQC A;  1M2D A;  2H72 A;  3IBH A;  3VWW A;  2CA8 A;  5J5N A;  4ZBA A;  3HY2 A;  7GSS A;  1V9W A;  1M7T A;  3MDK A;  1U87 A;  4MZB A;  1T7P B;  4G19 A;  1FG4 A;  3HDC A;  4POL A;  1XCC A;  2MBT A;  1GH2 A;  2GTU A;  3GYK A;  4Q5R A;  4I97 A;  1O8W A;  4BVY A;  1O7U A;  4OWY A;  3VUR A;  2C0G A;  5KOW A;  3DXB A;  2Z9S A;  2VCV A;  3MYD A;  1PMT A;  5E4W A;  1SJ6 A;  4BPY A;  1K0A A;  4PXO A;  3R2Q A;  4KDU A;  3IXR A;  1FW1 A;  4WR5 A;  2GZZ A;  4FYU A;  4NMU A;  1B8X A;  1B9X C;  4WKW A;  3TGZ A;  2C8U A;  3D22 A;  1KBN A;  3HA9 A;  3ZMK A;  2P5R A;  2C3N A;  3K8N A;  3LGC A;  5F06 A;  3WT2 A;  2H1A A;  2DJ2 A;  2XHF A;  2IFQ B;  2H8L A;  1TP9 A;  4EL1 A;  4QL7 A;  3KD0 A;  1N2A A;  3IK9 A;  3UL3 A;  3VFI A;  3FEU A;  1TW9 A;  3TJK A;  2A2P A;  2ES7 A;  3ZVJ A;  4A5P A;  3IE3 A;  1A0F A;  4GRF A;  2R0C A;  1GSS A;  1RQM A;  4K7I A;  4OFN A;  4K7O A;  4KND A;  3L9S A;  2IMF A;  4Z2T A;  2H0I A;  1TK0 B;  4HOJ A;  4I5Q A;  2FUG 2;  3H1N A;  5H5R A;  1C72 A;  3TKP A;  2L6C A;  1VF1 A;  6GSX A;  1WOU A;  2WB9 A;  3F6D A;  1T8E B;  2B3S A;  3ZFL A;  2VCT A;  1Y25 A;  3CRT A;  3LG6 A;  1V58 A;  2CAQ A;  3VWV A;  2VCQ A;  3IHG A;  1G7O A;  1XWC A;  2V6O A;  1F3B A;  4EKZ A;  4TR1 B;  4TVE A;  5CO3 A;  4N0V A;  4ECB A;  12GS A;  1EP8 A;  3ERF A;  1WIK A;  2B7J A;  3CXG A;  1PA3 A;  5E59 A;  5HR3 A;  3N9J A;  1J08 A;  2JAC A;  1VF2 A;  2J9H A;  4HQZ A;  4WBJ A;  1T00 A;  2LJR A;  1NHO A;  4G10 A;  4X43 A;  1SYX A;  5ECH B;  1S3C A;  1X0R A;  2MZC A;  3IV4 A;  1AQX A;  1YJ6 A;  2CZ2 A;  4CHS A;  4NV2 A;  2E2G A;  4TKY A;  3UVH A;  4K0N A;  5CRG A;  1T4Y A;  5GST A;  1PKZ A;  2E7P A;  5AIV A;  3C1R A;  1U6T A;  2LQO A;  6GST A;  2GT6 A;  2YJ7 A;  5H5Q A;  3KXO A;  2A4H A;  3TRX A;  2B1K A;  4POK A;  3M9K A;  1GSF A;  1FVJ A;  4OO5 A;  1V98 A;  1G7E A;  3U5R E;  2C0D A;  8GSS A;  3ZYW A;  1DBY A;  4FQU A;  3IAS 2;  3TKS E;  1WMJ A;  3F6F A;  1FVK A;  4EUY A;  1XZO A;  1BQ7 A;  3P2A A;  5EPF A;  3F9U A;  1X5E A;  3L78 A;  2HXK A;  2VAF A;  4EDY A;  2R4V A;  5GSS A;  1EGO A;  1GLP A;  4JU5 A;  2V41 A;  2ZNM A;  2E0Q A;  2H6X A;  5ELG A;  4WF5 A;  2DIY A;  3IRA A;  2MMO A;  3DVW A;  3I6A A;  2BTO T;  2DLX A;  4XCS A;  3ZIT A;  19GS A;  4BL7 B;  2FHE A;  1NHY A;  4XS6 A;  2G2Q A;  3QOU A;  4FH8 A;  5EL8 A;  4TXO A;  1O8X A;  4PTS A;  2DBC A;  2NPB A;  4OCF A;  1AIU A;  1ST9 A;  1ZCP A;  1THO A;  2F51 A;  2IMK A;  3IC4 A;  1SL1 B;  3PH9 A;  5DAL B;  2HI7 A;  3IAM 2;  5L71 A;  3Q74 A;  1ZYP A;  4G9H A;  2TRX A;  2YP6 A;  5A5K A;  1V57 A;  1R5P A;  4E8H A;  3KM6 A;  2FGX A;  4PX1 A;  2MBS A;  5DAK B;  3F63 A;  2I81 A;  1A0R P;  4K2X A;  4ISD A;  4MH2 A;  4ILF A;  1UA5 A;  4MPF A;  2B5X A;  5A4W A;  1ERV A;  5FWG A;  2H1B A;  4YKF A;  4ZIJ A;  5CNW A;  4MPG A;  