2B1LA

Crystal structure of n-terminal 57 residue deletion mutant of e. coli ccmg protein(residues 58-185)
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
128
structure length
128
Chain Sequence
MQFYQADVLTQGKPVLLNVWATWCPTCRAEHQYLNQLSAQGIRVVGMNYKDDRQKAISWLKELGNPYALSLFDGDGMLGLDLGVYGAPETFLIDGNGIIRYRHAGDLNPRVWEEEIKPLWEKYSKEAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Thiol:disulfide interchange protein dsbE
publication title Crystal structures of E. coli CcmG and its mutants reveal key roles of the N-terminal beta-sheet and the fingerprint region
pubmed doi rcsb
source organism Escherichia coli
total genus 38
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-09-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2b1lA00
1TJDA 4XRDA 4JEDA 3ZREA 3KXOA 2J23A 1OE8A 3HCZA 2V41A 4GTUA 4WXTA 5CRDA 1RQMA 1SK1A 5F0GA 1FB0A 1X5DA 2DJ2A 3F6DA 1WPIA 2VL3A 3H79A 4FYUA 2O87A 3I9V2 4KSMA 4FO5A 1GSUA 1ERTA 2VLUA 3H1NA 4WEYA 4HS1A 3TRXA 2G0FA 3FR6A 1XXUA 17GSA 4MZCA 1FVKA 1OKDA 1KEBA 1U88A 3UBLA 5J4UA 1JZWA 4H86A 1AW9A 2C3TA 2CAIA 1G7EA 1U3IA 4IP1A 4MH2A 3D6IA 4OMVA 6GSUA 4MF6A 2DJ0A 4PX1A 1F9MA 5FT3A 3W6GA 1XW6A 4OWYA 1MD3A 1OC3A 1PN9A 4KA0A 4V1Ap 4Q5NA 3A2XA 2XC2A 4K7NA 1OE7A 4L5LA 1RK4A 2B6MA 4IP6A 3WT1A 5IPHA 5IIZA 5CP1A 2ZCTA 3FHKA 3E9JB 2H01A 3GX8A 1XCCA 1GL8A 3QAVA 1XVQA 1W89A 2HRFA 5ID2A 3HHVA 2WCIA 1PQNA 3FEUA 1S3CA 2O85A 4GF0A 4MABA 4YAVA 4RQRA 1SJIA 3F4RA 3TRPA 1A23A 2QGVA 2VD0A 4XIHA 2C3QA 4DSSB 4RI7A 5JWOB 5EVOA 14GSA 4EC0A 4MJBA 1DBYA 2WB9A 4MH3A 4K1FA 4MF5A 4TRXA 4DSSA 6GSWA 2MBTA 3D22A 5J9BA 1ILOA 3TGZA 3HVVA 3ZIVA 2GZZA 19GSA 1J9BA 3EU3A 1SK0A 3HZ8A 3GKKA 1ZYQB 2PN8A 2KOKA 2IPAA 3MDKA 1JZDA 3D4TA 3M9JA 3H4KA 2YJHA 1FB6A 2OBIA 3RDWA 1GTUA 2HLSA 2H1AA 2VL9A 4L0UA 1XWGA 2VIMA 1GUHA 3LQ7A 1XBSA 1A0RP 1FOVA 4WR5A 4LLRA 3Q19A 1QMVA 1YEXA 4F2IA 2JL4A 1VF1A 3TKQA 4Z7XA 4HZ4A 2YWIA 2JSZA 2DJKA 2JU5A 2X8GA 1VF4A 4RI6A 2HNLA 2VL2C 3IAS2 2IMFA 3GURA 2V6KA 2LV3A 2C0DA 1EEJA 3E0UA 5DVBA 1T1VA 3EVIA 2GT5A 1PX6A 5IMFA 12GSA 2GSSA 1TRSA 2DC5A 3BD2A 4N0ZA 5CRWA 2AV4A 2YV7A 4NAXA 3WYWA 4KGIA 1YZXA 2GZPA 4EUYA 3F4SA 4OFTA 3QR6A 5A5KA 2MMAA 1VF3A 2EIOA 1XPVA 3APOA 1V57A 2H19A 2CQ9A 5C04A 1SKWB 2X64A 11GSA 4AF2A 2D2ZA 4TXOB 3TKRA 1GULA 3KMOA 2IMKA 3IE3A 4MDCA 3ZIJA 1QUWA 3G9BA 1R7HA 5ELAA 1HYUA 2CVKA 3GIXA 4TXOA 5EY6A 4JRRA 5CRHA 16GSA 1K0AA 3DGQA 2E0QA 6GSVA 1SENA 3QPMA 1EGOA 2WRTA 5DAKA 5J9CA 1WJKA 3BCKA 3M9KA 5CREA 4EKZA 2B5XA 1SL2B 2VCVA 3SBCA 2O8VB 1QQ2A 4ZBBA 3LORA 3E3EA 3IBHA 3HYPA 3APQA 2G2QA 4KDYA 1K0CA 1ZL9A 1PL2A 1O73A 2F51A 1TW9A 1K3YA 2O7KA 3UARA 1DSBA 3TB2A 2GGTA 2VCZA 1XOBA 3GRXA 2GQLA 1MD4A 1R5AA 4ZB6A 4EL1A 5INYA 3C73A 1G0TA 1G7OA 3Q18A 4XHMA 2IJYA 2EIRA 1SJZA 4E8EA 4ZBAA 3KD0A 3K8NA 1M9BA 3ZVJA 4WETA 4OD7A 3VWUA 1SKSB 4K8MA 2YN1A 5FWGA 5JCWA 4PQ1A 5CRGA 1M99A 1XWKA 3RAZA 1H4OA 3G7JA 2LJAA 1K0BA 3QDNA 3UVTA 4IW9A 5KEJA 3C1RA 2LRCA 4MP4A 2KUCA 3GMFA 5AIXA 3MNGA 1UN2A 2H6YA 3LYPA 5IO2A 2FWEA 4LMWA 3GL5A 2L57A 3EINA 4TVEA 2LUSA 3ERFA 1A8YA 3M3MA 3BCIA 3CBUA 4NWYA 3CRUA 4G2EA 5HR0A 3DWVA 3LWAA 5ECHB 1S3DA 2N5BA 3HY2A 3LYKA 3NOFA 2C1YA 1E2YA 1WWJA 4WKWA 4HQZA 4ILFA 3KJYA 2YNXA 1FAAA 1N2AA 4TR3A 3KP9A 2H71A 4ZL7A 2H72A 1ZOFA 3F9UA 3KZQA 1EOGA 1V2AA 2TRXA 1PRXA 2FA4A 1EV4A 1Z6NA 5A4WA 5CNWA 1BEDA 4BVYA 4IKHA 2OKAA 3V1WA 1K0NA 2LNSA 4K9ZA 2VD1A 3DVWA 1DE1A 1XWBA 1UA5A 3EWLA 4V1Ag 9GSSA 1GWCA 4KUNA 3GHAA 2VM2A 5C00A 1EV9A 1EZKA 1Q4JA 3HJPA 1B9XC 2KP2A 4ZIJA 5ENUA 4QL7A 3VLNA 3ZTLA 1EWXA 2C0GA 1OKTA 2WJUA 1GSFA 5DCGA 3GX0A 2YP6A 4ULXA 3TDGA 2YJ7A 2HYXA 4EF0A 4EO3A 4HDEA 5GZZB 1TRUA 1CQHA 3WGXA 1XVWA 1USBA 1CQGA 3NIVA 1B4QA 3WD6A 1GSDA 2LRTA 1KNGA 1TOFA 2DJ1A 3W8JA 2VM1A 3SWLA 1TRWA 1XW9A 1YJ6A 2LTKA 2O89A 3TKSA 4IQAA 3ZL5A 1U6TA 1WP0A 5JCUA 2C4JA 4LL4B 3TUEA 2DSAA 2CX4A 5DQSA 5H5QA 3GSSA 1URMA 2IWTA 5DJLA 4DSRA 2P5RA 1SK2A 3ERWA 5F8BA 2AJQB 1NSWA 2MMOA 2OJLA 1YDKA 3HVSA 2PVQA 2RM6A 1HNCA 2KHPA 2NDOA 3C7MA 4GRFA 3FK8A 1J08A 5LD0A 2HZEB 4NMUA 2FD3A 1NHOA 4F0BA 4MPGA 4NXIA 3C1SA 3GKMA 1O6JA 4NV5A 4DEJA 2B1LA 3I6AA 1TK8B 3JCML 4YQVA 1MEKA 2DMMA 3C8EA 3L9UA 2PBJA 4IBPA 3FZAA 4NHZA 2YWOA 2XPEA 4MJEA 4Q5RA 2IMDA 2L6DA 3L0HA 3ZITA 2FWHA 5IPGA 1ZMAA 4CHSA 5HR2A 5AIVA 5CO3A 3IOSA 2FLSA 3U5RE 3HVXA 2YCDA 4KAEA 1XWAA 2YWMA 3IPZA 1GH2A 5DALB 2FA8A 2QC7A 3DEXA 5D73A 4G9HA 3F63A 3D4MA 2V2GA 2H73A 2ZUPA 1SD9A 2H1GA 5D9VA 5GAND 4XS4B 1F3BA 5HQPA 4K0GA 1MTCA 4JR4A 4GWRA 1ZCPA 4XS4A 2L5LA 4V2LA 4JR6A 5JWQB 4N0VA 2IMIA 4HI7A 3DD3A 1PKZA 1OVNA 2MMNA 3HZ4A 1T8EB 1GTIA 3PINA 3BBYA 1I9DA 3RPPA 3FR9A 4OO5A 2R5GA 3IAM2 4X1UA 4FYBA 2CV4A 2GQMA 1JLWA 3OR5A 5JCGA 1B48A 4O7HA 4WF4A 3UIWA 1O81A 2XBQA 3P90A 2ALBA 1O8XA 3FZ9A 2RIIA 2F9SA 2R3XA 2V32A 4TOPA 2B7JA 4I6XA 2HSYA 1NM3A 4F9ZA 2OACA 3VPTA 2GSRA 3KH9A 3L78A 1XWCA 1Z9HA 3C71A 3TJBA 4RUVA 3NZNA 2WZ9A 4PURA 1IYHA 2IFQB 4YQUA 2IN3A 2LQQA 1TI3A 4MPFA 3GV1A 4LMVA 1X9MB 1M2DA 5G31A 1HNBA 2L59A 2N5FA 4IS0A 3FKFA 2VCTA 2DLXA 3KP8A 2L4CA 4HJ2A 3KTLA 2EC4A 3EMXA 1AIUA 1PD21 4IELA 1W4VA 3RHBA 2Z9SA 5HFKA 1MDKA 2KP1A 5J3RA 1A0FA 3A5WA 5IMAA 1R4WA 1K3LA 1EGRA 2GLRA 2WDUA 3QMXA 5AGYA 2GS3A 1SYRA 5B7CA 2LNTA 1RW1A 1T4YA 1PSQA 1X5CA 4IN0A 5L71A 3GFKA 3TCOA 3IHQA 4YAPA 4HEA2 4J56E 1ZYEA 3FW2A 18GSA 4BPYA 1B9YC 2VLTA 1TU7A 3H8QA 4CW9A 4HU9A 2CVBA 4PUAA 2LRNA 3GYKA 4RQXA 2CAQA 2DBCA 1DUGA 2GVPA 2TRCP 2FNOA 2C3NA 2PWJA 2F8FA 4KX4A 4J2FA 2RLIA 3IK7A 5A4UA 1XFLA 5ABRA 5IMDA 4V2MA 2X99A 2ZNMA 2ON5A 4IJ3A 2PU9C 5JWRB 4KW6A 1OAZA 1EOHA 1NHYA 1Z3EA 3ZLPA 2M80A 1TRVA 3I69A 2AB6A 2OADA 3PR8A 4BVXA 5D9TA 1AXDA 3HXSA 1SKRB 5F05A 5DJMA 4POMA 4YH2A 5D9XA 4I5QA 5F07A 4ZILA 1VRSD 2VCWA 4EDYA 2RM5A 3ED3A 2A2SA 2PGTA 4WF5A 3F0IA 3AY8A 4KCAA 3ZFLA 3GSTA 2NPBA 2YOIA 2LS5A 3VI7A 1GNEA 4J57E 2HFDA 3UVHA 2A4VA 3M0FA 4EE0A 1A8LA 2H75A 1KTEA 5F06A 4AJ8A 1ZZYA 1HNAA 1K0OA 2YZHA 3GA4A 2BJXA 3U6VA 1FG4A 4E8HA 3I43A 4XS1A 3DVXA 2C8UA 4X0XA 4AJ6A 13GSA 2GQKA 3IC4A 1R5PA 4POKA 3F3QA 2FCHA 5G5EA 3F6FA 3UAPA 1PL1A 1M2BA 3IK9A 1X9SB 3DYRA 3KIJA 5D8IA 5GAPD 3UBKA 2DJJA 3FYGA 5J41A 1AQXA 2GTUA 1U87A 2FHEA 4K2DA 3F4TA 1TKDB 4PXOA 1SJ6A 1B4PA 2PUKC 2V1MA 1BG5A 1T7PB 1GLPA 1QK8A 5H5SA 3KTBA 3TRQA 1XOAA 1M7TA 1S3AA 2M46A 2R4VA 4EVMA 4X43A 1F37A 3GKXA 4MJAA 3TKSE 3DKSA 2H30A 5DQYA 3RHCA 3VWXA 4N11A 2F3MA 2X8CA 3LEFA 2ON7A 3IA1A 2WGRA 1O8WA 4TN8A 2HT9A 3EE2A 2JACA 1JLVA 3CSJA 2B3SA 5B6NA 3LXTA 2P31A 1M9AA 2RUFA 4ZL9A 1FHEA 4K6XA 2R2JA 2AAWA 3H93A 5ECSA 3M1GA 5ECOB 1YY7A 3R2QA 4JZQA 1WRYA 3CMIA 2FUG2 5HR3A 4TR1B 1U3AA 2YANA 1FO5A 4KH7A 2OE3A 2LJKA 4TR1A 1EP8A 3DRNA 3TOTA 5ELGA 4NHWA 3F8UA 2MZCA 5ECNB 5G2ZA 4ZBDA 3RBTA 1YF0A 2V6OA 1YEPA 1ON4A 2XBIA 3P7XA 1DE2A 2CA8A 2JADA 1JFUA 3KH7A 1ACVA 3M8NA 4IJIA 4GQFA 1OC8A 1TK5B 3ZMLA 1GSSA 1GSYA 3GH6A 3GNJA 2FWGA 2PMTA 3BOAA 1PX7A 2KLXA 2JZRA 3VK9A 4BA7A 2CX3A 3APSA 5ECQB 2BTOT 4DSQA 1TK0B 1X0RA 3DXBA 5E59A 4IGJA 1J0FA 1WIKA 1GUMA 1HQOA 3LG6A 1PGTA 3N9JA 2B1KA 1OC9B 2VCXA 3BJ5A 5J5NA 1ZGNA 7GSSA 2XPDA 4P3YB 1GNWA 3LJRA 2GSQA 1V40A 3D5JA 4KE3A 1BQ7A 1Y25A 3EMPA 4O32A 2B7KA 4HZ2A 2H76A 4N10A 1H75A 3GH9A 3P8WA 4HU7A 2WS2A 4FYCA 4NPBA 2MMZA 5LCZA 1THOA 2B5EA 4L0WA 3IRAA 3L4NA 4OFNA 1X9WB 1C72A 2HZEA 5G1KA 5KN1A 1O7UA 3VURA 5ECMB 3VFIA 4YQMA 2C80A 4KSOA 2VCQA 3KMNA 3TKSC 3CRTA 3O6TA 1BJXA 3QAWA 1G6WA 1VGLA 2I81A 1AAZA 3MWHA 4LA1A 3VPQA 3LSZA 4ZB8A 2OBKA 3HA9A 5HR1A 4PNFA 5CYYA 3GTUB 1MDJA 4CDOA 1YF1A 4NV2A 1AQWA 5AISA 4K0NA 3A3TA 6GSYA 3DIEA 3GTUA 1AC1A 4G19A 2K9FA 2NTOA 1K3OA 2HE3A 5ECPB 5B8BA 4JE1A 5DALA 1TI1A 3EU4A 1Z5YE 3L9SA 1XW5A 2L5OA 3CSHA 2QSIA 1PMTA 1ABAA 1JZRA 1T00A 3RPNA 2HZFA 1WE0A 1T4ZA 5ID2B 2N5AA 2AYTA 2H0GA 2WFCA 2R6KA 1EP7A 5IOXA 3ZFBA 1UC7A 1E6BA 1THXA 5G30A 3UOMA 4GLTA 1SL1B 4F0CA 3FZ5A 4GSTA 2H66A 3ZMKA 3GUSA 1FVJA 4XTSA 4N30A 3EC3A 5HFIA 1GUKA 4KDUA 4V2NA 3W8SA 3WGEA 1M0UA 5ECIB 4PQIA 4BWQA 2M72A 1G6YA 3VI5A 4PUFC 2H74A 1OYJA 4HJMA 3DMLA 1IYIA 2C0FA 1BX9A 2VL2A 5EL8A 3ZZXA 3G7IA 4PQHA 3KEBA 4MCUA 1SYXA 1XZOA 2HSHA 4MLYA 5DDLA 4D73B 5D93A 4KDXA 4G10A 1HD2A 3A2VA 5ECKB 2FWFA 3GKNA 2LKUA 2E2MA 4D73A 3IDVA 5ECRB 2IFQA 5DCHA 4POBA 4L8EA 3GN3A 2DMLA 2GDRA 5H5RA 3MAKA 5GSTA 1YKAA 4MMMA 2RUEA 1V58A 3HDCA 4HUAA 2LJRA 3D0ZA 2K8SA 1A2JA 3KGKA 3WT2A 5KN2A 5B6MA 6GSSA 1GLQA 2P5QA 1PA3A 5B8AA 8GSSA 4GSNA 2GT6A 4ML6A 4AGSA 4TW5A 3GL3A 3IR4A 3QFBC 1YKCA 1GSEA 2WULA 1TP9A 2H6XA 5G1LA 20GSA 1GTAA 5E4WA 1Z7RA 5IO0A 3QAGA 3EURA 3ME8A 1EEMA 1T3BA 3PH9A 3TJFA 1UVZA 2H0IA 4Q5FA 3IXRA 4JBBA 6GSXA 4XCSA 2CZ3A 4KB3A 2L4QA 5DBQA 1YQ1A 3HJMA 4MK3A 2OE0A 2LSTA 5IMZA 2HI7A 2IL3A 2JSYA 1ST9A 1A24A 4IQ1A 4DVCA 3VWVA 3CXGA 4GQCA 1LJRA 2VUPA 1VF2A 1F2EA 1SU9A 3D21A 4BL7A 2XHFA 3FZ4A 5COHA 2HRNA 5A4VA 5IM9A 1M2AA 2I9HA 4F03A 3FRCA 2E7PA 2LQOA 5DAKB 3TOUA 1JHBA 4MA9A 5KN0A 1Z6MA 1Z7PA 5IQYA 1ERUA 1F3AA 4ECBA 4O92A 5D96A 1AUCA 1KBNA 3FY7A 2CZ2A 4HQSA 1XIYA 2MYGA 2VLVA 4Q5QA 5EPFA 3J7Yb 2VOCA 1B8XA 3O3TA 4PNGA 2OE1A 3TJJA 3HJOA 2FY6A 2JZTA 2B5YA 4I97A 3QD9A 2TIRA 5HFGA 1O85A 3LFLA 1TU8A 6GSTA 5ECLB 5GSSA 3A2WA 10GSA 2AUVA 2IMEA 4WR4A 3F3RA 4GSSA 4ECCA 3LXZA 1GSQA 3VWWA 1Q98A 3PGTA 3CTFA 4OO4A 5IMCA 2A2RA 1JZOA 5KN3A 1BYEA 22GSA 4QQ7A 4L5OA 3QCPA 3UMAA 4XS6A 5FHIA 4POLA 2FGXA 4WBJA 4QL9A 1FW1A 1A2LA 4IVFA 3UJ1A 4KNDA 3EYTA 2PPTA 1MDIA 3ZRDA 2I3YA 4TR4A 5IMVA 2H6ZA 2YPMA 1R26A 3US3A 3O76A 4BWSA 3CYNA 4HOJA 3P2AA 2R37A 4IHUA 3QFAC 2P0GA 4ECJA 1ERVA 4K7IA 3L9VA 3Q6OA 1PKWA 3ZYWA 4AJ7A 5CAXA 2IIYA 1TTZA 1NW2A 1GRXA 1V9WA 1K0DA 4ML1A 1X5EA 2DIYA 2QKEA 4KCEA 1QGVA 2CT6A 2H1DA 1WMJA 2GSTA 4OCFA 4TR0A 4ZB9A 3HD5A 4JU5A 1Y6EA 4XRAA 3TJGA 2PVOC 2BMXA 3TKPA 2VO4A 4EDZA 2X8HA 1ML6A 2F8AA 2H8LA 4EXJA 3LGCA 1F6MC 3J7Yk 3CSIA 2K8VA 2E2GA 3N5OA 2REMA 4TKYA 2NBSA 5IOWA 4ZXGA 1I5GA 2MBSA 4TXVA 4OCEA 2GZYA 1AQVA 3CTGA 1SD8A 2PERA 4I2UA 3G7YA 5AN1A 3Q74A 2ES7A 2YZUA 4PGTA 1A2MA 1GTBA 3UL3A 2LEGA 1BAYA 1N8JA 2H0HA 3ME7A 4MJCA 2L6CA 5LNKe 1ERWA 2AHEA 2C0EA 2CVDA 2VAFA 4ID0A 4LL1B 2EIQA 4GCIA 4MZWA 1QXHA 2K18A 2JZSA 3TJKA 5D9WA 3IV4A 5G5FA 1V98A 4GXZA 4OFMA 3QOUA 3S9FA 1TXXA 2DJ3A 4O5RA 4MZBA 3KM6A 3ZVJD 2DIZA 3MSZA 2I4AA 4WBRD 4FIWA 4K7OA 1K0MA 2J9HA 4ISDA 4MF7A 4ZL8A 1OC9A 2K6VA 2OA7A 4I2TA 2NVLA 2H70A 2I1UA 4I8BA 3WGDA 2HXKA 3ISOA 1QFNA 4FH8A 1LU4A 1WOUA 4ECIA 3HKRA 3KCMA 3ERGA 4F82A 4ACSA 1SL0B 3UEMA 2YV9A 2YWNA 1GP1A 1LBKA 2H1BA 1TDIA 3FR3A
