2A4HA

Solution structure of sep15 from drosophila melanogaster
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
126
structure length
126
Chain Sequence
MASHHHHHHLDQQPAAQRTYAKAILEVCTCKFRAYPQIQAFIQSGRPAKFPNLQIKYVRGLDPVVKLLDASGKVQETLSITKWNTDTVEEFFETHLAKDGAGKNSYSVVEDADGDDDEDYLRTNRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Selenoprotein Sep15
publication title NMR Structures of the Selenoproteins Sep15 and SelM Reveal Redox Activity of a New Thioredoxin-like Family.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 11
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2005-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08806 Sep15_SelM Sep15/SelM redox domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.50 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2a4hA01
2A4HA 2A2PA
chains in the Genus database with same CATH superfamily
1XWKA 3GH6A 2IMIA 4EE0A 5IMZA 3TKRA 1N2AA 2QKEA 2H6ZA 2H0GA 4N0ZA 2TIRA 3K8NA 2FCHA 1EZKA 4LLRA 4K8MA 2NBSA 2N5FA 4WR4A 1TXXA 4JEDA 2R0CA 2B5YA 1PGTA 3C1RA 4MLYA 2FWHA 2EC4A 2OE3A 3EMPA 5ECNB 3J7Yk 1ZYPA 4K7OA 4XTSA 4DSSB 1XWBA 2VLUA 1M2BA 2LKUA 1EEMA 2A4VA 2I9HA 3H1NA 4BPYA 2LSTA 3QAWA 3EU4A 2GTUA 2M46A 3CTGA 4IS0A 4MZWA 2DIYA 3F3QA 1GTAA 3W8JA 4NXIA 3D0ZA 1ABAA 3LJRA 5IIZA 1WIKA 1VF4A 2BTOT 3DMLA 5IMCA 3VPQA 1XWAA 3GFKA 3C8EA 2AHEA 4PTSA 2AV4A 4IJIA 1GUHA 1XOBA 1E2YA 3F4RA 4I2UA 4CHSA 16GSA 5D9WA 1X5EA 2KP1A 3ZVJD 4EF0A 2H75A 1ZGNA 1YQ1A 4BVYB 3UMAA 1HNBA 1FG4A 2WFCA 3BD2A 4X1UA 5E4WA 4KCAA 1IYIA 4OFTA 4G0LA 5DCHA 4GWRA 4E8EA 4F82A 5ECLB 2JSYA 5ECIB 2QA2A 2YPMA 4Q5QA 4KF9A 1SL0B 2LS5A 4IKHA 4TR1A 1Z5YE 1X5CA 2MZCA 1ERTA 3M8NA 4A5PA 3DRNA 2IFQA 2GS3A 2I4AA 3IAS2 1X9WB 2DMMA 2PMTA 3FZAA 3TKPA 3EPTA 2JZTA 2B1KA 13GSA 3EYTA 4GSTA 2VL9A 2H6YA 3KMOA 2F8AA 4MDCA 4HSCX 4OO5A 5DAKA 3A2WA 1A8YA 1PKWA 1FOVA 1MTCA 1PX6A 3TGZA 3LORA 4J57E 3D4TA 1XW6A 5AIVA 5HR0A 2C0DA 1I9DA 3ZMKA 1XPVA 1YF1A 1PX7A 2BJXA 2GSSA 1XW9A 5GSTA 3FRCA 2I3YA 3F6DA 1O81A 3LW9A 3LSZA 2GDRA 1R4WA 3VLNA 1WMJA 1YKCA 4QQ7A 3VWXA 2K8SA 4WBJA 2YP6A 11GSA 3MIXA 4TR0A 5FHIA 2GZZA 3CMIA 4MF7A 2KP2A 2L6CA 3QDNA 4MF5A 4IJ3A 2YZUA 2DSAA 2HYXA 1HYUA 2VUPA 1MDJA 4XS1A 1F3AA 4LMVA 1JLWA 3GV1A 4KE3A 3UBLA 3FW2A 3C1SA 2DMLA 2VCZA 2R5GA 1V57A 4F0BA 1U87A 3A2XA 1U3IA 3L4NA 1PKZA 1VF2A 2DJJA 2A4HA 3NOFA 4PQ1A 5B6NA 2VOCA 3RPPA 1M0UA 1O6JA 4YKFA 5B7CA 1GULA 1LJRA 1HQOA 1PMTA 4QL9A 5GSSA 1MEKA 4L0WA 2MMNA 3ZRDA 3QPMA 5LCZA 4XS4A 1XVQA 2R6KA 2H30A 3KP9A 4PUFC 4K2DA 2EIOA 5ECHB 2HLSA 4NHZA 3VURA 5AISA 5J3RA 3DGQA 2LRTA 1OYJA 1B9XC 2RUFA 3F0IA 3E0UA 4CY6A 2M80A 1SKWB 3DVWA 2F51A 4PXOA 4GSNA 2M72A 6GSXA 1PN9A 4EL1A 4IELA 1EP8A 2IMKA 1YEPA 4TRXA 1ZMAA 5KN0A 2YJ7A 3TJKA 1WWJA 5IOWA 5J41A 1QUWA 3RBTA 4DVCA 3FR6A 4AJ8A 3UL3A 3PINA 1SK2A 2FWFA 2VL2C 2NPBA 1M9AA 2YNXA 1AUCA 4NV2A 1M2DA 3KH9A 3FZ4A 2IPAA 2HZFA 2FWGA 4TXOB 2IIYA 5ECQB 4Z2RA 3F4SA 3LXZA 2DKHA 5ELAA 2GLRA 5DCGA 3P90A 3WGXA 1JZOA 2P5RA 3F3RA 4XRDA 2HSHA 4GQFA 2DJ1A 2H6XA 2VAFA 3IRAA 4ICYA 1TJDA 4KUNA 4KDYA 1WE0A 1WPIA 3M9KA 1VRSD 2L5OA 4ECJA 4RQRA 3EU3A 1DBYA 3PR8A 3FY7A 5F05A 2ALBA 3F4TA 3D4MA 1GRXA 3CTFA 4KNDA 3KEBA 1T4ZA 1DUGA 5HR2A 4BIKA 3EC3A 2JSZA 5BMUA 2AJQB 4MJBA 3F63A 1OE8A 4CDOA 1R5PA 2H74A 3PPUA 2GQLA 4POMA 4TR4A 2IJYA 4N0VA 1DSBA 1M2AA 2V1MA 4HDEA 5KN1A 3W6GA 1AW9A 3CRUA 4ZILA 1FVKA 1BQ7A 1ILOA 3ZTLA 1QQ2A 2UZ8A 4ZBBA 1M7TA 4EO3A 5L71A 4NWYA 1G7EA 4ILFA 1NHYA 2LEGA 5F06A 2YWMA 5G2ZA 1GUMA 3KXOA 4EIPA 2HSYA 1K0BA 1GSSA 2IN3A 2KLXA 1PN0A 5DJMA 4G9HA 5JWQB 2MYGA 4K0GA 4EVMA 1O8XA 4KX4A 2L4QA 4O92A 1S3RA 3D6IA 4TW5A 1TP9A 5EVOA 3TUEA 1OC9A 3JCML 3QOUA 3SBCA 2LNSA 7GSSA 3M9JA 1EV4A 4KAEA 4F03A 1OVNA 2MMAA 5ELGA 3GYKA 4Z2UA 1V2AA 2YZHA 3MDKA 1YKAA 1GSYA 2LNTA 3N9JA 4IW9A 2OACA 1K0AA 3APQA 1USBA 5F8BA 1GTUA 3EINA 1URMA 3RAZA 1JLVA 5CAXA 5IPGA 3ZFBA 2WRTA 5C04A 4BVXA 3ERFA 2QGVA 2CX4A 2K9FA 5EY6A 2IMEA 1KNGA 1GTBA 4F9ZA 5H5SA 4MABA 2CT6A 4ECBA 3A2VA 2GQMA 3DWVA 4EC0A 3MWHA 5DQSA 1EEJA 4ZBDA 4G10A 4JR6A 2C3QA 3TKSA 2CVKA 4RI7A 1SL1B 1PFOA 3GTUB 4HJ2A 4RI6A 4GXZA 2YJHA 4K0NA 2LUSA 2H70A 4EDYA 4TXVA 2H71A 18GSA 4HU9A 1THXA 5GAND 3DD3A 1OC8A 4MH3A 6GSTA 4ULXA 1J9BA 1AQVA 4HS1A 4V2MA 19GSA 2WS2A 2VIMA 3HYPA 1SJIA 2A2PA 3A5IA 2GZYA 2PUKC 3LGCA 3O76A 4AJ6A 2VCQA 2ZCTA 3WGDA 4IQAA 5G1KA 1O8WA 1A23A 3RHCA 2XBIA 4JZQA 4KH7A 3TJJA 1FB0A 1GSFA 4WF5A 2H8LA 1R7HA 12GSA 2WCIA 1X9MB 3GMFA 1E6BA 1XXUA 3H79A 4Z2TA 2F8FA 2HRFA 3KTLA 2PN8A 3TCOA 2X64A 4L0UA 1K3YA 1SD9A 4CY8A 3KCMA 3GX8A 3LXTA 2R0GA 3IA1A 3F9UA 4D73B 1BEDA 2JZRA 3NZNA 1G6YA 2FUG2 5INYA 2MBSA 4ZB6A 2LTKA 2HRKA 1V40A 2GZPA 4HI7A 1AQWA 4O5RA 9GSSA 4Q5NA 2LJRA 1R26A 4BWQA 4I2TA 3CSHA 1YDKA 2GT6A 3GIXA 2N5BA 4N10A 4HUAA 4FO5A 2H1DA 3ERWA 2X8HA 1YZXA 2OA7A 3A3TA 3HHVA 4F0CA 2OE0A 3GKXA 2VLTA 2DLXA 1GTIA 3HY2A 1VF1A 2CQ9A 3V1WA 1YEXA 5GZZB 2LJKA 3QAGA 1W89A 2K8VA 4MA9A 5JWRB 1F37A 4CW9A 1XZOA 2E0QA 2CZ2A 2H1GA 2X49A 1TI1A 2HNLA 2H0HA 4MJCA 1GWCA 2YCDA 3N5OA 4GSSA 5IO0A 3GHAA 3UIWA 2Z9SA 5A4WA 4K9ZA 4X43A 2E2MA 1FO5A 4L8EA 1M9BA 4OWYA 3DXBA 2IWTA 1M3IA 3VI5A 2NDOA 4XIHA 5HR1A 3QD9A 1M3JA 3FZ9A 2AYTA 1UVZA 3EURA 3P8WA 4TR1B 2QA1A 4ACSA 1ZYQB 5IO2A 4J56E 3DYRA 3KJYA 2TRCP 3QFBC 3TRPA 1X9SB 2IFQB 3UVTA 4LMWA 5IM9A 10GSA 3GUSA 3TKSE 3ISOA 4XCSA 5CRGA 4I6XA 1EGRA 3BCIA 3HJPA 2VLVA 4HU7A 5DAKB 2TRXA 1BX9A 3IE3A 4YAPA 4PQIA 4POBA 2ON7A 4IHUA 1WRYA 2L57A 3D22A 4KGIA 4DSQA 5J9CA 1G7OA 2H66A 3I43A 5J5NA 1JZWA 5HR3A 3VWUA 3FHKA 2R0PA 4TOPA 1SU9A 3PH9A 4TKYA 3MSZA 3Q6OA 4JR4A 5GAPD 1OKTA 2FNOA 4KSOA 4MJEA 2CA8A 5IQYA 3SWLA 1TTZA 2L4CA 3KGKA 4HQZA 5EPFA 3GKNA 3IV4A 1OAZA 5ECKB 3TRQA 5J4UA 2LRCA 3WT2A 4BA7A 2LQQA 5IPHA 1MDIA 2DKIA 1HD2A 1V9WA 2HSMA 1GUKA 4K7NA 2C0EA 2HZEA 4JU5A 2L5LA 3FR3A 4USSA 3P2AA 5D9XA 4ZL9A 4O5UA 1GH2A 1T1VA 1Z9HA 2JACA 1AXDA 1JHBA 3LFLA 3US3A 8GSSA 2FWEA 1YF0A 2HRAA 5KN3A 1J0FA 1SL2B 4KSMA 1H75A 2LRNA 3P7XA 5D8IA 3MNGA 3LWAA 1T7PB 1ON4A 3HVNA 3QR6A 2B3SA 4WF4A 4L5LA 5JWOB 2PVOC 3TDGA 2HE3A 4LA1A 2O8VB 3IHQA 4XS4B 5D96A 1UC7A 4GF0A 4MZBA 1SJ6A 1PRXA 4ECCA 2RM5A 1FHEA 3IPZA 1PSQA 2VCWA 2H73A 1K0DA 4YKGA 2NTOA 1F3BA 2C1YA 5ECPB 1FVJA 3HVSA 1V58A 4O7HA 5E59A 4WR5A 4KW6A 5B6MA 1XIYA 2EIQA 1XFLA 3FEUA 4XRAA 4WEYA 1GP1A 1ZYEA 2GGTA 2KOKA 4DEJA 3LQ7A 2X8CA 2VL2A 1JZRA 2GSRA 2XPDA 5KEJA 3WD6A 3A5WA 5HQPA 1SKRB 2YWNA 4IGJA 3F6FA 5ID2A 3BCKA 