3EVIA

Crystal structure of the thioredoxin-fold domain of human phosducin-like protein 2
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
118
structure length
118
Chain Sequence
KFGELREISGNQYVNEVTNAEEDVWVIIHLYRSSIPMCLLVNQHLSLLARKFPETKFVKAIVNSCIQHYHDNCLPTIFVYKNGQIEAKFIGIIECGGINLKLEELEWKLAEVGAIQTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Phosducin-like protein 2
publication title Structure of the thioredoxin-fold domain of human phosducin-like protein 2
pubmed doi rcsb
source organism Homo sapiens
total genus 35
structure length 118
sequence length 118
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-10-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3eviA00
2OA7A 5CNWA 3P7XA 1XXUA 3KD0A 1E2YA 1Z9HA 1S3CA 5J3RA 3DYRA 3GNJA 2FA4A 4LMVA 2H76A 1U88A 2WB9A 3FKFA 4IQ1A 2DBCA 2E7PA 1V98A 5ELGA 2QSIA 4GWRA 1XFLA 1WMJA 5EVOA 1ZL9A 4FYCA 2GQLA 1B48A 4HU9A 2PERA 3I6AA 3PGTA 2H0IA 1Q4JA 2AUVA 1TW9A 4JZQA 3TJKA 2HZEA 5IO2A 3RHCA 1F9MA 3IRAA 5A5KA 19GSA 4PX1A 1X9MB 3ZZXA 1X9WB 3FR9A 2MMAA 5B6NA 2JSZA 2CX4A 3U6VA 2L4QA 5DAKB 5CYYA 3J7Yk 2WULA 4FYBA 2OACA 2OJLA 3LWAA 4L5LA 1TJDA 2KOKA 3ZVJA 4FH8A 4TR1B 2LKUA 3HY2A 4IGJA 4ZIJA 1GULA 1T4YA 5J9BA 1SK1A 2LRCA 2HI7A 5AIVA 2CZ2A 2IIYA 1VF4A 1YJ6A 3P2AA 4WR4A 1XCCA 4L0UA 2JZRA 3PINA 1Z5YE 3WGXA 2OE3A 3EU3A 2HT9A 2V32A 3IV4A 4N30A 4WETA 1E6BA 4KGIA 4POMA 3F6DA 2YZHA 2DSAA 2GSQA 1M99A 1U3AA 4WBRD 3E0UA 3ERGA 4EVMA 2H6ZA 3NOFA 2HNLA 4MLYA 4J2FA 2QGVA 1WIKA 2VCWA 1TDIA 1SL0B 1I5GA 1Z7PA 4IP6A 4QQ7A 3ZLPA 4PUAA 1FAAA 4E8EA 1CQGA 4PQIA 2VCZA 4IHUA 1Z3EA 4FIWA 4CHSA 3RDWA 3UIWA 3FW2A 4AJ6A 3KP9A 5LNKe 2YWNA 4WKWA 1GL8A 4V2LA 1Z6NA 1TK5B 5CREA 1HYUA 5D8IA 1K0CA 3A2VA 2GQKA 2FNOA 2OADA 3A3TA 3ZFBA 3M3MA 2B5YA 3ME7A 2TIRA 4J56E 1AXDA 1IYHA 5C00A 4Q5QA 2H0HA 2C0FA 4MZWA 5HR0A 2YV9A 2LQQA 5GSSA 5DCGA 4J57E 3J7Yb 2BTOT 4DSSA 2IPAA 3ERWA 1XOAA 1XPVA 4HUAA 5A4WA 4O92A 2B5EA 2FWHA 3RAZA 2VCXA 3P8WA 4XS1A 2C0EA 4FO5A 1UVZA 1GSQA 2R5GA 4MJBA 2DJ2A 2CVDA 3RPNA 2D2ZA 2LQOA 4RI7A 1K0MA 3LSZA 1KNGA 5D9VA 4CDOA 2E0QA 1DE2A 5DBQA 4YQUA 1J0FA 1U87A 3G7YA 12GSA 1K3OA 1TTZA 2PMTA 4TN8A 1XWBA 1F37A 3MDKA 5ECRB 3W8JA 1SKRB 2VOCA 3RPPA 1R7HA 4CW9A 4MJCA 2JSYA 2HXKA 2PUKC 3F6FA 1TU7A 4I5QA 3LG6A 5JCWA 3Q19A 4KH7A 3VPTA 1YDKA 10GSA 3Q6OA 17GSA 4IBPA 4I97A 11GSA 2L6DA 3HVVA 4NAXA 2XHFA 5LD0A 1M9AA 2H73A 2H66A 2FLSA 5ABRA 1GSFA 2ALBA 4X43A 3CBUA 1ZYQB 2DMLA 4MH3A 3UJ1A 2AJQB 1JHBA 3BD2A 5B6MA 1FW1A 3HJOA 2DJ1A 1GLQA 4LL1B 1WE0A 2LRNA 3TB2A 3CRUA 2IMIA 2GVPA 2FD3A 2K6VA 14GSA 3O3TA 1JZRA 4PUFC 1AC1A 5IMDA 1A23A 3EWLA 3M0FA 4EDZA 2K8VA 2F8FA 1BX9A 1M0UA 2MMOA 4N0VA 4OWYA 2PN8A 1FO5A 3JCML 2V1MA 2FUG2 4E8HA 3KM6A 5B8AA 4TXOA 3APSA 1QUWA 4K7OA 4QL9A 4TRXA 3UMAA 4WF5A 5F05A 3HZ4A 1ZZYA 3DXBA 2MBTA 4HEA2 4F9ZA 1N8JA 5B8BA 4D73B 3D5JA 2XPDA 2B7JA 5DALA 1SJZA 1XWCA 2WDUA 4ZXGA 3TOTA 2H75A 3QD9A 5DQYA 4OD7A 1PMTA 4Q5RA 3GUSA 4K1FA 3ZTLA 4ZB9A 5L71A 5D73A 3WT1A 2NVLA 1YQ1A 4TVEA 2EIQA 2IMKA 3VI5A 4AGSA 1OC3A 4KUNA 4MZBA 4BA7A 1N2AA 1BYEA 1O73A 1RK4A 1MTCA 2DJKA 3EURA 2FWGA 2P31A 3A5WA 1XZOA 3S9FA 3KH9A 1B9YC 3VURA 3TJBA 1VRSD 3C1RA 5F8BA 3GX8A 4MF5A 1MDJA 1XWGA 2H71A 4XS4A 2AYTA 1S3AA 2O8VB 4OCEA 2IMDA 1X0RA 1NW2A 4HZ4A 1YEXA 2JZTA 9GSSA 3DMLA 4V1Ap 3W8SA 5C04A 2VLTA 4PQ1A 5GSTA 3DVXA 2H6YA 3ED3A 2FWEA 4POLA 2K8SA 1M2AA 1USBA 5J41A 4F0CA 1ZYEA 4IJIA 3LXTA 3QAGA 4O7HA 2N5BA 20GSA 4Q5FA 1SL2B 2XBIA 2LEGA 4F0BA 1PSQA 4OMVA 1F3AA 1QGVA 4FYUA 1X5DA 3IDVA 1LU4A 1GUHA 3GKMA 4ECJA 1TOFA 3F63A 4NXIA 4H86A 2FY6A 4HQZA 3L0HA 2V6OA 2O7KA 3DWVA 1SYXA 1M2BA 1AQWA 3GTUA 2VUPA 2H8LA 1M9BA 1X5CA 1B4PA 4ML1A 2AAWA 3VWXA 1WOUA 1K0DA 3CTFA 4PXOA 5FT3A 5IM9A 5E4WA 3M9JA 5IMVA 4KCAA 2YWIA 4F03A 3H4KA 2VL9A 1OE7A 3GKXA 2H30A 1EP7A 2GSSA 4P3YB 1R4WA 2V2GA 4MA9A 1TI1A 6GSWA 5ECIB 5B7CA 1EGOA 2YNXA 4MP4A 3WYWA 3I69A 4WXTA 3GKKA 3VWWA 1VF3A 3NIVA 2LSTA 2DLXA 4O32A 4YH2A 2JZSA 1A24A 5G5EA 5DJLA 4NHZA 3IK9A 3ZMLA 1GWCA 1MD4A 1XVQA 3TUEA 1QFNA 1RW1A 1W89A 4HDEA 4MF7A 2IWTA 3VPQA 2DJJA 2NPBA 4BWSA 1NHOA 1O85A 3TOUA 1O6JA 3F4SA 1SYRA 3ZRDA 2GT6A 1ZOFA 3IXRA 4ULXA 4EXJA 4TOPA 1QK8A 2VL2A 1V2AA 3DRNA 3F4RA 5DQSA 4OO4A 3C8EA 5DVBA 1PKZA 1AAZA 2J9HA 1GTBA 1V9WA 5HQPA 2LTKA 1GSUA 1FB6A 5JCUA 2C3QA 5A4UA 2YWMA 3FYGA 5ID2A 1QMVA 1PA3A 1GLPA 1LBKA 4K8MA 2CA8A 2MZCA 1OC8A 2VIMA 5IMCA 8GSSA 1ON4A 4DEJA 1EOGA 1EGRA 3GH9A 2H74A 2REMA 4HU7A 3VFIA 3ZFLA 1TRUA 1HNAA 2C80A 5AN1A 3GHAA 1DE1A 2NDOA 3CXGA 3HKRA 2MYGA 3TRPA 1G6YA 1G7EA 1ST9A 4KB3A 1AUCA 3LJRA 3UBKA 3WGDA 1XVWA 4V2MA 3IBHA 4GXZA 1W4VA 4HOJA 3DGQA 3EC3A 4XTSA 5ECOB 1UN2A 4KNDA 1J08A 2EC4A 2I1UA 3L78A 1H75A 1XW6A 2O89A 1YKAA 3M1GA 4ILFA 2J23A 1ACVA 3FR6A 4TXVA 4HQSA 1YKCA 1GTAA 3VWUA 6GSYA 4KSMA 2RUEA 3KXOA 2RIIA 22GSA 1SK2A 2XBQA 3TKRA 2HZEB 2OBKA 3IK7A 2L59A 3O76A 1JLVA 3IAS2 1R5PA 2CT6A 1THXA 3VWVA 4GQCA 1BAYA 4KSOA 2PVOC 2HZFA 3I43A 4IKHA 4GSTA 2VCTA 1IYIA 5FWGA 1OC9A 2R37A 4EO3A 4BWQA 3QCPA 2WCIA 3O6TA 1TKDB 3CMIA 4IELA 1KEBA 3ZVJD 2R3XA 4HI7A 3KP8A 3GMFA 2AB6A 2LNTA 4G2EA 1T8EB 3UVTA 5G1KA 3RHBA 1OAZA 4JBBA 3CSIA 2CAQA 2G0FA 2C4JA 3V1WA 1TP9A 3TJJA 4MK3A 13GSA 3APQA 1YF0A 3UEMA 2E2GA 4DVCA 3N9JA 5CP1A 3GX0A 1TK0B 2V6KA 2ON7A 1GNWA 4K0GA 5ECHB 3Q18A 5HFGA 2HRFA 1ERTA 1UC7A 3F3RA 2CQ9A 1I9DA 3W6GA 1EZKA 5G5FA 1A2JA 2DJ3A 2GSRA 3WGEA 2YOIA 2WGRA 1F3BA 1BG5A 1ERUA 1PX6A 1SL1B 2YP6A 4IJ3A 4YAPA 3HZ8A 5E59A 4POKA 1K0OA 3BBYA 2MBSA 1O8WA 1C72A 1DUGA 4MH2A 2H70A 1YEPA 2EIOA 2GLRA 2I4AA 4K2DA 4OO5A 1TK8B 3FHKA 3QOUA 4ECCA 3G9BA 4OCFA 4IQAA 3I9V2 3F0IA 3TDGA 5ENUA 1M2DA 2JU5A 4EUYA 3BJ5A 3GRXA 3F4TA 1ILOA 2ES7A 4YQVA 4JR6A 1PGTA 1K0NA 2NBSA 2M46A 1GUKA 2MMZA 1M7TA 2AV4A 2QKEA 1WP0A 2AHEA 1SJ6A 5IMZA 4IW9A 4GSNA 4DSSB 4K0NA 4IVFA 1MEKA 3FZ9A 3A2XA 2XC2A 3LGCA 3IA1A 4AJ8A 3IHQA 3H8QA 4X1UA 1EV4A 2PBJA 1YY7A 3GSSA 3KTBA 3UARA 4ACSA 2FCHA 1BJXA 3KH7A 2C3TA 4OFTA 3MWHA 5JWRB 3KGKA 1Z7RA 5AGYA 4ZBDA 2GGTA 1BQ7A 2MMNA 2X8GA 1NHYA 5KN0A 1VGLA 4G9HA 1EWXA 4GLTA 4RUVA 4ECBA 2B7KA 3HVSA 1FB0A 3LORA 1F6MC 1K0BA 4NPBA 4ZBAA 3ZYWA 1B9XC 4ZILA 4V1Ag 4DSRA 2PU9C 2PWJA 2K9FA 3FZ4A 2DMMA 5ELAA 3QFBC 1G6WA 1A2LA 1HQOA 1PD21 4NV2A 16GSA 3DIEA 5F06A 5A4VA 1QQ2A 2YN1A 2VD0A 3EYTA 2GDRA 1DSBA 3UVHA 3H79A 1MDIA 3IPZA 2KP1A 1JZDA 3VI7A 1THOA 5KN3A 4WF4A 4KA0A 1T4ZA 4EL1A 3E3EA 4KDUA 3CSHA 1HD2A 4DSQA 3HCZA 2B3SA 3D4MA 1SD9A 5EY6A 1OKTA 1SK0A 1YZXA 5ECNB 3HXSA 3D6IA 4TR3A 5IPGA 5KN2A 4RI6A 1URMA 1TXXA 3KMNA 4PGTA 2RM5A 5D9TA 3QFAC 3UOMA 1GSDA 2PVQA 1PN9A 3D21A 1ML6A 1XWKA 3Q74A 2DIYA 3L4NA 3ZREA 1KBNA 3DEXA 1A0RP 4XS6A 2WJUA 2IJYA 1ZCPA 4XHMA 3H93A 3TKPA 4JEDA 2X8HA 3LFLA 3GIXA 3F3QA 4GSSA 3IE3A 2FWFA 5DAKA 3ZITA 4TXOB 4POBA 2F9SA 4QL7A 2V41A 1ZMAA 3QR6A 3RBTA 2LUSA 5AISA 4L5OA 2CAIA 3EVIA 4TR1A 2R4VA 1GNEA 1TRVA 3ZMKA 2HSHA 3GFKA 2GZPA 1O8XA 3K8NA 3MSZA 2ZNMA 3FEUA 2GTUA 1SJIA 3QAVA 5J5NA 1OE8A 2WS2A 5DALB 4MZCA 5IQYA 4Z7XA 1WRYA 1Z6MA 3D22A 4GCIA 4TW5A 1T7PB 2VAFA 1GH2A 2VCQA 3TCOA 2H0GA 5JWOB 2L4CA 3KIJA 3GV1A 3GKNA 5IOWA 2LS5A 1FVKA 2VD1A 4HS1A 1GTUA 5EL8A 2LJKA 3TJFA 4K7NA 6GSSA 3GURA 3LQ7A 5HR2A 2HFDA 2KUCA 2OE1A 5HFIA 5DCHA 3QPMA 3HYPA 2H19A 3C73A 1SKWB 3HD5A 3GH6A 2YJ7A 1GSSA 2IN3A 3H1NA 1PL1A 3NZNA 3G7JA 4OFNA 5G30A 3P90A 1EEMA 1HNCA 3EU4A 3IR4A 3TGZA 2F8AA 3UBLA 4XS4B 2VL3A 4MJAA 2G2QA 2A2SA 4GRFA 3TRXA 5D93A 4AF2A 2CV4A 2I81A 5IMAA 4KE3A 3C1SA 1QXHA 1FVJA 1EP8A 1Q98A 2X8CA 1V57A 2L6CA 4TR0A 4IN0A 1HNBA 1PQNA 2HLSA 4MABA 4L8EA 3CTGA 3EMPA 2F3MA 3C7MA 4I2TA 1XBSA 3BCKA 2YCDA 1GTIA 2YANA 4OFMA 4X0XA 1V58A 3GN3A 1UA5A 4BL7A 2FA8A 5IO0A 1JZOA 1PKWA 4Q5NA 4HZ2A 2P5RA 2GSTA 2VM1A 1PRXA 4KW6A 5H5SA 2N5FA 3FRCA 3BOAA 1XW5A 2KHPA 5DDLA 1S3DA 2YJHA 3GTUB 3ME8A 4AJ7A 1F2EA 2JL4A 3LXZA 2CX3A 3LYKA 4G19A 2XPEA 4IP1A 2H72A 2IMFA 2C0DA 1EOHA 2VCVA 1FHEA 1XWAA 4NMUA 2VM2A 1K3YA 2B6MA 3DD3A 5ECMB 4ZL8A 5D9XA 4XCSA 1TU8A 2CVKA 3C71A 5JCGA 1T3BA 4BVXA 5J9CA 2VLVA 5ECLB 1GSYA 2BJXA 3KJYA 3M8NA 1RQMA 2EIRA 4MJEA 1A8LA 2K18A 3TKSE 4RQRA 3WD6A 5CRWA 4ZL9A 3OR5A 4MPFA 2I9HA 1X9SB 6GSXA 3TJGA 3M9KA 2HRNA 4KDXA 4ZL7A 2OBIA 1PX7A 1DBYA 1T1VA 2JADA 3ERFA 2QC7A 2HSYA 3UAPA 3KCMA 1OVNA 2X64A 3D0ZA 5EPFA 1JFUA 3LEFA 4YQMA 2C1YA 3CYNA 1PL2A 3GL5A 1AIUA 5CO3A 3TRQA 3ISOA 2P5QA 4MF6A 3F9UA 5HFKA 2B1LA 5ECSA 2R6KA 2IL3A 5ID2B 4LLRA 2YPMA 4LL4B 1GRXA 3GL3A 4PURA 2WRTA 3HJMA 3IAM2 2RM6A 1NSWA 2KP2A 3QAWA 1MDKA 1B4QA 1GUMA 2L5OA 2RUFA 4N10A 2ON5A 5INYA 1FG4A 4EE0A 5GAND 2ZCTA 2CVBA 1VF2A 3ZL5A 2E2MA 2IFQA 4PNFA 1O81A 4D73A 2YV7A 4KX4A 7GSSA 1H4OA 3VLNA 2X99A 2VLUA 4O5RA 4ISDA 3APOA 4TKYA 5F07A 4RQXA 3BCIA 5GAPD 3G7IA 4ZB6A 1GSEA 2B1KA 4XIHA 1J9BA 5ECPB 4G10A 3FZ5A 5D96A 1Y6EA 3MNGA 5H5RA 3DVWA 4TR4A 3R2QA 2H1AA 3LYPA 3PR8A 1BEDA 1O7UA 2DC5A 4KDYA 2FHEA 1X5EA 3CRTA 5DJMA 2GZZA 1LJRA 3TKSC 1A0FA 1YF1A 1GP1A 3L9UA 4XRDA 5HR1A 3SBCA 2TRXA 3HHVA 5IOXA 2GQMA 2Z9SA 4EF0A 5ECQB 1OC9B 1XOBA 4NHWA 2BMXA 2DIZA 3HA9A 3L9SA 3GSTA 1ERWA 3AY8A 4N0ZA 1T00A 3FR3A 2KLXA 1JZWA 4JU5A 1OYJA 2C8UA 1V40A 2WFCA 4MMMA 4WEYA 4BVYA 5HR3A 4EC0A 3ZIVA 4I8BA 4LMWA 1G7OA 1AQVA 1VF1A 2IMEA 3WT2A 3QDNA 4NV5A 1MD3A 5CAXA 1ABAA 4I6XA 4PNGA 3HJPA 2H1GA 3KZQA 1AW9A 5D9WA 5IPHA 2C3NA 5G1LA 4ML6A 1AQXA 3EMXA 2GZYA 1U3IA 1Y25A 2B5XA 1JLWA 2F51A 4IS0A 3HDCA 2PPTA 5CRDA 3FZAA 1XIYA 2YWOA 6GSUA 4HJMA 2PGTA 4WBJA 2R2JA 2IFQB 3VK9A 1FOVA 2DJ0A 4MDCA 2M72A 1SENA 2JACA 5ECKB 3L9VA 4F2IA 4K9ZA 4ZBBA 2A4VA 3MAKA 4JE1A 2L57A 5LCZA 1NM3A 5IIZA 2NTOA 2O85A 5KN1A 3CSJA 2H01A 3TKSA 3UL3A 1OKDA 5CRGA 3E9JB 5COHA 2LRTA 2ZUPA 3EINA 2H1BA 2M80A 1TRSA 3F8UA 5F0GA 3KEBA 3IOSA 1K3LA 3ZIJA 1A2MA 2L5LA 4I2UA 2HE3A 2N5AA 1XW9A 3EE2A 2GS3A 5CRHA 3TKQA 4ID0A 3PH9A 4MPGA 2LV3A 2LJAA 4XRAA 5JWQB 2GT5A 1ERVA 1SD8A 4K6XA 2P0GA 4NWYA 2C0GA 2OE0A 3D4TA 1SU9A 4F82A 1U6TA 1CQHA 2YZUA 4GTUA 4BPYA 1R5AA 3GYKA 3SWLA 4GF0A 3KMOA 3US3A 4K7IA 1SKSB 2A2RA 6GSTA 4LA1A 1A8YA 5FHIA 4PQHA 2RLIA 4HJ2A 1ZGNA 2LJRA 2VO4A 1EEJA 6GSVA 3KTLA 3FK8A 4MCUA 2TRCP 5AIXA 1G0TA 1TRWA 2H6XA 3A2WA 1WPIA 3FY7A 4JRRA 4EKZA 4GQFA 4V2NA 2WZ9A 4EDYA 4ZB8A 2OKAA 1B8XA 1EV9A 1WJKA 4YAVA 1KTEA 3U5RE 4N11A 5IMFA 1R26A 3IC4A 2VL2C 4JR4A 5H5QA 2CZ3A 5G31A 2LNSA 2I3YA 3GA4A 2HYXA 4ECIA 1K0AA 3QMXA 5KEJA 5G2ZA 4L0WA 4KAEA 4WR5A 3DKSA 18GSA 5GZZB 4KCEA 2O87A 2H1DA 3N5OA 1WWJA 1TI3A 5J4UA 3HVXA 2FGXA