chains in the Genus database with same CATH superfamily
1TJDA 4BIKA 4XRDA 4JEDA 3ZREA 3KXOA 2J23A 1OE8A 3HCZA 2V41A 2HRAA 4GTUA 4WXTA 5CRDA 1RQMA 1SK1A 5F0GA 1FB0A 1X5DA 2DJ2A 3F6DA 1WPIA 2VL3A 3H79A 4FYUA 2O87A 3I9V2 4KSMA 4FO5A 1GSUA 1ERTA 2VLUA 3H1NA 4WEYA 4HS1A 1XG8A 3TRXA 2G0FA 3FR6A 1XXUA 17GSA 4MZCA 1FVKA 1OKDA 1KEBA 1U88A 3UBLA 5J4UA 5KOXA 1JZWA 4H86A 1AW9A 2C3TA 2CAIA 1G7EA 1U3IA 4IP1A 4MH2A 3D6IA 4OMVA 6GSUA 4MF6A 2DJ0A 4PX1A 1F9MA 5FT3A 3W6GA 1XW6A 4OWYA 1MD3A 1OC3A 1PN9A 4KA0A 4V1Ap 4Q5NA 3A2XA 2XC2A 4K7NA 1OE7A 4L5LA 1RK4A 2B6MA 4IP6A 3WT1A 5IPHA 5IIZA 5CP1A 2ZCTA 3FHKA 3E9JB 2H01A 3GX8A 1XCCA 1GL8A 3QAVA 1XVQA 1W89A 2HRFA 5ID2A 3HHVA 2WCIA 1PQNA 3FEUA 1S3CA 2O85A 4GF0A 4MABA 4RQRA 4YAVA 1SJIA 3F4RA 3TRPA 1A23A 2QGVA 2VD0A 4HSCX 4XIHA 2C3QA 4DSSB 4RI7A 5JWOB 2UZ8A 5EVOA 14GSA 4EC0A 4MJBA 1DBYA 2WB9A 4MH3A 4K1FA 4MF5A 4TRXA 4DSSA 6GSWA 2MBTA 3D22A 5J9BA 1ILOA 3TGZA 3HVVA 2DKHA 3ZIVA 2GZZA 19GSA 1J9BA 3EU3A 1SK0A 3HZ8A 3GKKA 4PTSA 1ZYQB 2PN8A 2KOKA 2IPAA 3MDKA 1JZDA 3D4TA 3M9JA 4ICYA 3H4KA 3R3EA 2YJHA 1FB6A 2OBIA 3RDWA 1GTUA 2HLSA 2H1AA 2VL9A 4L0UA 1XWGA 2VIMA 1GUHA 3LQ7A 1XBSA 1A0RP 1FOVA 4WR5A 4LLRA 3Q19A 1QMVA 1YEXA 4F2IA 2JL4A 2R0GA 1VF1A 3TKQA 4Z7XA 4HZ4A 2YWIA 2JSZA 2DJKA 4K2XA 2JU5A 2X8GA 1VF4A 4RI6A 2HNLA 2VL2C 3IAS2 2IMFA 3GURA 2V6KA 2LV3A 2C0DA 1EEJA 3E0UA 5DVBA 1T1VA 3EVIA 2GT5A 1PX6A 5IMFA 12GSA 2GSSA 1TRSA 2DC5A 3BD2A 4N0ZA 5CRWA 2AV4A 2YV7A 4NAXA 3WYWA 4KGIA 1YZXA 2GZPA 4EUYA 3F4SA 4OFTA 3QR6A 5A5KA 2MMAA 1VF3A 2EIOA 3LW9A 1XPVA 3APOA 1V57A 2H19A 2CQ9A 5C04A 1SKWB 2X64A 11GSA 4AF2A 2D2ZA 4TXOB 3TKRA 1GULA 3KMOA 4EIQA 2IMKA 3IE3A 4MDCA 3ZIJA 1QUWA 3G9BA 1R7HA 5ELAA 1HYUA 2CVKA 3GIXA 4TXOA 5EY6A 4JRRA 5CRHA 16GSA 1K0AA 3DGQA 2E0QA 6GSVA 1SENA 3QPMA 1EGOA 2WRTA 5DAKA 5J9CA 1WJKA 3BCKA 3M9KA 5CREA 4EKZA 2B5XA 1SL2B 2VCVA 3SBCA 2O8VB 1QQ2A 4ZBBA 3LORA 3E3EA 3IBHA 3HYPA 3APQA 2G2QA 4KDYA 1K0CA 1ZL9A 1PL2A 4BVXB 1O73A 2F51A 1TW9A 1K3YA 2O7KA 3UARA 1DSBA 3TB2A 2GGTA 2VCZA 1XOBA 3MIXA 3GRXA 2GQLA 1MD4A 1R5AA 4ZB6A 4EL1A 5INYA 3C73A 1G0TA 1G7OA 3Q18A 4XHMA 2HSMA 2IJYA 2EIRA 1SJZA 4E8EA 4ZBAA 3KD0A 3K8NA 1M9BA 3ZVJA 4WETA 4OD7A 3VWUA 1SKSB 1M3IA 4K8MA 2YN1A 5FWGA 5JCWA 4PQ1A 5BRTA 5CRGA 1M99A 1XWKA 3RAZA 1H4OA 3G7JA 2LJAA 1K0BA 3QDNA 3UVTA 4IW9A 4G0LA 5KEJA 3C1RA 2LRCA 4MP4A 2KUCA 3GMFA 5AIXA 3MNGA 1UN2A 2H6YA 3LYPA 5IO2A 2FWEA 4LMWA 3GL5A 2L57A 3EINA 4TVEA 2LUSA 3ERFA 1A8YA 3M3MA 3BCIA 3CBUA 4NWYA 3CRUA 4G2EA 5HR0A 3DWVA 3LWAA 5ECHB 1S3DA 2N5BA 3HY2A 3LYKA 3NOFA 4KF9A 2C1YA 1E2YA 1WWJA 4WKWA 4HQZA 4ILFA 3KJYA 2YNXA 1FAAA 1N2AA 4TR3A 3KP9A 2H71A 4ZL7A 2H72A 1ZOFA 3F9UA 3KZQA 1EOGA 1V2AA 2TRXA 1PRXA 2FA4A 1EV4A 1Z6NA 5A4WA 5CNWA 1BEDA 4BVYA 4IKHA 2OKAA 3V1WA 1K0NA 2LNSA 4K9ZA 2VD1A 3DVWA 1DE1A 1XWBA 1UA5A 3EWLA 4V1Ag 9GSSA 1GWCA 4KUNA 3GHAA 2VM2A 5C00A 1EV9A 1EZKA 1Q4JA 3HJPA 1B9XC 2KP2A 4ZIJA 5ENUA 4QL7A 3VLNA 3ZTLA 1EWXA 2C0GA 1OKTA 2WJUA 4USSA 1GSFA 5DCGA 3GX0A 2YP6A 4ULXA 3TDGA 2YJ7A 2HYXA 4EF0A 4EO3A 4HDEA 5GZZB 1TRUA 1CQHA 3WGXA 1XVWA 1USBA 1CQGA 3NIVA 1B4QA 3WD6A 1GSDA 2LRTA 4K5RA 1KNGA 2DKIA 1TOFA 2DJ1A 3W8JA 2VM1A 3SWLA 1TRWA 1XW9A 1YJ6A 2LTKA 2O89A 3TKSA 4IQAA 3ZL5A 1U6TA 1WP0A 5JCUA 2C4JA 4LL4B 3TUEA 2DSAA 2CX4A 5DQSA 5H5QA 3GSSA 1URMA 2IWTA 5DJLA 4DSRA 2P5RA 1SK2A 3ERWA 5F8BA 2AJQB 1NSWA 2MMOA 2OJLA 1YDKA 3HVSA 2PVQA 2RM6A 1HNCA 2KHPA 2NDOA 3C7MA 4GRFA 3FK8A 1J08A 5LD0A 2HZEB 4NMUA 2FD3A 1NHOA 4F0BA 4MPGA 4NXIA 3C1SA 3GKMA 1O6JA 4NV5A 4DEJA 2B1LA 3I6AA 1TK8B 3JCML 4YQVA 1MEKA 2DMMA 3C8EA 3L9UA 2PBJA 4IBPA 3FZAA 4NHZA 2YWOA 2XPEA 4MJEA 4Q5RA 2IMDA 2L6DA 3L0HA 3ZITA 2FWHA 5IPGA 1ZMAA 4CHSA 5HR2A 5AIVA 5CO3A 3IOSA 2FLSA 3U5RE 3HVXA 2YCDA 4KAEA 1XWAA 2YWMA 3IPZA 1GH2A 5DALB 2FA8A 2QC7A 3DEXA 5D73A 4G9HA 3F63A 3D4MA 2V2GA 2H73A 2ZUPA 1SD9A 2H1GA 5D9VA 5GAND 4XS4B 1F3BA 3FMWA 5HQPA 4K0GA 1MTCA 4JR4A 4GWRA 1ZCPA 4XS4A 2L5LA 4V2LA 4JR6A 5JWQB 4N0VA 2IMIA 4HI7A 3DD3A 1PKZA 1OVNA 2MMNA 3HZ4A 1T8EB 1GTIA 3PINA 3BBYA 1I9DA 3RPPA 3FR9A 4OO5A 2R5GA 3IAM2 4X1UA 3HVNA 4FYBA 2CV4A 2GQMA 1JLWA 3OR5A 5JCGA 1B48A 4O7HA 4WF4A 3UIWA 1O81A 2XBQA 3P90A 2ALBA 1O8XA 3FZ9A 2RIIA 2F9SA 2R3XA 2V32A 4TOPA 2B7JA 4I6XA 2HSYA 1NM3A 4F9ZA 2OACA 3VPTA 2GSRA 3KH9A 3L78A 1XWCA 1Z9HA 3C71A 3TJBA 4RUVA 3NZNA 2WZ9A 4PURA 1IYHA 2IFQB 4YQUA 2IN3A 2LQQA 1TI3A 4MPFA 4G0IA 3GV1A 4LMVA 1X9MB 1M2DA 5G31A 1HNBA 2L59A 2N5FA 4IS0A 3FKFA 2VCTA 4FQUA 2DLXA 3KP8A 2L4CA 4HJ2A 3KTLA 2EC4A 3EMXA 1AIUA 1PD21 4IELA 1W4VA 3RHBA 2Z9SA 5HFKA 1MDKA 2KP1A 5J3RA 4Z2TA 1A0FA 3A5WA 5IMAA 2R0CA 1R4WA 1K3LA 1EGRA 2GLRA 2WDUA 3QMXA 5AGYA 2GS3A 4X4JA 1SYRA 5B7CA 2LNTA 1RW1A 1T4YA 1PSQA 1X5CA 4IN0A 5L71A 2R0PA 3GFKA 3TCOA 3IHQA 4YAPA 4HEA2 3PPUA 4J56E 1ZYEA 3FW2A 18GSA 4BPYA 1B9YC 2VLTA 1TU7A 3H8QA 4CW9A 4HU9A 2A2PA 2CVBA 4PUAA 2LRNA 3GYKA 4RQXA 2CAQA 2DBCA 1DUGA 2GVPA 2TRCP 2FNOA 2C3NA 2PWJA 2F8FA 4KX4A 4J2FA 2RLIA 3IK7A 5A4UA 1XFLA 5ABRA 5IMDA 4V2MA 2X99A 2ZNMA 2ON5A 4IJ3A 2PU9C 5JWRB 4KW6A 1OAZA 1EOHA 1NHYA 1Z3EA 3ZLPA 2M80A 1TRVA 3I69A 2AB6A 2OADA 3PR8A 4BVXA 5D9TA 1AXDA 3HXSA 1SKRB 5F05A 5DJMA 4POMA 4YH2A 5D9XA 4I5QA 5F07A 4ZILA 1VRSD 2VCWA 1FOHA 4EDYA 2RM5A 3ED3A 4A5PA 2A2SA 2PGTA 4WF5A 3F0IA 3AY8A 4KCAA 3ZFLA 3GSTA 2NPBA 2YOIA 2LS5A 3VI7A 1GNEA 4J57E 2HFDA 3UVHA 2A4VA 3M0FA 4EE0A 1A8LA 2H75A 1KTEA 5F06A 4AJ8A 1ZZYA 1HNAA 1K0OA 2YZHA 3GA4A 2BJXA 3U6VA 1FG4A 4E8HA 3I43A 4XS1A 3DVXA 2C8UA 4X0XA 4AJ6A 13GSA 2GQKA 3IC4A 1R5PA 4POKA 3F3QA 2FCHA 5G5EA 3F6FA 3UAPA 1PL1A 1M2BA 3IK9A 1X9SB 3DYRA 3KIJA 5D8IA 5GAPD 3UBKA 2DJJA 3FYGA 5J41A 1AQXA 2GTUA 1U87A 2FHEA 4K2DA 3F4TA 1TKDB 4PXOA 1SJ6A 1B4PA 2PUKC 2V1MA 1BG5A 1T7PB 1GLPA 1QK8A 5H5SA 3KTBA 3TRQA 1XOAA 1M7TA 1S3AA 2M46A 2R4VA 4EVMA 4X43A 1F37A 3GKXA 4MJAA 3TKSE 3DKSA 2H30A 5DQYA 3RHCA 3VWXA 4N11A 2F3MA 2X8CA 3LEFA 2ON7A 3IA1A 2WGRA 1O8WA 4TN8A 2HT9A 3EE2A 2JACA 1JLVA 3CSJA 2B3SA 5B6NA 3LXTA 2P31A 1M9AA 2RUFA 4ZL9A 1FHEA 4K6XA 2R2JA 2AAWA 3H93A 5ECSA 3M1GA 5ECOB 1YY7A 3R2QA 4JZQA 1WRYA 3CMIA 2FUG2 5HR3A 4TR1B 1U3AA 2YANA 1FO5A 4KH7A 2OE3A 2LJKA 4TR1A 1EP8A 3DRNA 3TOTA 5ELGA 4NHWA 3F8UA 2MZCA 5ECNB 5G2ZA 4ZBDA 3RBTA 1YF0A 2V6OA 1YEPA 1ON4A 2XBIA 3P7XA 1DE2A 2CA8A 2JADA 1JFUA 3KH7A 1ACVA 3M8NA 4IJIA 4GQFA 1OC8A 1TK5B 3ZMLA 1GSSA 1GSYA 3GH6A 3GNJA 2FWGA 2PMTA 4EIPA 3BOAA 1PX7A 2KLXA 4YKGA 2JZRA 3VK9A 4BA7A 2CX3A 3APSA 5ECQB 2BTOT 4DSQA 1TK0B 1X0RA 3DXBA 5E59A 4IGJA 2X4AA 1J0FA 1WIKA 1GUMA 1HQOA 3LG6A 1PGTA 2X49A 3N9JA 2B1KA 1OC9B 2VCXA 4MNNA 3BJ5A 5J5NA 1ZGNA 7GSSA 2XPDA 4P3YB 1GNWA 3LJRA 2GSQA 1V40A 3D5JA 4KE3A 1BQ7A 1Y25A 3EMPA 4O32A 2B7KA 4HZ2A 2H76A 4N10A 1H75A 3GH9A 3P8WA 4HU7A 2WS2A 4FYCA 4NPBA 2MMZA 5LCZA 1THOA 2B5EA 4L0WA 3IRAA 3L4NA 4OFNA 1X9WB 1C72A 2HZEA 5G1KA 5KN1A 1O7UA 3VURA 5ECMB 3VFIA 4YQMA 2C80A 4KSOA 2VCQA 3KMNA 3TKSC 3CRTA 3O6TA 1BJXA 3QAWA 1G6WA 1VGLA 2I81A 1AAZA 3MWHA 3IHGA 4LA1A 3VPQA 3LSZA 4ZB8A 2OBKA 4Z2UA 3HA9A 5HR1A 4PNFA 5CYYA 3GTUB 1MDJA 4CDOA 1PN0A 1YF1A 4NV2A 1AQWA 5AISA 4K0NA 3A3TA 6GSYA 2QA1A 3DIEA 3GTUA 1AC1A 4G19A 2K9FA 2NTOA 1K3OA 2HE3A 5ECPB 5B8BA 4JE1A 5DALA 1TI1A 3EU4A 1Z5YE 3L9SA 1XW5A 2L5OA 3CSHA 2QSIA 1PMTA 1ABAA 1JZRA 1T00A 3RPNA 2HZFA 1WE0A 1T4ZA 5ID2B 2N5AA 2AYTA 2H0GA 2WFCA 2R6KA 1EP7A 5IOXA 4CY8A 3ZFBA 1UC7A 1E6BA 1THXA 5G30A 3UOMA 4GLTA 1SL1B 4F0CA 3FZ5A 4GSTA 2H66A 3ZMKA 3GUSA 1FVJA 4XTSA 4N30A 3EC3A 5HFIA 1GUKA 4KDUA 4V2NA 3W8SA 3WGEA 1M0UA 5ECIB 4PQIA 4BWQA 2M72A 1G6YA 3VI5A 4PUFC 2H74A 1OYJA 4HJMA 3DMLA 1IYIA 2C0FA 1BX9A 2VL2A 5EL8A 3ZZXA 3G7IA 4PQHA 3KEBA 1ZYNA 4MCUA 1SYXA 1XZOA 2HSHA 4MLYA 5DDLA 4D73B 5D93A 4KDXA 4G10A 1HD2A 3A2VA 5ECKB 2FWFA 3GKNA 2LKUA 2E2MA 4D73A 3IDVA 5ECRB 2IFQA 5DCHA 4POBA 4L8EA 3GN3A 2DMLA 2GDRA 5H5RA 4Z2RA 3MAKA 5GSTA 1YKAA 4MMMA 2RUEA 1V58A 3HDCA 4HUAA 2LJRA 3D0ZA 2K8SA 1A2JA 3KGKA 3WT2A 5KN2A 5B6MA 4YKFA 6GSSA 1GLQA 1PFOA 2P5QA 1PA3A 5B8AA 8GSSA 4CY6A 4GSNA 2GT6A 4ML6A 4AGSA 4TW5A 2A4HA 3GL3A 3IR4A 3QFBC 1YKCA 1GSEA 2WULA 1TP9A 2H6XA 5G1LA 20GSA 1GTAA 5E4WA 1Z7RA 5IO0A 3QAGA 3EURA 3ME8A 1EEMA 1T3BA 3PH9A 3TJFA 1UVZA 2H0IA 4Q5FA 3IXRA 4JBBA 6GSXA 4XCSA 2CZ3A 4KB3A 2L4QA 5DBQA 1YQ1A 3HJMA 4MK3A 2OE0A 2LSTA 5IMZA 2HI7A 2IL3A 2JSYA 1ST9A 4BL7B 4O5UA 1A24A 4G0KA 4IQ1A 4DVCA 3VWVA 3CXGA 4GQCA 1LJRA 2VUPA 1VF2A 1F2EA 1SU9A 3D21A 4BL7A 2XHFA 3FZ4A 5COHA 2HRNA 5A4VA 5IM9A 1M2AA 2I9HA 4F03A 3FRCA 2E7PA 2LQOA 