3UEMA 2A2SA 3GNJA 4OFNA 2FA8A 2RIIA 2WZ9A 3UBKA 4G19A 3ZREA 3L0HA 1PA3A 1TKDB 2F9SA 5ECRB 4GRFA 2H01A 4IVFA 1EOGA 2O85A 1U88A 2MBTA 3M3MA 3HD5A 5A4UA 4NMUA 4HJMA 4IP1A 3GSTA 5G31A 6GSUA 1GSUA 3F8UA 4ISDA 4HQSA 1GLQA 1Z7PA 4ML1A 1U6TA 4I8BA 2WDUA 3KH7A 5DVBA 1T4YA 4POKA 3RHBA 3GURA 1A2LA 3PGTA 3VI7A 2HI7A 3ZYWA 1K3LA 1V98A 1W4VA 3FZ5A 1TK5B 5D93A 4OO4A 5D9VA 2R2JA 3HCZA 1EP7A 3GKMA 5JCGA 2V32A 2VO4A 2C4JA 3Q19A 3LEFA 1ACVA 5COHA 2GSTA 4BL7A 2V41A 1A2MA 2R37A 2FA4A 3MYDA 3GL5A 3UARA 5DALA 2B7JA 1A0FA 2X99A 2EIRA 1Q98A 2VL3A 4ZXGA 3IDVA 1ERWA 4IN0A 5ECOB 2MMOA 5DJLA 4EDZA 4BWSA 2C80A 3QMXA 3TB2A 1GNEA 4MK3A 4QL7A 1ZCPA 2AAWA 5CRHA 6GSYA 4N30A 5G30A 5G5FA 4PX1A 1IYHA 2IMDA 3HDCA 2V6KA 5B8BA 2FGXA 1FOHA 1X0RA 3CXGA 1K0NA 2WULA 1S3AA 2P31A 2D2ZA 3KP8A 4YAVA 3IHGA 2YANA 5IMVA 2GVPA 1ZOFA 2B6MA 3FR9A 3I69A 3LG6A 2H76A 4NAXA 4F2IA 4FIWA 3TOTA 4MJAA 3R3EA 3ZVJA 2DBCA 4KCEA 4MH2A 1TI3A 3M0FA 2VCXA 1U3AA 5CNWA 1TRUA 4GTUA 3HJOA 1OC3A 2OJLA 3KTBA 4OMVA 3IAM2 2HFDA 5A5KA 2B7KA 3CBUA 1XOAA 1OC9B 4J2FA 2CV4A 5JCUA 4X0XA 1T3BA 2DJ0A 4DSSA 4FYBA 3IR4A 4YH2A 1ERUA 1XG8A 5KOXA 4L5OA 1DE1A 3IBHA 1Z7RA 2K18A 3LYKA 3I9V2 4P3YB 4EKZA 5AGYA 4MMMA 1NSWA 3FKFA 2C0GA 1T8EB 1GLPA 3G9BA 4JBBA 5CRWA 2XBQA 3ED3A 1GSQA 4BVXB 2MMZA 3BBYA 2HXKA 2NVLA 5AN1A 2IL3A 6GSSA 1F9MA 4PUAA 4BVYA 3L9UA 3R2QA 1Z6MA 1AIUA 1N8JA 22GSA 2R4VA 4AJ7A 3VPTA 5G1LA 3UAPA 2J9HA 3C73A 1YJ6A 4MCUA 5ECSA 2VD1A 5AIXA 3U6VA 2HT9A 1CQGA 3VK9A 1PL2A 3C71A 2PPTA 1SYRA 4NPBA 1K0OA 5H5QA 2RM6A 1EGOA 1A0RP 4XS6A 2CAQA 4I97A 2YV7A 4IQ1A 3BJ5A 2G0FA 5ABRA 2H1BA 3ERGA 3H93A 1AQXA 1PD21 2LJAA 2DC5A 2CVBA 2I1UA 2P0GA 4WXTA 3ZLPA 3ZFLA 2CVDA 1TRWA 1VF3A 1Z3EA 4GQCA 1TU8A 4TVEA 1QFNA 3WYWA 3HVXA 2FD3A 2QSIA 2PWJA 1TDIA 1TRVA 3CSIA 1GSDA 2L59A 1G0TA 4KB3A 1K0CA 1FAAA 4YQUA 1H4OA 3DKSA 4HZ4A 5H5RA 3L9VA 2OKAA 2BMXA 2IMFA 4JE1A 2VD0A 3GSSA 2PERA 4DSRA 4XHMA 3UJ1A 3OR5A 4KDXA 2B5XA 1ML6A 4G2EA 1ERVA 3ME8A 4PGTA 5CO3A 5DQYA 4LL1B 1R5AA 1HNCA 1PQNA 2O89A 4AGSA 3TOUA 4FQUA 2RLIA 2GT5A 3BOAA 3S9FA 3QCPA 3QAVA 2G2QA 1XCCA 2PU9C 2JL4A 1F2EA 2DJKA 3H4KA 1XWCA 2GQKA 1Y6EA 3IK9A 4Q5RA 4K2XA 1M99A 5F07A 2KUCA 4OFMA 5D9TA 2N5AA 1WP0A 5J9BA 1OE7A 4ML6A 2XC2A 2AB6A 2V6OA 1EWXA 4X4JA 2YWIA 2VM1A 2CX3A 4G0IA 3GA4A 3HZ4A 1B8XA 4JRRA 5FT3A 1SJZA 4MPFA 5EL8A 3D5JA 5IMDA 1TW9A 2DJ2A 4IP6A 1SD8A 1PL1A 2HRNA 4GLTA 1FW1A 3RPNA 1XW5A 4ZIJA 3EMXA 4IBPA 1LBKA 3TKQA 3CRTA 2ZUPA 1GNWA 4TN8A 1LU4A 4GCIA 3HA9A 4WBRD 3KZQA 4TR3A 3TRXA 4NHWA 1BAYA 1BJXA 1QK8A 3O3TA 1B9YC 2VCVA 3UOMA 2DIZA 3VWWA 5CREA 1FB6A 2F3MA 4G0KA 1RQMA 1S3CA 1SENA 3GX0A 3HVVA 2PBJA 4HEA2 4YQVA 5ENUA 4MF6A 2PGTA 1XBSA 3WGEA 1BYEA 3QFAC 2WB9A 2WJUA 17GSA 4OCFA 1KEBA 2P5QA 4TXOA 3TJGA 5IOXA 2A2RA 1TU7A 4KDUA 1QGVA 2I81A 4ZL8A 2C0FA 2H0IA 4Z7XA 1B4PA 20GSA 4EIQA 2CAIA 5CYYA 3HJMA 4ZBAA 2JADA 1T00A 2LQOA 1MD4A 1BG5A 4PNFA 5DDLA 1EOHA 1ST9A 3ZITA 3HKRA 3ZIJA 3Q18A 1O73A 3EWLA 3G7YA 3EVIA 4PURA 4FYUA 1KBNA 1TK8B 2OE1A 3C7MA 3ZL5A 3APSA 3GL3A 2ON5A 3APOA 1B4QA 5A4VA 2OBKA 3FMWA 3CYNA 2R3XA 1EV9A 1Y25A 1A24A 1TK0B 5D73A 2QC7A 1O85A 4MNNA 2H72A 1AC1A 3ME7A 2PVQA 5CP1A 5BRTA 3L78A 1I5GA 3GN3A 2HZEB 2KHPA 3NIVA 3IC4A 4OD7A 4MZCA 5CRDA 4NV5A 2WGRA 6GSWA 2H1AA 2FY6A 4PNGA 3J7Yb 4POLA 3AY8A 4O32A 4O5QA 2E2GA 2YN1A 4EUYA 3ZIVA 5F0GA 5HFIA 3KM6A 4EXJA 6GSVA 3KIJA 5DBQA 14GSA 2J23A 4K1FA 4V2LA 2V2GA 3ZZXA 3IXRA 4I5QA 1WJKA 1CQHA 1X5DA 5B8AA 1SYXA 4V1Ag 4ECIA 2B1LA 5KOWA 2L6DA 2E7PA 1AAZA 1SK1A 4ID0A 3D21A 3RDWA 2DJ3A 2O87A 3DIEA 1A2JA 2OBIA 1XWGA 3DVXA 1JZDA 1XVWA 5FWGA 1NHOA 3KD0A 4ZB9A 3UVHA 5HFGA 1NM3A 5JCWA 3CQFA 3U5RE 1YY7A 2XHFA 1Q4JA 1SKSB 1TRSA 4HOJA 2ES7A 4FYCA 3IC8A 3LYPA 3ZMLA 1UA5A 3E3EA 3KMNA 1KTEA 1TOFA 3W8SA 5LNKe 5IMFA 5ID2B 1Z6NA 3GRXA 1RW1A 4HZ2A 4K5SA 3IK7A 3EE2A 1DE2A 1UN2A 3E9JB 1QMVA 3O6TA 1ZZYA 4H86A 4K6XA 2AUVA 3VWVA 2C3TA 2VM2A 4FH8A 2C8UA 1NW2A 3GKKA 2CZ3A 2LV3A 3TJBA 1S3DA 2JU5A 1K0MA 2FLSA 2GSQA 4K7IA 3GTUA 4KA0A 4LL4B 2RUEA 1A8LA 1B48A 5IMAA 3TJFA 5HFKA 1HNAA 4RQXA 3DEXA 2B5EA 1ZL9A 2VCTA 3GH9A 3HZ8A 4Q5FA 4RUVA 4V2NA 2H19A 1C72A 2YOIA 3G7JA 4MP4A 2O7KA 2X8GA 1THOA 1MDKA 3TKSC 2C3NA 1WOUA 2K6VA 1G6WA 3HXSA 4N11A 5C00A 2FHEA 1JFUA 4MPGA 3VFIA 4WKWA 5KN2A 1MD3A 4BL7B 3WT1A 4ZL7A 3MAKA 3L9SA 1GL8A 2YWOA 3CSJA 1QXHA 5DALB 4OCEA 4E8HA 1F6MC 3M1GA 2REMA 3FYGA 4K5RA 1O7UA 3H8QA 4YQMA 5ECMB 3IOSA 4AF2A 1J08A 3G7IA 3FK8A 2YV9A 2X4AA 2JZSA 3Q74A 4V1Ap 4ZB8A 4D73A 1GSEA 4PQHA 2XPEA 1SK0A 3I6AA 1OKDA 5LD0A 2ZNMA 5G5EA 1K3OA 2OADA 1VGLA 1ZYNA 4WETA 1RK4A
chains in the Genus database with same CATH topology
1XWKA 3GH6A 2IMIA 4EE0A 5IMZA 3TKRA 1N2AA 2QKEA 2H6ZA 2H0GA 4N0ZA 2TIRA 3K8NA 2FCHA 1EZKA 4LLRA 4K8MA 2NBSA 2N5FA 4WR4A 1TXXA 4JEDA 2R0CA 2B5YA 1PGTA 3C1RA 4MLYA 2FWHA 2EC4A 2OE3A 3EMPA 5ECNB 3J7Yk 1ZYPA 4K7OA 4XTSA 4DSSB 1XWBA 2VLUA 1M2BA 2LKUA 1EEMA 2A4VA 2I9HA 3H1NA 4BPYA 2LSTA 3QAWA 3EU4A 2GTUA 2M46A 3CTGA 4IS0A 4MZWA 2DIYA 3F3QA 1GTAA 3W8JA 4NXIA 3D0ZA 1ABAA 3LJRA 5IIZA 1WIKA 1VF4A 2BTOT 3DMLA 5IMCA 3VPQA 1XWAA 3GFKA 3C8EA 2AHEA 4PTSA 2AV4A 4IJIA 1GUHA 1XOBA 1E2YA 3F4RA 4I2UA 4CHSA 16GSA 5D9WA 1X5EA 2KP1A 3ZVJD 4EF0A 2H75A 1ZGNA 1YQ1A 4BVYB 3UMAA 1HNBA 1FG4A 2WFCA 3BD2A 4X1UA 5E4WA 4KCAA 1IYIA 4OFTA 4G0LA 5DCHA 4GWRA 4E8EA 4F82A 5ECLB 2JSYA 5ECIB 2QA2A 2YPMA 4Q5QA 4KF9A 1SL0B 2LS5A 4IKHA 4TR1A 1Z5YE 1X5CA 2MZCA 1ERTA 3M8NA 4A5PA 3DRNA 2IFQA 2GS3A 2I4AA 3IAS2 1X9WB 2DMMA 2PMTA 3FZAA 3TKPA 3EPTA 2JZTA 2B1KA 13GSA 3EYTA 4GSTA 2VL9A 2H6YA 3KMOA 2F8AA 4MDCA 4OO5A 5DAKA 3A2WA 1A8YA 1PKWA 1FOVA 1MTCA 1PX6A 3TGZA 3LORA 4J57E 3D4TA 1XW6A 5AIVA 5HR0A 2C0DA 1I9DA 3ZMKA 1XPVA 1YF1A 1PX7A 2BJXA 2GSSA 1XW9A 5GSTA 3FRCA 2I3YA 3F6DA 1O81A 3LW9A 3LSZA 2GDRA 1R4WA 3VLNA 1WMJA 1YKCA 4QQ7A 3VWXA 2K8SA 4WBJA 2YP6A 11GSA 3MIXA 4TR0A 5FHIA 2GZZA 3CMIA 4MF7A 2KP2A 2L6CA 3QDNA 4MF5A 4IJ3A 2YZUA 2DSAA 2HYXA 1HYUA 2VUPA 1MDJA 4XS1A 1F3AA 4LMVA 1JLWA 3GV1A 4KE3A 3UBLA 3FW2A 3C1SA 2DMLA 2VCZA 2R5GA 1V57A 4F0BA 1U87A 3A2XA 1U3IA 3L4NA 1PKZA 1VF2A 2DJJA 2A4HA 3NOFA 4PQ1A 5B6NA 2VOCA 3RPPA 1M0UA 1O6JA 4YKFA 5B7CA 1GULA 1LJRA 1HQOA 1PMTA 4QL9A 5GSSA 1MEKA 4L0WA 2MMNA 3ZRDA 3QPMA 5LCZA 4XS4A 1XVQA 2R6KA 2H30A 3KP9A 4PUFC 4K2DA 2EIOA 5ECHB 2HLSA 4NHZA 3VURA 5AISA 5J3RA 3DGQA 2LRTA 1OYJA 1B9XC 2RUFA 3F0IA 3E0UA 4CY6A 2M80A 1SKWB 3DVWA 2F51A 4PXOA 4GSNA 2M72A 6GSXA 1PN9A 4EL1A 4IELA 1EP8A 2IMKA 1YEPA 