1B9YC

Structural analysis of phosducin and its phosphorylation-regulated interaction with transducin beta-gamma
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
217
structure length
167
Chain Sequence
EGQATHTGPKGVINDWRKFKLESEGCLRKYRRQCMQDMHQKLSFGPRYGFVYELETGEQFLETIEKEQKVTTIVVNIYEDGVRGCDALNSSLECLAAEYPMVKFCKIRASNTGAGDRFSSDVLPTLLVYKGGELISNFISVAEQFAEDFFAADVESFLNEYGLLPER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords PROTEIN (TRANSDUCIN)
publication title A molecular mechanism for the phosphorylation-dependent regulation of heterotrimeric G proteins by phosducin.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 46
structure length 167
sequence length 217
ec nomenclature
pdb deposition date 1999-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02114 Phosducin Phosducin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.168.10 Mainly Alpha Orthogonal Bundle Phosducin; domain 2 Phosducin, domain 2 1b9yC02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1b9yC01
1YKCA 5DCHA 1XBSA 4YQMA 1O73A 4MZWA 4TOPA 1OVNA 1SU9A 2X99A 3LXTA 2QSIA 3VWWA 5J41A 4DSRA 3H4KA 3QD9A 4KAEA 2R3XA 4ZL8A 3O6TA 2L5OA 1OYJA 5IMVA 1Y25A 2LUSA 1OC3A 2LRCA 2KLXA 3DVXA 1X5DA 5H5QA 1KBNA 1MDIA 3TDGA 3Q6OA 1IYHA 4XS6A 3I43A 3VWXA 3GNJA 1YDKA 1WP0A 1Z6NA 3RPPA 4YAVA 2YCDA 4LA1A 1X9WB 1QK8A 3R2QA 1URMA 4G10A 4YAPA 4WR5A 2V6OA 3I9V2 5EPFA 1G6YA 4ECJA 3ME7A 2H6ZA 22GSA 4WF4A 2CZ3A 3ED3A 1GWCA 2LJRA 1X0RA 3ERGA 4MA9A 2IPAA 1QFNA 3KTBA 3C7MA 5ECRB 3ZFLA 3EYTA 1A8LA 2DJ0A 3O76A 5FWGA 4HZ4A 2B6MA 5GAPD 1KTEA 2O85A 4NV2A 4LMVA 4AJ6A 5ELGA 4DVCA 2B5YA 4X1UA 3LG6A 2GSTA 2D2ZA 1U88A 3FW2A 2OE3A 2H75A 2E0QA 5DALB 3TJKA 1ML6A 2WB9A 2L59A 3KTLA 4GRFA 2FA4A 4POLA 5IQYA 2C1YA 2OA7A 13GSA 1B9YC 1WPIA 3EVIA 2AHEA 4EC0A 1TJDA 3NOFA 5CRHA 2K8VA 3C73A 2HZEB 4PQ1A 5HFKA 1JZRA 6GSXA 5C00A 1WWJA 3DGQA 3QAGA 4F03A 2HRFA 1NHOA 2IIYA 2F8FA 2IMFA 1XWKA 1UVZA 4Z7XA 5G5FA 2L4QA 1XWBA 1BX9A 4ZILA 1SL0B 2H30A 3RAZA 5ECMB 4XS1A 1O7UA 4HJ2A 1G7OA 3I69A 2VO4A 1GRXA 5A4VA 2A2SA 3FYGA 4F0BA 3M9JA 1SJZA 2GZZA 2G0FA 4TN8A 1Z9HA 2MBTA 5DBQA 4DSQA 2AV4A 3QAWA 1SD9A 3IA1A 1Z3EA 4ZB8A 1PQNA 6GSVA 3HCZA 3WT2A 1ZYQB 4XS4B 3KH7A 5AGYA 1M2AA 3TUEA 5IPHA 2J9HA 4MLYA 2CVKA 4MMMA 4KW6A 1I5GA 2V41A 2CX4A 1F6MC 1MDKA 1OKDA 1JLVA 2J23A 3EINA 3LSZA 3GA4A 2P0GA 3GHAA 1DUGA 1V2AA 1XW5A 1PSQA 2F3MA 2GZPA 2VOCA 3EC3A 4CDOA 2DJ2A 5F06A 2IFQA 1GH2A 5LD0A 2EC4A 5HFIA 2YNXA 1U3AA 5F05A 3VWVA 4YQUA 2RM5A 1ZCPA 4EE0A 3TRQA 2CZ2A 5J9CA 3ZMLA 1FB6A 8GSSA 1PX7A 4POMA 1MD4A 3F63A 5G1LA 3WD6A 4ACSA 1A23A 5IM9A 1A2JA 1OE8A 4MF6A 1V98A 2P5QA 1YJ6A 2HZFA 1A2MA 4J2FA 1QXHA 4RUVA 1J08A 2H6XA 1TDIA 2B1LA 2IMDA 1GSDA 3WYWA 3EWLA 2M46A 1LBKA 1W4VA 3BBYA 1T7PB 1SYRA 4ZL9A 3C8EA 1E6BA 4K2DA 3QPMA 1T4YA 1V58A 1VRSD 5IOXA 4QL9A 3IE3A 2C4JA 3UBLA 2HLSA 3KGKA 4ZB6A 4ECBA 3FZAA 2XBIA 1AIUA 3F6FA 1YF1A 5EVOA 1AXDA 1SJ6A 3MWHA 2MMAA 1ERUA 1LJRA 3WGEA 2KP1A 5KN0A 2H0GA 2V32A 4N0ZA 2R6KA 3QDNA 4JR4A 1TRSA 4PUFC 3J7Yb 2PPTA 1H75A 4PNFA 2HRNA 5ECIB 2GSSA 4P3YB 1TOFA 1T8EB 1GUMA 2HSHA 3QR6A 1SK1A 4CW9A 4HEA2 4ISDA 4RQRA 3H79A 5C04A 1SL1B 3HD5A 2H01A 2WGRA 3QMXA 2VD1A 1SJIA 2FCHA 5DALA 5ECQB 3HHVA 4TR0A 4Q5RA 3BCIA 3GKMA 1SKSB 4ULXA 3TRPA 3HY2A 2E2MA 3FR3A 3EMPA 3VURA 1PX6A 4LL1B 4F0CA 3CSIA 5KN3A 2I4AA 3KP8A 1FHEA 4IVFA 2HZEA 2VAFA 3L9SA 1HNAA 3F3RA 2MYGA 1TRUA 4L5OA 4NHZA 3ZIVA 1OE7A 2GS3A 5IO2A 5CYYA 1Z5YE 2LTKA 1GP1A 2YJHA 5A4WA 1YZXA 3N9JA 4JU5A 2LQOA 1YQ1A 4XHMA 2K6VA 1EZKA 1FVJA 4I5QA 1UA5A 2C3TA 2VCZA 5GSTA 1XIYA 2WS2A 4WR4A 3ME8A 1TXXA 4EKZA 1SL2B 2L57A 4IW9A 4PXOA 1R7HA 3KMNA 1GSUA 1M9BA 4PURA 2OBIA 4OD7A 4Q5FA 1K0CA 1X5EA 2VIMA 3IXRA 1E2YA 2OADA 3TCOA 1YF0A 3E3EA 2H8LA 2G2QA 5E59A 2DIYA 2FWFA 4BWSA 3GURA 5HQPA 4I2UA 1FOVA 2GQLA 5ECSA 3P90A 4PNGA 5G5EA 5F07A 4XS4A 1SENA 2O89A 4WXTA 2P31A 2F8AA 5IMZA 3TJBA 2I1UA 1GTBA 2IN3A 3NZNA 4MF7A 3EU4A 3CTGA 1XW6A 2CA8A 2C0FA 1X9MB 4BPYA 3F3QA 3H1NA 2P5RA 5EL8A 2JL4A 4KDUA 1AW9A 3UVHA 1GULA 3D4TA 2V1MA 2YV7A 1X9SB 3D4MA 3WT1A 2DMLA 1S3CA 5IIZA 4RI7A 1O6JA 4IQAA 2X8HA 4XCSA 2BTOT 3JCML 2YP6A 1XWCA 4K6XA 3TKRA 4NPBA 2ON7A 3Q74A 3GKNA 1DE1A 2YWIA 2OE0A 2YJ7A 5JCGA 1M0UA 1TK0B 3GFKA 3LWAA 1PRXA 2PVOC 2WFCA 2YZHA 4PUAA 1T3BA 9GSSA 1TW9A 2XC2A 2LSTA 1PGTA 3E9JB 1TU8A 3VPTA 4F82A 3W6GA 1WIKA 2B1KA 1RW1A 1GLQA 3L9VA 4J56E 4O32A 4YH2A 2B3SA 2ALBA 1K0NA 2BJXA 1S3AA 5A5KA 1SD8A 5L71A 1GUHA 1K3LA 1SKWB 2MBSA 2KOKA 3PINA 4FO5A 1Q98A 4TR3A 5B6NA 1FAAA 2M72A 5ECHB 4BL7A 4L0UA 3FRCA 3DIEA 3ZYWA 4GSSA 1YEXA 4TKYA 3V1WA 3GYKA 4DEJA 3QFBC 1EWXA 1KEBA 3US3A 5EY6A 4GQFA 2YV9A 1PA3A 4D73B 3CXGA 4MABA 5DAKB 4OFNA 2JADA 3TKPA 1XWAA 3DRNA 18GSA 1Q4JA 1U6TA 1AC1A 3HJMA 4V1Ag 4OFTA 5B8BA 4N30A 1THXA 1M7TA 4KDXA 3TKSC 3DMLA 2XBQA 3NIVA 1XOBA 2GZYA 4G2EA 4MZCA 1OC8A 3FZ4A 4FH8A 2C3NA 4KCEA 4MH2A 3F4TA 4IP1A 4N11A 4ZBDA 1K0OA 4EDZA 1USBA 5AIXA 4KDYA 5DCGA 4LMWA 3VFIA 1HNCA 3ISOA 3LGCA 4K7NA 3ERFA 4K7IA 2A2RA 5ELAA 4KA0A 3W8JA 5J9BA 3U5RE 4MK3A 3VK9A 4FYBA 3M1GA 4ML1A 2JZSA 4H86A 2CVDA 2TRXA 1A24A 2FLSA 3UARA 1OC9B 1VF2A 3WGDA 3ZITA 3M9KA 1NSWA 3P2AA 1EGRA 3MSZA 3UIWA 2WCIA 3Q18A 4NXIA 1F3BA 1EEJA 5D9VA 3IOSA 1GNWA 4NWYA 4TXOB 1UN2A 4O5RA 3H93A 3M0FA 5GSSA 3GX8A 1ERTA 3HJPA 2LNSA 3ZVJA 1XWGA 3CYNA 3LFLA 1Y6EA 1F9MA 1ZYEA 2NVLA 3CSJA 5IO0A 2AB6A 4ZBAA 4MJEA 3TKSE 1GLPA 3GRXA 4V2LA 1YKAA 4GTUA 2YANA 4EDYA 4XTSA 3DWVA 1VGLA 3KIJA 20GSA 4V2MA 2DJKA 3C1RA 3DXBA 2PUKC 4EUYA 2X64A 4IQ1A 3EU3A 3IRAA 4HQZA 6GSWA 4N10A 1BQ7A 3UEMA 1GSEA 2BMXA 4EF0A 4MCUA 1PL2A 2B5EA 3VI5A 1G7EA 1EV4A 2PWJA 3EURA 4DSSB 2FNOA 3IC4A 2VCVA 1EP8A 2H1DA 2H71A 1T00A 1M9AA 4MF5A 2DJ1A 3BOAA 4ML6A 3RHCA 3TKSA 1GSFA 3PR8A 5IMCA 1PN9A 3CSHA 2O8VB 1WJKA 4F9ZA 3IV4A 1WOUA 2L6DA 2PBJA 2HNLA 2LV3A 2TIRA 2C0EA 4GSNA 1DSBA 4V2NA 6GSSA 4L5LA 4JRRA 4O7HA 5IOWA 1F2EA 4FIWA 1VF4A 3TJFA 2AAWA 3FR9A 2DMMA 5ECLB 2RM6A 4JEDA 3GMFA 3KH9A 4EL1A 3APSA 2FD3A 1EEMA 1TU7A 1A8YA 2HT9A 3FY7A 2HSYA 4ZL7A 1GSQA 3KM6A 1K0MA 3LQ7A 3GTUB 4WBJA 1BEDA 1VF1A 1T1VA 2CT6A 4IBPA 5HR2A 2C0DA 3RHBA 4K8MA 3A5WA 4KH7A 3D21A 3MNGA 5ECOB 4JZQA 1HNBA 2ZNMA 4KCAA 2IJYA 1KNGA 2LQQA 5COHA 2VLVA 2PERA 3DVWA 1V9WA 2H1BA 4GSTA 4OMVA 1BJXA 1WRYA 3E0UA 2H72A 1YY7A 3L4NA 4TXVA 4OWYA 1WE0A 3BD2A 4L0WA 3IR4A 4ZBBA 3RBTA 2WJUA 1GL8A 1NM3A 2A4VA 2H66A 3LEFA 4IS0A 2KUCA 4L8EA 2MZCA 1DE2A 2MMOA 1B4QA 3KMOA 4O92A 4IHUA 5D9TA 2MMZA 5FT3A 4YQVA 4NMUA 2R5GA 4AGSA 4D73A 5IPGA 3K8NA 4KUNA 4G9HA 5DAKA 4OO4A 12GSA 1GSYA 2GT6A 1B4PA 4EVMA 3TOUA 2RUEA 1TRVA 1Z7RA 2K9FA 2REMA 5KEJA 2CAQA 1F37A 3N5OA 5HR0A 1JZDA 3CRUA 3F0IA 2LKUA 2YN1A 5ECPB 1PL1A 2NBSA 4AJ7A 3HXSA 4F2IA 3PH9A 3CBUA 2L5LA 2NPBA 2FY6A 2VLTA 5IMAA 1QUWA 1J9BA 1A0FA 2DJJA 5ECNB 2CV4A 1GTIA 2GTUA 3KD0A 4NAXA 4IGJA 5F8BA 1AQXA 2JU5A 5B6MA 5CREA 5JWQB 2OBKA 1EOHA 1ST9A 1XZOA 2FGXA 4KB3A 2EIOA 3HKRA 1XXUA 2QGVA 3GL5A 3L0HA 1V40A 3HA9A 2FHEA 2H73A 1O8WA 2WZ9A 3GSSA 3F4RA 3DD3A 1OC9A 1T4ZA 1HQOA 2V2GA 5H5SA 1UC7A 4GXZA 3L9UA 4WBRD 5ID2B 4I97A 3GX0A 2YWOA 1THOA 3FZ9A 5J4UA 3LXZA 4QL7A 4GF0A 1Z6MA 4TXOA 4PGTA 4MH3A 3G7YA 4J57E 3ZFBA 3GKXA 2HYXA 2PVQA 1M99A 4TR1B 4ILFA 2LRTA 1JLWA 5DVBA 2B7JA 1RK4A 5CNWA 2GQMA 3G7IA 4LLRA 3MAKA 1DBYA 2X8GA 2GVPA 4ECCA 4IN0A 2FUG2 3F8UA 1FG4A 5G1KA 3O3TA 3I6AA 4HQSA 4POKA 3GH6A 1M2DA 3RDWA 2HE3A 2E7PA 1LU4A 3HVVA 4WETA 1RQMA 2IWTA 3DKSA 4ZB9A 2VL2C 4IJ3A 1O8XA 1VF3A 2RIIA 4DSSA 2GQKA 5IMDA 3FZ5A 3VLNA 3ZZXA 5HR1A 19GSA 4FYUA 2H1AA 2L4CA 1CQGA 2JZTA 4OCEA 1N2AA 17GSA 3QOUA 3UOMA 2XPEA 2E2GA 4POBA 1AAZA 2H19A 3TJJA 1K3OA 1R4WA 4HZ2A 3GV1A 2C0GA 4BA7A 4KGIA 1FW1A 2WDUA 3D0ZA 4TVEA 1AQVA 3WGXA 3TGZA 3ZTLA 2VCXA 2GGTA 4HOJA 1R26A 5IMFA 3J7Yk 2V6KA 3IK7A 1ABAA 3ZLPA 1QGVA 5JWRB 3IAS2 5CRDA 2LJAA 3GTUA 1O85A 3LORA 1SYXA 5J3RA 2FWHA 1WMJA 2ES7A 3M3MA 3D6IA 2LS5A 4PQIA 4IJIA 3ZL5A 4BVYA 5ENUA 5B8AA 2HXKA 2H6YA 4WEYA 4MJBA 4MJCA 3GIXA 3QAVA 1NHYA 1ZMAA 4Q5NA 3TB2A 14GSA 3C1SA 2GSQA 3GUSA 1F3AA 1O81A 1ZOFA 1BG5A 2KHPA 1TRWA 4Q5QA 4RI6A 1ILOA 2YOIA 5ABRA 4HU9A 3TRXA 5D73A 5CRWA 2LRNA 1XVQA 2AYTA 5AISA 4KSOA 2OE1A 2CVBA 1B8XA 4K7OA 3ZIJA 1AUCA 4MP4A 3EMXA 3BCKA 1FVKA 2GSRA 3L78A 1ZZYA 3CTFA 2IMIA 4I8BA 3APOA 4EXJA 2VL2A 3UJ1A 3GKKA 2R2JA 3A3TA 3IDVA 4OFMA 1H4OA 3LYKA 2Z9SA 2PU9C 4G19A 2N5FA 4HU7A 5CAXA 2R37A 1XFLA 2C80A 1JZWA 2X8CA 1TTZA 1ERWA 3A2WA 5HFGA 4I6XA 3UAPA 3KXOA 2GT5A 3TKQA 1B9XC 4TW5A 2H1GA 1M2BA 10GSA 2XHFA 3IHQA 2K8SA 2QC7A 1EOGA 1U3IA 2VLUA 4XRDA 2VM2A 3HJOA 3QFAC 5DJLA 3UMAA 3KJYA 4KX4A 5H5RA 1JHBA 5ID2A 2WULA 5D93A 2O87A 2DBCA 1MEKA 2OACA 4HJMA 1FO5A 5G31A 1SK0A 4HUAA 1XPVA 2DSAA 3QCPA 1EV9A 4X0XA 3GSTA 3UVTA 2O7KA 4WKWA 3F9UA 5G2ZA 2PN8A 3ZRDA 4TR1A 3IAM2 2VCQA 7GSSA 2C8UA 2IMEA 3RPNA 4BVXA 4K0GA 2VM1A 1ZL9A 2VL3A 1J0FA 3F4SA 2IL3A 1TKDB 1HYUA 3G7JA 3TOTA 2R4VA 5CO3A 1OAZA 1PKZA 2VCWA 2IMKA 2I9HA 2QKEA 1SKRB 2JSZA 2K18A 5AIVA 5J5NA 3A2XA 2F51A 2GLRA 1A2LA 1XCCA 5DQYA 2CAIA 2HI7A 4TRXA 3IBHA 4E8HA 2DIZA 3CRTA 5FHIA 1C72A 5CP1A 2H0IA 4IP6A 2L6CA 3GH9A 1R5AA 4GWRA 5KN1A 2GDRA 4QQ7A 1TK8B 4ECIA 1K0AA 4MZBA 2JZRA 4PQHA 4AF2A 3OR5A 1TK5B 2AUVA 2LJKA 2PGTA 1FB0A 1BAYA 4JE1A 3HZ8A 6GSTA 2FA8A 2HFDA 5HR3A 5CRGA 1N8JA 2DC5A 3FKFA 3HYPA 3DYRA 1GSSA 2H76A 2YWMA 2I3YA 1ON4A 1AQWA 5DJMA 2KP2A 3BJ5A 4IKHA 4NHWA 5AN1A 1BYEA 4XRAA 5G30A 1GTUA 1XOAA 3IPZA 3D22A 3H8QA 2H70A 2JSYA 4OCFA 2WRTA 2ON5A 6GSYA 1G6WA 2VD0A 2CX3A 4KE3A 5JCWA 1QMVA 3DEXA 16GSA 3FHKA 2OJLA 4PX1A 3IK9A 1IYIA 1U87A 1K0BA 4IELA 2RLIA 2JACA 2ZCTA 3GN3A 2VL9A 2N5BA 1ERVA 3VWUA 2NTOA 4BWQA 3C71A 2TRCP 4ZXGA 6GSUA 2LNTA 4N0VA 5GZZB 2EIQA 4K0NA 2AJQB 2B5XA 4WF5A 1PMTA 3G9BA 4GLTA 3KP9A 11GSA 4GQCA 3M8NA 4NV5A 2VUPA 4JR6A 5D96A 1R5PA 2VCTA 2EIRA 2XPDA 2NDOA 3FR6A 5LCZA 3AY8A 3ERWA 4JBBA 2ZUPA 3W8SA 3LJRA 3Q19A 3MDKA 3SBCA 1MTCA 2DLXA 4MPGA 4AJ8A 2M80A 5ECKB 1GUKA 2H0HA 3GL3A 1S3DA 1K0DA 1NW2A 1SK2A 1JZOA 4V1Ap 4ID0A 3KEBA 4XIHA 2OKAA 3ZREA 3S9FA 3HDCA 2B7KA 1XW9A 1QQ2A 3F6DA 2DJ3A 1EGOA 3HZ4A 1HD2A 4HI7A 3ZMKA 1W89A 2N5AA 3PGTA 3D5JA 4HS1A 5DQSA 3A2VA 4OO5A 1K3YA 1G0TA 1XVWA 3SWLA 2H74A 1GNEA 2YZUA 4RQXA 4FYCA 5B7CA 2C3QA 5D9XA 1X5CA 4CHSA 3HVXA 2FWEA 3CMIA 5D9WA 4KSMA 4MPFA 1JFUA 2PMTA 4I2TA 2MMNA 4LL4B 5D8IA 4EO3A 2FWGA 2I81A 1TI3A 3UL3A 3KZQA 1PD21 2LEGA 1ZGNA 1B48A 5LNKe 1TP9A 1MDJA 1Z7PA 4GCIA 4E8EA 3U6VA 3LYPA 5DDLA 1A0RP 5JCUA 3VI7A 3P7XA 2RUFA 1PKWA 2CQ9A 1MD3A 1OKTA 5F0GA 3FK8A 4MDCA 4X43A 5INYA 5A4UA 1TI1A 1CQHA 1EP7A 1V57A 3KCMA 4MJAA 3APQA 5GAND 4K9ZA 3TJGA 3EE2A 1GTAA 5KN2A 4TR4A 2F9SA 3P8WA 3FEUA 3UBKA 5E4WA 1ACVA 4K1FA 4KNDA 5JWOB 2IFQB 4ZIJA 1YEPA 3VPQA 3HVSA 2YPMA 3ZVJD 2YWNA 4HDEA 1I9DA
