1W4VA

Structure of the oxidised form of human thioredoxin 2
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
110
structure length
110
Chain Sequence
HGSTTFNIQDGPDFQDRVVNSETPVVVDFHAQWCGPCKILGPRLEKMVAKQHGKVVMAKVDIDDHTDLAIEYEVSAVPTVLAMKNGDVVDKFVGIKDEDQLEAFLKKLIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords THIOREDOXIN, MITOCHONDRIAL
publication title Crystal Structures of Oxidized and Reduced Forms of Human Mitochondrial Thioredoxin 2.
pubmed doi rcsb
source organism Homo sapiens
total genus 34
structure length 110
sequence length 110
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2004-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1w4vA00
4ZILA 3TKPA 4F9ZA 5FHIA 2HZEB 2JZRA 3TKQA 3WYWA 1HNBA 2VAFA 3VI7A 4HS1A 2FLSA 2K9FA 2WULA 4K6XA 4ISDA 1TDIA 3MDKA 3SBCA 3G7JA 4IVFA 3ZZXA 2YNXA 5HFIA 2H66A 3UAPA 2Z9SA 3JCML 6GSYA 2DLXA 1WWJA 4MCUA 3GV1A 1GTAA 1MTCA 5H5SA 3APQA 22GSA 3ME7A 2B1LA 3BOAA 1URMA 5ENUA 2LRTA 5IO0A 2O8VB 2RUEA 2L57A 1DUGA 2EIQA 2X64A 1RK4A 1Y6EA 6GSWA 2VO4A 3HVVA 2X99A 4JR4A 4OD7A 4GCIA 2F3MA 4K8MA 4K7NA 3BJ5A 3RPNA 3CSIA 1G6WA 2R37A 3QAGA 2YV9A 4KSOA 1Z6MA 1LBKA 1SD9A 1A0FA 1VF4A 4ML6A 2TRCP 3TJGA 4JU5A 4IQAA 2IPAA 3H8QA 2HSYA 1Q4JA 1XIYA 2H8LA 1AQXA 2YWOA 2K18A 2WS2A 2J23A 3CSHA 2PVOC 4KA0A 2VLTA 1K0NA 4ECCA 2CT6A 2PMTA 5J41A 2TRXA 5J9CA 4BPYA 3D4MA 2J9HA 4V2LA 4MZCA 4J56E 1A23A 2P5QA 2B7KA 3TDGA 2XPEA 4MJCA 1JZWA 4E8EA 1ERTA 2ES7A 5INYA 4AGSA 3TRQA 3QMXA 5ELGA 2NDOA 5EVOA 4EDZA 1OC9A 4JE1A 2V41A 2GZPA 4RQRA 2C80A 3IK9A 1K0OA 4ULXA 1HD2A 5G5FA 1ST9A 4AF2A 3ZRDA 1Q98A 2PN8A 3KTLA 1O8XA 2LTKA 2YPMA 4GXZA 4KSMA 5D9TA 1WE0A 3C71A 5CYYA 3IAS2 3EMXA 1H75A 4NHZA 2VM1A 4P3YB 3K8NA 3LQ7A 3KP8A 2LRNA 4NPBA 1TK0B 2R4VA 3BCKA 2O85A 5CRGA 1IYHA 4IKHA 5KN2A 5C04A 1WIKA 2P5RA 3CTGA 2R5GA 2GS3A 5DBQA 4YAPA 3UIWA 2OA7A 3QFAC 5IOWA 2GQKA 3FW2A 2LKUA 5HQPA 3P8WA 2I4AA 2YJ7A 1OAZA 5F8BA 1J08A 1TI3A 1M7TA 3UL3A 3SWLA 1R26A 4MP4A 4ZL8A 3M1GA 1QFNA 1U87A 2A2RA 2C1YA 4IELA 1OC9B 4FIWA 4G19A 4ZBAA 3BBYA 4TXOA 2QGVA 3KCMA 1A24A 3W8JA 3EWLA 2KHPA 1XW5A 1B9XC 2B7JA 4OFTA 3VWVA 5HR1A 3FK8A 3ZREA 2PUKC 1XWGA 1F6MC 4K0NA 5GZZB 2F9SA 3GKNA 1Z3EA 1PN9A 4HZ4A 1UA5A 1NW2A 2V1MA 3RHCA 2AYTA 5ID2A 1GUKA 3DKSA 4HU7A 5AISA 4TR1A 3ZMLA 3ZLPA 1GSYA 6GSSA 1DSBA 2DC5A 3GFKA 3GL5A 1OKTA 3ZTLA 2KUCA 5E4WA 1QGVA 2FY6A 4PUFC 1PKWA 2MMNA 1ABAA 4WBJA 3LSZA 1TRWA 3QPMA 4NWYA 3M9KA 4JEDA 2ALBA 3HY2A 4PQ1A 2MBTA 1RW1A 3CTFA 5D9VA 3DEXA 1X5CA 3WD6A 1V57A 4N10A 12GSA 2HRFA 3E0UA 1A2JA 3Q74A 3LFLA 2GQMA 3C7MA 4XS4A 1ILOA 1GSSA 2WJUA 4TR0A 4TXOB 3FHKA 3F4RA 3EVIA 4PUAA 2C4JA 1TTZA 1VGLA 4TRXA 1TU7A 3KIJA 4Z7XA 1K3OA 3KGKA 2IMKA 3ZITA 3IAM2 3WGDA 2G2QA 2FUG2 4RUVA 5DALA 5B8AA 1EGOA 4ILFA 5B7CA 3QFBC 2R2JA 1V40A 1ZOFA 4KAEA 2LS5A 4IP1A 2XBIA 3GX0A 1ZYEA 1M2BA 1VRSD 4DVCA 5ID2B 1HQOA 4TR1B 3TKRA 1MD4A 3QCPA 5HFGA 1M9AA 2AHEA 4NXIA 4POLA 4ACSA 4MMMA 5F06A 4MA9A 3WT2A 2REMA 4XTSA 4E8HA 3IV4A 4EO3A 1SD8A 3EYTA 3IOSA 1TRUA 2GSRA 3FR3A 2GZYA 1LU4A 4YQMA 3EC3A 2MZCA 4BL7A 2GSSA 2EC4A 2CA8A 4EDYA 3AY8A 1EOGA 3LG6A 4OO5A 4KB3A 4GSTA 2VD0A 1E2YA 3C8EA 3A3TA 3PH9A 2BMXA 1M9BA 4O32A 1YY7A 3CYNA 4BWQA 3EURA 4MPGA 3RHBA 4POBA 4MF6A 1V9WA 1WRYA 2VUPA 4HZ2A 4QL9A 1VF3A 2CAQA 2B5XA 5DALB 4F2IA 3DRNA 5IMZA 3N9JA 3APSA 5G31A 3DMLA 3H1NA 5ELAA 2ZCTA 5JWRB 3FR6A 3NZNA 3GH9A 1W4VA 1TJDA 2DSAA 3UBKA 4DSQA 2O89A 2C0DA 2YANA 2GSTA 1M2AA 3I9V2 4I6XA 5IMFA 4PURA 4MABA 4BVYA 1B4QA 5IMVA 1A8YA 14GSA 4YQVA 3CRTA 4PQHA 4MF5A 1GULA 2JZTA 1A2MA 2FA8A 1YEPA 1LJRA 1SJIA 1BEDA 3FKFA 2OE1A 3ZL5A 1O7UA 3MAKA 1C72A 1TOFA 3RPPA 4TXVA 2L6DA 4EXJA 2JZSA 5B6NA 2VLVA 3GHAA 2AV4A 1GL8A 5KN0A 1G7EA 5J9BA 3F4TA 1A0RP 2PERA 4ECJA 3DWVA 2HNLA 1EOHA 5J4UA 5KEJA 2V32A 1XVQA 3GKXA 5ECHB 1MEKA 1SK2A 1EGRA 2LJRA 4Q5NA 5GAND 4G2EA 2CZ3A 2LUSA 2CX4A 4LL1B 2OE0A 3P90A 2H0HA 3C73A 2DIZA 4K2DA 1ZCPA 3LXZA 1B8XA 3F3QA 5L71A 2PGTA 4HQSA 1PGTA 3IBHA 4TW5A 1QK8A 4NV2A 3D6IA 1X9WB 2C3NA 2JSZA 1NSWA 1PL2A 4F03A 2FWGA 3LWAA 4GQFA 5COHA 4GLTA 3ZIJA 4KGIA 1S3CA 1ZMAA 4GF0A 5CAXA 4WEYA 2H01A 1GTUA 5ECLB 3NOFA 1XZOA 4BVXA 3UEMA 1V98A 1T00A 3KP9A 1B9YC 4XIHA 5HR0A 2CVBA 2L6CA 2GSQA 3FZ9A 1ZL9A 5ECRB 1EP8A 3LGCA 2FNOA 4TOPA 2OBKA 4O92A 2L4QA 2LSTA 4LL4B 3BD2A 5F0GA 3L4NA 2OJLA 2PPTA 3GMFA 5IPGA 3FR9A 3E9JB 3IR4A 2VLUA 2H1GA 2H75A 1KTEA 4MJEA 5D96A 1GSDA 2OADA 4WKWA 4HUAA 4XHMA 4G10A 4N11A 5CRHA 3DVWA 5A4VA 3FRCA 1EP7A 3DXBA 3CRUA 3HDCA 2P0GA 1S3DA 3FY7A 2WRTA 1U3IA 2B5YA 2R6KA 3O76A 3CSJA 1IYIA 2FD3A 3UVTA 5HFKA 1PSQA 4F0BA 2QC7A 1Z9HA 4G9HA 2XBQA 2K8SA 2JL4A 3HKRA 3US3A 2VL9A 3HJOA 1ML6A 3EU3A 4AJ6A 3A2XA 1UVZA 2IJYA 1ERVA 4HOJA 1VF2A 3ZMKA 2VD1A 4L5OA 3W6GA 5C00A 4O7HA 4OMVA 5DVBA 2C8UA 3F3RA 4ZL9A 3VFIA 1K0AA 2BJXA 4FYBA 1FAAA 3IA1A 3GKMA 4LA1A 3A2WA 2M46A 3LXTA 3ME8A 3Q19A 1XW9A 1NHOA 2YOIA 2VCVA 1Z6NA 3GH6A 1R7HA 1G0TA 2NBSA 3TKSC 3IHQA 4GWRA 1TU8A 20GSA 18GSA 2C3TA 3OR5A 1A8LA 5CP1A 1SKRB 2AB6A 2X8GA 1MDJA 4POMA 1GTIA 4PGTA 2B1KA 3GSSA 1EV9A 1XWAA 1FB0A 1EEJA 1SK0A 3TKSA 2QSIA 1BQ7A 5G1LA 2E2MA 4EE0A 1XCCA 1F37A 2HI7A 4WR5A 2JU5A 5ECMB 6GSTA 1KNGA 4OO4A 1EZKA 1XPVA 4I97A 2E0QA 2GT6A 5DAKA 2H19A 3D22A 2LJAA 3VURA 1PD21 5D8IA 5D9XA 4IHUA 3PINA 4GRFA 3KD0A 5HR3A 2H6YA 4WR4A 1N2AA 3QR6A 3G7YA 3M0FA 2D2ZA 3VI5A 1KBNA 4XRDA 2GQLA 4DSRA 3F6FA 2TIRA 3ZVJD 3PGTA 3HYPA 4KUNA 3G7IA 4RQXA 3ERFA 2GTUA 1TW9A 5DQYA 4WXTA 1SENA 4L5LA 13GSA 1T3BA 3L9UA 4RI6A 3IC4A 1YEXA 2HZFA 1AAZA 1AUCA 1PL1A 3HD5A 3O3TA 2N5AA 1QXHA 1B48A 4IGJA 4JZQA 1SYRA 4CDOA 1WMJA 5AIVA 1WPIA 2H0IA 3D4TA 4HQZA 2O7KA 4HJ2A 1DBYA 3HXSA 2DJ0A 1ERWA 2YZHA 4V2MA 2YN1A 4TR4A 3F8UA 3TJFA 3L9VA 3TB2A 4EF0A 1QUWA 3J7Yk 1JZOA 4Q5FA 5DAKB 1K0DA 2V6KA 2YZUA 3D5JA 3S9FA 1K3LA 1Y25A 3VPTA 4KDYA 4WETA 5ECNB 1J9BA 3QAVA 2OACA 4GSSA 3LEFA 4FYUA 1FVJA 4WF4A 2NPBA 3GTUA 3MSZA 5B8BA 3TCOA 3C1RA 2H30A 4CHSA 5HR2A 2JSYA 5H5RA 4OCFA 1GLQA 1M0UA 2H72A 1F3BA 1GSQA 5GAPD 3L0HA 1K3YA 2CX3A 1SL0B 1SYXA 5GSTA 4PQIA 5KN3A 3RBTA 1V2AA 2H1DA 2OE3A 5F07A 1TXXA 1NM3A 4K0GA 2E7PA 2IFQA 3FZ5A 5IPHA 2DIYA 1FOVA 3F0IA 5IQYA 1EEMA 4H86A 3TGZA 1OKDA 2A2SA 3EE2A 4PNGA 4LLRA 6GSVA 1XFLA 2G0FA 5CNWA 3QD9A 3RAZA 4XS4B 2AJQB 3P7XA 1GH2A 4N0VA 5ECSA 2B3SA 1CQGA 2B5EA 3HVSA 4ZBBA 3VWUA 1GUMA 1SKSB 5DCGA 2YWNA 1EV4A 1JZRA 4ZB9A 2HXKA 4X1UA 4K1FA 1SL2B 2LNSA 4OCEA 4IBPA 2H76A 4K7OA 1T7PB 2IMIA 1AQVA 5ECOB 3HA9A 5J5NA 1E6BA 1GWCA 5DDLA 1RQMA 3EINA 4K9ZA 1O85A 2JACA 1FVKA 2ON7A 2IMDA 3GTUB 3MWHA 4N30A 1OE7A 5CRWA 4KW6A 2IL3A 3HCZA 4GTUA 1FHEA 3APOA 3CXGA 2C0GA 1M99A 2GLRA 2H0GA 2WCIA 3O6TA 5ECQB 4EVMA 2FA4A 3HJPA 2F51A 1PKZA 1FW1A 1XOAA 3D21A 3KH7A 4D73A 3L9SA 1SJZA 1BAYA 4KCAA 3IK7A 3KMOA 4IQ1A 3GA4A 2WGRA 3I69A 4OFNA 4MJBA 4V2NA 1O81A 4MJAA 2HFDA 2IFQB 3J7Yb 2B6MA 1J0FA 5IM9A 2V2GA 2VOCA 2V6OA 1R5AA 1TP9A 1YQ1A 3KXOA 3FEUA 2GT5A 2F8AA 2YP6A 4OWYA 4MF7A 5FWGA 1BJXA 3U5RE 1QMVA 1U88A 2RM5A 3LYKA 1PQNA 4YQUA 3E3EA 1GNEA 1YKCA 4KDUA 2MYGA 2RUFA 2IIYA 3I43A 2VCWA 2H70A 1OVNA 1AXDA 2GZZA 2JADA 1NHYA 5A4UA 1G7OA 1TKDB 4J57E 17GSA 3V1WA 1F3AA 4RI7A 3L78A 1O6JA 4FO5A 3KJYA 3GRXA 5IOXA 3KMNA 