chains in the Genus database with same CATH superfamily
2OA7A 5CNWA 3P7XA 1XXUA 3KD0A 1E2YA 1Z9HA 1S3CA 5J3RA 3DYRA 3GNJA 2FA4A 3MYDA 4LMVA 2H76A 1U88A 2WB9A 3FKFA 4IQ1A 2DBCA 2E7PA 1V98A 5ELGA 2QSIA 4GWRA 1M3IA 1XFLA 1WMJA 5EVOA 1ZL9A 4FYCA 2GQLA 1B48A 4HU9A 2PERA 3I6AA 3PGTA 2H0IA 1Q4JA 2AUVA 1TW9A 4JZQA 3TJKA 2HZEA 5IO2A 3RHCA 1F9MA 3IRAA 5A5KA 19GSA 4PX1A 1X9MB 3ZZXA 1X9WB 3FR9A 2MMAA 5B6NA 2JSZA 2CX4A 3U6VA 2L4QA 5DAKB 2HRKA 5CYYA 3J7Yk 2WULA 4FYBA 2OACA 2OJLA 3LWAA 4L5LA 1TJDA 2KOKA 3ZVJA 4FH8A 4TR1B 2LKUA 3HY2A 4IGJA 4ZIJA 1GULA 1T4YA 5J9BA 1SK1A 2LRCA 3HVNA 2HI7A 5AIVA 2CZ2A 2IIYA 1VF4A 1YJ6A 3P2AA 4WR4A 1XCCA 4L0UA 2JZRA 3PINA 1Z5YE 3WGXA 2OE3A 3EU3A 2HT9A 2V32A 3IV4A 4N30A 4WETA 1E6BA 4KGIA 4POMA 3F6DA 2YZHA 2DSAA 2GSQA 1M99A 1U3AA 4WBRD 3E0UA 2X4AA 3ERGA 4EVMA 2H6ZA 3NOFA 2HNLA 4EIQA 4MLYA 4J2FA 2QGVA 1WIKA 2VCWA 1TDIA 1SL0B 1I5GA 1Z7PA 4IP6A 4QQ7A 3ZLPA 4PUAA 1FAAA 4E8EA 1CQGA 4PQIA 2VCZA 4IHUA 1Z3EA 4FIWA 4CHSA 3RDWA 3UIWA 3FW2A 4AJ6A 3KP9A 5LNKe 2YWNA 4WKWA 1GL8A 4V2LA 1Z6NA 1TK5B 5CREA 1HYUA 5D8IA 1K0CA 3A2VA 2GQKA 2FNOA 2OADA 3A3TA 3ZFBA 3M3MA 2B5YA 3ME7A 2TIRA 4USSA 4J56E 1AXDA 1IYHA 5C00A 4Q5QA 2H0HA 2C0FA 4MZWA 5HR0A 2YV9A 2LQQA 5GSSA 1ZYPA 5DCGA 4J57E 4BL7B 3J7Yb 2BTOT 4DSSA 2IPAA 3ERWA 1XOAA 1XPVA 4HUAA 5A4WA 4O92A 2B5EA 2FWHA 3RAZA 2VCXA 3P8WA 4XS1A 2C0EA 4FO5A 1UVZA 1GSQA 2R5GA 4MJBA 2DJ2A 2CVDA 3RPNA 2D2ZA 2LQOA 4RI7A 1K0MA 3LSZA 1KNGA 5D9VA 4CDOA 2E0QA 1DE2A 5DBQA 4YQUA 3R3EA 1J0FA 1U87A 3G7YA 12GSA 1K3OA 1TTZA 2PMTA 4TN8A 1XWBA 1F37A 3MDKA 5ECRB 3W8JA 1SKRB 2VOCA 3RPPA 1R7HA 4X4JA 4CW9A 4MJCA 2JSYA 2HXKA 2PUKC 3F6FA 1TU7A 4I5QA 3LG6A 5JCWA 3Q19A 4KH7A 3VPTA 4BVXB 1YDKA 10GSA 3Q6OA 17GSA 4IBPA 4I97A 11GSA 2L6DA 3HVVA 4NAXA 2XHFA 5LD0A 1M9AA 2H73A 2H66A 2FLSA 1M3JA 5ABRA 1GSFA 2ALBA 4X43A 3CBUA 1ZYQB 2DMLA 4MH3A 3UJ1A 2AJQB 1JHBA 3BD2A 5B6MA 1FW1A 3HJOA 2DJ1A 1GLQA 4LL1B 1WE0A 2LRNA 3TB2A 3CRUA 2IMIA 2GVPA 2FD3A 2K6VA 1XG8A 14GSA 3O3TA 1JZRA 4PUFC 1AC1A 5IMDA 1A23A 3EWLA 3IC8A 3M0FA 4EDZA 2K8VA 2F8FA 1BX9A 1M0UA 2MMOA 4N0VA 4OWYA 2PN8A 1FO5A 3JCML 2V1MA 2FUG2 4E8HA 3KM6A 5B8AA 4TXOA 3APSA 1QUWA 4K7OA 4QL9A 4TRXA 3UMAA 4WF5A 5F05A 3HZ4A 1ZZYA 3DXBA 2MBTA 4HEA2 4F9ZA 1N8JA 5B8BA 4D73B 3D5JA 2XPDA 2B7JA 5DALA 1SJZA 1XWCA 2WDUA 4ZXGA 3TOTA 2H75A 3QD9A 5DQYA 4OD7A 1PMTA 4Q5RA 3GUSA 4K1FA 3ZTLA 4ZB9A 4KF9A 5L71A 5D73A 3WT1A 2NVLA 1YQ1A 4TVEA 2EIQA 2IMKA 3VI5A 4AGSA 1OC3A 4KUNA 4MZBA 4BA7A 1N2AA 1BYEA 1O73A 1RK4A 1MTCA 2DJKA 3EURA 2FWGA 2P31A 3A5WA 1XZOA 3S9FA 3KH9A 1B9YC 3VURA 3TJBA 1VRSD 3C1RA 5F8BA 3GX8A 4MF5A 1MDJA 1XWGA 2H71A 4XS4A 2AYTA 1S3AA 2O8VB 4OCEA 2IMDA 1X0RA 1NW2A 4HZ4A 1YEXA 2JZTA 9GSSA 3DMLA 4MNNA 4V1Ap 3W8SA 5C04A 4BVYB 2VLTA 4PQ1A 5GSTA 3DVXA 2H6YA 3ED3A 2FWEA 4POLA 2K8SA 1M2AA 1USBA 5J41A 4F0CA 1ZYEA 4IJIA 3LXTA 3QAGA 4O7HA 2N5BA 20GSA 4Q5FA 1SL2B 2XBIA 2LEGA 4F0BA 1PSQA 4OMVA 1F3AA 1QGVA 4FYUA 1X5DA 3IDVA 1LU4A 1GUHA 3GKMA 4ECJA 1TOFA 3F63A 4NXIA 4H86A 2FY6A 4HQZA 3L0HA 2V6OA 2O7KA 3DWVA 1SYXA 1M2BA 1AQWA 3GTUA 2VUPA 2H8LA 1M9BA 1X5CA 1B4PA 4ML1A 2AAWA 3VWXA 1WOUA 1K0DA 3CTFA 4PXOA 5FT3A 5IM9A 5E4WA 3M9JA 5IMVA 4KCAA 2YWIA 4F03A 3H4KA 2VL9A 1ZYNA 1OE7A 3GKXA 2H30A 1EP7A 2GSSA 4P3YB 1R4WA 2V2GA 4MA9A 1TI1A 6GSWA 5ECIB 5B7CA 1EGOA 2YNXA 4MP4A 3WYWA 3I69A 4WXTA 3GKKA 3VWWA 1VF3A 3NIVA 2LSTA 2DLXA 4O32A 4YH2A 2JZSA 1A24A 5G5EA 5DJLA 4NHZA 3IK9A 3ZMLA 1GWCA 1MD4A 1XVQA 3TUEA 1QFNA 1RW1A 1W89A 4HDEA 4MF7A 2IWTA 3VPQA 2DJJA 2NPBA 4BWSA 1NHOA 1O85A 3TOUA 1O6JA 3F4SA 1SYRA 3ZRDA 2GT6A 1ZOFA 3IXRA 4ULXA 4EXJA 4TOPA 1QK8A 2VL2A 1V2AA 3DRNA 3F4RA 5DQSA 4OO4A 3C8EA 5DVBA 1PKZA 1AAZA 2J9HA 1GTBA 1V9WA 5HQPA 2LTKA 1GSUA 1FB6A 5JCUA 2C3QA 5A4UA 2YWMA 3FYGA 5ID2A 1QMVA 1PA3A 1GLPA 1LBKA 4K8MA 2CA8A 2MZCA 1OC8A 2VIMA 5IMCA 8GSSA 1ON4A 4DEJA 1EOGA 1EGRA 3GH9A 2R0PA 2H74A 2REMA 4HU7A 3VFIA 3ZFLA 1TRUA 1HNAA 2C80A 5AN1A 3GHAA 1DE1A 2NDOA 3CXGA 3HKRA 2MYGA 3TRPA 1G6YA 1G7EA 1ST9A 4KB3A 1AUCA 3LJRA 3UBKA 3WGDA 1XVWA 4V2MA 3IBHA 4GXZA 1W4VA 4HOJA 3DGQA 3EC3A 4XTSA 5ECOB 1UN2A 4KNDA 1J08A 2EC4A 2I1UA 3L78A 1H75A 1XW6A 2O89A 1YKAA 3M1GA 4ILFA 2J23A 1ACVA 3FR6A 4TXVA 4HQSA 1YKCA 1GTAA 3VWUA 6GSYA 4KSMA 2RUEA 3KXOA 2RIIA 22GSA 1SK2A 2XBQA 3TKRA 2HZEB 2OBKA 3IK7A 2L59A 3O76A 1JLVA 3IAS2 1R5PA 2CT6A 1THXA 3VWVA 4GQCA 1BAYA 4KSOA 2PVOC 2HZFA 3I43A 4IKHA 4GSTA 2VCTA 1IYIA 5FWGA 1OC9A 2R37A 4EO3A 4BWQA 3QCPA 2WCIA 3O6TA 2X49A 3CMIA 1TKDB 4IELA 1KEBA 3ZVJD 2R3XA 4HI7A 3KP8A 3GMFA 2AB6A 2LNTA 4G2EA 1T8EB 3UVTA 5G1KA 3RHBA 1OAZA 4JBBA 3CSIA 2CAQA 2G0FA 2C4JA 3V1WA 1TP9A 3TJJA 4MK3A 13GSA 4A5PA 3APQA 1YF0A 3UEMA 2E2GA 4DVCA 3N9JA 5CP1A 3GX0A 1TK0B 2V6KA 2ON7A 1GNWA 4K0GA 5ECHB 3Q18A 5HFGA 2HRFA 1ERTA 4FQUA 3EPTA 1UC7A 3F3RA 2CQ9A 1I9DA 3W6GA 1EZKA 5G5FA 1A2JA 2DJ3A 2GSRA 3WGEA 3FMWA 2YOIA 2WGRA 1F3BA 5BRTA 1BG5A 1ERUA 1PX6A 1SL1B 2YP6A 4IJ3A 4YAPA 3HZ8A 5E59A 4POKA 1K0OA 3BBYA 2MBSA 1O8WA 2UZ8A 1C72A 1DUGA 4MH2A 2H70A 1YEPA 2EIOA 2GLRA 2I4AA 4K2DA 4OO5A 1TK8B 3FHKA 2R0GA 3QOUA 4K5SA 4ECCA 3G9BA 4OCFA 4IQAA 3I9V2 3F0IA 3TDGA 5ENUA 1M2DA 2JU5A 4EUYA 3BJ5A 3GRXA 3F4TA 1ILOA 2ES7A 4YQVA 4JR6A 1FOHA 1PGTA 1K0NA 2NBSA 2M46A 1GUKA 2MMZA 1M7TA 2AV4A 2QKEA 1WP0A 2AHEA 1SJ6A 5IMZA 4IW9A 4GSNA 4DSSB 4K0NA 4IVFA 1MEKA 3FZ9A 3A2XA 2XC2A 3LGCA 3IA1A 4AJ8A 3IHQA 3H8QA 4X1UA 1EV4A 2PBJA 1YY7A 3GSSA 3KTBA 3UARA 4ACSA 2FCHA 1BJXA 3KH7A 2C3TA 4OFTA 4YKGA 3MWHA 5JWRB 3KGKA 1Z7RA 5AGYA 4ZBDA 2GGTA 1BQ7A 2MMNA 2X8GA 1NHYA 5KN0A 1VGLA 4G9HA 1EWXA 4GLTA 4RUVA 4ECBA 2B7KA 3HVSA 1FB0A 3LORA 1F6MC 1K0BA 4NPBA 4ZBAA 3ZYWA 1B9XC 3PPUA 4ZILA 4V1Ag 4DSRA 2PU9C 2PWJA 2K9FA 3FZ4A 2DMMA 5ELAA 3QFBC 1G6WA 1A2LA 1HQOA 1PD21 4NV2A 16GSA 3A5IA 3DIEA 5F06A 5A4VA 1QQ2A 2YN1A 2VD0A 3EYTA 3LW9A 2GDRA 1DSBA 3UVHA 5BMUA 3H79A 1MDIA 3IPZA 2KP1A 1JZDA 1PFOA 3VI7A 1THOA 5KN3A 4WF4A 4KA0A 1T4ZA 4EL1A 3E3EA 4KDUA 4CY8A 3CSHA 1HD2A 4DSQA 3HCZA 2B3SA 3D4MA 1SD9A 5EY6A 1OKTA 1SK0A 1YZXA 5ECNB 3HXSA 3D6IA 4TR3A 5IPGA 5KN2A 4RI6A 1URMA 1TXXA 3KMNA 4PGTA 2RM5A 5D9TA 3QFAC 3UOMA 1GSDA 2PVQA 1PN9A 3D21A 1ML6A 1XWKA 3Q74A 2DIYA 3L4NA 3ZREA 1KBNA 3DEXA 1A0RP 4XS6A 2WJUA 2IJYA 1ZCPA 4XHMA 3H93A 3TKPA 4JEDA 2X8HA 3MIXA 3LFLA 3GIXA 4EIPA 3F3QA 4GSSA 3IE3A 2FWFA 5DAKA 3ZITA 4TXOB 4POBA 2F9SA 4QL7A 2V41A 1ZMAA 2R0CA 3QR6A 3RBTA 2LUSA 5AISA 4L5OA 2CAIA 4PTSA 3EVIA 4TR1A 2R4VA 1GNEA 1TRVA 3ZMKA 2HSHA 3GFKA 2GZPA 1O8XA 3K8NA 3MSZA 2ZNMA 3FEUA 2GTUA 1SJIA 3QAVA 5J5NA 1OE8A 2WS2A 1S3RA 5DALB 4MZCA 5IQYA 4Z7XA 1WRYA 1Z6MA 3D22A 5KOWA 4GCIA 4TW5A 1T7PB 5KOXA 2VAFA 1GH2A 2VCQA 3TCOA 2H0GA 5JWOB 2L4CA 3KIJA 3GV1A 3GKNA 4K2XA 5IOWA 2LS5A 1FVKA 2VD1A 4HS1A 1GTUA 5EL8A 2LJKA 3TJFA 4K7NA 6GSSA 3GURA 3LQ7A 5HR2A 2HFDA 2KUCA 2OE1A 5HFIA 5DCHA 3QPMA 3HYPA 2H19A 3C73A 1SKWB 3HD5A 3GH6A 2YJ7A 1GSSA 2IN3A 3H1NA 1PL1A 3NZNA 3G7JA 4OFNA 5G30A 3P90A 1EEMA 1HNCA 3EU4A 3IR4A 3TGZA 2F8AA 3UBLA 4XS4B 2VL3A 4MJAA 2QA1A 2G2QA 2A2SA 4GRFA 3TRXA 5D93A 4AF2A 2CV4A 2I81A 5IMAA 4KE3A 3C1SA 1QXHA 1FVJA 1EP8A 1Q98A 2X8CA 1V57A 2L6CA 4TR0A 4IN0A 1HNBA 1PQNA 2HLSA 4MABA 4L8EA 3CTGA 3EMPA 2F3MA 3C7MA 2A4HA 4I2TA 1XBSA 3BCKA 2YCDA 1GTIA 2YANA 4OFMA 4X0XA 1V58A 3GN3A 1UA5A 4BL7A 2FA8A 5IO0A 1JZOA 1PKWA 4Q5NA 4HZ2A 2P5RA 2GSTA 2VM1A 1PRXA 4KW6A 5H5SA 2N5FA 3FRCA 3BOAA 1XW5A 2KHPA 5DDLA 1S3DA 2YJHA 3GTUB 3ME8A 4AJ7A 1F2EA 2JL4A 3LXZA 2CX3A 3LYKA 4G19A 2XPEA 4IP1A 2H72A 2IMFA 2C0DA 1EOHA 2VCVA 1FHEA 1XWAA 4NMUA 4O5UA 2VM2A 1K3YA 2B6MA 3DD3A 5ECMB 4ZL8A 5D9XA 4XCSA 4HSCX 1TU8A 2CVKA 3C71A 5JCGA 1T3BA 4BVXA 2HRAA 5J9CA 2VLVA 5ECLB 1GSYA 2BJXA 3KJYA 3M8NA 1RQMA 2EIRA 4MJEA 1A8LA 2K18A 4Z2RA 3TKSE 4RQRA 4YKFA 3WD6A 5CRWA 4ZL9A 3OR5A 4MPFA 2I9HA 1X9SB 6GSXA 3TJGA 3M9KA 2HRNA 4KDXA 3CQFA 4ZL7A 2OBIA 1PX7A 1DBYA 1T1VA 2JADA 3ERFA 2QC7A 2HSYA 3UAPA 3KCMA 1OVNA 2X64A 3D0ZA 5EPFA 1JFUA 3LEFA 4YQMA 2C1YA 3CYNA 2DKIA 1PL2A 3GL5A 1AIUA 5CO3A 3TRQA 3ISOA 2P5QA 4MF6A 3F9UA 5HFKA 2B1LA 5ECSA 2R6KA 2IL3A 5ID2B 4LLRA 4Z2UA 2YPMA 4LL4B 1GRXA 3GL3A 4PURA 2WRTA 3HJMA 3IAM2 2RM6A 1NSWA 2KP2A 3QAWA 1MDKA 1B4QA 1GUMA 2L5OA 4G0LA 2RUFA 4N10A 2ON5A 5INYA 1FG4A 4EE0A 5GAND 2ZCTA 2CVBA 1VF2A 2DKHA 3ZL5A 2E2MA 2IFQA 4PNFA 1O81A 4D73A 2YV7A 4KX4A 7GSSA 4O5QA 1H4OA 3VLNA 2X99A 2VLUA 4O5RA 4ISDA 3APOA 4TKYA 5F07A 4RQXA 3BCIA 5GAPD 3G7IA 4ZB6A 1GSEA 2B1KA 4XIHA 4Z2TA 1J9BA 5ECPB 4G10A 3FZ5A 5D96A 1Y6EA 3MNGA 5H5RA 3DVWA 4TR4A 3R2QA 2H1AA 3LYPA 3PR8A 1BEDA 