chains in the Genus database with same CATH superfamily
1YKCA 5DCHA 1XBSA 4YQMA 1O73A 4MZWA 4TOPA 1OVNA 1SU9A 2HSMA 2X99A 3LXTA 3CQFA 2QSIA 3VWWA 5J41A 4DSRA 3H4KA 3QD9A 4KAEA 2R3XA 4ZL8A 3O6TA 2L5OA 1OYJA 5IMVA 1Y25A 2LUSA 1OC3A 2LRCA 2KLXA 3DVXA 1X5DA 5H5QA 1KBNA 1MDIA 3TDGA 3Q6OA 1IYHA 4XS6A 4Z2TA 4EIPA 3I43A 3VWXA 3GNJA 1YDKA 1WP0A 1Z6NA 3RPPA 4YAVA 2YCDA 4LA1A 1X9WB 1QK8A 3R2QA 1URMA 4G10A 4YAPA 4WR5A 2V6OA 3I9V2 5EPFA 1G6YA 4ECJA 3ME7A 2H6ZA 22GSA 4WF4A 2CZ3A 3ED3A 1GWCA 2LJRA 1X0RA 3ERGA 4G0IA 4MA9A 2IPAA 1QFNA 3KTBA 3C7MA 5ECRB 3ZFLA 3EYTA 1A8LA 2DJ0A 3O76A 5FWGA 4HZ4A 2B6MA 5GAPD 1KTEA 2O85A 4NV2A 4LMVA 4AJ6A 5ELGA 4DVCA 2B5YA 4X1UA 3LG6A 2GSTA 2D2ZA 1U88A 3FW2A 2OE3A 2H75A 2E0QA 5DALB 3TJKA 1ML6A 2WB9A 2L59A 3KTLA 4GRFA 2FA4A 4POLA 5IQYA 2C1YA 2OA7A 13GSA 1B9YC 1WPIA 3EVIA 2AHEA 4EC0A 1TJDA 3NOFA 5CRHA 2K8VA 3C73A 2HZEB 4PQ1A 5HFKA 3LW9A 1JZRA 6GSXA 5C00A 1WWJA 3DGQA 3QAGA 4F03A 2HRFA 1FOHA 1NHOA 2IIYA 2F8FA 2IMFA 1XWKA 1UVZA 4Z7XA 5G5FA 2L4QA 1XWBA 1BX9A 4ZILA 1SL0B 2H30A 3RAZA 5ECMB 4X4JA 4BIKA 4XS1A 1O7UA 4HJ2A 1G7OA 2QA2A 3I69A 2VO4A 1GRXA 5A4VA 2A2SA 3FYGA 4F0BA 3M9JA 1SJZA 2GZZA 2G0FA 4TN8A 1Z9HA 2MBTA 5DBQA 4DSQA 2AV4A 3QAWA 1SD9A 3IA1A 1Z3EA 4ZB8A 1PQNA 3JAMI 6GSVA 3HCZA 3WT2A 1ZYQB 4XS4B 3KH7A 5AGYA 1M2AA 3TUEA 5IPHA 2J9HA 4MLYA 2CVKA 4MMMA 4KW6A 1I5GA 2V41A 2CX4A 1F6MC 1MDKA 1OKDA 1JLVA 1M3JA 2J23A 3EINA 3LSZA 3GA4A 2P0GA 3GHAA 1DUGA 1V2AA 1XW5A 1PSQA 2F3MA 2GZPA 2VOCA 3EC3A 4CDOA 2DJ2A 4MNNA 5F06A 2IFQA 1GH2A 5LD0A 2EC4A 5HFIA 2YNXA 1U3AA 5F05A 3VWVA 4PTSA 4YQUA 2RM5A 1ZCPA 4EE0A 3TRQA 2CZ2A 5J9CA 3ZMLA 1FB6A 8GSSA 1PX7A 4POMA 1MD4A 3F63A 5G1LA 3WD6A 4ACSA 1A23A 5IM9A 1A2JA 1OE8A 4MF6A 1V98A 2P5QA 1YJ6A 2HZFA 1A2MA 4J2FA 1QXHA 4RUVA 1J08A 2H6XA 1TDIA 2B1LA 2IMDA 1GSDA 3WYWA 3EWLA 2M46A 1LBKA 1W4VA 3BBYA 1T7PB 1SYRA 4ZL9A 3C8EA 1E6BA 4K2DA 3QPMA 1T4YA 1V58A 1VRSD 5IOXA 4QL9A 3IE3A 2C4JA 3UBLA 2HLSA 3KGKA 4ZB6A 4ECBA 4BVYB 3FZAA 2XBIA 4BL7B 1AIUA 3F6FA 1YF1A 5EVOA 1AXDA 1SJ6A 3MWHA 2MMAA 1ERUA 1LJRA 3WGEA 2KP1A 5KN0A 2H0GA 2V32A 4N0ZA 2R6KA 3QDNA 4JR4A 1TRSA 4PUFC 3J7Yb 2PPTA 1H75A 4PNFA 2HRNA 5ECIB 2GSSA 4P3YB 1TOFA 1T8EB 1GUMA 2HSHA 3QR6A 1SK1A 4CW9A 4HEA2 4ISDA 4RQRA 3H79A 5C04A 1SL1B 3HD5A 2H01A 2WGRA 3QMXA 2VD1A 1SJIA 2FCHA 5DALA 5ECQB 3HHVA 4TR0A 4Q5RA 3BCIA 3GKMA 1SKSB 4ULXA 4YKFA 3TRPA 3HY2A 2E2MA 3FR3A 3EMPA 3VURA 4USSA 1PX6A 4LL1B 4F0CA 3CSIA 5KN3A 2I4AA 3KP8A 1FHEA 4IVFA 2HZEA 2VAFA 3L9SA 1HNAA 3F3RA 2MYGA 1TRUA 4L5OA 4NHZA 3ZIVA 1OE7A 2GS3A 5IO2A 5CYYA 1Z5YE 2LTKA 1GP1A 2YJHA 5A4WA 1YZXA 3N9JA 4JU5A 2LQOA 1YQ1A 4XHMA 2K6VA 1EZKA 1FVJA 4I5QA 1UA5A 2C3TA 2VCZA 3IC8A 5GSTA 1XIYA 2WS2A 4WR4A 3ME8A 1TXXA 4EKZA 1SL2B 2L57A 3MYDA 4IW9A 4PXOA 1R7HA 3KMNA 1GSUA 1M9BA 4PURA 2DKHA 2OBIA 4OD7A 4Q5FA 1K0CA 1X5EA 2VIMA 3IXRA 1E2YA 2OADA 3TCOA 1YF0A 3E3EA 2H8LA 2G2QA 5E59A 2DIYA 2FWFA 4BWSA 3GURA 5HQPA 4BVXB 4I2UA 1FOVA 2GQLA 5ECSA 3P90A 4PNGA 5G5EA 5F07A 4XS4A 1SENA 2O89A 2HRAA 4Z2RA 4WXTA 2P31A 2F8AA 5IMZA 3TJBA 2I1UA 1GTBA 2IN3A 3NZNA 4MF7A 3EU4A 3CTGA 1XW6A 2CA8A 2C0FA 1X9MB 4BPYA 3F3QA 3H1NA 2P5RA 5EL8A 2JL4A 4KDUA 5LL6V 1AW9A 3UVHA 1GULA 3D4TA 2V1MA 2YV7A 1X9SB 3D4MA 3WT1A 2DMLA 1S3CA 5IIZA 4RI7A 1O6JA 4IQAA 2X8HA 4K2XA 4XCSA 2BTOT 3JCML 2YP6A 1XWCA 4K6XA 3TKRA 4NPBA 2ON7A 3Q74A 3GKNA 1DE1A 1ZYNA 2YWIA 2OE0A 2YJ7A 5JCGA 1M0UA 1TK0B 3GFKA 4YKGA 3LWAA 1PRXA 2PVOC 2WFCA 2YZHA 4PUAA 1T3BA 9GSSA 1TW9A 2XC2A 2LSTA 1PGTA 3E9JB 1TU8A 3VPTA 4F82A 3W6GA 1WIKA 2B1KA 1RW1A 1GLQA 3L9VA 4J56E 4O32A 4YH2A 2B3SA 2ALBA 1K0NA 2BJXA 1S3AA 5A5KA 1SD8A 5L71A 3PPUA 1GUHA 1K3LA 1SKWB 2MBSA 2KOKA 3PINA 4FO5A 1Q98A 4TR3A 5B6NA 1FAAA 2M72A 5ECHB 4BL7A 4L0UA 3FRCA 3DIEA 3ZYWA 4GSSA 1YEXA 4TKYA 3V1WA 3GYKA 5FLXI 4DEJA 2R0GA 3QFBC 1EWXA 1KEBA 3US3A 5EY6A 4GQFA 2YV9A 4Z2UA 1PA3A 4D73B 3CXGA 4MABA 5DAKB 4OFNA 2JADA 3TKPA 1XWAA 3DRNA 18GSA 1Q4JA 1U6TA 1AC1A 3HJMA 4V1Ag 4OFTA 5B8BA 4N30A 1THXA 1M7TA 4KDXA 3TKSC 3DMLA 2XBQA 3NIVA 1XOBA 2GZYA 4G2EA 4MZCA 1OC8A 3FZ4A 4FH8A 2C3NA 4KCEA 4A5PA 4MH2A 3F4TA 4IP1A 4N11A 4K5RA 4ZBDA 1K0OA 4EDZA 1USBA 5AIXA 4KDYA 5DCGA 4LMWA 3VFIA 1HNCA 3ISOA 3LGCA 4K7NA 3ERFA 4K7IA 2A2RA 5ELAA 4KA0A 3W8JA 2A4HA 3IHGA 5J9BA 3U5RE 4MK3A 3VK9A 4FYBA 3M1GA 4ML1A 2JZSA 4H86A 2CVDA 2DKIA 2TRXA 1A24A 2FLSA 3UARA 1OC9B 1VF2A 3WGDA 3ZITA 3M9KA 1NSWA 3P2AA 1EGRA 3MSZA 3UIWA 2WCIA 3Q18A 4NXIA 1F3BA 1EEJA 5D9VA 3IOSA 1GNWA 4NWYA 4TXOB 1UN2A 4O5RA 3H93A 3M0FA 5GSSA 3GX8A 1ERTA 3HJPA 2LNSA 3ZVJA 1XWGA 3CYNA 3LFLA 1Y6EA 1F9MA 1ZYEA 2NVLA 3CSJA 5IO0A 2AB6A 4ZBAA 4MJEA 3TKSE 1GLPA 3GRXA 4V2LA 1YKAA 4GTUA 2YANA 4EDYA 5KOWA 4XTSA 3DWVA 1VGLA 3KIJA 20GSA 4V2MA 2DJKA 3C1RA 3DXBA 2PUKC 4EUYA 2X64A 4IQ1A 3EU3A 3IRAA 4HQZA 6GSWA 4N10A 1BQ7A 3UEMA 1GSEA 2BMXA 4EF0A 4MCUA 1PL2A 2B5EA 1PN0A 3VI5A 1G7EA 1EV4A 2PWJA 3EURA 4DSSB 2FNOA 3IC4A 2VCVA 1EP8A 2H1DA 2H71A 3HVNA 1T00A 1M9AA 4MF5A 2DJ1A 3BOAA 4ML6A 3RHCA 3TKSA 1GSFA 3PR8A 5IMCA 1PN9A 3CSHA 2O8VB 1WJKA 4F9ZA 3IV4A 1WOUA 2L6DA 2PBJA 2HNLA 2LV3A 2TIRA 2C0EA 4GSNA 1DSBA 4V2NA 6GSSA 4L5LA 4JRRA 4O7HA 5IOWA 1F2EA 4FIWA 1VF4A 3TJFA 2AAWA 3FR9A 2DMMA 5ECLB 2RM6A 4JEDA 3GMFA 3KH9A 4EL1A 3APSA 2FD3A 1EEMA 1TU7A 1A8YA 4G0LA 2HT9A 3FY7A 2HSYA 4ZL7A 1GSQA 3KM6A 1K0MA 3LQ7A 3GTUB 4WBJA 1BEDA 1VF1A 1T1VA 2CT6A 4IBPA 5HR2A 2C0DA 3RHBA 4K8MA 3A5WA 4KH7A 3D21A 3MNGA 5ECOB 4JZQA 1HNBA 2ZNMA 4KCAA 2IJYA 1KNGA 2LQQA 5COHA 2VLVA 2PERA 3DVWA 1V9WA 1XG8A 4FQUA 2H1BA 4GSTA 4OMVA 1BJXA 1WRYA 1M3IA 3E0UA 5KOXA 2H72A 1YY7A 1ZYPA 3L4NA 4TXVA 4OWYA 1WE0A 3BD2A 4L0WA 3IR4A 4ZBBA 3RBTA 2WJUA 1GL8A 1NM3A 2A4VA 2H66A 3LEFA 4IS0A 2KUCA 4L8EA 2MZCA 1DE2A 2MMOA 1B4QA 3KMOA 4O92A 4IHUA 5D9TA 2MMZA 5FT3A 4YQVA 4NMUA 2R5GA 4AGSA 4D73A 5IPGA 3K8NA 4KUNA 4G9HA 4OO4A 5DAKA 12GSA 1GSYA 2GT6A 1B4PA 4EVMA 3TOUA 2RUEA 1TRVA 1Z7RA 2K9FA 2REMA 5KEJA 2CAQA 1F37A 3N5OA 5HR0A 1JZDA 3CRUA 3F0IA 2LKUA 2YN1A 5ECPB 1PL1A 2NBSA 4AJ7A 3HXSA 4F2IA 3PH9A 3CBUA 2L5LA 2NPBA 2FY6A 2VLTA 5IMAA 1QUWA 1J9BA 1A0FA 2DJJA 5ECNB 2CV4A 1GTIA 2GTUA 3KD0A 4NAXA 4IGJA 5F8BA 1AQXA 2JU5A 5B6MA 5CREA 5JWQB 2OBKA 1EOHA 1ST9A 1XZOA 2FGXA 4KB3A 2EIOA 3HKRA 1XXUA 1S3RA 2QGVA 3GL5A 3L0HA 1V40A 5IT9I 3HA9A 2FHEA 2H73A 1O8WA 2WZ9A 3GSSA 3F4RA 3DD3A 1OC9A 1T4ZA 1HQOA 2V2GA 5H5SA 1UC7A 4GXZA 3L9UA 4WBRD 5ID2B 4I97A 3GX0A 2YWOA 1THOA 3FZ9A 5J4UA 3LXZA 4QL7A 4GF0A 1Z6MA 4TXOA 4PGTA 4MH3A 3G7YA 4J57E 3ZFBA 3GKXA 2HYXA 2PVQA 1M99A 4TR1B 4ILFA 2LRTA 1JLWA 5DVBA 2B7JA 1RK4A 5CNWA 2GQMA 3G7IA 4LLRA 3MAKA 1DBYA 2X8GA 2GVPA 4ECCA 4IN0A 2FUG2 3F8UA 1FG4A 3FMWA 5G1KA 3O3TA 3I6AA 4HQSA 4POKA 3GH6A 1M2DA 3RDWA 2HE3A 2E7PA 1LU4A 3HVVA 4WETA 1RQMA 2IWTA 3DKSA 4ZB9A 2VL2C 4IJ3A 1O8XA 1VF3A 2RIIA 4DSSA 2GQKA 5IMDA 3FZ5A 3VLNA 3ZZXA 2R0PA 5HR1A 19GSA 4FYUA 2H1AA 2L4CA 1CQGA 2JZTA 4OCEA 3J81I 1N2AA 5A2QI 17GSA 3QOUA 3UOMA 2XPEA 2E2GA 4POBA 1AAZA 2H19A 3TJJA 1K3OA 1R4WA 4HZ2A 4CY8A 3GV1A 2C0GA 4BA7A 4KGIA 1FW1A 2WDUA 3D0ZA 4TVEA 1AQVA 3WGXA 3TGZA 3ZTLA 2VCXA 2GGTA 4HOJA 1R26A 5IMFA 3J7Yk 2V6KA 3IK7A 1ABAA 3ZLPA 1QGVA 5JWRB 3IAS2 5CRDA 2LJAA 3GTUA 4CY6A 1O85A 3LORA 1SYXA 5J3RA 2FWHA 1WMJA 2ES7A 3M3MA 3D6IA 2LS5A 3MIXA 4PQIA 2X49A 4IJIA 3ZL5A 4BVYA 5ENUA 5B8AA 2HXKA 2H6YA 4WEYA 4MJBA 4MJCA 3GIXA 3QAVA 1NHYA 1ZMAA 4Q5NA 3TB2A 14GSA 3C1SA 2GSQA 3GUSA 1F3AA 1O81A 1ZOFA 1BG5A 4KF9A 2KHPA 1TRWA 4Q5QA 4RI6A 1ILOA 2YOIA 5ABRA 4HU9A 3TRXA 5D73A 1PFOA 5CRWA 2LRNA 1XVQA 2AYTA 5AISA 4KSOA 2OE1A 2CVBA 1B8XA 4K7OA 3ZIJA 1AUCA 4MP4A 3EMXA 3BCKA 1FVKA 2GSRA 3L78A 1ZZYA 2QA1A 3CTFA 2IMIA 4I8BA 3APOA 4EXJA 2VL2A 3UJ1A 3EPTA 3GKKA 2R2JA 3A3TA 3IDVA 4OFMA 1H4OA 3LYKA 2Z9SA 2PU9C 4G19A 2N5FA 4HU7A 5CAXA 2R37A 1XFLA 2C80A 1JZWA 2X8CA 1TTZA 1ERWA 3A2WA 5HFGA 4I6XA 3UAPA 3KXOA 2GT5A 3TKQA 1B9XC 4TW5A 2H1GA 1M2BA 10GSA 2XHFA 3IHQA 2K8SA 2QC7A 1EOGA 1U3IA 2VLUA 4XRDA 2VM2A 3HJOA 3QFAC 5DJLA 4O5QA 2A2PA 3UMAA 3KJYA 4KX4A 5H5RA 1JHBA 5ID2A 2WULA 4EIQA 5D93A 2O87A 2DBCA 1MEKA 2OACA 4HJMA 1FO5A 5G31A 1SK0A 2HRKA 2X4AA 4HUAA 1XPVA 2DSAA 3QCPA 1EV9A 4X0XA 3GSTA 3UVTA 2O7KA 4WKWA 3F9UA 5G2ZA 2PN8A 3ZRDA 4TR1A 3IAM2 2VCQA 7GSSA 2C8UA 2IMEA 3RPNA 4BVXA 4K0GA 2VM1A 1ZL9A 2VL3A 1J0FA 3F4SA 2IL3A 1TKDB 1HYUA 3G7JA 3TOTA 