1TI1A 3BCIA 3GX8A 3GSTA 2I3YA 3VWWA 1JLVA 1SL1B 2LEGA 4D73B 1GSEA 2K6VA 4FYCA 5G5EA 4ZIJA 2AAWA 1Z7RA 3GN3A 4IS0A 1SU9A 2DBCA 4X0XA 1OYJA 1YZXA 2H71A 2I9HA 3LJRA 1THOA 3IPZA 1PX7A 1TRVA 3TKSE 4ZB6A 5JWQB 16GSA 3TRPA 1GRXA 3DGQA 3VWXA 1ZYQB 1O73A 2I81A 3DVXA 1XWKA 1MD3A 2CVKA 4AJ7A 3HZ8A 3Q18A 3GNJA 2FWFA 4NMUA 4WF5A 5DJLA 1T8EB 5G1KA 4L0WA 3MNGA 4XS1A 2CQ9A 2H1BA 3TUEA 3ERWA 1S3AA 4DSSA 3C1SA 5ECKB 1MDKA 5JCUA 1CQHA 10GSA 3TJKA 1YF0A 2CZ2A 2FCHA 2FWEA 1XWCA 1A2LA 3ISOA 4I2UA 4JBBA 3WGXA 3RDWA 4BA7A 2M72A 1THXA 5EPFA 4XRAA 1FO5A 5G30A 6GSXA 2VL2C 2C0EA 1K0MA 4PXOA 5EL8A 1WP0A 2CV4A 5CREA 2IMEA 3LYPA 5LNKe 2A4VA 2F8FA 2MMZA 4MH2A 5A4WA 5AGYA 4IP6A 5CO3A 2YWMA 4F82A 2X8CA 1ZGNA 2VL2A 4WBRD 1ERUA 3ZYWA 1YF1A 1FB6A 4ZXGA 4XS6A 3G9BA 4PNFA 3KH9A 4HJMA 1UN2A 4EUYA 2OKAA 4ECIA 3HJMA 3IRAA 1HNCA 5D73A 4IJ3A 5ECPB 4HI7A 3HHVA 4I2TA 2PBJA 4TN8A 1YDKA 4QQ7A 4L8EA 2N5BA 1WOUA 1XXUA 3KEBA 4DSSB 2HYXA 1ACVA 2HLSA 2RLIA 1X9MB 1ON4A 1Z5YE 1M2DA 1VF1A 1PX6A 3M9JA 1R4WA 5A5KA 3UBLA 1XBSA 1X5DA 2VM2A 4KCEA 2NTOA 3F6DA 4K7IA 4KE3A 2XHFA 5IO2A 3VK9A 2LJKA 1AIUA 3GUSA 3UMAA 5GSSA 4ZL7A 2L5LA 4PX1A 2MMAA 2DMMA 2YCDA 2FWHA 1PRXA 3TOUA 1GSUA 2ZNMA 2H1AA 3IXRA 2CVDA 4CW9A 5E59A 2I1UA 4MZWA 4LMVA 3EU4A 4I8BA 4TKYA 3GYKA 5CRDA 3TRXA 5J3RA 2HRNA 2LV3A 4KX4A 2QKEA 4ZBDA 3GURA 2KP2A 4Q5QA 2DJKA 2MMOA 2AUVA 1XOBA 1QQ2A 5DJMA 4MLYA 4NAXA 5ECIB 4IW9A 1I9DA 2L4CA 1K0CA 5FT3A 1JHBA 1G6YA 4EL1A 3NIVA 1U6TA 2R3XA 1K0BA 4F0CA 4POKA 8GSSA 1JFUA 4XCSA 1T4ZA 2BTOT 3I6AA 5F05A 5IMCA 1BG5A 2C0FA 3LORA 3ED3A 3GL3A 2N5FA 4JRRA 1DE1A 2DJ3A 3GKKA 4HEA2 1ZZYA 2L59A 3IDVA 2PU9C 1YKAA 2L5OA 3HZ4A 2DMLA 4NHWA 4N0ZA 2DJ1A 4GSNA 4LMWA 1WJKA 5DQSA 1HYUA 2WZ9A 2FGXA 1X9SB 3UOMA 5AIXA 2LNTA 4EC0A 2M80A 1YJ6A 3TJJA 3H79A 1PMTA 4YAVA 2YJHA 3H4KA 2LRCA 4NV5A 2VCZA 5EY6A 4IN0A 3QDNA 1AW9A 1EWXA 3KTBA 3VLNA 3ZVJA 3ZIVA 3HVXA 2KOKA 2YWIA 3DIEA 4ECBA 3FZ4A 3KM6A 2C3QA 1XW6A 9GSSA 2K8VA 2GVPA 4V1Ag 2KLXA 5H5QA 3CMIA 1GUHA 3DYRA 2PWJA 1UC7A 2HT9A 4L0UA 5D93A 5G2ZA 4TR3A 2RIIA 3F4SA 3N5OA 5IMDA 2KP1A 5ABRA 4MDCA 3FZAA 3H93A 4AJ8A 4IJIA 4DEJA 5JCGA 7GSSA 3A2VA 1JZDA 4QL7A 1TRSA 1R5PA 11GSA 3FYGA 2DJ2A 2P31A 2ON5A 1W89A 2WFCA 2PVQA 1KEBA 1OE8A 4MH3A 1SKWB 4O5RA 1GSFA 1MDIA 3KZQA 3ERGA 2E2GA 4MPFA 4TVEA 1GNWA 1SJ6A 5AN1A 1JLWA 2DJJA 2GGTA 4OFMA 3M8NA 5DCHA 4KH7A 4KDXA 4J2FA 1USBA 3U6VA 2IN3A 1T1VA 3IE3A 4X43A 2OBIA 3F63A 5LCZA 1N8JA 1F9MA 1HNAA 3PR8A 4HU9A 3ZFLA 4JR6A 3TJBA 2CAIA 1XVWA 1U3AA 3GIXA 2ZUPA 5LD0A 3UJ1A 3P2AA 2H73A 4EKZA 3QAWA 2HZEA 1BX9A 1SK1A 4MK3A 1B4PA 1FG4A 4ML1A 3ZFBA 5B6MA 4YH2A 1TK8B 4KNDA 1BYEA 6GSUA 2H6XA 1GLPA 2RM6A 3WGEA 3DD3A 2XC2A 2VCQA 4FH8A 1GTBA 2EIOA 3VPQA 1OC3A 2YV7A 5JCWA 2GDRA 3EMPA 3TOTA 1F2EA 3CBUA 3WT1A 5D9WA 2HSHA 4ID0A 3UVHA 2VL3A 4ZB8A 5KN1A 1H4OA 1I5GA 2VCTA 1PA3A 1Z7PA 1TK5B 4Q5RA 2VCXA 2WB9A 2IWTA 2LQOA 4BWSA 4MZBA 19GSA 2O87A 4V1Ap 3W8SA 1AC1A 2H6ZA 2LQQA 2MBSA 1AQWA 3M3MA 2FHEA 4GQCA 3F9UA 1X0RA 3UARA 1XWBA 3QOUA 1O8WA 4I5QA 1GP1A 5IMAA 2XPDA 3Q6OA 3R2QA 2H74A 5JWOB 1DE2A 2NVLA 1T4YA 2HE3A 2VIMA 1X5EA 1OC8A 1V58A 2EIRA 3D0ZA 2X8HA 4HDEA 2IMFA 5IIZA 2WDUA 3A5WA
chains in the Genus database with same CATH superfamily
4ZILA 3TKPA 4F9ZA 5FHIA 2HZEB 2JZRA 3TKQA 2DKHA 3WYWA 4EIPA 1HNBA 2VAFA 3VI7A 4HS1A 2FLSA 2K9FA 2WULA 4K6XA 4ISDA 1TDIA 3MDKA 3SBCA 3G7JA 4IVFA 3ZZXA 2YNXA 5HFIA 2H66A 3UAPA 2Z9SA 3JCML 6GSYA 2DLXA 1WWJA 4MCUA 3GV1A 1GTAA 1MTCA 5H5SA 3APQA 22GSA 3ME7A 2B1LA 3BOAA 1URMA 5ENUA 2LRTA 5IO0A 2O8VB 2RUEA 2L57A 1DUGA 2EIQA 2X64A 1RK4A 1Y6EA 6GSWA 2VO4A 3HVVA 2X99A 4JR4A 4OD7A 4GCIA 2F3MA 4K8MA 4K7NA 3BJ5A 3RPNA 3CSIA 1G6WA 2R37A 3QAGA 2YV9A 4KSOA 1Z6MA 1LBKA 1SD9A 1A0FA 1VF4A 4ML6A 2TRCP 3TJGA 4JU5A 4IQAA 2IPAA 3H8QA 2HSYA 1Q4JA 1XIYA 2H8LA 1AQXA 2YWOA 2K18A 2WS2A 2J23A 3CSHA 2HRKA 2PVOC 4KA0A 2VLTA 1K0NA 4ECCA 2CT6A 4G0LA 2PMTA 5J41A 2TRXA 5J9CA 4BPYA 3D4MA 2J9HA 4V2LA 4MZCA 4J56E 1A23A 2P5QA 2B7KA 3TDGA 2XPEA 4MJCA 1JZWA 4E8EA 1ERTA 2ES7A 5INYA 4AGSA 3TRQA 3QMXA 5ELGA 2NDOA 5EVOA 4EDZA 1OC9A 4JE1A 2V41A 2GZPA 4RQRA 2C80A 3IK9A 2R0GA 1K0OA 4ULXA 1HD2A 5G5FA 1ST9A 4AF2A 3ZRDA 1Q98A 2PN8A 3KTLA 1O8XA 2LTKA 2YPMA 4GXZA 4KSMA 5D9TA 1WE0A 3C71A 5CYYA 3IAS2 3EMXA 1H75A 4NHZA 2VM1A 4P3YB 3K8NA 3LQ7A 3KP8A 4Z2UA 2LRNA 4NPBA 1TK0B 2R4VA 3BCKA 2O85A 3IHGA 5CRGA 1IYHA 4IKHA 5KN2A 5C04A 1WIKA 2P5RA 3CTGA 2R5GA 2GS3A 5DBQA 4YAPA 3UIWA 2OA7A 3QFAC 5IOWA 2GQKA 3FW2A 2LKUA 5HQPA 3P8WA 2I4AA 2YJ7A 1OAZA 5F8BA 1J08A 1TI3A 1M7TA 3UL3A 3SWLA 1R26A 4MP4A 4ZL8A 3M1GA 1ZYNA 1QFNA 1U87A 2A2RA 2C1YA 4IELA 1OC9B 4FIWA 4G19A 4ZBAA 3BBYA 4TXOA 2QGVA 3KCMA 1A24A 3W8JA 3EWLA 2KHPA 1XW5A 1B9XC 2B7JA 4OFTA 3VWVA 5HR1A 3FK8A 3ZREA 2PUKC 1XWGA 1F6MC 4K0NA 5GZZB 2F9SA 3GKNA 1Z3EA 1PN9A 4HZ4A 1UA5A 1NW2A 2V1MA 3RHCA 2AYTA 5ID2A 1GUKA 3DKSA 4HU7A 5AISA 4TR1A 3ZMLA 3ZLPA 1GSYA 6GSSA 1DSBA 2DC5A 3GFKA 3GL5A 1OKTA 3ZTLA 4PTSA 2KUCA 2R0CA 5E4WA 1QGVA 2FY6A 4PUFC 1PKWA 2MMNA 1ABAA 4WBJA 3LSZA 1TRWA 3QPMA 4NWYA 3M9KA 4JEDA 2ALBA 3HY2A 4PQ1A 5BMUA 4K5SA 2MBTA 1RW1A 3CTFA 5D9VA 3DEXA 1X5CA 3WD6A 1V57A 4N10A 12GSA 2HRFA 3E0UA 1A2JA 3Q74A 3LFLA 2GQMA 3C7MA 4XS4A 1ILOA 1GSSA 2WJUA 4TR0A 4TXOB 3FHKA 3F4RA 3EVIA 4PUAA 2C4JA 1TTZA 1VGLA 4TRXA 1TU7A 3KIJA 4Z7XA 1K3OA 3KGKA 2IMKA 3ZITA 3IAM2 3WGDA 2G2QA 2FUG2 4RUVA 5DALA 5B8AA 1EGOA 4ILFA 5B7CA 3QFBC 2R2JA 1V40A 1ZOFA 4KAEA 2LS5A 4IP1A 2XBIA 3GX0A 1ZYEA 1M2BA 1VRSD 4DVCA 5ID2B 1HQOA 4TR1B 3TKRA 1MD4A 3QCPA 5HFGA 1M9AA 2AHEA 4NXIA 4POLA 4ACSA 4MMMA 5F06A 4MA9A 3WT2A 2REMA 4XTSA 4E8HA 3IV4A 4EO3A 1SD8A 3EYTA 3IOSA 1TRUA 2GSRA 3FR3A 2GZYA 1LU4A 4YQMA 3EC3A 2MZCA 4BL7A 2GSSA 2EC4A 2CA8A 4EDYA 3AY8A 1EOGA 3LG6A 4OO5A 4KB3A 4GSTA 2VD0A 1E2YA 3C8EA 3A3TA 3PH9A 2BMXA 1M9BA 4O32A 1YY7A 3CYNA 4BWQA 3EURA 2X49A 4EIQA 4MPGA 3RHBA 4POBA 4MF6A 4YKGA 1V9WA 1WRYA 2VUPA 4HZ2A 4QL9A 1VF3A 2CAQA 2B5XA 5DALB 4F2IA 3DRNA 5IMZA 3N9JA 3APSA 5G31A 3DMLA 3H1NA 5ELAA 2ZCTA 5JWRB 3FR6A 3NZNA 3GH9A 1W4VA 1TJDA 2DSAA 3UBKA 4DSQA 2O89A 2C0DA 2YANA 2GSTA 1M2AA 3I9V2 4I6XA 5IMFA 4PURA 4MABA 4BVYA 1B4QA 5IMVA 1A8YA 14GSA 4YQVA 3CRTA 4PQHA 4MF5A 1GULA 2JZTA 1A2MA 2FA8A 1YEPA 1LJRA 1SJIA 1BEDA 3FKFA 2OE1A 3ZL5A 1O7UA 3MAKA 1C72A 1TOFA 3RPPA 4TXVA 3PPUA 2L6DA 4EXJA 4BIKA 2JZSA 5B6NA 2VLVA 3GHAA 2AV4A 1S3RA 1GL8A 5KN0A 1G7EA 4O5QA 5J9BA 3F4TA 1A0RP 2PERA 4ECJA 3DWVA 5KOWA 2HNLA 1EOHA 5J4UA 4CY8A 5KEJA 2V32A 1XVQA 3GKXA 5ECHB 1MEKA 1SK2A 1EGRA 2LJRA 4Q5NA 5GAND 4G2EA 2CZ3A 2LUSA 2CX4A 4LL1B 2OE0A 3P90A 2H0HA 3C73A 2DIZA 4K2DA 1ZCPA 3LXZA 4BVYB 1B8XA 3F3QA 5L71A 2PGTA 4HQSA 1PGTA 3IBHA 4TW5A 1QK8A 4NV2A 3D6IA 1X9WB 2C3NA 2JSZA 1NSWA 1PL2A 4F03A 2FWGA 3LWAA 4GQFA 5COHA 4GLTA 3ZIJA 4KGIA 1S3CA 1ZMAA 4GF0A 5CAXA 4WEYA 2H01A 1GTUA 5ECLB 3NOFA 1XZOA 4BVXA 3UEMA 1V98A 1T00A 3KP9A 1B9YC 4XIHA 5HR0A 2CVBA 2L6CA 2GSQA 3FZ9A 1ZL9A 5ECRB 1EP8A 3LGCA 2FNOA 4TOPA 2OBKA 4O92A 2L4QA 2UZ8A 2LSTA 4LL4B 3BD2A 5F0GA 3L4NA 2OJLA 2PPTA 3GMFA 5IPGA 3FR9A 3E9JB 3IR4A 2VLUA 2H1GA 2H75A 1KTEA 4MJEA 5D96A 3R3EA 1GSDA 2OADA 4WKWA 4HUAA 4XHMA 4G10A 4N11A 5CRHA 3DVWA 5A4VA 3FRCA 1EP7A 3DXBA 3CRUA 3HDCA 