5DAKB 3TOUA 1JHBA 4MA9A 5KN0A 1Z6MA 1Z7PA 5IQYA 1ERUA 1F3AA 4ECBA 4O92A 5D96A 1AUCA 1KBNA 3FY7A 2CZ2A 4HQSA 1XIYA 2MYGA 2VLVA 4Q5QA 5EPFA 3J7Yb 2VOCA 1B8XA 3O3TA 4PNGA 2OE1A 3TJJA 3HJOA 2FY6A 2JZTA 2B5YA 4I97A 3QD9A 2TIRA 5HFGA 2QA2A 1O85A 3LFLA 1TU8A 6GSTA 5ECLB 5GSSA 3A2WA 10GSA 2AUVA 2IMEA 4WR4A 3F3RA 4GSSA 4ECCA 3LXZA 1GSQA 3VWWA 1Q98A 3PGTA 3CTFA 4OO4A 5IMCA 2A2RA 1JZOA 5KN3A 1BYEA 22GSA 4QQ7A 4L5OA 3QCPA 3EPTA 3UMAA 4XS6A 5FHIA 4POLA 2FGXA 4WBJA 4QL9A 1FW1A 1A2LA 4IVFA 3UJ1A 4KNDA 3EYTA 3MYDA 2PPTA 1MDIA 3ZRDA 2I3YA 4TR4A 5IMVA 2HRKA 2H6ZA 2YPMA 1R26A 3US3A 3O76A 4BWSA 3CYNA 4HOJA 1ZYPA 3P2AA 2R37A 4IHUA 3QFAC 2P0GA 4ECJA 1ERVA 4K7IA 3L9VA 3Q6OA 1PKWA 3ZYWA 4AJ7A 5CAXA 2IIYA 1TTZA 1NW2A 1GRXA 1V9WA 1K0DA 4ML1A 1X5EA 2DIYA 3CQFA 2QKEA 4KCEA 1QGVA 2CT6A 2H1DA 1WMJA 2GSTA 4OCFA 4TR0A 4ZB9A 3HD5A 4JU5A 4K5SA 1Y6EA 4XRAA 3TJGA 2PVOC 2BMXA 3TKPA 4O5QA 2VO4A 4EDZA 2X8HA 1ML6A 2F8AA 2H8LA 4EXJA 3LGCA 1F6MC 3J7Yk 3CSIA 2K8VA 2E2GA 4BVYB 3N5OA 2REMA 4TKYA 2NBSA 5IOWA 4ZXGA 1I5GA 2MBSA 4TXVA 4OCEA 2GZYA 1AQVA 3CTGA 1SD8A 2PERA 4I2UA 3G7YA 5AN1A 3Q74A 2ES7A 2YZUA 4PGTA 1A2MA 1M3JA 1GTBA 3UL3A 2LEGA 1BAYA 1N8JA 2H0HA 5KOWA 3ME7A 4MJCA 2L6CA 5LNKe 1ERWA 2AHEA 2C0EA 2CVDA 2VAFA 4ID0A 4LL1B 2EIQA 4GCIA 4MZWA 1QXHA 2K18A 2JZSA 3TJKA 5D9WA 3IV4A 5G5FA 1V98A 4GXZA 4OFMA 3QOUA 3S9FA 1TXXA 2DJ3A 4O5RA 4MZBA 3KM6A 3ZVJD 2DIZA 3MSZA 2I4AA 4WBRD 3A5IA 4FIWA 4K7OA 1K0MA 2J9HA 4ISDA 4MF7A 4ZL8A 1OC9A 2K6VA 2OA7A 4I2TA 2NVLA 2H70A 2I1UA 4I8BA 3WGDA 2HXKA 3ISOA 1QFNA 4FH8A 1LU4A 1WOUA 4ECIA 3HKRA 3KCMA 3ERGA 4F82A 4ACSA 1SL0B 3UEMA 2YV9A 2YWNA 1GP1A 1LBKA 1S3RA 2H1BA 3IC8A 1TDIA 5BMUA 3FR3A
chains in the Genus database with same CATH topology
1TJDA 4XRDA 4JEDA 3ZREA 3KXOA 2J23A 1OE8A 3HCZA 2V41A 2HRAA 4GTUA 4WXTA 5CRDA 1RQMA 1SK1A 5F0GA 1FB0A 1X5DA 2DJ2A 3F6DA 1WPIA 2VL3A 3H79A 4FYUA 2O87A 3I9V2 4KSMA 4FO5A 1GSUA 1ERTA 2VLUA 3H1NA 4WEYA 4HS1A 3TRXA 2G0FA 3FR6A 1XXUA 17GSA 4MZCA 1FVKA 1OKDA 1KEBA 1U88A 3UBLA 5J4UA 5KOXA 1JZWA 4H86A 1AW9A 2C3TA 2CAIA 1G7EA 1U3IA 4IP1A 4MH2A 3D6IA 4OMVA 6GSUA 4MF6A 2DJ0A 4PX1A 1F9MA 5FT3A 3W6GA 1XW6A 4OWYA 1MD3A 1OC3A 1PN9A 4KA0A 4V1Ap 4Q5NA 3A2XA 2XC2A 4K7NA 1OE7A 4L5LA 1RK4A 2B6MA 4IP6A 3WT1A 5IPHA 5IIZA 5CP1A 2ZCTA 3FHKA 3E9JB 2H01A 3GX8A 1XCCA 1GL8A 3QAVA 1XVQA 1W89A 2HRFA 5ID2A 3HHVA 2WCIA 1PQNA 3FEUA 1S3CA 2O85A 4GF0A 4MABA 4YAVA 4RQRA 1SJIA 3F4RA 3TRPA 1A23A 2QGVA 2VD0A 4XIHA 2C3QA 4DSSB 4RI7A 5JWOB 2UZ8A 5EVOA 14GSA 4EC0A 4MJBA 1DBYA 2WB9A 4MH3A 4K1FA 4MF5A 4TRXA 4DSSA 6GSWA 2MBTA 3D22A 5J9BA 1ILOA 3TGZA 3HVVA 2DKHA 3ZIVA 2GZZA 19GSA 1J9BA 3EU3A 1SK0A 3HZ8A 3GKKA 4PTSA 1ZYQB 2PN8A 2KOKA 2IPAA 3MDKA 1JZDA 3D4TA 3M9JA 4ICYA 3H4KA 3R3EA 2YJHA 1FB6A 2OBIA 3RDWA 1GTUA 2HLSA 2H1AA 2VL9A 4L0UA 1XWGA 2VIMA 1GUHA 3LQ7A 1XBSA 1A0RP 1FOVA 4WR5A 4LLRA 3Q19A 1QMVA 1YEXA 4F2IA 2JL4A 2R0GA 1VF1A 3TKQA 4Z7XA 4HZ4A 2YWIA 2JSZA 2DJKA 4K2XA 2JU5A 2X8GA 1VF4A 4RI6A 2HNLA 2VL2C 3IAS2 2IMFA 3GURA 2V6KA 2LV3A 2C0DA 1EEJA 3E0UA 5DVBA 1T1VA 3EVIA 2GT5A 1PX6A 5IMFA 12GSA 2GSSA 1TRSA 2DC5A 3BD2A 4N0ZA 5CRWA 2AV4A 2YV7A 4NAXA 3WYWA 4KGIA 1YZXA 2GZPA 4EUYA 3F4SA 4OFTA 3QR6A 5A5KA 2MMAA 1VF3A 2EIOA 3LW9A 1XPVA 3APOA 1V57A 2H19A 2CQ9A 5C04A 1SKWB 2X64A 11GSA 4AF2A 2D2ZA 4TXOB 3TKRA 1GULA 3KMOA 4EIQA 2IMKA 3IE3A 4MDCA 3ZIJA 1QUWA 3G9BA 1R7HA 5ELAA 1HYUA 2CVKA 3GIXA 4TXOA 5EY6A 4JRRA 5CRHA 16GSA 1K0AA 3DGQA 2E0QA 6GSVA 1SENA 3QPMA 1EGOA 2WRTA 5DAKA 5J9CA 1WJKA 3BCKA 3M9KA 5CREA 4EKZA 2B5XA 1SL2B 2VCVA 3SBCA 2O8VB 1QQ2A 4ZBBA 3LORA 3E3EA 3IBHA 3HYPA 3APQA 2G2QA 4KDYA 1K0CA 1ZL9A 1PL2A 4BVXB 1O73A 2F51A 1TW9A 1K3YA 2O7KA 3UARA 1DSBA 3TB2A 2GGTA 2VCZA 1XOBA 3MIXA 3GRXA 2GQLA 1MD4A 1R5AA 4ZB6A 4EL1A 5INYA 3C73A 1G0TA 1G7OA 3Q18A 4XHMA 2HSMA 2IJYA 2EIRA 1SJZA 4E8EA 4ZBAA 3KD0A 3K8NA 1M9BA 3ZVJA 4WETA 4OD7A 3VWUA 1SKSB 4K8MA 2YN1A 5FWGA 5JCWA 4PQ1A 5BRTA 5CRGA 1M99A 1XWKA 3RAZA 1H4OA 3G7JA 2LJAA 1K0BA 3QDNA 3UVTA 4IW9A 4G0LA 5KEJA 3C1RA 2LRCA 4MP4A 2KUCA 3GMFA 5AIXA 3MNGA 1UN2A 2H6YA 3LYPA 5IO2A 2FWEA 4LMWA 3GL5A 2L57A 3EINA 4TVEA 2LUSA 3ERFA 1A8YA 3M3MA 3BCIA 3CBUA 4NWYA 3CRUA 4G2EA 5HR0A 3DWVA 3LWAA 5ECHB 1S3DA 2N5BA 3HY2A 3LYKA 3NOFA 4KF9A 2C1YA 1E2YA 1WWJA 4WKWA 4HQZA 4ILFA 3KJYA 2YNXA 1FAAA 1N2AA 4TR3A 3KP9A 2H71A 4ZL7A 2H72A 1ZOFA 3F9UA 3KZQA 1EOGA 1V2AA 2TRXA 1PRXA 2FA4A 1EV4A 1Z6NA 5A4WA 5CNWA 1BEDA 4BVYA 4IKHA 2OKAA 3V1WA 1K0NA 2LNSA 4K9ZA 2VD1A 3DVWA 1DE1A 1XWBA 1UA5A 3EWLA 4V1Ag 9GSSA 1GWCA 4KUNA 3GHAA 2VM2A 5C00A 1EV9A 1EZKA 1Q4JA 3HJPA 1B9XC 2KP2A 4ZIJA 5ENUA 4QL7A 3VLNA 3ZTLA 1EWXA 2C0GA 1OKTA 2WJUA 4USSA 1GSFA 5DCGA 3GX0A 2YP6A 4ULXA 3TDGA 2YJ7A 2HYXA 4EF0A 4EO3A 4HDEA 5GZZB 1TRUA 1CQHA 3WGXA 1XVWA 1USBA 1CQGA 3NIVA 1B4QA 3WD6A 1GSDA 2LRTA 4K5RA 1KNGA 2DKIA 1TOFA 2DJ1A 3W8JA 2VM1A 3SWLA 1TRWA 1XW9A 1YJ6A 2LTKA 2O89A 3TKSA 4IQAA 3ZL5A 1U6TA 1WP0A 5JCUA 2C4JA 4LL4B 3TUEA 2DSAA 2CX4A 5DQSA 5H5QA 3GSSA 1URMA 2IWTA 5DJLA 4DSRA 2P5RA 1SK2A 3ERWA 5F8BA 2AJQB 1NSWA 2MMOA 2OJLA 1YDKA 3HVSA 2PVQA 2RM6A 1HNCA 2KHPA 2NDOA 3C7MA 4GRFA 3FK8A 1J08A 5LD0A 2HZEB 4NMUA 2FD3A 1NHOA 4F0BA 4MPGA 4NXIA 3C1SA 3GKMA 1O6JA 4NV5A 4DEJA 2B1LA 3I6AA 1TK8B 3JCML 4YQVA 1MEKA 2DMMA 3C8EA 3L9UA 2PBJA 4IBPA 3FZAA 4NHZA 2YWOA 2XPEA 4MJEA 4Q5RA 2IMDA 2L6DA 3L0HA 3ZITA 2FWHA 5IPGA 1ZMAA 4CHSA 5HR2A 5AIVA 5CO3A 3IOSA 2FLSA 3U5RE 3HVXA 2YCDA 4KAEA 1XWAA 2YWMA 3IPZA 1GH2A 5DALB 2FA8A 2QC7A 3DEXA 5D73A 4G9HA 3F63A 3D4MA 2V2GA 2H73A 2ZUPA 1SD9A 2H1GA 5D9VA 5GAND 4XS4B 1F3BA 3FMWA 5HQPA 4K0GA 1MTCA 4JR4A 4GWRA 1ZCPA 4XS4A 2L5LA 4V2LA 4JR6A 5JWQB 4N0VA 2IMIA 4HI7A 3DD3A 1PKZA 1OVNA 2MMNA 3HZ4A 1T8EB 1GTIA 3PINA 3BBYA 1I9DA 3RPPA 3FR9A 4OO5A 2R5GA 3IAM2 4X1UA 4FYBA 2CV4A 2GQMA 1JLWA 3OR5A 5JCGA 1B48A 4O7HA 4WF4A 3UIWA 1O81A 2XBQA 3P90A 2ALBA 1O8XA 3FZ9A 2RIIA 2F9SA 2R3XA 2V32A 4TOPA 2B7JA 4I6XA 2HSYA 1NM3A 4F9ZA 2OACA 3VPTA 2GSRA 3KH9A 3L78A 1XWCA 1Z9HA 3C71A 3TJBA 4RUVA 3NZNA 2WZ9A 4PURA 1IYHA 2IFQB 4YQUA 2IN3A 2LQQA 1TI3A 4MPFA 4G0IA 3GV1A 4LMVA 1X9MB 1M2DA 5G31A 1HNBA 2L59A 2N5FA 4IS0A 3FKFA 2VCTA 4FQUA 2DLXA 3KP8A 2L4CA 4HJ2A 3KTLA 2EC4A 3EMXA 1AIUA 1PD21 4IELA 1W4VA 3RHBA 2Z9SA 5HFKA 1MDKA 2KP1A 5J3RA 4Z2TA 1A0FA 3A5WA 5IMAA 2R0CA 1R4WA 1K3LA 1EGRA 2GLRA 2WDUA 3QMXA 5AGYA 2GS3A 4X4JA 1SYRA 5B7CA 2LNTA 1RW1A 1T4YA 1PSQA 1X5CA 4IN0A 5L71A 2R0PA 3GFKA 3TCOA 3IHQA 4YAPA 4HEA2 3PPUA 4J56E 1ZYEA 3FW2A 18GSA 4BPYA 1B9YC 2VLTA 1TU7A 3H8QA 4CW9A 4HU9A 2A2PA 2CVBA 4PUAA 2LRNA 3GYKA 4RQXA 2CAQA 2DBCA 1DUGA 2GVPA 2TRCP 2FNOA 2C3NA 2PWJA 2F8FA 4KX4A 4J2FA 2RLIA 3IK7A 5A4UA 1XFLA 5ABRA 5IMDA 4V2MA 2X99A 2ZNMA 2ON5A 4IJ3A 2PU9C 5JWRB 4KW6A 1OAZA 1EOHA 1NHYA 1Z3EA 3ZLPA 2M80A 1TRVA 3I69A 2AB6A 2OADA 3PR8A 4BVXA 5D9TA 1AXDA 3HXSA 1SKRB 5F05A 5DJMA 4POMA 4YH2A 5D9XA 4I5QA 5F07A 4ZILA 1VRSD 2VCWA 1FOHA 4EDYA 2RM5A 3ED3A 4A5PA 2A2SA 2PGTA 4WF5A 3F0IA 3AY8A 4KCAA 3ZFLA 3GSTA 2NPBA 2YOIA 2LS5A 3VI7A 1GNEA 4J57E 2HFDA 3UVHA 2A4VA 3M0FA 4EE0A 1A8LA 2H75A 1KTEA 5F06A 4AJ8A 1ZZYA 1HNAA 1K0OA 2YZHA 3GA4A 2BJXA 3U6VA 1FG4A 4E8HA 3I43A 4XS1A 3DVXA 2C8UA 4X0XA 4AJ6A 13GSA 2GQKA 3IC4A 1R5PA 4POKA 3F3QA 2FCHA 5G5EA 3F6FA 3UAPA 1PL1A 1M2BA 3IK9A 1X9SB 3DYRA 3KIJA 5D8IA 5GAPD 3UBKA 2DJJA 3FYGA 5J41A 1AQXA 2GTUA 1U87A 2FHEA 4K2DA 3F4TA 1TKDB 4PXOA 1SJ6A 1B4PA 2PUKC 2V1MA 1BG5A 1T7PB 1GLPA 1QK8A 5H5SA 3KTBA 3TRQA 1XOAA 1M7TA 1S3AA 2M46A 2R4VA 4EVMA 4X43A 1F37A 3GKXA 4MJAA 3TKSE 3DKSA 2H30A 5DQYA 3RHCA 3VWXA 4N11A 2F3MA 2X8CA 3LEFA 2ON7A 3IA1A 2WGRA 1O8WA 4TN8A 2HT9A 3EE2A 2JACA 1JLVA 3CSJA 2B3SA 5B6NA 3LXTA 2P31A 1M9AA 2RUFA 4ZL9A 1FHEA 4K6XA 2R2JA 2AAWA 3H93A 5ECSA 3M1GA 5ECOB 1YY7A 3R2QA 4JZQA 1WRYA 3CMIA 2FUG2 5HR3A 4TR1B 1U3AA 2YANA 1FO5A 4KH7A 2OE3A 2LJKA 4TR1A 1EP8A 3DRNA 3TOTA 5ELGA 4NHWA 3F8UA 2MZCA 5ECNB 5G2ZA 4ZBDA 3RBTA 1YF0A 2V6OA 1YEPA 1ON4A 2XBIA 3P7XA 1DE2A 2CA8A 2JADA 1JFUA 3KH7A 1ACVA 3M8NA 4IJIA 4GQFA 1OC8A 1TK5B 3ZMLA 1GSSA 1GSYA 3GH6A 3GNJA 2FWGA 2PMTA 4EIPA 3BOAA 1PX7A 2KLXA 4YKGA 2JZRA 3VK9A 4BA7A 2CX3A 3APSA 5ECQB 2BTOT 4DSQA 1TK0B 1X0RA 3DXBA 5E59A 4IGJA 2X4AA 1J0FA 1WIKA 1GUMA 1HQOA 3LG6A 1PGTA 2X49A 3N9JA 2B1KA 1OC9B 2VCXA 4MNNA 3BJ5A 5J5NA 1ZGNA 7GSSA 2XPDA 4P3YB 1GNWA 3LJRA 2GSQA 1V40A 3D5JA 4KE3A 1BQ7A 1Y25A 3EMPA 4O32A 2B7KA 4HZ2A 2H76A 4N10A 1H75A 3GH9A 3P8WA 4HU7A 2WS2A 4FYCA 4NPBA 2MMZA 5LCZA 1THOA 2B5EA 4L0WA 3IRAA 3L4NA 4OFNA 1X9WB 1C72A 2HZEA 5G1KA 5KN1A 1O7UA 3VURA 5ECMB 3VFIA 4YQMA 2C80A 4KSOA 2VCQA 3KMNA 3TKSC 3CRTA 3O6TA 1BJXA 3QAWA 1G6WA 1VGLA 2I81A 1AAZA 3MWHA 3IHGA 4LA1A 3VPQA 3LSZA 4ZB8A 2OBKA 4Z2UA 3HA9A 5HR1A 4PNFA 5CYYA 3GTUB 1MDJA 4CDOA 1PN0A 1YF1A 4NV2A 1AQWA 5AISA 4K0NA 3A3TA 6GSYA 2QA1A 3DIEA 3GTUA 1AC1A 4G19A 2K9FA 2NTOA 1K3OA 2HE3A 5ECPB 5B8BA 4JE1A 5DALA 1TI1A 3EU4A 1Z5YE 3L9SA 1XW5A 2L5OA 3CSHA 2QSIA 1PMTA 1ABAA 1JZRA 1T00A 3RPNA 2HZFA 1WE0A 1T4ZA 5ID2B 2N5AA 2AYTA 2H0GA 2WFCA 2R6KA 1EP7A 5IOXA 4CY8A 3ZFBA 1UC7A 1E6BA 1THXA 5G30A 3UOMA 4GLTA 1SL1B 4F0CA 3FZ5A 4GSTA 2H66A 3ZMKA 3GUSA 1FVJA 4XTSA 4N30A 3EC3A 5HFIA 1GUKA 4KDUA 4V2NA 3W8SA 3WGEA 1M0UA 5ECIB 4PQIA 4BWQA 2M72A 1G6YA 3VI5A 4PUFC 2H74A 1OYJA 4HJMA 3DMLA 1IYIA 2C0FA 1BX9A 2VL2A 5EL8A 3ZZXA 3G7IA 4PQHA 3KEBA 1ZYNA 4MCUA 1SYXA 1XZOA 2HSHA 4MLYA 5DDLA 4D73B 5D93A 4KDXA 4G10A 1HD2A 3A2VA 5ECKB 2FWFA 3GKNA 2LKUA 2E2MA 4D73A 3IDVA 5ECRB 2IFQA 5DCHA 4POBA 4L8EA 3GN3A 