2R4VA 5CO3A 1OAZA 1PKZA 2VCWA 2IMKA 2I9HA 2QKEA 1SKRB 2JSZA 2K18A 5AIVA 5J5NA 3A2XA 5BMUA 2F51A 4K5SA 2GLRA 1A2LA 1XCCA 5DQYA 2CAIA 2HI7A 4TRXA 3IBHA 4E8HA 2DIZA 3CRTA 5FHIA 1C72A 3J80I 5CP1A 2H0IA 4IP6A 2L6CA 3GH9A 1R5AA 4GWRA 5KN1A 2GDRA 4QQ7A 1TK8B 4O5UA 4ECIA 1K0AA 4MZBA 2JZRA 4PQHA 4AF2A 3OR5A 1TK5B 2AUVA 2LJKA 2PGTA 1FB0A 1BAYA 4JE1A 3HZ8A 4G0KA 6GSTA 2FA8A 2HFDA 5HR3A 5CRGA 1N8JA 2DC5A 3FKFA 3HYPA 2R0CA 3A5IA 3DYRA 1GSSA 2H76A 2YWMA 2I3YA 1ON4A 1AQWA 5DJMA 2KP2A 3BJ5A 4IKHA 4NHWA 5AN1A 1BYEA 4XRAA 5G30A 1GTUA 1XOAA 3IPZA 3D22A 4ICYA 3H8QA 2H70A 2JSYA 4OCFA 2WRTA 2ON5A 6GSYA 1G6WA 2VD0A 2CX3A 4KE3A 5JCWA 1QMVA 3DEXA 16GSA 3FHKA 2OJLA 4PX1A 3R3EA 3IK9A 1IYIA 1U87A 1K0BA 4IELA 2RLIA 2JACA 2ZCTA 3GN3A 2VL9A 2N5BA 1ERVA 3VWUA 2NTOA 4BWQA 3C71A 2TRCP 4ZXGA 6GSUA 2LNTA 4N0VA 5GZZB 2EIQA 4K0NA 2AJQB 2B5XA 4WF5A 1PMTA 3G9BA 4GLTA 3KP9A 11GSA 4GQCA 3M8NA 4NV5A 2VUPA 4JR6A 5D96A 1R5PA 2VCTA 2EIRA 2XPDA 2NDOA 3FR6A 5LCZA 3AY8A 3ERWA 4JBBA 2ZUPA 3W8SA 3LJRA 3Q19A 3MDKA 3SBCA 2UZ8A 1MTCA 2DLXA 4MPGA 4AJ8A 2M80A 5ECKB 1GUKA 2H0HA 3GL3A 1S3DA 1K0DA 1NW2A 1SK2A 1JZOA 4V1Ap 4ID0A 3KEBA 4XIHA 2OKAA 3ZREA 3S9FA 3HDCA 2B7KA 1XW9A 1QQ2A 3F6DA 2DJ3A 1EGOA 3HZ4A 1HD2A 4HI7A 3ZMKA 5BRTA 1W89A 2N5AA 3PGTA 3D5JA 4HS1A 5DQSA 3A2VA 4OO5A 1K3YA 1G0TA 1XVWA 3SWLA 2H74A 1GNEA 2YZUA 4RQXA 4FYCA 5B7CA 2C3QA 5D9XA 1X5CA 4CHSA 3HVXA 2FWEA 3CMIA 5D9WA 4KSMA 4MPFA 1JFUA 2PMTA 4I2TA 4HSCX 2MMNA 4LL4B 5D8IA 4EO3A 2FWGA 2I81A 1TI3A 3UL3A 3KZQA 1PD21 2LEGA 1ZGNA 1B48A 5LNKe 1TP9A 1MDJA 1Z7PA 4GCIA 4E8EA 3U6VA 3LYPA 5DDLA 1A0RP 5JCUA 3VI7A 3P7XA 2RUFA 1PKWA 2CQ9A 1MD3A 1OKTA 5F0GA 3FK8A 4MDCA 4X43A 5INYA 5A4UA 1TI1A 1CQHA 1EP7A 1V57A 3KCMA 4MJAA 3APQA 5GAND 4K9ZA 3TJGA 3EE2A 1GTAA 5KN2A 4TR4A 2F9SA 3P8WA 3FEUA 3UBKA 5E4WA 1ACVA 4K1FA 4KNDA 5JWOB 2IFQB 4ZIJA 1YEPA 3VPQA 3HVSA 2YPMA 3ZVJD 2YWNA 4HDEA 1I9DA
chains in the Genus database with same CATH topology
1YKCA 5DCHA 1XBSA 4YQMA 1O73A 4MZWA 4TOPA 1OVNA 1SU9A 2HSMA 2X99A 3LXTA 2QSIA 3VWWA 5J41A 4DSRA 3H4KA 3QD9A 4KAEA 2R3XA 4ZL8A 3O6TA 2L5OA 1OYJA 5IMVA 1Y25A 2LUSA 1OC3A 2LRCA 2KLXA 3DVXA 1X5DA 5H5QA 1KBNA 1MDIA 3TDGA 3Q6OA 1IYHA 4XS6A 4Z2TA 4EIPA 3I43A 3VWXA 3GNJA 1YDKA 1WP0A 1Z6NA 3RPPA 4YAVA 2YCDA 4LA1A 1X9WB 1QK8A 3R2QA 1URMA 4G10A 4YAPA 4WR5A 2V6OA 3I9V2 5EPFA 1G6YA 4ECJA 3ME7A 2H6ZA 22GSA 4WF4A 2CZ3A 3ED3A 1GWCA 2LJRA 1X0RA 3ERGA 4G0IA 4MA9A 2IPAA 1QFNA 3KTBA 3C7MA 5ECRB 3ZFLA 3EYTA 1A8LA 2DJ0A 3O76A 5FWGA 4HZ4A 2B6MA 5GAPD 1KTEA 2O85A 4NV2A 4LMVA 4AJ6A 5ELGA 4DVCA 2B5YA 4X1UA 3LG6A 2GSTA 2D2ZA 1U88A 3FW2A 2OE3A 2H75A 2E0QA 5DALB 3TJKA 1ML6A 2WB9A 2L59A 3KTLA 4GRFA 2FA4A 4POLA 5IQYA 2C1YA 2OA7A 13GSA 1B9YC 1WPIA 3EVIA 2AHEA 4EC0A 1TJDA 3NOFA 5CRHA 2K8VA 3C73A 2HZEB 4PQ1A 5HFKA 3LW9A 1JZRA 6GSXA 5C00A 1WWJA 3DGQA 3QAGA 4F03A 2HRFA 1FOHA 1NHOA 2IIYA 2F8FA 2IMFA 1XWKA 1UVZA 4Z7XA 5G5FA 2L4QA 1XWBA 1BX9A 4ZILA 1SL0B 2H30A 3RAZA 5ECMB 4X4JA 4XS1A 1O7UA 4HJ2A 1G7OA 2QA2A 3I69A 2VO4A 1GRXA 5A4VA 2A2SA 3FYGA 4F0BA 3M9JA 1SJZA 2GZZA 2G0FA 4TN8A 1Z9HA 2MBTA 5DBQA 4DSQA 2AV4A 3QAWA 1SD9A 3IA1A 1Z3EA 4ZB8A 1PQNA 6GSVA 3HCZA 3WT2A 1ZYQB 4XS4B 3KH7A 5AGYA 1M2AA 3TUEA 5IPHA 2J9HA 4MLYA 2CVKA 4MMMA 4KW6A 1I5GA 2V41A 2CX4A 1F6MC 1MDKA 1OKDA 1JLVA 2J23A 3EINA 3LSZA 3GA4A 2P0GA 3GHAA 1DUGA 1V2AA 1XW5A 1PSQA 2F3MA 2GZPA 2VOCA 3EC3A 4CDOA 2DJ2A 4MNNA 5F06A 2IFQA 1GH2A 5LD0A 2EC4A 5HFIA 2YNXA 1U3AA 5F05A 3VWVA 4PTSA 4YQUA 2RM5A 1ZCPA 4EE0A 3TRQA 2CZ2A 5J9CA 3ZMLA 1FB6A 8GSSA 1PX7A 4POMA 1MD4A 3F63A 5G1LA 3WD6A 4ACSA 1A23A 5IM9A 1A2JA 1OE8A 4MF6A 1V98A 2P5QA 1YJ6A 2HZFA 1A2MA 4J2FA 1QXHA 4RUVA 1J08A 2H6XA 1TDIA 2B1LA 2IMDA 1GSDA 3WYWA 3EWLA 2M46A 1LBKA 1W4VA 3BBYA 1T7PB 1SYRA 4ZL9A 3C8EA 1E6BA 4K2DA 3QPMA 1T4YA 1V58A 1VRSD 5IOXA 4QL9A 3IE3A 2C4JA 3UBLA 2HLSA 3KGKA 4ZB6A 4ECBA 4BVYB 3FZAA 2XBIA 4BL7B 1AIUA 3F6FA 1YF1A 5EVOA 1AXDA 1SJ6A 3MWHA 2MMAA 1ERUA 1LJRA 3WGEA 2KP1A 5KN0A 2H0GA 2V32A 4N0ZA 2R6KA 3QDNA 4JR4A 1TRSA 4PUFC 3J7Yb 2PPTA 1H75A 4PNFA 2HRNA 5ECIB 2GSSA 4P3YB 1TOFA 1T8EB 1GUMA 2HSHA 3QR6A 1SK1A 4CW9A 4HEA2 4ISDA 4RQRA 3H79A 5C04A 1SL1B 3HD5A 2H01A 2WGRA 3QMXA 2VD1A 1SJIA 2FCHA 5DALA 5ECQB 3HHVA 4TR0A 4Q5RA 3BCIA 3GKMA 1SKSB 4ULXA 4YKFA 3TRPA 3HY2A 2E2MA 3FR3A 3EMPA 3VURA 4USSA 1PX6A 4LL1B 4F0CA 3CSIA 5KN3A 2I4AA 3KP8A 1FHEA 4IVFA 2HZEA 2VAFA 3L9SA 1HNAA 3F3RA 2MYGA 1TRUA 4L5OA 4NHZA 3ZIVA 1OE7A 2GS3A 5IO2A 5CYYA 1Z5YE 2LTKA 1GP1A 2YJHA 5A4WA 1YZXA 3N9JA 4JU5A 2LQOA 1YQ1A 4XHMA 2K6VA 1EZKA 1FVJA 4I5QA 1UA5A 2C3TA 2VCZA 3IC8A 5GSTA 1XIYA 2WS2A 4WR4A 3ME8A 1TXXA 4EKZA 1SL2B 2L57A 3MYDA 4IW9A 4PXOA 1R7HA 3KMNA 1GSUA 1M9BA 4PURA 2DKHA 2OBIA 4OD7A 4Q5FA 1K0CA 1X5EA 2VIMA 3IXRA 1E2YA 2OADA 3TCOA 1YF0A 3E3EA 2H8LA 2G2QA 5E59A 2DIYA 2FWFA 4BWSA 3GURA 5HQPA 4BVXB 4I2UA 1FOVA 2GQLA 5ECSA 3P90A 4PNGA 5G5EA 5F07A 4XS4A 1SENA 2O89A 2HRAA 4Z2RA 4WXTA 2P31A 2F8AA 5IMZA 3TJBA 2I1UA 1GTBA 2IN3A 3NZNA 4MF7A 3EU4A 3CTGA 1XW6A 2CA8A 2C0FA 1X9MB 4BPYA 3F3QA 3H1NA 2P5RA 5EL8A 2JL4A 4KDUA 1AW9A 3UVHA 1GULA 3D4TA 2V1MA 2YV7A 1X9SB 3D4MA 3WT1A 2DMLA 1S3CA 5IIZA 4RI7A 1O6JA 4IQAA 2X8HA 4K2XA 4XCSA 2BTOT 3JCML 2YP6A 1XWCA 4K6XA 3TKRA 4NPBA 2ON7A 3Q74A 3GKNA 1DE1A 1ZYNA 2YWIA 2OE0A 2YJ7A 5JCGA 1M0UA 1TK0B 3GFKA 4YKGA 3LWAA 1PRXA 2PVOC 2WFCA 2YZHA 4PUAA 1T3BA 9GSSA 1TW9A 2XC2A 2LSTA 1PGTA 3E9JB 1TU8A 3VPTA 4F82A 3W6GA 1WIKA 2B1KA 1RW1A 1GLQA 3L9VA 4J56E 4O32A 4YH2A 2B3SA 2ALBA 1K0NA 2BJXA 1S3AA 5A5KA 1SD8A 5L71A 3PPUA 1GUHA 1K3LA 1SKWB 2MBSA 2KOKA 3PINA 4FO5A 1Q98A 4TR3A 5B6NA 1FAAA 2M72A 5ECHB 4BL7A 4L0UA 3FRCA 3DIEA 3ZYWA 4GSSA 1YEXA 4TKYA 3V1WA 3GYKA 4DEJA 2R0GA 3QFBC 1EWXA 1KEBA 3US3A 5EY6A 4GQFA 2YV9A 4Z2UA 1PA3A 4D73B 3CXGA 4MABA 5DAKB 4OFNA 2JADA 3TKPA 1XWAA 3DRNA 18GSA 1Q4JA 1U6TA 1AC1A 3HJMA 4V1Ag 4OFTA 5B8BA 4N30A 1THXA 1M7TA 4KDXA 3TKSC 3DMLA 2XBQA 3NIVA 1XOBA 2GZYA 4G2EA 4MZCA 1OC8A 3FZ4A 4FH8A 2C3NA 4KCEA 4A5PA 4MH2A 3F4TA 4IP1A 4N11A 4K5RA 4ZBDA 1K0OA 4EDZA 1USBA 5AIXA 4KDYA 5DCGA 4LMWA 3VFIA 1HNCA 3ISOA 3LGCA 4K7NA 3ERFA 4K7IA 2A2RA 5ELAA 4KA0A 3W8JA 2A4HA 3IHGA 5J9BA 3U5RE 4MK3A 3VK9A 4FYBA 3M1GA 4ML1A 2JZSA 4H86A 2CVDA 2DKIA 2TRXA 1A24A 2FLSA 3UARA 1OC9B 1VF2A 3WGDA 3ZITA 3M9KA 1NSWA 3P2AA 1EGRA 3MSZA 3UIWA 2WCIA 3Q18A 4NXIA 1F3BA 1EEJA 5D9VA 3IOSA 1GNWA 4NWYA 4TXOB 1UN2A 4O5RA 3H93A 3M0FA 5GSSA 3GX8A 1ERTA 3HJPA 2LNSA 3ZVJA 1XWGA 3CYNA 3LFLA 1Y6EA 1F9MA 1ZYEA 2NVLA 3CSJA 5IO0A 2AB6A 4ZBAA 4MJEA 3TKSE 1GLPA 3GRXA 4V2LA 1YKAA 4GTUA 2YANA 4EDYA 5KOWA 4XTSA 3DWVA 1VGLA 3KIJA 20GSA 4V2MA 2DJKA 3C1RA 3DXBA 2PUKC 4EUYA 2X64A 4IQ1A 3EU3A 3IRAA 4HQZA 6GSWA 4N10A 1BQ7A 3UEMA 1GSEA 2BMXA 4EF0A 4MCUA 1PL2A 2B5EA 1PN0A 3VI5A 1G7EA 1EV4A 2PWJA 3EURA 4DSSB 2FNOA 3IC4A 2VCVA 1EP8A 2H1DA 2H71A 1T00A 1M9AA 4MF5A 2DJ1A 3BOAA 4ML6A 3RHCA 3TKSA 1GSFA 3PR8A 5IMCA 1PN9A 3CSHA 2O8VB 1WJKA 4F9ZA 3IV4A 1WOUA 2L6DA 2PBJA 2HNLA 2LV3A 2TIRA 2C0EA 4GSNA 1DSBA 4V2NA 6GSSA 4L5LA 4JRRA 4O7HA 5IOWA 1F2EA 4FIWA 1VF4A 3TJFA 2AAWA 3FR9A 2DMMA 5ECLB 2RM6A 4JEDA 3GMFA 3KH9A 4EL1A 3APSA 2FD3A 1EEMA 1TU7A 1A8YA 4G0LA 2HT9A 3FY7A 2HSYA 4ZL7A 1GSQA 3KM6A 1K0MA 3LQ7A 3GTUB 4WBJA 1BEDA 1VF1A 1T1VA 2CT6A 4IBPA 5HR2A 2C0DA 3RHBA 4K8MA 3A5WA 4KH7A 3D21A 3MNGA 5ECOB 4JZQA 1HNBA 2ZNMA 4KCAA 2IJYA 1KNGA 2LQQA 5COHA 2VLVA 2PERA 3DVWA 1V9WA 4FQUA 2H1BA 4GSTA 4OMVA 1BJXA 1WRYA 3E0UA 5KOXA 2H72A 1YY7A 1ZYPA 3L4NA 4TXVA 4OWYA 1WE0A 3BD2A 4L0WA 3IR4A 4ZBBA 3RBTA 2WJUA 1GL8A 1NM3A 2A4VA 2H66A 3LEFA 4IS0A 2KUCA 4L8EA 2MZCA 1DE2A 2MMOA 1B4QA 3KMOA 4O92A 4IHUA 5D9TA 2MMZA 5FT3A 4YQVA 4NMUA 2R5GA 4AGSA 4D73A 5IPGA 3K8NA 4KUNA 4G9HA 4OO4A 5DAKA 12GSA 1GSYA 2GT6A 1B4PA 4EVMA 3TOUA 2RUEA 1TRVA 1Z7RA 2K9FA 2REMA 5KEJA 2CAQA 1F37A 3N5OA 5HR0A 1JZDA 3CRUA 3F0IA 2LKUA 2YN1A 5ECPB 1PL1A 2NBSA 4AJ7A 3HXSA 4F2IA 3PH9A 3CBUA 2L5LA 2NPBA 2FY6A 2VLTA 5IMAA 1QUWA 1J9BA 1A0FA 2DJJA 5ECNB 2CV4A 1GTIA 2GTUA 3KD0A 4NAXA 4IGJA 5F8BA 1AQXA 2JU5A 5B6MA 5CREA 5JWQB 2OBKA 1EOHA 1ST9A 1XZOA 2FGXA 4KB3A 2EIOA 3HKRA 1XXUA 2QGVA 3GL5A 3L0HA 1V40A 3HA9A 2FHEA 2H73A 1O8WA 2WZ9A 3GSSA 3F4RA 3DD3A 1OC9A 1T4ZA 1HQOA 2V2GA 5H5SA 1UC7A 4GXZA 3L9UA 4WBRD 5ID2B 4I97A 3GX0A 2YWOA 1THOA 3FZ9A 5J4UA 3LXZA 4QL7A 4GF0A 1Z6MA 4TXOA 4PGTA 4MH3A 3G7YA 4J57E 3ZFBA 3GKXA 2HYXA 2PVQA 1M99A 4TR1B 4ILFA 2LRTA 1JLWA 5DVBA 2B7JA 1RK4A 5CNWA 2GQMA 3G7IA 4LLRA 3MAKA 1DBYA 2X8GA 2GVPA 4ECCA 4IN0A 2FUG2 3F8UA 1FG4A 3FMWA 5G1KA 3O3TA 3I6AA 4HQSA 4POKA 3GH6A 1M2DA 3RDWA 2HE3A 2E7PA 1LU4A 3HVVA 4WETA 1RQMA 2IWTA 3DKSA 4ZB9A 2VL2C 4IJ3A 1O8XA 1VF3A 2RIIA 4DSSA 2GQKA 5IMDA 3FZ5A 3VLNA 3ZZXA 2R0PA 5HR1A 19GSA 4FYUA 2H1AA 2L4CA 1CQGA 2JZTA 4OCEA 1N2AA 17GSA 3QOUA 3UOMA 2XPEA 2E2GA 4POBA 1AAZA 2H19A 3TJJA 1K3OA 1R4WA 4HZ2A 4CY8A 3GV1A 2C0GA 4BA7A 4KGIA 1FW1A 2WDUA 3D0ZA 4TVEA 1AQVA 3WGXA 3TGZA 3ZTLA 2VCXA 2GGTA 4HOJA 1R26A 5IMFA 3J7Yk 2V6KA 3IK7A 1ABAA 3ZLPA 1QGVA 5JWRB 3IAS2 5CRDA 2LJAA 3GTUA 4CY6A 1O85A 3LORA 1SYXA 5J3RA 2FWHA 1WMJA 2ES7A 3M3MA 3D6IA 2LS5A 3MIXA 4PQIA 2X49A 4IJIA 3ZL5A 4BVYA 5ENUA 5B8AA 2HXKA 2H6YA 4WEYA 4MJBA 4MJCA 3GIXA 3QAVA 1NHYA 1ZMAA 4Q5NA 3TB2A 14GSA 3C1SA 2GSQA 3GUSA 1F3AA 1O81A 1ZOFA 1BG5A 4KF9A 2KHPA 1TRWA 4Q5QA 4RI6A 1ILOA 2YOIA 5ABRA 4HU9A 3TRXA 5D73A 5CRWA 2LRNA 1XVQA 2AYTA 5AISA 4KSOA 2OE1A 2CVBA 1B8XA 4K7OA 3ZIJA 1AUCA 4MP4A 3EMXA 3BCKA 1FVKA 2GSRA 3L78A 1ZZYA 2QA1A 3CTFA 2IMIA 4I8BA 3APOA 4EXJA 2VL2A 3UJ1A 3EPTA 3GKKA 2R2JA 3A3TA 