2P0GA 1S3DA 3FY7A 2WRTA 4X4JA 1U3IA 2B5YA 2R6KA 3O76A 3CSJA 1IYIA 2HSMA 2FD3A 3UVTA 5HFKA 1PSQA 4F0BA 2QC7A 1Z9HA 4G9HA 2XBQA 2K8SA 2JL4A 3HKRA 3US3A 4Z2TA 2VL9A 3HJOA 1ML6A 3EU3A 4AJ6A 3A2XA 1UVZA 2IJYA 1ERVA 4HOJA 4BVXB 1VF2A 3ZMKA 2VD1A 4L5OA 3W6GA 5C00A 4O7HA 4OMVA 5DVBA 2C8UA 3F3RA 4ZL9A 3VFIA 1K0AA 2BJXA 4FYBA 1FAAA 3IA1A 3GKMA 4LA1A 3A2WA 2M46A 3LXTA 2DKIA 3ME8A 3Q19A 1XW9A 1NHOA 2YOIA 2VCVA 1Z6NA 3GH6A 1R7HA 1G0TA 2NBSA 3TKSC 3IHQA 4GWRA 1TU8A 20GSA 18GSA 2C3TA 3OR5A 1A8LA 5CP1A 1SKRB 2AB6A 2X8GA 1MDJA 4POMA 1GTIA 4PGTA 3A5IA 2B1KA 3GSSA 1EV9A 1XWAA 1FB0A 3CQFA 1EEJA 1SK0A 3TKSA 2QSIA 1BQ7A 5G1LA 2E2MA 4EE0A 1XCCA 1F37A 2HI7A 3LW9A 4WR5A 2JU5A 5ECMB 6GSTA 1KNGA 4OO4A 1EZKA 1XPVA 4I97A 2E0QA 2GT6A 5DAKA 2H19A 3D22A 5BRTA 2LJAA 3VURA 1PD21 5D8IA 5D9XA 4IHUA 3PINA 2X4AA 4G0IA 4GRFA 3KD0A 5HR3A 2H6YA 4WR4A 1N2AA 4Z2RA 3QR6A 3G7YA 3M0FA 2D2ZA 3VI5A 1KBNA 4XRDA 2GQLA 4DSRA 4CY6A 3MYDA 3F6FA 2TIRA 3ZVJD 3PGTA 3HYPA 4KUNA 4O5UA 3G7IA 4RQXA 3ERFA 2GTUA 1TW9A 4WXTA 1SENA 5DQYA 4L5LA 13GSA 1T3BA 3L9UA 4RI6A 3IC4A 1YEXA 2HZFA 1AAZA 1AUCA 1PL1A 3HD5A 3O3TA 2N5AA 1QXHA 1B48A 4IGJA 4JZQA 1SYRA 4CDOA 1WMJA 5AIVA 1WPIA 2H0IA 3D4TA 4HQZA 2O7KA 4HJ2A 2QA1A 1DBYA 3HXSA 2DJ0A 1ERWA 2YZHA 4V2MA 2YN1A 4TR4A 3F8UA 3TJFA 3L9VA 3TB2A 4EF0A 1QUWA 3J7Yk 1JZOA 4Q5FA 5DAKB 1K0DA 2V6KA 2YZUA 3D5JA 3S9FA 1K3LA 1Y25A 3VPTA 4KDYA 4WETA 5ECNB 1J9BA 3QAVA 2OACA 4GSSA 4ICYA 3LEFA 4FYUA 1FVJA 4WF4A 2NPBA 3GTUA 3MSZA 5B8BA 3TCOA 3C1RA 2H30A 1PN0A 4CHSA 5HR2A 2JSYA 5H5RA 4OCFA 1GLQA 1M0UA 2H72A 1F3BA 2A4HA 1GSQA 5GAPD 3L0HA 1K3YA 2CX3A 1SL0B 1SYXA 5GSTA 4PQIA 5KN3A 3RBTA 1V2AA 2H1DA 2OE3A 5F07A 1TXXA 1NM3A 4K0GA 2E7PA 2IFQA 3FZ5A 5IPHA 1XG8A 2DIYA 1FOVA 3F0IA 5IQYA 1EEMA 4H86A 3TGZA 1OKDA 2A2SA 3EE2A 4PNGA 4LLRA 6GSVA 1XFLA 2G0FA 5CNWA 3QD9A 3RAZA 4XS4B 2AJQB 3P7XA 1GH2A 4N0VA 5ECSA 2B3SA 1CQGA 2B5EA 3HVSA 4ZBBA 3VWUA 1GUMA 1SKSB 5DCGA 2YWNA 1EV4A 1JZRA 4ZB9A 2HXKA 4X1UA 4K1FA 1SL2B 2LNSA 4OCEA 4IBPA 2H76A 4K7OA 1T7PB 2IMIA 1AQVA 5ECOB 3HA9A 5J5NA 1E6BA 1GWCA 5DDLA 1RQMA 3EINA 4K9ZA 1O85A 2JACA 1FVKA 2ON7A 2IMDA 3GTUB 3MWHA 4N30A 1OE7A 5CRWA 4KW6A 2IL3A 3HCZA 4GTUA 1FHEA 3APOA 3CXGA 2C0GA 1M99A 2GLRA 2H0GA 2WCIA 3O6TA 5ECQB 4EVMA 2FA4A 3HJPA 2F51A 1PKZA 1FW1A 1XOAA 3D21A 3KH7A 4D73A 3L9SA 1SJZA 1BAYA 4KCAA 3IK7A 3KMOA 4IQ1A 3GA4A 2WGRA 3I69A 4OFNA 4MJBA 4V2NA 1O81A 4MJAA 2HFDA 2IFQB 3J7Yb 2B6MA 1J0FA 5IM9A 2V2GA 2VOCA 2V6OA 1R5AA 1TP9A 4BL7B 1YQ1A 3KXOA 3FEUA 2GT5A 2F8AA 2YP6A 4OWYA 4MF7A 5FWGA 1BJXA 3U5RE 1QMVA 1U88A 2RM5A 3LYKA 1PQNA 4YQUA 3E3EA 1GNEA 1YKCA 4KDUA 2MYGA 2RUFA 2IIYA 3I43A 2QA2A 2VCWA 1ZYPA 2H70A 1OVNA 1AXDA 2GZZA 2JADA 1NHYA 5A4UA 1G7OA 1TKDB 4J57E 17GSA 3V1WA 1F3AA 4RI7A 3L78A 1O6JA 4FO5A 3KJYA 3GRXA 5IOXA 3KMNA 1TI1A 3BCIA 3GX8A 3GSTA 2I3YA 3VWWA 1JLVA 1SL1B 2LEGA 4D73B 1GSEA 2K6VA 4FYCA 5G5EA 4ZIJA 2AAWA 1Z7RA 3GN3A 4IS0A 1SU9A 2DBCA 4X0XA 1OYJA 1YZXA 2H71A 2I9HA 3LJRA 1THOA 3IPZA 1PX7A 1TRVA 3TKSE 4ZB6A 5JWQB 16GSA 2HRAA 3TRPA 1GRXA 3DGQA 3VWXA 4A5PA 1ZYQB 1O73A 2I81A 3DVXA 1XWKA 1MD3A 2CVKA 4AJ7A 3HZ8A 3Q18A 3GNJA 2FWFA 4NMUA 4WF5A 5DJLA 1T8EB 5G1KA 4L0WA 3MNGA 4XS1A 2CQ9A 2H1BA 3TUEA 3ERWA 1S3AA 4DSSA 3C1SA 5ECKB 1MDKA 5JCUA 1CQHA 10GSA 3TJKA 1YF0A 2CZ2A 2FCHA 2FWEA 1XWCA 1A2LA 3ISOA 4I2UA 4JBBA 3WGXA 3RDWA 4BA7A 2M72A 1THXA 5EPFA 4XRAA 1FO5A 5G30A 6GSXA 2VL2C 2C0EA 1K0MA 4PXOA 5EL8A 1WP0A 2CV4A 5CREA 2IMEA 3LYPA 5LNKe 2A4VA 2F8FA 2MMZA 4MH2A 5A4WA 5AGYA 4IP6A 5CO3A 2YWMA 4F82A 2X8CA 1ZGNA 2VL2A 4WBRD 1ERUA 4YKFA 3ZYWA 1YF1A 1FB6A 4ZXGA 4XS6A 3G9BA 4PNFA 3KH9A 4HJMA 1UN2A 4EUYA 2OKAA 4ECIA 3HJMA 3IRAA 1HNCA 5D73A 4IJ3A 5ECPB 4HI7A 3HHVA 4I2TA 3HVNA 2PBJA 4TN8A 1YDKA 4QQ7A 4L8EA 2N5BA 1WOUA 1XXUA 3KEBA 4DSSB 2HYXA 1ACVA 2A2PA 2HLSA 2RLIA 1X9MB 1ON4A 1Z5YE 3EPTA 1M2DA 1VF1A 1PX6A 3M9JA 1R4WA 5A5KA 3UBLA 1XBSA 1X5DA 2VM2A 4KCEA 2NTOA 3F6DA 4K7IA 4KE3A 2XHFA 5IO2A 3VK9A 2LJKA 1AIUA 3GUSA 3UMAA 5GSSA 4ZL7A 2L5LA 4PX1A 2MMAA 2DMMA 2YCDA 2FWHA 1PRXA 3TOUA 1GSUA 2ZNMA 2H1AA 3IXRA 2CVDA 4CW9A 5E59A 2I1UA 4MZWA 4LMVA 3EU4A 4I8BA 4TKYA 3GYKA 5CRDA 3TRXA 5J3RA 2HRNA 2LV3A 4KX4A 2QKEA 4ZBDA 3GURA 2KP2A 4Q5QA 2DJKA 2MMOA 2AUVA 1XOBA 1QQ2A 5DJMA 4MLYA 4NAXA 5ECIB 4IW9A 1I9DA 2L4CA 1K0CA 5FT3A 1JHBA 1G6YA 4EL1A 3NIVA 1U6TA 2R3XA 1K0BA 4F0CA 4POKA 3FMWA 8GSSA 1JFUA 4XCSA 1T4ZA 2BTOT 4HSCX 3I6AA 5F05A 5IMCA 1BG5A 2C0FA 3LORA 3ED3A 3GL3A 2N5FA 4JRRA 1DE1A 2DJ3A 3GKKA 4HEA2 1ZZYA 2L59A 3IDVA 2PU9C 1YKAA 2L5OA 3HZ4A 2DMLA 4NHWA 4N0ZA 2DJ1A 4GSNA 4LMWA 1WJKA 5DQSA 1HYUA 2WZ9A 2FGXA 1X9SB 3UOMA 5AIXA 2LNTA 4EC0A 2M80A 1YJ6A 3TJJA 1PFOA 3H79A 1PMTA 4YAVA 2YJHA 1FOHA 3H4KA 2LRCA 4NV5A 2VCZA 5EY6A 4IN0A 3QDNA 1AW9A 1EWXA 3KTBA 3VLNA 3ZVJA 3ZIVA 3HVXA 2KOKA 2YWIA 3DIEA 4ECBA 1M3JA 3FZ4A 3KM6A 2C3QA 1XW6A 9GSSA 2K8VA 2GVPA 4V1Ag 2KLXA 5H5QA 3CMIA 1GUHA 3DYRA 2PWJA 1UC7A 2HT9A 4L0UA 5D93A 5G2ZA 4TR3A 2RIIA 3F4SA 3N5OA 5IMDA 2KP1A 5ABRA 4MDCA 3FZAA 3H93A 4AJ8A 4IJIA 4DEJA 5JCGA 7GSSA 3A2VA 1JZDA 4QL7A 1TRSA 1R5PA 4MNNA 11GSA 3FYGA 2DJ2A 2P31A 2ON5A 1W89A 2WFCA 2PVQA 1KEBA 1OE8A 4MH3A 1SKWB 4O5RA 1GSFA 1MDIA 3KZQA 3ERGA 2E2GA 4MPFA 4TVEA 1GNWA 1M3IA 1SJ6A 5AN1A 1JLWA 2DJJA 2GGTA 4OFMA 3M8NA 5DCHA 4KH7A 4KDXA 4J2FA 1USBA 3U6VA 2IN3A 1T1VA 3IE3A 4X43A 2OBIA 3F63A 5LCZA 1N8JA 1F9MA 1HNAA 3PR8A 4HU9A 3ZFLA 4JR6A 3TJBA 2CAIA 1XVWA 1U3AA 3IC8A 4K2XA 3GIXA 2ZUPA 5LD0A 3UJ1A 3P2AA 2H73A 4EKZA 3QAWA 2HZEA 1BX9A 1SK1A 4MK3A 1B4PA 1FG4A 4ML1A 3ZFBA 5B6MA 4YH2A 1TK8B 4KNDA 1BYEA 6GSUA 2H6XA 1GLPA 2RM6A 3WGEA 3DD3A 2XC2A 2VCQA 4FH8A 1GTBA 2R0PA 2EIOA 3VPQA 1OC3A 2YV7A 5JCWA 2GDRA 3EMPA 3TOTA 1F2EA 4G0KA 3CBUA 3WT1A 5D9WA 2HSHA 4ID0A 4K5RA 4KF9A 3UVHA 2VL3A 4FQUA 4ZB8A 5KN1A 1H4OA 1I5GA 2VCTA 1PA3A 1Z7PA 1TK5B 4Q5RA 2VCXA 2WB9A 2IWTA 2LQOA 4BWSA 4MZBA 19GSA 2O87A 4V1Ap 3W8SA 1AC1A 2H6ZA 2LQQA 2MBSA 1AQWA 3M3MA 2FHEA 4GQCA 3MIXA 3F9UA 1X0RA 3UARA 1XWBA 3QOUA 1O8WA 4I5QA 1GP1A 5IMAA 2XPDA 3Q6OA 3R2QA 2H74A 5JWOB 1DE2A 5KOXA 4USSA 2NVLA 1T4YA 2HE3A 2VIMA 1X5EA 1OC8A 1V58A 2EIRA 3D0ZA 2X8HA 4HDEA 2IMFA 5IIZA 2WDUA 3A5WA
chains in the Genus database with same CATH topology