1O7UA 2DC5A 4KDYA 2FHEA 1X5EA 3CRTA 5DJMA 2GZZA 1LJRA 3TKSC 1A0FA 1YF1A 1GP1A 3L9UA 4XRDA 5HR1A 4BIKA 3SBCA 2TRXA 3HHVA 5IOXA 2GQMA 2Z9SA 4EF0A 5ECQB 1OC9B 1XOBA 4NHWA 2BMXA 2DIZA 3HA9A 3L9SA 3GSTA 1ERWA 3AY8A 4N0ZA 1T00A 2HSMA 3FR3A 2KLXA 1JZWA 4JU5A 1OYJA 2C8UA 1V40A 2WFCA 4MMMA 4WEYA 4BVYA 5HR3A 4EC0A 3ZIVA 4I8BA 4LMWA 1G7OA 1AQVA 1VF1A 2IMEA 3WT2A 3QDNA 4NV5A 1MD3A 5CAXA 1ABAA 4I6XA 4PNGA 3HJPA 2H1GA 3KZQA 1AW9A 5D9WA 5IPHA 2C3NA 5G1LA 4ML6A 1AQXA 3EMXA 2GZYA 1U3IA 1Y25A 2B5XA 1JLWA 4ICYA 2F51A 4IS0A 3HDCA 2PPTA 5CRDA 3FZAA 1XIYA 2YWOA 6GSUA 4HJMA 2PGTA 4WBJA 2R2JA 2IFQB 3VK9A 1FOVA 1PN0A 2DJ0A 4MDCA 2M72A 1SENA 2JACA 5ECKB 3L9VA 4F2IA 4K9ZA 4ZBBA 2A4VA 3MAKA 4JE1A 2L57A 5LCZA 1NM3A 5IIZA 2NTOA 2O85A 5KN1A 3CSJA 2H01A 3TKSA 3UL3A 1OKDA 5CRGA 4G0IA 3E9JB 5COHA 2LRTA 2ZUPA 3EINA 2H1BA 2M80A 1TRSA 3F8UA 5F0GA 3KEBA 3IOSA 4G0KA 1K3LA 3ZIJA 1A2MA 2L5LA 4I2UA 2HE3A 2N5AA 1XW9A 3EE2A 2GS3A 5CRHA 3IHGA 3TKQA 4ID0A 3PH9A 4K5RA 4MPGA 2LV3A 2LJAA 4XRAA 5JWQB 2GT5A 1ERVA 1SD8A 4K6XA 2P0GA 4NWYA 2C0GA 2OE0A 3D4TA 1SU9A 4F82A 1U6TA 1CQHA 2YZUA 4GTUA 4BPYA 1R5AA 3GYKA 3SWLA 4GF0A 3KMOA 3US3A 4K7IA 1SKSB 2A2RA 6GSTA 4LA1A 1A8YA 5FHIA 4PQHA 2RLIA 4HJ2A 1ZGNA 2LJRA 4CY6A 2VO4A 1EEJA 6GSVA 3KTLA 3FK8A 4MCUA 2TRCP 5AIXA 1G0TA 1TRWA 2H6XA 3A2WA 1WPIA 3FY7A 4JRRA 4EKZA 4GQFA 4V2NA 2WZ9A 4EDYA 4ZB8A 2OKAA 1B8XA 1EV9A 1WJKA 4YAVA 1KTEA 3U5RE 4N11A 2A2PA 2QA2A 5IMFA 1R26A 3IC4A 2VL2C 4JR4A 5H5QA 2CZ3A 5G31A 2LNSA 2I3YA 3GA4A 2HYXA 4ECIA 1K0AA 3QMXA 5KEJA 5G2ZA 4L0WA 4KAEA 4WR5A 3DKSA 18GSA 5GZZB 4KCEA 2O87A 2H1DA 3N5OA 1WWJA 1TI3A 5J4UA 3HVXA 2FGXA
chains in the Genus database with same CATH topology
2OA7A 5CNWA 3P7XA 1XXUA 3KD0A 1E2YA 1Z9HA 1S3CA 5J3RA 3DYRA 3GNJA 2FA4A 3MYDA 4LMVA 2H76A 1U88A 2WB9A 3FKFA 4IQ1A 2DBCA 2E7PA 1V98A 5ELGA 2QSIA 4GWRA 1XFLA 1WMJA 5EVOA 1ZL9A 4FYCA 2GQLA 1B48A 4HU9A 2PERA 3I6AA 3PGTA 2H0IA 1Q4JA 2AUVA 1TW9A 4JZQA 3TJKA 2HZEA 5IO2A 3RHCA 1F9MA 3IRAA 5A5KA 19GSA 4PX1A 1X9MB 3ZZXA 1X9WB 3FR9A 2MMAA 5B6NA 2JSZA 2CX4A 3U6VA 2L4QA 5DAKB 2HRKA 5CYYA 3J7Yk 2WULA 4FYBA 2OACA 2OJLA 3LWAA 4L5LA 1TJDA 2KOKA 3ZVJA 4FH8A 4TR1B 2LKUA 3HY2A 4IGJA 4ZIJA 1GULA 1T4YA 5J9BA 1SK1A 2LRCA 2HI7A 5AIVA 2CZ2A 2IIYA 1VF4A 1YJ6A 3P2AA 4WR4A 1XCCA 4L0UA 2JZRA 3PINA 1Z5YE 3WGXA 2OE3A 3EU3A 2HT9A 2V32A 3IV4A 4N30A 4WETA 1E6BA 4KGIA 4POMA 3F6DA 2YZHA 2DSAA 2GSQA 1M99A 1U3AA 4WBRD 3E0UA 2X4AA 3ERGA 4EVMA 2H6ZA 3NOFA 2HNLA 4EIQA 4MLYA 4J2FA 2QGVA 1WIKA 2VCWA 1TDIA 1SL0B 1I5GA 1Z7PA 4IP6A 4QQ7A 3ZLPA 4PUAA 1FAAA 4E8EA 1CQGA 4PQIA 2VCZA 4IHUA 1Z3EA 4FIWA 4CHSA 3RDWA 3UIWA 3FW2A 4AJ6A 3KP9A 5LNKe 2YWNA 4WKWA 1GL8A 4V2LA 1Z6NA 1TK5B 5CREA 1HYUA 5D8IA 1K0CA 3A2VA 2GQKA 2FNOA 2OADA 3A3TA 3ZFBA 3M3MA 2B5YA 3ME7A 2TIRA 4USSA 4J56E 1AXDA 1IYHA 5C00A 4Q5QA 2H0HA 2C0FA 4MZWA 5HR0A 2YV9A 2LQQA 5GSSA 1ZYPA 5DCGA 4J57E 4BL7B 3J7Yb 2BTOT 4DSSA 2IPAA 3ERWA 1XOAA 1XPVA 4HUAA 5A4WA 4O92A 2B5EA 2FWHA 3RAZA 2VCXA 3P8WA 4XS1A 2C0EA 4FO5A 1UVZA 1GSQA 2R5GA 4MJBA 2DJ2A 2CVDA 3RPNA 2D2ZA 2LQOA 4RI7A 1K0MA 3LSZA 1KNGA 5D9VA 4CDOA 2E0QA 1DE2A 5DBQA 4YQUA 3R3EA 1J0FA 1U87A 3G7YA 12GSA 1K3OA 1TTZA 2PMTA 4TN8A 1XWBA 1F37A 3MDKA 5ECRB 3W8JA 1SKRB 2VOCA 3RPPA 1R7HA 4X4JA 4CW9A 4MJCA 2JSYA 2HXKA 2PUKC 3F6FA 1TU7A 4I5QA 3LG6A 5JCWA 3Q19A 4KH7A 3VPTA 4BVXB 1YDKA 10GSA 3Q6OA 17GSA 4IBPA 4I97A 11GSA 2L6DA 3HVVA 4NAXA 2XHFA 5LD0A 1M9AA 2H73A 2H66A 2FLSA 5ABRA 1GSFA 2ALBA 4X43A 3CBUA 1ZYQB 2DMLA 4MH3A 3UJ1A 2AJQB 1JHBA 3BD2A 5B6MA 1FW1A 3HJOA 2DJ1A 1GLQA 4LL1B 1WE0A 2LRNA 3TB2A 3CRUA 2IMIA 2GVPA 2FD3A 2K6VA 14GSA 3O3TA 1JZRA 4PUFC 1AC1A 5IMDA 1A23A 3EWLA 3IC8A 3M0FA 4EDZA 2K8VA 2F8FA 1BX9A 1M0UA 2MMOA 4N0VA 4OWYA 2PN8A 1FO5A 3JCML 2V1MA 2FUG2 4E8HA 3KM6A 5B8AA 4TXOA 3APSA 1QUWA 4K7OA 4QL9A 4TRXA 3UMAA 4WF5A 5F05A 3HZ4A 1ZZYA 3DXBA 2MBTA 4HEA2 4F9ZA 1N8JA 5B8BA 4D73B 3D5JA 2XPDA 2B7JA 5DALA 1SJZA 1XWCA 2WDUA 4ZXGA 3TOTA 2H75A 3QD9A 5DQYA 4OD7A 1PMTA 4Q5RA 3GUSA 4K1FA 3ZTLA 4ZB9A 4KF9A 5L71A 5D73A 3WT1A 2NVLA 1YQ1A 4TVEA 2EIQA 2IMKA 3VI5A 4AGSA 1OC3A 4KUNA 4MZBA 4BA7A 1N2AA 1BYEA 1O73A 1RK4A 1MTCA 2DJKA 3EURA 2FWGA 2P31A 3A5WA 1XZOA 3S9FA 3KH9A 1B9YC 3VURA 3TJBA 1VRSD 3C1RA 5F8BA 3GX8A 4MF5A 1MDJA 1XWGA 2H71A 4XS4A 2AYTA 1S3AA 2O8VB 4OCEA 2IMDA 1X0RA 1NW2A 4HZ4A 1YEXA 2JZTA 9GSSA 3DMLA 4MNNA 4V1Ap 3W8SA 5C04A 4BVYB 2VLTA 4PQ1A 5GSTA 3DVXA 2H6YA 3ED3A 2FWEA 4POLA 2K8SA 1M2AA 1USBA 5J41A 4F0CA 1ZYEA 4IJIA 3LXTA 3QAGA 4O7HA 2N5BA 20GSA 4Q5FA 1SL2B 2XBIA 2LEGA 4F0BA 1PSQA 4OMVA 1F3AA 1QGVA 4FYUA 1X5DA 3IDVA 1LU4A 1GUHA 3GKMA 4ECJA 1TOFA 3F63A 4NXIA 4H86A 2FY6A 4HQZA 3L0HA 2V6OA 2O7KA 3DWVA 1SYXA 1M2BA 1AQWA 3GTUA 2VUPA 2H8LA 1M9BA 1X5CA 1B4PA 4ML1A 2AAWA 3VWXA 1WOUA 1K0DA 3CTFA 4PXOA 5FT3A 5IM9A 5E4WA 3M9JA 5IMVA 4KCAA 2YWIA 4F03A 3H4KA 2VL9A 1ZYNA 1OE7A 3GKXA 2H30A 1EP7A 2GSSA 4P3YB 1R4WA 2V2GA 4MA9A 1TI1A 6GSWA 5ECIB 5B7CA 1EGOA 2YNXA 4MP4A 3WYWA 3I69A 4WXTA 3GKKA 3VWWA 1VF3A 3NIVA 2LSTA 2DLXA 4O32A 4YH2A 2JZSA 1A24A 5G5EA 5DJLA 4NHZA 3IK9A 3ZMLA 1GWCA 1MD4A 1XVQA 3TUEA 1QFNA 1RW1A 1W89A 4HDEA 4MF7A 2IWTA 3VPQA 2DJJA 2NPBA 4BWSA 1NHOA 1O85A 3TOUA 1O6JA 3F4SA 1SYRA 3ZRDA 2GT6A 1ZOFA 3IXRA 4ULXA 4EXJA 4TOPA 1QK8A 2VL2A 1V2AA 3DRNA 3F4RA 5DQSA 4OO4A 3C8EA 5DVBA 1PKZA 1AAZA 2J9HA 1GTBA 1V9WA 5HQPA 2LTKA 1GSUA 1FB6A 5JCUA 2C3QA 5A4UA 2YWMA 3FYGA 5ID2A 1QMVA 1PA3A 1GLPA 1LBKA 4K8MA 2CA8A 2MZCA 1OC8A 2VIMA 5IMCA 8GSSA 1ON4A 4DEJA 1EOGA 1EGRA 3GH9A 2R0PA 2H74A 2REMA 4HU7A 3VFIA 3ZFLA 1TRUA 1HNAA 2C80A 5AN1A 3GHAA 1DE1A 2NDOA 3CXGA 3HKRA 2MYGA 3TRPA 1G6YA 1G7EA 1ST9A 4KB3A 1AUCA 3LJRA 3UBKA 3WGDA 1XVWA 4V2MA 3IBHA 4GXZA 1W4VA 4HOJA 3DGQA 3EC3A 4XTSA 5ECOB 1UN2A 4KNDA 1J08A 2EC4A 2I1UA 3L78A 1H75A 1XW6A 2O89A 1YKAA 3M1GA 4ILFA 2J23A 1ACVA 3FR6A 4TXVA 4HQSA 1YKCA 1GTAA 3VWUA 6GSYA 4KSMA 2RUEA 3KXOA 2RIIA 22GSA 1SK2A 2XBQA 3TKRA 2HZEB 2OBKA 3IK7A 2L59A 3O76A 1JLVA 3IAS2 1R5PA 2CT6A 1THXA 3VWVA 4GQCA 1BAYA 4KSOA 2PVOC 2HZFA 3I43A 4IKHA 4GSTA 2VCTA 1IYIA 5FWGA 1OC9A 2R37A 4EO3A 4BWQA 3QCPA 2WCIA 3O6TA 2X49A 3CMIA 1TKDB 4IELA 1KEBA 3ZVJD 2R3XA 4HI7A 3KP8A 3GMFA 2AB6A 2LNTA 4G2EA 1T8EB 3UVTA 5G1KA 3RHBA 1OAZA 4JBBA 3CSIA 2CAQA 2G0FA 2C4JA 3V1WA 1TP9A 3TJJA 4MK3A 13GSA 4A5PA 3APQA 1YF0A 3UEMA 2E2GA 4DVCA 3N9JA 5CP1A 3GX0A 1TK0B 2V6KA 2ON7A 1GNWA 4K0GA 5ECHB 3Q18A 5HFGA 2HRFA 1ERTA 4FQUA 3EPTA 1UC7A 3F3RA 2CQ9A 1I9DA 3W6GA 1EZKA 5G5FA 1A2JA 2DJ3A 2GSRA 3WGEA 3FMWA 2YOIA 2WGRA 1F3BA 5BRTA 1BG5A 1ERUA 1PX6A 1SL1B 2YP6A 4IJ3A 4YAPA 3HZ8A 5E59A 4POKA 1K0OA 3BBYA 2MBSA 1O8WA 2UZ8A 1C72A 1DUGA 4MH2A 2H70A 1YEPA 2EIOA 2GLRA 2I4AA 4K2DA 4OO5A 1TK8B 3FHKA 2R0GA 3QOUA 4K5SA 4ECCA 3G9BA 4OCFA 4IQAA 3I9V2 3F0IA 3TDGA 5ENUA 1M2DA 2JU5A 4EUYA 3BJ5A 3GRXA 3F4TA 1ILOA 2ES7A 4YQVA 4JR6A 1FOHA 1PGTA 1K0NA 2NBSA 2M46A 1GUKA 2MMZA 1M7TA 2AV4A 2QKEA 1WP0A 2AHEA 1SJ6A 5IMZA 4IW9A 4GSNA 4DSSB 4K0NA 4IVFA 1MEKA 3FZ9A 3A2XA 2XC2A 3LGCA 3IA1A 4AJ8A 3IHQA 3H8QA 4X1UA 1EV4A 2PBJA 1YY7A 3GSSA 3KTBA 3UARA 4ACSA 2FCHA 1BJXA 3KH7A 2C3TA 4OFTA 4YKGA 3MWHA 5JWRB 3KGKA 1Z7RA 5AGYA 4ZBDA 2GGTA 1BQ7A 2MMNA 2X8GA 1NHYA 5KN0A 1VGLA 4G9HA 1EWXA 4GLTA 4RUVA 4ECBA 2B7KA 3HVSA 1FB0A 3LORA 1F6MC 1K0BA 4NPBA 4ZBAA 3ZYWA 1B9XC 3PPUA 4ZILA 4V1Ag 4DSRA 2PU9C 2PWJA 2K9FA 3FZ4A 2DMMA 5ELAA 3QFBC 1G6WA 1A2LA 1HQOA 1PD21 4NV2A 16GSA 3A5IA 3DIEA 5F06A 5A4VA 1QQ2A 2YN1A 2VD0A 3EYTA 3LW9A 2GDRA 1DSBA 3UVHA 5BMUA 3H79A 1MDIA 3IPZA 2KP1A 1JZDA 3VI7A 1THOA 5KN3A 4WF4A 4KA0A 1T4ZA 4EL1A 3E3EA 4KDUA 4CY8A 3CSHA 1HD2A 4DSQA 3HCZA 2B3SA 3D4MA 1SD9A 5EY6A 1OKTA 1SK0A 1YZXA 5ECNB 3HXSA 3D6IA 4TR3A 5IPGA 5KN2A 4RI6A 1URMA 1TXXA 3KMNA 4PGTA 2RM5A 5D9TA 3QFAC 3UOMA 1GSDA 2PVQA 1PN9A 3D21A 1ML6A 1XWKA 3Q74A 2DIYA 3L4NA 3ZREA 1KBNA 3DEXA 1A0RP 4XS6A 2WJUA 2IJYA 1ZCPA 4XHMA 3H93A 3TKPA 4JEDA 2X8HA 3MIXA 3LFLA 3GIXA 4EIPA 3F3QA 4GSSA 3IE3A 2FWFA 5DAKA 3ZITA 4TXOB 4POBA 2F9SA 4QL7A 2V41A 1ZMAA 2R0CA 3QR6A 3RBTA 2LUSA 5AISA 4L5OA 2CAIA 4PTSA 3EVIA 4TR1A 2R4VA 1GNEA 1TRVA 3ZMKA 2HSHA 3GFKA 2GZPA 1O8XA 3K8NA 3MSZA 2ZNMA 3FEUA 2GTUA 1SJIA 3QAVA 5J5NA 1OE8A 2WS2A 5DALB 4MZCA 5IQYA 4Z7XA 1WRYA 1Z6MA 3D22A 5KOWA 4GCIA 4TW5A 1T7PB 5KOXA 2VAFA 1GH2A 2VCQA 3TCOA 2H0GA 5JWOB 2L4CA 3KIJA 3GV1A 3GKNA 4K2XA 5IOWA 2LS5A 1FVKA 2VD1A 4HS1A 1GTUA 5EL8A 2LJKA 3TJFA 4K7NA 6GSSA 3GURA 3LQ7A 5HR2A 2HFDA 2KUCA 2OE1A 5HFIA 5DCHA 3QPMA 3HYPA 2H19A 3C73A 1SKWB 3HD5A 3GH6A 2YJ7A 1GSSA 2IN3A 3H1NA 1PL1A 3NZNA 3G7JA 4OFNA 5G30A 3P90A 1EEMA 1HNCA 3EU4A 3IR4A 3TGZA 2F8AA 3UBLA 4XS4B 2VL3A 4MJAA 2QA1A 2G2QA 2A2SA 4GRFA 3TRXA 5D93A 4AF2A 2CV4A 2I81A 5IMAA 4KE3A 3C1SA 1QXHA 1FVJA 1EP8A 1Q98A 2X8CA 1V57A 2L6CA 4TR0A 4IN0A 1HNBA 1PQNA 2HLSA 4MABA 4L8EA 3CTGA 3EMPA 2F3MA 3C7MA 2A4HA 4I2TA 1XBSA 3BCKA 2YCDA 1GTIA 2YANA 4OFMA 4X0XA 1V58A 3GN3A 1UA5A 4BL7A 2FA8A 5IO0A 1JZOA 1PKWA 4Q5NA 4HZ2A 2P5RA 2GSTA 2VM1A 1PRXA 4KW6A 5H5SA 2N5FA 3FRCA 3BOAA 1XW5A 2KHPA 5DDLA 1S3DA 2YJHA 3GTUB 3ME8A 4AJ7A 1F2EA 2JL4A 3LXZA 2CX3A 3LYKA 4G19A 2XPEA 4IP1A 2H72A 2IMFA 2C0DA 1EOHA 2VCVA 1FHEA 1XWAA 4NMUA 4O5UA 2VM2A 1K3YA 2B6MA 3DD3A 5ECMB 4ZL8A 5D9XA 4XCSA 1TU8A 2CVKA 3C71A 5JCGA 1T3BA 4BVXA 2HRAA 5J9CA 2VLVA 5ECLB 1GSYA 2BJXA 3KJYA 3M8NA 1RQMA 2EIRA 4MJEA 1A8LA 2K18A 4Z2RA 3TKSE 4RQRA 4YKFA 3WD6A 5CRWA 4ZL9A 3OR5A 4MPFA 2I9HA 1X9SB 6GSXA 3TJGA 3M9KA 2HRNA 4KDXA 4ZL7A 2OBIA 1PX7A 1DBYA 1T1VA 2JADA 