3IDVA 4OFMA 1H4OA 3LYKA 2Z9SA 2PU9C 4G19A 2N5FA 4HU7A 5CAXA 2R37A 1XFLA 2C80A 1JZWA 2X8CA 1TTZA 1ERWA 3A2WA 5HFGA 4I6XA 3UAPA 3KXOA 2GT5A 3TKQA 1B9XC 4TW5A 2H1GA 1M2BA 10GSA 2XHFA 3IHQA 2K8SA 2QC7A 1EOGA 1U3IA 2VLUA 4XRDA 2VM2A 3HJOA 3QFAC 5DJLA 4O5QA 2A2PA 3UMAA 3KJYA 4KX4A 5H5RA 1JHBA 5ID2A 2WULA 4EIQA 5D93A 2O87A 2DBCA 1MEKA 2OACA 4HJMA 1FO5A 5G31A 1SK0A 2HRKA 2X4AA 4HUAA 1XPVA 2DSAA 3QCPA 1EV9A 4X0XA 3GSTA 3UVTA 2O7KA 4WKWA 3F9UA 5G2ZA 2PN8A 3ZRDA 4TR1A 3IAM2 2VCQA 7GSSA 2C8UA 2IMEA 3RPNA 4BVXA 4K0GA 2VM1A 1ZL9A 2VL3A 1J0FA 3F4SA 2IL3A 1TKDB 1HYUA 3G7JA 3TOTA 2R4VA 5CO3A 1OAZA 1PKZA 2VCWA 2IMKA 2I9HA 2QKEA 1SKRB 2JSZA 2K18A 5AIVA 5J5NA 3A2XA 5BMUA 2F51A 4K5SA 2GLRA 1A2LA 1XCCA 5DQYA 2CAIA 2HI7A 4TRXA 3IBHA 4E8HA 2DIZA 3CRTA 5FHIA 1C72A 5CP1A 2H0IA 4IP6A 2L6CA 3GH9A 1R5AA 4GWRA 5KN1A 2GDRA 4QQ7A 1TK8B 4O5UA 4ECIA 1K0AA 4MZBA 2JZRA 4PQHA 4AF2A 3OR5A 1TK5B 2AUVA 2LJKA 2PGTA 1FB0A 1BAYA 4JE1A 3HZ8A 4G0KA 6GSTA 2FA8A 2HFDA 5HR3A 5CRGA 1N8JA 2DC5A 3FKFA 3HYPA 2R0CA 3A5IA 3DYRA 1GSSA 2H76A 2YWMA 2I3YA 1ON4A 1AQWA 5DJMA 2KP2A 3BJ5A 4IKHA 4NHWA 5AN1A 1BYEA 4XRAA 5G30A 1GTUA 1XOAA 3IPZA 3D22A 4ICYA 3H8QA 2H70A 2JSYA 4OCFA 2WRTA 2ON5A 6GSYA 1G6WA 2VD0A 2CX3A 4KE3A 5JCWA 1QMVA 3DEXA 16GSA 3FHKA 2OJLA 4PX1A 3R3EA 3IK9A 1IYIA 1U87A 1K0BA 4IELA 2RLIA 2JACA 2ZCTA 3GN3A 2VL9A 2N5BA 1ERVA 3VWUA 2NTOA 4BWQA 3C71A 2TRCP 4ZXGA 6GSUA 2LNTA 4N0VA 5GZZB 2EIQA 4K0NA 2AJQB 2B5XA 4WF5A 1PMTA 3G9BA 4GLTA 3KP9A 11GSA 4GQCA 3M8NA 4NV5A 2VUPA 4JR6A 5D96A 1R5PA 2VCTA 2EIRA 2XPDA 2NDOA 3FR6A 5LCZA 3AY8A 3ERWA 4JBBA 2ZUPA 3W8SA 3LJRA 3Q19A 3MDKA 3SBCA 2UZ8A 1MTCA 2DLXA 4MPGA 4AJ8A 2M80A 5ECKB 1GUKA 2H0HA 3GL3A 1S3DA 1K0DA 1NW2A 1SK2A 1JZOA 4V1Ap 4ID0A 3KEBA 4XIHA 2OKAA 3ZREA 3S9FA 3HDCA 2B7KA 1XW9A 1QQ2A 3F6DA 2DJ3A 1EGOA 3HZ4A 1HD2A 4HI7A 3ZMKA 5BRTA 1W89A 2N5AA 3PGTA 3D5JA 4HS1A 5DQSA 3A2VA 4OO5A 1K3YA 1G0TA 1XVWA 3SWLA 2H74A 1GNEA 2YZUA 4RQXA 4FYCA 5B7CA 2C3QA 5D9XA 1X5CA 4CHSA 3HVXA 2FWEA 3CMIA 5D9WA 4KSMA 4MPFA 1JFUA 2PMTA 4I2TA 2MMNA 4LL4B 5D8IA 4EO3A 2FWGA 2I81A 1TI3A 3UL3A 3KZQA 1PD21 2LEGA 1ZGNA 1B48A 5LNKe 1TP9A 1MDJA 1Z7PA 4GCIA 4E8EA 3U6VA 3LYPA 5DDLA 1A0RP 5JCUA 3VI7A 3P7XA 2RUFA 1PKWA 2CQ9A 1MD3A 1OKTA 5F0GA 3FK8A 4MDCA 4X43A 5INYA 5A4UA 1TI1A 1CQHA 1EP7A 1V57A 3KCMA 4MJAA 3APQA 5GAND 4K9ZA 3TJGA 3EE2A 1GTAA 5KN2A 4TR4A 2F9SA 3P8WA 3FEUA 3UBKA 5E4WA 1ACVA 4K1FA 4KNDA 5JWOB 2IFQB 4ZIJA 1YEPA 3VPQA 3HVSA 2YPMA 3ZVJD 2YWNA 4HDEA 1I9DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YKC A;  5DCH A;  1XBS A;  4YQM A;  1O73 A;  4MZW A;  4TOP A;  1OVN A;  1SU9 A;  2X99 A;  3LXT A;  2QSI A;  3VWW A;  5J41 A;  4DSR A;  3H4K A;  3QD9 A;  4KAE A;  2R3X A;  4ZL8 A;  3O6T A;  2L5O A;  1OYJ A;  5IMV A;  1Y25 A;  2LUS A;  1OC3 A;  2LRC A;  2KLX A;  3DVX A;  1X5D A;  5H5Q A;  1KBN A;  1MDI A;  3TDG A;  3Q6O A;  1IYH A;  4XS6 A;  3I43 A;  3VWX A;  3GNJ A;  1YDK A;  1WP0 A;  1Z6N A;  3RPP A;  4YAV A;  2YCD A;  4LA1 A;  1X9W B;  1QK8 A;  3R2Q A;  1URM A;  4G10 A;  4YAP A;  4WR5 A;  2V6O A;  3I9V 2;  5EPF A;  1G6Y A;  4ECJ A;  3ME7 A;  2H6Z A;  22GS A;  4WF4 A;  2CZ3 A;  3ED3 A;  1GWC A;  2LJR A;  1X0R A;  3ERG A;  4MA9 A;  2IPA A;  1QFN A;  3KTB A;  3C7M A;  5ECR B;  3ZFL A;  3EYT A;  1A8L A;  2DJ0 A;  3O76 A;  5FWG A;  4HZ4 A;  2B6M A;  5GAP D;  1KTE A;  2O85 A;  4NV2 A;  4LMV A;  4AJ6 A;  5ELG A;  4DVC A;  2B5Y A;  4X1U A;  3LG6 A;  2GST A;  2D2Z A;  1U88 A;  3FW2 A;  2OE3 A;  2H75 A;  2E0Q A;  5DAL B;  3TJK A;  1ML6 A;  2WB9 A;  2L59 A;  3KTL A;  4GRF A;  2FA4 A;  4POL A;  5IQY A;  2C1Y A;  2OA7 A;  13GS A;  1B9Y C;  1WPI A;  3EVI A;  2AHE A;  4EC0 A;  1TJD A;  3NOF A;  5CRH A;  2K8V A;  3C73 A;  2HZE B;  4PQ1 A;  5HFK A;  1JZR A;  6GSX A;  5C00 A;  1WWJ A;  3DGQ A;  3QAG A;  4F03 A;  2HRF A;  1NHO A;  2IIY A;  2F8F A;  2IMF A;  1XWK A;  1UVZ A;  4Z7X A;  5G5F A;  2L4Q A;  1XWB A;  1BX9 A;  4ZIL A;  1SL0 B;  2H30 A;  3RAZ A;  5ECM B;  4XS1 A;  1O7U A;  4HJ2 A;  1G7O A;  3I69 A;  2VO4 A;  1GRX A;  5A4V A;  2A2S A;  3FYG A;  4F0B A;  3M9J A;  1SJZ A;  2GZZ A;  2G0F A;  4TN8 A;  1Z9H A;  2MBT A;  5DBQ A;  4DSQ A;  2AV4 A;  3QAW A;  1SD9 A;  3IA1 A;  1Z3E A;  4ZB8 A;  1PQN A;  6GSV A;  3HCZ A;  3WT2 A;  1ZYQ B;  4XS4 B;  3KH7 A;  5AGY A;  1M2A A;  3TUE A;  5IPH A;  2J9H A;  4MLY A;  2CVK A;  4MMM A;  4KW6 A;  1I5G A;  2V41 A;  2CX4 A;  1F6M C;  1MDK A;  1OKD A;  1JLV A;  2J23 A;  3EIN A;  3LSZ A;  3GA4 A;  2P0G A;  3GHA A;  1DUG A;  1V2A A;  1XW5 A;  1PSQ A;  2F3M A;  2GZP A;  2VOC A;  3EC3 A;  4CDO A;  2DJ2 A;  5F06 A;  2IFQ A;  1GH2 A;  5LD0 A;  2EC4 A;  5HFI A;  2YNX A;  1U3A A;  5F05 A;  3VWV A;  4YQU A;  2RM5 A;  1ZCP A;  4EE0 A;  3TRQ A;  2CZ2 A;  5J9C A;  3ZML A;  1FB6 A;  8GSS A;  1PX7 A;  4POM A;  1MD4 A;  3F63 A;  5G1L A;  3WD6 A;  4ACS A;  1A23 A;  5IM9 A;  1A2J A;  1OE8 A;  4MF6 A;  1V98 A;  2P5Q A;  1YJ6 A;  2HZF A;  1A2M A;  4J2F A;  1QXH A;  4RUV A;  1J08 A;  2H6X A;  1TDI A;  2B1L A;  2IMD A;  1GSD A;  3WYW A;  3EWL A;  2M46 A;  1LBK A;  1W4V A;  3BBY A;  1T7P B;  1SYR A;  4ZL9 A;  3C8E A;  1E6B A;  4K2D A;  3QPM A;  1T4Y A;  1V58 A;  1VRS D;  5IOX A;  4QL9 A;  3IE3 A;  2C4J A;  3UBL A;  2HLS A;  3KGK A;  4ZB6 A;  4ECB A;  3FZA A;  2XBI A;  1AIU A;  3F6F A;  1YF1 A;  5EVO A;  1AXD A;  1SJ6 A;  3MWH A;  2MMA A;  1ERU A;  1LJR A;  3WGE A;  2KP1 A;  5KN0 A;  2H0G A;  2V32 A;  4N0Z A;  2R6K A;  3QDN A;  4JR4 A;  1TRS A;  4PUF C;  3J7Y b;  2PPT A;  1H75 A;  4PNF A;  2HRN A;  5ECI B;  2GSS A;  4P3Y B;  1TOF A;  1T8E B;  1GUM A;  2HSH A;  3QR6 A;  1SK1 A;  4CW9 A;  4HEA 2;  4ISD A;  4RQR A;  3H79 A;  5C04 A;  1SL1 B;  3HD5 A;  2H01 A;  2WGR A;  3QMX A;  2VD1 A;  1SJI A;  2FCH A;  5DAL A;  5ECQ B;  3HHV A;  4TR0 A;  4Q5R A;  3BCI A;  3GKM A;  1SKS B;  4ULX A;  3TRP A;  3HY2 A;  2E2M A;  3FR3 A;  3EMP A;  3VUR A;  1PX6 A;  4LL1 B;  4F0C A;  3CSI A;  5KN3 A;  2I4A A;  3KP8 A;  1FHE A;  4IVF A;  2HZE A;  2VAF A;  3L9S A;  1HNA A;  3F3R A;  2MYG A;  1TRU A;  4L5O A;  4NHZ A;  3ZIV A;  1OE7 A;  2GS3 A;  5IO2 A;  5CYY A;  1Z5Y E;  2LTK A;  1GP1 A;  2YJH A;  5A4W A;  1YZX A;  3N9J A;  4JU5 A;  2LQO A;  1YQ1 A;  4XHM A;  2K6V A;  1EZK A;  1FVJ A;  4I5Q A;  1UA5 A;  2C3T A;  2VCZ A;  5GST A;  1XIY A;  2WS2 A;  4WR4 A;  3ME8 A;  1TXX A;  4EKZ A;  1SL2 B;  2L57 A;  4IW9 A;  4PXO A;  1R7H A;  3KMN A;  1GSU A;  1M9B A;  4PUR A;  2OBI A;  4OD7 A;  4Q5F A;  1K0C A;  1X5E A;  2VIM A;  3IXR A;  1E2Y A;  2OAD A;  3TCO A;  1YF0 A;  3E3E A;  2H8L A;  2G2Q A;  5E59 A;  2DIY A;  2FWF A;  4BWS A;  3GUR A;  5HQP A;  4I2U A;  1FOV A;  2GQL A;  5ECS A;  3P90 A;  4PNG A;  5G5E A;  5F07 A;  4XS4 A;  1SEN A;  2O89 A;  4WXT A;  2P31 A;  2F8A A;  5IMZ A;  3TJB A;  2I1U A;  1GTB A;  2IN3 A;  3NZN A;  4MF7 A;  3EU4 A;  3CTG A;  1XW6 A;  2CA8 A;  2C0F A;  1X9M B;  4BPY A;  3F3Q A;  3H1N A;  2P5R A;  5EL8 A;  2JL4 A;  4KDU A;  1AW9 A;  3UVH A;  1GUL A;  3D4T A;  2V1M A;  2YV7 A;  1X9S B;  3D4M A;  3WT1 A;  2DML A;  1S3C A;  5IIZ A;  4RI7 A;  1O6J A;  4IQA A;  2X8H A;  4XCS A;  2BTO T;  3JCM L;  2YP6 A;  1XWC A;  4K6X A;  3TKR A;  4NPB A;  2ON7 A;  3Q74 A;  3GKN A;  1DE1 A;  2YWI A;  2OE0 A;  2YJ7 A;  5JCG A;  1M0U A;  1TK0 B;  3GFK A;  3LWA A;  1PRX A;  2PVO C;  2WFC A;  2YZH A;  4PUA A;  1T3B A;  9GSS A;  1TW9 A;  2XC2 A;  2LST A;  1PGT A;  3E9J B;  1TU8 A;  3VPT A;  4F82 A;  3W6G A;  1WIK A;  2B1K A;  1RW1 A;  1GLQ A;  3L9V A;  4J56 E;  4O32 A;  4YH2 A;  2B3S A;  2ALB A;  1K0N A;  2BJX A;  1S3A A;  5A5K A;  1SD8 A;  5L71 A;  1GUH A;  1K3L A;  1SKW B;  2MBS A;  2KOK A;  3PIN A;  4FO5 A;  1Q98 A;  4TR3 A;  5B6N A;  1FAA A;  2M72 A;  5ECH B;  4BL7 A;  4L0U A;  3FRC A;  3DIE A;  3ZYW A;  4GSS A;  1YEX A;  4TKY A;  3V1W A;  3GYK A;  4DEJ A;  3QFB C;  1EWX A;  1KEB A;  3US3 A;  5EY6 A;  4GQF A;  2YV9 A;  1PA3 A;  4D73 B;  3CXG A;  4MAB A;  5DAK B;  4OFN A;  2JAD A;  3TKP A;  1XWA A;  3DRN A;  18GS A;  1Q4J A;  1U6T A;  1AC1 A;  3HJM A;  4V1A g;  4OFT A;  5B8B A;  4N30 A;  1THX A;  1M7T A;  4KDX A;  3TKS C;  3DML A;  2XBQ A;  3NIV A;  1XOB A;  2GZY A;  4G2E A;  4MZC A;  1OC8 A;  3FZ4 A;  4FH8 A;  2C3N A;  4KCE A;  4MH2 A;  3F4T A;  4IP1 A;  4N11 A;  4ZBD A;  1K0O A;  4EDZ A;  1USB A;  5AIX A;  4KDY A;  5DCG A;  4LMW A;  3VFI A;  1HNC A;  3ISO A;  3LGC A;  4K7N A;  3ERF A;  4K7I A;  2A2R A;  5ELA A;  4KA0 A;  3W8J A;  5J9B A;  3U5R E;  4MK3 A;  3VK9 A;  4FYB A;  3M1G A;  4ML1 A;  2JZS A;  4H86 A;  2CVD A;  2TRX A;  1A24 A;  2FLS A;  3UAR A;  1OC9 B;  1VF2 A;  3WGD A;  3ZIT A;  3M9K A;  1NSW A;  3P2A A;  1EGR A;  3MSZ A;  3UIW A;  2WCI A;  3Q18 A;  4NXI A;  1F3B A;  1EEJ A;  5D9V A;  3IOS A;  1GNW A;  4NWY A;  4TXO B;  1UN2 A;  4O5R A;  3H93 A;  3M0F A;  5GSS A;  3GX8 A;  1ERT A;  3HJP A;  2LNS A;  3ZVJ A;  1XWG A;  3CYN A;  3LFL A;  1Y6E A;  1F9M A;  1ZYE A;  2NVL A;  3CSJ A;  5IO0 A;  2AB6 A;  4ZBA A;  4MJE A;  3TKS E;  1GLP A;  3GRX A;  4V2L A;  1YKA A;  4GTU A;  2YAN A;  4EDY A;  4XTS A;  3DWV A;  1VGL A;  3KIJ A;  20GS A;  4V2M A;  2DJK A;  3C1R A;  3DXB A;  2PUK C;  4EUY A;  2X64 A;  4IQ1 A;  3EU3 A;  3IRA A;  4HQZ A;  6GSW A;  4N10 A;  1BQ7 A;  3UEM A;  1GSE A;  2BMX A;  4EF0 A;  4MCU A;  1PL2 A;  2B5E A;  3VI5 A;  1G7E A;  1EV4 A;  2PWJ A;  3EUR A;  4DSS B;  2FNO A;  3IC4 A;  2VCV A;  1EP8 