4ZILA 3TKPA 4F9ZA 5FHIA 2HZEB 2JZRA 3TKQA 2DKHA 3WYWA 4EIPA 1HNBA 2VAFA 3VI7A 4HS1A 2FLSA 2K9FA 2WULA 4K6XA 4ISDA 1TDIA 3MDKA 3SBCA 3G7JA 4IVFA 3ZZXA 2YNXA 5HFIA 2H66A 3UAPA 2Z9SA 3JCML 6GSYA 2DLXA 1WWJA 4MCUA 3GV1A 1GTAA 1MTCA 5H5SA 3APQA 22GSA 3ME7A 2B1LA 3BOAA 1URMA 5ENUA 2LRTA 5IO0A 2O8VB 2RUEA 2L57A 1DUGA 2EIQA 2X64A 1RK4A 1Y6EA 6GSWA 2VO4A 3HVVA 2X99A 4JR4A 4OD7A 4GCIA 2F3MA 4K8MA 4K7NA 3BJ5A 3RPNA 3CSIA 1G6WA 2R37A 3QAGA 2YV9A 4KSOA 1Z6MA 1LBKA 1SD9A 1A0FA 1VF4A 4ML6A 2TRCP 3TJGA 4JU5A 4IQAA 2IPAA 3H8QA 2HSYA 1Q4JA 1XIYA 2H8LA 1AQXA 2YWOA 2K18A 2WS2A 2J23A 3CSHA 2HRKA 2PVOC 4KA0A 2VLTA 1K0NA 4ECCA 2CT6A 4G0LA 2PMTA 5J41A 2TRXA 5J9CA 4BPYA 3D4MA 2J9HA 4V2LA 4MZCA 4J56E 1A23A 2P5QA 2B7KA 3TDGA 2XPEA 4MJCA 1JZWA 4E8EA 1ERTA 2ES7A 5INYA 4AGSA 3TRQA 3QMXA 5ELGA 2NDOA 5EVOA 4EDZA 1OC9A 4JE1A 2V41A 2GZPA 4RQRA 2C80A 3IK9A 2R0GA 1K0OA 4ULXA 1HD2A 5G5FA 1ST9A 4AF2A 3ZRDA 1Q98A 2PN8A 3KTLA 1O8XA 2LTKA 2YPMA 4GXZA 4KSMA 5D9TA 1WE0A 3C71A 5CYYA 3IAS2 3EMXA 1H75A 4NHZA 2VM1A 4P3YB 3K8NA 3LQ7A 3KP8A 4Z2UA 2LRNA 4NPBA 1TK0B 2R4VA 3BCKA 2O85A 3IHGA 5CRGA 1IYHA 4IKHA 5KN2A 5C04A 1WIKA 2P5RA 3CTGA 2R5GA 2GS3A 5DBQA 4YAPA 3UIWA 2OA7A 3QFAC 5IOWA 2GQKA 3FW2A 2LKUA 5HQPA 3P8WA 2I4AA 2YJ7A 1OAZA 5F8BA 1J08A 1TI3A 1M7TA 3UL3A 3SWLA 1R26A 4MP4A 4ZL8A 3M1GA 1ZYNA 1QFNA 1U87A 2A2RA 2C1YA 4IELA 1OC9B 4FIWA 4G19A 4ZBAA 3BBYA 4TXOA 2QGVA 3KCMA 1A24A 3W8JA 3EWLA 2KHPA 1XW5A 1B9XC 2B7JA 4OFTA 3VWVA 5HR1A 3FK8A 3ZREA 2PUKC 1XWGA 1F6MC 4K0NA 5GZZB 2F9SA 3GKNA 1Z3EA 1PN9A 4HZ4A 1UA5A 1NW2A 2V1MA 3RHCA 2AYTA 5ID2A 1GUKA 3DKSA 4HU7A 5AISA 4TR1A 3ZMLA 3ZLPA 1GSYA 6GSSA 1DSBA 2DC5A 3GFKA 3GL5A 1OKTA 3ZTLA 4PTSA 2KUCA 2R0CA 5E4WA 1QGVA 2FY6A 4PUFC 1PKWA 2MMNA 1ABAA 4WBJA 3LSZA 1TRWA 3QPMA 4NWYA 3M9KA 4JEDA 2ALBA 3HY2A 4PQ1A 5BMUA 4K5SA 2MBTA 1RW1A 3CTFA 5D9VA 3DEXA 1X5CA 3WD6A 1V57A 4N10A 12GSA 2HRFA 3E0UA 1A2JA 3Q74A 3LFLA 2GQMA 3C7MA 4XS4A 1ILOA 1GSSA 2WJUA 4TR0A 4TXOB 3FHKA 3F4RA 3EVIA 4PUAA 2C4JA 1TTZA 1VGLA 4TRXA 1TU7A 3KIJA 4Z7XA 1K3OA 3KGKA 2IMKA 3ZITA 3IAM2 3WGDA 2G2QA 2FUG2 4RUVA 5DALA 5B8AA 1EGOA 4ILFA 5B7CA 3QFBC 2R2JA 1V40A 1ZOFA 4KAEA 2LS5A 4IP1A 2XBIA 3GX0A 1ZYEA 1M2BA 1VRSD 4DVCA 5ID2B 1HQOA 4TR1B 3TKRA 1MD4A 3QCPA 5HFGA 1M9AA 2AHEA 4NXIA 4POLA 4ACSA 4MMMA 5F06A 4MA9A 3WT2A 2REMA 4XTSA 4E8HA 3IV4A 4EO3A 1SD8A 3EYTA 3IOSA 1TRUA 2GSRA 3FR3A 2GZYA 1LU4A 4YQMA 3EC3A 2MZCA 4BL7A 2GSSA 2EC4A 2CA8A 4EDYA 3AY8A 1EOGA 3LG6A 4OO5A 4KB3A 4GSTA 2VD0A 1E2YA 3C8EA 3A3TA 3PH9A 2BMXA 1M9BA 4O32A 1YY7A 3CYNA 4BWQA 3EURA 2X49A 4EIQA 4MPGA 3RHBA 4POBA 4MF6A 4YKGA 1V9WA 1WRYA 2VUPA 4HZ2A 4QL9A 1VF3A 2CAQA 2B5XA 5DALB 4F2IA 3DRNA 5IMZA 3N9JA 3APSA 5G31A 3DMLA 3H1NA 5ELAA 2ZCTA 5JWRB 3FR6A 3NZNA 3GH9A 1W4VA 1TJDA 2DSAA 3UBKA 4DSQA 2O89A 2C0DA 2YANA 2GSTA 1M2AA 3I9V2 4I6XA 5IMFA 4PURA 4MABA 4BVYA 1B4QA 5IMVA 1A8YA 14GSA 4YQVA 3CRTA 4PQHA 4MF5A 1GULA 2JZTA 1A2MA 2FA8A 1YEPA 1LJRA 1SJIA 1BEDA 3FKFA 2OE1A 3ZL5A 1O7UA 3MAKA 1C72A 1TOFA 3RPPA 4TXVA 3PPUA 2L6DA 4EXJA 2JZSA 5B6NA 2VLVA 3GHAA 2AV4A 1GL8A 5KN0A 1G7EA 4O5QA 5J9BA 3F4TA 1A0RP 2PERA 4ECJA 3DWVA 5KOWA 2HNLA 1EOHA 5J4UA 4CY8A 5KEJA 2V32A 1XVQA 3GKXA 5ECHB 1MEKA 1SK2A 1EGRA 2LJRA 4Q5NA 5GAND 4G2EA 2CZ3A 2LUSA 2CX4A 4LL1B 2OE0A 3P90A 2H0HA 3C73A 2DIZA 4K2DA 1ZCPA 3LXZA 4BVYB 1B8XA 3F3QA 5L71A 2PGTA 4HQSA 1PGTA 3IBHA 4TW5A 1QK8A 4NV2A 3D6IA 1X9WB 2C3NA 2JSZA 1NSWA 1PL2A 4F03A 2FWGA 3LWAA 4GQFA 5COHA 4GLTA 3ZIJA 4KGIA 1S3CA 1ZMAA 4GF0A 5CAXA 4WEYA 2H01A 1GTUA 5ECLB 3NOFA 1XZOA 4BVXA 3UEMA 1V98A 1T00A 3KP9A 1B9YC 4XIHA 5HR0A 2CVBA 2L6CA 2GSQA 3FZ9A 1ZL9A 5ECRB 1EP8A 3LGCA 2FNOA 4TOPA 2OBKA 4O92A 2L4QA 2UZ8A 2LSTA 4LL4B 3BD2A 5F0GA 3L4NA 2OJLA 2PPTA 3GMFA 5IPGA 3FR9A 3E9JB 3IR4A 2VLUA 2H1GA 2H75A 1KTEA 4MJEA 5D96A 3R3EA 1GSDA 2OADA 4WKWA 4HUAA 4XHMA 4G10A 4N11A 5CRHA 3DVWA 5A4VA 3FRCA 1EP7A 3DXBA 3CRUA 3HDCA 2P0GA 1S3DA 3FY7A 2WRTA 4X4JA 1U3IA 2B5YA 2R6KA 3O76A 3CSJA 1IYIA 2HSMA 2FD3A 3UVTA 5HFKA 1PSQA 4F0BA 2QC7A 1Z9HA 4G9HA 2XBQA 2K8SA 2JL4A 3HKRA 3US3A 4Z2TA 2VL9A 3HJOA 1ML6A 3EU3A 4AJ6A 3A2XA 1UVZA 2IJYA 1ERVA 4HOJA 4BVXB 1VF2A 3ZMKA 2VD1A 4L5OA 3W6GA 5C00A 4O7HA 4OMVA 5DVBA 2C8UA 3F3RA 4ZL9A 3VFIA 1K0AA 2BJXA 4FYBA 1FAAA 3IA1A 3GKMA 4LA1A 3A2WA 2M46A 3LXTA 2DKIA 3ME8A 3Q19A 1XW9A 1NHOA 2YOIA 2VCVA 1Z6NA 3GH6A 1R7HA 1G0TA 2NBSA 3TKSC 3IHQA 4GWRA 1TU8A 20GSA 18GSA 2C3TA 3OR5A 1A8LA 5CP1A 1SKRB 2AB6A 2X8GA 1MDJA 4POMA 1GTIA 4PGTA 3A5IA 2B1KA 3GSSA 1EV9A 1XWAA 1FB0A 1EEJA 1SK0A 3TKSA 2QSIA 1BQ7A 5G1LA 2E2MA 4EE0A 1XCCA 1F37A 2HI7A 3LW9A 4WR5A 2JU5A 5ECMB 6GSTA 1KNGA 4OO4A 1EZKA 1XPVA 4I97A 2E0QA 2GT6A 5DAKA 2H19A 3D22A 5BRTA 2LJAA 3VURA 1PD21 5D8IA 5D9XA 4IHUA 3PINA 2X4AA 4G0IA 4GRFA 3KD0A 5HR3A 2H6YA 4WR4A 1N2AA 4Z2RA 3QR6A 3G7YA 3M0FA 2D2ZA 3VI5A 1KBNA 4XRDA 2GQLA 4DSRA 4CY6A 3MYDA 3F6FA 2TIRA 3ZVJD 3PGTA 3HYPA 4KUNA 4O5UA 3G7IA 4RQXA 3ERFA 2GTUA 1TW9A 4WXTA 1SENA 5DQYA 4L5LA 13GSA 1T3BA 3L9UA 4RI6A 3IC4A 1YEXA 2HZFA 1AAZA 1AUCA 1PL1A 3HD5A 3O3TA 2N5AA 1QXHA 1B48A 4IGJA 4JZQA 1SYRA 4CDOA 1WMJA 5AIVA 1WPIA 2H0IA 3D4TA 4HQZA 2O7KA 4HJ2A 2QA1A 1DBYA 3HXSA 2DJ0A 1ERWA 2YZHA 4V2MA 2YN1A 4TR4A 3F8UA 3TJFA 3L9VA 3TB2A 4EF0A 1QUWA 3J7Yk 1JZOA 4Q5FA 5DAKB 1K0DA 2V6KA 2YZUA 3D5JA 3S9FA 1K3LA 1Y25A 3VPTA 4KDYA 4WETA 5ECNB 1J9BA 3QAVA 2OACA 4GSSA 4ICYA 3LEFA 4FYUA 1FVJA 4WF4A 2NPBA 3GTUA 3MSZA 5B8BA 3TCOA 3C1RA 2H30A 1PN0A 4CHSA 5HR2A 2JSYA 5H5RA 4OCFA 1GLQA 1M0UA 2H72A 1F3BA 2A4HA 1GSQA 5GAPD 3L0HA 1K3YA 2CX3A 1SL0B 1SYXA 5GSTA 4PQIA 5KN3A 3RBTA 1V2AA 2H1DA 2OE3A 5F07A 1TXXA 1NM3A 4K0GA 2E7PA 2IFQA 3FZ5A 5IPHA 2DIYA 1FOVA 3F0IA 5IQYA 1EEMA 4H86A 3TGZA 1OKDA 2A2SA 3EE2A 4PNGA 4LLRA 6GSVA 1XFLA 2G0FA 5CNWA 3QD9A 3RAZA 4XS4B 2AJQB 3P7XA 1GH2A 4N0VA 5ECSA 2B3SA 1CQGA 2B5EA 3HVSA 4ZBBA 3VWUA 1GUMA 1SKSB 5DCGA 2YWNA 1EV4A 1JZRA 4ZB9A 2HXKA 4X1UA 4K1FA 1SL2B 2LNSA 4OCEA 4IBPA 2H76A 4K7OA 1T7PB 2IMIA 1AQVA 5ECOB 3HA9A 5J5NA 1E6BA 1GWCA 5DDLA 1RQMA 3EINA 4K9ZA 1O85A 2JACA 1FVKA 2ON7A 2IMDA 3GTUB 3MWHA 4N30A 1OE7A 5CRWA 4KW6A 2IL3A 3HCZA 4GTUA 1FHEA 3APOA 3CXGA 2C0GA 1M99A 2GLRA 2H0GA 2WCIA 3O6TA 5ECQB 4EVMA 2FA4A 3HJPA 2F51A 1PKZA 1FW1A 1XOAA 3D21A 3KH7A 4D73A 3L9SA 1SJZA 1BAYA 4KCAA 3IK7A 3KMOA 4IQ1A 3GA4A 2WGRA 3I69A 4OFNA 4MJBA 4V2NA 1O81A 4MJAA 2HFDA 2IFQB 3J7Yb 2B6MA 1J0FA 5IM9A 2V2GA 2VOCA 2V6OA 1R5AA 1TP9A 4BL7B 1YQ1A 3KXOA 3FEUA 2GT5A 2F8AA 2YP6A 4OWYA 4MF7A 5FWGA 1BJXA 3U5RE 1QMVA 1U88A 2RM5A 3LYKA 1PQNA 4YQUA 3E3EA 1GNEA 1YKCA 4KDUA 2MYGA 2RUFA 2IIYA 3I43A 2QA2A 2VCWA 1ZYPA 2H70A 1OVNA 1AXDA 2GZZA 2JADA 1NHYA 5A4UA 1G7OA 1TKDB 4J57E 17GSA 3V1WA 1F3AA 4RI7A 3L78A 1O6JA 4FO5A 3KJYA 3GRXA 5IOXA 3KMNA 1TI1A 3BCIA 3GX8A 3GSTA 2I3YA 3VWWA 1JLVA 1SL1B 2LEGA 4D73B 1GSEA 2K6VA 4FYCA 5G5EA 4ZIJA 2AAWA 1Z7RA 3GN3A 4IS0A 1SU9A 2DBCA 4X0XA 1OYJA 1YZXA 2H71A 2I9HA 3LJRA 1THOA 3IPZA 1PX7A 1TRVA 3TKSE 4ZB6A 5JWQB 16GSA 2HRAA 3TRPA 1GRXA 3DGQA 3VWXA 4A5PA 1ZYQB 1O73A 2I81A 3DVXA 1XWKA 1MD3A 2CVKA 4AJ7A 3HZ8A 3Q18A 3GNJA 2FWFA 4NMUA 4WF5A 5DJLA 1T8EB 5G1KA 4L0WA 3MNGA 4XS1A 2CQ9A 2H1BA 3TUEA 3ERWA 1S3AA 4DSSA 3C1SA 5ECKB 1MDKA 5JCUA 1CQHA 10GSA 3TJKA 1YF0A 2CZ2A 2FCHA 2FWEA 1XWCA 1A2LA 3ISOA 4I2UA 4JBBA 3WGXA 3RDWA 4BA7A 2M72A 1THXA 5EPFA 4XRAA 1FO5A 5G30A 6GSXA 2VL2C 2C0EA 1K0MA 4PXOA 5EL8A 1WP0A 2CV4A 5CREA 2IMEA 3LYPA 5LNKe 2A4VA 2F8FA 2MMZA 4MH2A 5A4WA 5AGYA 4IP6A 5CO3A 2YWMA 4F82A 2X8CA 1ZGNA 2VL2A 4WBRD 1ERUA 4YKFA 3ZYWA 1YF1A 1FB6A 4ZXGA 4XS6A 3G9BA 4PNFA 3KH9A 4HJMA 1UN2A 4EUYA 2OKAA 4ECIA 3HJMA 3IRAA 1HNCA 5D73A 4IJ3A 5ECPB 4HI7A 3HHVA 4I2TA 2PBJA 4TN8A 1YDKA 4QQ7A 4L8EA 2N5BA 1WOUA 1XXUA 3KEBA 4DSSB 2HYXA 1ACVA 2A2PA 2HLSA 2RLIA 1X9MB 1ON4A 1Z5YE 3EPTA 1M2DA 1VF1A 1PX6A 3M9JA 1R4WA 5A5KA 3UBLA 1XBSA 1X5DA 2VM2A 4KCEA 2NTOA 3F6DA 4K7IA 4KE3A 2XHFA 5IO2A 3VK9A 2LJKA 1AIUA 3GUSA 3UMAA 5GSSA 4ZL7A 2L5LA 4PX1A 2MMAA 2DMMA 2YCDA 2FWHA 1PRXA 3TOUA 1GSUA 2ZNMA 2H1AA 3IXRA 2CVDA 4CW9A 5E59A 2I1UA 4MZWA 4LMVA 3EU4A 4I8BA 4TKYA 3GYKA 5CRDA 3TRXA 5J3RA 2HRNA 2LV3A 4KX4A 2QKEA 4ZBDA 3GURA 2KP2A 4Q5QA 2DJKA 2MMOA 2AUVA 