4TRXA 1ZMAA 5KN0A 2YJ7A 3TJKA 1WWJA 5IOWA 5J41A 1QUWA 3RBTA 4DVCA 3FR6A 4AJ8A 3UL3A 3PINA 1SK2A 2FWFA 2VL2C 2NPBA 1M9AA 2YNXA 1AUCA 4NV2A 1M2DA 3KH9A 3FZ4A 2IPAA 2HZFA 2FWGA 4TXOB 2IIYA 5ECQB 4Z2RA 3F4SA 3LXZA 2DKHA 5ELAA 2GLRA 5DCGA 3P90A 3WGXA 1JZOA 2P5RA 3F3RA 4XRDA 2HSHA 4GQFA 2DJ1A 2H6XA 2VAFA 3IRAA 4ICYA 1TJDA 4KUNA 4KDYA 1WE0A 1WPIA 3M9KA 1VRSD 2L5OA 4ECJA 4RQRA 3EU3A 1DBYA 3PR8A 3FY7A 5F05A 2ALBA 3F4TA 3D4MA 1GRXA 3CTFA 4KNDA 3KEBA 1T4ZA 1DUGA 5HR2A 3EC3A 2JSZA 5BMUA 2AJQB 4MJBA 3F63A 1OE8A 4CDOA 1R5PA 2H74A 3PPUA 2GQLA 4POMA 4TR4A 2IJYA 4N0VA 1DSBA 1M2AA 2V1MA 4HDEA 5KN1A 3W6GA 1AW9A 3CRUA 4ZILA 1FVKA 1BQ7A 1ILOA 3ZTLA 1QQ2A 2UZ8A 4ZBBA 1M7TA 4EO3A 5L71A 4NWYA 1G7EA 4ILFA 1NHYA 2LEGA 5F06A 2YWMA 5G2ZA 1GUMA 3KXOA 4EIPA 2HSYA 1K0BA 1GSSA 2IN3A 2KLXA 1PN0A 5DJMA 4G9HA 5JWQB 2MYGA 4K0GA 4EVMA 1O8XA 4KX4A 2L4QA 4O92A 3D6IA 4TW5A 1TP9A 5EVOA 3TUEA 1OC9A 3JCML 3QOUA 3SBCA 2LNSA 7GSSA 3M9JA 1EV4A 4KAEA 4F03A 1OVNA 2MMAA 5ELGA 3GYKA 4Z2UA 1V2AA 2YZHA 3MDKA 1YKAA 1GSYA 2LNTA 3N9JA 4IW9A 2OACA 1K0AA 3APQA 1USBA 5F8BA 1GTUA 3EINA 1URMA 3RAZA 1JLVA 5CAXA 5IPGA 3ZFBA 2WRTA 5C04A 4BVXA 3ERFA 2QGVA 2CX4A 2K9FA 5EY6A 2IMEA 1KNGA 1GTBA 4F9ZA 5H5SA 4MABA 2CT6A 4ECBA 3A2VA 2GQMA 3DWVA 4EC0A 3MWHA 5DQSA 1EEJA 4ZBDA 4G10A 4JR6A 2C3QA 3TKSA 2CVKA 4RI7A 1SL1B 3GTUB 4HJ2A 4RI6A 4GXZA 2YJHA 4K0NA 2LUSA 2H70A 4EDYA 4TXVA 2H71A 18GSA 4HU9A 1THXA 5GAND 3DD3A 1OC8A 4MH3A 6GSTA 4ULXA 1J9BA 1AQVA 4HS1A 4V2MA 19GSA 2WS2A 2VIMA 3HYPA 1SJIA 2A2PA 3A5IA 2GZYA 2PUKC 3LGCA 3O76A 4AJ6A 2VCQA 2ZCTA 3WGDA 4IQAA 5G1KA 1O8WA 1A23A 3RHCA 2XBIA 4JZQA 4KH7A 3TJJA 1FB0A 1GSFA 4WF5A 2H8LA 1R7HA 12GSA 2WCIA 1X9MB 3GMFA 1E6BA 1XXUA 3H79A 4Z2TA 2F8FA 2HRFA 3KTLA 2PN8A 3TCOA 2X64A 4L0UA 1K3YA 1SD9A 4CY8A 3KCMA 3GX8A 3LXTA 2R0GA 3IA1A 3F9UA 4D73B 1BEDA 2JZRA 3NZNA 1G6YA 2FUG2 5INYA 2MBSA 4ZB6A 2LTKA 2HRKA 1V40A 2GZPA 4HI7A 1AQWA 4O5RA 9GSSA 4Q5NA 2LJRA 1R26A 4BWQA 4I2TA 3CSHA 1YDKA 2GT6A 3GIXA 2N5BA 4N10A 4HUAA 4FO5A 2H1DA 3ERWA 2X8HA 1YZXA 2OA7A 3A3TA 3HHVA 4F0CA 2OE0A 3GKXA 2VLTA 2DLXA 1GTIA 3HY2A 1VF1A 2CQ9A 3V1WA 1YEXA 5GZZB 2LJKA 3QAGA 1W89A 2K8VA 4MA9A 5JWRB 1F37A 4CW9A 1XZOA 2E0QA 2CZ2A 2H1GA 2X49A 1TI1A 2HNLA 2H0HA 4MJCA 1GWCA 2YCDA 3N5OA 4GSSA 5IO0A 3GHAA 3UIWA 2Z9SA 5A4WA 4K9ZA 4X43A 2E2MA 1FO5A 4L8EA 1M9BA 4OWYA 3DXBA 2IWTA 3VI5A 2NDOA 4XIHA 5HR1A 3QD9A 3FZ9A 2AYTA 1UVZA 3EURA 3P8WA 4TR1B 2QA1A 4ACSA 1ZYQB 5IO2A 4J56E 3DYRA 3KJYA 2TRCP 3QFBC 3TRPA 1X9SB 2IFQB 3UVTA 4LMWA 5IM9A 10GSA 3GUSA 3TKSE 3ISOA 4XCSA 5CRGA 4I6XA 1EGRA 3BCIA 3HJPA 2VLVA 4HU7A 5DAKB 2TRXA 1BX9A 3IE3A 4YAPA 4PQIA 4POBA 2ON7A 4IHUA 1WRYA 2L57A 3D22A 4KGIA 4DSQA 5J9CA 1G7OA 2H66A 3I43A 5J5NA 1JZWA 5HR3A 3VWUA 3FHKA 2R0PA 4TOPA 1SU9A 3PH9A 4TKYA 3MSZA 3Q6OA 4JR4A 5GAPD 1OKTA 2FNOA 4KSOA 4MJEA 2CA8A 5IQYA 3SWLA 1TTZA 2L4CA 3KGKA 4HQZA 5EPFA 3GKNA 3IV4A 1OAZA 5ECKB 3TRQA 5J4UA 2LRCA 3WT2A 4BA7A 2LQQA 5IPHA 1MDIA 2DKIA 1HD2A 1V9WA 2HSMA 1GUKA 4K7NA 2C0EA 2HZEA 4JU5A 2L5LA 3FR3A 4USSA 3P2AA 5D9XA 4ZL9A 4O5UA 1GH2A 1T1VA 1Z9HA 2JACA 1AXDA 1JHBA 3LFLA 3US3A 8GSSA 2FWEA 1YF0A 2HRAA 5KN3A 1J0FA 1SL2B 4KSMA 1H75A 2LRNA 3P7XA 5D8IA 3MNGA 3LWAA 1T7PB 1ON4A 3QR6A 2B3SA 4WF4A 4L5LA 5JWOB 2PVOC 3TDGA 2HE3A 4LA1A 2O8VB 3IHQA 4XS4B 5D96A 1UC7A 4GF0A 4MZBA 1SJ6A 1PRXA 4ECCA 2RM5A 1FHEA 3IPZA 1PSQA 2VCWA 2H73A 1K0DA 4YKGA 2NTOA 1F3BA 2C1YA 5ECPB 1FVJA 3HVSA 1V58A 4O7HA 5E59A 4WR5A 4KW6A 5B6MA 1XIYA 2EIQA 1XFLA 3FEUA 4XRAA 4WEYA 1GP1A 1ZYEA 2GGTA 2KOKA 4DEJA 3LQ7A 2X8CA 2VL2A 1JZRA 2GSRA 2XPDA 5KEJA 3WD6A 3A5WA 5HQPA 1SKRB 2YWNA 4IGJA 3F6FA 5ID2A 3BCKA 3UEMA 2A2SA 3GNJA 4OFNA 2FA8A 2RIIA 2WZ9A 3UBKA 4G19A 3ZREA 3L0HA 1PA3A 1TKDB 2F9SA 5ECRB 4GRFA 2H01A 4IVFA 1EOGA 2O85A 1U88A 2MBTA 3M3MA 3HD5A 5A4UA 4NMUA 4HJMA 4IP1A 3GSTA 5G31A 6GSUA 1GSUA 3F8UA 4ISDA 4HQSA 1GLQA 1Z7PA 4ML1A 1U6TA 4I8BA 2WDUA 3KH7A 5DVBA 1T4YA 4POKA 3RHBA 3GURA 1A2LA 3PGTA 3VI7A 2HI7A 3ZYWA 1K3LA 1V98A 1W4VA 3FZ5A 1TK5B 5D93A 4OO4A 5D9VA 2R2JA 3HCZA 1EP7A 3GKMA 5JCGA 2V32A 2VO4A 2C4JA 3Q19A 3LEFA 1ACVA 5COHA 2GSTA 4BL7A 2V41A 1A2MA 2R37A 2FA4A 3MYDA 3GL5A 3UARA 5DALA 2B7JA 1A0FA 2X99A 2EIRA 1Q98A 2VL3A 4ZXGA 3IDVA 1ERWA 4IN0A 5ECOB 2MMOA 5DJLA 4EDZA 4BWSA 2C80A 3QMXA 3TB2A 1GNEA 4MK3A 4QL7A 1ZCPA 2AAWA 5CRHA 6GSYA 4N30A 5G30A 5G5FA 4PX1A 1IYHA 2IMDA 3HDCA 2V6KA 5B8BA 2FGXA 1FOHA 1X0RA 3CXGA 1K0NA 2WULA 1S3AA 2P31A 2D2ZA 3KP8A 4YAVA 3IHGA 2YANA 5IMVA 2GVPA 1ZOFA 2B6MA 3FR9A 3I69A 3LG6A 2H76A 4NAXA 4F2IA 4FIWA 3TOTA 4MJAA 3R3EA 3ZVJA 2DBCA 4KCEA 4MH2A 1TI3A 3M0FA 2VCXA 1U3AA 5CNWA 1TRUA 4GTUA 3HJOA 1OC3A 2OJLA 3KTBA 4OMVA 3IAM2 2HFDA 5A5KA 2B7KA 3CBUA 1XOAA 1OC9B 4J2FA 2CV4A 5JCUA 4X0XA 1T3BA 2DJ0A 4DSSA 4FYBA 3IR4A 4YH2A 1ERUA 5KOXA 4L5OA 1DE1A 3IBHA 1Z7RA 2K18A 3LYKA 3I9V2 4P3YB 4EKZA 5AGYA 4MMMA 1NSWA 3FKFA 2C0GA 1T8EB 1GLPA 3G9BA 4JBBA 5CRWA 2XBQA 3ED3A 1GSQA 4BVXB 2MMZA 3BBYA 2HXKA 2NVLA 5AN1A 2IL3A 6GSSA 1F9MA 4PUAA 4BVYA 3L9UA 3R2QA 1Z6MA 1AIUA 1N8JA 22GSA 2R4VA 4AJ7A 3VPTA 5G1LA 3UAPA 2J9HA 3C73A 1YJ6A 4MCUA 5ECSA 2VD1A 5AIXA 3U6VA 2HT9A 1CQGA 3VK9A 1PL2A 3C71A 2PPTA 1SYRA 4NPBA 1K0OA 5H5QA 2RM6A 1EGOA 1A0RP 4XS6A 2CAQA 4I97A 2YV7A 4IQ1A 3BJ5A 2G0FA 5ABRA 2H1BA 3ERGA 3H93A 1AQXA 1PD21 2LJAA 2DC5A 2CVBA 2I1UA 2P0GA 4WXTA 3ZLPA 3ZFLA 2CVDA 1TRWA 1VF3A 1Z3EA 4GQCA 1TU8A 4TVEA 1QFNA 3WYWA 3HVXA 2FD3A 2QSIA 2PWJA 1TDIA 1TRVA 3CSIA 1GSDA 2L59A 1G0TA 4KB3A 1K0CA 1FAAA 4YQUA 1H4OA 3DKSA 4HZ4A 5H5RA 3L9VA 2OKAA 2BMXA 2IMFA 4JE1A 2VD0A 3GSSA 2PERA 4DSRA 4XHMA 3UJ1A 3OR5A 4KDXA 2B5XA 1ML6A 4G2EA 1ERVA 3ME8A 4PGTA 5CO3A 5DQYA 4LL1B 1R5AA 1HNCA 1PQNA 2O89A 4AGSA 3TOUA 4FQUA 2RLIA 2GT5A 3BOAA 3S9FA 3QCPA 3QAVA 2G2QA 1XCCA 2PU9C 2JL4A 1F2EA 2DJKA 3H4KA 1XWCA 2GQKA 1Y6EA 3IK9A 4Q5RA 4K2XA 1M99A 5F07A 2KUCA 4OFMA 5D9TA 2N5AA 1WP0A 5J9BA 1OE7A 4ML6A 2XC2A 2AB6A 2V6OA 1EWXA 4X4JA 2YWIA 2VM1A 2CX3A 4G0IA 3GA4A 3HZ4A 1B8XA 4JRRA 5FT3A 1SJZA 4MPFA 5EL8A 3D5JA 5IMDA 1TW9A 2DJ2A 4IP6A 1SD8A 1PL1A 2HRNA 4GLTA 1FW1A 3RPNA 1XW5A 4ZIJA 3EMXA 4IBPA 1LBKA 3TKQA 3CRTA 2ZUPA 1GNWA 4TN8A 1LU4A 4GCIA 3HA9A 4WBRD 3KZQA 4TR3A 3TRXA 4NHWA 1BAYA 1BJXA 1QK8A 3O3TA 1B9YC 2VCVA 3UOMA 2DIZA 3VWWA 5CREA 1FB6A 2F3MA 4G0KA 1RQMA 1S3CA 1SENA 3GX0A 3HVVA 2PBJA 4HEA2 4YQVA 5ENUA 4MF6A 2PGTA 1XBSA 3WGEA 1BYEA 3QFAC 2WB9A 2WJUA 17GSA 4OCFA 1KEBA 2P5QA 4TXOA 3TJGA 5IOXA 2A2RA 1TU7A 4KDUA 