A;  2H1D A;  2H71 A;  1T00 A;  1M9A A;  4MF5 A;  2DJ1 A;  3BOA A;  4ML6 A;  3RHC A;  3TKS A;  1GSF A;  3PR8 A;  5IMC A;  1PN9 A;  3CSH A;  2O8V B;  1WJK A;  4F9Z A;  3IV4 A;  1WOU A;  2L6D A;  2PBJ A;  2HNL A;  2LV3 A;  2TIR A;  2C0E A;  4GSN A;  1DSB A;  4V2N A;  6GSS A;  4L5L A;  4JRR A;  4O7H A;  5IOW A;  1F2E A;  4FIW A;  1VF4 A;  3TJF A;  2AAW A;  3FR9 A;  2DMM A;  5ECL B;  2RM6 A;  4JED A;  3GMF A;  3KH9 A;  4EL1 A;  3APS A;  2FD3 A;  1EEM A;  1TU7 A;  1A8Y A;  2HT9 A;  3FY7 A;  2HSY A;  4ZL7 A;  1GSQ A;  3KM6 A;  1K0M A;  3LQ7 A;  3GTU B;  4WBJ A;  1BED A;  1VF1 A;  1T1V A;  2CT6 A;  4IBP A;  5HR2 A;  2C0D A;  3RHB A;  4K8M A;  3A5W A;  4KH7 A;  3D21 A;  3MNG A;  5ECO B;  4JZQ A;  1HNB A;  2ZNM A;  4KCA A;  2IJY A;  1KNG A;  2LQQ A;  5COH A;  2VLV A;  2PER A;  3DVW A;  1V9W A;  2H1B A;  4GST A;  4OMV A;  1BJX A;  1WRY A;  3E0U A;  2H72 A;  1YY7 A;  3L4N A;  4TXV A;  4OWY A;  1WE0 A;  3BD2 A;  4L0W A;  3IR4 A;  4ZBB A;  3RBT A;  2WJU A;  1GL8 A;  1NM3 A;  2A4V A;  2H66 A;  3LEF A;  4IS0 A;  2KUC A;  4L8E A;  2MZC A;  1DE2 A;  2MMO A;  1B4Q A;  3KMO A;  4O92 A;  4IHU A;  5D9T A;  2MMZ A;  5FT3 A;  4YQV A;  4NMU A;  2R5G A;  4AGS A;  4D73 A;  5IPG A;  3K8N A;  4KUN A;  4G9H A;  5DAK A;  4OO4 A;  12GS A;  1GSY A;  2GT6 A;  1B4P A;  4EVM A;  3TOU A;  2RUE A;  1TRV A;  1Z7R A;  2K9F A;  2REM A;  5KEJ A;  2CAQ A;  1F37 A;  3N5O A;  5HR0 A;  1JZD A;  3CRU A;  3F0I A;  2LKU A;  2YN1 A;  5ECP B;  1PL1 A;  2NBS A;  4AJ7 A;  3HXS A;  4F2I A;  3PH9 A;  3CBU A;  2L5L A;  2NPB A;  2FY6 A;  2VLT A;  5IMA A;  1QUW A;  1J9B A;  1A0F A;  2DJJ A;  5ECN B;  2CV4 A;  1GTI A;  2GTU A;  3KD0 A;  4NAX A;  4IGJ A;  5F8B A;  1AQX A;  2JU5 A;  5B6M A;  5CRE A;  5JWQ B;  2OBK A;  1EOH A;  1ST9 A;  1XZO A;  2FGX A;  4KB3 A;  2EIO A;  3HKR A;  1XXU A;  2QGV A;  3GL5 A;  3L0H A;  1V40 A;  3HA9 A;  2FHE A;  2H73 A;  1O8W A;  2WZ9 A;  3GSS A;  3F4R A;  3DD3 A;  1OC9 A;  1T4Z A;  1HQO A;  2V2G A;  5H5S A;  1UC7 A;  4GXZ A;  3L9U A;  4WBR D;  5ID2 B;  4I97 A;  3GX0 A;  2YWO A;  1THO A;  3FZ9 A;  5J4U A;  3LXZ A;  4QL7 A;  4GF0 A;  1Z6M A;  4TXO A;  4PGT A;  4MH3 A;  3G7Y A;  4J57 E;  3ZFB A;  3GKX A;  2HYX A;  2PVQ A;  1M99 A;  4TR1 B;  4ILF A;  2LRT A;  1JLW A;  5DVB A;  2B7J A;  1RK4 A;  5CNW A;  2GQM A;  3G7I A;  4LLR A;  3MAK A;  1DBY A;  2X8G A;  2GVP A;  4ECC A;  4IN0 A;  2FUG 2;  3F8U A;  1FG4 A;  5G1K A;  3O3T A;  3I6A A;  4HQS A;  4POK A;  3GH6 A;  1M2D A;  3RDW A;  2HE3 A;  2E7P A;  1LU4 A;  3HVV A;  4WET A;  1RQM A;  2IWT A;  3DKS A;  4ZB9 A;  2VL2 C;  4IJ3 A;  1O8X A;  1VF3 A;  2RII A;  4DSS A;  2GQK A;  5IMD A;  3FZ5 A;  3VLN A;  3ZZX A;  5HR1 A;  19GS A;  4FYU A;  2H1A A;  2L4C A;  1CQG A;  2JZT A;  4OCE A;  1N2A A;  17GS A;  3QOU A;  3UOM A;  2XPE A;  2E2G A;  4POB A;  1AAZ A;  2H19 A;  3TJJ A;  1K3O A;  1R4W A;  4HZ2 A;  3GV1 A;  2C0G A;  4BA7 A;  4KGI A;  1FW1 A;  2WDU A;  3D0Z A;  4TVE A;  1AQV A;  3WGX A;  3TGZ A;  3ZTL A;  2VCX A;  2GGT A;  4HOJ A;  1R26 A;  5IMF A;  3J7Y k;  2V6K A;  3IK7 A;  1ABA A;  3ZLP A;  1QGV A;  5JWR B;  3IAS 2;  5CRD A;  2LJA A;  3GTU A;  1O85 A;  3LOR A;  1SYX A;  5J3R A;  2FWH A;  1WMJ A;  2ES7 A;  3M3M A;  3D6I A;  2LS5 A;  4PQI A;  4IJI A;  3ZL5 A;  4BVY A;  5ENU A;  5B8A A;  2HXK A;  2H6Y A;  4WEY A;  4MJB A;  4MJC A;  3GIX A;  3QAV A;  1NHY A;  1ZMA A;  4Q5N A;  3TB2 A;  14GS A;  3C1S A;  2GSQ A;  3GUS A;  1F3A A;  1O81 A;  1ZOF A;  1BG5 A;  2KHP A;  1TRW A;  4Q5Q A;  4RI6 A;  1ILO A;  2YOI A;  5ABR A;  4HU9 A;  3TRX A;  5D73 A;  5CRW A;  2LRN A;  1XVQ A;  2AYT A;  5AIS A;  4KSO A;  2OE1 A;  2CVB A;  1B8X A;  4K7O A;  3ZIJ A;  1AUC A;  4MP4 A;  3EMX A;  3BCK A;  1FVK A;  2GSR A;  3L78 A;  1ZZY A;  3CTF A;  2IMI A;  4I8B A;  3APO A;  4EXJ A;  2VL2 A;  3UJ1 A;  3GKK A;  2R2J A;  3A3T A;  3IDV A;  4OFM A;  1H4O A;  3LYK A;  2Z9S A;  2PU9 C;  4G19 A;  2N5F A;  4HU7 A;  5CAX A;  2R37 A;  1XFL A;  2C80 A;  1JZW A;  2X8C A;  1TTZ A;  1ERW A;  3A2W A;  5HFG A;  4I6X A;  3UAP A;  3KXO A;  2GT5 A;  3TKQ A;  1B9X C;  4TW5 A;  2H1G A;  1M2B A;  10GS A;  2XHF A;  3IHQ A;  2K8S A;  2QC7 A;  1EOG A;  1U3I A;  2VLU A;  4XRD A;  2VM2 A;  3HJO A;  3QFA C;  5DJL A;  3UMA A;  3KJY A;  4KX4 A;  5H5R A;  1JHB A;  5ID2 A;  2WUL A;  5D93 A;  2O87 A;  2DBC A;  1MEK A;  2OAC A;  4HJM A;  1FO5 A;  5G31 A;  1SK0 A;  4HUA A;  1XPV A;  2DSA A;  3QCP A;  1EV9 A;  4X0X A;  3GST A;  3UVT A;  2O7K A;  4WKW A;  3F9U A;  5G2Z A;  2PN8 A;  3ZRD A;  4TR1 A;  3IAM 2;  2VCQ A;  7GSS A;  2C8U A;  2IME A;  3RPN A;  4BVX A;  4K0G A;  2VM1 A;  1ZL9 A;  2VL3 A;  1J0F A;  3F4S A;  2IL3 A;  1TKD B;  1HYU A;  3G7J A;  3TOT A;  2R4V A;  5CO3 A;  1OAZ A;  1PKZ A;  2VCW A;  2IMK A;  2I9H A;  2QKE A;  1SKR B;  2JSZ A;  2K18 A;  5AIV A;  5J5N A;  3A2X A;  2F51 A;  2GLR A;  1A2L A;  1XCC A;  5DQY A;  2CAI A;  2HI7 A;  4TRX A;  3IBH A;  4E8H A;  2DIZ A;  3CRT A;  5FHI A;  1C72 A;  5CP1 A;  2H0I A;  4IP6 A;  2L6C A;  3GH9 A;  1R5A A;  4GWR A;  5KN1 A;  2GDR A;  4QQ7 A;  1TK8 B;  4ECI A;  1K0A A;  4MZB A;  2JZR A;  4PQH A;  4AF2 A;  3OR5 A;  1TK5 B;  2AUV A;  2LJK A;  2PGT A;  1FB0 A;  1BAY A;  4JE1 A;  3HZ8 A;  6GST A;  2FA8 A;  2HFD A;  5HR3 A;  5CRG A;  1N8J A;  2DC5 A;  3FKF A;  3HYP A;  3DYR A;  1GSS A;  2H76 A;  2YWM A;  2I3Y A;  1ON4 A;  1AQW A;  5DJM A;  2KP2 A;  3BJ5 A;  4IKH A;  4NHW A;  5AN1 A;  1BYE A;  4XRA A;  5G30 A;  1GTU A;  1XOA A;  3IPZ A;  3D22 A;  3H8Q A;  2H70 A;  2JSY A;  4OCF A;  2WRT A;  2ON5 A;  6GSY A;  1G6W A;  2VD0 A;  2CX3 A;  4KE3 A;  5JCW A;  1QMV A;  3DEX A;  16GS A;  3FHK A;  2OJL A;  4PX1 A;  3IK9 A;  1IYI A;  1U87 A;  1K0B A;  4IEL A;  2RLI A;  2JAC A;  2ZCT A;  3GN3 A;  2VL9 A;  2N5B A;  1ERV A;  3VWU A;  2NTO A;  4BWQ A;  3C71 A;  2TRC P;  4ZXG A;  6GSU A;  2LNT A;  4N0V A;  5GZZ B;  2EIQ A;  4K0N A;  2AJQ B;  2B5X A;  4WF5 A;  1PMT A;  3G9B A;  4GLT A;  3KP9 A;  11GS A;  4GQC A;  3M8N A;  4NV5 A;  2VUP A;  4JR6 A;  5D96 A;  1R5P A;  2VCT A;  2EIR A;  2XPD A;  2NDO A;  3FR6 A;  5LCZ A;  3AY8 A;  3ERW A;  4JBB A;  2ZUP A;  3W8S A;  3LJR A;  3Q19 A;  3MDK A;  3SBC A;  1MTC A;  2DLX A;  4MPG A;  4AJ8 A;  2M80 A;  5ECK B;  1GUK A;  2H0H A;  3GL3 A;  1S3D A;  1K0D A;  1NW2 A;  1SK2 A;  1JZO A;  4V1A p;  4ID0 A;  3KEB A;  4XIH A;  2OKA A;  3ZRE A;  3S9F A;  3HDC A;  2B7K A;  1XW9 A;  1QQ2 A;  3F6D A;  2DJ3 A;  1EGO A;  3HZ4 A;  1HD2 A;  4HI7 A;  3ZMK A;  1W89 A;  2N5A A;  3PGT A;  3D5J A;  4HS1 A;  5DQS A;  3A2V A;  4OO5 A;  1K3Y A;  1G0T A;  1XVW A;  3SWL A;  2H74 A;  1GNE A;  2YZU A;  4RQX A;  4FYC A;  5B7C A;  2C3Q A;  5D9X A;  1X5C A;  4CHS A;  3HVX A;  2FWE A;  3CMI A;  5D9W A;  4KSM A;  4MPF A;  1JFU A;  2PMT A;  4I2T A;  2MMN A;  4LL4 B;  5D8I A;  4EO3 A;  2FWG A;  2I81 A;  1TI3 A;  3UL3 A;  3KZQ A;  1PD2 1;  2LEG A;  1ZGN A;  1B48 A;  5LNK e;  1TP9 A;  1MDJ A;  1Z7P A;  4GCI A;  4E8E A;  3U6V A;  3LYP A;  5DDL A;  1A0R P;  5JCU A;  3VI7 A;  3P7X A;  2RUF A;  1PKW A;  2CQ9 A;  1MD3 A;  1OKT A;  5F0G A;  3FK8 A;  4MDC A;  4X43 A;  5INY A;  5A4U A;  1TI1 A;  1CQH A;  1EP7 A;  1V57 A;  3KCM A;  4MJA A;  3APQ A;  5GAN D;  4K9Z A;  3TJG A;  3EE2 A;  1GTA A;  5KN2 A;  4TR4 A;  2F9S A;  3P8W A;  3FEU A;  3UBK A;  5E4W A;  1ACV A;  4K1F A;  4KND A;  5JWO B;  2IFQ B;  4ZIJ A;  1YEP A;  3VPQ A;  3HVS A;  2YPM A;  3ZVJ D;  2YWN A;  4HDE A;  1I9D A; 
#chains in the Genus database with same CATH topology
 1YKC A;  5DCH A;  1XBS A;  4YQM A;  1O73 A;  4MZW A;  4TOP A;  1OVN A;  1SU9 A;  2HSM A;  2X99 A;  3LXT A;  3CQF A;  2QSI A;  3VWW A;  5J41 A;  4DSR A;  3H4K A;  3QD9 A;  4KAE A;  2R3X A;  4ZL8 A;  3O6T A;  2L5O A;  1OYJ A;  5IMV A;  1Y25 A;  2LUS A;  1OC3 A;  2LRC A;  2KLX A;  3DVX A;  1X5D A;  5H5Q A;  1KBN A;  1MDI A;  3TDG A;  3Q6O A;  1IYH A;  4XS6 A;  4Z2T A;  4EIP A;  3I43 A;  3VWX A;  3GNJ A;  1YDK A;  1WP0 A;  1Z6N A;  3RPP A;  4YAV A;  2YCD A;  4LA1 A;  1X9W B;  1QK8 A;  3R2Q A;  1URM A;  4G10 A;  4YAP A;  4WR5 A;  2V6O A;  3I9V 2;  5EPF A;  1G6Y A;  4ECJ A;  3ME7 A;  2H6Z A;  22GS A;  4WF4 A;  2CZ3 A;  3ED3 A;  1GWC A;  2LJR A;  1X0R A;  3ERG A;  4G0I A;  4MA9 A;  2IPA A;  1QFN A;  3KTB A;  3C7M A;  5ECR B;  3ZFL A;  3EYT A;  1A8L A;  2DJ0 A;  3O76 A;  5FWG A;  4HZ4 A;  2B6M A;  5GAP D;  1KTE A;  2O85 A;  4NV2 A;  4LMV A;  4AJ6 A;  5ELG A;  4DVC A;  2B5Y A;  4X1U A;  3LG6 A;  2GST A;  2D2Z A;  1U88 A;  3FW2 A;  2OE3 A;  2H75 A;  2E0Q A;  5DAL B;  3TJK A;  1ML6 A;  2WB9 A;  2L59 A;  3KTL A;  4GRF A;  2FA4 A;  4POL A;  5IQY A;  2C1Y A;  2OA7 A;  13GS A;  1B9Y C;  1WPI A;  3EVI A;  2AHE A;  4EC0 A;  1TJD A;  3NOF A;  5CRH A;  2K8V A;  3C73 A;  2HZE B;  4PQ1 A;  5HFK A;  3LW9 A;  1JZR A;  6GSX A;  5C00 A;  1WWJ A;  3DGQ A;  3QAG A;  4F03 A;  2HRF A;  1FOH A;  1NHO A;  2IIY A;  2F8F A;  2IMF A;  1XWK A;  1UVZ A;  4Z7X A;  5G5F A;  2L4Q A;  1XWB A;  1BX9 A;  4ZIL A;  1SL0 B;  2H30 A;  3RAZ A;  5ECM B;  4X4J A;  4BIK A;  4XS1 A;  1O7U A;  4HJ2 A;  1G7O A;  2QA2 A;  3I69 A;  2VO4 A;  1GRX A;  5A4V A;  2A2S A;  3FYG A;  4F0B A;  3M9J A;  1SJZ A;  2GZZ A;  2G0F A;  4TN8 A;  1Z9H A;  2MBT A;  5DBQ A;  4DSQ A;  2AV4 A;  3QAW A;  1SD9 A;  3IA1 A;  1Z3E A;  4ZB8 A;  1PQN A;  3JAM I;  6GSV A;  3HCZ A;  3WT2 A;  1ZYQ B;  4XS4 B;  3KH7 A;  5AGY A;  