1XOBA 1QQ2A 5DJMA 4MLYA 4NAXA 5ECIB 4IW9A 1I9DA 2L4CA 1K0CA 5FT3A 1JHBA 1G6YA 4EL1A 3NIVA 1U6TA 2R3XA 1K0BA 4F0CA 4POKA 3FMWA 8GSSA 1JFUA 4XCSA 1T4ZA 2BTOT 3I6AA 5F05A 5IMCA 1BG5A 2C0FA 3LORA 3ED3A 3GL3A 2N5FA 4JRRA 1DE1A 2DJ3A 3GKKA 4HEA2 1ZZYA 2L59A 3IDVA 2PU9C 1YKAA 2L5OA 3HZ4A 2DMLA 4NHWA 4N0ZA 2DJ1A 4GSNA 4LMWA 1WJKA 5DQSA 1HYUA 2WZ9A 2FGXA 1X9SB 3UOMA 5AIXA 2LNTA 4EC0A 2M80A 1YJ6A 3TJJA 3H79A 1PMTA 4YAVA 2YJHA 1FOHA 3H4KA 2LRCA 4NV5A 2VCZA 5EY6A 4IN0A 3QDNA 1AW9A 1EWXA 3KTBA 3VLNA 3ZVJA 3ZIVA 3HVXA 2KOKA 2YWIA 3DIEA 4ECBA 3FZ4A 3KM6A 2C3QA 1XW6A 9GSSA 2K8VA 2GVPA 4V1Ag 2KLXA 5H5QA 3CMIA 1GUHA 3DYRA 2PWJA 1UC7A 2HT9A 4L0UA 5D93A 5G2ZA 4TR3A 2RIIA 3F4SA 3N5OA 5IMDA 2KP1A 5ABRA 4MDCA 3FZAA 3H93A 4AJ8A 4IJIA 4DEJA 5JCGA 7GSSA 3A2VA 1JZDA 4QL7A 1TRSA 1R5PA 4MNNA 11GSA 3FYGA 2DJ2A 2P31A 2ON5A 1W89A 2WFCA 2PVQA 1KEBA 1OE8A 4MH3A 1SKWB 4O5RA 1GSFA 1MDIA 3KZQA 3ERGA 2E2GA 4MPFA 4TVEA 1GNWA 1SJ6A 5AN1A 1JLWA 2DJJA 2GGTA 4OFMA 3M8NA 5DCHA 4KH7A 4KDXA 4J2FA 1USBA 3U6VA 2IN3A 1T1VA 3IE3A 4X43A 2OBIA 3F63A 5LCZA 1N8JA 1F9MA 1HNAA 3PR8A 4HU9A 3ZFLA 4JR6A 3TJBA 2CAIA 1XVWA 1U3AA 3IC8A 4K2XA 3GIXA 2ZUPA 5LD0A 3UJ1A 3P2AA 2H73A 4EKZA 3QAWA 2HZEA 1BX9A 1SK1A 4MK3A 1B4PA 1FG4A 4ML1A 3ZFBA 5B6MA 4YH2A 1TK8B 4KNDA 1BYEA 6GSUA 2H6XA 1GLPA 2RM6A 3WGEA 3DD3A 2XC2A 2VCQA 4FH8A 1GTBA 2R0PA 2EIOA 3VPQA 1OC3A 2YV7A 5JCWA 2GDRA 3EMPA 3TOTA 1F2EA 4G0KA 3CBUA 3WT1A 5D9WA 2HSHA 4ID0A 4K5RA 4KF9A 3UVHA 2VL3A 4FQUA 4ZB8A 5KN1A 1H4OA 1I5GA 2VCTA 1PA3A 1Z7PA 1TK5B 4Q5RA 2VCXA 2WB9A 2IWTA 2LQOA 4BWSA 4MZBA 19GSA 2O87A 4V1Ap 3W8SA 1AC1A 2H6ZA 2LQQA 2MBSA 1AQWA 3M3MA 2FHEA 4GQCA 3MIXA 3F9UA 1X0RA 3UARA 1XWBA 3QOUA 1O8WA 4I5QA 1GP1A 5IMAA 2XPDA 3Q6OA 3R2QA 2H74A 5JWOB 1DE2A 5KOXA 4USSA 2NVLA 1T4YA 2HE3A 2VIMA 1X5EA 1OC8A 1V58A 2EIRA 3D0ZA 2X8HA 4HDEA 2IMFA 5IIZA 2WDUA 3A5WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZIL A;  3TKP A;  4F9Z A;  5FHI A;  2HZE B;  2JZR A;  3TKQ A;  3WYW A;  1HNB A;  2VAF A;  3VI7 A;  4HS1 A;  2FLS A;  2K9F A;  2WUL A;  4K6X A;  4ISD A;  1TDI A;  3MDK A;  3SBC A;  3G7J A;  4IVF A;  3ZZX A;  2YNX A;  5HFI A;  2H66 A;  3UAP A;  2Z9S A;  3JCM L;  6GSY A;  2DLX A;  1WWJ A;  4MCU A;  3GV1 A;  1GTA A;  1MTC A;  5H5S A;  3APQ A;  22GS A;  3ME7 A;  2B1L A;  3BOA A;  1URM A;  5ENU A;  2LRT A;  5IO0 A;  2O8V B;  2RUE A;  2L57 A;  1DUG A;  2EIQ A;  2X64 A;  1RK4 A;  1Y6E A;  6GSW A;  2VO4 A;  3HVV A;  2X99 A;  4JR4 A;  4OD7 A;  4GCI A;  2F3M A;  4K8M A;  4K7N A;  3BJ5 A;  3RPN A;  3CSI A;  1G6W A;  2R37 A;  3QAG A;  2YV9 A;  4KSO A;  1Z6M A;  1LBK A;  1SD9 A;  1A0F A;  1VF4 A;  4ML6 A;  2TRC P;  3TJG A;  4JU5 A;  4IQA A;  2IPA A;  3H8Q A;  2HSY A;  1Q4J A;  1XIY A;  2H8L A;  1AQX A;  2YWO A;  2K18 A;  2WS2 A;  2J23 A;  3CSH A;  2PVO C;  4KA0 A;  2VLT A;  1K0N A;  4ECC A;  2CT6 A;  2PMT A;  5J41 A;  2TRX A;  5J9C A;  4BPY A;  3D4M A;  2J9H A;  4V2L A;  4MZC A;  4J56 E;  1A23 A;  2P5Q A;  2B7K A;  3TDG A;  2XPE A;  4MJC A;  1JZW A;  4E8E A;  1ERT A;  2ES7 A;  5INY A;  4AGS A;  3TRQ A;  3QMX A;  5ELG A;  2NDO A;  5EVO A;  4EDZ A;  1OC9 A;  4JE1 A;  2V41 A;  2GZP A;  4RQR A;  2C80 A;  3IK9 A;  1K0O A;  4ULX A;  1HD2 A;  5G5F A;  1ST9 A;  4AF2 A;  3ZRD A;  1Q98 A;  2PN8 A;  3KTL A;  1O8X A;  2LTK A;  2YPM A;  4GXZ A;  4KSM A;  5D9T A;  1WE0 A;  3C71 A;  5CYY A;  3IAS 2;  3EMX A;  1H75 A;  4NHZ A;  2VM1 A;  4P3Y B;  3K8N A;  3LQ7 A;  3KP8 A;  2LRN A;  4NPB A;  1TK0 B;  2R4V A;  3BCK A;  2O85 A;  5CRG A;  1IYH A;  4IKH A;  5KN2 A;  5C04 A;  1WIK A;  2P5R A;  3CTG A;  2R5G A;  2GS3 A;  5DBQ A;  4YAP A;  3UIW A;  2OA7 A;  3QFA C;  5IOW A;  2GQK A;  3FW2 A;  2LKU A;  5HQP A;  3P8W A;  2I4A A;  2YJ7 A;  1OAZ A;  5F8B A;  1J08 A;  1TI3 A;  1M7T A;  3UL3 A;  3SWL A;  1R26 A;  4MP4 A;  4ZL8 A;  3M1G A;  1QFN A;  1U87 A;  2A2R A;  2C1Y A;  4IEL A;  1OC9 B;  4FIW A;  4G19 A;  4ZBA A;  3BBY A;  4TXO A;  2QGV A;  3KCM A;  1A24 A;  3W8J A;  3EWL A;  2KHP A;  1XW5 A;  1B9X C;  2B7J A;  4OFT A;  3VWV A;  5HR1 A;  3FK8 A;  3ZRE A;  2PUK C;  1XWG A;  1F6M C;  4K0N A;  5GZZ B;  2F9S A;  3GKN A;  1Z3E A;  1PN9 A;  4HZ4 A;  1UA5 A;  1NW2 A;  2V1M A;  3RHC A;  2AYT A;  5ID2 A;  1GUK A;  3DKS A;  4HU7 A;  5AIS A;  4TR1 A;  3ZML A;  3ZLP A;  1GSY A;  6GSS A;  1DSB A;  2DC5 A;  3GFK A;  3GL5 A;  1OKT A;  3ZTL A;  2KUC A;  5E4W A;  1QGV A;  2FY6 A;  4PUF C;  1PKW A;  2MMN A;  1ABA A;  4WBJ A;  3LSZ A;  1TRW A;  3QPM A;  4NWY A;  3M9K A;  4JED A;  2ALB A;  3HY2 A;  4PQ1 A;  2MBT A;  1RW1 A;  3CTF A;  5D9V A;  3DEX A;  1X5C A;  3WD6 A;  1V57 A;  4N10 A;  12GS A;  2HRF A;  3E0U A;  1A2J A;  3Q74 A;  3LFL A;  2GQM A;  3C7M A;  4XS4 A;  1ILO A;  1GSS A;  2WJU A;  4TR0 A;  4TXO B;  3FHK A;  3F4R A;  3EVI A;  4PUA A;  2C4J A;  1TTZ A;  1VGL A;  4TRX A;  1TU7 A;  3KIJ A;  4Z7X A;  1K3O A;  3KGK A;  2IMK A;  3ZIT A;  3IAM 2;  3WGD A;  2G2Q A;  2FUG 2;  4RUV A;  5DAL A;  5B8A A;  1EGO A;  4ILF A;  5B7C A;  3QFB C;  2R2J A;  1V40 A;  1ZOF A;  4KAE A;  2LS5 A;  4IP1 A;  2XBI A;  3GX0 A;  1ZYE A;  1M2B A;  1VRS D;  4DVC A;  5ID2 B;  1HQO A;  4TR1 B;  3TKR A;  1MD4 A;  3QCP A;  5HFG A;  1M9A A;  2AHE A;  4NXI A;  4POL A;  4ACS A;  4MMM A;  5F06 A;  4MA9 A;  3WT2 A;  2REM A;  4XTS A;  4E8H A;  3IV4 A;  4EO3 A;  1SD8 A;  3EYT A;  3IOS A;  1TRU A;  2GSR A;  3FR3 A;  2GZY A;  1LU4 A;  4YQM A;  3EC3 A;  2MZC A;  4BL7 A;  2GSS A;  2EC4 A;  2CA8 A;  4EDY A;  3AY8 A;  1EOG A;  3LG6 A;  4OO5 A;  4KB3 A;  4GST A;  2VD0 A;  1E2Y A;  3C8E A;  3A3T A;  3PH9 A;  2BMX A;  1M9B A;  4O32 A;  1YY7 A;  3CYN A;  4BWQ A;  3EUR A;  4MPG A;  3RHB A;  4POB A;  4MF6 A;  1V9W A;  1WRY A;  2VUP A;  4HZ2 A;  4QL9 A;  1VF3 A;  2CAQ A;  2B5X A;  5DAL B;  4F2I A;  3DRN A;  5IMZ A;  3N9J A;  3APS A;  5G31 A;  3DML A;  3H1N A;  5ELA A;  2ZCT A;  5JWR B;  3FR6 A;  3NZN A;  3GH9 A;  1W4V A;  1TJD A;  2DSA A;  3UBK A;  4DSQ A;  2O89 A;  2C0D A;  2YAN A;  2GST A;  1M2A A;  3I9V 2;  4I6X A;  5IMF A;  4PUR A;  4MAB A;  4BVY A;  1B4Q A;  5IMV A;  1A8Y A;  14GS A;  4YQV A;  3CRT A;  4PQH A;  4MF5 A;  1GUL A;  2JZT A;  1A2M A;  2FA8 A;  1YEP A;  1LJR A;  1SJI A;  1BED A;  3FKF A;  2OE1 A;  3ZL5 A;  1O7U A;  3MAK A;  1C72 A;  1TOF A;  3RPP A;  4TXV A;  2L6D A;  4EXJ A;  2JZS A;  5B6N A;  2VLV A;  3GHA A;  2AV4 A;  1GL8 A;  5KN0 A;  1G7E A;  5J9B A;  3F4T A;  1A0R P;  2PER A;  4ECJ A;  3DWV A;  2HNL A;  1EOH A;  5J4U A;  5KEJ A;  2V32 A;  1XVQ A;  3GKX A;  5ECH B;  1MEK A;  1SK2 A;  1EGR A;  2LJR A;  4Q5N A;  5GAN D;  4G2E A;  2CZ3 A;  2LUS A;  2CX4 A;  4LL1 B;  2OE0 A;  3P90 A;  2H0H A;  3C73 A;  2DIZ A;  4K2D A;  1ZCP A;  3LXZ A;  1B8X A;  3F3Q A;  5L71 A;  2PGT A;  4HQS A;  1PGT A;  3IBH A;  4TW5 A;  1QK8 A;  4NV2 A;  3D6I A;  1X9W B;  2C3N A;  2JSZ A;  1NSW A;  1PL2 A;  4F03 A;  2FWG A;  3LWA A;  4GQF A;  5COH A;  4GLT A;  3ZIJ A;  4KGI A;  1S3C A;  1ZMA A;  4GF0 A;  5CAX A;  4WEY A;  2H01 A;  1GTU A;  5ECL B;  3NOF A;  1XZO A;  4BVX A;  3UEM A;  1V98 A;  1T00 A;  3KP9 A;  1B9Y C;  4XIH A;  5HR0 A;  2CVB