3ERFA 2QC7A 2HSYA 3UAPA 3KCMA 1OVNA 2X64A 3D0ZA 5EPFA 1JFUA 3LEFA 4YQMA 2C1YA 3CYNA 2DKIA 1PL2A 3GL5A 1AIUA 5CO3A 3TRQA 3ISOA 2P5QA 4MF6A 3F9UA 5HFKA 2B1LA 5ECSA 2R6KA 2IL3A 5ID2B 4LLRA 4Z2UA 2YPMA 4LL4B 1GRXA 3GL3A 4PURA 2WRTA 3HJMA 3IAM2 2RM6A 1NSWA 2KP2A 3QAWA 1MDKA 1B4QA 1GUMA 2L5OA 4G0LA 2RUFA 4N10A 2ON5A 5INYA 1FG4A 4EE0A 5GAND 2ZCTA 2CVBA 1VF2A 2DKHA 3ZL5A 2E2MA 2IFQA 4PNFA 1O81A 4D73A 2YV7A 4KX4A 7GSSA 4O5QA 1H4OA 3VLNA 2X99A 2VLUA 4O5RA 4ISDA 3APOA 4TKYA 5F07A 4RQXA 3BCIA 5GAPD 3G7IA 4ZB6A 1GSEA 2B1KA 4XIHA 4Z2TA 1J9BA 5ECPB 4G10A 3FZ5A 5D96A 1Y6EA 3MNGA 5H5RA 3DVWA 4TR4A 3R2QA 2H1AA 3LYPA 3PR8A 1BEDA 1O7UA 2DC5A 4KDYA 2FHEA 1X5EA 3CRTA 5DJMA 2GZZA 1LJRA 3TKSC 1A0FA 1YF1A 1GP1A 3L9UA 4XRDA 5HR1A 3SBCA 2TRXA 3HHVA 5IOXA 2GQMA 2Z9SA 4EF0A 5ECQB 1OC9B 1XOBA 4NHWA 2BMXA 2DIZA 3HA9A 3L9SA 3GSTA 1ERWA 3AY8A 4N0ZA 1T00A 2HSMA 3FR3A 2KLXA 1JZWA 4JU5A 1OYJA 2C8UA 1V40A 2WFCA 4MMMA 4WEYA 4BVYA 5HR3A 4EC0A 3ZIVA 4I8BA 4LMWA 1G7OA 1AQVA 1VF1A 2IMEA 3WT2A 3QDNA 4NV5A 1MD3A 5CAXA 1ABAA 4I6XA 4PNGA 3HJPA 2H1GA 3KZQA 1AW9A 5D9WA 5IPHA 2C3NA 5G1LA 4ML6A 1AQXA 3EMXA 2GZYA 1U3IA 1Y25A 2B5XA 1JLWA 4ICYA 2F51A 4IS0A 3HDCA 2PPTA 5CRDA 3FZAA 1XIYA 2YWOA 6GSUA 4HJMA 2PGTA 4WBJA 2R2JA 2IFQB 3VK9A 1FOVA 1PN0A 2DJ0A 4MDCA 2M72A 1SENA 2JACA 5ECKB 3L9VA 4F2IA 4K9ZA 4ZBBA 2A4VA 3MAKA 4JE1A 2L57A 5LCZA 1NM3A 5IIZA 2NTOA 2O85A 5KN1A 3CSJA 2H01A 3TKSA 3UL3A 1OKDA 5CRGA 4G0IA 3E9JB 5COHA 2LRTA 2ZUPA 3EINA 2H1BA 2M80A 1TRSA 3F8UA 5F0GA 3KEBA 3IOSA 4G0KA 1K3LA 3ZIJA 1A2MA 2L5LA 4I2UA 2HE3A 2N5AA 1XW9A 3EE2A 2GS3A 5CRHA 3IHGA 3TKQA 4ID0A 3PH9A 4K5RA 4MPGA 2LV3A 2LJAA 4XRAA 5JWQB 2GT5A 1ERVA 1SD8A 4K6XA 2P0GA 4NWYA 2C0GA 2OE0A 3D4TA 1SU9A 4F82A 1U6TA 1CQHA 2YZUA 4GTUA 4BPYA 1R5AA 3GYKA 3SWLA 4GF0A 3KMOA 3US3A 4K7IA 1SKSB 2A2RA 6GSTA 4LA1A 1A8YA 5FHIA 4PQHA 2RLIA 4HJ2A 1ZGNA 2LJRA 4CY6A 2VO4A 1EEJA 6GSVA 3KTLA 3FK8A 4MCUA 2TRCP 5AIXA 1G0TA 1TRWA 2H6XA 3A2WA 1WPIA 3FY7A 4JRRA 4EKZA 4GQFA 4V2NA 2WZ9A 4EDYA 4ZB8A 2OKAA 1B8XA 1EV9A 1WJKA 4YAVA 1KTEA 3U5RE 4N11A 2A2PA 2QA2A 5IMFA 1R26A 3IC4A 2VL2C 4JR4A 5H5QA 2CZ3A 5G31A 2LNSA 2I3YA 3GA4A 2HYXA 4ECIA 1K0AA 3QMXA 5KEJA 5G2ZA 4L0WA 4KAEA 4WR5A 3DKSA 18GSA 5GZZB 4KCEA 2O87A 2H1DA 3N5OA 1WWJA 1TI3A 5J4UA 3HVXA 2FGXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OA7 A;  5CNW A;  3P7X A;  1XXU A;  3KD0 A;  1E2Y A;  1Z9H A;  1S3C A;  5J3R A;  3DYR A;  3GNJ A;  2FA4 A;  4LMV A;  2H76 A;  1U88 A;  2WB9 A;  3FKF A;  4IQ1 A;  2DBC A;  2E7P A;  1V98 A;  5ELG A;  2QSI A;  4GWR A;  1XFL A;  1WMJ A;  5EVO A;  1ZL9 A;  4FYC A;  2GQL A;  1B48 A;  4HU9 A;  2PER A;  3I6A A;  3PGT A;  2H0I A;  1Q4J A;  2AUV A;  1TW9 A;  4JZQ A;  3TJK A;  2HZE A;  5IO2 A;  3RHC A;  1F9M A;  3IRA A;  5A5K A;  19GS A;  4PX1 A;  1X9M B;  3ZZX A;  1X9W B;  3FR9 A;  2MMA A;  5B6N A;  2JSZ A;  2CX4 A;  3U6V A;  2L4Q A;  5DAK B;  5CYY A;  3J7Y k;  2WUL A;  4FYB A;  2OAC A;  2OJL A;  3LWA A;  4L5L A;  1TJD A;  2KOK A;  3ZVJ A;  4FH8 A;  4TR1 B;  2LKU A;  3HY2 A;  4IGJ A;  4ZIJ A;  1GUL A;  1T4Y A;  5J9B A;  1SK1 A;  2LRC A;  2HI7 A;  5AIV A;  2CZ2 A;  2IIY A;  1VF4 A;  1YJ6 A;  3P2A A;  4WR4 A;  1XCC A;  4L0U A;  2JZR A;  3PIN A;  1Z5Y E;  3WGX A;  2OE3 A;  3EU3 A;  2HT9 A;  2V32 A;  3IV4 A;  4N30 A;  4WET A;  1E6B A;  4KGI A;  4POM A;  3F6D A;  2YZH A;  2DSA A;  2GSQ A;  1M99 A;  1U3A A;  4WBR D;  3E0U A;  3ERG A;  4EVM A;  2H6Z A;  3NOF A;  2HNL A;  4MLY A;  4J2F A;  2QGV A;  1WIK A;  2VCW A;  1TDI A;  1SL0 B;  1I5G A;  1Z7P A;  4IP6 A;  4QQ7 A;  3ZLP A;  4PUA A;  1FAA A;  4E8E A;  1CQG A;  4PQI A;  2VCZ A;  4IHU A;  1Z3E A;  4FIW A;  4CHS A;  3RDW A;  3UIW A;  3FW2 A;  4AJ6 A;  3KP9 A;  5LNK e;  2YWN A;  4WKW A;  1GL8 A;  4V2L A;  1Z6N A;  1TK5 B;  5CRE A;  1HYU A;  5D8I A;  1K0C A;  3A2V A;  2GQK A;  2FNO A;  2OAD A;  3A3T A;  3ZFB A;  3M3M A;  2B5Y A;  3ME7 A;  2TIR A;  4J56 E;  1AXD A;  1IYH A;  5C00 A;  4Q5Q A;  2H0H A;  2C0F A;  4MZW A;  5HR0 A;  2YV9 A;  2LQQ A;  5GSS A;  5DCG A;  4J57 E;  3J7Y b;  2BTO T;  4DSS A;  2IPA A;  3ERW A;  1XOA A;  1XPV A;  4HUA A;  5A4W A;  4O92 A;  2B5E A;  2FWH A;  3RAZ A;  2VCX A;  3P8W A;  4XS1 A;  2C0E A;  4FO5 A;  1UVZ A;  1GSQ A;  2R5G A;  4MJB A;  2DJ2 A;  2CVD A;  3RPN A;  2D2Z A;  2LQO A;  4RI7 A;  1K0M A;  3LSZ A;  1KNG A;  5D9V A;  4CDO A;  2E0Q A;  1DE2 A;  5DBQ A;  4YQU A;  1J0F A;  1U87 A;  3G7Y A;  12GS A;  1K3O A;  1TTZ A;  2PMT A;  4TN8 A;  1XWB A;  1F37 A;  3MDK A;  5ECR B;  3W8J A;  1SKR B;  2VOC A;  3RPP A;  1R7H A;  4CW9 A;  4MJC A;  2JSY A;  2HXK A;  2PUK C;  3F6F A;  1TU7 A;  4I5Q A;  3LG6 A;  5JCW A;  3Q19 A;  4KH7 A;  3VPT A;  1YDK A;  10GS A;  3Q6O A;  17GS A;  4IBP A;  4I97 A;  11GS A;  2L6D A;  3HVV A;  4NAX A;  2XHF A;  5LD0 A;  1M9A A;  2H73 A;  2H66 A;  2FLS A;  5ABR A;  1GSF A;  2ALB A;  4X43 A;  3CBU A;  1ZYQ B;  2DML A;  4MH3 A;  3UJ1 A;  2AJQ B;  1JHB A;  3BD2 A;  5B6M A;  1FW1 A;  3HJO A;  2DJ1 A;  1GLQ A;  4LL1 B;  1WE0 A;  2LRN A;  3TB2 A;  3CRU A;  2IMI A;  2GVP A;  2FD3 A;  2K6V A;  14GS A;  3O3T A;  1JZR A;  4PUF C;  1AC1 A;  5IMD A;  1A23 A;  3EWL A;  3M0F A;  4EDZ A;  2K8V A;  2F8F A;  1BX9 A;  1M0U A;  2MMO A;  4N0V A;  4OWY A;  2PN8 A;  1FO5 A;  3JCM L;  2V1M A;  2FUG 2;  4E8H A;  3KM6 A;  5B8A A;  4TXO A;  3APS A;  1QUW A;  4K7O A;  4QL9 A;  4TRX A;  3UMA A;  4WF5 A;  5F05 A;  3HZ4 A;  1ZZY A;  3DXB A;  2MBT A;  4HEA 2;  4F9Z A;  1N8J A;  5B8B A;  4D73 B;  3D5J A;  2XPD A;  2B7J A;  5DAL A;  1SJZ A;  1XWC A;  2WDU A;  4ZXG A;  3TOT A;  2H75 A;  3QD9 A;  5DQY A;  4OD7 A;  1PMT A;  4Q5R A;  3GUS A;  4K1F A;  3ZTL A;  4ZB9 A;  5L71 A;  5D73 A;  3WT1 A;  2NVL A;  1YQ1 A;  4TVE A;  2EIQ A;  2IMK A;  3VI5 A;  4AGS A;  1OC3 A;  4KUN A;  4MZB A;  4BA7 A;  1N2A A;  1BYE A;  1O73 A;  1RK4 A;  1MTC A;  2DJK A;  3EUR A;  2FWG A;  2P31 A;  3A5W A;  1XZO A;  3S9F A;  3KH9 A;  1B9Y C;  3VUR A;  3TJB A;  1VRS D;  3C1R A;  5F8B A;  3GX8 A;  4MF5 A;  1MDJ A;  1XWG A;  2H71 A;  4XS4 A;  2AYT A;  1S3A A;  2O8V B;  4OCE A;  2IMD A;  1X0R A;  1NW2 A;  4HZ4 A;  1YEX A;  2JZT A;  9GSS A;  3DML A;  4V1A p;  3W8S A;  5C04 A;  2VLT A;  4PQ1 A;  5GST A;  3DVX A;  2H6Y A;  3ED3 A;  2FWE A;  4POL A;  2K8S A;  1M2A A;  1USB A;  5J41 A;  4F0C A;  1ZYE A;  4IJI A;  3LXT A;  3QAG A;  4O7H A;  2N5B A;  20GS A;  4Q5F A;  1SL2 B;  2XBI A;  2LEG A;  4F0B A;  1PSQ A;  4OMV A;  1F3A A;  1QGV A;  4FYU A;  1X5D A;  3IDV A;  1LU4 A;  1GUH A;  3GKM A;  4ECJ A;  1TOF A;  3F63 A;  4NXI A;  4H86 A;  2FY6 A;  4HQZ A;  3L0H A;  2V6O A;  2O7K A;  3DWV A;  1SYX A;  1M2B A;  1AQW A;  3GTU A;  2VUP A;  2H8L A;  1M9B A;  1X5C A;  1B4P A;  4ML1 A;  2AAW A;  3VWX A;  1WOU A;  1K0D A;  3CTF A;  4PXO A;  5FT3 A;  5IM9 A;  5E4W A;  3M9J A;  5IMV A;  4KCA A;  2YWI A;  4F03 A;  3H4K A;  2VL9 A;  1OE7 A;  3GKX A;  2H30 A;  1EP7 A;  2GSS A;  4P3Y B;  1R4W A;  2V2G A;  4MA9 A;  1TI1 A;  6GSW A;  5ECI B;  5B7C A;  1EGO A;  2YNX A;  4MP4 A;  3WYW A;  3I69 A;  4WXT A;  3GKK A;  3VWW A;  1VF3 A;  3NIV A;  2LST A;  2DLX A;  4O32 A;  4YH2 A;  2JZS A;  1A24 A;  5G5E A;  5DJL A;  4NHZ A;  3IK9 A;  3ZML A;  1GWC A;  1MD4 A;  1XVQ A;  3TUE A;  1QFN A;  1RW1 A;  1W89 A;  4HDE A;  4MF7 A;  2IWT A;  3VPQ A;  2DJJ A;  2NPB A;  4BWS A;  1NHO A;  1O85 A;  3TOU A;  1O6J A;  3F4S A;  1SYR A;  3ZRD A;  2GT6 A;  1ZOF A;  3IXR A;  4ULX A;  4EXJ A;  4TOP A;  1QK8 A;  2VL2 A;  1V2A A;  3DRN A;  3F4R A;  5DQS A;  4OO4 A;  3C8E A;  5DVB A;  1PKZ A;  1AAZ A;  2J9H A;  1GTB A;  1V9W A;  5HQP A;  2LTK A;  1GSU A;  1FB6 A;  5JCU A;  2C3Q A;  5A4U A;  2YWM A;  3FYG A;  5ID2 A;  1QMV A;  1PA3 A;  1GLP A;  1LBK A;  4K8M A;  2CA8 A;  2MZC A;  1OC8 A;  2VIM A;  5IMC A;  8GSS A;  1ON4 A;  4DEJ A;  1EOG A;  1EGR A;  3GH9 A;  2H74 A;  2REM A;  4HU7 A;  3VFI A;  3ZFL A;  1TRU A;  1HNA A;  2C80 A;  5AN1 A;  3GHA A;  1DE1 A;  2NDO A;  3CXG A;  3HKR A;  2MYG A;  3TRP A;  1G6Y A;  1G7E A;  1ST9 A;  4KB3 A;  1AUC A;  3LJR A;  3UBK A;  3WGD A;  1XVW A;  4V2M A;  3IBH A;  4GXZ A;  1W4V A;  4HOJ A;  3DGQ A;  3EC3 A;  4XTS A;  5ECO B;  1UN2 A;  4KND A;  1J08 A;  2EC4 A;  2I1U A;  3L78 A;  1H75 A;  1XW6 A;  2O89 A;  1YKA A;  3M1G A;  4ILF A;  2J23 A;  1ACV A;  3FR6 A;  4TXV A;  4HQS A;  1YKC A;  1GTA A;  3VWU A;  6GSY A;  4KSM A;  2RUE A;  3KXO A;  2RII A;  22GS A;  1SK2 A;  2XBQ A;  3TKR A;  2HZE B;  2OBK A;  3IK7 A;  2L59 A;  3O76 A;  1JLV A;  3IAS 2;  1R5P A;  2CT6 A;  1THX A;  3VWV A;  4GQC A;  1BAY A;  4KSO A;  2PVO C;  2HZF A;  3I43 A;  4IKH A;  4GST A;  2VCT A;  1IYI A;  5FWG A;  1OC9 A;  2R37 A;  4EO3 A;  4BWQ A;  3QCP A;  2WCI A;  3O6T A;  1TKD B;  3CMI A;  4IEL A;  1KEB A;  3ZVJ D;  2R3X A;  4HI7 A;  3KP8 A;  3GMF A;  2AB6 A;  2LNT A;  4G2E A;  1T8E B;  3UVT A;  5G1K A;  3RHB A;  1OAZ A;  4JBB A;  3CSI A;  2CAQ A;  2G0F A;  2C4J A;  3V1W A;  1TP9 A;  3TJJ A;  4MK3 A;  13GS A;  3APQ A;  1YF0 A;  3UEM A;  2E2G A;  4DVC A;  3N9J A;  5CP1 A;  3GX0 A;  1TK0 B;  2V6K A;  2ON7 A;  1GNW A;  4K0G A;  5ECH B;  3Q18 A;  5HFG A;  2HRF A;  1ERT A;  1UC7 A;  3F3R A;  2CQ9 A;  1I9D A;  3W6G A;  1EZK A;  5G5F A;  1A2J A;  2DJ3 A;  2GSR A;  3WGE A;  2YOI A;  2WGR A;  1F3B A;  1BG5 A;  1ERU A;  1PX6 A;  1SL1 B;  2YP6 A;  4IJ3 A;  4YAP A;  3HZ8 