2DMLA 2GDRA 5H5RA 4Z2RA 3MAKA 5GSTA 1YKAA 4MMMA 2RUEA 1V58A 3HDCA 4HUAA 2LJRA 3D0ZA 2K8SA 1A2JA 3KGKA 3WT2A 5KN2A 5B6MA 4YKFA 6GSSA 1GLQA 2P5QA 1PA3A 5B8AA 8GSSA 4CY6A 4GSNA 2GT6A 4ML6A 4AGSA 4TW5A 2A4HA 3GL3A 3IR4A 3QFBC 1YKCA 1GSEA 2WULA 1TP9A 2H6XA 5G1LA 20GSA 1GTAA 5E4WA 1Z7RA 5IO0A 3QAGA 3EURA 3ME8A 1EEMA 1T3BA 3PH9A 3TJFA 1UVZA 2H0IA 4Q5FA 3IXRA 4JBBA 6GSXA 4XCSA 2CZ3A 4KB3A 2L4QA 5DBQA 1YQ1A 3HJMA 4MK3A 2OE0A 2LSTA 5IMZA 2HI7A 2IL3A 2JSYA 1ST9A 4BL7B 4O5UA 1A24A 4G0KA 4IQ1A 4DVCA 3VWVA 3CXGA 4GQCA 1LJRA 2VUPA 1VF2A 1F2EA 1SU9A 3D21A 4BL7A 2XHFA 3FZ4A 5COHA 2HRNA 5A4VA 5IM9A 1M2AA 2I9HA 4F03A 3FRCA 2E7PA 2LQOA 5DAKB 3TOUA 1JHBA 4MA9A 5KN0A 1Z6MA 1Z7PA 5IQYA 1ERUA 1F3AA 4ECBA 4O92A 5D96A 1AUCA 1KBNA 3FY7A 2CZ2A 4HQSA 1XIYA 2MYGA 2VLVA 4Q5QA 5EPFA 3J7Yb 2VOCA 1B8XA 3O3TA 4PNGA 2OE1A 3TJJA 3HJOA 2FY6A 2JZTA 2B5YA 4I97A 3QD9A 2TIRA 5HFGA 2QA2A 1O85A 3LFLA 1TU8A 6GSTA 5ECLB 5GSSA 3A2WA 10GSA 2AUVA 2IMEA 4WR4A 3F3RA 4GSSA 4ECCA 3LXZA 1GSQA 3VWWA 1Q98A 3PGTA 3CTFA 4OO4A 5IMCA 2A2RA 1JZOA 5KN3A 1BYEA 22GSA 4QQ7A 4L5OA 3QCPA 3EPTA 3UMAA 4XS6A 5FHIA 4POLA 2FGXA 4WBJA 4QL9A 1FW1A 1A2LA 4IVFA 3UJ1A 4KNDA 3EYTA 3MYDA 2PPTA 1MDIA 3ZRDA 2I3YA 4TR4A 5IMVA 2HRKA 2H6ZA 2YPMA 1R26A 3US3A 3O76A 4BWSA 3CYNA 4HOJA 1ZYPA 3P2AA 2R37A 4IHUA 3QFAC 2P0GA 4ECJA 1ERVA 4K7IA 3L9VA 3Q6OA 1PKWA 3ZYWA 4AJ7A 5CAXA 2IIYA 1TTZA 1NW2A 1GRXA 1V9WA 1K0DA 4ML1A 1X5EA 2DIYA 2QKEA 4KCEA 1QGVA 2CT6A 2H1DA 1WMJA 2GSTA 4OCFA 4TR0A 4ZB9A 3HD5A 4JU5A 4K5SA 1Y6EA 4XRAA 3TJGA 2PVOC 2BMXA 3TKPA 4O5QA 2VO4A 4EDZA 2X8HA 1ML6A 2F8AA 2H8LA 4EXJA 3LGCA 1F6MC 3J7Yk 3CSIA 2K8VA 2E2GA 4BVYB 3N5OA 2REMA 4TKYA 2NBSA 5IOWA 4ZXGA 1I5GA 2MBSA 4TXVA 4OCEA 2GZYA 1AQVA 3CTGA 1SD8A 2PERA 4I2UA 3G7YA 5AN1A 3Q74A 2ES7A 2YZUA 4PGTA 1A2MA 1GTBA 3UL3A 2LEGA 1BAYA 1N8JA 2H0HA 5KOWA 3ME7A 4MJCA 2L6CA 5LNKe 1ERWA 2AHEA 2C0EA 2CVDA 2VAFA 4ID0A 4LL1B 2EIQA 4GCIA 4MZWA 1QXHA 2K18A 2JZSA 3TJKA 5D9WA 3IV4A 5G5FA 1V98A 4GXZA 4OFMA 3QOUA 3S9FA 1TXXA 2DJ3A 4O5RA 4MZBA 3KM6A 3ZVJD 2DIZA 3MSZA 2I4AA 4WBRD 3A5IA 4FIWA 4K7OA 1K0MA 2J9HA 4ISDA 4MF7A 4ZL8A 1OC9A 2K6VA 2OA7A 4I2TA 2NVLA 2H70A 2I1UA 4I8BA 3WGDA 2HXKA 3ISOA 1QFNA 4FH8A 1LU4A 1WOUA 4ECIA 3HKRA 3KCMA 3ERGA 4F82A 4ACSA 1SL0B 3UEMA 2YV9A 2YWNA 1GP1A 1LBKA 2H1BA 3IC8A 1TDIA 5BMUA 3FR3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TJD A;  4XRD A;  4JED A;  3ZRE A;  3KXO A;  2J23 A;  1OE8 A;  3HCZ A;  2V41 A;  4GTU A;  4WXT A;  5CRD A;  1RQM A;  1SK1 A;  5F0G A;  1FB0 A;  1X5D A;  2DJ2 A;  3F6D A;  1WPI A;  2VL3 A;  3H79 A;  4FYU A;  2O87 A;  3I9V 2;  4KSM A;  4FO5 A;  1GSU A;  1ERT A;  2VLU A;  3H1N A;  4WEY A;  4HS1 A;  3TRX A;  2G0F A;  3FR6 A;  1XXU A;  17GS A;  4MZC A;  1FVK A;  1OKD A;  1KEB A;  1U88 A;  3UBL A;  5J4U A;  1JZW A;  4H86 A;  1AW9 A;  2C3T A;  2CAI A;  1G7E A;  1U3I A;  4IP1 A;  4MH2 A;  3D6I A;  4OMV A;  6GSU A;  4MF6 A;  2DJ0 A;  4PX1 A;  1F9M A;  5FT3 A;  3W6G A;  1XW6 A;  4OWY A;  1MD3 A;  1OC3 A;  1PN9 A;  4KA0 A;  4V1A p;  4Q5N A;  3A2X A;  2XC2 A;  4K7N A;  1OE7 A;  4L5L A;  1RK4 A;  2B6M A;  4IP6 A;  3WT1 A;  5IPH A;  5IIZ A;  5CP1 A;  2ZCT A;  3FHK A;  3E9J B;  2H01 A;  3GX8 A;  1XCC A;  1GL8 A;  3QAV A;  1XVQ A;  1W89 A;  2HRF A;  5ID2 A;  3HHV A;  2WCI A;  1PQN A;  3FEU A;  1S3C A;  2O85 A;  4GF0 A;  4MAB A;  4YAV A;  4RQR A;  1SJI A;  3F4R A;  3TRP A;  1A23 A;  2QGV A;  2VD0 A;  4XIH A;  2C3Q A;  4DSS B;  4RI7 A;  5JWO B;  5EVO A;  14GS A;  4EC0 A;  4MJB A;  1DBY A;  2WB9 A;  4MH3 A;  4K1F A;  4MF5 A;  4TRX A;  4DSS A;  6GSW A;  2MBT A;  3D22 A;  5J9B A;  1ILO A;  3TGZ A;  3HVV A;  3ZIV A;  2GZZ A;  19GS A;  1J9B A;  3EU3 A;  1SK0 A;  3HZ8 A;  3GKK A;  1ZYQ B;  2PN8 A;  2KOK A;  2IPA A;  3MDK A;  1JZD A;  3D4T A;  3M9J A;  3H4K A;  2YJH A;  1FB6 A;  2OBI A;  3RDW A;  1GTU A;  2HLS A;  2H1A A;  2VL9 A;  4L0U A;  1XWG A;  2VIM A;  1GUH A;  3LQ7 A;  1XBS A;  1A0R P;  1FOV A;  4WR5 A;  4LLR A;  3Q19 A;  1QMV A;  1YEX A;  4F2I A;  2JL4 A;  1VF1 A;  3TKQ A;  4Z7X A;  4HZ4 A;  2YWI A;  2JSZ A;  2DJK A;  2JU5 A;  2X8G A;  1VF4 A;  4RI6 A;  2HNL A;  2VL2 C;  3IAS 2;  2IMF A;  3GUR A;  2V6K A;  2LV3 A;  2C0D A;  1EEJ A;  3E0U A;  5DVB A;  1T1V A;  3EVI A;  2GT5 A;  1PX6 A;  5IMF A;  12GS A;  2GSS A;  1TRS A;  2DC5 A;  3BD2 A;  4N0Z A;  5CRW A;  2AV4 A;  2YV7 A;  4NAX A;  3WYW A;  4KGI A;  1YZX A;  2GZP A;  4EUY A;  3F4S A;  4OFT A;  3QR6 A;  5A5K A;  2MMA A;  1VF3 A;  2EIO A;  1XPV A;  3APO A;  1V57 A;  2H19 A;  2CQ9 A;  5C04 A;  1SKW B;  2X64 A;  11GS A;  4AF2 A;  2D2Z A;  4TXO B;  3TKR A;  1GUL A;  3KMO A;  2IMK A;  3IE3 A;  4MDC A;  3ZIJ A;  1QUW A;  3G9B A;  1R7H A;  5ELA A;  1HYU A;  2CVK A;  3GIX A;  4TXO A;  5EY6 A;  4JRR A;  5CRH A;  16GS A;  1K0A A;  3DGQ A;  2E0Q A;  6GSV A;  1SEN A;  3QPM A;  1EGO A;  2WRT A;  5DAK A;  5J9C A;  1WJK A;  3BCK A;  3M9K A;  5CRE A;  4EKZ A;  2B5X A;  1SL2 B;  2VCV A;  3SBC A;  2O8V B;  1QQ2 A;  4ZBB A;  3LOR A;  3E3E A;  3IBH A;  3HYP A;  3APQ A;  2G2Q A;  4KDY A;  1K0C A;  1ZL9 A;  1PL2 A;  1O73 A;  2F51 A;  1TW9 A;  1K3Y A;  2O7K A;  3UAR A;  1DSB A;  3TB2 A;  2GGT A;  2VCZ A;  1XOB A;  3GRX A;  2GQL A;  1MD4 A;  1R5A A;  4ZB6 A;  4EL1 A;  5INY A;  3C73 A;  1G0T A;  1G7O A;  3Q18 A;  4XHM A;  2IJY A;  2EIR A;  1SJZ A;  4E8E A;  4ZBA A;  3KD0 A;  3K8N A;  1M9B A;  3ZVJ A;  4WET A;  4OD7 A;  3VWU A;  1SKS B;  4K8M A;  2YN1 A;  5FWG A;  5JCW A;  4PQ1 A;  5CRG A;  1M99 A;  1XWK A;  3RAZ A;  1H4O A;  3G7J A;  2LJA A;  1K0B A;  3QDN A;  3UVT A;  4IW9 A;  5KEJ A;  3C1R A;  2LRC A;  4MP4 A;  2KUC A;  3GMF A;  5AIX A;  3MNG A;  1UN2 A;  2H6Y A;  3LYP A;  5IO2 A;  2FWE A;  4LMW A;  3GL5 A;  2L57 A;  3EIN A;  4TVE A;  2LUS A;  3ERF A;  1A8Y A;  3M3M A;  3BCI A;  3CBU A;  4NWY A;  3CRU A;  4G2E A;  5HR0 A;  3DWV A;  3LWA A;  5ECH B;  1S3D A;  2N5B A;  3HY2 A;  3LYK A;  3NOF A;  2C1Y A;  1E2Y A;  1WWJ A;  4WKW A;  4HQZ A;  4ILF A;  3KJY A;  2YNX A;  1FAA A;  1N2A A;  4TR3 A;  3KP9 A;  2H71 A;  4ZL7 A;  2H72 A;  1ZOF A;  3F9U A;  3KZQ A;  1EOG A;  1V2A A;  2TRX A;  1PRX A;  2FA4 A;  1EV4 A;  1Z6N A;  5A4W A;  5CNW A;  1BED A;  4BVY A;  4IKH A;  2OKA A;  3V1W A;  1K0N A;  2LNS A;  4K9Z A;  2VD1 A;  3DVW A;  1DE1 A;  1XWB A;  1UA5 A;  3EWL A;  4V1A g;  9GSS A;  1GWC A;  4KUN A;  3GHA A;  2VM2 A;  5C00 A;  1EV9 A;  1EZK A;  1Q4J A;  3HJP A;  1B9X C;  2KP2 A;  4ZIJ A;  5ENU A;  4QL7 A;  3VLN A;  3ZTL A;  1EWX A;  2C0G A;  1OKT A;  2WJU A;  1GSF A;  5DCG A;  3GX0 A;  2YP6 A;  4ULX A;  3TDG A;  2YJ7 A;  2HYX A;  4EF0 A;  4EO3 A;  4HDE A;  5GZZ B;  1TRU A;  1CQH A;  3WGX A;  1XVW A;  1USB A;  1CQG A;  3NIV A;  1B4Q A;  3WD6 A;  1GSD A;  2LRT A;  1KNG A;  1TOF A;  2DJ1 A;  3W8J A;  2VM1 A;  3SWL A;  1TRW A;  1XW9 A;  1YJ6 A;  2LTK A;  2O89 A;  3TKS A;  4IQA A;  3ZL5 A;  1U6T A;  1WP0 A;  5JCU A;  2C4J A;  4LL4 B;  3TUE A;  2DSA A;  2CX4 A;  5DQS A;  5H5Q A;  3GSS A;  1URM A;  2IWT A;  5DJL A;  4DSR A;  2P5R A;  1SK2 A;  3ERW A;  5F8B A;  2AJQ B;  1NSW A;  2MMO A;  2OJL A;  1YDK A;  3HVS A;  2PVQ A;  2RM6 A;  1HNC A;  2KHP A;  2NDO A;  3C7M A;  4GRF A;  3FK8 A;  1J08 A;  5LD0 A;  2HZE B;  4NMU A;  2FD3 A;  1NHO A;  4F0B A;  4MPG A;  4NXI A;  3C1S A;  3GKM A;  1O6J A;  4NV5 A;  4DEJ A;  2B1L A;  3I6A A;  1TK8 B;  3JCM L;  4YQV A;  1MEK A;  2DMM A;  3C8E A;  3L9U A;  2PBJ A;  4IBP A;  3FZA A;  4NHZ A;  2YWO A;  2XPE A;  4MJE A;  4Q5R A;  2IMD A;  2L6D A;  3L0H A;  3ZIT A;  2FWH A;  5IPG A;  1ZMA A;  4CHS A;  5HR2 A;  5AIV A;  5CO3 A;  3IOS A;  2FLS A;  3U5R E;  3HVX A;  2YCD A;  4KAE A;  1XWA A;  2YWM A;  3IPZ A;  1GH2 A;  5DAL B;  2FA8 A;  2QC7 A;  3DEX A;  5D73 A;  4G9H A;  3F63 A;  3D4M A;  2V2G A;  2H73 A;  2ZUP A;  1SD9 A;  2H1G A;  5D9V A;  5GAN D;  4XS4 B;  1F3B A;  5HQP A;  4K0G A;  1MTC A;  4JR4 A;  4GWR A;  1ZCP A;  4XS4 A;  2L5L A;  4V2L A;  4JR6 A;  5JWQ B;  4N0V A;  2IMI A;  4HI7 A;  3DD3 A;  1PKZ A;  1OVN A;  2MMN A;  3HZ4 A;  1T8E B;  1GTI A;  3PIN A;  3BBY A;  1I9D A;  3RPP A;  3FR9 A;  4OO5 A;  2R5G A;  3IAM 2;  4X1U A;  4FYB A;  2CV4 A;  2GQM A;  1JLW A;  3OR5 A;  5JCG A;  1B48 A;  4O7H A;  4WF4 A;  3UIW A;  1O81 A;  2XBQ A;  3P90 A;  2ALB A;  1O8X A;  3FZ9 A;  2RII A;  2F9S A;  2R3X A;  2V32 A;  4TOP A;  2B7J A;  4I6X A;  2HSY A;  1NM3 A;  4F9Z A;  2OAC A;  3VPT A;  2GSR A;  3KH9 A;  3L78 A;  1XWC A;  1Z9H A;  3C71 A;  3TJB A;  4RUV A;  3NZN A;  2WZ9 A;  4PUR A;  1IYH A;  2IFQ B;  4YQU A;  2IN3 A;  2LQQ A;  1TI3 A;  4MPF A;  3GV1 A;  4LMV A;  1X9M B;  1M2D A;  5G31 A;  1HNB A;  2L59 A;  2N5F A;  4IS0 A;  3FKF A;  2VCT A;  2DLX A;  3KP8 A;  2L4C A;  4HJ2 A;  3KTL A;  2EC4 A;  3EMX A;  1AIU A;  1PD2 1;  4IEL A;  1W4V A;  3RHB A;  2Z9S A;  5HFK A;  1MDK A;  2KP1 A;  5J3R A;  1A0F A;  3A5W A;  5IMA A;  1R4W A;  1K3L A;  1EGR A;  2GLR A;  2WDU A;  3QMX A;  5AGY A;  2GS3 A;  1SYR A;  5B7C A;  2LNT A;  1RW1 A;  1T4Y A;  1PSQ A;  1X5C A;  4IN0 A;  5L71 A;  3GFK A;  3TCO A;  3IHQ A;  4YAP A;  4HEA 2;  4J56 E;  1ZYE A;  3FW2 A;  18GS A;  4BPY A;  1B9Y C;  2VLT A;  1TU7 A;  3H8Q A;  4CW9 A;  4HU9 A;  2CVB A;  4PUA A;  2LRN A;  3GYK A;  4RQX A;  2CAQ A;  2DBC A;  1DUG A;  2GVP A;  2TRC P;  2FNO A;  2C3N A;  2PWJ A;  2F8F A;  4KX4 A;  4J2F A;  2RLI A;  3IK7 A;  5A4U