1QGVA 2I81A 4ZL8A 2C0FA 2H0IA 4Z7XA 1B4PA 20GSA 4EIQA 2CAIA 5CYYA 3HJMA 4ZBAA 2JADA 1T00A 2LQOA 1MD4A 1BG5A 4PNFA 5DDLA 1EOHA 1ST9A 3ZITA 3HKRA 3ZIJA 3Q18A 1O73A 3EWLA 3G7YA 3EVIA 4PURA 4FYUA 1KBNA 1TK8B 2OE1A 3C7MA 3ZL5A 3APSA 3GL3A 2ON5A 3APOA 1B4QA 5A4VA 2OBKA 3FMWA 3CYNA 2R3XA 1EV9A 1Y25A 1A24A 1TK0B 5D73A 2QC7A 1O85A 4MNNA 2H72A 1AC1A 3ME7A 2PVQA 5CP1A 5BRTA 3L78A 1I5GA 3GN3A 2HZEB 2KHPA 3NIVA 3IC4A 4OD7A 4MZCA 5CRDA 4NV5A 2WGRA 6GSWA 2H1AA 2FY6A 4PNGA 3J7Yb 4POLA 3AY8A 4O32A 4O5QA 2E2GA 2YN1A 4EUYA 3ZIVA 5F0GA 5HFIA 3KM6A 4EXJA 6GSVA 3KIJA 5DBQA 14GSA 2J23A 4K1FA 4V2LA 2V2GA 3ZZXA 3IXRA 4I5QA 1WJKA 1CQHA 1X5DA 5B8AA 1SYXA 4V1Ag 4ECIA 2B1LA 5KOWA 2L6DA 2E7PA 1AAZA 1SK1A 4ID0A 3D21A 3RDWA 2DJ3A 2O87A 3DIEA 1A2JA 2OBIA 1XWGA 3DVXA 1JZDA 1XVWA 5FWGA 1NHOA 3KD0A 4ZB9A 3UVHA 5HFGA 1NM3A 5JCWA 3U5RE 1YY7A 2XHFA 1Q4JA 1SKSB 1TRSA 4HOJA 2ES7A 4FYCA 3IC8A 3LYPA 3ZMLA 1UA5A 3E3EA 3KMNA 1KTEA 1TOFA 3W8SA 5LNKe 5IMFA 5ID2B 1Z6NA 3GRXA 1RW1A 4HZ2A 4K5SA 3IK7A 3EE2A 1DE2A 1UN2A 3E9JB 1QMVA 3O6TA 1ZZYA 4H86A 4K6XA 2AUVA 3VWVA 2C3TA 2VM2A 4FH8A 2C8UA 1NW2A 3GKKA 2CZ3A 2LV3A 3TJBA 1S3DA 2JU5A 1K0MA 2FLSA 2GSQA 4K7IA 3GTUA 4KA0A 4LL4B 2RUEA 1A8LA 1B48A 5IMAA 3TJFA 5HFKA 1HNAA 4RQXA 3DEXA 2B5EA 1ZL9A 2VCTA 3GH9A 3HZ8A 4Q5FA 4RUVA 4V2NA 2H19A 1C72A 2YOIA 3G7JA 4MP4A 2O7KA 2X8GA 1THOA 1MDKA 3TKSC 2C3NA 1WOUA 2K6VA 1G6WA 3HXSA 4N11A 5C00A 2FHEA 1JFUA 4MPGA 3VFIA 4WKWA 5KN2A 1MD3A 4BL7B 3WT1A 4ZL7A 3MAKA 3L9SA 1GL8A 2YWOA 3CSJA 1QXHA 5DALB 4OCEA 4E8HA 1F6MC 3M1GA 2REMA 3FYGA 4K5RA 1O7UA 3H8QA 4YQMA 5ECMB 3IOSA 4AF2A 1J08A 3G7IA 3FK8A 2YV9A 2X4AA 2JZSA 3Q74A 4V1Ap 4ZB8A 4D73A 1GSEA 4PQHA 2XPEA 1SK0A 3I6AA 1OKDA 5LD0A 2ZNMA 5G5EA 1K3OA 2OADA 1VGLA 1ZYNA 4WETA 1RK4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A4H A;  2A2P A; 
#chains in the Genus database with same CATH topology
 1XWK A;  3GH6 A;  2IMI A;  4EE0 A;  5IMZ A;  3TKR A;  1N2A A;  2QKE A;  2H6Z A;  2H0G A;  4N0Z A;  2TIR A;  3K8N A;  2FCH A;  1EZK A;  4LLR A;  4K8M A;  2NBS A;  2N5F A;  4WR4 A;  1TXX A;  4JED A;  2R0C A;  2B5Y A;  1PGT A;  3C1R A;  4MLY A;  2FWH A;  2EC4 A;  2OE3 A;  3EMP A;  5ECN B;  3J7Y k;  1ZYP A;  4K7O A;  4XTS A;  4DSS B;  1XWB A;  2VLU A;  1M2B A;  2LKU A;  1EEM A;  2A4V A;  2I9H A;  3H1N A;  4BPY A;  2LST A;  3QAW A;  3EU4 A;  2GTU A;  2M46 A;  3CTG A;  4IS0 A;  4MZW A;  2DIY A;  3F3Q A;  1GTA A;  3W8J A;  4NXI A;  3D0Z A;  1ABA A;  3LJR A;  5IIZ A;  1WIK A;  1VF4 A;  2BTO T;  3DML A;  5IMC A;  3VPQ A;  1XWA A;  3GFK A;  3C8E A;  2AHE A;  4PTS A;  2AV4 A;  4IJI A;  1GUH A;  1XOB A;  1E2Y A;  3F4R A;  4I2U A;  4CHS A;  16GS A;  5D9W A;  1X5E A;  2KP1 A;  3ZVJ D;  4EF0 A;  2H75 A;  1ZGN A;  1YQ1 A;  4BVY B;  3UMA A;  1HNB A;  1FG4 A;  2WFC A;  3BD2 A;  4X1U A;  5E4W A;  4KCA A;  1IYI A;  4OFT A;  4G0L A;  5DCH A;  4GWR A;  4E8E A;  4F82 A;  5ECL B;  2JSY A;  5ECI B;  2QA2 A;  2YPM A;  4Q5Q A;  4KF9 A;  1SL0 B;  2LS5 A;  4IKH A;  4TR1 A;  1Z5Y E;  1X5C A;  2MZC A;  1ERT A;  3M8N A;  4A5P A;  3DRN A;  2IFQ A;  2GS3 A;  2I4A A;  3IAS 2;  1X9W B;  2DMM A;  2PMT A;  3FZA A;  3TKP A;  3EPT A;  2JZT A;  2B1K A;  13GS A;  3EYT A;  4GST A;  2VL9 A;  2H6Y A;  3KMO A;  2F8A A;  4MDC A;  4HSC X;  4OO5 A;  5DAK A;  3A2W A;  1A8Y A;  1PKW A;  1FOV A;  1MTC A;  1PX6 A;  3TGZ A;  3LOR A;  4J57 E;  3D4T A;  1XW6 A;  5AIV A;  5HR0 A;  2C0D A;  1I9D A;  3ZMK A;  1XPV A;  1YF1 A;  1PX7 A;  2BJX A;  2GSS A;  1XW9 A;  5GST A;  3FRC A;  2I3Y A;  3F6D A;  1O81 A;  3LW9 A;  3LSZ A;  2GDR A;  1R4W A;  3VLN A;  1WMJ A;  1YKC A;  4QQ7 A;  3VWX A;  2K8S A;  4WBJ A;  2YP6 A;  11GS A;  3MIX A;  4TR0 A;  5FHI A;  2GZZ A;  3CMI A;  4MF7 A;  2KP2 A;  2L6C A;  3QDN A;  4MF5 A;  4IJ3 A;  2YZU A;  2DSA A;  2HYX A;  1HYU A;  2VUP A;  1MDJ A;  4XS1 A;  1F3A A;  4LMV A;  1JLW A;  3GV1 A;  4KE3 A;  3UBL A;  3FW2 A;  3C1S A;  2DML A;  2VCZ A;  2R5G A;  1V57 A;  4F0B A;  1U87 A;  3A2X A;  1U3I A;  3L4N A;  1PKZ A;  1VF2 A;  2DJJ A;  2A4H A;  3NOF A;  4PQ1 A;  5B6N A;  2VOC A;  3RPP A;  1M0U A;  1O6J A;  4YKF A;  5B7C A;  1GUL A;  1LJR A;  1HQO A;  1PMT A;  4QL9 A;  5GSS A;  1MEK A;  4L0W A;  2MMN A;  3ZRD A;  3QPM A;  5LCZ A;  4XS4 A;  1XVQ A;  2R6K A;  2H30 A;  3KP9 A;  4PUF C;  4K2D A;  2EIO A;  5ECH B;  2HLS A;  4NHZ A;  3VUR A;  5AIS A;  5J3R A;  3DGQ A;  2LRT A;  1OYJ A;  1B9X C;  2RUF A;  3F0I A;  3E0U A;  4CY6 A;  2M80 A;  1SKW B;  3DVW A;  2F51 A;  4PXO A;  4GSN A;  2M72 A;  6GSX A;  1PN9 A;  4EL1 A;  4IEL A;  1EP8 A;  2IMK A;  1YEP A;  4TRX A;  1ZMA A;  5KN0 A;  2YJ7 A;  3TJK A;  1WWJ A;  5IOW A;  5J41 A;  1QUW A;  3RBT A;  4DVC A;  3FR6 A;  4AJ8 A;  3UL3 A;  3PIN A;  1SK2 A;  2FWF A;  2VL2 C;  2NPB A;  1M9A A;  2YNX A;  1AUC A;  4NV2 A;  1M2D A;  3KH9 A;  3FZ4 A;  2IPA A;  2HZF A;  2FWG A;  4TXO B;  2IIY A;  5ECQ B;  4Z2R A;  3F4S A;  3LXZ A;  2DKH A;  5ELA A;  2GLR A;  5DCG A;  3P90 A;  3WGX A;  1JZO A;  2P5R A;  3F3R A;  4XRD A;  2HSH A;  4GQF A;  2DJ1 A;  2H6X A;  2VAF A;  3IRA A;  4ICY A;  1TJD A;  4KUN A;  4KDY A;  1WE0 A;  1WPI A;  3M9K A;  1VRS D;  2L5O A;  4ECJ A;  4RQR A;  3EU3 A;  1DBY A;  3PR8 A;  3FY7 A;  5F05 A;  2ALB A;  3F4T A;  3D4M A;  1GRX A;  3CTF A;  4KND A;  3KEB A;  1T4Z A;  1DUG A;  5HR2 A;  4BIK A;  3EC3 A;  2JSZ A;  5BMU A;  2AJQ B;  4MJB A;  3F63 A;  1OE8 A;  4CDO A;  1R5P A;  2H74 A;  3PPU A;  2GQL A;  4POM A;  4TR4 A;  2IJY A;  4N0V A;  1DSB A;  1M2A A;  2V1M A;  4HDE A;  5KN1 A;  3W6G A;  1AW9 A;  3CRU A;  4ZIL A;  1FVK A;  1BQ7 A;  1ILO A;  3ZTL A;  1QQ2 A;  2UZ8 A;  4ZBB A;  1M7T A;  4EO3 A;  5L71 A;  4NWY A;  1G7E A;  4ILF A;  1NHY A;  2LEG A;  5F06 A;  2YWM A;  5G2Z A;  1GUM A;  3KXO A;  4EIP A;  2HSY A;  1K0B A;  1GSS A;  2IN3 A;  2KLX A;  1PN0 A;  5DJM A;  4G9H A;  5JWQ B;  2MYG A;  4K0G A;  4EVM A;  1O8X A;  4KX4 A;  2L4Q A;  4O92 A;  1S3R A;  3D6I A;  4TW5 A;  1TP9 A;  5EVO A;  3TUE A;  1OC9 A;  3JCM L;  3QOU A;  3SBC A;  2LNS A;  7GSS A;  3M9J A;  1EV4 A;  4KAE A;  4F03 A;  1OVN A;  2MMA A;  5ELG A;  3GYK A;  4Z2U A;  1V2A A;  2YZH A;  3MDK A;  1YKA A;  1GSY A;  2LNT A;  3N9J A;  4IW9 A;  2OAC A;  1K0A A;  3APQ A;  1USB A;  5F8B A;  1GTU A;  3EIN A;  1URM A;  3RAZ A;  1JLV A;  5CAX A;  5IPG A;  3ZFB A;  2WRT A;  5C04 A;  4BVX A;  3ERF A;  2QGV A;  2CX4 A;  