A;  2L6C A;  2GSQ A;  3FZ9 A;  1ZL9 A;  5ECR B;  1EP8 A;  3LGC A;  2FNO A;  4TOP A;  2OBK A;  4O92 A;  2L4Q A;  2LST A;  4LL4 B;  3BD2 A;  5F0G A;  3L4N A;  2OJL A;  2PPT A;  3GMF A;  5IPG A;  3FR9 A;  3E9J B;  3IR4 A;  2VLU A;  2H1G A;  2H75 A;  1KTE A;  4MJE A;  5D96 A;  1GSD A;  2OAD A;  4WKW A;  4HUA A;  4XHM A;  4G10 A;  4N11 A;  5CRH A;  3DVW A;  5A4V A;  3FRC A;  1EP7 A;  3DXB A;  3CRU A;  3HDC A;  2P0G A;  1S3D A;  3FY7 A;  2WRT A;  1U3I A;  2B5Y A;  2R6K A;  3O76 A;  3CSJ A;  1IYI A;  2FD3 A;  3UVT A;  5HFK A;  1PSQ A;  4F0B A;  2QC7 A;  1Z9H A;  4G9H A;  2XBQ A;  2K8S A;  2JL4 A;  3HKR A;  3US3 A;  2VL9 A;  3HJO A;  1ML6 A;  3EU3 A;  4AJ6 A;  3A2X A;  1UVZ A;  2IJY A;  1ERV A;  4HOJ A;  1VF2 A;  3ZMK A;  2VD1 A;  4L5O A;  3W6G A;  5C00 A;  4O7H A;  4OMV A;  5DVB A;  2C8U A;  3F3R A;  4ZL9 A;  3VFI A;  1K0A A;  2BJX A;  4FYB A;  1FAA A;  3IA1 A;  3GKM A;  4LA1 A;  3A2W A;  2M46 A;  3LXT A;  3ME8 A;  3Q19 A;  1XW9 A;  1NHO A;  2YOI A;  2VCV A;  1Z6N A;  3GH6 A;  1R7H A;  1G0T A;  2NBS A;  3TKS C;  3IHQ A;  4GWR A;  1TU8 A;  20GS A;  18GS A;  2C3T A;  3OR5 A;  1A8L A;  5CP1 A;  1SKR B;  2AB6 A;  2X8G A;  1MDJ A;  4POM A;  1GTI A;  4PGT A;  2B1K A;  3GSS A;  1EV9 A;  1XWA A;  1FB0 A;  1EEJ A;  1SK0 A;  3TKS A;  2QSI A;  1BQ7 A;  5G1L A;  2E2M A;  4EE0 A;  1XCC A;  1F37 A;  2HI7 A;  4WR5 A;  2JU5 A;  5ECM B;  6GST A;  1KNG A;  4OO4 A;  1EZK A;  1XPV A;  4I97 A;  2E0Q A;  2GT6 A;  5DAK A;  2H19 A;  3D22 A;  2LJA A;  3VUR A;  1PD2 1;  5D8I A;  5D9X A;  4IHU A;  3PIN A;  4GRF A;  3KD0 A;  5HR3 A;  2H6Y A;  4WR4 A;  1N2A A;  3QR6 A;  3G7Y A;  3M0F A;  2D2Z A;  3VI5 A;  1KBN A;  4XRD A;  2GQL A;  4DSR A;  3F6F A;  2TIR A;  3ZVJ D;  3PGT A;  3HYP A;  4KUN A;  3G7I A;  4RQX A;  3ERF A;  2GTU A;  1TW9 A;  5DQY A;  4WXT A;  1SEN A;  4L5L A;  13GS A;  1T3B A;  3L9U A;  4RI6 A;  3IC4 A;  1YEX A;  2HZF A;  1AAZ A;  1AUC A;  1PL1 A;  3HD5 A;  3O3T A;  2N5A A;  1QXH A;  1B48 A;  4IGJ A;  4JZQ A;  1SYR A;  4CDO A;  1WMJ A;  5AIV A;  1WPI A;  2H0I A;  3D4T A;  4HQZ A;  2O7K A;  4HJ2 A;  1DBY A;  3HXS A;  2DJ0 A;  1ERW A;  2YZH A;  4V2M A;  2YN1 A;  4TR4 A;  3F8U A;  3TJF A;  3L9V A;  3TB2 A;  4EF0 A;  1QUW A;  3J7Y k;  1JZO A;  4Q5F A;  5DAK B;  1K0D A;  2V6K A;  2YZU A;  3D5J A;  3S9F A;  1K3L A;  1Y25 A;  3VPT A;  4KDY A;  4WET A;  5ECN B;  1J9B A;  3QAV A;  2OAC A;  4GSS A;  3LEF A;  4FYU A;  1FVJ A;  4WF4 A;  2NPB A;  3GTU A;  3MSZ A;  5B8B A;  3TCO A;  3C1R A;  2H30 A;  4CHS A;  5HR2 A;  2JSY A;  5H5R A;  4OCF A;  1GLQ A;  1M0U A;  2H72 A;  1F3B A;  1GSQ A;  5GAP D;  3L0H A;  1K3Y A;  2CX3 A;  1SL0 B;  1SYX A;  5GST A;  4PQI A;  5KN3 A;  3RBT A;  1V2A A;  2H1D A;  2OE3 A;  5F07 A;  1TXX A;  1NM3 A;  4K0G A;  2E7P A;  2IFQ A;  3FZ5 A;  5IPH A;  2DIY A;  1FOV A;  3F0I A;  5IQY A;  1EEM A;  4H86 A;  3TGZ A;  1OKD A;  2A2S A;  3EE2 A;  4PNG A;  4LLR A;  6GSV A;  1XFL A;  2G0F A;  5CNW A;  3QD9 A;  3RAZ A;  4XS4 B;  2AJQ B;  3P7X A;  1GH2 A;  4N0V A;  5ECS A;  2B3S A;  1CQG A;  2B5E A;  3HVS A;  4ZBB A;  3VWU A;  1GUM A;  1SKS B;  5DCG A;  2YWN A;  1EV4 A;  1JZR A;  4ZB9 A;  2HXK A;  4X1U A;  4K1F A;  1SL2 B;  2LNS A;  4OCE A;  4IBP A;  2H76 A;  4K7O A;  1T7P B;  2IMI A;  1AQV A;  5ECO B;  3HA9 A;  5J5N A;  1E6B A;  1GWC A;  5DDL A;  1RQM A;  3EIN A;  4K9Z A;  1O85 A;  2JAC A;  1FVK A;  2ON7 A;  2IMD A;  3GTU B;  3MWH A;  4N30 A;  1OE7 A;  5CRW A;  4KW6 A;  2IL3 A;  3HCZ A;  4GTU A;  1FHE A;  3APO A;  3CXG A;  2C0G A;  1M99 A;  2GLR A;  2H0G A;  2WCI A;  3O6T A;  5ECQ B;  4EVM A;  2FA4 A;  3HJP A;  2F51 A;  1PKZ A;  1FW1 A;  1XOA A;  3D21 A;  3KH7 A;  4D73 A;  3L9S A;  1SJZ A;  1BAY A;  4KCA A;  3IK7 A;  3KMO A;  4IQ1 A;  3GA4 A;  2WGR A;  3I69 A;  4OFN A;  4MJB A;  4V2N A;  1O81 A;  4MJA A;  2HFD A;  2IFQ B;  3J7Y b;  2B6M A;  1J0F A;  5IM9 A;  2V2G A;  2VOC A;  2V6O A;  1R5A A;  1TP9 A;  1YQ1 A;  3KXO A;  3FEU A;  2GT5 A;  2F8A A;  2YP6 A;  4OWY A;  4MF7 A;  5FWG A;  1BJX A;  3U5R E;  1QMV A;  1U88 A;  2RM5 A;  3LYK A;  1PQN A;  4YQU A;  3E3E A;  1GNE A;  1YKC A;  4KDU A;  2MYG A;  2RUF A;  2IIY A;  3I43 A;  2VCW A;  2H70 A;  1OVN A;  1AXD A;  2GZZ A;  2JAD A;  1NHY A;  5A4U A;  1G7O A;  1TKD B;  4J57 E;  17GS A;  3V1W A;  1F3A A;  4RI7 A;  3L78 A;  1O6J A;  4FO5 A;  3KJY A;  3GRX A;  5IOX A;  3KMN A;  1TI1 A;  3BCI A;  3GX8 A;  3GST A;  2I3Y A;  3VWW A;  1JLV A;  1SL1 B;  2LEG A;  4D73 B;  1GSE A;  2K6V A;  4FYC A;  5G5E A;  4ZIJ A;  2AAW A;  1Z7R A;  3GN3 A;  4IS0 A;  1SU9 A;  2DBC A;  4X0X A;  1OYJ A;  1YZX A;  2H71 A;  2I9H A;  3LJR A;  1THO A;  3IPZ A;  1PX7 A;  1TRV A;  3TKS E;  4ZB6 A;  5JWQ B;  16GS A;  3TRP A;  1GRX A;  3DGQ A;  3VWX A;  1ZYQ B;  1O73 A;  2I81 A;  3DVX A;  1XWK A;  1MD3 A;  2CVK A;  4AJ7 A;  3HZ8 A;  3Q18 A;  3GNJ A;  2FWF A;  4NMU A;  4WF5 A;  5DJL A;  1T8E B;  5G1K A;  4L0W A;  3MNG A;  4XS1 A;  2CQ9 A;  2H1B A;  3TUE A;  3ERW A;  1S3A A;  4DSS A;  3C1S A;  5ECK B;  1MDK A;  5JCU A;  1CQH A;  10GS A;  3TJK A;  1YF0 A;  2CZ2 A;  2FCH A;  2FWE A;  1XWC A;  1A2L A;  3ISO A;  4I2U A;  4JBB A;  3WGX A;  3RDW A;  4BA7 A;  2M72 A;  1THX A;  5EPF A;  4XRA A;  1FO5 A;  5G30 A;  6GSX A;  2VL2 C;  2C0E A;  1K0M A;  4PXO A;  5EL8 A;  1WP0 A;  2CV4 A;  5CRE A;  2IME A;  3LYP A;  5LNK e;  2A4V A;  2F8F A;  2MMZ A;  4MH2 A;  5A4W A;  5AGY A;  4IP6 A;  5CO3 A;  2YWM A;  4F82 A;  2X8C A;  1ZGN A;  2VL2 A;  4WBR D;  1ERU A;  3ZYW A;  1YF1 A;  1FB6 A;  4ZXG A;  4XS6 A;  3G9B A;  4PNF A;  3KH9 A;  4HJM A;  1UN2 A;  4EUY A;  2OKA A;  4ECI A;  3HJM A;  3IRA A;  1HNC A;  5D73 A;  4IJ3 A;  5ECP B;  4HI7 A;  3HHV A;  4I2T A;  2PBJ A;  4TN8 A;  1YDK A;  4QQ7 A;  4L8E A;  2N5B A;  1WOU A;  1XXU A;  3KEB A;  4DSS B;  2HYX A;  1ACV A;  2HLS A;  2RLI A;  1X9M B;  1ON4 A;  1Z5Y E;  1M2D A;  1VF1 A;  1PX6 A;  3M9J A;  1R4W A;  5A5K A;  3UBL A;  1XBS A;  1X5D A;  2VM2 A;  4KCE A;  2NTO A;  3F6D A;  4K7I A;  4KE3 A;  2XHF A;  5IO2 A;  3VK9 A;  2LJK A;  1AIU A;  3GUS A;  3UMA A;  5GSS A;  4ZL7 A;  2L5L A;  4PX1 A;  2MMA A;  2DMM A;  2YCD A;  2FWH A;  1PRX A;  3TOU A;  1GSU A;  2ZNM A;  2H1A A;  3IXR A;  2CVD A;  4CW9 A;  5E59 A;  2I1U A;  4MZW A;  4LMV A;  3EU4 A;  4I8B A;  4TKY A;  3GYK A;  5CRD A;  3TRX A;  5J3R A;  2HRN A;  2LV3 A;  4KX4 A;  2QKE A;  4ZBD A;  3GUR A;  2KP2 A;  4Q5Q A;  2DJK A;  2MMO A;  2AUV A;  1XOB A;  1QQ2 A;  5DJM A;  4MLY A;  4NAX A;  5ECI B;  4IW9 A;  1I9D A;  2L4C A;  1K0C A;  5FT3 A;  1JHB A;  1G6Y A;  4EL1 A;  3NIV A;  1U6T A;  2R3X A;  1K0B A;  4F0C A;  4POK A;  8GSS A;  1JFU A;  4XCS A;  1T4Z A;  2BTO T;  3I6A A;  5F05 A;  5IMC A;  1BG5 A;  2C0F A;  3LOR A;  3ED3 A;  3GL3 A;  2N5F A;  4JRR A;  1DE1 A;  2DJ3 A;  3GKK A;  4HEA 2;  1ZZY A;  2L59 A;  3IDV A;  2PU9 C;  1YKA A;  2L5O A;  3HZ4 A;  2DML A;  4NHW A;  4N0Z A;  2DJ1 A;  4GSN A;  4LMW A;  1WJK A;  5DQS A;  1HYU A;  2WZ9 A;  2FGX A;  1X9S B;  3UOM A;  5AIX A;  2LNT A;  4EC0 A;  2M80 A;  1YJ6 A;  3TJJ A;  3H79 A;  1PMT A;  4YAV A;  2YJH A;  