A;  1XFL A;  5ABR A;  5IMD A;  4V2M A;  2X99 A;  2ZNM A;  2ON5 A;  4IJ3 A;  2PU9 C;  5JWR B;  4KW6 A;  1OAZ A;  1EOH A;  1NHY A;  1Z3E A;  3ZLP A;  2M80 A;  1TRV A;  3I69 A;  2AB6 A;  2OAD A;  3PR8 A;  4BVX A;  5D9T A;  1AXD A;  3HXS A;  1SKR B;  5F05 A;  5DJM A;  4POM A;  4YH2 A;  5D9X A;  4I5Q A;  5F07 A;  4ZIL A;  1VRS D;  2VCW A;  4EDY A;  2RM5 A;  3ED3 A;  2A2S A;  2PGT A;  4WF5 A;  3F0I A;  3AY8 A;  4KCA A;  3ZFL A;  3GST A;  2NPB A;  2YOI A;  2LS5 A;  3VI7 A;  1GNE A;  4J57 E;  2HFD A;  3UVH A;  2A4V A;  3M0F A;  4EE0 A;  1A8L A;  2H75 A;  1KTE A;  5F06 A;  4AJ8 A;  1ZZY A;  1HNA A;  1K0O A;  2YZH A;  3GA4 A;  2BJX A;  3U6V A;  1FG4 A;  4E8H A;  3I43 A;  4XS1 A;  3DVX A;  2C8U A;  4X0X A;  4AJ6 A;  13GS A;  2GQK A;  3IC4 A;  1R5P A;  4POK A;  3F3Q A;  2FCH A;  5G5E A;  3F6F A;  3UAP A;  1PL1 A;  1M2B A;  3IK9 A;  1X9S B;  3DYR A;  3KIJ A;  5D8I A;  5GAP D;  3UBK A;  2DJJ A;  3FYG A;  5J41 A;  1AQX A;  2GTU A;  1U87 A;  2FHE A;  4K2D A;  3F4T A;  1TKD B;  4PXO A;  1SJ6 A;  1B4P A;  2PUK C;  2V1M A;  1BG5 A;  1T7P B;  1GLP A;  1QK8 A;  5H5S A;  3KTB A;  3TRQ A;  1XOA A;  1M7T A;  1S3A A;  2M46 A;  2R4V A;  4EVM A;  4X43 A;  1F37 A;  3GKX A;  4MJA A;  3TKS E;  3DKS A;  2H30 A;  5DQY A;  3RHC A;  3VWX A;  4N11 A;  2F3M A;  2X8C A;  3LEF A;  2ON7 A;  3IA1 A;  2WGR A;  1O8W A;  4TN8 A;  2HT9 A;  3EE2 A;  2JAC A;  1JLV A;  3CSJ A;  2B3S A;  5B6N A;  3LXT A;  2P31 A;  1M9A A;  2RUF A;  4ZL9 A;  1FHE A;  4K6X A;  2R2J A;  2AAW A;  3H93 A;  5ECS A;  3M1G A;  5ECO B;  1YY7 A;  3R2Q A;  4JZQ A;  1WRY A;  3CMI A;  2FUG 2;  5HR3 A;  4TR1 B;  1U3A A;  2YAN A;  1FO5 A;  4KH7 A;  2OE3 A;  2LJK A;  4TR1 A;  1EP8 A;  3DRN A;  3TOT A;  5ELG A;  4NHW A;  3F8U A;  2MZC A;  5ECN B;  5G2Z A;  4ZBD A;  3RBT A;  1YF0 A;  2V6O A;  1YEP A;  1ON4 A;  2XBI A;  3P7X A;  1DE2 A;  2CA8 A;  2JAD A;  1JFU A;  3KH7 A;  1ACV A;  3M8N A;  4IJI A;  4GQF A;  1OC8 A;  1TK5 B;  3ZML A;  1GSS A;  1GSY A;  3GH6 A;  3GNJ A;  2FWG A;  2PMT A;  3BOA A;  1PX7 A;  2KLX A;  2JZR A;  3VK9 A;  4BA7 A;  2CX3 A;  3APS A;  5ECQ B;  2BTO T;  4DSQ A;  1TK0 B;  1X0R A;  3DXB A;  5E59 A;  4IGJ A;  1J0F A;  1WIK A;  1GUM A;  1HQO A;  3LG6 A;  1PGT A;  3N9J A;  2B1K A;  1OC9 B;  2VCX A;  3BJ5 A;  5J5N A;  1ZGN A;  7GSS A;  2XPD A;  4P3Y B;  1GNW A;  3LJR A;  2GSQ A;  1V40 A;  3D5J A;  4KE3 A;  1BQ7 A;  1Y25 A;  3EMP A;  4O32 A;  2B7K A;  4HZ2 A;  2H76 A;  4N10 A;  1H75 A;  3GH9 A;  3P8W A;  4HU7 A;  2WS2 A;  4FYC A;  4NPB A;  2MMZ A;  5LCZ A;  1THO A;  2B5E A;  4L0W A;  3IRA A;  3L4N A;  4OFN A;  1X9W B;  1C72 A;  2HZE A;  5G1K A;  5KN1 A;  1O7U A;  3VUR A;  5ECM B;  3VFI A;  4YQM A;  2C80 A;  4KSO A;  2VCQ A;  3KMN A;  3TKS C;  3CRT A;  3O6T A;  1BJX A;  3QAW A;  1G6W A;  1VGL A;  2I81 A;  1AAZ A;  3MWH A;  4LA1 A;  3VPQ A;  3LSZ A;  4ZB8 A;  2OBK A;  3HA9 A;  5HR1 A;  4PNF A;  5CYY A;  3GTU B;  1MDJ A;  4CDO A;  1YF1 A;  4NV2 A;  1AQW A;  5AIS A;  4K0N A;  3A3T A;  6GSY A;  3DIE A;  3GTU A;  1AC1 A;  4G19 A;  2K9F A;  2NTO A;  1K3O A;  2HE3 A;  5ECP B;  5B8B A;  4JE1 A;  5DAL A;  1TI1 A;  3EU4 A;  1Z5Y E;  3L9S A;  1XW5 A;  2L5O A;  3CSH A;  2QSI A;  1PMT A;  1ABA A;  1JZR A;  1T00 A;  3RPN A;  2HZF A;  1WE0 A;  1T4Z A;  5ID2 B;  2N5A A;  2AYT A;  2H0G A;  2WFC A;  2R6K A;  1EP7 A;  5IOX A;  3ZFB A;  1UC7 A;  1E6B A;  1THX A;  5G30 A;  3UOM A;  4GLT A;  1SL1 B;  4F0C A;  3FZ5 A;  4GST A;  2H66 A;  3ZMK A;  3GUS A;  1FVJ A;  4XTS A;  4N30 A;  3EC3 A;  5HFI A;  1GUK A;  4KDU A;  4V2N A;  3W8S A;  3WGE A;  1M0U A;  5ECI B;  4PQI A;  4BWQ A;  2M72 A;  1G6Y A;  3VI5 A;  4PUF C;  2H74 A;  1OYJ A;  4HJM A;  3DML A;  1IYI A;  2C0F A;  1BX9 A;  2VL2 A;  5EL8 A;  3ZZX A;  3G7I A;  4PQH A;  3KEB A;  4MCU A;  1SYX A;  1XZO A;  2HSH A;  4MLY A;  5DDL A;  4D73 B;  5D93 A;  4KDX A;  4G10 A;  1HD2 A;  3A2V A;  5ECK B;  2FWF A;  3GKN A;  2LKU A;  2E2M A;  4D73 A;  3IDV A;  5ECR B;  2IFQ A;  5DCH A;  4POB A;  4L8E A;  3GN3 A;  2DML A;  2GDR A;  5H5R A;  3MAK A;  5GST A;  1YKA A;  4MMM A;  2RUE A;  1V58 A;  3HDC A;  4HUA A;  2LJR A;  3D0Z A;  2K8S A;  1A2J A;  3KGK A;  3WT2 A;  5KN2 A;  5B6M A;  6GSS A;  1GLQ A;  2P5Q A;  1PA3 A;  5B8A A;  8GSS A;  4GSN A;  2GT6 A;  4ML6 A;  4AGS A;  4TW5 A;  3GL3 A;  3IR4 A;  3QFB C;  1YKC A;  1GSE A;  2WUL A;  1TP9 A;  2H6X A;  5G1L A;  20GS A;  1GTA A;  5E4W A;  1Z7R A;  5IO0 A;  3QAG A;  3EUR A;  3ME8 A;  1EEM A;  1T3B A;  3PH9 A;  3TJF A;  1UVZ A;  2H0I A;  4Q5F A;  3IXR A;  4JBB A;  6GSX A;  4XCS A;  2CZ3 A;  4KB3 A;  2L4Q A;  5DBQ A;  1YQ1 A;  3HJM A;  4MK3 A;  2OE0 A;  2LST A;  5IMZ A;  2HI7 A;  2IL3 A;  2JSY A;  1ST9 A;  1A24 A;  4IQ1 A;  4DVC A;  3VWV A;  3CXG A;  4GQC A;  1LJR A;  2VUP A;  1VF2 A;  1F2E A;  1SU9 A;  3D21 A;  4BL7 A;  2XHF A;  3FZ4 A;  5COH A;  2HRN A;  5A4V A;  5IM9 A;  1M2A A;  2I9H A;  4F03 A;  3FRC A;  2E7P A;  2LQO A;  5DAK B;  3TOU A;  1JHB A;  4MA9 A;  5KN0 A;  1Z6M A;  1Z7P A;  5IQY A;  1ERU A;  1F3A A;  4ECB A;  4O92 A;  5D96 A;  1AUC A;  1KBN A;  3FY7 A;  2CZ2 A;  4HQS A;  1XIY A;  2MYG A;  2VLV A;  4Q5Q A;  5EPF A;  3J7Y b;  2VOC A;  1B8X A;  3O3T A;  4PNG A;  2OE1 A;  3TJJ A;  3HJO A;  2FY6 A;  2JZT A;  2B5Y A;  4I97 A;  3QD9 A;  2TIR A;  5HFG A;  1O85 A;  3LFL A;  1TU8 A;  6GST A;  5ECL B;  5GSS A;  3A2W A;  10GS A;  2AUV A;  2IME A;  4WR4 A;  3F3R A;  4GSS A;  4ECC A;  3LXZ A;  1GSQ A;  3VWW A;  1Q98 A;  3PGT A;  3CTF A;  4OO4 A;  5IMC A;  2A2R A;  1JZO A;  5KN3 A;  1BYE A;  22GS A;  4QQ7 A;  4L5O A;  3QCP A;  3UMA A;  4XS6 A;  5FHI A;  4POL A;  2FGX A;  4WBJ A;  4QL9 A;  1FW1 A;  1A2L A;  4IVF A;  3UJ1 A;  4KND A;  3EYT A;  2PPT A;  1MDI A;  3ZRD A;  2I3Y A;  4TR4 A;  5IMV A;  2H6Z A;  2YPM A;  1R26 A;  3US3 A;  3O76 A;  4BWS A;  3CYN A;  4HOJ A;  3P2A A;  2R37 A;  4IHU A;  3QFA C;  2P0G A;  4ECJ A;  1ERV A;  4K7I A;  3L9V A;  3Q6O A;  1PKW A;  3ZYW A;  4AJ7 A;  5CAX A;  2IIY A;  1TTZ A;  1NW2 A;  1GRX A;  1V9W A;  1K0D A;  4ML1 A;  1X5E A;  2DIY A;  2QKE A;  4KCE A;  1QGV A;  2CT6 A;  2H1D A;  1WMJ A;  2GST A;  4OCF A;  4TR0 A;  4ZB9 A;  3HD5 A;  4JU5 A;  1Y6E A;  4XRA A;  3TJG A;  2PVO C;  2BMX A;  3TKP A;  2VO4 A;  4EDZ A;  2X8H A;  1ML6 A;  2F8A A;  2H8L A;  4EXJ A;  3LGC A;  1F6M C;  3J7Y k;  3CSI A;  2K8V A;  2E2G A;  3N5O A;  2REM A;  4TKY A;  2NBS A;  5IOW A;  4ZXG A;  1I5G A;  2MBS A;  4TXV A;  4OCE A;  2GZY A;  1AQV A;  3CTG A;  1SD8 A;  2PER A;  4I2U A;  3G7Y A;  5AN1 A;  3Q74 A;  2ES7 A;  2YZU A;  4PGT A;  1A2M A;  1GTB A;  3UL3 A;  2LEG A;  1BAY A;  1N8J A;  2H0H A;  3ME7 A;  4MJC A;  2L6C A;  5LNK e;  1ERW A;  2AHE A;  2C0E A;  2CVD A;  2VAF A;  4ID0 A;  4LL1 B;  2EIQ A;  4GCI A;  4MZW A;  1QXH A;  2K18 A;  2JZS A;  3TJK A;  5D9W A;  3IV4 A;  5G5F A;  1V98 A;  4GXZ A;  4OFM A;  3QOU A;  3S9F A;  1TXX A;  2DJ3 A;  4O5R A;  4MZB A;  3KM6 A;  3ZVJ D;  2DIZ A;  3MSZ A;  2I4A A;  4WBR D;  4FIW A;  4K7O A;  1K0M A;  2J9H A;  4ISD A;  4MF7 A;  4ZL8 A;  1OC9 A;  2K6V A;  2OA7 A;  4I2T A;  2NVL A;  2H70 A;  2I1U A;  4I8B A;  3WGD A;  2HXK A;  3ISO A;  1QFN A;  4FH8 A;  1LU4 A;  1WOU A;  4ECI A;  3HKR A;  3KCM A;  3ERG A;  4F82 A;  4ACS A;  1SL0 B;  3UEM A;  2YV9 A;  2YWN A;  1GP1 A;  1LBK A;  2H1B A;  1TDI A;  3FR3 A; 
#chains in the Genus database with same CATH topology
 1TJD A;  4BIK A;  4XRD A;  4JED A;  3ZRE A;  3KXO A;  2J23 A;  1OE8 A;  3HCZ A;  2V41 A;  2HRA A;  4GTU A;  4WXT A;  5CRD A;  1RQM A;  1SK1 A;  5F0G A;  1FB0 A;  1X5D A;  2DJ2 A;  3F6D A;  1WPI A;  2VL3 A;  3H79 A;  4FYU A;  2O87 A;  3I9V 2;  4KSM A;  4FO5 A;  1GSU A;  1ERT A;  2VLU A;  3H1N A;  4WEY A;  4HS1 A;  1XG8 A;  3TRX A;  2G0F A;  3FR6 A;  1XXU A;  17GS A;  4MZC A;  1FVK A;  1OKD A;  1KEB A;  1U88 A;  3UBL A;  5J4U A;  5KOX A;  1JZW A;  4H86 A;  1AW9 A;  2C3T A;  2CAI A;  1G7E A;  1U3I A;  4IP1 A;  4MH2 A;  3D6I A;  4OMV A;  6GSU A;  4MF6 A;  2DJ0 A;  4PX1 A;  1F9M A;  5FT3 A;  3W6G A;  1XW6 A;  4OWY A;  1MD3 A;  1OC3 A;  1PN9 A;  4KA0 A;  4V1A p;  4Q5N A;  3A2X A;  2XC2 A;  4K7N A;  1OE7 A;  4L5L A;  1RK4 A;  2B6M A;  4IP6 A;  3WT1 A;  5IPH A;  5IIZ A;  5CP1 A;  2ZCT A;  3FHK A;  3E9J B;  2H01 A;  3GX8 A;  1XCC A;  1GL8 A;  3QAV A;  1XVQ A;  1W89 A;  2HRF A;  5ID2 A;  3HHV A;  2WCI A;  1PQN A;  3FEU A;  1S3C A;  2O85 A;  4GF0 A;  4MAB A;  4RQR A;  4YAV A;  1SJI A;  3F4R A;  3TRP A;  1A23 A;  2QGV A;  2VD0 A;  4HSC X;  4XIH A;  2C3Q A;  4DSS B;  4RI7 A;  5JWO B;  2UZ8 A;  5EVO A;  14GS A;  4EC0 A;  4MJB A;  1DBY A;  2WB9 A;  4MH3 A;  4K1F A;  4MF5 A;  4TRX A;  4DSS A;  6GSW A;  2MBT A;  3D22 A;  5J9B A;  1ILO A;  3TGZ A;  3HVV A;  2DKH A;  3ZIV A;  2GZZ A;  19GS A;  1J9B A;  3EU3 A;  1SK0 A;  3HZ8 A;  3GKK A;  4PTS A;  1ZYQ B;  2PN8 A;  2KOK A;  2IPA A;  3MDK A;  1JZD A;  3D4T A;  3M9J A;  4ICY A;  3H4K A;  3R3E A;  2YJH A;  1FB6 A;  2OBI A;  3RDW A;  1GTU A;  2HLS A;  2H1A A;  2VL9 A;  4L0U A;  1XWG A;  2VIM A;  1GUH A;  3LQ7 A;  1XBS A;  1A0R P;  1FOV A;  4WR5 A;  4LLR A;  3Q19 A;  1QMV A;  1YEX A;  4F2I A;  2JL4 A;  2R0G A;  1VF1 A;  3TKQ A;  4Z7X A;  4HZ4 A;  2YWI A;  2JSZ A;  2DJK A;  4K2X A;  2JU5 A;  2X8G A;  1VF4 A;  4RI6 A;  2HNL A;  2VL2 C;  3IAS 2;  2IMF A;  3GUR A;  2V6K A;  2LV3 A;  2C0D A;  