A;  5E59 A;  4POK A;  1K0O A;  3BBY A;  2MBS A;  1O8W A;  1C72 A;  1DUG A;  4MH2 A;  2H70 A;  1YEP A;  2EIO A;  2GLR A;  2I4A A;  4K2D A;  4OO5 A;  1TK8 B;  3FHK A;  3QOU A;  4ECC A;  3G9B A;  4OCF A;  4IQA A;  3I9V 2;  3F0I A;  3TDG A;  5ENU A;  1M2D A;  2JU5 A;  4EUY A;  3BJ5 A;  3GRX A;  3F4T A;  1ILO A;  2ES7 A;  4YQV A;  4JR6 A;  1PGT A;  1K0N A;  2NBS A;  2M46 A;  1GUK A;  2MMZ A;  1M7T A;  2AV4 A;  2QKE A;  1WP0 A;  2AHE A;  1SJ6 A;  5IMZ A;  4IW9 A;  4GSN A;  4DSS B;  4K0N A;  4IVF A;  1MEK A;  3FZ9 A;  3A2X A;  2XC2 A;  3LGC A;  3IA1 A;  4AJ8 A;  3IHQ A;  3H8Q A;  4X1U A;  1EV4 A;  2PBJ A;  1YY7 A;  3GSS A;  3KTB A;  3UAR A;  4ACS A;  2FCH A;  1BJX A;  3KH7 A;  2C3T A;  4OFT A;  3MWH A;  5JWR B;  3KGK A;  1Z7R A;  5AGY A;  4ZBD A;  2GGT A;  1BQ7 A;  2MMN A;  2X8G A;  1NHY A;  5KN0 A;  1VGL A;  4G9H A;  1EWX A;  4GLT A;  4RUV A;  4ECB A;  2B7K A;  3HVS A;  1FB0 A;  3LOR A;  1F6M C;  1K0B A;  4NPB A;  4ZBA A;  3ZYW A;  1B9X C;  4ZIL A;  4V1A g;  4DSR A;  2PU9 C;  2PWJ A;  2K9F A;  3FZ4 A;  2DMM A;  5ELA A;  3QFB C;  1G6W A;  1A2L A;  1HQO A;  1PD2 1;  4NV2 A;  16GS A;  3DIE A;  5F06 A;  5A4V A;  1QQ2 A;  2YN1 A;  2VD0 A;  3EYT A;  2GDR A;  1DSB A;  3UVH A;  3H79 A;  1MDI A;  3IPZ A;  2KP1 A;  1JZD A;  3VI7 A;  1THO A;  5KN3 A;  4WF4 A;  4KA0 A;  1T4Z A;  4EL1 A;  3E3E A;  4KDU A;  3CSH A;  1HD2 A;  4DSQ A;  3HCZ A;  2B3S A;  3D4M A;  1SD9 A;  5EY6 A;  1OKT A;  1SK0 A;  1YZX A;  5ECN B;  3HXS A;  3D6I A;  4TR3 A;  5IPG A;  5KN2 A;  4RI6 A;  1URM A;  1TXX A;  3KMN A;  4PGT A;  2RM5 A;  5D9T A;  3QFA C;  3UOM A;  1GSD A;  2PVQ A;  1PN9 A;  3D21 A;  1ML6 A;  1XWK A;  3Q74 A;  2DIY A;  3L4N A;  3ZRE A;  1KBN A;  3DEX A;  1A0R P;  4XS6 A;  2WJU A;  2IJY A;  1ZCP A;  4XHM A;  3H93 A;  3TKP A;  4JED A;  2X8H A;  3LFL A;  3GIX A;  3F3Q A;  4GSS A;  3IE3 A;  2FWF A;  5DAK A;  3ZIT A;  4TXO B;  4POB A;  2F9S A;  4QL7 A;  2V41 A;  1ZMA A;  3QR6 A;  3RBT A;  2LUS A;  5AIS A;  4L5O A;  2CAI A;  3EVI A;  4TR1 A;  2R4V A;  1GNE A;  1TRV A;  3ZMK A;  2HSH A;  3GFK A;  2GZP A;  1O8X A;  3K8N A;  3MSZ A;  2ZNM A;  3FEU A;  2GTU A;  1SJI A;  3QAV A;  5J5N A;  1OE8 A;  2WS2 A;  5DAL B;  4MZC A;  5IQY A;  4Z7X A;  1WRY A;  1Z6M A;  3D22 A;  4GCI A;  4TW5 A;  1T7P B;  2VAF A;  1GH2 A;  2VCQ A;  3TCO A;  2H0G A;  5JWO B;  2L4C A;  3KIJ A;  3GV1 A;  3GKN A;  5IOW A;  2LS5 A;  1FVK A;  2VD1 A;  4HS1 A;  1GTU A;  5EL8 A;  2LJK A;  3TJF A;  4K7N A;  6GSS A;  3GUR A;  3LQ7 A;  5HR2 A;  2HFD A;  2KUC A;  2OE1 A;  5HFI A;  5DCH A;  3QPM A;  3HYP A;  2H19 A;  3C73 A;  1SKW B;  3HD5 A;  3GH6 A;  2YJ7 A;  1GSS A;  2IN3 A;  3H1N A;  1PL1 A;  3NZN A;  3G7J A;  4OFN A;  5G30 A;  3P90 A;  1EEM A;  1HNC A;  3EU4 A;  3IR4 A;  3TGZ A;  2F8A A;  3UBL A;  4XS4 B;  2VL3 A;  4MJA A;  2G2Q A;  2A2S A;  4GRF A;  3TRX A;  5D93 A;  4AF2 A;  2CV4 A;  2I81 A;  5IMA A;  4KE3 A;  3C1S A;  1QXH A;  1FVJ A;  1EP8 A;  1Q98 A;  2X8C A;  1V57 A;  2L6C A;  4TR0 A;  4IN0 A;  1HNB A;  1PQN A;  2HLS A;  4MAB A;  4L8E A;  3CTG A;  3EMP A;  2F3M A;  3C7M A;  4I2T A;  1XBS A;  3BCK A;  2YCD A;  1GTI A;  2YAN A;  4OFM A;  4X0X A;  1V58 A;  3GN3 A;  1UA5 A;  4BL7 A;  2FA8 A;  5IO0 A;  1JZO A;  1PKW A;  4Q5N A;  4HZ2 A;  2P5R A;  2GST A;  2VM1 A;  1PRX A;  4KW6 A;  5H5S A;  2N5F A;  3FRC A;  3BOA A;  1XW5 A;  2KHP A;  5DDL A;  1S3D A;  2YJH A;  3GTU B;  3ME8 A;  4AJ7 A;  1F2E A;  2JL4 A;  3LXZ A;  2CX3 A;  3LYK A;  4G19 A;  2XPE A;  4IP1 A;  2H72 A;  2IMF A;  2C0D A;  1EOH A;  2VCV A;  1FHE A;  1XWA A;  4NMU A;  2VM2 A;  1K3Y A;  2B6M A;  3DD3 A;  5ECM B;  4ZL8 A;  5D9X A;  4XCS A;  1TU8 A;  2CVK A;  3C71 A;  5JCG A;  1T3B A;  4BVX A;  5J9C A;  2VLV A;  5ECL B;  1GSY A;  2BJX A;  3KJY A;  3M8N A;  1RQM A;  2EIR A;  4MJE A;  1A8L A;  2K18 A;  3TKS E;  4RQR A;  3WD6 A;  5CRW A;  4ZL9 A;  3OR5 A;  4MPF A;  2I9H A;  1X9S B;  6GSX A;  3TJG A;  3M9K A;  2HRN A;  4KDX A;  4ZL7 A;  2OBI A;  1PX7 A;  1DBY A;  1T1V A;  2JAD A;  3ERF A;  2QC7 A;  2HSY A;  3UAP A;  3KCM A;  1OVN A;  2X64 A;  3D0Z A;  5EPF A;  1JFU A;  3LEF A;  4YQM A;  2C1Y A;  3CYN A;  1PL2 A;  3GL5 A;  1AIU A;  5CO3 A;  3TRQ A;  3ISO A;  2P5Q A;  4MF6 A;  3F9U A;  5HFK A;  2B1L A;  5ECS A;  2R6K A;  2IL3 A;  5ID2 B;  4LLR A;  2YPM A;  4LL4 B;  1GRX A;  3GL3 A;  4PUR A;  2WRT A;  3HJM A;  3IAM 2;  2RM6 A;  1NSW A;  2KP2 A;  3QAW A;  1MDK A;  1B4Q A;  1GUM A;  2L5O A;  2RUF A;  4N10 A;  2ON5 A;  5INY A;  1FG4 A;  4EE0 A;  5GAN D;  2ZCT A;  2CVB A;  1VF2 A;  3ZL5 A;  2E2M A;  2IFQ A;  4PNF A;  1O81 A;  4D73 A;  2YV7 A;  4KX4 A;  7GSS A;  1H4O A;  3VLN A;  2X99 A;  2VLU A;  4O5R A;  4ISD A;  3APO A;  4TKY A;  5F07 A;  4RQX A;  3BCI A;  5GAP D;  3G7I A;  4ZB6 A;  1GSE A;  2B1K A;  4XIH A;  1J9B A;  5ECP B;  4G10 A;  3FZ5 A;  5D96 A;  1Y6E A;  3MNG A;  5H5R A;  3DVW A;  4TR4 A;  3R2Q A;  2H1A A;  3LYP A;  3PR8 A;  1BED A;  1O7U A;  2DC5 A;  4KDY A;  2FHE A;  1X5E A;  3CRT A;  5DJM A;  2GZZ A;  1LJR A;  3TKS C;  1A0F A;  1YF1 A;  1GP1 A;  3L9U A;  4XRD A;  5HR1 A;  3SBC A;  2TRX A;  3HHV A;  5IOX A;  2GQM A;  2Z9S A;  4EF0 A;  5ECQ B;  1OC9 B;  1XOB A;  4NHW A;  2BMX A;  2DIZ A;  3HA9 A;  3L9S A;  3GST A;  1ERW A;  3AY8 A;  4N0Z A;  1T00 A;  3FR3 A;  2KLX A;  1JZW A;  4JU5 A;  1OYJ A;  2C8U A;  1V40 A;  2WFC A;  4MMM A;  4WEY A;  4BVY A;  5HR3 A;  4EC0 A;  3ZIV A;  4I8B A;  4LMW A;  1G7O A;  1AQV A;  1VF1 A;  2IME A;  3WT2 A;  3QDN A;  4NV5 A;  1MD3 A;  5CAX A;  1ABA A;  4I6X A;  4PNG A;  3HJP A;  2H1G A;  3KZQ A;  1AW9 A;  5D9W A;  5IPH A;  2C3N A;  5G1L A;  4ML6 A;  1AQX A;  3EMX A;  2GZY A;  1U3I A;  1Y25 A;  2B5X A;  1JLW A;  2F51 A;  4IS0 A;  3HDC A;  2PPT A;  5CRD A;  3FZA A;  1XIY A;  2YWO A;  6GSU A;  4HJM A;  2PGT A;  4WBJ A;  2R2J A;  2IFQ B;  3VK9 A;  1FOV A;  2DJ0 A;  4MDC A;  2M72 A;  1SEN A;  2JAC A;  5ECK B;  3L9V A;  4F2I A;  4K9Z A;  4ZBB A;  2A4V A;  3MAK A;  4JE1 A;  2L57 A;  5LCZ A;  1NM3 A;  5IIZ A;  2NTO A;  2O85 A;  5KN1 A;  3CSJ A;  2H01 A;  3TKS A;  3UL3 A;  1OKD A;  5CRG A;  3E9J B;  5COH A;  2LRT A;  2ZUP A;  3EIN A;  2H1B A;  2M80 A;  1TRS A;  3F8U A;  5F0G A;  3KEB A;  3IOS A;  1K3L A;  3ZIJ A;  1A2M A;  2L5L A;  4I2U A;  2HE3 A;  2N5A A;  1XW9 A;  3EE2 A;  2GS3 A;  5CRH A;  3TKQ A;  4ID0 A;  3PH9 A;  4MPG A;  2LV3 A;  2LJA A;  4XRA A;  5JWQ B;  2GT5 A;  1ERV A;  1SD8 A;  4K6X A;  2P0G A;  4NWY A;  2C0G A;  2OE0 A;  3D4T A;  1SU9 A;  4F82 A;  1U6T A;  1CQH A;  2YZU A;  4GTU A;  4BPY A;  1R5A A;  3GYK A;  3SWL A;  4GF0 A;  3KMO A;  3US3 A;  4K7I A;  1SKS B;  2A2R A;  6GST A;  4LA1 A;  1A8Y A;  5FHI A;  4PQH A;  2RLI A;  4HJ2 A;  1ZGN A;  2LJR A;  2VO4 A;  1EEJ A;  6GSV A;  3KTL A;  3FK8 A;  4MCU A;  2TRC P;  5AIX A;  1G0T A;  1TRW A;  2H6X A;  3A2W A;  1WPI A;  3FY7 A;  4JRR A;  4EKZ A;  4GQF A;  4V2N A;  2WZ9 A;  4EDY A;  4ZB8 A;  2OKA A;  1B8X A;  1EV9 A;  1WJK A;  4YAV A;  1KTE A;  3U5R E;  4N11 A;  5IMF A;  1R26 A;  3IC4 A;  2VL2 C;  4JR4 A;  5H5Q A;  2CZ3 A;  5G31 A;  2LNS A;  2I3Y A;  3GA4 A;  2HYX A;  4ECI A;  1K0A A;  3QMX A;  5KEJ A;  5G2Z A;  4L0W A;  4KAE A;  4WR5 A;  3DKS A;  18GS A;  5GZZ B;  4KCE A;  2O87 A;  2H1D A;  3N5O A;  1WWJ A;  1TI3 A;  5J4U A;  3HVX A;  2FGX A; 
#chains in the Genus database with same CATH topology
 2OA7 A;  5CNW A;  3P7X A;  1XXU A;  3KD0 A;  1E2Y A;  1Z9H A;  1S3C A;  5J3R A;  3DYR A;  3GNJ A;  2FA4 A;  3MYD A;  4LMV A;  2H76 A;  1U88 A;  2WB9 A;  3FKF A;  4IQ1 A;  2DBC A;  2E7P A;  1V98 A;  5ELG A;  2QSI A;  4GWR A;  1M3I A;  1XFL A;  1WMJ A;  5EVO A;  1ZL9 A;  4FYC A;  2GQL A;  1B48 A;  4HU9 A;  2PER A;  3I6A A;  3PGT A;  2H0I A;  1Q4J A;  2AUV A;  1TW9 A;  4JZQ A;  3TJK A;  2HZE A;  5IO2 A;  3RHC A;  1F9M A;  3IRA A;  5A5K A;  19GS A;  4PX1 A;  1X9M B;  3ZZX A;  1X9W B;  3FR9 A;  2MMA A;  5B6N A;  2JSZ A;  2CX4 A;  3U6V A;  2L4Q A;  5DAK B;  2HRK A;  5CYY A;  3J7Y k;  2WUL A;  4FYB A;  2OAC A;  2OJL A;  3LWA A;  4L5L A;  1TJD A;  2KOK A;  3ZVJ A;  4FH8 A;  4TR1 B;  2LKU A;  3HY2 A;  4IGJ A;  4ZIJ A;  1GUL A;  1T4Y A;  5J9B A;  1SK1 A;  2LRC A;  3HVN A;  2HI7 A;  5AIV A;  2CZ2 A;  2IIY A;  1VF4 A;  1YJ6 A;  3P2A A;  4WR4 A;  1XCC A;  4L0U A;  2JZR A;  3PIN A;  1Z5Y E;  3WGX A;  2OE3 A;  3EU3 A;  2HT9 A;  2V32 A;  3IV4 A;  4N30 A;  4WET A;  1E6B A;  4KGI A;  4POM A;  3F6D A;  2YZH A;  2DSA A;  2GSQ A;  1M99 A;  1U3A A;  4WBR D;  3E0U A;  2X4A A;  3ERG A;  4EVM A;  2H6Z A;  3NOF A;  2HNL A;  4EIQ A;  4MLY A;  4J2F A;  2QGV A;  1WIK A;  2VCW A;  1TDI A;  1SL0 B;  1I5G A;  1Z7P A;  4IP6 A;  4QQ7 A;  3ZLP A;  4PUA A;  1FAA A;  4E8E A;  1CQG A;  4PQI A;  2VCZ A;  4IHU A;  1Z3E A;  4FIW A;  4CHS A;  3RDW A;  3UIW A;  3FW2 A;  4AJ6 A;  3KP9 A;  5LNK e;  2YWN A;  4WKW A;  1GL8 A;  4V2L A;  1Z6N A;  1TK5 B;  5CRE A;  1HYU A;  5D8I A;  1K0C A;  3A2V A;  2GQK A;  2FNO A;  2OAD A;  3A3T A;  3ZFB A;  3M3M A;  2B5Y A;  3ME7 A;  2TIR A;  4USS A;  4J56 E;  1AXD A;  1IYH A;  5C00 A;  4Q5Q A;  2H0H A;  2C0F A;  4MZW A;  5HR0 A;  2YV9 A;  2LQQ A;  5GSS A;  1ZYP A;  5DCG A;  4J57 E;  4BL7 B;  3J7Y b;  2BTO T;  4DSS A;  2IPA A;  3ERW A;  1XOA A;  1XPV A;  4HUA A;  5A4W A;  4O92 A;  2B5E A;  2FWH A;  3RAZ A;  2VCX A;  3P8W A;  4XS1 A;  2C0E A;  