2K9F A;  5EY6 A;  2IME A;  1KNG A;  1GTB A;  4F9Z A;  5H5S A;  4MAB A;  2CT6 A;  4ECB A;  3A2V A;  2GQM A;  3DWV A;  4EC0 A;  3MWH A;  5DQS A;  1EEJ A;  4ZBD A;  4G10 A;  4JR6 A;  2C3Q A;  3TKS A;  2CVK A;  4RI7 A;  1SL1 B;  1PFO A;  3GTU B;  4HJ2 A;  4RI6 A;  4GXZ A;  2YJH A;  4K0N A;  2LUS A;  2H70 A;  4EDY A;  4TXV A;  2H71 A;  18GS A;  4HU9 A;  1THX A;  5GAN D;  3DD3 A;  1OC8 A;  4MH3 A;  6GST A;  4ULX A;  1J9B A;  1AQV A;  4HS1 A;  4V2M A;  19GS A;  2WS2 A;  2VIM A;  3HYP A;  1SJI A;  2A2P A;  3A5I A;  2GZY A;  2PUK C;  3LGC A;  3O76 A;  4AJ6 A;  2VCQ A;  2ZCT A;  3WGD A;  4IQA A;  5G1K A;  1O8W A;  1A23 A;  3RHC A;  2XBI A;  4JZQ A;  4KH7 A;  3TJJ A;  1FB0 A;  1GSF A;  4WF5 A;  2H8L A;  1R7H A;  12GS A;  2WCI A;  1X9M B;  3GMF A;  1E6B A;  1XXU A;  3H79 A;  4Z2T A;  2F8F A;  2HRF A;  3KTL A;  2PN8 A;  3TCO A;  2X64 A;  4L0U A;  1K3Y A;  1SD9 A;  4CY8 A;  3KCM A;  3GX8 A;  3LXT A;  2R0G A;  3IA1 A;  3F9U A;  4D73 B;  1BED A;  2JZR A;  3NZN A;  1G6Y A;  2FUG 2;  5INY A;  2MBS A;  4ZB6 A;  2LTK A;  2HRK A;  1V40 A;  2GZP A;  4HI7 A;  1AQW A;  4O5R A;  9GSS A;  4Q5N A;  2LJR A;  1R26 A;  4BWQ A;  4I2T A;  3CSH A;  1YDK A;  2GT6 A;  3GIX A;  2N5B A;  4N10 A;  4HUA A;  4FO5 A;  2H1D A;  3ERW A;  2X8H A;  1YZX A;  2OA7 A;  3A3T A;  3HHV A;  4F0C A;  2OE0 A;  3GKX A;  2VLT A;  2DLX A;  1GTI A;  3HY2 A;  1VF1 A;  2CQ9 A;  3V1W A;  1YEX A;  5GZZ B;  2LJK A;  3QAG A;  1W89 A;  2K8V A;  4MA9 A;  5JWR B;  1F37 A;  4CW9 A;  1XZO A;  2E0Q A;  2CZ2 A;  2H1G A;  2X49 A;  1TI1 A;  2HNL A;  2H0H A;  4MJC A;  1GWC A;  2YCD A;  3N5O A;  4GSS A;  5IO0 A;  3GHA A;  3UIW A;  2Z9S A;  5A4W A;  4K9Z A;  4X43 A;  2E2M A;  1FO5 A;  4L8E A;  1M9B A;  4OWY A;  3DXB A;  2IWT A;  1M3I A;  3VI5 A;  2NDO A;  4XIH A;  5HR1 A;  3QD9 A;  1M3J A;  3FZ9 A;  2AYT A;  1UVZ A;  3EUR A;  3P8W A;  4TR1 B;  2QA1 A;  4ACS A;  1ZYQ B;  5IO2 A;  4J56 E;  3DYR A;  3KJY A;  2TRC P;  3QFB C;  3TRP A;  1X9S B;  2IFQ B;  3UVT A;  4LMW A;  5IM9 A;  10GS A;  3GUS A;  3TKS E;  3ISO A;  4XCS A;  5CRG A;  4I6X A;  1EGR A;  3BCI A;  3HJP A;  2VLV A;  4HU7 A;  5DAK B;  2TRX A;  1BX9 A;  3IE3 A;  4YAP A;  4PQI A;  4POB A;  2ON7 A;  4IHU A;  1WRY A;  2L57 A;  3D22 A;  4KGI A;  4DSQ A;  5J9C A;  1G7O A;  2H66 A;  3I43 A;  5J5N A;  1JZW A;  5HR3 A;  3VWU A;  3FHK A;  2R0P A;  4TOP A;  1SU9 A;  3PH9 A;  4TKY A;  3MSZ A;  3Q6O A;  4JR4 A;  5GAP D;  1OKT A;  2FNO A;  4KSO A;  4MJE A;  2CA8 A;  5IQY A;  3SWL A;  1TTZ A;  2L4C A;  3KGK A;  4HQZ A;  5EPF A;  3GKN A;  3IV4 A;  1OAZ A;  5ECK B;  3TRQ A;  5J4U A;  2LRC A;  3WT2 A;  4BA7 A;  2LQQ A;  5IPH A;  1MDI A;  2DKI A;  1HD2 A;  1V9W A;  2HSM A;  1GUK A;  4K7N A;  2C0E A;  2HZE A;  4JU5 A;  2L5L A;  3FR3 A;  4USS A;  3P2A A;  5D9X A;  4ZL9 A;  4O5U A;  1GH2 A;  1T1V A;  1Z9H A;  2JAC A;  1AXD A;  1JHB A;  3LFL A;  3US3 A;  8GSS A;  2FWE A;  1YF0 A;  2HRA A;  5KN3 A;  1J0F A;  1SL2 B;  4KSM A;  1H75 A;  2LRN A;  3P7X A;  5D8I A;  3MNG A;  3LWA A;  1T7P B;  1ON4 A;  3HVN A;  3QR6 A;  2B3S A;  4WF4 A;  4L5L A;  5JWO B;  2PVO C;  3TDG A;  2HE3 A;  4LA1 A;  2O8V B;  3IHQ A;  4XS4 B;  5D96 A;  1UC7 A;  4GF0 A;  4MZB A;  1SJ6 A;  1PRX A;  4ECC A;  2RM5 A;  1FHE A;  3IPZ A;  1PSQ A;  2VCW A;  2H73 A;  1K0D A;  4YKG A;  2NTO A;  1F3B A;  2C1Y A;  5ECP B;  1FVJ A;  3HVS A;  1V58 A;  4O7H A;  5E59 A;  4WR5 A;  4KW6 A;  5B6M A;  1XIY A;  2EIQ A;  1XFL A;  3FEU A;  4XRA A;  4WEY A;  1GP1 A;  1ZYE A;  2GGT A;  2KOK A;  4DEJ A;  3LQ7 A;  2X8C A;  2VL2 A;  1JZR A;  2GSR A;  2XPD A;  5KEJ A;  3WD6 A;  3A5W A;  5HQP A;  1SKR B;  2YWN A;  4IGJ A;  3F6F A;  5ID2 A;  3BCK A;  3UEM A;  2A2S A;  3GNJ A;  4OFN A;  2FA8 A;  2RII A;  2WZ9 A;  3UBK A;  4G19 A;  3ZRE A;  3L0H A;  1PA3 A;  1TKD B;  2F9S A;  5ECR B;  4GRF A;  2H01 A;  4IVF A;  1EOG A;  2O85 A;  1U88 A;  2MBT A;  3M3M A;  3HD5 A;  5A4U A;  4NMU A;  4HJM A;  4IP1 A;  3GST A;  5G31 A;  6GSU A;  1GSU A;  3F8U A;  4ISD A;  4HQS A;  1GLQ A;  1Z7P A;  4ML1 A;  1U6T A;  4I8B A;  2WDU A;  3KH7 A;  5DVB A;  1T4Y A;  4POK A;  3RHB A;  3GUR A;  1A2L A;  3PGT A;  3VI7 A;  2HI7 A;  3ZYW A;  1K3L A;  1V98 A;  1W4V A;  3FZ5 A;  1TK5 B;  5D93 A;  4OO4 A;  5D9V A;  2R2J A;  3HCZ A;  1EP7 A;  3GKM A;  5JCG A;  2V32 A;  2VO4 A;  2C4J A;  3Q19 A;  3LEF A;  1ACV A;  5COH A;  2GST A;  4BL7 A;  2V41 A;  1A2M A;  2R37 A;  2FA4 A;  3MYD A;  3GL5 A;  3UAR A;  5DAL A;  2B7J A;  1A0F A;  2X99 A;  2EIR A;  1Q98 A;  2VL3 A;  4ZXG A;  3IDV A;  1ERW A;  4IN0 A;  5ECO B;  2MMO A;  5DJL A;  4EDZ A;  4BWS A;  2C80 A;  3QMX A;  3TB2 A;  1GNE A;  4MK3 A;  4QL7 A;  1ZCP A;  2AAW A;  5CRH A;  6GSY A;  4N30 A;  5G30 A;  5G5F A;  4PX1 A;  1IYH A;  2IMD A;  3HDC A;  2V6K A;  5B8B A;  2FGX A;  1FOH A;  1X0R A;  3CXG A;  1K0N A;  2WUL A;  1S3A A;  2P31 A;  2D2Z A;  3KP8 A;  4YAV A;  3IHG A;  2YAN A;  5IMV A;  2GVP A;  1ZOF A;  2B6M A;  3FR9 A;  3I69 A;  3LG6 A;  2H76 A;  4NAX A;  4F2I A;  4FIW A;  3TOT A;  4MJA A;  3R3E A;  3ZVJ A;  2DBC A;  4KCE A;  4MH2 A;  1TI3 A;  3M0F A;  2VCX A;  1U3A A;  5CNW A;  1TRU A;  4GTU A;  3HJO A;  1OC3 A;  2OJL A;  3KTB A;  4OMV A;  3IAM 2;  2HFD A;  5A5K A;  2B7K A;  3CBU A;  1XOA A;  1OC9 B;  4J2F A;  2CV4 A;  5JCU A;  4X0X A;  1T3B A;  2DJ0 A;  4DSS A;  4FYB A;  3IR4 A;  4YH2 A;  1ERU A;  1XG8 A;  5KOX A;  4L5O A;  1DE1 A;  3IBH A;  1Z7R A;  2K18 A;  3LYK A;  3I9V 2;  4P3Y B;  4EKZ A;  5AGY A;  4MMM A;  1NSW A;  3FKF A;  2C0G A;  1T8E B;  1GLP A;  3G9B A;  4JBB A;  5CRW A;  2XBQ A;  3ED3 A;  1GSQ A;  4BVX B;  2MMZ A;  3BBY A;  2HXK A;  2NVL A;  5AN1 A;  2IL3 A;  6GSS A;  1F9M A;  4PUA A;  4BVY A;  3L9U A;  3R2Q A;  1Z6M A;  1AIU A;  1N8J A;  22GS A;  2R4V A;  4AJ7 A;  3VPT A;  5G1L A;  3UAP A;  2J9H A;  3C73 A;  1YJ6 A;  4MCU A;  5ECS A;  2VD1 A;  5AIX A;  3U6V A;  2HT9 A;  1CQG A;  3VK9 A;  1PL2 A;  3C71 A;  2PPT A;  1SYR A;  4NPB A;  1K0O A;  5H5Q A;  2RM6 A;  1EGO A;  1A0R P;  4XS6 A;  2CAQ A;  4I97 A;  2YV7 A;  4IQ1 A;  3BJ5 A;  2G0F A;  5ABR A;  2H1B A;  3ERG A;  3H93 A;  1AQX A;  1PD2 1;  2LJA A;  2DC5 A;  2CVB A;  2I1U A;  2P0G A;  4WXT A;  3ZLP A;  3ZFL A;  2CVD A;  1TRW A;  1VF3 A;  1Z3E A;  4GQC A;  1TU8 A;  4TVE A;  1QFN A;  3WYW A;  3HVX A;  2FD3 A;  2QSI A;  2PWJ A;  1TDI A;  1TRV A;  3CSI A;  1GSD A;  