1EEJ A;  3E0U A;  5DVB A;  1T1V A;  3EVI A;  2GT5 A;  1PX6 A;  5IMF A;  12GS A;  2GSS A;  1TRS A;  2DC5 A;  3BD2 A;  4N0Z A;  5CRW A;  2AV4 A;  2YV7 A;  4NAX A;  3WYW A;  4KGI A;  1YZX A;  2GZP A;  4EUY A;  3F4S A;  4OFT A;  3QR6 A;  5A5K A;  2MMA A;  1VF3 A;  2EIO A;  3LW9 A;  1XPV A;  3APO A;  1V57 A;  2H19 A;  2CQ9 A;  5C04 A;  1SKW B;  2X64 A;  11GS A;  4AF2 A;  2D2Z A;  4TXO B;  3TKR A;  1GUL A;  3KMO A;  4EIQ A;  2IMK A;  3IE3 A;  4MDC A;  3ZIJ A;  1QUW A;  3G9B A;  1R7H A;  5ELA A;  1HYU A;  2CVK A;  3GIX A;  4TXO A;  5EY6 A;  4JRR A;  5CRH A;  16GS A;  1K0A A;  3DGQ A;  2E0Q A;  6GSV A;  1SEN A;  3QPM A;  1EGO A;  2WRT A;  5DAK A;  5J9C A;  1WJK A;  3BCK A;  3M9K A;  5CRE A;  4EKZ A;  2B5X A;  1SL2 B;  2VCV A;  3SBC A;  2O8V B;  1QQ2 A;  4ZBB A;  3LOR A;  3E3E A;  3IBH A;  3HYP A;  3APQ A;  2G2Q A;  4KDY A;  1K0C A;  1ZL9 A;  1PL2 A;  4BVX B;  1O73 A;  2F51 A;  1TW9 A;  1K3Y A;  2O7K A;  3UAR A;  1DSB A;  3TB2 A;  2GGT A;  2VCZ A;  1XOB A;  3MIX A;  3GRX A;  2GQL A;  1MD4 A;  1R5A A;  4ZB6 A;  4EL1 A;  5INY A;  3C73 A;  1G0T A;  1G7O A;  3Q18 A;  4XHM A;  2HSM A;  2IJY A;  2EIR A;  1SJZ A;  4E8E A;  4ZBA A;  3KD0 A;  3K8N A;  1M9B A;  3ZVJ A;  4WET A;  4OD7 A;  3VWU A;  1SKS B;  1M3I A;  4K8M A;  2YN1 A;  5FWG A;  5JCW A;  4PQ1 A;  5BRT A;  5CRG A;  1M99 A;  1XWK A;  3RAZ A;  1H4O A;  3G7J A;  2LJA A;  1K0B A;  3QDN A;  3UVT A;  4IW9 A;  4G0L A;  5KEJ A;  3C1R A;  2LRC A;  4MP4 A;  2KUC A;  3GMF A;  5AIX A;  3MNG A;  1UN2 A;  2H6Y A;  3LYP A;  5IO2 A;  2FWE A;  4LMW A;  3GL5 A;  2L57 A;  3EIN A;  4TVE A;  2LUS A;  3ERF A;  1A8Y A;  3M3M A;  3BCI A;  3CBU A;  4NWY A;  3CRU A;  4G2E A;  5HR0 A;  3DWV A;  3LWA A;  5ECH B;  1S3D A;  2N5B A;  3HY2 A;  3LYK A;  3NOF A;  4KF9 A;  2C1Y A;  1E2Y A;  1WWJ A;  4WKW A;  4HQZ A;  4ILF A;  3KJY A;  2YNX A;  1FAA A;  1N2A A;  4TR3 A;  3KP9 A;  2H71 A;  4ZL7 A;  2H72 A;  1ZOF A;  3F9U A;  3KZQ A;  1EOG A;  1V2A A;  2TRX A;  1PRX A;  2FA4 A;  1EV4 A;  1Z6N A;  5A4W A;  5CNW A;  1BED A;  4BVY A;  4IKH A;  2OKA A;  3V1W A;  1K0N A;  2LNS A;  4K9Z A;  2VD1 A;  3DVW A;  1DE1 A;  1XWB A;  1UA5 A;  3EWL A;  4V1A g;  9GSS A;  1GWC A;  4KUN A;  3GHA A;  2VM2 A;  5C00 A;  1EV9 A;  1EZK A;  1Q4J A;  3HJP A;  1B9X C;  2KP2 A;  4ZIJ A;  5ENU A;  4QL7 A;  3VLN A;  3ZTL A;  1EWX A;  2C0G A;  1OKT A;  2WJU A;  4USS A;  1GSF A;  5DCG A;  3GX0 A;  2YP6 A;  4ULX A;  3TDG A;  2YJ7 A;  2HYX A;  4EF0 A;  4EO3 A;  4HDE A;  5GZZ B;  1TRU A;  1CQH A;  3WGX A;  1XVW A;  1USB A;  1CQG A;  3NIV A;  1B4Q A;  3WD6 A;  1GSD A;  2LRT A;  4K5R A;  1KNG A;  2DKI A;  1TOF A;  2DJ1 A;  3W8J A;  2VM1 A;  3SWL A;  1TRW A;  1XW9 A;  1YJ6 A;  2LTK A;  2O89 A;  3TKS A;  4IQA A;  3ZL5 A;  1U6T A;  1WP0 A;  5JCU A;  2C4J A;  4LL4 B;  3TUE A;  2DSA A;  2CX4 A;  5DQS A;  5H5Q A;  3GSS A;  1URM A;  2IWT A;  5DJL A;  4DSR A;  2P5R A;  1SK2 A;  3ERW A;  5F8B A;  2AJQ B;  1NSW A;  2MMO A;  2OJL A;  1YDK A;  3HVS A;  2PVQ A;  2RM6 A;  1HNC A;  2KHP A;  2NDO A;  3C7M A;  4GRF A;  3FK8 A;  1J08 A;  5LD0 A;  2HZE B;  4NMU A;  2FD3 A;  1NHO A;  4F0B A;  4MPG A;  4NXI A;  3C1S A;  3GKM A;  1O6J A;  4NV5 A;  4DEJ A;  2B1L A;  3I6A A;  1TK8 B;  3JCM L;  4YQV A;  1MEK A;  2DMM A;  3C8E A;  3L9U A;  2PBJ A;  4IBP A;  3FZA A;  4NHZ A;  2YWO A;  2XPE A;  4MJE A;  4Q5R A;  2IMD A;  2L6D A;  3L0H A;  3ZIT A;  2FWH A;  5IPG A;  1ZMA A;  4CHS A;  5HR2 A;  5AIV A;  5CO3 A;  3IOS A;  2FLS A;  3U5R E;  3HVX A;  2YCD A;  4KAE A;  1XWA A;  2YWM A;  3IPZ A;  1GH2 A;  5DAL B;  2FA8 A;  2QC7 A;  3DEX A;  5D73 A;  4G9H A;  3F63 A;  3D4M A;  2V2G A;  2H73 A;  2ZUP A;  1SD9 A;  2H1G A;  5D9V A;  5GAN D;  4XS4 B;  1F3B A;  3FMW A;  5HQP A;  4K0G A;  1MTC A;  4JR4 A;  4GWR A;  1ZCP A;  4XS4 A;  2L5L A;  4V2L A;  4JR6 A;  5JWQ B;  4N0V A;  2IMI A;  4HI7 A;  3DD3 A;  1PKZ A;  1OVN A;  2MMN A;  3HZ4 A;  1T8E B;  1GTI A;  3PIN A;  3BBY A;  1I9D A;  3RPP A;  3FR9 A;  4OO5 A;  2R5G A;  3IAM 2;  4X1U A;  3HVN A;  4FYB A;  2CV4 A;  2GQM A;  1JLW A;  3OR5 A;  5JCG A;  1B48 A;  4O7H A;  4WF4 A;  3UIW A;  1O81 A;  2XBQ A;  3P90 A;  2ALB A;  1O8X A;  3FZ9 A;  2RII A;  2F9S A;  2R3X A;  2V32 A;  4TOP A;  2B7J A;  4I6X A;  2HSY A;  1NM3 A;  4F9Z A;  2OAC A;  3VPT A;  2GSR A;  3KH9 A;  3L78 A;  1XWC A;  1Z9H A;  3C71 A;  3TJB A;  4RUV A;  3NZN A;  2WZ9 A;  4PUR A;  1IYH A;  2IFQ B;  4YQU A;  2IN3 A;  2LQQ A;  1TI3 A;  4MPF A;  4G0I A;  3GV1 A;  4LMV A;  1X9M B;  1M2D A;  5G31 A;  1HNB A;  2L59 A;  2N5F A;  4IS0 A;  3FKF A;  2VCT A;  4FQU A;  2DLX A;  3KP8 A;  2L4C A;  4HJ2 A;  3KTL A;  2EC4 A;  3EMX A;  1AIU A;  1PD2 1;  4IEL A;  1W4V A;  3RHB A;  2Z9S A;  5HFK A;  1MDK A;  2KP1 A;  5J3R A;  4Z2T A;  1A0F A;  3A5W A;  5IMA A;  2R0C A;  1R4W A;  1K3L A;  1EGR A;  2GLR A;  2WDU A;  3QMX A;  5AGY A;  2GS3 A;  4X4J A;  1SYR A;  5B7C A;  2LNT A;  1RW1 A;  1T4Y A;  1PSQ A;  1X5C A;  4IN0 A;  5L71 A;  2R0P A;  3GFK A;  3TCO A;  3IHQ A;  4YAP A;  4HEA 2;  3PPU A;  4J56 E;  1ZYE A;  3FW2 A;  18GS A;  4BPY A;  1B9Y C;  2VLT A;  1TU7 A;  3H8Q A;  4CW9 A;  4HU9 A;  2A2P A;  2CVB A;  4PUA A;  2LRN A;  3GYK A;  4RQX A;  2CAQ A;  2DBC A;  1DUG A;  2GVP A;  2TRC P;  2FNO A;  2C3N A;  2PWJ A;  2F8F A;  4KX4 A;  4J2F A;  2RLI A;  3IK7 A;  5A4U A;  1XFL A;  5ABR A;  5IMD A;  4V2M A;  2X99 A;  2ZNM A;  2ON5 A;  4IJ3 A;  2PU9 C;  5JWR B;  4KW6 A;  1OAZ A;  1EOH A;  1NHY A;  1Z3E A;  3ZLP A;  2M80 A;  1TRV A;  3I69 A;  2AB6 A;  2OAD A;  3PR8 A;  4BVX A;  5D9T A;  1AXD A;  3HXS A;  1SKR B;  5F05 A;  5DJM A;  4POM A;  4YH2 A;  5D9X A;  4I5Q A;  5F07 A;  4ZIL A;  1VRS D;  2VCW A;  1FOH A;  4EDY A;  2RM5 A;  3ED3 A;  4A5P A;  2A2S A;  2PGT A;  4WF5 A;  3F0I A;  3AY8 A;  4KCA A;  3ZFL A;  3GST A;  2NPB A;  2YOI A;  2LS5 A;  3VI7 A;  1GNE A;  4J57 E;  2HFD A;  3UVH A;  2A4V A;  3M0F A;  4EE0 A;  1A8L A;  2H75 A;  1KTE A;  5F06 A;  4AJ8 A;  1ZZY A;  1HNA A;  1K0O A;  2YZH A;  3GA4 A;  2BJX A;  3U6V A;  1FG4 A;  4E8H A;  3I43 A;  4XS1 A;  3DVX A;  2C8U A;  4X0X A;  4AJ6 A;  13GS A;  2GQK A;  3IC4 A;  1R5P A;  4POK A;  3F3Q A;  2FCH A;  5G5E A;  3F6F A;  3UAP A;  1PL1 A;  1M2B A;  3IK9 A;  1X9S B;  3DYR A;  3KIJ A;  5D8I A;  5GAP D;  3UBK A;  2DJJ A;  3FYG A;  5J41 A;  1AQX A;  2GTU A;  1U87 A;  2FHE A;  4K2D A;  3F4T A;  1TKD B;  4PXO A;  1SJ6 A;  1B4P A;  2PUK C;  2V1M A;  1BG5 A;  1T7P B;  1GLP A;  1QK8 A;  5H5S A;  3KTB A;  3TRQ A;  1XOA A;  1M7T A;  1S3A A;  2M46 A;  2R4V A;  4EVM A;  4X43 A;  1F37 A;  3GKX A;  4MJA A;  3TKS E;  3DKS A;  2H30 A;  5DQY A;  3RHC A;  3VWX A;  4N11 A;  2F3M A;  2X8C A;  3LEF A;  2ON7 A;  3IA1 A;  2WGR A;  1O8W A;  4TN8 A;  2HT9 A;  3EE2 A;  2JAC A;  1JLV A;  3CSJ A;  2B3S A;  5B6N A;  3LXT A;  2P31 A;  1M9A A;  2RUF A;  4ZL9 A;  1FHE A;  4K6X A;  2R2J A;  2AAW A;  3H93 A;  5ECS A;  3M1G A;  5ECO B;  1YY7 A;  3R2Q A;  4JZQ A;  1WRY A;  3CMI A;  2FUG 2;  5HR3 A;  4TR1 B;  1U3A A;  2YAN A;  1FO5 A;  4KH7 A;  2OE3 A;  2LJK A;  4TR1 A;  1EP8 A;  3DRN A;  3TOT A;  5ELG A;  4NHW A;  3F8U A;  2MZC A;  5ECN B;  5G2Z A;  4ZBD A;  3RBT A;  1YF0 A;  2V6O A;  1YEP A;  1ON4 A;  2XBI A;  3P7X A;  1DE2 A;  2CA8 A;  2JAD A;  1JFU A;  3KH7 A;  1ACV A;  3M8N A;  4IJI A;  4GQF A;  1OC8 A;  1TK5 B;  3ZML A;  1GSS A;  1GSY A;  3GH6 A;  3GNJ A;  2FWG A;  2PMT A;  4EIP A;  3BOA A;  1PX7 A;  2KLX A;  4YKG A;  2JZR A;  3VK9 A;  4BA7 A;  2CX3 A;  3APS A;  5ECQ B;  2BTO T;  4DSQ A;  1TK0 B;  1X0R A;  3DXB A;  5E59 A;  4IGJ A;  2X4A A;  1J0F A;  1WIK A;  1GUM A;  1HQO A;  3LG6 A;  1PGT A;  2X49 A;  3N9J A;  2B1K A;  1OC9 B;  2VCX A;  4MNN A;  3BJ5 A;  5J5N A;  1ZGN A;  7GSS A;  2XPD A;  4P3Y B;  1GNW A;  3LJR A;  2GSQ A;  1V40 A;  3D5J A;  4KE3 A;  1BQ7 A;  1Y25 A;  3EMP A;  4O32 A;  2B7K A;  4HZ2 A;  2H76 A;  4N10 A;  1H75 A;  3GH9 A;  3P8W A;  4HU7 A;  2WS2 A;  4FYC A;  4NPB A;  2MMZ A;  5LCZ A;  1THO A;  2B5E A;  4L0W A;  3IRA A;  3L4N A;  4OFN A;  1X9W B;  1C72 A;  2HZE A;  5G1K A;  5KN1 A;  1O7U A;  3VUR A;  5ECM B;  3VFI A;  4YQM A;  2C80 A;  4KSO A;  2VCQ A;  3KMN A;  3TKS C;  3CRT A;  3O6T A;  1BJX A;  3QAW A;  1G6W A;  1VGL A;  2I81 A;  1AAZ A;  3MWH A;  3IHG A;  4LA1 A;  3VPQ A;  3LSZ A;  4ZB8 A;  2OBK A;  4Z2U A;  3HA9 A;  5HR1 A;  4PNF A;  5CYY A;  3GTU B;  1MDJ A;  4CDO A;  1PN0 A;  1YF1 A;  4NV2 A;  1AQW A;  5AIS A;  4K0N A;  3A3T A;  6GSY A;  2QA1 A;  3DIE A;  3GTU A;  1AC1 A;  4G19 A;  2K9F A;  2NTO A;  1K3O A;  2HE3 A;  5ECP B;  5B8B A;  4JE1 A;  5DAL A;  1TI1 A;  3EU4 A;  1Z5Y E;  3L9S A;  1XW5 A;  2L5O A;  3CSH A;  2QSI A;  1PMT A;  1ABA A;  1JZR A;  1T00 A;  3RPN A;  2HZF A;  1WE0 A;  1T4Z A;  5ID2 B;  2N5A A;  2AYT A;  2H0G A;  2WFC A;  2R6K A;  1EP7 A;  5IOX A;  4CY8 A;  3ZFB A;  1UC7 A;  1E6B A;  1THX A;  5G30 A;  3UOM A;  4GLT A;  1SL1 B;  4F0C A;  3FZ5 A;  4GST A;  2H66 A;  3ZMK A;  3GUS A;  1FVJ A;  4XTS A;  4N30 A;  3EC3 A;  5HFI A;  1GUK A;  4KDU A;  4V2N A;  3W8S A;  3WGE A;  1M0U A;  5ECI B;  4PQI A;  4BWQ A;  2M72 A;  1G6Y A;  3VI5 A;  4PUF C;  2H74 A;  1OYJ A;  4HJM A;  3DML A;  1IYI A;  2C0F A;  1BX9 A;  2VL2 A;  5EL8 A;  3ZZX A;  3G7I A;  4PQH A;  3KEB A;  1ZYN A;  4MCU A;  1SYX A;  1XZO A;  2HSH A;  4MLY A;  5DDL A;  4D73 B;  5D93 