1M2A A;  3TUE A;  5IPH A;  2J9H A;  4MLY A;  2CVK A;  4MMM A;  4KW6 A;  1I5G A;  2V41 A;  2CX4 A;  1F6M C;  1MDK A;  1OKD A;  1JLV A;  1M3J A;  2J23 A;  3EIN A;  3LSZ A;  3GA4 A;  2P0G A;  3GHA A;  1DUG A;  1V2A A;  1XW5 A;  1PSQ A;  2F3M A;  2GZP A;  2VOC A;  3EC3 A;  4CDO A;  2DJ2 A;  4MNN A;  5F06 A;  2IFQ A;  1GH2 A;  5LD0 A;  2EC4 A;  5HFI A;  2YNX A;  1U3A A;  5F05 A;  3VWV A;  4PTS A;  4YQU A;  2RM5 A;  1ZCP A;  4EE0 A;  3TRQ A;  2CZ2 A;  5J9C A;  3ZML A;  1FB6 A;  8GSS A;  1PX7 A;  4POM A;  1MD4 A;  3F63 A;  5G1L A;  3WD6 A;  4ACS A;  1A23 A;  5IM9 A;  1A2J A;  1OE8 A;  4MF6 A;  1V98 A;  2P5Q A;  1YJ6 A;  2HZF A;  1A2M A;  4J2F A;  1QXH A;  4RUV A;  1J08 A;  2H6X A;  1TDI A;  2B1L A;  2IMD A;  1GSD A;  3WYW A;  3EWL A;  2M46 A;  1LBK A;  1W4V A;  3BBY A;  1T7P B;  1SYR A;  4ZL9 A;  3C8E A;  1E6B A;  4K2D A;  3QPM A;  1T4Y A;  1V58 A;  1VRS D;  5IOX A;  4QL9 A;  3IE3 A;  2C4J A;  3UBL A;  2HLS A;  3KGK A;  4ZB6 A;  4ECB A;  4BVY B;  3FZA A;  2XBI A;  4BL7 B;  1AIU A;  3F6F A;  1YF1 A;  5EVO A;  1AXD A;  1SJ6 A;  3MWH A;  2MMA A;  1ERU A;  1LJR A;  3WGE A;  2KP1 A;  5KN0 A;  2H0G A;  2V32 A;  4N0Z A;  2R6K A;  3QDN A;  4JR4 A;  1TRS A;  4PUF C;  3J7Y b;  2PPT A;  1H75 A;  4PNF A;  2HRN A;  5ECI B;  2GSS A;  4P3Y B;  1TOF A;  1T8E B;  1GUM A;  2HSH A;  3QR6 A;  1SK1 A;  4CW9 A;  4HEA 2;  4ISD A;  4RQR A;  3H79 A;  5C04 A;  1SL1 B;  3HD5 A;  2H01 A;  2WGR A;  3QMX A;  2VD1 A;  1SJI A;  2FCH A;  5DAL A;  5ECQ B;  3HHV A;  4TR0 A;  4Q5R A;  3BCI A;  3GKM A;  1SKS B;  4ULX A;  4YKF A;  3TRP A;  3HY2 A;  2E2M A;  3FR3 A;  3EMP A;  3VUR A;  4USS A;  1PX6 A;  4LL1 B;  4F0C A;  3CSI A;  5KN3 A;  2I4A A;  3KP8 A;  1FHE A;  4IVF A;  2HZE A;  2VAF A;  3L9S A;  1HNA A;  3F3R A;  2MYG A;  1TRU A;  4L5O A;  4NHZ A;  3ZIV A;  1OE7 A;  2GS3 A;  5IO2 A;  5CYY A;  1Z5Y E;  2LTK A;  1GP1 A;  2YJH A;  5A4W A;  1YZX A;  3N9J A;  4JU5 A;  2LQO A;  1YQ1 A;  4XHM A;  2K6V A;  1EZK A;  1FVJ A;  4I5Q A;  1UA5 A;  2C3T A;  2VCZ A;  3IC8 A;  5GST A;  1XIY A;  2WS2 A;  4WR4 A;  3ME8 A;  1TXX A;  4EKZ A;  1SL2 B;  2L57 A;  3MYD A;  4IW9 A;  4PXO A;  1R7H A;  3KMN A;  1GSU A;  1M9B A;  4PUR A;  2DKH A;  2OBI A;  4OD7 A;  4Q5F A;  1K0C A;  1X5E A;  2VIM A;  3IXR A;  1E2Y A;  2OAD A;  3TCO A;  1YF0 A;  3E3E A;  2H8L A;  2G2Q A;  5E59 A;  2DIY A;  2FWF A;  4BWS A;  3GUR A;  5HQP A;  4BVX B;  4I2U A;  1FOV A;  2GQL A;  5ECS A;  3P90 A;  4PNG A;  5G5E A;  5F07 A;  4XS4 A;  1SEN A;  2O89 A;  2HRA A;  4Z2R A;  4WXT A;  2P31 A;  2F8A A;  5IMZ A;  3TJB A;  2I1U A;  1GTB A;  2IN3 A;  3NZN A;  4MF7 A;  3EU4 A;  3CTG A;  1XW6 A;  2CA8 A;  2C0F A;  1X9M B;  4BPY A;  3F3Q A;  3H1N A;  2P5R A;  5EL8 A;  2JL4 A;  4KDU A;  5LL6 V;  1AW9 A;  3UVH A;  1GUL A;  3D4T A;  2V1M A;  2YV7 A;  1X9S B;  3D4M A;  3WT1 A;  2DML A;  1S3C A;  5IIZ A;  4RI7 A;  1O6J A;  4IQA A;  2X8H A;  4K2X A;  4XCS A;  2BTO T;  3JCM L;  2YP6 A;  1XWC A;  4K6X A;  3TKR A;  4NPB A;  2ON7 A;  3Q74 A;  3GKN A;  1DE1 A;  1ZYN A;  2YWI A;  2OE0 A;  2YJ7 A;  5JCG A;  1M0U A;  1TK0 B;  3GFK A;  4YKG A;  3LWA A;  1PRX A;  2PVO C;  2WFC A;  2YZH A;  4PUA A;  1T3B A;  9GSS A;  1TW9 A;  2XC2 A;  2LST A;  1PGT A;  3E9J B;  1TU8 A;  3VPT A;  4F82 A;  3W6G A;  1WIK A;  2B1K A;  1RW1 A;  1GLQ A;  3L9V A;  4J56 E;  4O32 A;  4YH2 A;  2B3S A;  2ALB A;  1K0N A;  2BJX A;  1S3A A;  5A5K A;  1SD8 A;  5L71 A;  3PPU A;  1GUH A;  1K3L A;  1SKW B;  2MBS A;  2KOK A;  3PIN A;  4FO5 A;  1Q98 A;  4TR3 A;  5B6N A;  1FAA A;  2M72 A;  5ECH B;  4BL7 A;  4L0U A;  3FRC A;  3DIE A;  3ZYW A;  4GSS A;  1YEX A;  4TKY A;  3V1W A;  3GYK A;  5FLX I;  4DEJ A;  2R0G A;  3QFB C;  1EWX A;  1KEB A;  3US3 A;  5EY6 A;  4GQF A;  2YV9 A;  4Z2U A;  1PA3 A;  4D73 B;  3CXG A;  4MAB A;  5DAK B;  4OFN A;  2JAD A;  3TKP A;  1XWA A;  3DRN A;  18GS A;  1Q4J A;  1U6T A;  1AC1 A;  3HJM A;  4V1A g;  4OFT A;  5B8B A;  4N30 A;  1THX A;  1M7T A;  4KDX A;  3TKS C;  3DML A;  2XBQ A;  3NIV A;  1XOB A;  2GZY A;  4G2E A;  4MZC A;  1OC8 A;  3FZ4 A;  4FH8 A;  2C3N A;  4KCE A;  4A5P A;  4MH2 A;  3F4T A;  4IP1 A;  4N11 A;  4K5R A;  4ZBD A;  1K0O A;  4EDZ A;  1USB A;  5AIX A;  4KDY A;  5DCG A;  4LMW A;  3VFI A;  1HNC A;  3ISO A;  3LGC A;  4K7N A;  3ERF A;  4K7I A;  2A2R A;  5ELA A;  4KA0 A;  3W8J A;  2A4H A;  3IHG A;  5J9B A;  3U5R E;  4MK3 A;  3VK9 A;  4FYB A;  3M1G A;  4ML1 A;  2JZS A;  4H86 A;  2CVD A;  2DKI A;  2TRX A;  1A24 A;  2FLS A;  3UAR A;  1OC9 B;  1VF2 A;  3WGD A;  3ZIT A;  3M9K A;  1NSW A;  3P2A A;  1EGR A;  3MSZ A;  3UIW A;  2WCI A;  3Q18 A;  4NXI A;  1F3B A;  1EEJ A;  5D9V A;  3IOS A;  1GNW A;  4NWY A;  4TXO B;  1UN2 A;  4O5R A;  3H93 A;  3M0F A;  5GSS A;  3GX8 A;  1ERT A;  3HJP A;  2LNS A;  3ZVJ A;  1XWG A;  3CYN A;  3LFL A;  1Y6E A;  1F9M A;  1ZYE A;  2NVL A;  3CSJ A;  5IO0 A;  2AB6 A;  4ZBA A;  4MJE A;  3TKS E;  1GLP A;  3GRX A;  4V2L A;  1YKA A;  4GTU A;  2YAN A;  4EDY A;  5KOW A;  4XTS A;  3DWV A;  1VGL A;  3KIJ A;  20GS A;  4V2M A;  2DJK A;  3C1R A;  3DXB A;  2PUK C;  4EUY A;  2X64 A;  4IQ1 A;  3EU3 A;  3IRA A;  4HQZ A;  6GSW A;  4N10 A;  1BQ7 A;  3UEM A;  1GSE A;  2BMX A;  4EF0 A;  4MCU A;  1PL2 A;  2B5E A;  1PN0 A;  3VI5 A;  1G7E A;  1EV4 A;  2PWJ A;  3EUR A;  4DSS B;  2FNO A;  3IC4 A;  2VCV A;  1EP8 A;  2H1D A;  2H71 A;  3HVN A;  1T00 A;  1M9A A;  4MF5 A;  2DJ1 A;  3BOA A;  4ML6 A;  3RHC A;  3TKS A;  1GSF A;  3PR8 A;  5IMC A;  1PN9 A;  3CSH A;  2O8V B;  1WJK A;  4F9Z A;  3IV4 A;  1WOU A;  2L6D A;  2PBJ A;  2HNL A;  2LV3 A;  2TIR A;  2C0E A;  4GSN A;  1DSB A;  4V2N A;  6GSS A;  4L5L A;  4JRR A;  4O7H A;  5IOW A;  1F2E A;  4FIW A;  1VF4 A;  3TJF A;  2AAW A;  3FR9 A;  2DMM A;  5ECL B;  2RM6 A;  4JED A;  3GMF A;  3KH9 A;  4EL1 A;  3APS A;  2FD3 A;  1EEM A;  1TU7 A;  1A8Y A;  4G0L A;  2HT9 A;  3FY7 A;  2HSY A;  4ZL7 A;  1GSQ A;  3KM6 A;  1K0M A;  3LQ7 A;  3GTU B;  4WBJ A;  1BED A;  1VF1 A;  1T1V A;  2CT6 A;  4IBP A;  5HR2 A;  2C0D A;  3RHB A;  4K8M A;  3A5W A;  4KH7 A;  3D21 A;  3MNG A;  5ECO B;  4JZQ A;  1HNB A;  2ZNM A;  4KCA A;  2IJY A;  1KNG A;  2LQQ A;  5COH A;  2VLV A;  2PER A;  3DVW A;  1V9W A;  1XG8 A;  4FQU A;  2H1B A;  4GST A;  4OMV A;  1BJX A;  1WRY A;  1M3I A;  3E0U A;  5KOX A;  2H72 A;  1YY7 A;  1ZYP A;  3L4N A;  4TXV A;  4OWY A;  1WE0 A;  3BD2 A;  4L0W A;  3IR4 A;  4ZBB A;  3RBT A;  2WJU A;  1GL8 A;  1NM3 A;  2A4V A;  2H66 A;  3LEF A;  4IS0 A;  2KUC A;  4L8E A;  2MZC A;  1DE2 A;  2MMO A;  1B4Q A;  3KMO A;  4O92 A;  4IHU A;  5D9T A;  2MMZ A;  5FT3 A;  4YQV A;  4NMU A;  2R5G A;  4AGS A;  4D73 A;  5IPG A;  3K8N A;  4KUN A;  4G9H A;  4OO4 A;  5DAK A;  12GS A;  1GSY A;  2GT6 A;  1B4P A;  4EVM A;  3TOU A;  2RUE A;  1TRV A;  1Z7R A;  2K9F A;  2REM A;  5KEJ A;  2CAQ A;  1F37 A;  3N5O A;  5HR0 A;  1JZD A;  3CRU A;  3F0I A;  2LKU A;  2YN1 A;  5ECP B;  1PL1 A;  2NBS A;  4AJ7 A;  3HXS A;  4F2I A;  3PH9 A;  3CBU A;  2L5L A;  2NPB A;  2FY6 A;  2VLT A;  5IMA A;  1QUW A;  1J9B A;  1A0F A;  2DJJ A;  5ECN B;  2CV4 A;  1GTI A;  2GTU A;  3KD0 A;  4NAX A;  4IGJ A;  5F8B A;  1AQX A;  2JU5 A;  5B6M A;  5CRE A;  5JWQ B;  2OBK A;  1EOH A;  1ST9 A;  1XZO A;  2FGX A;  4KB3 A;  2EIO A;  3HKR A;  1XXU A;  1S3R A;  2QGV A;  3GL5 A;  3L0H A;  1V40 A;  5IT9 I;  3HA9 A;  2FHE A;  2H73 A;  1O8W A;  2WZ9 A;  3GSS A;  3F4R A;  3DD3 A;  1OC9 A;  1T4Z A;  1HQO A;  2V2G A;  5H5S A;  1UC7 A;  4GXZ A;  3L9U A;  4WBR D;  5ID2 B;  4I97 A;  3GX0 A;  2YWO A;  1THO A;  3FZ9 A;  5J4U A;  3LXZ A;  4QL7 A;  4GF0 A;  1Z6M A;  4TXO A;  4PGT A;  4MH3 A;  3G7Y A;  4J57 E;  3ZFB A;  3GKX A;  2HYX A;  2PVQ A;  1M99 A;  4TR1 B;  4ILF A;  2LRT A;  1JLW A;  5DVB A;  2B7J A;  1RK4 A;  5CNW A;  2GQM A;  3G7I A;  4LLR A;  3MAK A;  1DBY A;  2X8G A;  2GVP A;  4ECC A;  4IN0 A;  2FUG 2;  3F8U A;  1FG4 A;  3FMW A;  5G1K A;  3O3T A;  3I6A A;  4HQS A;  4POK A;  3GH6 A;  1M2D A;  3RDW A;  2HE3 A;  2E7P A;  1LU4 A;  3HVV A;  4WET A;  1RQM A;  2IWT A;  3DKS A;  4ZB9 A;  2VL2 C;  4IJ3 A;  1O8X A;  1VF3 A;  2RII A;  4DSS A;  2GQK A;  5IMD A;  3FZ5 A;  3VLN A;  3ZZX A;  2R0P A;  5HR1 A;  19GS A;  4FYU A;  2H1A A;  2L4C A;  1CQG A;  2JZT A;  4OCE A;  3J81 I;  1N2A A;  5A2Q I;  17GS A;  3QOU A;  3UOM A;  2XPE A;  2E2G A;  4POB A;  1AAZ A;  2H19 A;  3TJJ A;  1K3O A;  1R4W A;  4HZ2 A;  4CY8 A;  3GV1 A;  2C0G A;  4BA7 A;  4KGI A;  1FW1 A;  2WDU A;  3D0Z A;  4TVE A;  1AQV A;  3WGX A;  3TGZ A;  3ZTL A;  2VCX A;  2GGT A;  4HOJ A;  1R26 A;  5IMF A;  3J7Y k;  2V6K A;  3IK7 A;  1ABA A;  3ZLP A;  1QGV A;  5JWR B;  3IAS 2;  5CRD A;  2LJA A;  3GTU A;  4CY6 A;  1O85 A;  3LOR A;  1SYX A;  5J3R A;  2FWH A;  1WMJ A;  2ES7 A;  3M3M A;  3D6I A;  2LS5 A;  3MIX A;  4PQI A;  2X49 A;  4IJI A;  3ZL5 A;  4BVY A;  5ENU A;  5B8A A;  2HXK A;  2H6Y A;  4WEY A;  4MJB A;  4MJC A;  3GIX A;  3QAV A;  1NHY A;  1ZMA A;  4Q5N A;  3TB2 A;  14GS A;  3C1S A;  2GSQ A;  3GUS A;  1F3A A;  1O81 A;  1ZOF A;  1BG5 A;  4KF9 A;  2KHP A;  1TRW A;  4Q5Q A;  4RI6 A;  1ILO A;  2YOI A;  5ABR A;  4HU9 A;  3TRX A;  5D73 A;  1PFO A;  5CRW A;  2LRN A;  1XVQ A;  2AYT A;  5AIS A;  4KSO A;  2OE1 A;  2CVB A;  1B8X A;  4K7O A;  3ZIJ A;  1AUC A;  4MP4 A;  3EMX A;  3BCK A;  1FVK A;  2GSR A;  3L78 A;  1ZZY A;  2QA1 A;  3CTF A;  2IMI A;  4I8B A;  3APO A;  4EXJ A;  2VL2 A;  3UJ1 A;  3EPT