2L59 A;  1G0T A;  4KB3 A;  1K0C A;  1FAA A;  4YQU A;  1H4O A;  3DKS A;  4HZ4 A;  5H5R A;  3L9V A;  2OKA A;  2BMX A;  2IMF A;  4JE1 A;  2VD0 A;  3GSS A;  2PER A;  4DSR A;  4XHM A;  3UJ1 A;  3OR5 A;  4KDX A;  2B5X A;  1ML6 A;  4G2E A;  1ERV A;  3ME8 A;  4PGT A;  5CO3 A;  5DQY A;  4LL1 B;  1R5A A;  1HNC A;  1PQN A;  2O89 A;  4AGS A;  3TOU A;  4FQU A;  2RLI A;  2GT5 A;  3BOA A;  3S9F A;  3QCP A;  3QAV A;  2G2Q A;  1XCC A;  2PU9 C;  2JL4 A;  1F2E A;  2DJK A;  3H4K A;  1XWC A;  2GQK A;  1Y6E A;  3IK9 A;  4Q5R A;  4K2X A;  1M99 A;  5F07 A;  2KUC A;  4OFM A;  5D9T A;  2N5A A;  1WP0 A;  5J9B A;  1OE7 A;  4ML6 A;  2XC2 A;  2AB6 A;  2V6O A;  1EWX A;  4X4J A;  2YWI A;  2VM1 A;  2CX3 A;  4G0I A;  3GA4 A;  3HZ4 A;  1B8X A;  4JRR A;  5FT3 A;  1SJZ A;  4MPF A;  5EL8 A;  3D5J A;  5IMD A;  1TW9 A;  2DJ2 A;  4IP6 A;  1SD8 A;  1PL1 A;  2HRN A;  4GLT A;  1FW1 A;  3RPN A;  1XW5 A;  4ZIJ A;  3EMX A;  4IBP A;  1LBK A;  3TKQ A;  3CRT A;  2ZUP A;  1GNW A;  4TN8 A;  1LU4 A;  4GCI A;  3HA9 A;  4WBR D;  3KZQ A;  4TR3 A;  3TRX A;  4NHW A;  1BAY A;  1BJX A;  1QK8 A;  3O3T A;  1B9Y C;  2VCV A;  3UOM A;  2DIZ A;  3VWW A;  5CRE A;  1FB6 A;  2F3M A;  4G0K A;  1RQM A;  1S3C A;  1SEN A;  3GX0 A;  3HVV A;  2PBJ A;  4HEA 2;  4YQV A;  5ENU A;  4MF6 A;  2PGT A;  1XBS A;  3WGE A;  1BYE A;  3QFA C;  2WB9 A;  2WJU A;  17GS A;  4OCF A;  1KEB A;  2P5Q A;  4TXO A;  3TJG A;  5IOX A;  2A2R A;  1TU7 A;  4KDU A;  1QGV A;  2I81 A;  4ZL8 A;  2C0F A;  2H0I A;  4Z7X A;  1B4P A;  20GS A;  4EIQ A;  2CAI A;  5CYY A;  3HJM A;  4ZBA A;  2JAD A;  1T00 A;  2LQO A;  1MD4 A;  1BG5 A;  4PNF A;  5DDL A;  1EOH A;  1ST9 A;  3ZIT A;  3HKR A;  3ZIJ A;  3Q18 A;  1O73 A;  3EWL A;  3G7Y A;  3EVI A;  4PUR A;  4FYU A;  1KBN A;  1TK8 B;  2OE1 A;  3C7M A;  3ZL5 A;  3APS A;  3GL3 A;  2ON5 A;  3APO A;  1B4Q A;  5A4V A;  2OBK A;  3FMW A;  3CYN A;  2R3X A;  1EV9 A;  1Y25 A;  1A24 A;  1TK0 B;  5D73 A;  2QC7 A;  1O85 A;  4MNN A;  2H72 A;  1AC1 A;  3ME7 A;  2PVQ A;  5CP1 A;  5BRT A;  3L78 A;  1I5G A;  3GN3 A;  2HZE B;  2KHP A;  3NIV A;  3IC4 A;  4OD7 A;  4MZC A;  5CRD A;  4NV5 A;  2WGR A;  6GSW A;  2H1A A;  2FY6 A;  4PNG A;  3J7Y b;  4POL A;  3AY8 A;  4O32 A;  4O5Q A;  2E2G A;  2YN1 A;  4EUY A;  3ZIV A;  5F0G A;  5HFI A;  3KM6 A;  4EXJ A;  6GSV A;  3KIJ A;  5DBQ A;  14GS A;  2J23 A;  4K1F A;  4V2L A;  2V2G A;  3ZZX A;  3IXR A;  4I5Q A;  1WJK A;  1CQH A;  1X5D A;  5B8A A;  1SYX A;  4V1A g;  4ECI A;  2B1L A;  5KOW A;  2L6D A;  2E7P A;  1AAZ A;  1SK1 A;  4ID0 A;  3D21 A;  3RDW A;  2DJ3 A;  2O87 A;  3DIE A;  1A2J A;  2OBI A;  1XWG A;  3DVX A;  1JZD A;  1XVW A;  5FWG A;  1NHO A;  3KD0 A;  4ZB9 A;  3UVH A;  5HFG A;  1NM3 A;  5JCW A;  3CQF A;  3U5R E;  1YY7 A;  2XHF A;  1Q4J A;  1SKS B;  1TRS A;  4HOJ A;  2ES7 A;  4FYC A;  3IC8 A;  3LYP A;  3ZML A;  1UA5 A;  3E3E A;  3KMN A;  1KTE A;  1TOF A;  3W8S A;  5LNK e;  5IMF A;  5ID2 B;  1Z6N A;  3GRX A;  1RW1 A;  4HZ2 A;  4K5S A;  3IK7 A;  3EE2 A;  1DE2 A;  1UN2 A;  3E9J B;  1QMV A;  3O6T A;  1ZZY A;  4H86 A;  4K6X A;  2AUV A;  3VWV A;  2C3T A;  2VM2 A;  4FH8 A;  2C8U A;  1NW2 A;  3GKK A;  2CZ3 A;  2LV3 A;  3TJB A;  1S3D A;  2JU5 A;  1K0M A;  2FLS A;  2GSQ A;  4K7I A;  3GTU A;  4KA0 A;  4LL4 B;  2RUE A;  1A8L A;  1B48 A;  5IMA A;  3TJF A;  5HFK A;  1HNA A;  4RQX A;  3DEX A;  2B5E A;  1ZL9 A;  2VCT A;  3GH9 A;  3HZ8 A;  4Q5F A;  4RUV A;  4V2N A;  2H19 A;  1C72 A;  2YOI A;  3G7J A;  4MP4 A;  2O7K A;  2X8G A;  1THO A;  1MDK A;  3TKS C;  2C3N A;  1WOU A;  2K6V A;  1G6W A;  3HXS A;  4N11 A;  5C00 A;  2FHE A;  1JFU A;  4MPG A;  3VFI A;  4WKW A;  5KN2 A;  1MD3 A;  4BL7 B;  3WT1 A;  4ZL7 A;  3MAK A;  3L9S A;  1GL8 A;  2YWO A;  3CSJ A;  1QXH A;  5DAL B;  4OCE A;  4E8H A;  1F6M C;  3M1G A;  2REM A;  3FYG A;  4K5R A;  1O7U A;  3H8Q A;  4YQM A;  5ECM B;  3IOS A;  4AF2 A;  1J08 A;  3G7I A;  3FK8 A;  2YV9 A;  2X4A A;  2JZS A;  3Q74 A;  4V1A p;  4ZB8 A;  4D73 A;  1GSE A;  4PQH A;  2XPE A;  1SK0 A;  3I6A A;  1OKD A;  5LD0 A;  2ZNM A;  5G5E A;  1K3O A;  2OAD A;  1VGL A;  1ZYN A;  4WET A;  1RK4 A; 
#chains in the Genus database with same CATH homology
 1XWK A;  3GH6 A;  2IMI A;  4EE0 A;  5IMZ A;  3TKR A;  1N2A A;  2QKE A;  2H6Z A;  2H0G A;  4N0Z A;  2TIR A;  3K8N A;  2FCH A;  1EZK A;  4LLR A;  4K8M A;  2NBS A;  2N5F A;  4WR4 A;  1TXX A;  4JED A;  2R0C A;  2B5Y A;  1PGT A;  3C1R A;  4MLY A;  2FWH A;  2EC4 A;  2OE3 A;  3EMP A;  5ECN B;  3J7Y k;  1ZYP A;  4K7O A;  4XTS A;  4DSS B;  1XWB A;  2VLU A;  1M2B A;  2LKU A;  1EEM A;  2A4V A;  2I9H A;  3H1N A;  4BPY A;  2LST A;  3QAW A;  3EU4 A;  2GTU A;  2M46 A;  3CTG A;  4IS0 A;  4MZW A;  2DIY A;  3F3Q A;  1GTA A;  3W8J A;  4NXI A;  3D0Z A;  1ABA A;  3LJR A;  5IIZ A;  1WIK A;  1VF4 A;  2BTO T;  3DML A;  5IMC A;  3VPQ A;  1XWA A;  3GFK A;  3C8E A;  2AHE A;  4PTS A;  2AV4 A;  4IJI A;  1GUH A;  1XOB A;  1E2Y A;  3F4R A;  4I2U A;  4CHS A;  16GS A;  5D9W A;  1X5E A;  2KP1 A;  3ZVJ D;  4EF0 A;  2H75 A;  1ZGN A;  1YQ1 A;  4BVY B;  3UMA A;  1HNB A;  1FG4 A;  2WFC A;  3BD2 A;  4X1U A;  5E4W A;  4KCA A;  1IYI A;  4OFT A;  4G0L A;  5DCH A;  4GWR A;  4E8E A;  4F82 A;  5ECL B;  2JSY A;  5ECI B;  2QA2 A;  2YPM A;  4Q5Q A;  4KF9 A;  1SL0 B;  2LS5 A;  4IKH A;  4TR1 A;  1Z5Y E;  1X5C A;  2MZC A;  1ERT A;  3M8N A;  4A5P A;  3DRN A;  2IFQ A;  2GS3 A;  2I4A A;  3IAS 2;  1X9W B;  2DMM A;  2PMT A;  3FZA A;  3TKP A;  3EPT A;  2JZT A;  2B1K A;  13GS A;  3EYT A;  4GST A;  2VL9 A;  2H6Y A;  3KMO A;  2F8A A;  4MDC A;  4OO5 A;  5DAK A;  3A2W A;  1A8Y A;  1PKW A;  1FOV A;  1MTC A;  1PX6 A;  3TGZ A;  3LOR A;  4J57 E;  3D4T A;  1XW6 A;  5AIV A;  5HR0 A;  2C0D A;  1I9D A;  3ZMK A;  1XPV A;  1YF1 A;  1PX7 A;  2BJX A;  2GSS A;  1XW9 A;  5GST A;  3FRC A;  2I3Y A;  3F6D A;  1O81 A;  3LW9 A;  3LSZ A;  2GDR A;  1R4W A;  3VLN A;  1WMJ A;  1YKC A;  4QQ7 A;  3VWX A;  2K8S A;  4WBJ A;  2YP6 A;  11GS A;  3MIX A;  4TR0 A;  5FHI A;  2GZZ A;  3CMI A;  4MF7 A;  2KP2 A;  2L6C A;  3QDN A;  4MF5 A;  4IJ3 A;  2YZU A;  2DSA A;  2HYX A;  1HYU A;  2VUP A;  1MDJ A;  4XS1 A;  1F3A A;  4LMV A;  1JLW A;  3GV1 A;  4KE3 A;  3UBL A;  3FW2 A;  3C1S A;  2DML A;  2VCZ A;  2R5G A;  1V57 A;  4F0B A;  1U87 A;  3A2X A;  1U3I A;  3L4N A;  1PKZ A;  1VF2 A;  2DJJ A;  2A4H A;  3NOF A;  4PQ1 A;  5B6N A;  2VOC A;  3RPP A;  1M0U