4FO5 A;  1UVZ A;  1GSQ A;  2R5G A;  4MJB A;  2DJ2 A;  2CVD A;  3RPN A;  2D2Z A;  2LQO A;  4RI7 A;  1K0M A;  3LSZ A;  1KNG A;  5D9V A;  4CDO A;  2E0Q A;  1DE2 A;  5DBQ A;  4YQU A;  3R3E A;  1J0F A;  1U87 A;  3G7Y A;  12GS A;  1K3O A;  1TTZ A;  2PMT A;  4TN8 A;  1XWB A;  1F37 A;  3MDK A;  5ECR B;  3W8J A;  1SKR B;  2VOC A;  3RPP A;  1R7H A;  4X4J A;  4CW9 A;  4MJC A;  2JSY A;  2HXK A;  2PUK C;  3F6F A;  1TU7 A;  4I5Q A;  3LG6 A;  5JCW A;  3Q19 A;  4KH7 A;  3VPT A;  4BVX B;  1YDK A;  10GS A;  3Q6O A;  17GS A;  4IBP A;  4I97 A;  11GS A;  2L6D A;  3HVV A;  4NAX A;  2XHF A;  5LD0 A;  1M9A A;  2H73 A;  2H66 A;  2FLS A;  1M3J A;  5ABR A;  1GSF A;  2ALB A;  4X43 A;  3CBU A;  1ZYQ B;  2DML A;  4MH3 A;  3UJ1 A;  2AJQ B;  1JHB A;  3BD2 A;  5B6M A;  1FW1 A;  3HJO A;  2DJ1 A;  1GLQ A;  4LL1 B;  1WE0 A;  2LRN A;  3TB2 A;  3CRU A;  2IMI A;  2GVP A;  2FD3 A;  2K6V A;  1XG8 A;  14GS A;  3O3T A;  1JZR A;  4PUF C;  1AC1 A;  5IMD A;  1A23 A;  3EWL A;  3IC8 A;  3M0F A;  4EDZ A;  2K8V A;  2F8F A;  1BX9 A;  1M0U A;  2MMO A;  4N0V A;  4OWY A;  2PN8 A;  1FO5 A;  3JCM L;  2V1M A;  2FUG 2;  4E8H A;  3KM6 A;  5B8A A;  4TXO A;  3APS A;  1QUW A;  4K7O A;  4QL9 A;  4TRX A;  3UMA A;  4WF5 A;  5F05 A;  3HZ4 A;  1ZZY A;  3DXB A;  2MBT A;  4HEA 2;  4F9Z A;  1N8J A;  5B8B A;  4D73 B;  3D5J A;  2XPD A;  2B7J A;  5DAL A;  1SJZ A;  1XWC A;  2WDU A;  4ZXG A;  3TOT A;  2H75 A;  3QD9 A;  5DQY A;  4OD7 A;  1PMT A;  4Q5R A;  3GUS A;  4K1F A;  3ZTL A;  4ZB9 A;  4KF9 A;  5L71 A;  5D73 A;  3WT1 A;  2NVL A;  1YQ1 A;  4TVE A;  2EIQ A;  2IMK A;  3VI5 A;  4AGS A;  1OC3 A;  4KUN A;  4MZB A;  4BA7 A;  1N2A A;  1BYE A;  1O73 A;  1RK4 A;  1MTC A;  2DJK A;  3EUR A;  2FWG A;  2P31 A;  3A5W A;  1XZO A;  3S9F A;  3KH9 A;  1B9Y C;  3VUR A;  3TJB A;  1VRS D;  3C1R A;  5F8B A;  3GX8 A;  4MF5 A;  1MDJ A;  1XWG A;  2H71 A;  4XS4 A;  2AYT A;  1S3A A;  2O8V B;  4OCE A;  2IMD A;  1X0R A;  1NW2 A;  4HZ4 A;  1YEX A;  2JZT A;  9GSS A;  3DML A;  4MNN A;  4V1A p;  3W8S A;  5C04 A;  4BVY B;  2VLT A;  4PQ1 A;  5GST A;  3DVX A;  2H6Y A;  3ED3 A;  2FWE A;  4POL A;  2K8S A;  1M2A A;  1USB A;  5J41 A;  4F0C A;  1ZYE A;  4IJI A;  3LXT A;  3QAG A;  4O7H A;  2N5B A;  20GS A;  4Q5F A;  1SL2 B;  2XBI A;  2LEG A;  4F0B A;  1PSQ A;  4OMV A;  1F3A A;  1QGV A;  4FYU A;  1X5D A;  3IDV A;  1LU4 A;  1GUH A;  3GKM A;  4ECJ A;  1TOF A;  3F63 A;  4NXI A;  4H86 A;  2FY6 A;  4HQZ A;  3L0H A;  2V6O A;  2O7K A;  3DWV A;  1SYX A;  1M2B A;  1AQW A;  3GTU A;  2VUP A;  2H8L A;  1M9B A;  1X5C A;  1B4P A;  4ML1 A;  2AAW A;  3VWX A;  1WOU A;  1K0D A;  3CTF A;  4PXO A;  5FT3 A;  5IM9 A;  5E4W A;  3M9J A;  5IMV A;  4KCA A;  2YWI A;  4F03 A;  3H4K A;  2VL9 A;  1ZYN A;  1OE7 A;  3GKX A;  2H30 A;  1EP7 A;  2GSS A;  4P3Y B;  1R4W A;  2V2G A;  4MA9 A;  1TI1 A;  6GSW A;  5ECI B;  5B7C A;  1EGO A;  2YNX A;  4MP4 A;  3WYW A;  3I69 A;  4WXT A;  3GKK A;  3VWW A;  1VF3 A;  3NIV A;  2LST A;  2DLX A;  4O32 A;  4YH2 A;  2JZS A;  1A24 A;  5G5E A;  5DJL A;  4NHZ A;  3IK9 A;  3ZML A;  1GWC A;  1MD4 A;  1XVQ A;  3TUE A;  1QFN A;  1RW1 A;  1W89 A;  4HDE A;  4MF7 A;  2IWT A;  3VPQ A;  2DJJ A;  2NPB A;  4BWS A;  1NHO A;  1O85 A;  3TOU A;  1O6J A;  3F4S A;  1SYR A;  3ZRD A;  2GT6 A;  1ZOF A;  3IXR A;  4ULX A;  4EXJ A;  4TOP A;  1QK8 A;  2VL2 A;  1V2A A;  3DRN A;  3F4R A;  5DQS A;  4OO4 A;  3C8E A;  5DVB A;  1PKZ A;  1AAZ A;  2J9H A;  1GTB A;  1V9W A;  5HQP A;  2LTK A;  1GSU A;  1FB6 A;  5JCU A;  2C3Q A;  5A4U A;  2YWM A;  3FYG A;  5ID2 A;  1QMV A;  1PA3 A;  1GLP A;  1LBK A;  4K8M A;  2CA8 A;  2MZC A;  1OC8 A;  2VIM A;  5IMC A;  8GSS A;  1ON4 A;  4DEJ A;  1EOG A;  1EGR A;  3GH9 A;  2R0P A;  2H74 A;  2REM A;  4HU7 A;  3VFI A;  3ZFL A;  1TRU A;  1HNA A;  2C80 A;  5AN1 A;  3GHA A;  1DE1 A;  2NDO A;  3CXG A;  3HKR A;  2MYG A;  3TRP A;  1G6Y A;  1G7E A;  1ST9 A;  4KB3 A;  1AUC A;  3LJR A;  3UBK A;  3WGD A;  1XVW A;  4V2M A;  3IBH A;  4GXZ A;  1W4V A;  4HOJ A;  3DGQ A;  3EC3 A;  4XTS A;  5ECO B;  1UN2 A;  4KND A;  1J08 A;  2EC4 A;  2I1U A;  3L78 A;  1H75 A;  1XW6 A;  2O89 A;  1YKA A;  3M1G A;  4ILF A;  2J23 A;  1ACV A;  3FR6 A;  4TXV A;  4HQS A;  1YKC A;  1GTA A;  3VWU A;  6GSY A;  4KSM A;  2RUE A;  3KXO A;  2RII A;  22GS A;  1SK2 A;  2XBQ A;  3TKR A;  2HZE B;  2OBK A;  3IK7 A;  2L59 A;  3O76 A;  1JLV A;  3IAS 2;  1R5P A;  2CT6 A;  1THX A;  3VWV A;  4GQC A;  1BAY A;  4KSO A;  2PVO C;  2HZF A;  3I43 A;  4IKH A;  4GST A;  2VCT A;  1IYI A;  5FWG A;  1OC9 A;  2R37 A;  4EO3 A;  4BWQ A;  3QCP A;  2WCI A;  3O6T A;  2X49 A;  3CMI A;  1TKD B;  4IEL A;  1KEB A;  3ZVJ D;  2R3X A;  4HI7 A;  3KP8 A;  3GMF A;  2AB6 A;  2LNT A;  4G2E A;  1T8E B;  3UVT A;  5G1K A;  3RHB A;  1OAZ A;  4JBB A;  3CSI A;  2CAQ A;  2G0F A;  2C4J A;  3V1W A;  1TP9 A;  3TJJ A;  4MK3 A;  13GS A;  4A5P A;  3APQ A;  1YF0 A;  3UEM A;  2E2G A;  4DVC A;  3N9J A;  5CP1 A;  3GX0 A;  1TK0 B;  2V6K A;  2ON7 A;  1GNW A;  4K0G A;  5ECH B;  3Q18 A;  5HFG A;  2HRF A;  1ERT A;  4FQU A;  3EPT A;  1UC7 A;  3F3R A;  2CQ9 A;  1I9D A;  3W6G A;  1EZK A;  5G5F A;  1A2J A;  2DJ3 A;  2GSR A;  3WGE A;  3FMW A;  2YOI A;  2WGR A;  1F3B A;  5BRT A;  1BG5 A;  1ERU A;  1PX6 A;  1SL1 B;  2YP6 A;  4IJ3 A;  4YAP A;  3HZ8 A;  5E59 A;  4POK A;  1K0O A;  3BBY A;  2MBS A;  1O8W A;  2UZ8 A;  1C72 A;  1DUG A;  4MH2 A;  2H70 A;  1YEP A;  2EIO A;  2GLR A;  2I4A A;  4K2D A;  4OO5 A;  1TK8 B;  3FHK A;  2R0G A;  3QOU A;  4K5S A;  4ECC A;  3G9B A;  4OCF A;  4IQA A;  3I9V 2;  3F0I A;  3TDG A;  5ENU A;  1M2D A;  2JU5 A;  4EUY A;  3BJ5 A;  3GRX A;  3F4T A;  1ILO A;  2ES7 A;  4YQV A;  4JR6 A;  1FOH A;  1PGT A;  1K0N A;  2NBS A;  2M46 A;  1GUK A;  2MMZ A;  1M7T A;  2AV4 A;  2QKE A;  1WP0 A;  2AHE A;  1SJ6 A;  5IMZ A;  4IW9 A;  4GSN A;  4DSS B;  4K0N A;  4IVF A;  1MEK A;  3FZ9 A;  3A2X A;  2XC2 A;  3LGC A;  3IA1 A;  4AJ8 A;  3IHQ A;  3H8Q A;  4X1U A;  1EV4 A;  2PBJ A;  1YY7 A;  3GSS A;  3KTB A;  3UAR A;  4ACS A;  2FCH A;  1BJX A;  3KH7 A;  2C3T A;  4OFT A;  4YKG A;  3MWH A;  5JWR B;  3KGK A;  1Z7R A;  5AGY A;  4ZBD A;  2GGT A;  1BQ7 A;  2MMN A;  2X8G A;  1NHY A;  5KN0 A;  1VGL A;  4G9H A;  1EWX A;  4GLT A;  4RUV A;  4ECB A;  2B7K A;  3HVS A;  1FB0 A;  3LOR A;  1F6M C;  1K0B A;  4NPB A;  4ZBA A;  3ZYW A;  1B9X C;  3PPU A;  4ZIL A;  4V1A g;  4DSR A;  2PU9 C;  2PWJ A;  2K9F A;  3FZ4 A;  2DMM A;  5ELA A;  3QFB C;  1G6W A;  1A2L A;  1HQO A;  1PD2 1;  4NV2 A;  16GS A;  3A5I A;  3DIE A;  5F06 A;  5A4V A;  1QQ2 A;  2YN1 A;  2VD0 A;  3EYT A;  3LW9 A;  2GDR A;  1DSB A;  3UVH A;  5BMU A;  3H79 A;  1MDI A;  3IPZ A;  2KP1 A;  1JZD A;  1PFO A;  3VI7 A;  1THO A;  5KN3 A;  4WF4 A;  4KA0 A;  1T4Z A;  4EL1 A;  3E3E A;  4KDU A;  4CY8 A;  3CSH A;  1HD2 A;  4DSQ A;  3HCZ A;  2B3S A;  3D4M A;  1SD9 A;  5EY6 A;  1OKT A;  1SK0 A;  1YZX A;  5ECN B;  3HXS A;  3D6I A;  4TR3 A;  5IPG A;  5KN2 A;  4RI6 A;  1URM A;  1TXX A;  3KMN A;  4PGT A;  2RM5 A;  5D9T A;  3QFA C;  3UOM A;  1GSD A;  2PVQ A;  1PN9 A;  3D21 A;  1ML6 A;  1XWK A;  3Q74 A;  2DIY A;  3L4N A;  3ZRE A;  1KBN A;  3DEX A;  1A0R P;  4XS6 A;  2WJU A;  2IJY A;  1ZCP A;  4XHM A;  3H93 A;  3TKP A;  4JED A;  2X8H A;  3MIX A;  3LFL A;  3GIX A;  4EIP A;  3F3Q A;  4GSS A;  3IE3 A;  2FWF A;  5DAK A;  3ZIT A;  4TXO B;  4POB A;  2F9S A;  4QL7 A;  2V41 A;  1ZMA A;  2R0C A;  3QR6 A;  3RBT A;  2LUS A;  5AIS A;  4L5O A;  2CAI A;  4PTS A;  3EVI A;  4TR1 A;  2R4V A;  1GNE A;  1TRV A;  3ZMK A;  2HSH A;  3GFK A;  2GZP A;  1O8X A;  3K8N A;  3MSZ A;  2ZNM A;  3FEU A;  2GTU A;  1SJI A;  3QAV A;  5J5N A;  1OE8 A;  2WS2 A;  1S3R A;  5DAL B;  4MZC A;  5IQY A;  4Z7X A;  1WRY A;  1Z6M A;  3D22 A;  5KOW A;  4GCI A;  4TW5 A;  1T7P B;  5KOX A;  2VAF A;  1GH2 A;  2VCQ A;  3TCO A;  2H0G A;  5JWO B;  2L4C A;  3KIJ A;  3GV1 A;  3GKN A;  4K2X A;  5IOW A;  2LS5 A;  1FVK A;  2VD1 A;  4HS1 A;  1GTU A;  5EL8 A;  2LJK A;  3TJF A;  4K7N A;  6GSS A;  3GUR A;  3LQ7 A;  5HR2 A;  2HFD A;  2KUC A;  2OE1 A;  5HFI A;  5DCH A;  3QPM A;  3HYP A;  2H19 A;  3C73 A;  1SKW B;  3HD5 A;  3GH6 A;  2YJ7 A;  1GSS A;  2IN3 A;  3H1N A;  1PL1 A;  3NZN A;  3G7J A;  4OFN A;  5G30 A;  3P90 A;  1EEM A;  1HNC A;  3EU4 A;  3IR4 A;  3TGZ A;  2F8A A;  3UBL A;  4XS4 B;  2VL3 A;  4MJA A;  2QA1 A;  2G2Q A;  2A2S A;  4GRF A;  3TRX A;  5D93 A;  4AF2 A;  2CV4 A;  2I81 A;  5IMA A;  4KE3 A;  3C1S A;  1QXH A;  1FVJ A;  1EP8 A;  1Q98 A;  2X8C A;  1V57 A;  2L6C A;  4TR0 A;  4IN0 A;  1HNB A;  1PQN A;  2HLS A;  4MAB A;  4L8E A;  3CTG A;  3EMP A;  2F3M A;  3C7M A;  2A4H A;  4I2T A;  1XBS A;  3BCK A;  2YCD A;  1GTI A;  2YAN A;  4OFM A;  4X0X A;  1V58 A;  3GN3 A;  1UA5 A;  4BL7 A;  2FA8 A;  5IO0 A;  1JZO A;  1PKW A;  4Q5N A;  4HZ2 A;  2P5R A;  2GST A;  2VM1 A;  1PRX A;  4KW6 A;  5H5S A;  2N5F A;  3FRC A;  3BOA A;  1XW5 A;  2KHP A;  5DDL A;  1S3D A;  2YJH A;  3GTU B;  3ME8 A;  4AJ7 A;  1F2E A;  2JL4 A;  3LXZ A;  2CX3 A;  3LYK A;  4G19 A;  2XPE A;  4IP1 A;  2H72 A;  2IMF A;  2C0D A;  1EOH A;  2VCV A;  1FHE A;  1XWA A;  4NMU A;  4O5U A;  2VM2 A;  1K3Y A;  2B6M A;  3DD3 A;  5ECM B;  4ZL8 A;  5D9X A;  4XCS A;  4HSC X;  1TU8 A;  2CVK A;  3C71 A;  5JCG A;  1T3B A;  4BVX A;  2HRA A;  5J9C A;  2VLV A;  5ECL B;  1GSY A;  2BJX A;  3KJY A;  3M8N A;  1RQM A;  2EIR A;  4MJE A;  