2OE3 A;  2WGR A;  2GDR A;  2H6Y A;  3RAZ A;  1JLW A;  2DKI A;  3CSJ A;  3F4R A;  2P5Q A;  4HZ2 A;  4POM A;  4LMV A;  4V1A g;  2YV7 A;  1TK5 B;  2B1L A;  2YWM A;  4JBB A;  1ERU A;  3OR5 A;  4Q5N A;  3ISO A;  2OE1 A;  4MF6 A;  1TKD B;  3GUR A;  4IQA A;  5LD0 A;  2LST A;  3C7M A;  2N5F A;  1I5G A;  5AGY A;  1XIY A;  1PRX A;  1PQN A;  3APS A;  4GQF A;  1B4Q A;  1AW9 A;  1TRW A;  1B48 A;  5ENU A;  1CQG A;  4FYB A;  2CAI A;  2JZT A;  4Z7X A;  3ZVJ D;  1AAZ A;  2MMZ A;  1Z7P A;  1CQH A;  2GLR A;  1NSW A;  1FO5 A;  6GSV A;  4KW6 A;  5ECL B;  1LJR A;  2VCX A;  1X5C A;  2OBK A;  5B7C A;  2C80 A;  4EF0 A;  4WXT A;  4MK3 A;  2LNS A;  2FY6 A;  5F05 A;  1NM3 A;  4KSM A;  2VD0 A;  3EMX A;  3DVX A;  5AN1 A;  3PIN A;  2WFC A;  1GUL A;  5IQY A;  2BMX A;  1U88 A;  1YQ1 A;  4O5U A;  16GS A;  1TI1 A;  3JCM L;  1I9D A;  1JZR A;  4O5Q A;  5D93 A;  4MZC A;  2HT9 A;  1Z3E A;  1DE2 A;  3GHA A;  4EDZ A;  2PER A;  4GSN A;  3LWA A;  4L5L A;  4YAV A;  1JZD A;  3DKS A;  4EO3 A;  5IPH A;  1M9A A;  4RQX A;  2PMT A;  2C0F A;  4ECJ A;  5HR1 A;  1M0U A;  5AIX A;  4BVX A;  3QDN A;  5IMD A;  2ALB A;  3BD2 A;  4MJA A;  5DCG A;  3I9V 2;  4J2F A;  3GL3 A;  1SYR A;  3LSZ A;  1S3A A;  1F6M C;  4YQM A;  2PUK C;  2V2G A;  3F8U A;  1GTU A;  1QFN A;  1M99 A;  4HQS A;  4KDY A;  2VL2 A;  3HVS A;  2GGT A;  1X9W B;  2GQM A;  2DJ0 A;  1M2A A;  1V40 A;  2P31 A;  3E9J B;  1TRS A;  4Q5F A;  3S9F A;  2IIY A;  1ACV A;  3FZA A;  1BYE A;  4CW9 A;  4ZL7 A;  3QFB C;  5DJL A;  1PX7 A;  1S3D A;  3H79 A;  4WEY A;  5IMF A;  3BJ5 A;  1SL0 B;  2AAW A;  1DSB A;  4ID0 A;  1GUM A;  4X4J A;  2WUL A;  2AB6 A;  1XW9 A;  1ZMA A;  4PNG A;  2XBI A;  2LRT A;  5KEJ A;  5ECN B;  3PR8 A;  1EV9 A;  3HKR A;  3LQ7 A;  3ZL5 A;  4I2U A;  2UZ8 A;  2L4Q A;  4GCI A;  3VK9 A;  1GRX A;  1QUW A;  2GST A;  3GH6 A;  2PVO C;  4PNF A;  3A2W A;  1XPV A;  3VWX A;  3L9V A;  3QFA C;  4USS A;  1X9M B;  3FZ5 A;  5J3R A;  2C4J A;  4ZB9 A;  3KH7 A;  3FMW A;  2IJY A;  1JZW A;  3TB2 A;  2FWF A;  2GT5 A;  5DDL A;  3GTU B;  1PGT A;  4N0Z A;  1JZO A;  3UIW A;  5GAN D;  5ECQ B;  1XOB A;  1SL2 B;  3D0Z A;  2H76 A;  4AF2 A;  1G6Y A;  2YV9 A;  3HHV A;  2BJX A;  4KF9 A;  2L57 A;  2QA2 A;  2LJK A;  2FWH A;  3NIV A;  1FOV A;  3KEB A;  1R4W A;  1F9M A;  2CVD A;  1K3Y A;  1BJX A;  4XS1 A;  2O87 A;  3QR6 A;  2JAD A;  2K9F A;  2LNT A;  4OO4 A;  3ZIJ A;  1ILO A;  4XHM A;  1U3A A;  3DYR A;  2M46 A;  4DSS A;  2ON5 A;  2VCZ A;  3GUS A;  2FA8 A;  2AJQ B;  4DEJ A;  1FHE A;  1Z5Y E;  4AJ7 A;  3O76 A;  2I3Y A;  4BWQ A;  2VLV A;  5A4U A;  3WT1 A;  1SKS B;  2VM1 A;  4TN8 A;  1SK2 A;  4AGS A;  4K5S A;  3FZ4 A;  4LL4 B;  5G30 A;  4EC0 A;  1F3A A;  1TXX A;  14GS A;  1GSU A;  2X4A A;  3PPU A;  3EVI A;  2VL9 A;  3LW9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...