3H4K A;  2LRC A;  4NV5 A;  2VCZ A;  5EY6 A;  4IN0 A;  3QDN A;  1AW9 A;  1EWX A;  3KTB A;  3VLN A;  3ZVJ A;  3ZIV A;  3HVX A;  2KOK A;  2YWI A;  3DIE A;  4ECB A;  3FZ4 A;  3KM6 A;  2C3Q A;  1XW6 A;  9GSS A;  2K8V A;  2GVP A;  4V1A g;  2KLX A;  5H5Q A;  3CMI A;  1GUH A;  3DYR A;  2PWJ A;  1UC7 A;  2HT9 A;  4L0U A;  5D93 A;  5G2Z A;  4TR3 A;  2RII A;  3F4S A;  3N5O A;  5IMD A;  2KP1 A;  5ABR A;  4MDC A;  3FZA A;  3H93 A;  4AJ8 A;  4IJI A;  4DEJ A;  5JCG A;  7GSS A;  3A2V A;  1JZD A;  4QL7 A;  1TRS A;  1R5P A;  11GS A;  3FYG A;  2DJ2 A;  2P31 A;  2ON5 A;  1W89 A;  2WFC A;  2PVQ A;  1KEB A;  1OE8 A;  4MH3 A;  1SKW B;  4O5R A;  1GSF A;  1MDI A;  3KZQ A;  3ERG A;  2E2G A;  4MPF A;  4TVE A;  1GNW A;  1SJ6 A;  5AN1 A;  1JLW A;  2DJJ A;  2GGT A;  4OFM A;  3M8N A;  5DCH A;  4KH7 A;  4KDX A;  4J2F A;  1USB A;  3U6V A;  2IN3 A;  1T1V A;  3IE3 A;  4X43 A;  2OBI A;  3F63 A;  5LCZ A;  1N8J A;  1F9M A;  1HNA A;  3PR8 A;  4HU9 A;  3ZFL A;  4JR6 A;  3TJB A;  2CAI A;  1XVW A;  1U3A A;  3GIX A;  2ZUP A;  5LD0 A;  3UJ1 A;  3P2A A;  2H73 A;  4EKZ A;  3QAW A;  2HZE A;  1BX9 A;  1SK1 A;  4MK3 A;  1B4P A;  1FG4 A;  4ML1 A;  3ZFB A;  5B6M A;  4YH2 A;  1TK8 B;  4KND A;  1BYE A;  6GSU A;  2H6X A;  1GLP A;  2RM6 A;  3WGE A;  3DD3 A;  2XC2 A;  2VCQ A;  4FH8 A;  1GTB A;  2EIO A;  3VPQ A;  1OC3 A;  2YV7 A;  5JCW A;  2GDR A;  3EMP A;  3TOT A;  1F2E A;  3CBU A;  3WT1 A;  5D9W A;  2HSH A;  4ID0 A;  3UVH A;  2VL3 A;  4ZB8 A;  5KN1 A;  1H4O A;  1I5G A;  2VCT A;  1PA3 A;  1Z7P A;  1TK5 B;  4Q5R A;  2VCX A;  2WB9 A;  2IWT A;  2LQO A;  4BWS A;  4MZB A;  19GS A;  2O87 A;  4V1A p;  3W8S A;  1AC1 A;  2H6Z A;  2LQQ A;  2MBS A;  1AQW A;  3M3M A;  2FHE A;  4GQC A;  3F9U A;  1X0R A;  3UAR A;  1XWB A;  3QOU A;  1O8W A;  4I5Q A;  1GP1 A;  5IMA A;  2XPD A;  3Q6O A;  3R2Q A;  2H74 A;  5JWO B;  1DE2 A;  2NVL A;  1T4Y A;  2HE3 A;  2VIM A;  1X5E A;  1OC8 A;  1V58 A;  2EIR A;  3D0Z A;  2X8H A;  4HDE A;  2IMF A;  5IIZ A;  2WDU A;  3A5W A; 
#chains in the Genus database with same CATH topology
 4ZIL A;  3TKP A;  4F9Z A;  5FHI A;  2HZE B;  2JZR A;  3TKQ A;  2DKH A;  3WYW A;  4EIP A;  1HNB A;  2VAF A;  3VI7 A;  4HS1 A;  2FLS A;  2K9F A;  2WUL A;  4K6X A;  4ISD A;  1TDI A;  3MDK A;  3SBC A;  3G7J A;  4IVF A;  3ZZX A;  2YNX A;  5HFI A;  2H66 A;  3UAP A;  2Z9S A;  3JCM L;  6GSY A;  2DLX A;  1WWJ A;  4MCU A;  3GV1 A;  1GTA A;  1MTC A;  5H5S A;  3APQ A;  22GS A;  3ME7 A;  2B1L A;  3BOA A;  1URM A;  5ENU A;  2LRT A;  5IO0 A;  2O8V B;  2RUE A;  2L57 A;  1DUG A;  2EIQ A;  2X64 A;  1RK4 A;  1Y6E A;  6GSW A;  2VO4 A;  3HVV A;  2X99 A;  4JR4 A;  4OD7 A;  4GCI A;  2F3M A;  4K8M A;  4K7N A;  3BJ5 A;  3RPN A;  3CSI A;  1G6W A;  2R37 A;  3QAG A;  2YV9 A;  4KSO A;  1Z6M A;  1LBK A;  1SD9 A;  1A0F A;  1VF4 A;  4ML6 A;  2TRC P;  3TJG A;  4JU5 A;  4IQA A;  2IPA A;  3H8Q A;  2HSY A;  1Q4J A;  1XIY A;  2H8L A;  1AQX A;  2YWO A;  2K18 A;  2WS2 A;  2J23 A;  3CSH A;  2HRK A;  2PVO C;  4KA0 A;  2VLT A;  1K0N A;  4ECC A;  2CT6 A;  4G0L A;  2PMT A;  5J41 A;  2TRX A;  5J9C A;  4BPY A;  3D4M A;  2J9H A;  4V2L A;  4MZC A;  4J56 E;  1A23 A;  2P5Q A;  2B7K A;  3TDG A;  2XPE A;  4MJC A;  1JZW A;  4E8E A;  1ERT A;  2ES7 A;  5INY A;  4AGS A;  3TRQ A;  3QMX A;  5ELG A;  2NDO A;  5EVO A;  4EDZ A;  1OC9 A;  4JE1 A;  2V41 A;  2GZP A;  4RQR A;  2C80 A;  3IK9 A;  2R0G A;  1K0O A;  4ULX A;  1HD2 A;  5G5F A;  1ST9 A;  4AF2 A;  3ZRD A;  1Q98 A;  2PN8 A;  3KTL A;  1O8X A;  2LTK A;  2YPM A;  4GXZ A;  4KSM A;  5D9T A;  1WE0 A;  3C71 A;  5CYY A;  3IAS 2;  3EMX A;  1H75 A;  4NHZ A;  2VM1 A;  4P3Y B;  3K8N A;  3LQ7 A;  3KP8 A;  4Z2U A;  2LRN A;  4NPB A;  1TK0 B;  2R4V A;  3BCK A;  2O85 A;  3IHG A;  5CRG A;  1IYH A;  4IKH A;  5KN2 A;  5C04 A;  1WIK A;  2P5R A;  3CTG A;  2R5G A;  2GS3 A;  5DBQ A;  4YAP A;  3UIW A;  2OA7 A;  3QFA C;  5IOW A;  2GQK A;  3FW2 A;  2LKU A;  5HQP A;  3P8W A;  2I4A A;  2YJ7 A;  1OAZ A;  5F8B A;  1J08 A;  1TI3 A;  1M7T A;  3UL3 A;  3SWL A;  1R26 A;  4MP4 A;  4ZL8 A;  3M1G A;  1ZYN A;  1QFN A;  1U87 A;  2A2R A;  2C1Y A;  4IEL A;  1OC9 B;  4FIW A;  4G19 A;  4ZBA A;  3BBY A;  4TXO A;  2QGV A;  3KCM A;  1A24 A;  3W8J A;  3EWL A;  2KHP A;  1XW5 A;  1B9X C;  2B7J A;  4OFT A;  3VWV A;  5HR1 A;  3FK8 A;  3ZRE A;  2PUK C;  1XWG A;  1F6M C;  4K0N A;  5GZZ B;  2F9S A;  3GKN A;  1Z3E A;  1PN9 A;  4HZ4 A;  1UA5 A;  1NW2 A;  2V1M A;  3RHC A;  2AYT A;  5ID2 A;  1GUK A;  3DKS A;  4HU7 A;  5AIS A;  4TR1 A;  3ZML A;  3ZLP A;  1GSY A;  6GSS A;  1DSB A;  2DC5 A;  3GFK A;  3GL5 A;  1OKT A;  3ZTL A;  4PTS A;  2KUC A;  2R0C A;  5E4W A;  1QGV A;  2FY6 A;  4PUF C;  1PKW A;  2MMN A;  1ABA A;  4WBJ A;  3LSZ A;  1TRW A;  3QPM A;  4NWY A;  3M9K A;  4JED A;  2ALB A;  3HY2 A;  4PQ1 A;  5BMU A;  4K5S A;  2MBT A;  1RW1 A;  3CTF A;  5D9V A;  3DEX A;  1X5C A;  3WD6 A;  1V57 A;  4N10 A;  12GS A;  2HRF A;  3E0U A;  1A2J A;  3Q74 A;  3LFL A;  2GQM A;  3C7M A;  4XS4 A;  1ILO A;  1GSS A;  2WJU A;  4TR0 A;  4TXO B;  3FHK A;  3F4R A;  3EVI A;  4PUA A;  2C4J A;  1TTZ A;  1VGL A;  4TRX A;  1TU7 A;  3KIJ A;  4Z7X A;  1K3O A;  3KGK A;  2IMK A;  3ZIT A;  3IAM 2;  3WGD A;  2G2Q A;  2FUG 2;  4RUV A;  5DAL A;  5B8A A;  1EGO A;  4ILF A;  5B7C A;  3QFB C;  2R2J A;  1V40 A;  1ZOF A;  4KAE A;  2LS5 A;  4IP1 A;  2XBI A;  3GX0 A;  1ZYE A;  1M2B A;  1VRS D;  4DVC A;  5ID2 B;  1HQO A;  4TR1 B;  3TKR A;  1MD4 A;  3QCP A;  5HFG A;  1M9A A;  2AHE A;  4NXI A;  4POL A;  4ACS A;  4MMM A;  5F06 A;  4MA9 A;  3WT2 A;  2REM A;  4XTS A;  4E8H A;  3IV4 A;  4EO3 A;  1SD8 A;  3EYT A;  3IOS A;  1TRU A;  2GSR A;  3FR3 A;  2GZY A;  1LU4 A;  4YQM A;  3EC3 A;  2MZC A;  4BL7 A;  2GSS A;  2EC4 A;  2CA8 A;  4EDY A;  3AY8 A;  1EOG A;  3LG6 A;  4OO5 A;  4KB3 A;  4GST A;  2VD0 A;  1E2Y A;  3C8E A;  3A3T A;  3PH9 A;  2BMX A;  1M9B A;  4O32 A;  1YY7 A;  3CYN A;  4BWQ A;  3EUR A;  2X49 A;  4EIQ A;  4MPG A;  3RHB A;  4POB A;  4MF6 A;  4YKG A;  1V9W A;  1WRY A;  2VUP A;  4HZ2 A;  4QL9 A;  1VF3 A;  2CAQ A;  2B5X A;  5DAL B;  4F2I A;  3DRN A;  5IMZ A;  3N9J A;  3APS A;  5G31 A;  3DML A;  3H1N A;  5ELA A;  2ZCT A;  5JWR B;  3FR6 A;  3NZN A;  3GH9 A;  1W4V A;  1TJD A;  2DSA A;  3UBK A;  4DSQ A;  2O89 A;  2C0D A;  2YAN A;  2GST A;  1M2A A;  3I9V 2;  4I6X A;  5IMF A;  4PUR A;  4MAB A;  4BVY A;  1B4Q A;  5IMV A;  1A8Y A;  14GS A;  4YQV A;  3CRT A;  4PQH A;  4MF5 A;  1GUL A;  2JZT A;  1A2M A;  2FA8 A;  1YEP A;  1LJR A;  1SJI A;  1BED A;  3FKF A;  2OE1 A;  3ZL5 A;  1O7U A;  3MAK A;  1C72 A;  1TOF A;  3RPP A;  4TXV A;  3PPU A;  2L6D A;  4EXJ A;  4BIK A;  2JZS A;  5B6N A;  2VLV A;  3GHA A;  2AV4 A;  1S3R A;  1GL8 A;  5KN0 A;  1G7E A;  4O5Q A;  5J9B A;  3F4T A;  1A0R P;  2PER A;  4ECJ A;  3DWV A;  5KOW A;  2HNL A;  1EOH A;  5J4U A;  4CY8 A;  5KEJ A;  2V32 A;  1XVQ A;  3GKX A;  5ECH B;  1MEK A;  1SK2 A;  1EGR A;  2LJR A;  4Q5N A;  5GAN D;  4G2E A;  2CZ3 A;  2LUS A;  2CX4 A;  4LL1 B;  2OE0 A;  3P90 A;  2H0H A;  3C73 A;  2DIZ A;  4K2D A;  1ZCP A;  3LXZ A;  4BVY B;  1B8X A;  3F3Q A;  5L71 A;  