A;  1O6J A;  4YKF A;  5B7C A;  1GUL A;  1LJR A;  1HQO A;  1PMT A;  4QL9 A;  5GSS A;  1MEK A;  4L0W A;  2MMN A;  3ZRD A;  3QPM A;  5LCZ A;  4XS4 A;  1XVQ A;  2R6K A;  2H30 A;  3KP9 A;  4PUF C;  4K2D A;  2EIO A;  5ECH B;  2HLS A;  4NHZ A;  3VUR A;  5AIS A;  5J3R A;  3DGQ A;  2LRT A;  1OYJ A;  1B9X C;  2RUF A;  3F0I A;  3E0U A;  4CY6 A;  2M80 A;  1SKW B;  3DVW A;  2F51 A;  4PXO A;  4GSN A;  2M72 A;  6GSX A;  1PN9 A;  4EL1 A;  4IEL A;  1EP8 A;  2IMK A;  1YEP A;  4TRX A;  1ZMA A;  5KN0 A;  2YJ7 A;  3TJK A;  1WWJ A;  5IOW A;  5J41 A;  1QUW A;  3RBT A;  4DVC A;  3FR6 A;  4AJ8 A;  3UL3 A;  3PIN A;  1SK2 A;  2FWF A;  2VL2 C;  2NPB A;  1M9A A;  2YNX A;  1AUC A;  4NV2 A;  1M2D A;  3KH9 A;  3FZ4 A;  2IPA A;  2HZF A;  2FWG A;  4TXO B;  2IIY A;  5ECQ B;  4Z2R A;  3F4S A;  3LXZ A;  2DKH A;  5ELA A;  2GLR A;  5DCG A;  3P90 A;  3WGX A;  1JZO A;  2P5R A;  3F3R A;  4XRD A;  2HSH A;  4GQF A;  2DJ1 A;  2H6X A;  2VAF A;  3IRA A;  4ICY A;  1TJD A;  4KUN A;  4KDY A;  1WE0 A;  1WPI A;  3M9K A;  1VRS D;  2L5O A;  4ECJ A;  4RQR A;  3EU3 A;  1DBY A;  3PR8 A;  3FY7 A;  5F05 A;  2ALB A;  3F4T A;  3D4M A;  1GRX A;  3CTF A;  4KND A;  3KEB A;  1T4Z A;  1DUG A;  5HR2 A;  3EC3 A;  2JSZ A;  5BMU A;  2AJQ B;  4MJB A;  3F63 A;  1OE8 A;  4CDO A;  1R5P A;  2H74 A;  3PPU A;  2GQL A;  4POM A;  4TR4 A;  2IJY A;  4N0V A;  1DSB A;  1M2A A;  2V1M A;  4HDE A;  5KN1 A;  3W6G A;  1AW9 A;  3CRU A;  4ZIL A;  1FVK A;  1BQ7 A;  1ILO A;  3ZTL A;  1QQ2 A;  2UZ8 A;  4ZBB A;  1M7T A;  4EO3 A;  5L71 A;  4NWY A;  1G7E A;  4ILF A;  1NHY A;  2LEG A;  5F06 A;  2YWM A;  5G2Z A;  1GUM A;  3KXO A;  4EIP A;  2HSY A;  1K0B A;  1GSS A;  2IN3 A;  2KLX A;  1PN0 A;  5DJM A;  4G9H A;  5JWQ B;  2MYG A;  4K0G A;  4EVM A;  1O8X A;  4KX4 A;  2L4Q A;  4O92 A;  3D6I A;  4TW5 A;  1TP9 A;  5EVO A;  3TUE A;  1OC9 A;  3JCM L;  3QOU A;  3SBC A;  2LNS A;  7GSS A;  3M9J A;  1EV4 A;  4KAE A;  4F03 A;  1OVN A;  2MMA A;  5ELG A;  3GYK A;  4Z2U A;  1V2A A;  2YZH A;  3MDK A;  1YKA A;  1GSY A;  2LNT A;  3N9J A;  4IW9 A;  2OAC A;  1K0A A;  3APQ A;  1USB A;  5F8B A;  1GTU A;  3EIN A;  1URM A;  3RAZ A;  1JLV A;  5CAX A;  5IPG A;  3ZFB A;  2WRT A;  5C04 A;  4BVX A;  3ERF A;  2QGV A;  2CX4 A;  2K9F A;  5EY6 A;  2IME A;  1KNG A;  1GTB A;  4F9Z A;  5H5S A;  4MAB A;  2CT6 A;  4ECB A;  3A2V A;  2GQM A;  3DWV A;  4EC0 A;  3MWH A;  5DQS A;  1EEJ A;  4ZBD A;  4G10 A;  4JR6 A;  2C3Q A;  3TKS A;  2CVK A;  4RI7 A;  1SL1 B;  3GTU B;  4HJ2 A;  4RI6 A;  4GXZ A;  2YJH A;  4K0N A;  2LUS A;  2H70 A;  4EDY A;  4TXV A;  2H71 A;  18GS A;  4HU9 A;  1THX A;  5GAN D;  3DD3 A;  1OC8 A;  4MH3 A;  6GST A;  4ULX A;  1J9B A;  1AQV A;  4HS1 A;  4V2M A;  19GS A;  2WS2 A;  2VIM A;  3HYP A;  1SJI A;  2A2P A;  3A5I A;  2GZY A;  2PUK C;  3LGC A;  3O76 A;  4AJ6 A;  2VCQ A;  2ZCT A;  3WGD A;  4IQA A;  5G1K A;  1O8W A;  1A23 A;  3RHC A;  2XBI A;  4JZQ A;  4KH7 A;  3TJJ A;  1FB0 A;  1GSF A;  4WF5 A;  2H8L A;  1R7H A;  12GS A;  2WCI A;  1X9M B;  3GMF A;  1E6B A;  1XXU A;  3H79 A;  4Z2T A;  2F8F A;  2HRF A;  3KTL A;  2PN8 A;  3TCO A;  2X64 A;  4L0U A;  1K3Y A;  1SD9 A;  4CY8 A;  3KCM A;  3GX8 A;  3LXT A;  2R0G A;  3IA1 A;  3F9U A;  4D73 B;  1BED A;  2JZR A;  3NZN A;  1G6Y A;  2FUG 2;  5INY A;  2MBS A;  4ZB6 A;  2LTK A;  2HRK A;  1V40 A;  2GZP A;  4HI7 A;  1AQW A;  4O5R A;  9GSS A;  4Q5N A;  2LJR A;  1R26 A;  4BWQ A;  4I2T A;  3CSH A;  1YDK A;  2GT6 A;  3GIX A;  2N5B A;  4N10 A;  4HUA A;  4FO5 A;  2H1D A;  3ERW A;  2X8H A;  1YZX A;  2OA7 A;  3A3T A;  3HHV A;  4F0C A;  2OE0 A;  3GKX A;  2VLT A;  2DLX A;  1GTI A;  3HY2 A;  1VF1 A;  2CQ9 A;  3V1W A;  1YEX A;  5GZZ B;  2LJK A;  3QAG A;  1W89 A;  2K8V A;  4MA9 A;  5JWR B;  1F37 A;  4CW9 A;  1XZO A;  2E0Q A;  2CZ2 A;  2H1G A;  2X49 A;  1TI1 A;  2HNL A;  2H0H A;  4MJC A;  1GWC A;  2YCD A;  3N5O A;  4GSS A;  5IO0 A;  3GHA A;  3UIW A;  2Z9S A;  5A4W A;  4K9Z A;  4X43 A;  2E2M A;  1FO5 A;  4L8E A;  1M9B A;  4OWY A;  3DXB A;  2IWT A;  3VI5 A;  2NDO A;  4XIH A;  5HR1 A;  3QD9 A;  3FZ9 A;  2AYT A;  1UVZ A;  3EUR A;  3P8W A;  4TR1 B;  2QA1 A;  4ACS A;  1ZYQ B;  5IO2 A;  4J56 E;  3DYR A;  3KJY A;  2TRC P;  3QFB C;  3TRP A;  1X9S B;  2IFQ B;  3UVT A;  4LMW A;  5IM9 A;  10GS A;  3GUS A;  3TKS E;  3ISO A;  4XCS A;  5CRG A;  4I6X A;  1EGR A;  3BCI A;  3HJP A;  2VLV A;  4HU7 A;  5DAK B;  2TRX A;  1BX9 A;  3IE3 A;  4YAP A;  4PQI A;  4POB A;  2ON7 A;  4IHU A;  1WRY A;  2L57 A;  3D22 A;  4KGI A;  4DSQ A;  5J9C A;  1G7O A;  2H66 A;  3I43 A;  5J5N A;  1JZW A;  5HR3 A;  3VWU A;  3FHK A;  2R0P A;  4TOP A;  1SU9 A;  3PH9 A;  4TKY A;  3MSZ A;  3Q6O A;  4JR4 A;  5GAP D;  1OKT A;  2FNO A;  4KSO A;  4MJE A;  2CA8 A;  5IQY A;  3SWL A;  1TTZ A;  2L4C A;  3KGK A;  4HQZ A;  5EPF A;  3GKN A;  3IV4 A;  1OAZ A;  5ECK B;  3TRQ A;  5J4U A;  2LRC A;  3WT2 A;  4BA7 A;  2LQQ A;  5IPH A;  1MDI A;  2DKI A;  1HD2 A;  1V9W A;  2HSM A;  1GUK A;  4K7N A;  2C0E A;  2HZE A;  4JU5 A;  2L5L A;  3FR3 A;  4USS A;  3P2A A;  5D9X A;  4ZL9 A;  4O5U A;  1GH2 A;  1T1V A;  1Z9H A;  2JAC A;  1AXD A;  1JHB A;  3LFL A;  3US3 A;  8GSS A;  2FWE A;  1YF0 A;  2HRA A;  5KN3 A;  1J0F A;  1SL2 B;  4KSM A;  1H75 A;  2LRN A;  3P7X A;  5D8I A;  3MNG A;  3LWA A;  1T7P B;  1ON4 A;  3QR6 A;  2B3S A;  4WF4 A;  4L5L A;  5JWO B;  2PVO C;  3TDG A;  2HE3 A;  4LA1 A;  2O8V B;  3IHQ A;  4XS4 B;  5D96 A;  1UC7 A;  4GF0 A;  4MZB A;  1SJ6 A;  1PRX A;  4ECC A;  2RM5 A;  1FHE A;  3IPZ A;  1PSQ A;  2VCW A;  2H73 A;  1K0D A;  4YKG A;  2NTO A;  1F3B A;  2C1Y A;  5ECP B;  1FVJ A;  3HVS A;  1V58 A;  4O7H A;  5E59 A;  4WR5 A;  4KW6 A;  5B6M A;  1XIY A;  2EIQ A;  1XFL A;  3FEU A;  4XRA A;  4WEY A;  1GP1 A;  1ZYE A;  2GGT A;  2KOK A;  4DEJ A;  3LQ7 A;  2X8C A;  2VL2 A;  1JZR A;  2GSR A;  2XPD A;  5KEJ A;  3WD6 A;  3A5W A;  5HQP A;  1SKR B;  2YWN A;  4IGJ A;  3F6F A;  5ID2 A;  3BCK A;  3UEM A;  2A2S A;  3GNJ A;  4OFN A;  2FA8 A;  2RII A;  2WZ9 A;  3UBK A;  4G19 A;  3ZRE A;  3L0H A;  1PA3 A;  1TKD B;  2F9S A;  5ECR B;  4GRF A;  2H01 A;  4IVF A;  1EOG A;  2O85 A;  1U88 A;  2MBT A;  3M3M A;  3HD5 A;  5A4U A;  4NMU A;  4HJM A;  4IP1 A;  3GST A;  5G31 A;  6GSU A;  1GSU A;  3F8U A;  4ISD A;  4HQS A;  1GLQ A;  1Z7P A;  4ML1 A;  1U6T A;  4I8B A;  2WDU A;  3KH7 A;  5DVB A;  1T4Y A;  4POK A;  3RHB A;  3GUR A;  1A2L A;  