1A8L A;  2K18 A;  4Z2R A;  3TKS E;  4RQR A;  4YKF A;  3WD6 A;  5CRW A;  4ZL9 A;  3OR5 A;  4MPF A;  2I9H A;  1X9S B;  6GSX A;  3TJG A;  3M9K A;  2HRN A;  4KDX A;  3CQF A;  4ZL7 A;  2OBI A;  1PX7 A;  1DBY A;  1T1V A;  2JAD A;  3ERF A;  2QC7 A;  2HSY A;  3UAP A;  3KCM A;  1OVN A;  2X64 A;  3D0Z A;  5EPF A;  1JFU A;  3LEF A;  4YQM A;  2C1Y A;  3CYN A;  2DKI A;  1PL2 A;  3GL5 A;  1AIU A;  5CO3 A;  3TRQ A;  3ISO A;  2P5Q A;  4MF6 A;  3F9U A;  5HFK A;  2B1L A;  5ECS A;  2R6K A;  2IL3 A;  5ID2 B;  4LLR A;  4Z2U A;  2YPM A;  4LL4 B;  1GRX A;  3GL3 A;  4PUR A;  2WRT A;  3HJM A;  3IAM 2;  2RM6 A;  1NSW A;  2KP2 A;  3QAW A;  1MDK A;  1B4Q A;  1GUM A;  2L5O A;  4G0L A;  2RUF A;  4N10 A;  2ON5 A;  5INY A;  1FG4 A;  4EE0 A;  5GAN D;  2ZCT A;  2CVB A;  1VF2 A;  2DKH A;  3ZL5 A;  2E2M A;  2IFQ A;  4PNF A;  1O81 A;  4D73 A;  2YV7 A;  4KX4 A;  7GSS A;  4O5Q A;  1H4O A;  3VLN A;  2X99 A;  2VLU A;  4O5R A;  4ISD A;  3APO A;  4TKY A;  5F07 A;  4RQX A;  3BCI A;  5GAP D;  3G7I A;  4ZB6 A;  1GSE A;  2B1K A;  4XIH A;  4Z2T A;  1J9B A;  5ECP B;  4G10 A;  3FZ5 A;  5D96 A;  1Y6E A;  3MNG A;  5H5R A;  3DVW A;  4TR4 A;  3R2Q A;  2H1A A;  3LYP A;  3PR8 A;  1BED A;  1O7U A;  2DC5 A;  4KDY A;  2FHE A;  1X5E A;  3CRT A;  5DJM A;  2GZZ A;  1LJR A;  3TKS C;  1A0F A;  1YF1 A;  1GP1 A;  3L9U A;  4XRD A;  5HR1 A;  4BIK A;  3SBC A;  2TRX A;  3HHV A;  5IOX A;  2GQM A;  2Z9S A;  4EF0 A;  5ECQ B;  1OC9 B;  1XOB A;  4NHW A;  2BMX A;  2DIZ A;  3HA9 A;  3L9S A;  3GST A;  1ERW A;  3AY8 A;  4N0Z A;  1T00 A;  2HSM A;  3FR3 A;  2KLX A;  1JZW A;  4JU5 A;  1OYJ A;  2C8U A;  1V40 A;  2WFC A;  4MMM A;  4WEY A;  4BVY A;  5HR3 A;  4EC0 A;  3ZIV A;  4I8B A;  4LMW A;  1G7O A;  1AQV A;  1VF1 A;  2IME A;  3WT2 A;  3QDN A;  4NV5 A;  1MD3 A;  5CAX A;  1ABA A;  4I6X A;  4PNG A;  3HJP A;  2H1G A;  3KZQ A;  1AW9 A;  5D9W A;  5IPH A;  2C3N A;  5G1L A;  4ML6 A;  1AQX A;  3EMX A;  2GZY A;  1U3I A;  1Y25 A;  2B5X A;  1JLW A;  4ICY A;  2F51 A;  4IS0 A;  3HDC A;  2PPT A;  5CRD A;  3FZA A;  1XIY A;  2YWO A;  6GSU A;  4HJM A;  2PGT A;  4WBJ A;  2R2J A;  2IFQ B;  3VK9 A;  1FOV A;  1PN0 A;  2DJ0 A;  4MDC A;  2M72 A;  1SEN A;  2JAC A;  5ECK B;  3L9V A;  4F2I A;  4K9Z A;  4ZBB A;  2A4V A;  3MAK A;  4JE1 A;  2L57 A;  5LCZ A;  1NM3 A;  5IIZ A;  2NTO A;  2O85 A;  5KN1 A;  3CSJ A;  2H01 A;  3TKS A;  3UL3 A;  1OKD A;  5CRG A;  4G0I A;  3E9J B;  5COH A;  2LRT A;  2ZUP A;  3EIN A;  2H1B A;  2M80 A;  1TRS A;  3F8U A;  5F0G A;  3KEB A;  3IOS A;  4G0K A;  1K3L A;  3ZIJ A;  1A2M A;  2L5L A;  4I2U A;  2HE3 A;  2N5A A;  1XW9 A;  3EE2 A;  2GS3 A;  5CRH A;  3IHG A;  3TKQ A;  4ID0 A;  3PH9 A;  4K5R A;  4MPG A;  2LV3 A;  2LJA A;  4XRA A;  5JWQ B;  2GT5 A;  1ERV A;  1SD8 A;  4K6X A;  2P0G A;  4NWY A;  2C0G A;  2OE0 A;  3D4T A;  1SU9 A;  4F82 A;  1U6T A;  1CQH A;  2YZU A;  4GTU A;  4BPY A;  1R5A A;  3GYK A;  3SWL A;  4GF0 A;  3KMO A;  3US3 A;  4K7I A;  1SKS B;  2A2R A;  6GST A;  4LA1 A;  1A8Y A;  5FHI A;  4PQH A;  2RLI A;  4HJ2 A;  1ZGN A;  2LJR A;  4CY6 A;  2VO4 A;  1EEJ A;  6GSV A;  3KTL A;  3FK8 A;  4MCU A;  2TRC P;  5AIX A;  1G0T A;  1TRW A;  2H6X A;  3A2W A;  1WPI A;  3FY7 A;  4JRR A;  4EKZ A;  4GQF A;  4V2N A;  2WZ9 A;  4EDY A;  4ZB8 A;  2OKA A;  1B8X A;  1EV9 A;  1WJK A;  4YAV A;  1KTE A;  3U5R E;  4N11 A;  2A2P A;  2QA2 A;  5IMF A;  1R26 A;  3IC4 A;  2VL2 C;  4JR4 A;  5H5Q A;  2CZ3 A;  5G31 A;  2LNS A;  2I3Y A;  3GA4 A;  2HYX A;  4ECI A;  1K0A A;  3QMX A;  5KEJ A;  5G2Z A;  4L0W A;  4KAE A;  4WR5 A;  3DKS A;  18GS A;  5GZZ B;  4KCE A;  2O87 A;  2H1D A;  3N5O A;  1WWJ A;  1TI3 A;  5J4U A;  3HVX A;  2FGX A; 
#chains in the Genus database with same CATH homology
 2OA7 A;  5CNW A;  3P7X A;  1XXU A;  3KD0 A;  1E2Y A;  1Z9H A;  1S3C A;  5J3R A;  3DYR A;  3GNJ A;  2FA4 A;  3MYD A;  4LMV A;  2H76 A;  1U88 A;  2WB9 A;  3FKF A;  4IQ1 A;  2DBC A;  2E7P A;  1V98 A;  5ELG A;  2QSI A;  4GWR A;  1XFL A;  1WMJ A;  5EVO A;  1ZL9 A;  4FYC A;  2GQL A;  1B48 A;  4HU9 A;  2PER A;  3I6A A;  3PGT A;  2H0I A;  1Q4J A;  2AUV A;  1TW9 A;  4JZQ A;  3TJK A;  2HZE A;  5IO2 A;  3RHC A;  1F9M A;  3IRA A;  5A5K A;  19GS A;  4PX1 A;  1X9M B;  3ZZX A;  1X9W B;  3FR9 A;  2MMA A;  5B6N A;  2JSZ A;  2CX4 A;  3U6V A;  2L4Q A;  5DAK B;  2HRK A;  5CYY A;  3J7Y k;  2WUL A;  4FYB A;  2OAC A;  2OJL A;  3LWA A;  4L5L A;  1TJD A;  2KOK A;  3ZVJ A;  4FH8 A;  4TR1 B;  2LKU A;  3HY2 A;  4IGJ A;  4ZIJ A;  1GUL A;  1T4Y A;  5J9B A;  1SK1 A;  2LRC A;  2HI7 A;  5AIV A;  2CZ2 A;  2IIY A;  1VF4 A;  1YJ6 A;  3P2A A;  4WR4 A;  1XCC A;  4L0U A;  2JZR A;  3PIN A;  1Z5Y E;  3WGX A;  2OE3 A;  3EU3 A;  2HT9 A;  2V32 A;  3IV4 A;  4N30 A;  4WET A;  1E6B A;  4KGI A;  4POM A;  3F6D A;  2YZH A;  2DSA A;  2GSQ A;  1M99 A;  1U3A A;  4WBR D;  3E0U A;  2X4A A;  3ERG A;  4EVM A;  2H6Z A;  3NOF A;  2HNL A;  4EIQ A;  4MLY A;  4J2F A;  2QGV A;  1WIK A;  2VCW A;  1TDI A;  1SL0 B;  1I5G A;  1Z7P A;  4IP6 A;  4QQ7 A;  3ZLP A;  4PUA A;  1FAA A;  4E8E A;  1CQG A;  4PQI A;  2VCZ A;  4IHU A;  1Z3E A;  4FIW A;  4CHS A;  3RDW A;  3UIW A;  3FW2 A;  4AJ6 A;  3KP9 A;  5LNK e;  2YWN A;  4WKW A;  1GL8 A;  4V2L A;  1Z6N A;  1TK5 B;  5CRE A;  1HYU A;  5D8I A;  1K0C A;  3A2V A;  2GQK A;  2FNO A;  2OAD A;  3A3T A;  3ZFB A;  3M3M A;  2B5Y A;  3ME7 A;  2TIR A;  4USS A;  4J56 E;  1AXD A;  1IYH A;  5C00 A;  4Q5Q A;  2H0H A;  2C0F A;  4MZW A;  5HR0 A;  2YV9 A;  2LQQ A;  5GSS A;  1ZYP A;  5DCG A;  4J57 E;  4BL7 B;  3J7Y b;  2BTO T;  4DSS A;  2IPA A;  3ERW A;  1XOA A;  1XPV A;  4HUA A;  5A4W A;  4O92 A;  2B5E A;  2FWH A;  3RAZ A;  2VCX A;  3P8W A;  4XS1 A;  2C0E A;  4FO5 A;  1UVZ A;  1GSQ A;  2R5G A;  4MJB A;  2DJ2 A;  2CVD A;  3RPN A;  2D2Z A;  2LQO A;  4RI7 A;  1K0M A;  3LSZ A;  1KNG A;  5D9V A;  4CDO A;  2E0Q A;  1DE2 A;  5DBQ A;  4YQU A;  3R3E A;  1J0F A;  1U87 A;  3G7Y A;  12GS A;  1K3O A;  1TTZ A;  2PMT A;  4TN8 A;  1XWB A;  1F37 A;  3MDK A;  5ECR B;  3W8J A;  1SKR B;  2VOC A;  3RPP A;  1R7H A;  4X4J A;  4CW9 A;  4MJC A;  2JSY A;  2HXK A;  2PUK C;  3F6F A;  1TU7 A;  4I5Q A;  3LG6 A;  5JCW A;  3Q19 A;  4KH7 A;  3VPT A;  4BVX B;  1YDK A;  10GS A;  3Q6O A;  17GS A;  4IBP A;  4I97 A;  11GS A;  2L6D A;  3HVV A;  4NAX A;  2XHF A;  5LD0 A;  1M9A A;  2H73 A;  2H66 A;  2FLS A;  5ABR A;  1GSF A;  2ALB A;  4X43 A;  3CBU A;  1ZYQ B;  2DML A;  4MH3 A;  3UJ1 A;  2AJQ B;  1JHB A;  3BD2 A;  5B6M A;  1FW1 A;  3HJO A;  2DJ1 A;  1GLQ A;  4LL1 B;  1WE0 A;  2LRN A;  3TB2 A;  3CRU A;  2IMI A;  2GVP A;  2FD3 A;  2K6V A;  14GS A;  3O3T A;  1JZR A;  4PUF C;  1AC1 A;  5IMD A;  1A23 A;  3EWL A;  3IC8 A;  3M0F A;  4EDZ A;  2K8V A;  2F8F A;  1BX9 A;  1M0U A;  2MMO A;  4N0V A;  4OWY A;  2PN8 A;  1FO5 A;  3JCM L;  2V1M A;  2FUG 2;  4E8H A;  3KM6 A;  5B8A A;  4TXO A;  3APS A;  1QUW A;  4K7O A;  4QL9 A;  4TRX A;  3UMA A;  4WF5 A;  5F05 A;  3HZ4 A;  1ZZY A;  3DXB A;  2MBT A;  4HEA 2;  4F9Z A;  1N8J A;  5B8B A;  4D73 B;  3D5J A;  2XPD A;  2B7J A;  5DAL A;  1SJZ A;  1XWC A;  2WDU A;  4ZXG A;  3TOT A;  2H75 A;  3QD9 A;  5DQY A;  4OD7 A;  1PMT A;  4Q5R A;  3GUS A;  4K1F A;  3ZTL A;  4ZB9 A;  4KF9 A;  5L71 A;  5D73 A;  3WT1 A;  2NVL A;  1YQ1 A;  4TVE A;  2EIQ A;  2IMK A;  3VI5 A;  4AGS A;  1OC3 A;  4KUN A;  4MZB A;  4BA7 A;  1N2A A;  1BYE A;  1O73 A;  1RK4 A;  1MTC A;  2DJK A;  3EUR A;  2FWG A;  2P31 A;  3A5W A;  1XZO A;  3S9F A;  3KH9 A;  1B9Y C;  3VUR A;  3TJB A;  1VRS D;  3C1R A;  5F8B A;  3GX8 A;  4MF5 A;  1MDJ A;  1XWG A;  2H71 A;  4XS4 A;  2AYT A;  1S3A A;  2O8V B;  4OCE A;  2IMD A;  1X0R A;  1NW2 A;  4HZ4 A;  1YEX A;  2JZT A;  9GSS A;  3DML A;  4MNN A;  4V1A p;  3W8S A;  5C04 A;  4BVY B;  2VLT A;  4PQ1 A;  5GST A;  3DVX A;  2H6Y A;  3ED3 A;  2FWE A;  4POL A;  2K8S A;  1M2A A;  1USB A;  5J41 A;  4F0C A;  1ZYE A;  4IJI A;  3LXT A;  3QAG A;  4O7H A;  2N5B A;  20GS A;  4Q5F A;  1SL2 B;  2XBI A;  2LEG A;  4F0B A;  1PSQ A;  4OMV A;  1F3A A;  1QGV A;  4FYU A;  1X5D A;  3IDV A;  1LU4 A;  1GUH A;  3GKM A;  4ECJ A;  1TOF A;  3F63 A;  4NXI A;  4H86 A;  2FY6 A;  4HQZ A;  3L0H A;  2V6O A;  2O7K A;  3DWV A;  1SYX A;  1M2B A;  1AQW A;  3GTU A;  2VUP A;  2H8L A;  1M9B A;  1X5C A;  1B4P A;  4ML1 A;  2AAW A;  3VWX A;  1WOU A;  1K0D A;  3CTF A;  4PXO A;  5FT3 A;  5IM9 A;  5E4W A;  3M9J A;  5IMV A;  4KCA A;  2YWI A;  4F03 A;  3H4K A;  2VL9 A;  1ZYN A;  1OE7 A;  3GKX A;  2H30 A;  1EP7 A;  2GSS A;  4P3Y B;  1R4W A;  2V2G A;  4MA9 A;  1TI1 A;  6GSW A;  5ECI B;  5B7C A;  1EGO A;  2YNX A;  4MP4 A;  3WYW A;  3I69 A;  4WXT A;  3GKK A;  3VWW A;  1VF3 A;  3NIV A;  2LST A;  2DLX A;  4O32 A;  4YH2 A;  2JZS A;  1A24 A;  5G5E A;  5DJL A;  4NHZ A;  3IK9 A;  3ZML A;  1GWC A;  1MD4 A;  1XVQ A;  3TUE A;  1QFN A;  1RW1 A;  1W89 A;  4HDE A;  4MF7 A;  2IWT A;  3VPQ A;  2DJJ A;  2NPB A;  4BWS A;  1NHO A;  1O85 A;  3TOU A;  1O6J A;  3F4S A;  1SYR A;  3ZRD A;  2GT6 A;  1ZOF A;  3IXR A;  4ULX A;  4EXJ A;  4TOP A;  1QK8 A;  2VL2 A;  1V2A A;  3DRN A;  3F4R A;  5DQS A;  4OO4 A;  3C8E A;  5DVB A;  1PKZ A;  1AAZ A;  2J9H A;  1GTB A;  1V9W A;  5HQP A;  2LTK A;  1GSU A;  1FB6 A;  5JCU A;  2C3Q A;  5A4U A;  2YWM A;  3FYG A;  5ID2 A;  1QMV A;  1PA3 A;  1GLP A;  1LBK A;  4K8M A;  2CA8 A;  2MZC A;  1OC8 A;  2VIM A;  5IMC A;  8GSS A;  1ON4 A;  4DEJ A;  