A;  4KDX A;  4G10 A;  1HD2 A;  3A2V A;  5ECK B;  2FWF A;  3GKN A;  2LKU A;  2E2M A;  4D73 A;  3IDV A;  5ECR B;  2IFQ A;  5DCH A;  4POB A;  4L8E A;  3GN3 A;  2DML A;  2GDR A;  5H5R A;  4Z2R A;  3MAK A;  5GST A;  1YKA A;  4MMM A;  2RUE A;  1V58 A;  3HDC A;  4HUA A;  2LJR A;  3D0Z A;  2K8S A;  1A2J A;  3KGK A;  3WT2 A;  5KN2 A;  5B6M A;  4YKF A;  6GSS A;  1GLQ A;  1PFO A;  2P5Q A;  1PA3 A;  5B8A A;  8GSS A;  4CY6 A;  4GSN A;  2GT6 A;  4ML6 A;  4AGS A;  4TW5 A;  2A4H A;  3GL3 A;  3IR4 A;  3QFB C;  1YKC A;  1GSE A;  2WUL A;  1TP9 A;  2H6X A;  5G1L A;  20GS A;  1GTA A;  5E4W A;  1Z7R A;  5IO0 A;  3QAG A;  3EUR A;  3ME8 A;  1EEM A;  1T3B A;  3PH9 A;  3TJF A;  1UVZ A;  2H0I A;  4Q5F A;  3IXR A;  4JBB A;  6GSX A;  4XCS A;  2CZ3 A;  4KB3 A;  2L4Q A;  5DBQ A;  1YQ1 A;  3HJM A;  4MK3 A;  2OE0 A;  2LST A;  5IMZ A;  2HI7 A;  2IL3 A;  2JSY A;  1ST9 A;  4BL7 B;  4O5U A;  1A24 A;  4G0K A;  4IQ1 A;  4DVC A;  3VWV A;  3CXG A;  4GQC A;  1LJR A;  2VUP A;  1VF2 A;  1F2E A;  1SU9 A;  3D21 A;  4BL7 A;  2XHF A;  3FZ4 A;  5COH A;  2HRN A;  5A4V A;  5IM9 A;  1M2A A;  2I9H A;  4F03 A;  3FRC A;  2E7P A;  2LQO A;  5DAK B;  3TOU A;  1JHB A;  4MA9 A;  5KN0 A;  1Z6M A;  1Z7P A;  5IQY A;  1ERU A;  1F3A A;  4ECB A;  4O92 A;  5D96 A;  1AUC A;  1KBN A;  3FY7 A;  2CZ2 A;  4HQS A;  1XIY A;  2MYG A;  2VLV A;  4Q5Q A;  5EPF A;  3J7Y b;  2VOC A;  1B8X A;  3O3T A;  4PNG A;  2OE1 A;  3TJJ A;  3HJO A;  2FY6 A;  2JZT A;  2B5Y A;  4I97 A;  3QD9 A;  2TIR A;  5HFG A;  2QA2 A;  1O85 A;  3LFL A;  1TU8 A;  6GST A;  5ECL B;  5GSS A;  3A2W A;  10GS A;  2AUV A;  2IME A;  4WR4 A;  3F3R A;  4GSS A;  4ECC A;  3LXZ A;  1GSQ A;  3VWW A;  1Q98 A;  3PGT A;  3CTF A;  4OO4 A;  5IMC A;  2A2R A;  1JZO A;  5KN3 A;  1BYE A;  22GS A;  4QQ7 A;  4L5O A;  3QCP A;  3EPT A;  3UMA A;  4XS6 A;  5FHI A;  4POL A;  2FGX A;  4WBJ A;  4QL9 A;  1FW1 A;  1A2L A;  4IVF A;  3UJ1 A;  4KND A;  3EYT A;  3MYD A;  2PPT A;  1MDI A;  3ZRD A;  2I3Y A;  4TR4 A;  5IMV A;  2HRK A;  2H6Z A;  2YPM A;  1R26 A;  3US3 A;  3O76 A;  4BWS A;  3CYN A;  4HOJ A;  1ZYP A;  3P2A A;  2R37 A;  4IHU A;  3QFA C;  2P0G A;  4ECJ A;  1ERV A;  4K7I A;  3L9V A;  3Q6O A;  1PKW A;  3ZYW A;  4AJ7 A;  5CAX A;  2IIY A;  1TTZ A;  1NW2 A;  1GRX A;  1V9W A;  1K0D A;  4ML1 A;  1X5E A;  2DIY A;  3CQF A;  2QKE A;  4KCE A;  1QGV A;  2CT6 A;  2H1D A;  1WMJ A;  2GST A;  4OCF A;  4TR0 A;  4ZB9 A;  3HD5 A;  4JU5 A;  4K5S A;  1Y6E A;  4XRA A;  3TJG A;  2PVO C;  2BMX A;  3TKP A;  4O5Q A;  2VO4 A;  4EDZ A;  2X8H A;  1ML6 A;  2F8A A;  2H8L A;  4EXJ A;  3LGC A;  1F6M C;  3J7Y k;  3CSI A;  2K8V A;  2E2G A;  4BVY B;  3N5O A;  2REM A;  4TKY A;  2NBS A;  5IOW A;  4ZXG A;  1I5G A;  2MBS A;  4TXV A;  4OCE A;  2GZY A;  1AQV A;  3CTG A;  1SD8 A;  2PER A;  4I2U A;  3G7Y A;  5AN1 A;  3Q74 A;  2ES7 A;  2YZU A;  4PGT A;  1A2M A;  1M3J A;  1GTB A;  3UL3 A;  2LEG A;  1BAY A;  1N8J A;  2H0H A;  5KOW A;  3ME7 A;  4MJC A;  2L6C A;  5LNK e;  1ERW A;  2AHE A;  2C0E A;  2CVD A;  2VAF A;  4ID0 A;  4LL1 B;  2EIQ A;  4GCI A;  4MZW A;  1QXH A;  2K18 A;  2JZS A;  3TJK A;  5D9W A;  3IV4 A;  5G5F A;  1V98 A;  4GXZ A;  4OFM A;  3QOU A;  3S9F A;  1TXX A;  2DJ3 A;  4O5R A;  4MZB A;  3KM6 A;  3ZVJ D;  2DIZ A;  3MSZ A;  2I4A A;  4WBR D;  3A5I A;  4FIW A;  4K7O A;  1K0M A;  2J9H A;  4ISD A;  4MF7 A;  4ZL8 A;  1OC9 A;  2K6V A;  2OA7 A;  4I2T A;  2NVL A;  2H70 A;  2I1U A;  4I8B A;  3WGD A;  2HXK A;  3ISO A;  1QFN A;  4FH8 A;  1LU4 A;  1WOU A;  4ECI A;  3HKR A;  3KCM A;  3ERG A;  4F82 A;  4ACS A;  1SL0 B;  3UEM A;  2YV9 A;  2YWN A;  1GP1 A;  1LBK A;  1S3R A;  2H1B A;  3IC8 A;  1TDI A;  5BMU A;  3FR3 A; 
#chains in the Genus database with same CATH homology
 1TJD A;  4XRD A;  4JED A;  3ZRE A;  3KXO A;  2J23 A;  1OE8 A;  3HCZ A;  2V41 A;  2HRA A;  4GTU A;  4WXT A;  5CRD A;  1RQM A;  1SK1 A;  5F0G A;  1FB0 A;  1X5D A;  2DJ2 A;  3F6D A;  1WPI A;  2VL3 A;  3H79 A;  4FYU A;  2O87 A;  3I9V 2;  4KSM A;  4FO5 A;  1GSU A;  1ERT A;  2VLU A;  3H1N A;  4WEY A;  4HS1 A;  3TRX A;  2G0F A;  3FR6 A;  1XXU A;  17GS A;  4MZC A;  1FVK A;  1OKD A;  1KEB A;  1U88 A;  3UBL A;  5J4U A;  5KOX A;  1JZW A;  4H86 A;  1AW9 A;  2C3T A;  2CAI A;  1G7E A;  1U3I A;  4IP1 A;  4MH2 A;  3D6I A;  4OMV A;  6GSU A;  4MF6 A;  2DJ0 A;  4PX1 A;  1F9M A;  5FT3 A;  3W6G A;  1XW6 A;  4OWY A;  1MD3 A;  1OC3 A;  1PN9 A;  4KA0 A;  4V1A p;  4Q5N A;  3A2X A;  2XC2 A;  4K7N A;  1OE7 A;  4L5L A;  1RK4 A;  2B6M A;  4IP6 A;  3WT1 A;  5IPH A;  5IIZ A;  5CP1 A;  2ZCT A;  3FHK A;  3E9J B;  2H01 A;  3GX8 A;  1XCC A;  1GL8 A;  3QAV A;  1XVQ A;  1W89 A;  2HRF A;  5ID2 A;  3HHV A;  2WCI A;  1PQN A;  3FEU A;  1S3C A;  2O85 A;  4GF0 A;  4MAB A;  4YAV A;  4RQR A;  1SJI A;  3F4R A;  3TRP A;  1A23 A;  2QGV A;  2VD0 A;  4XIH A;  2C3Q A;  4DSS B;  4RI7 A;  5JWO B;  2UZ8 A;  5EVO A;  14GS A;  4EC0 A;  4MJB A;  1DBY A;  2WB9 A;  4MH3 A;  4K1F A;  4MF5 A;  4TRX A;  4DSS A;  6GSW A;  2MBT A;  3D22 A;  5J9B A;  1ILO A;  3TGZ A;  3HVV A;  2DKH A;  3ZIV A;  2GZZ A;  19GS A;  1J9B A;  3EU3 A;  1SK0 A;  3HZ8 A;  3GKK A;  4PTS A;  1ZYQ B;  2PN8 A;  2KOK A;  2IPA A;  3MDK A;  1JZD A;  3D4T A;  3M9J A;  4ICY A;  3H4K A;  3R3E A;  2YJH A;  1FB6 A;  2OBI A;  3RDW A;  1GTU A;  2HLS A;  2H1A A;  2VL9 A;  4L0U A;  1XWG A;  2VIM A;  1GUH A;  3LQ7 A;  1XBS A;  1A0R P;  1FOV A;  4WR5 A;  4LLR A;  3Q19 A;  1QMV A;  1YEX A;  4F2I A;  2JL4 A;  2R0G A;  1VF1 A;  3TKQ A;  4Z7X A;  4HZ4 A;  2YWI A;  2JSZ A;  2DJK A;  4K2X A;  2JU5 A;  2X8G A;  1VF4 A;  4RI6 A;  2HNL A;  2VL2 C;  3IAS 2;  2IMF A;  3GUR A;  2V6K A;  2LV3 A;  2C0D A;  1EEJ A;  3E0U A;  5DVB A;  1T1V A;  3EVI A;  2GT5 A;  1PX6 A;  5IMF A;  12GS A;  2GSS A;  1TRS A;  2DC5 A;  3BD2 A;  4N0Z A;  5CRW A;  2AV4 A;  2YV7 A;  4NAX A;  3WYW A;  4KGI A;  1YZX A;  2GZP A;  4EUY A;  3F4S A;  4OFT A;  3QR6 A;  5A5K A;  2MMA A;  1VF3 A;  2EIO A;  3LW9 A;  1XPV A;  3APO A;  1V57 A;  2H19 A;  2CQ9 A;  5C04 A;  1SKW B;  2X64 A;  11GS A;  4AF2 A;  2D2Z A;  4TXO B;  3TKR A;  1GUL A;  3KMO A;  4EIQ A;  2IMK A;  3IE3 A;  4MDC A;  3ZIJ A;  1QUW A;  3G9B A;  1R7H A;  5ELA A;  1HYU A;  2CVK A;  3GIX A;  4TXO A;  5EY6 A;  4JRR A;  5CRH A;  16GS A;  1K0A A;  3DGQ A;  2E0Q A;  6GSV A;  1SEN A;  3QPM A;  1EGO A;  2WRT A;  5DAK A;  5J9C A;  1WJK A;  3BCK A;  3M9K A;  5CRE A;  4EKZ A;  2B5X A;  1SL2 B;  2VCV A;  3SBC A;  2O8V B;  1QQ2 A;  4ZBB A;  3LOR A;  3E3E A;  3IBH A;  3HYP A;  3APQ A;  2G2Q A;  4KDY A;  1K0C A;  1ZL9 A;  1PL2 A;  4BVX B;  1O73 A;  2F51 A;  1TW9 A;  1K3Y A;  2O7K A;  3UAR A;  1DSB A;  3TB2 A;  2GGT A;  2VCZ A;  1XOB A;  3MIX A;  3GRX A;  2GQL A;  1MD4 A;  1R5A A;  4ZB6 A;  4EL1 A;  5INY A;  3C73 A;  1G0T A;  1G7O A;  3Q18 A;  4XHM A;  2HSM A;  2IJY A;  2EIR A;  1SJZ A;  4E8E A;  4ZBA A;  3KD0 A;  3K8N A;  1M9B A;  3ZVJ A;  4WET A;  4OD7 A;  3VWU A;  1SKS B;  4K8M A;  2YN1 A;  5FWG A;  5JCW A;  4PQ1 A;  5BRT A;  5CRG A;  1M99 A;  1XWK A;  3RAZ A;  1H4O A;  3G7J A;  2LJA A;  1K0B A;  3QDN A;  3UVT A;  4IW9 A;  4G0L A;  5KEJ A;  3C1R A;  2LRC A;  4MP4 A;  2KUC A;  3GMF A;  5AIX A;  3MNG A;  1UN2 A;  2H6Y A;  3LYP A;  5IO2 A;  2FWE A;  4LMW A;  3GL5 A;  2L57 A;  3EIN A;  4TVE A;  2LUS A;  3ERF A;  1A8Y A;  3M3M A;  3BCI A;  3CBU A;  4NWY A;  3CRU A;  4G2E A;  5HR0 A;  3DWV A;  3LWA A;  5ECH B;  1S3D A;  2N5B A;  3HY2 A;  3LYK A;  3NOF A;  4KF9 A;  2C1Y A;  1E2Y A;  1WWJ A;  4WKW A;  4HQZ A;  4ILF A;  3KJY A;  2YNX A;  1FAA A;  1N2A A;  4TR3 A;  3KP9 A;  2H71 A;  4ZL7 A;  2H72 A;  1ZOF A;  3F9U A;  3KZQ A;  1EOG A;  1V2A A;  2TRX A;  1PRX A;  2FA4 A;  1EV4 A;  1Z6N A;  5A4W A;  5CNW A;  1BED A;  4BVY A;  4IKH A;  2OKA A;  3V1W A;  1K0N A;  2LNS A;  4K9Z A;  2VD1 A;  3DVW A;  1DE1 A;  1XWB A;  1UA5 A;  3EWL A;  4V1A g;  9GSS A;  1GWC A;  4KUN A;  3GHA A;  2VM2 A;  5C00 A;  1EV9 A;  1EZK A;  1Q4J A;  3HJP A;  1B9X C;  2KP2 A;  4ZIJ A;  5ENU A;  4QL7 A;  3VLN A;  3ZTL A;  1EWX A;  2C0G A;  1OKT A;  2WJU A;  4USS A;  1GSF A;  5DCG A;  3GX0 A;  2YP6 A;  4ULX A;  3TDG A;  2YJ7 A;  2HYX A;  4EF0 A;  4EO3 A;  4HDE A;  5GZZ B;  1TRU A;  1CQH A;  3WGX A;  1XVW A;  1USB A;  1CQG A;  3NIV A;  1B4Q A;  3WD6 A;  1GSD A;  2LRT A;  4K5R A;  1KNG A;  2DKI A;  1TOF A;  2DJ1 A;  3W8J A;  2VM1 A;  3SWL A;  1TRW A;  1XW9 A;  1YJ6 A;  2LTK A;  2O89 A;  3TKS A;  4IQA A;  3ZL5 A;  1U6T A;  1WP0 A;  5JCU A;  2C4J A;  4LL4 B;  3TUE A;  2DSA A;  2CX4 A;  5DQS A;  5H5Q A;  3GSS A;  1URM A;  2IWT A;  5DJL A;  4DSR A;  2P5R A;  1SK2 A;  3ERW A;  5F8B A;  2AJQ B;  1NSW A;  2MMO A;  2OJL A;  1YDK A;  3HVS A;  2PVQ A;  2RM6 A;  1HNC A;  2KHP A;  2NDO A;  3C7M A;  4GRF A;  3FK8 A;  1J08 A;  5LD0 A;  2HZE B;  4NMU A;  2FD3 A;  1NHO A;  4F0B A;  4MPG A;  4NXI A;  3C1S A;  3GKM A;  1O6J A;  4NV5 A;  4DEJ A;  2B1L A;  3I6A A;  1TK8 B;  3JCM L;  4YQV A;  1MEK A;  2DMM A;  3C8E A;  3L9U A;  2PBJ A;  4IBP A;  3FZA A;  4NHZ A;  2YWO A;  2XPE A;  4MJE A;  4Q5R A;  2IMD A;  2L6D A;  3L0H A;  3ZIT A;  2FWH A;  5IPG A;  1ZMA A;  4CHS A;  5HR2 A;  5AIV A;  5CO3 A;  3IOS A;  2FLS A;  3U5R E;  3HVX A;  2YCD A;  4KAE A;  1XWA A;  2YWM A;  3IPZ A;  1GH2 A;  5DAL B;  2FA8 A;  2QC7 A;  3DEX A;  5D73 A;  4G9H A;  3F63 A;  3D4M A;  2V2G A;  2H73 A;  2ZUP A;  