3PGT A;  3VI7 A;  2HI7 A;  3ZYW A;  1K3L A;  1V98 A;  1W4V A;  3FZ5 A;  1TK5 B;  5D93 A;  4OO4 A;  5D9V A;  2R2J A;  3HCZ A;  1EP7 A;  3GKM A;  5JCG A;  2V32 A;  2VO4 A;  2C4J A;  3Q19 A;  3LEF A;  1ACV A;  5COH A;  2GST A;  4BL7 A;  2V41 A;  1A2M A;  2R37 A;  2FA4 A;  3MYD A;  3GL5 A;  3UAR A;  5DAL A;  2B7J A;  1A0F A;  2X99 A;  2EIR A;  1Q98 A;  2VL3 A;  4ZXG A;  3IDV A;  1ERW A;  4IN0 A;  5ECO B;  2MMO A;  5DJL A;  4EDZ A;  4BWS A;  2C80 A;  3QMX A;  3TB2 A;  1GNE A;  4MK3 A;  4QL7 A;  1ZCP A;  2AAW A;  5CRH A;  6GSY A;  4N30 A;  5G30 A;  5G5F A;  4PX1 A;  1IYH A;  2IMD A;  3HDC A;  2V6K A;  5B8B A;  2FGX A;  1FOH A;  1X0R A;  3CXG A;  1K0N A;  2WUL A;  1S3A A;  2P31 A;  2D2Z A;  3KP8 A;  4YAV A;  3IHG A;  2YAN A;  5IMV A;  2GVP A;  1ZOF A;  2B6M A;  3FR9 A;  3I69 A;  3LG6 A;  2H76 A;  4NAX A;  4F2I A;  4FIW A;  3TOT A;  4MJA A;  3R3E A;  3ZVJ A;  2DBC A;  4KCE A;  4MH2 A;  1TI3 A;  3M0F A;  2VCX A;  1U3A A;  5CNW A;  1TRU A;  4GTU A;  3HJO A;  1OC3 A;  2OJL A;  3KTB A;  4OMV A;  3IAM 2;  2HFD A;  5A5K A;  2B7K A;  3CBU A;  1XOA A;  1OC9 B;  4J2F A;  2CV4 A;  5JCU A;  4X0X A;  1T3B A;  2DJ0 A;  4DSS A;  4FYB A;  3IR4 A;  4YH2 A;  1ERU A;  5KOX A;  4L5O A;  1DE1 A;  3IBH A;  1Z7R A;  2K18 A;  3LYK A;  3I9V 2;  4P3Y B;  4EKZ A;  5AGY A;  4MMM A;  1NSW A;  3FKF A;  2C0G A;  1T8E B;  1GLP A;  3G9B A;  4JBB A;  5CRW A;  2XBQ A;  3ED3 A;  1GSQ A;  4BVX B;  2MMZ A;  3BBY A;  2HXK A;  2NVL A;  5AN1 A;  2IL3 A;  6GSS A;  1F9M A;  4PUA A;  4BVY A;  3L9U A;  3R2Q A;  1Z6M A;  1AIU A;  1N8J A;  22GS A;  2R4V A;  4AJ7 A;  3VPT A;  5G1L A;  3UAP A;  2J9H A;  3C73 A;  1YJ6 A;  4MCU A;  5ECS A;  2VD1 A;  5AIX A;  3U6V A;  2HT9 A;  1CQG A;  3VK9 A;  1PL2 A;  3C71 A;  2PPT A;  1SYR A;  4NPB A;  1K0O A;  5H5Q A;  2RM6 A;  1EGO A;  1A0R P;  4XS6 A;  2CAQ A;  4I97 A;  2YV7 A;  4IQ1 A;  3BJ5 A;  2G0F A;  5ABR A;  2H1B A;  3ERG A;  3H93 A;  1AQX A;  1PD2 1;  2LJA A;  2DC5 A;  2CVB A;  2I1U A;  2P0G A;  4WXT A;  3ZLP A;  3ZFL A;  2CVD A;  1TRW A;  1VF3 A;  1Z3E A;  4GQC A;  1TU8 A;  4TVE A;  1QFN A;  3WYW A;  3HVX A;  2FD3 A;  2QSI A;  2PWJ A;  1TDI A;  1TRV A;  3CSI A;  1GSD A;  2L59 A;  1G0T A;  4KB3 A;  1K0C A;  1FAA A;  4YQU A;  1H4O A;  3DKS A;  4HZ4 A;  5H5R A;  3L9V A;  2OKA A;  2BMX A;  2IMF A;  4JE1 A;  2VD0 A;  3GSS A;  2PER A;  4DSR A;  4XHM A;  3UJ1 A;  3OR5 A;  4KDX A;  2B5X A;  1ML6 A;  4G2E A;  1ERV A;  3ME8 A;  4PGT A;  5CO3 A;  5DQY A;  4LL1 B;  1R5A A;  1HNC A;  1PQN A;  2O89 A;  4AGS A;  3TOU A;  4FQU A;  2RLI A;  2GT5 A;  3BOA A;  3S9F A;  3QCP A;  3QAV A;  2G2Q A;  1XCC A;  2PU9 C;  2JL4 A;  1F2E A;  2DJK A;  3H4K A;  1XWC A;  2GQK A;  1Y6E A;  3IK9 A;  4Q5R A;  4K2X A;  1M99 A;  5F07 A;  2KUC A;  4OFM A;  5D9T A;  2N5A A;  1WP0 A;  5J9B A;  1OE7 A;  4ML6 A;  2XC2 A;  2AB6 A;  2V6O A;  1EWX A;  4X4J A;  2YWI A;  2VM1 A;  2CX3 A;  4G0I A;  3GA4 A;  3HZ4 A;  1B8X A;  4JRR A;  5FT3 A;  1SJZ A;  4MPF A;  5EL8 A;  3D5J A;  5IMD A;  1TW9 A;  2DJ2 A;  4IP6 A;  1SD8 A;  1PL1 A;  2HRN A;  4GLT A;  1FW1 A;  3RPN A;  1XW5 A;  4ZIJ A;  3EMX A;  4IBP A;  1LBK A;  3TKQ A;  3CRT A;  2ZUP A;  1GNW A;  4TN8 A;  1LU4 A;  4GCI A;  3HA9 A;  4WBR D;  3KZQ A;  4TR3 A;  3TRX A;  4NHW A;  1BAY A;  1BJX A;  1QK8 A;  3O3T A;  1B9Y C;  2VCV A;  3UOM A;  2DIZ A;  3VWW A;  5CRE A;  1FB6 A;  2F3M A;  4G0K A;  1RQM A;  1S3C A;  1SEN A;  3GX0 A;  3HVV A;  2PBJ A;  4HEA 2;  4YQV A;  5ENU A;  4MF6 A;  2PGT A;  1XBS A;  3WGE A;  1BYE A;  3QFA C;  2WB9 A;  2WJU A;  17GS A;  4OCF A;  1KEB A;  2P5Q A;  4TXO A;  3TJG A;  5IOX A;  2A2R A;  1TU7 A;  4KDU A;  1QGV A;  2I81 A;  4ZL8 A;  2C0F A;  2H0I A;  4Z7X A;  1B4P A;  20GS A;  4EIQ A;  2CAI A;  5CYY A;  3HJM A;  4ZBA A;  2JAD A;  1T00 A;  2LQO A;  1MD4 A;  1BG5 A;  4PNF A;  5DDL A;  1EOH A;  1ST9 A;  3ZIT A;  3HKR A;  3ZIJ A;  3Q18 A;  1O73 A;  3EWL A;  3G7Y A;  3EVI A;  4PUR A;  4FYU A;  1KBN A;  1TK8 B;  2OE1 A;  3C7M A;  3ZL5 A;  3APS A;  3GL3 A;  2ON5 A;  3APO A;  1B4Q A;  5A4V A;  2OBK A;  3FMW A;  3CYN A;  2R3X A;  1EV9 A;  1Y25 A;  1A24 A;  1TK0 B;  5D73 A;  2QC7 A;  1O85 A;  4MNN A;  2H72 A;  1AC1 A;  3ME7 A;  2PVQ A;  5CP1 A;  5BRT A;  3L78 A;  1I5G A;  3GN3 A;  2HZE B;  2KHP A;  3NIV A;  3IC4 A;  4OD7 A;  4MZC A;  5CRD A;  4NV5 A;  2WGR A;  6GSW A;  2H1A A;  2FY6 A;  4PNG A;  3J7Y b;  4POL A;  3AY8 A;  4O32 A;  4O5Q A;  2E2G A;  2YN1 A;  4EUY A;  3ZIV A;  5F0G A;  5HFI A;  3KM6 A;  4EXJ A;  6GSV A;  3KIJ A;  5DBQ A;  14GS A;  2J23 A;  4K1F A;  4V2L A;  2V2G A;  3ZZX A;  3IXR A;  4I5Q A;  1WJK A;  1CQH A;  1X5D A;  5B8A A;  1SYX A;  4V1A g;  4ECI A;  2B1L A;  5KOW A;  2L6D A;  2E7P A;  1AAZ A;  1SK1 A;  4ID0 A;  3D21 A;  3RDW A;  2DJ3 A;  2O87 A;  3DIE A;  1A2J A;  2OBI A;  1XWG A;  3DVX A;  1JZD A;  1XVW A;  5FWG A;  1NHO A;  3KD0 A;  4ZB9 A;  3UVH A;  5HFG A;  1NM3 A;  5JCW A;  3U5R E;  1YY7 A;  2XHF A;  1Q4J A;  1SKS B;  1TRS A;  4HOJ A;  2ES7 A;  4FYC A;  3IC8 A;  3LYP A;  3ZML A;  1UA5 A;  3E3E A;  3KMN A;  1KTE A;  1TOF A;  3W8S A;  5LNK e;  5IMF A;  5ID2 B;  1Z6N A;  3GRX A;  1RW1 A;  4HZ2 A;  4K5S A;  3IK7 A;  3EE2 A;  1DE2 A;  1UN2 A;  3E9J B;  1QMV A;  3O6T A;  1ZZY A;  4H86 A;  4K6X A;  2AUV A;  3VWV A;  2C3T A;  2VM2 A;  4FH8 A;  2C8U A;  1NW2 A;  3GKK A;  2CZ3 A;  2LV3 A;  3TJB A;  1S3D A;  2JU5 A;  1K0M A;  2FLS A;  2GSQ A;  4K7I A;  3GTU A;  4KA0 A;  4LL4 B;  2RUE A;  1A8L A;  1B48 A;  5IMA A;  3TJF A;  5HFK A;  1HNA A;  4RQX A;  3DEX A;  2B5E A;  1ZL9 A;  2VCT A;  3GH9 A;  3HZ8 A;  4Q5F A;  4RUV A;  4V2N A;  2H19 A;  1C72 A;  2YOI A;  3G7J A;  4MP4 A;  2O7K A;  2X8G A;  1THO A;  1MDK A;  3TKS C;  2C3N A;  1WOU A;  2K6V A;  1G6W A;  3HXS A;  4N11 A;  5C00 A;  2FHE A;  1JFU A;  4MPG A;  3VFI A;  4WKW A;  5KN2 A;  1MD3 A;  4BL7 B;  3WT1 A;  4ZL7 A;  3MAK A;  3L9S A;  1GL8 A;  2YWO A;  3CSJ A;  1QXH A;  5DAL B;  4OCE A;  4E8H A;  1F6M C;  3M1G A;  2REM A;  3FYG A;  4K5R A;  1O7U A;  3H8Q A;  4YQM A;  5ECM B;  3IOS A;  4AF2 A;  1J08 A;  3G7I A;  3FK8 A;  2YV9 A;  2X4A A;  2JZS A;  3Q74 A;  4V1A p;  4ZB8 A;  4D73 A;  1GSE A;  4PQH A;  2XPE A;  1SK0 A;  3I6A A;  1OKD A;  5LD0 A;  2ZNM A;  5G5E A;  1K3O A;  2OAD A;  1VGL A;  1ZYN A;  4WET A;  1RK4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...