1EOG A;  1EGR A;  3GH9 A;  2R0P A;  2H74 A;  2REM A;  4HU7 A;  3VFI A;  3ZFL A;  1TRU A;  1HNA A;  2C80 A;  5AN1 A;  3GHA A;  1DE1 A;  2NDO A;  3CXG A;  3HKR A;  2MYG A;  3TRP A;  1G6Y A;  1G7E A;  1ST9 A;  4KB3 A;  1AUC A;  3LJR A;  3UBK A;  3WGD A;  1XVW A;  4V2M A;  3IBH A;  4GXZ A;  1W4V A;  4HOJ A;  3DGQ A;  3EC3 A;  4XTS A;  5ECO B;  1UN2 A;  4KND A;  1J08 A;  2EC4 A;  2I1U A;  3L78 A;  1H75 A;  1XW6 A;  2O89 A;  1YKA A;  3M1G A;  4ILF A;  2J23 A;  1ACV A;  3FR6 A;  4TXV A;  4HQS A;  1YKC A;  1GTA A;  3VWU A;  6GSY A;  4KSM A;  2RUE A;  3KXO A;  2RII A;  22GS A;  1SK2 A;  2XBQ A;  3TKR A;  2HZE B;  2OBK A;  3IK7 A;  2L59 A;  3O76 A;  1JLV A;  3IAS 2;  1R5P A;  2CT6 A;  1THX A;  3VWV A;  4GQC A;  1BAY A;  4KSO A;  2PVO C;  2HZF A;  3I43 A;  4IKH A;  4GST A;  2VCT A;  1IYI A;  5FWG A;  1OC9 A;  2R37 A;  4EO3 A;  4BWQ A;  3QCP A;  2WCI A;  3O6T A;  2X49 A;  3CMI A;  1TKD B;  4IEL A;  1KEB A;  3ZVJ D;  2R3X A;  4HI7 A;  3KP8 A;  3GMF A;  2AB6 A;  2LNT A;  4G2E A;  1T8E B;  3UVT A;  5G1K A;  3RHB A;  1OAZ A;  4JBB A;  3CSI A;  2CAQ A;  2G0F A;  2C4J A;  3V1W A;  1TP9 A;  3TJJ A;  4MK3 A;  13GS A;  4A5P A;  3APQ A;  1YF0 A;  3UEM A;  2E2G A;  4DVC A;  3N9J A;  5CP1 A;  3GX0 A;  1TK0 B;  2V6K A;  2ON7 A;  1GNW A;  4K0G A;  5ECH B;  3Q18 A;  5HFG A;  2HRF A;  1ERT A;  4FQU A;  3EPT A;  1UC7 A;  3F3R A;  2CQ9 A;  1I9D A;  3W6G A;  1EZK A;  5G5F A;  1A2J A;  2DJ3 A;  2GSR A;  3WGE A;  3FMW A;  2YOI A;  2WGR A;  1F3B A;  5BRT A;  1BG5 A;  1ERU A;  1PX6 A;  1SL1 B;  2YP6 A;  4IJ3 A;  4YAP A;  3HZ8 A;  5E59 A;  4POK A;  1K0O A;  3BBY A;  2MBS A;  1O8W A;  2UZ8 A;  1C72 A;  1DUG A;  4MH2 A;  2H70 A;  1YEP A;  2EIO A;  2GLR A;  2I4A A;  4K2D A;  4OO5 A;  1TK8 B;  3FHK A;  2R0G A;  3QOU A;  4K5S A;  4ECC A;  3G9B A;  4OCF A;  4IQA A;  3I9V 2;  3F0I A;  3TDG A;  5ENU A;  1M2D A;  2JU5 A;  4EUY A;  3BJ5 A;  3GRX A;  3F4T A;  1ILO A;  2ES7 A;  4YQV A;  4JR6 A;  1FOH A;  1PGT A;  1K0N A;  2NBS A;  2M46 A;  1GUK A;  2MMZ A;  1M7T A;  2AV4 A;  2QKE A;  1WP0 A;  2AHE A;  1SJ6 A;  5IMZ A;  4IW9 A;  4GSN A;  4DSS B;  4K0N A;  4IVF A;  1MEK A;  3FZ9 A;  3A2X A;  2XC2 A;  3LGC A;  3IA1 A;  4AJ8 A;  3IHQ A;  3H8Q A;  4X1U A;  1EV4 A;  2PBJ A;  1YY7 A;  3GSS A;  3KTB A;  3UAR A;  4ACS A;  2FCH A;  1BJX A;  3KH7 A;  2C3T A;  4OFT A;  4YKG A;  3MWH A;  5JWR B;  3KGK A;  1Z7R A;  5AGY A;  4ZBD A;  2GGT A;  1BQ7 A;  2MMN A;  2X8G A;  1NHY A;  5KN0 A;  1VGL A;  4G9H A;  1EWX A;  4GLT A;  4RUV A;  4ECB A;  2B7K A;  3HVS A;  1FB0 A;  3LOR A;  1F6M C;  1K0B A;  4NPB A;  4ZBA A;  3ZYW A;  1B9X C;  3PPU A;  4ZIL A;  4V1A g;  4DSR A;  2PU9 C;  2PWJ A;  2K9F A;  3FZ4 A;  2DMM A;  5ELA A;  3QFB C;  1G6W A;  1A2L A;  1HQO A;  1PD2 1;  4NV2 A;  16GS A;  3A5I A;  3DIE A;  5F06 A;  5A4V A;  1QQ2 A;  2YN1 A;  2VD0 A;  3EYT A;  3LW9 A;  2GDR A;  1DSB A;  3UVH A;  5BMU A;  3H79 A;  1MDI A;  3IPZ A;  2KP1 A;  1JZD A;  3VI7 A;  1THO A;  5KN3 A;  4WF4 A;  4KA0 A;  1T4Z A;  4EL1 A;  3E3E A;  4KDU A;  4CY8 A;  3CSH A;  1HD2 A;  4DSQ A;  3HCZ A;  2B3S A;  3D4M A;  1SD9 A;  5EY6 A;  1OKT A;  1SK0 A;  1YZX A;  5ECN B;  3HXS A;  3D6I A;  4TR3 A;  5IPG A;  5KN2 A;  4RI6 A;  1URM A;  1TXX A;  3KMN A;  4PGT A;  2RM5 A;  5D9T A;  3QFA C;  3UOM A;  1GSD A;  2PVQ A;  1PN9 A;  3D21 A;  1ML6 A;  1XWK A;  3Q74 A;  2DIY A;  3L4N A;  3ZRE A;  1KBN A;  3DEX A;  1A0R P;  4XS6 A;  2WJU A;  2IJY A;  1ZCP A;  4XHM A;  3H93 A;  3TKP A;  4JED A;  2X8H A;  3MIX A;  3LFL A;  3GIX A;  4EIP A;  3F3Q A;  4GSS A;  3IE3 A;  2FWF A;  5DAK A;  3ZIT A;  4TXO B;  4POB A;  2F9S A;  4QL7 A;  2V41 A;  1ZMA A;  2R0C A;  3QR6 A;  3RBT A;  2LUS A;  5AIS A;  4L5O A;  2CAI A;  4PTS A;  3EVI A;  4TR1 A;  2R4V A;  1GNE A;  1TRV A;  3ZMK A;  2HSH A;  3GFK A;  2GZP A;  1O8X A;  3K8N A;  3MSZ A;  2ZNM A;  3FEU A;  2GTU A;  1SJI A;  3QAV A;  5J5N A;  1OE8 A;  2WS2 A;  5DAL B;  4MZC A;  5IQY A;  4Z7X A;  1WRY A;  1Z6M A;  3D22 A;  5KOW A;  4GCI A;  4TW5 A;  1T7P B;  5KOX A;  2VAF A;  1GH2 A;  2VCQ A;  3TCO A;  2H0G A;  5JWO B;  2L4C A;  3KIJ A;  3GV1 A;  3GKN A;  4K2X A;  5IOW A;  2LS5 A;  1FVK A;  2VD1 A;  4HS1 A;  1GTU A;  5EL8 A;  2LJK A;  3TJF A;  4K7N A;  6GSS A;  3GUR A;  3LQ7 A;  5HR2 A;  2HFD A;  2KUC A;  2OE1 A;  5HFI A;  5DCH A;  3QPM A;  3HYP A;  2H19 A;  3C73 A;  1SKW B;  3HD5 A;  3GH6 A;  2YJ7 A;  1GSS A;  2IN3 A;  3H1N A;  1PL1 A;  3NZN A;  3G7J A;  4OFN A;  5G30 A;  3P90 A;  1EEM A;  1HNC A;  3EU4 A;  3IR4 A;  3TGZ A;  2F8A A;  3UBL A;  4XS4 B;  2VL3 A;  4MJA A;  2QA1 A;  2G2Q A;  2A2S A;  4GRF A;  3TRX A;  5D93 A;  4AF2 A;  2CV4 A;  2I81 A;  5IMA A;  4KE3 A;  3C1S A;  1QXH A;  1FVJ A;  1EP8 A;  1Q98 A;  2X8C A;  1V57 A;  2L6C A;  4TR0 A;  4IN0 A;  1HNB A;  1PQN A;  2HLS A;  4MAB A;  4L8E A;  3CTG A;  3EMP A;  2F3M A;  3C7M A;  2A4H A;  4I2T A;  1XBS A;  3BCK A;  2YCD A;  1GTI A;  2YAN A;  4OFM A;  4X0X A;  1V58 A;  3GN3 A;  1UA5 A;  4BL7 A;  2FA8 A;  5IO0 A;  1JZO A;  1PKW A;  4Q5N A;  4HZ2 A;  2P5R A;  2GST A;  2VM1 A;  1PRX A;  4KW6 A;  5H5S A;  2N5F A;  3FRC A;  3BOA A;  1XW5 A;  2KHP A;  5DDL A;  1S3D A;  2YJH A;  3GTU B;  3ME8 A;  4AJ7 A;  1F2E A;  2JL4 A;  3LXZ A;  2CX3 A;  3LYK A;  4G19 A;  2XPE A;  4IP1 A;  2H72 A;  2IMF A;  2C0D A;  1EOH A;  2VCV A;  1FHE A;  1XWA A;  4NMU A;  4O5U A;  2VM2 A;  1K3Y A;  2B6M A;  3DD3 A;  5ECM B;  4ZL8 A;  5D9X A;  4XCS A;  1TU8 A;  2CVK A;  3C71 A;  5JCG A;  1T3B A;  4BVX A;  2HRA A;  5J9C A;  2VLV A;  5ECL B;  1GSY A;  2BJX A;  3KJY A;  3M8N A;  1RQM A;  2EIR A;  4MJE A;  1A8L A;  2K18 A;  4Z2R A;  3TKS E;  4RQR A;  4YKF A;  3WD6 A;  5CRW A;  4ZL9 A;  3OR5 A;  4MPF A;  2I9H A;  1X9S B;  6GSX A;  3TJG A;  3M9K A;  2HRN A;  4KDX A;  4ZL7 A;  2OBI A;  1PX7 A;  1DBY A;  1T1V A;  2JAD A;  3ERF A;  2QC7 A;  2HSY A;  3UAP A;  3KCM A;  1OVN A;  2X64 A;  3D0Z A;  5EPF A;  1JFU A;  3LEF A;  4YQM A;  2C1Y A;  3CYN A;  2DKI A;  1PL2 A;  3GL5 A;  1AIU A;  5CO3 A;  3TRQ A;  3ISO A;  2P5Q A;  4MF6 A;  3F9U A;  5HFK A;  2B1L A;  5ECS A;  2R6K A;  2IL3 A;  5ID2 B;  4LLR A;  4Z2U A;  2YPM A;  4LL4 B;  1GRX A;  3GL3 A;  4PUR A;  2WRT A;  3HJM A;  3IAM 2;  2RM6 A;  1NSW A;  2KP2 A;  3QAW A;  1MDK A;  1B4Q A;  1GUM A;  2L5O A;  4G0L A;  2RUF A;  4N10 A;  2ON5 A;  5INY A;  1FG4 A;  4EE0 A;  5GAN D;  2ZCT A;  2CVB A;  1VF2 A;  2DKH A;  3ZL5 A;  2E2M A;  2IFQ A;  4PNF A;  1O81 A;  4D73 A;  2YV7 A;  4KX4 A;  7GSS A;  4O5Q A;  1H4O A;  3VLN A;  2X99 A;  2VLU A;  4O5R A;  4ISD A;  3APO A;  4TKY A;  5F07 A;  4RQX A;  3BCI A;  5GAP D;  3G7I A;  4ZB6 A;  1GSE A;  2B1K A;  4XIH A;  4Z2T A;  1J9B A;  5ECP B;  4G10 A;  3FZ5 A;  5D96 A;  1Y6E A;  3MNG A;  5H5R A;  3DVW A;  4TR4 A;  3R2Q A;  2H1A A;  3LYP A;  3PR8 A;  1BED A;  1O7U A;  2DC5 A;  4KDY A;  2FHE A;  1X5E A;  3CRT A;  5DJM A;  2GZZ A;  1LJR A;  3TKS C;  1A0F A;  1YF1 A;  1GP1 A;  3L9U A;  4XRD A;  5HR1 A;  3SBC A;  2TRX A;  3HHV A;  5IOX A;  2GQM A;  2Z9S A;  4EF0 A;  5ECQ B;  1OC9 B;  1XOB A;  4NHW A;  2BMX A;  2DIZ A;  3HA9 A;  3L9S A;  3GST A;  1ERW A;  3AY8 A;  4N0Z A;  1T00 A;  2HSM A;  3FR3 A;  2KLX A;  1JZW A;  4JU5 A;  1OYJ A;  2C8U A;  1V40 A;  2WFC A;  4MMM A;  4WEY A;  4BVY A;  5HR3 A;  4EC0 A;  3ZIV A;  4I8B A;  4LMW A;  1G7O A;  1AQV A;  1VF1 A;  2IME A;  3WT2 A;  3QDN A;  4NV5 A;  1MD3 A;  5CAX A;  1ABA A;  4I6X A;  4PNG A;  3HJP A;  2H1G A;  3KZQ A;  1AW9 A;  5D9W A;  5IPH A;  2C3N A;  5G1L A;  4ML6 A;  1AQX A;  3EMX A;  2GZY A;  1U3I A;  1Y25 A;  2B5X A;  1JLW A;  4ICY A;  2F51 A;  4IS0 A;  3HDC A;  2PPT A;  5CRD A;  3FZA A;  1XIY A;  2YWO A;  6GSU A;  4HJM A;  2PGT A;  4WBJ A;  2R2J A;  2IFQ B;  3VK9 A;  1FOV A;  1PN0 A;  2DJ0 A;  4MDC A;  2M72 A;  1SEN A;  2JAC A;  5ECK B;  3L9V A;  4F2I A;  4K9Z A;  4ZBB A;  2A4V A;  3MAK A;  4JE1 A;  2L57 A;  5LCZ A;  1NM3 A;  5IIZ A;  2NTO A;  2O85 A;  5KN1 A;  3CSJ A;  2H01 A;  3TKS A;  3UL3 A;  1OKD A;  5CRG A;  4G0I A;  3E9J B;  5COH A;  2LRT A;  2ZUP A;  3EIN A;  2H1B A;  2M80 A;  1TRS A;  3F8U A;  5F0G A;  3KEB A;  3IOS A;  4G0K A;  1K3L A;  3ZIJ A;  1A2M A;  2L5L A;  4I2U A;  2HE3 A;  2N5A A;  1XW9 A;  3EE2 A;  2GS3 A;  5CRH A;  3IHG A;  3TKQ A;  4ID0 A;  3PH9 A;  4K5R A;  4MPG A;  2LV3 A;  2LJA A;  4XRA A;  5JWQ B;  2GT5 A;  1ERV A;  1SD8 A;  4K6X A;  2P0G A;  4NWY A;  2C0G A;  2OE0 A;  3D4T A;  1SU9 A;  4F82 A;  1U6T A;  1CQH A;  2YZU A;  4GTU A;  4BPY A;  1R5A A;  3GYK A;  3SWL A;  4GF0 A;  3KMO A;  3US3 A;  4K7I A;  1SKS B;  2A2R A;  6GST A;  4LA1 A;  1A8Y A;  5FHI A;  4PQH A;  2RLI A;  4HJ2 A;  1ZGN A;  2LJR A;  4CY6 A;  2VO4 A;  1EEJ A;  6GSV A;  3KTL A;  3FK8 A;  4MCU A;  2TRC P;  5AIX A;  1G0T A;  1TRW A;  2H6X A;  3A2W A;  1WPI A;  3FY7 A;  4JRR A;  4EKZ A;  4GQF A;  4V2N A;  2WZ9 A;  4EDY A;  4ZB8 A;  2OKA A;  1B8X A;  1EV9 A;  1WJK A;  4YAV A;  1KTE A;  3U5R E;  4N11 A;  2A2P A;  2QA2 A;  5IMF A;  1R26 A;  3IC4 A;  2VL2 C;  4JR4 A;  5H5Q A;  2CZ3 A;  5G31 A;  2LNS A;  2I3Y A;  3GA4 A;  2HYX A;  4ECI A;  1K0A A;  3QMX A;  5KEJ A;  5G2Z A;  4L0W A;  4KAE A;  4WR5 A;  3DKS A;  18GS A;  5GZZ B;  4KCE A;  2O87 A;  2H1D A;  3N5O A;  1WWJ A;  1TI3 A;  5J4U A;  3HVX A;  2FGX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...