A;  3GKK A;  2R2J A;  3A3T A;  3IDV A;  4OFM A;  1H4O A;  3LYK A;  2Z9S A;  2PU9 C;  4G19 A;  2N5F A;  4HU7 A;  5CAX A;  2R37 A;  1XFL A;  2C80 A;  1JZW A;  2X8C A;  1TTZ A;  1ERW A;  3A2W A;  5HFG A;  4I6X A;  3UAP A;  3KXO A;  2GT5 A;  3TKQ A;  1B9X C;  4TW5 A;  2H1G A;  1M2B A;  10GS A;  2XHF A;  3IHQ A;  2K8S A;  2QC7 A;  1EOG A;  1U3I A;  2VLU A;  4XRD A;  2VM2 A;  3HJO A;  3QFA C;  5DJL A;  4O5Q A;  2A2P A;  3UMA A;  3KJY A;  4KX4 A;  5H5R A;  1JHB A;  5ID2 A;  2WUL A;  4EIQ A;  5D93 A;  2O87 A;  2DBC A;  1MEK A;  2OAC A;  4HJM A;  1FO5 A;  5G31 A;  1SK0 A;  2HRK A;  2X4A A;  4HUA A;  1XPV A;  2DSA A;  3QCP A;  1EV9 A;  4X0X A;  3GST A;  3UVT A;  2O7K A;  4WKW A;  3F9U A;  5G2Z A;  2PN8 A;  3ZRD A;  4TR1 A;  3IAM 2;  2VCQ A;  7GSS A;  2C8U A;  2IME A;  3RPN A;  4BVX A;  4K0G A;  2VM1 A;  1ZL9 A;  2VL3 A;  1J0F A;  3F4S A;  2IL3 A;  1TKD B;  1HYU A;  3G7J A;  3TOT A;  2R4V A;  5CO3 A;  1OAZ A;  1PKZ A;  2VCW A;  2IMK A;  2I9H A;  2QKE A;  1SKR B;  2JSZ A;  2K18 A;  5AIV A;  5J5N A;  3A2X A;  5BMU A;  2F51 A;  4K5S A;  2GLR A;  1A2L A;  1XCC A;  5DQY A;  2CAI A;  2HI7 A;  4TRX A;  3IBH A;  4E8H A;  2DIZ A;  3CRT A;  5FHI A;  1C72 A;  3J80 I;  5CP1 A;  2H0I A;  4IP6 A;  2L6C A;  3GH9 A;  1R5A A;  4GWR A;  5KN1 A;  2GDR A;  4QQ7 A;  1TK8 B;  4O5U A;  4ECI A;  1K0A A;  4MZB A;  2JZR A;  4PQH A;  4AF2 A;  3OR5 A;  1TK5 B;  2AUV A;  2LJK A;  2PGT A;  1FB0 A;  1BAY A;  4JE1 A;  3HZ8 A;  4G0K A;  6GST A;  2FA8 A;  2HFD A;  5HR3 A;  5CRG A;  1N8J A;  2DC5 A;  3FKF A;  3HYP A;  2R0C A;  3A5I A;  3DYR A;  1GSS A;  2H76 A;  2YWM A;  2I3Y A;  1ON4 A;  1AQW A;  5DJM A;  2KP2 A;  3BJ5 A;  4IKH A;  4NHW A;  5AN1 A;  1BYE A;  4XRA A;  5G30 A;  1GTU A;  1XOA A;  3IPZ A;  3D22 A;  4ICY A;  3H8Q A;  2H70 A;  2JSY A;  4OCF A;  2WRT A;  2ON5 A;  6GSY A;  1G6W A;  2VD0 A;  2CX3 A;  4KE3 A;  5JCW A;  1QMV A;  3DEX A;  16GS A;  3FHK A;  2OJL A;  4PX1 A;  3R3E A;  3IK9 A;  1IYI A;  1U87 A;  1K0B A;  4IEL A;  2RLI A;  2JAC A;  2ZCT A;  3GN3 A;  2VL9 A;  2N5B A;  1ERV A;  3VWU A;  2NTO A;  4BWQ A;  3C71 A;  2TRC P;  4ZXG A;  6GSU A;  2LNT A;  4N0V A;  5GZZ B;  2EIQ A;  4K0N A;  2AJQ B;  2B5X A;  4WF5 A;  1PMT A;  3G9B A;  4GLT A;  3KP9 A;  11GS A;  4GQC A;  3M8N A;  4NV5 A;  2VUP A;  4JR6 A;  5D96 A;  1R5P A;  2VCT A;  2EIR A;  2XPD A;  2NDO A;  3FR6 A;  5LCZ A;  3AY8 A;  3ERW A;  4JBB A;  2ZUP A;  3W8S A;  3LJR A;  3Q19 A;  3MDK A;  3SBC A;  2UZ8 A;  1MTC A;  2DLX A;  4MPG A;  4AJ8 A;  2M80 A;  5ECK B;  1GUK A;  2H0H A;  3GL3 A;  1S3D A;  1K0D A;  1NW2 A;  1SK2 A;  1JZO A;  4V1A p;  4ID0 A;  3KEB A;  4XIH A;  2OKA A;  3ZRE A;  3S9F A;  3HDC A;  2B7K A;  1XW9 A;  1QQ2 A;  3F6D A;  2DJ3 A;  1EGO A;  3HZ4 A;  1HD2 A;  4HI7 A;  3ZMK A;  5BRT A;  1W89 A;  2N5A A;  3PGT A;  3D5J A;  4HS1 A;  5DQS A;  3A2V A;  4OO5 A;  1K3Y A;  1G0T A;  1XVW A;  3SWL A;  2H74 A;  1GNE A;  2YZU A;  4RQX A;  4FYC A;  5B7C A;  2C3Q A;  5D9X A;  1X5C A;  4CHS A;  3HVX A;  2FWE A;  3CMI A;  5D9W A;  4KSM A;  4MPF A;  1JFU A;  2PMT A;  4I2T A;  4HSC X;  2MMN A;  4LL4 B;  5D8I A;  4EO3 A;  2FWG A;  2I81 A;  1TI3 A;  3UL3 A;  3KZQ A;  1PD2 1;  2LEG A;  1ZGN A;  1B48 A;  5LNK e;  1TP9 A;  1MDJ A;  1Z7P A;  4GCI A;  4E8E A;  3U6V A;  3LYP A;  5DDL A;  1A0R P;  5JCU A;  3VI7 A;  3P7X A;  2RUF A;  1PKW A;  2CQ9 A;  1MD3 A;  1OKT A;  5F0G A;  3FK8 A;  4MDC A;  4X43 A;  5INY A;  5A4U A;  1TI1 A;  1CQH A;  1EP7 A;  1V57 A;  3KCM A;  4MJA A;  3APQ A;  5GAN D;  4K9Z A;  3TJG A;  3EE2 A;  1GTA A;  5KN2 A;  4TR4 A;  2F9S A;  3P8W A;  3FEU A;  3UBK A;  5E4W A;  1ACV A;  4K1F A;  4KND A;  5JWO B;  2IFQ B;  4ZIJ A;  1YEP A;  3VPQ A;  3HVS A;  2YPM A;  3ZVJ D;  2YWN A;  4HDE A;  1I9D A; 
#chains in the Genus database with same CATH homology
 1YKC A;  5DCH A;  1XBS A;  4YQM A;  1O73 A;  4MZW A;  4TOP A;  1OVN A;  1SU9 A;  2HSM A;  2X99 A;  3LXT A;  2QSI A;  3VWW A;  5J41 A;  4DSR A;  3H4K A;  3QD9 A;  4KAE A;  2R3X A;  4ZL8 A;  3O6T A;  2L5O A;  1OYJ A;  5IMV A;  1Y25 A;  2LUS A;  1OC3 A;  2LRC A;  2KLX A;  3DVX A;  1X5D A;  5H5Q A;  1KBN A;  1MDI A;  3TDG A;  3Q6O A;  1IYH A;  4XS6 A;  4Z2T A;  4EIP A;  3I43 A;  3VWX A;  3GNJ A;  1YDK A;  1WP0 A;  1Z6N A;  3RPP A;  4YAV A;  2YCD A;  4LA1 A;  1X9W B;  1QK8 A;  3R2Q A;  1URM A;  4G10 A;  4YAP A;  4WR5 A;  2V6O A;  3I9V 2;  5EPF A;  1G6Y A;  4ECJ A;  3ME7 A;  2H6Z A;  22GS A;  4WF4 A;  2CZ3 A;  3ED3 A;  1GWC A;  2LJR A;  1X0R A;  3ERG A;  4G0I A;  4MA9 A;  2IPA A;  1QFN A;  3KTB A;  3C7M A;  5ECR B;  3ZFL A;  3EYT A;  1A8L A;  2DJ0 A;  3O76 A;  5FWG A;  4HZ4 A;  2B6M A;  5GAP D;  1KTE A;  2O85 A;  4NV2 A;  4LMV A;  4AJ6 A;  5ELG A;  4DVC A;  2B5Y A;  4X1U A;  3LG6 A;  2GST A;  2D2Z A;  1U88 A;  3FW2 A;  2OE3 A;  2H75 A;  2E0Q A;  5DAL B;  3TJK A;  1ML6 A;  2WB9 A;  2L59 A;  3KTL A;  4GRF A;  2FA4 A;  4POL A;  5IQY A;  2C1Y A;  2OA7 A;  13GS A;  1B9Y C;  1WPI A;  3EVI A;  2AHE A;  4EC0 A;  1TJD A;  3NOF A;  5CRH A;  2K8V A;  3C73 A;  2HZE B;  4PQ1 A;  5HFK A;  3LW9 A;  1JZR A;  6GSX A;  5C00 A;  1WWJ A;  3DGQ A;  3QAG A;  4F03 A;  2HRF A;  1FOH A;  1NHO A;  2IIY A;  2F8F A;  2IMF A;  1XWK A;  1UVZ A;  4Z7X A;  5G5F A;  2L4Q A;  1XWB A;  1BX9 A;  4ZIL A;  1SL0 B;  2H30 A;  3RAZ A;  5ECM B;  4X4J A;  4XS1 A;  1O7U A;  4HJ2 A;  1G7O A;  2QA2 A;  3I69 A;  2VO4 A;  1GRX A;  5A4V A;  2A2S A;  3FYG A;  4F0B A;  3M9J A;  1SJZ A;  2GZZ A;  2G0F A;  4TN8 A;  1Z9H A;  2MBT A;  5DBQ A;  4DSQ A;  2AV4 A;  3QAW A;  1SD9 A;  3IA1 A;  1Z3E A;  4ZB8 A;  1PQN A;  6GSV A;  3HCZ A;  3WT2 A;  1ZYQ B;  4XS4 B;  3KH7 A;  5AGY A;  1M2A A;  3TUE A;  5IPH A;  2J9H A;  4MLY A;  2CVK A;  4MMM A;  4KW6 A;  1I5G A;  2V41 A;  2CX4 A;  1F6M C;  1MDK A;  1OKD A;  1JLV A;  2J23 A;  3EIN A;  3LSZ A;  3GA4 A;  2P0G A;  3GHA A;  1DUG A;  1V2A A;  1XW5 A;  1PSQ A;  2F3M A;  2GZP A;  2VOC A;  3EC3 A;  4CDO A;  2DJ2 A;  4MNN A;  5F06 A;  2IFQ A;  1GH2 A;  5LD0 A;  2EC4 A;  5HFI A;  2YNX A;  1U3A A;  5F05 A;  3VWV A;  4PTS A;  4YQU A;  2RM5 A;  1ZCP A;  4EE0 A;  3TRQ A;  2CZ2 A;  5J9C A;  3ZML A;  1FB6 A;  8GSS A;  1PX7 A;  4POM A;  1MD4 A;  3F63 A;  5G1L A;  3WD6 A;  4ACS A;  1A23 A;  5IM9 A;  1A2J A;  1OE8 A;  4MF6 A;  1V98 A;  2P5Q A;  1YJ6 A;  2HZF A;  1A2M A;  4J2F A;  1QXH A;  4RUV A;  1J08 A;  2H6X A;  1TDI A;  2B1L A;  2IMD A;  1GSD A;  3WYW A;  3EWL A;  2M46 A;  1LBK A;  1W4V A;  3BBY A;  1T7P B;  1SYR A;  4ZL9 A;  3C8E A;  1E6B A;  4K2D A;  3QPM A;  1T4Y A;  1V58 A;  1VRS D;  5IOX A;  4QL9 A;  3IE3 A;  2C4J A;  3UBL A;  2HLS A;  3KGK A;  4ZB6 A;  4ECB A;  4BVY B;  3FZA A;  2XBI A;  4BL7 B;  1AIU A;  3F6F A;  1YF1 A;  5EVO A;  1AXD A;  1SJ6 A;  3MWH A;  2MMA A;  1ERU A;  1LJR A;  3WGE A;  2KP1 A;  5KN0 A;  2H0G A;  2V32 A;  4N0Z A;  2R6K A;  3QDN A;  4JR4 A;  1TRS A;  4PUF C;  3J7Y b;  2PPT A;  1H75 A;  4PNF A;  2HRN A;  5ECI B;  2GSS A;  4P3Y B;  1TOF A;  1T8E B;  1GUM A;  2HSH A;  3QR6 A;  1SK1 A;  4CW9 A;  4HEA 2;  4ISD A;  4RQR A;  3H79 A;  5C04 A;  1SL1 B;  3HD5 A;  2H01 A;  2WGR A;  3QMX A;  2VD1 A;  1SJI A;  2FCH A;  5DAL A;  5ECQ B;  3HHV A;  4TR0 A;  4Q5R A;  3BCI A;  3GKM A;  1SKS B;  4ULX A;  4YKF A;  3TRP A;  3HY2 A;  2E2M A;  3FR3 A;  3EMP A;  3VUR A;  4USS A;  1PX6 A;  4LL1 B;  4F0C A;  3CSI A;  5KN3 A;  2I4A A;  3KP8 A;  1FHE A;  4IVF A;  2HZE A;  2VAF A;  3L9S A;  1HNA A;  3F3R A;  2MYG A;  1TRU A;  4L5O A;  4NHZ A;  3ZIV A;  1OE7 A;  2GS3 A;  5IO2 A;  5CYY A;  1Z5Y E;  2LTK A;  1GP1 A;  2YJH A;  5A4W A;  1YZX A;  3N9J A;  4JU5 A;  2LQO A;  1YQ1 A;  4XHM A;  2K6V A;  1EZK A;  1FVJ A;  4I5Q A;  1UA5 A;  2C3T A;  2VCZ A;  3IC8 A;  5GST A;  1XIY A;  2WS2 A;  4WR4 A;  3ME8 A;  1TXX A;  4EKZ A;  1SL2 B;  2L57 A;  3MYD A;  4IW9 A;  4PXO A;  1R7H A;  3KMN A;  1GSU A;  1M9B A;  4PUR A;  2DKH A;  2OBI A;  4OD7 A;  4Q5F A;  1K0C A;  1X5E A;  2VIM A;  3IXR A;  1E2Y A;  2OAD A;  3TCO A;  1YF0 A;  3E3E A;  2H8L A;  2G2Q A;  5E59 A;  2DIY A;  2FWF A;  4BWS A;  3GUR A;  5HQP A;  4BVX B;  4I2U A;  1FOV A;  2GQL A;  5ECS A;  3P90 A;  4PNG A;  5G5E A;  5F07 A;  4XS4 A;  1SEN A;  2O89 A;  2HRA A;  4Z2R A;  4WXT A;  2P31 A;  2F8A A;  5IMZ A;  3TJB A;  2I1U A;  1GTB A;  2IN3 A;  3NZN A;  4MF7 A;  3EU4 A;  3CTG A;  1XW6 A;  2CA8 A;  2C0F A;  1X9M B;  4BPY A;  3F3Q A;  3H1N A;  2P5R A;  5EL8 A;  2JL4 A;  4KDU A;  1AW9 A;  3UVH A;  1GUL A;  3D4T A;  2V1M A;  2YV7 A;  1X9S B;  3D4M A;  3WT1 A;  2DML A;  1S3C A;  5IIZ A;  4RI7 A;  1O6J A;  4IQA A;  2X8H A;  4K2X A;  4XCS A;  2BTO T;  3JCM L;  2YP6 A;  1XWC A;  4K6X A;  3TKR A;  4NPB A;  2ON7 A;  3Q74 A;  3GKN A;  1DE1 A;  1ZYN A;  2YWI A;  2OE0 A;  2YJ7 A;  5JCG A;  1M0U A;  1TK0 B;  3GFK A;  4YKG A;  3LWA A;  1PRX A;  2PVO C;  2WFC A;  2YZH A;  4PUA A;  1T3B A;  9GSS A;  1TW9 A;  2XC2 A;  2LST A;  1PGT A;  3E9J B;  1TU8 A;  3VPT A;  4F82 A;  3W6G A;  1WIK A;  2B1K A;  1RW1 A;  1GLQ A;  3L9V A;  4J56 E;  4O32 A;  4YH2 A;  2B3S A;  2ALB A;  1K0N A;  2BJX A;  1S3A A;  5A5K A;  1SD8 A;  5L71 A;  3PPU A;  1GUH A;  1K3L A;  1SKW B;  2MBS A;  2KOK A;  3PIN A;  4FO5 A;  1Q98 A;  4TR3 A;  5B6N A;  1FAA A;  2M72 A;  5ECH B;  4BL7 A;  4L0U A;  3FRC A;  3DIE A;  3ZYW A;  4GSS A;  1YEX A;  4TKY A;  3V1W A;  3GYK A;  4DEJ A;  2R0G A;  3QFB C;  1EWX A;  1KEB A;  