1SD9 A;  2H1G A;  5D9V A;  5GAN D;  4XS4 B;  1F3B A;  3FMW A;  5HQP A;  4K0G A;  1MTC A;  4JR4 A;  4GWR A;  1ZCP A;  4XS4 A;  2L5L A;  4V2L A;  4JR6 A;  5JWQ B;  4N0V A;  2IMI A;  4HI7 A;  3DD3 A;  1PKZ A;  1OVN A;  2MMN A;  3HZ4 A;  1T8E B;  1GTI A;  3PIN A;  3BBY A;  1I9D A;  3RPP A;  3FR9 A;  4OO5 A;  2R5G A;  3IAM 2;  4X1U A;  4FYB A;  2CV4 A;  2GQM A;  1JLW A;  3OR5 A;  5JCG A;  1B48 A;  4O7H A;  4WF4 A;  3UIW A;  1O81 A;  2XBQ A;  3P90 A;  2ALB A;  1O8X A;  3FZ9 A;  2RII A;  2F9S A;  2R3X A;  2V32 A;  4TOP A;  2B7J A;  4I6X A;  2HSY A;  1NM3 A;  4F9Z A;  2OAC A;  3VPT A;  2GSR A;  3KH9 A;  3L78 A;  1XWC A;  1Z9H A;  3C71 A;  3TJB A;  4RUV A;  3NZN A;  2WZ9 A;  4PUR A;  1IYH A;  2IFQ B;  4YQU A;  2IN3 A;  2LQQ A;  1TI3 A;  4MPF A;  4G0I A;  3GV1 A;  4LMV A;  1X9M B;  1M2D A;  5G31 A;  1HNB A;  2L59 A;  2N5F A;  4IS0 A;  3FKF A;  2VCT A;  4FQU A;  2DLX A;  3KP8 A;  2L4C A;  4HJ2 A;  3KTL A;  2EC4 A;  3EMX A;  1AIU A;  1PD2 1;  4IEL A;  1W4V A;  3RHB A;  2Z9S A;  5HFK A;  1MDK A;  2KP1 A;  5J3R A;  4Z2T A;  1A0F A;  3A5W A;  5IMA A;  2R0C A;  1R4W A;  1K3L A;  1EGR A;  2GLR A;  2WDU A;  3QMX A;  5AGY A;  2GS3 A;  4X4J A;  1SYR A;  5B7C A;  2LNT A;  1RW1 A;  1T4Y A;  1PSQ A;  1X5C A;  4IN0 A;  5L71 A;  2R0P A;  3GFK A;  3TCO A;  3IHQ A;  4YAP A;  4HEA 2;  3PPU A;  4J56 E;  1ZYE A;  3FW2 A;  18GS A;  4BPY A;  1B9Y C;  2VLT A;  1TU7 A;  3H8Q A;  4CW9 A;  4HU9 A;  2A2P A;  2CVB A;  4PUA A;  2LRN A;  3GYK A;  4RQX A;  2CAQ A;  2DBC A;  1DUG A;  2GVP A;  2TRC P;  2FNO A;  2C3N A;  2PWJ A;  2F8F A;  4KX4 A;  4J2F A;  2RLI A;  3IK7 A;  5A4U A;  1XFL A;  5ABR A;  5IMD A;  4V2M A;  2X99 A;  2ZNM A;  2ON5 A;  4IJ3 A;  2PU9 C;  5JWR B;  4KW6 A;  1OAZ A;  1EOH A;  1NHY A;  1Z3E A;  3ZLP A;  2M80 A;  1TRV A;  3I69 A;  2AB6 A;  2OAD A;  3PR8 A;  4BVX A;  5D9T A;  1AXD A;  3HXS A;  1SKR B;  5F05 A;  5DJM A;  4POM A;  4YH2 A;  5D9X A;  4I5Q A;  5F07 A;  4ZIL A;  1VRS D;  2VCW A;  1FOH A;  4EDY A;  2RM5 A;  3ED3 A;  4A5P A;  2A2S A;  2PGT A;  4WF5 A;  3F0I A;  3AY8 A;  4KCA A;  3ZFL A;  3GST A;  2NPB A;  2YOI A;  2LS5 A;  3VI7 A;  1GNE A;  4J57 E;  2HFD A;  3UVH A;  2A4V A;  3M0F A;  4EE0 A;  1A8L A;  2H75 A;  1KTE A;  5F06 A;  4AJ8 A;  1ZZY A;  1HNA A;  1K0O A;  2YZH A;  3GA4 A;  2BJX A;  3U6V A;  1FG4 A;  4E8H A;  3I43 A;  4XS1 A;  3DVX A;  2C8U A;  4X0X A;  4AJ6 A;  13GS A;  2GQK A;  3IC4 A;  1R5P A;  4POK A;  3F3Q A;  2FCH A;  5G5E A;  3F6F A;  3UAP A;  1PL1 A;  1M2B A;  3IK9 A;  1X9S B;  3DYR A;  3KIJ A;  5D8I A;  5GAP D;  3UBK A;  2DJJ A;  3FYG A;  5J41 A;  1AQX A;  2GTU A;  1U87 A;  2FHE A;  4K2D A;  3F4T A;  1TKD B;  4PXO A;  1SJ6 A;  1B4P A;  2PUK C;  2V1M A;  1BG5 A;  1T7P B;  1GLP A;  1QK8 A;  5H5S A;  3KTB A;  3TRQ A;  1XOA A;  1M7T A;  1S3A A;  2M46 A;  2R4V A;  4EVM A;  4X43 A;  1F37 A;  3GKX A;  4MJA A;  3TKS E;  3DKS A;  2H30 A;  5DQY A;  3RHC A;  3VWX A;  4N11 A;  2F3M A;  2X8C A;  3LEF A;  2ON7 A;  3IA1 A;  2WGR A;  1O8W A;  4TN8 A;  2HT9 A;  3EE2 A;  2JAC A;  1JLV A;  3CSJ A;  2B3S A;  5B6N A;  3LXT A;  2P31 A;  1M9A A;  2RUF A;  4ZL9 A;  1FHE A;  4K6X A;  2R2J A;  2AAW A;  3H93 A;  5ECS A;  3M1G A;  5ECO B;  1YY7 A;  3R2Q A;  4JZQ A;  1WRY A;  3CMI A;  2FUG 2;  5HR3 A;  4TR1 B;  1U3A A;  2YAN A;  1FO5 A;  4KH7 A;  2OE3 A;  2LJK A;  4TR1 A;  1EP8 A;  3DRN A;  3TOT A;  5ELG A;  4NHW A;  3F8U A;  2MZC A;  5ECN B;  5G2Z A;  4ZBD A;  3RBT A;  1YF0 A;  2V6O A;  1YEP A;  1ON4 A;  2XBI A;  3P7X A;  1DE2 A;  2CA8 A;  2JAD A;  1JFU A;  3KH7 A;  1ACV A;  3M8N A;  4IJI A;  4GQF A;  1OC8 A;  1TK5 B;  3ZML A;  1GSS A;  1GSY A;  3GH6 A;  3GNJ A;  2FWG A;  2PMT A;  4EIP A;  3BOA A;  1PX7 A;  2KLX A;  4YKG A;  2JZR A;  3VK9 A;  4BA7 A;  2CX3 A;  3APS A;  5ECQ B;  2BTO T;  4DSQ A;  1TK0 B;  1X0R A;  3DXB A;  5E59 A;  4IGJ A;  2X4A A;  1J0F A;  1WIK A;  1GUM A;  1HQO A;  3LG6 A;  1PGT A;  2X49 A;  3N9J A;  2B1K A;  1OC9 B;  2VCX A;  4MNN A;  3BJ5 A;  5J5N A;  1ZGN A;  7GSS A;  2XPD A;  4P3Y B;  1GNW A;  3LJR A;  2GSQ A;  1V40 A;  3D5J A;  4KE3 A;  1BQ7 A;  1Y25 A;  3EMP A;  4O32 A;  2B7K A;  4HZ2 A;  2H76 A;  4N10 A;  1H75 A;  3GH9 A;  3P8W A;  4HU7 A;  2WS2 A;  4FYC A;  4NPB A;  2MMZ A;  5LCZ A;  1THO A;  2B5E A;  4L0W A;  3IRA A;  3L4N A;  4OFN A;  1X9W B;  1C72 A;  2HZE A;  5G1K A;  5KN1 A;  1O7U A;  3VUR A;  5ECM B;  3VFI A;  4YQM A;  2C80 A;  4KSO A;  2VCQ A;  3KMN A;  3TKS C;  3CRT A;  3O6T A;  1BJX A;  3QAW A;  1G6W A;  1VGL A;  2I81 A;  1AAZ A;  3MWH A;  3IHG A;  4LA1 A;  3VPQ A;  3LSZ A;  4ZB8 A;  2OBK A;  4Z2U A;  3HA9 A;  5HR1 A;  4PNF A;  5CYY A;  3GTU B;  1MDJ A;  4CDO A;  1PN0 A;  1YF1 A;  4NV2 A;  1AQW A;  5AIS A;  4K0N A;  3A3T A;  6GSY A;  2QA1 A;  3DIE A;  3GTU A;  1AC1 A;  4G19 A;  2K9F A;  2NTO A;  1K3O A;  2HE3 A;  5ECP B;  5B8B A;  4JE1 A;  5DAL A;  1TI1 A;  3EU4 A;  1Z5Y E;  3L9S A;  1XW5 A;  2L5O A;  3CSH A;  2QSI A;  1PMT A;  1ABA A;  1JZR A;  1T00 A;  3RPN A;  2HZF A;  1WE0 A;  1T4Z A;  5ID2 B;  2N5A A;  2AYT A;  2H0G A;  2WFC A;  2R6K A;  1EP7 A;  5IOX A;  4CY8 A;  3ZFB A;  1UC7 A;  1E6B A;  1THX A;  5G30 A;  3UOM A;  4GLT A;  1SL1 B;  4F0C A;  3FZ5 A;  4GST A;  2H66 A;  3ZMK A;  3GUS A;  1FVJ A;  4XTS A;  4N30 A;  3EC3 A;  5HFI A;  1GUK A;  4KDU A;  4V2N A;  3W8S A;  3WGE A;  1M0U A;  5ECI B;  4PQI A;  4BWQ A;  2M72 A;  1G6Y A;  3VI5 A;  4PUF C;  2H74 A;  1OYJ A;  4HJM A;  3DML A;  1IYI A;  2C0F A;  1BX9 A;  2VL2 A;  5EL8 A;  3ZZX A;  3G7I A;  4PQH A;  3KEB A;  1ZYN A;  4MCU A;  1SYX A;  1XZO A;  2HSH A;  4MLY A;  5DDL A;  4D73 B;  5D93 A;  4KDX A;  4G10 A;  1HD2 A;  3A2V A;  5ECK B;  2FWF A;  3GKN A;  2LKU A;  2E2M A;  4D73 A;  3IDV A;  5ECR B;  2IFQ A;  5DCH A;  4POB A;  4L8E A;  3GN3 A;  2DML A;  2GDR A;  5H5R A;  4Z2R A;  3MAK A;  5GST A;  1YKA A;  4MMM A;  2RUE A;  1V58 A;  3HDC A;  4HUA A;  2LJR A;  3D0Z A;  2K8S A;  1A2J A;  3KGK A;  3WT2 A;  5KN2 A;  5B6M A;  4YKF A;  6GSS A;  1GLQ A;  2P5Q A;  1PA3 A;  5B8A A;  8GSS A;  4CY6 A;  4GSN A;  2GT6 A;  4ML6 A;  4AGS A;  4TW5 A;  2A4H A;  3GL3 A;  3IR4 A;  3QFB C;  1YKC A;  1GSE A;  2WUL A;  1TP9 A;  2H6X A;  5G1L A;  20GS A;  1GTA A;  5E4W A;  1Z7R A;  5IO0 A;  3QAG A;  3EUR A;  3ME8 A;  1EEM A;  1T3B A;  3PH9 A;  3TJF A;  1UVZ A;  2H0I A;  4Q5F A;  3IXR A;  4JBB A;  6GSX A;  4XCS A;  2CZ3 A;  4KB3 A;  2L4Q A;  5DBQ A;  1YQ1 A;  3HJM A;  4MK3 A;  2OE0 A;  2LST A;  5IMZ A;  2HI7 A;  2IL3 A;  2JSY A;  1ST9 A;  4BL7 B;  4O5U A;  1A24 A;  4G0K A;  4IQ1 A;  4DVC A;  3VWV A;  3CXG A;  4GQC A;  1LJR A;  2VUP A;  1VF2 A;  1F2E A;  1SU9 A;  3D21 A;  4BL7 A;  2XHF A;  3FZ4 A;  5COH A;  2HRN A;  5A4V A;  5IM9 A;  1M2A A;  2I9H A;  4F03 A;  3FRC A;  2E7P A;  2LQO A;  5DAK B;  3TOU A;  1JHB A;  4MA9 A;  5KN0 A;  1Z6M A;  1Z7P A;  5IQY A;  1ERU A;  1F3A A;  4ECB A;  4O92 A;  5D96 A;  1AUC A;  1KBN A;  3FY7 A;  2CZ2 A;  4HQS A;  1XIY A;  2MYG A;  2VLV A;  4Q5Q A;  5EPF A;  3J7Y b;  2VOC A;  1B8X A;  3O3T A;  4PNG A;  2OE1 A;  3TJJ A;  3HJO A;  2FY6 A;  2JZT A;  2B5Y A;  4I97 A;  3QD9 A;  2TIR A;  5HFG A;  2QA2 A;  1O85 A;  3LFL A;  1TU8 A;  6GST A;  5ECL B;  5GSS A;  3A2W A;  10GS A;  2AUV A;  2IME A;  4WR4 A;  3F3R A;  4GSS A;  4ECC A;  3LXZ A;  1GSQ A;  3VWW A;  1Q98 A;  3PGT A;  3CTF A;  4OO4 A;  5IMC A;  2A2R A;  1JZO A;  5KN3 A;  1BYE A;  22GS A;  4QQ7 A;  4L5O A;  3QCP A;  3EPT A;  3UMA A;  4XS6 A;  5FHI A;  4POL A;  2FGX A;  4WBJ A;  4QL9 A;  1FW1 A;  1A2L A;  4IVF A;  3UJ1 A;  4KND A;  3EYT A;  3MYD A;  2PPT A;  1MDI A;  3ZRD A;  2I3Y A;  4TR4 A;  5IMV A;  2HRK A;  2H6Z A;  2YPM A;  1R26 A;  3US3 A;  3O76 A;  4BWS A;  3CYN A;  4HOJ A;  1ZYP A;  3P2A A;  2R37 A;  4IHU A;  3QFA C;  2P0G A;  4ECJ A;  1ERV A;  4K7I A;  3L9V A;  3Q6O A;  1PKW A;  3ZYW A;  4AJ7 A;  5CAX A;  2IIY A;  1TTZ A;  1NW2 A;  1GRX A;  1V9W A;  1K0D A;  4ML1 A;  1X5E A;  2DIY A;  2QKE A;  4KCE A;  1QGV A;  2CT6 A;  2H1D A;  1WMJ A;  2GST A;  4OCF A;  4TR0 A;  4ZB9 A;  3HD5 A;  4JU5 A;  4K5S A;  1Y6E A;  4XRA A;  3TJG A;  2PVO C;  2BMX A;  3TKP A;  4O5Q A;  2VO4 A;  4EDZ A;  2X8H A;  1ML6 A;  2F8A A;  2H8L A;  4EXJ A;  3LGC A;  1F6M C;  3J7Y k;  3CSI A;  2K8V A;  2E2G A;  4BVY B;  3N5O A;  2REM A;  4TKY A;  2NBS A;  5IOW A;  4ZXG A;  1I5G A;  2MBS A;  4TXV A;  4OCE A;  2GZY A;  1AQV A;  3CTG A;  1SD8 A;  2PER A;  4I2U A;  3G7Y A;  5AN1 A;  3Q74 A;  2ES7 A;  2YZU A;  4PGT A;  1A2M A;  1GTB A;  3UL3 A;  2LEG A;  1BAY A;  1N8J A;  2H0H A;  5KOW A;  3ME7 A;  4MJC A;  2L6C A;  5LNK e;  1ERW A;  2AHE A;  2C0E A;  2CVD A;  2VAF A;  4ID0 A;  4LL1 B;  2EIQ A;  4GCI A;  4MZW A;  1QXH A;  2K18 A;  2JZS A;  3TJK A;  5D9W A;  3IV4 A;  5G5F A;  1V98 A;  4GXZ A;  4OFM A;  3QOU A;  3S9F A;  1TXX A;  2DJ3 A;  4O5R A;  4MZB A;  3KM6 A;  3ZVJ D;  2DIZ A;  3MSZ A;  2I4A A;  4WBR D;  3A5I A;  4FIW A;  4K7O A;  1K0M A;  2J9H A;  4ISD A;  4MF7 A;  4ZL8 A;  1OC9 A;  2K6V A;  2OA7 A;  4I2T A;  2NVL A;  2H70 A;  2I1U A;  4I8B A;  3WGD A;  2HXK A;  3ISO A;  1QFN A;  4FH8 A;  1LU4 A;  1WOU A;  4ECI A;  3HKR A;  3KCM A;  3ERG A;  4F82 A;  4ACS A;  1SL0 B;  3UEM A;  2YV9 A;  2YWN A;  1GP1 A;  1LBK A;  2H1B A;  3IC8 A;  1TDI A;  5BMU A;  3FR3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...