3US3 A;  5EY6 A;  4GQF A;  2YV9 A;  4Z2U A;  1PA3 A;  4D73 B;  3CXG A;  4MAB A;  5DAK B;  4OFN A;  2JAD A;  3TKP A;  1XWA A;  3DRN A;  18GS A;  1Q4J A;  1U6T A;  1AC1 A;  3HJM A;  4V1A g;  4OFT A;  5B8B A;  4N30 A;  1THX A;  1M7T A;  4KDX A;  3TKS C;  3DML A;  2XBQ A;  3NIV A;  1XOB A;  2GZY A;  4G2E A;  4MZC A;  1OC8 A;  3FZ4 A;  4FH8 A;  2C3N A;  4KCE A;  4A5P A;  4MH2 A;  3F4T A;  4IP1 A;  4N11 A;  4K5R A;  4ZBD A;  1K0O A;  4EDZ A;  1USB A;  5AIX A;  4KDY A;  5DCG A;  4LMW A;  3VFI A;  1HNC A;  3ISO A;  3LGC A;  4K7N A;  3ERF A;  4K7I A;  2A2R A;  5ELA A;  4KA0 A;  3W8J A;  2A4H A;  3IHG A;  5J9B A;  3U5R E;  4MK3 A;  3VK9 A;  4FYB A;  3M1G A;  4ML1 A;  2JZS A;  4H86 A;  2CVD A;  2DKI A;  2TRX A;  1A24 A;  2FLS A;  3UAR A;  1OC9 B;  1VF2 A;  3WGD A;  3ZIT A;  3M9K A;  1NSW A;  3P2A A;  1EGR A;  3MSZ A;  3UIW A;  2WCI A;  3Q18 A;  4NXI A;  1F3B A;  1EEJ A;  5D9V A;  3IOS A;  1GNW A;  4NWY A;  4TXO B;  1UN2 A;  4O5R A;  3H93 A;  3M0F A;  5GSS A;  3GX8 A;  1ERT A;  3HJP A;  2LNS A;  3ZVJ A;  1XWG A;  3CYN A;  3LFL A;  1Y6E A;  1F9M A;  1ZYE A;  2NVL A;  3CSJ A;  5IO0 A;  2AB6 A;  4ZBA A;  4MJE A;  3TKS E;  1GLP A;  3GRX A;  4V2L A;  1YKA A;  4GTU A;  2YAN A;  4EDY A;  5KOW A;  4XTS A;  3DWV A;  1VGL A;  3KIJ A;  20GS A;  4V2M A;  2DJK A;  3C1R A;  3DXB A;  2PUK C;  4EUY A;  2X64 A;  4IQ1 A;  3EU3 A;  3IRA A;  4HQZ A;  6GSW A;  4N10 A;  1BQ7 A;  3UEM A;  1GSE A;  2BMX A;  4EF0 A;  4MCU A;  1PL2 A;  2B5E A;  1PN0 A;  3VI5 A;  1G7E A;  1EV4 A;  2PWJ A;  3EUR A;  4DSS B;  2FNO A;  3IC4 A;  2VCV A;  1EP8 A;  2H1D A;  2H71 A;  1T00 A;  1M9A A;  4MF5 A;  2DJ1 A;  3BOA A;  4ML6 A;  3RHC A;  3TKS A;  1GSF A;  3PR8 A;  5IMC A;  1PN9 A;  3CSH A;  2O8V B;  1WJK A;  4F9Z A;  3IV4 A;  1WOU A;  2L6D A;  2PBJ A;  2HNL A;  2LV3 A;  2TIR A;  2C0E A;  4GSN A;  1DSB A;  4V2N A;  6GSS A;  4L5L A;  4JRR A;  4O7H A;  5IOW A;  1F2E A;  4FIW A;  1VF4 A;  3TJF A;  2AAW A;  3FR9 A;  2DMM A;  5ECL B;  2RM6 A;  4JED A;  3GMF A;  3KH9 A;  4EL1 A;  3APS A;  2FD3 A;  1EEM A;  1TU7 A;  1A8Y A;  4G0L A;  2HT9 A;  3FY7 A;  2HSY A;  4ZL7 A;  1GSQ A;  3KM6 A;  1K0M A;  3LQ7 A;  3GTU B;  4WBJ A;  1BED A;  1VF1 A;  1T1V A;  2CT6 A;  4IBP A;  5HR2 A;  2C0D A;  3RHB A;  4K8M A;  3A5W A;  4KH7 A;  3D21 A;  3MNG A;  5ECO B;  4JZQ A;  1HNB A;  2ZNM A;  4KCA A;  2IJY A;  1KNG A;  2LQQ A;  5COH A;  2VLV A;  2PER A;  3DVW A;  1V9W A;  4FQU A;  2H1B A;  4GST A;  4OMV A;  1BJX A;  1WRY A;  3E0U A;  5KOX A;  2H72 A;  1YY7 A;  1ZYP A;  3L4N A;  4TXV A;  4OWY A;  1WE0 A;  3BD2 A;  4L0W A;  3IR4 A;  4ZBB A;  3RBT A;  2WJU A;  1GL8 A;  1NM3 A;  2A4V A;  2H66 A;  3LEF A;  4IS0 A;  2KUC A;  4L8E A;  2MZC A;  1DE2 A;  2MMO A;  1B4Q A;  3KMO A;  4O92 A;  4IHU A;  5D9T A;  2MMZ A;  5FT3 A;  4YQV A;  4NMU A;  2R5G A;  4AGS A;  4D73 A;  5IPG A;  3K8N A;  4KUN A;  4G9H A;  4OO4 A;  5DAK A;  12GS A;  1GSY A;  2GT6 A;  1B4P A;  4EVM A;  3TOU A;  2RUE A;  1TRV A;  1Z7R A;  2K9F A;  2REM A;  5KEJ A;  2CAQ A;  1F37 A;  3N5O A;  5HR0 A;  1JZD A;  3CRU A;  3F0I A;  2LKU A;  2YN1 A;  5ECP B;  1PL1 A;  2NBS A;  4AJ7 A;  3HXS A;  4F2I A;  3PH9 A;  3CBU A;  2L5L A;  2NPB A;  2FY6 A;  2VLT A;  5IMA A;  1QUW A;  1J9B A;  1A0F A;  2DJJ A;  5ECN B;  2CV4 A;  1GTI A;  2GTU A;  3KD0 A;  4NAX A;  4IGJ A;  5F8B A;  1AQX A;  2JU5 A;  5B6M A;  5CRE A;  5JWQ B;  2OBK A;  1EOH A;  1ST9 A;  1XZO A;  2FGX A;  4KB3 A;  2EIO A;  3HKR A;  1XXU A;  2QGV A;  3GL5 A;  3L0H A;  1V40 A;  3HA9 A;  2FHE A;  2H73 A;  1O8W A;  2WZ9 A;  3GSS A;  3F4R A;  3DD3 A;  1OC9 A;  1T4Z A;  1HQO A;  2V2G A;  5H5S A;  1UC7 A;  4GXZ A;  3L9U A;  4WBR D;  5ID2 B;  4I97 A;  3GX0 A;  2YWO A;  1THO A;  3FZ9 A;  5J4U A;  3LXZ A;  4QL7 A;  4GF0 A;  1Z6M A;  4TXO A;  4PGT A;  4MH3 A;  3G7Y A;  4J57 E;  3ZFB A;  3GKX A;  2HYX A;  2PVQ A;  1M99 A;  4TR1 B;  4ILF A;  2LRT A;  1JLW A;  5DVB A;  2B7J A;  1RK4 A;  5CNW A;  2GQM A;  3G7I A;  4LLR A;  3MAK A;  1DBY A;  2X8G A;  2GVP A;  4ECC A;  4IN0 A;  2FUG 2;  3F8U A;  1FG4 A;  3FMW A;  5G1K A;  3O3T A;  3I6A A;  4HQS A;  4POK A;  3GH6 A;  1M2D A;  3RDW A;  2HE3 A;  2E7P A;  1LU4 A;  3HVV A;  4WET A;  1RQM A;  2IWT A;  3DKS A;  4ZB9 A;  2VL2 C;  4IJ3 A;  1O8X A;  1VF3 A;  2RII A;  4DSS A;  2GQK A;  5IMD A;  3FZ5 A;  3VLN A;  3ZZX A;  2R0P A;  5HR1 A;  19GS A;  4FYU A;  2H1A A;  2L4C A;  1CQG A;  2JZT A;  4OCE A;  1N2A A;  17GS A;  3QOU A;  3UOM A;  2XPE A;  2E2G A;  4POB A;  1AAZ A;  2H19 A;  3TJJ A;  1K3O A;  1R4W A;  4HZ2 A;  4CY8 A;  3GV1 A;  2C0G A;  4BA7 A;  4KGI A;  1FW1 A;  2WDU A;  3D0Z A;  4TVE A;  1AQV A;  3WGX A;  3TGZ A;  3ZTL A;  2VCX A;  2GGT A;  4HOJ A;  1R26 A;  5IMF A;  3J7Y k;  2V6K A;  3IK7 A;  1ABA A;  3ZLP A;  1QGV A;  5JWR B;  3IAS 2;  5CRD A;  2LJA A;  3GTU A;  4CY6 A;  1O85 A;  3LOR A;  1SYX A;  5J3R A;  2FWH A;  1WMJ A;  2ES7 A;  3M3M A;  3D6I A;  2LS5 A;  3MIX A;  4PQI A;  2X49 A;  4IJI A;  3ZL5 A;  4BVY A;  5ENU A;  5B8A A;  2HXK A;  2H6Y A;  4WEY A;  4MJB A;  4MJC A;  3GIX A;  3QAV A;  1NHY A;  1ZMA A;  4Q5N A;  3TB2 A;  14GS A;  3C1S A;  2GSQ A;  3GUS A;  1F3A A;  1O81 A;  1ZOF A;  1BG5 A;  4KF9 A;  2KHP A;  1TRW A;  4Q5Q A;  4RI6 A;  1ILO A;  2YOI A;  5ABR A;  4HU9 A;  3TRX A;  5D73 A;  5CRW A;  2LRN A;  1XVQ A;  2AYT A;  5AIS A;  4KSO A;  2OE1 A;  2CVB A;  1B8X A;  4K7O A;  3ZIJ A;  1AUC A;  4MP4 A;  3EMX A;  3BCK A;  1FVK A;  2GSR A;  3L78 A;  1ZZY A;  2QA1 A;  3CTF A;  2IMI A;  4I8B A;  3APO A;  4EXJ A;  2VL2 A;  3UJ1 A;  3EPT A;  3GKK A;  2R2J A;  3A3T A;  3IDV A;  4OFM A;  1H4O A;  3LYK A;  2Z9S A;  2PU9 C;  4G19 A;  2N5F A;  4HU7 A;  5CAX A;  2R37 A;  1XFL A;  2C80 A;  1JZW A;  2X8C A;  1TTZ A;  1ERW A;  3A2W A;  5HFG A;  4I6X A;  3UAP A;  3KXO A;  2GT5 A;  3TKQ A;  1B9X C;  4TW5 A;  2H1G A;  1M2B A;  10GS A;  2XHF A;  3IHQ A;  2K8S A;  2QC7 A;  1EOG A;  1U3I A;  2VLU A;  4XRD A;  2VM2 A;  3HJO A;  3QFA C;  5DJL A;  4O5Q A;  2A2P A;  3UMA A;  3KJY A;  4KX4 A;  5H5R A;  1JHB A;  5ID2 A;  2WUL A;  4EIQ A;  5D93 A;  2O87 A;  2DBC A;  1MEK A;  2OAC A;  4HJM A;  1FO5 A;  5G31 A;  1SK0 A;  2HRK A;  2X4A A;  4HUA A;  1XPV A;  2DSA A;  3QCP A;  1EV9 A;  4X0X A;  3GST A;  3UVT A;  2O7K A;  4WKW A;  3F9U A;  5G2Z A;  2PN8 A;  3ZRD A;  4TR1 A;  3IAM 2;  2VCQ A;  7GSS A;  2C8U A;  2IME A;  3RPN A;  4BVX A;  4K0G A;  2VM1 A;  1ZL9 A;  2VL3 A;  1J0F A;  3F4S A;  2IL3 A;  1TKD B;  1HYU A;  3G7J A;  3TOT A;  2R4V A;  5CO3 A;  1OAZ A;  1PKZ A;  2VCW A;  2IMK A;  2I9H A;  2QKE A;  1SKR B;  2JSZ A;  2K18 A;  5AIV A;  5J5N A;  3A2X A;  5BMU A;  2F51 A;  4K5S A;  2GLR A;  1A2L A;  1XCC A;  5DQY A;  2CAI A;  2HI7 A;  4TRX A;  3IBH A;  4E8H A;  2DIZ A;  3CRT A;  5FHI A;  1C72 A;  5CP1 A;  2H0I A;  4IP6 A;  2L6C A;  3GH9 A;  1R5A A;  4GWR A;  5KN1 A;  2GDR A;  4QQ7 A;  1TK8 B;  4O5U A;  4ECI A;  1K0A A;  4MZB A;  2JZR A;  4PQH A;  4AF2 A;  3OR5 A;  1TK5 B;  2AUV A;  2LJK A;  2PGT A;  1FB0 A;  1BAY A;  4JE1 A;  3HZ8 A;  4G0K A;  6GST A;  2FA8 A;  2HFD A;  5HR3 A;  5CRG A;  1N8J A;  2DC5 A;  3FKF A;  3HYP A;  2R0C A;  3A5I A;  3DYR A;  1GSS A;  2H76 A;  2YWM A;  2I3Y A;  1ON4 A;  1AQW A;  5DJM A;  2KP2 A;  3BJ5 A;  4IKH A;  4NHW A;  5AN1 A;  1BYE A;  4XRA A;  5G30 A;  1GTU A;  1XOA A;  3IPZ A;  3D22 A;  4ICY A;  3H8Q A;  2H70 A;  2JSY A;  4OCF A;  2WRT A;  2ON5 A;  6GSY A;  1G6W A;  2VD0 A;  2CX3 A;  4KE3 A;  5JCW A;  1QMV A;  3DEX A;  16GS A;  3FHK A;  2OJL A;  4PX1 A;  3R3E A;  3IK9 A;  1IYI A;  1U87 A;  1K0B A;  4IEL A;  2RLI A;  2JAC A;  2ZCT A;  3GN3 A;  2VL9 A;  2N5B A;  1ERV A;  3VWU A;  2NTO A;  4BWQ A;  3C71 A;  2TRC P;  4ZXG A;  6GSU A;  2LNT A;  4N0V A;  5GZZ B;  2EIQ A;  4K0N A;  2AJQ B;  2B5X A;  4WF5 A;  1PMT A;  3G9B A;  4GLT A;  3KP9 A;  11GS A;  4GQC A;  3M8N A;  4NV5 A;  2VUP A;  4JR6 A;  5D96 A;  1R5P A;  2VCT A;  2EIR A;  2XPD A;  2NDO A;  3FR6 A;  5LCZ A;  3AY8 A;  3ERW A;  4JBB A;  2ZUP A;  3W8S A;  3LJR A;  3Q19 A;  3MDK A;  3SBC A;  2UZ8 A;  1MTC A;  2DLX A;  4MPG A;  4AJ8 A;  2M80 A;  5ECK B;  1GUK A;  2H0H A;  3GL3 A;  1S3D A;  1K0D A;  1NW2 A;  1SK2 A;  1JZO A;  4V1A p;  4ID0 A;  3KEB A;  4XIH A;  2OKA A;  3ZRE A;  3S9F A;  3HDC A;  2B7K A;  1XW9 A;  1QQ2 A;  3F6D A;  2DJ3 A;  1EGO A;  3HZ4 A;  1HD2 A;  4HI7 A;  3ZMK A;  5BRT A;  1W89 A;  2N5A A;  3PGT A;  3D5J A;  4HS1 A;  5DQS A;  3A2V A;  4OO5 A;  1K3Y A;  1G0T A;  1XVW A;  3SWL A;  2H74 A;  1GNE A;  2YZU A;  4RQX A;  4FYC A;  5B7C A;  2C3Q A;  5D9X A;  1X5C A;  4CHS A;  3HVX A;  2FWE A;  3CMI A;  5D9W A;  4KSM A;  4MPF A;  1JFU A;  2PMT A;  4I2T A;  2MMN A;  4LL4 B;  5D8I A;  4EO3 A;  2FWG A;  2I81 A;  1TI3 A;  3UL3 A;  3KZQ A;  1PD2 1;  2LEG A;  1ZGN A;  1B48 A;  5LNK e;  1TP9 A;  1MDJ A;  1Z7P A;  4GCI A;  4E8E A;  3U6V A;  3LYP A;  5DDL A;  1A0R P;  5JCU A;  3VI7 A;  3P7X A;  2RUF A;  1PKW A;  2CQ9 A;  1MD3 A;  1OKT A;  5F0G A;  3FK8 A;  4MDC A;  4X43 A;  5INY A;  5A4U A;  1TI1 A;  1CQH A;  1EP7 A;  1V57 A;  3KCM A;  4MJA A;  3APQ A;  5GAN D;  4K9Z A;  3TJG A;  3EE2 A;  1GTA A;  5KN2 A;  4TR4 A;  2F9S A;  3P8W A;  3FEU A;  3UBK A;  5E4W A;  1ACV A;  4K1F A;  4KND A;  5JWO B;  2IFQ B;  4ZIJ A;  1YEP A;  3VPQ A;  3HVS A;  2YPM A;  3ZVJ D;  2YWN A;  4HDE A;  1I9D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...