2PGT A;  4HQS A;  1PGT A;  3IBH A;  4TW5 A;  1QK8 A;  4NV2 A;  3D6I A;  1X9W B;  2C3N A;  2JSZ A;  1NSW A;  1PL2 A;  4F03 A;  2FWG A;  3LWA A;  4GQF A;  5COH A;  4GLT A;  3ZIJ A;  4KGI A;  1S3C A;  1ZMA A;  4GF0 A;  5CAX A;  4WEY A;  2H01 A;  1GTU A;  5ECL B;  3NOF A;  1XZO A;  4BVX A;  3UEM A;  1V98 A;  1T00 A;  3KP9 A;  1B9Y C;  4XIH A;  5HR0 A;  2CVB A;  2L6C A;  2GSQ A;  3FZ9 A;  1ZL9 A;  5ECR B;  1EP8 A;  3LGC A;  2FNO A;  4TOP A;  2OBK A;  4O92 A;  2L4Q A;  2UZ8 A;  2LST A;  4LL4 B;  3BD2 A;  5F0G A;  3L4N A;  2OJL A;  2PPT A;  3GMF A;  5IPG A;  3FR9 A;  3E9J B;  3IR4 A;  2VLU A;  2H1G A;  2H75 A;  1KTE A;  4MJE A;  5D96 A;  3R3E A;  1GSD A;  2OAD A;  4WKW A;  4HUA A;  4XHM A;  4G10 A;  4N11 A;  5CRH A;  3DVW A;  5A4V A;  3FRC A;  1EP7 A;  3DXB A;  3CRU A;  3HDC A;  2P0G A;  1S3D A;  3FY7 A;  2WRT A;  4X4J A;  1U3I A;  2B5Y A;  2R6K A;  3O76 A;  3CSJ A;  1IYI A;  2HSM A;  2FD3 A;  3UVT A;  5HFK A;  1PSQ A;  4F0B A;  2QC7 A;  1Z9H A;  4G9H A;  2XBQ A;  2K8S A;  2JL4 A;  3HKR A;  3US3 A;  4Z2T A;  2VL9 A;  3HJO A;  1ML6 A;  3EU3 A;  4AJ6 A;  3A2X A;  1UVZ A;  2IJY A;  1ERV A;  4HOJ A;  4BVX B;  1VF2 A;  3ZMK A;  2VD1 A;  4L5O A;  3W6G A;  5C00 A;  4O7H A;  4OMV A;  5DVB A;  2C8U A;  3F3R A;  4ZL9 A;  3VFI A;  1K0A A;  2BJX A;  4FYB A;  1FAA A;  3IA1 A;  3GKM A;  4LA1 A;  3A2W A;  2M46 A;  3LXT A;  2DKI A;  3ME8 A;  3Q19 A;  1XW9 A;  1NHO A;  2YOI A;  2VCV A;  1Z6N A;  3GH6 A;  1R7H A;  1G0T A;  2NBS A;  3TKS C;  3IHQ A;  4GWR A;  1TU8 A;  20GS A;  18GS A;  2C3T A;  3OR5 A;  1A8L A;  5CP1 A;  1SKR B;  2AB6 A;  2X8G A;  1MDJ A;  4POM A;  1GTI A;  4PGT A;  3A5I A;  2B1K A;  3GSS A;  1EV9 A;  1XWA A;  1FB0 A;  3CQF A;  1EEJ A;  1SK0 A;  3TKS A;  2QSI A;  1BQ7 A;  5G1L A;  2E2M A;  4EE0 A;  1XCC A;  1F37 A;  2HI7 A;  3LW9 A;  4WR5 A;  2JU5 A;  5ECM B;  6GST A;  1KNG A;  4OO4 A;  1EZK A;  1XPV A;  4I97 A;  2E0Q A;  2GT6 A;  5DAK A;  2H19 A;  3D22 A;  5BRT A;  2LJA A;  3VUR A;  1PD2 1;  5D8I A;  5D9X A;  4IHU A;  3PIN A;  2X4A A;  4G0I A;  4GRF A;  3KD0 A;  5HR3 A;  2H6Y A;  4WR4 A;  1N2A A;  4Z2R A;  3QR6 A;  3G7Y A;  3M0F A;  2D2Z A;  3VI5 A;  1KBN A;  4XRD A;  2GQL A;  4DSR A;  4CY6 A;  3MYD A;  3F6F A;  2TIR A;  3ZVJ D;  3PGT A;  3HYP A;  4KUN A;  4O5U A;  3G7I A;  4RQX A;  3ERF A;  2GTU A;  1TW9 A;  4WXT A;  1SEN A;  5DQY A;  4L5L A;  13GS A;  1T3B A;  3L9U A;  4RI6 A;  3IC4 A;  1YEX A;  2HZF A;  1AAZ A;  1AUC A;  1PL1 A;  3HD5 A;  3O3T A;  2N5A A;  1QXH A;  1B48 A;  4IGJ A;  4JZQ A;  1SYR A;  4CDO A;  1WMJ A;  5AIV A;  1WPI A;  2H0I A;  3D4T A;  4HQZ A;  2O7K A;  4HJ2 A;  2QA1 A;  1DBY A;  3HXS A;  2DJ0 A;  1ERW A;  2YZH A;  4V2M A;  2YN1 A;  4TR4 A;  3F8U A;  3TJF A;  3L9V A;  3TB2 A;  4EF0 A;  1QUW A;  3J7Y k;  1JZO A;  4Q5F A;  5DAK B;  1K0D A;  2V6K A;  2YZU A;  3D5J A;  3S9F A;  1K3L A;  1Y25 A;  3VPT A;  4KDY A;  4WET A;  5ECN B;  1J9B A;  3QAV A;  2OAC A;  4GSS A;  4ICY A;  3LEF A;  4FYU A;  1FVJ A;  4WF4 A;  2NPB A;  3GTU A;  3MSZ A;  5B8B A;  3TCO A;  3C1R A;  2H30 A;  1PN0 A;  4CHS A;  5HR2 A;  2JSY A;  5H5R A;  4OCF A;  1GLQ A;  1M0U A;  2H72 A;  1F3B A;  2A4H A;  1GSQ A;  5GAP D;  3L0H A;  1K3Y A;  2CX3 A;  1SL0 B;  1SYX A;  5GST A;  4PQI A;  5KN3 A;  3RBT A;  1V2A A;  2H1D A;  2OE3 A;  5F07 A;  1TXX A;  1NM3 A;  4K0G A;  2E7P A;  2IFQ A;  3FZ5 A;  5IPH A;  1XG8 A;  2DIY A;  1FOV A;  3F0I A;  5IQY A;  1EEM A;  4H86 A;  3TGZ A;  1OKD A;  2A2S A;  3EE2 A;  4PNG A;  4LLR A;  6GSV A;  1XFL A;  2G0F A;  5CNW A;  3QD9 A;  3RAZ A;  4XS4 B;  2AJQ B;  3P7X A;  1GH2 A;  4N0V A;  5ECS A;  2B3S A;  1CQG A;  2B5E A;  3HVS A;  4ZBB A;  3VWU A;  1GUM A;  1SKS B;  5DCG A;  2YWN A;  1EV4 A;  1JZR A;  4ZB9 A;  2HXK A;  4X1U A;  4K1F A;  1SL2 B;  2LNS A;  4OCE A;  4IBP A;  2H76 A;  4K7O A;  1T7P B;  2IMI A;  1AQV A;  5ECO B;  3HA9 A;  5J5N A;  1E6B A;  1GWC A;  5DDL A;  1RQM A;  3EIN A;  4K9Z A;  1O85 A;  2JAC A;  1FVK A;  2ON7 A;  2IMD A;  3GTU B;  3MWH A;  4N30 A;  1OE7 A;  5CRW A;  4KW6 A;  2IL3 A;  3HCZ A;  4GTU A;  1FHE A;  3APO A;  3CXG A;  2C0G A;  1M99 A;  2GLR A;  2H0G A;  2WCI A;  3O6T A;  5ECQ B;  4EVM A;  2FA4 A;  3HJP A;  2F51 A;  1PKZ A;  1FW1 A;  1XOA A;  3D21 A;  3KH7 A;  4D73 A;  3L9S A;  1SJZ A;  1BAY A;  4KCA A;  3IK7 A;  3KMO A;  4IQ1 A;  3GA4 A;  2WGR A;  3I69 A;  4OFN A;  4MJB A;  4V2N A;  1O81 A;  4MJA A;  2HFD A;  2IFQ B;  3J7Y b;  2B6M A;  1J0F A;  5IM9 A;  2V2G A;  2VOC A;  2V6O A;  1R5A A;  1TP9 A;  4BL7 B;  1YQ1 A;  3KXO A;  3FEU A;  2GT5 A;  2F8A A;  2YP6 A;  4OWY A;  4MF7 A;  5FWG A;  1BJX A;  3U5R E;  1QMV A;  1U88 A;  2RM5 A;  3LYK A;  1PQN A;  4YQU A;  3E3E A;  1GNE A;  1YKC A;  4KDU A;  2MYG A;  2RUF A;  2IIY A;  3I43 A;  2QA2 A;  2VCW A;  1ZYP A;  2H70 A;  1OVN A;  1AXD A;  2GZZ A;  2JAD A;  1NHY A;  5A4U A;  1G7O A;  1TKD B;  4J57 E;  17GS A;  3V1W A;  1F3A A;  4RI7 A;  3L78 A;  1O6J A;  4FO5 A;  3KJY A;  3GRX A;  5IOX A;  3KMN A;  1TI1 A;  3BCI A;  3GX8 A;  3GST A;  2I3Y A;  3VWW A;  1JLV A;  1SL1 B;  2LEG A;  4D73 B;  1GSE A;  2K6V A;  4FYC A;  5G5E A;  4ZIJ A;  2AAW A;  1Z7R A;  3GN3 A;  4IS0 A;  1SU9 A;  2DBC A;  4X0X A;  1OYJ A;  1YZX A;  2H71 A;  2I9H A;  3LJR A;  1THO A;  3IPZ A;  1PX7 A;  1TRV A;  3TKS E;  4ZB6 A;  5JWQ B;  16GS A;  2HRA A;  3TRP A;  1GRX A;  3DGQ A;  3VWX A;  4A5P A;  1ZYQ B;  1O73 A;  2I81 A;  3DVX A;  1XWK A;  1MD3 A;  2CVK A;  4AJ7 A;  3HZ8 A;  3Q18 A;  3GNJ A;  2FWF A;  4NMU A;  4WF5 A;  5DJL A;  1T8E B;  5G1K A;  4L0W A;  3MNG A;  4XS1 A;  2CQ9 A;  2H1B A;  3TUE A;  3ERW A;  1S3A A;  4DSS A;  3C1S A;  5ECK B;  1MDK A;  5JCU A;  1CQH A;  10GS A;  3TJK A;  1YF0 A;  2CZ2 A;  2FCH A;  2FWE A;  1XWC A;  1A2L A;  3ISO A;  4I2U A;  4JBB A;  3WGX A;  3RDW A;  4BA7 A;  2M72 A;  1THX A;  5EPF A;  4XRA A;  1FO5 A;  5G30 A;  6GSX A;  2VL2 C;  2C0E A;  1K0M A;  4PXO A;  5EL8 A;  1WP0 A;  2CV4 A;  5CRE A;  2IME A;  3LYP A;  5LNK e;  2A4V A;  2F8F A;  2MMZ A;  4MH2 A;  5A4W A;  5AGY A;  4IP6 A;  5CO3 A;  2YWM A;  4F82 A;  2X8C A;  1ZGN A;  2VL2 A;  4WBR D;  1ERU A;  4YKF A;  3ZYW A;  1YF1 A;  1FB6 A;  4ZXG A;  4XS6 A;  3G9B A;  4PNF A;  3KH9 A;  4HJM A;  1UN2 A;  4EUY A;  2OKA A;  4ECI A;  3HJM A;  3IRA A;  1HNC A;  5D73 A;  4IJ3 A;  5ECP B;  4HI7 A;  3HHV A;  4I2T A;  3HVN A;  2PBJ A;  4TN8 A;  1YDK A;  4QQ7 A;  4L8E A;  2N5B A;  1WOU A;  1XXU A;  3KEB A;  4DSS B;  2HYX A;  1ACV A;  2A2P A;  2HLS A;  2RLI A;  1X9M B;  1ON4 A;  1Z5Y E;  3EPT A;  1M2D A;  1VF1 A;  1PX6 A;  3M9J A;  1R4W A;  5A5K A;  3UBL A;  1XBS A;  1X5D A;  2VM2 A;  4KCE A;  2NTO A;  3F6D A;  4K7I A;  4KE3 A;  2XHF A;  5IO2 A;  3VK9 A;  2LJK A;  1AIU A;  3GUS A;  3UMA A;  5GSS A;  4ZL7 A;  2L5L A;  4PX1 A;  2MMA A;  2DMM A;  2YCD A;  2FWH A;  1PRX A;  3TOU A;  1GSU A;  2ZNM A;  2H1A A;  3IXR A;  2CVD A;  4CW9 A;  5E59 A;  2I1U A;  4MZW A;  4LMV A;  3EU4 A;  4I8B A;  4TKY A;  3GYK A;  5CRD A;  3TRX A;  5J3R A;  2HRN A;  2LV3 A;  4KX4 A;  2QKE A;  4ZBD A;  3GUR A;  2KP2 A;  4Q5Q A;  2DJK A;  2MMO A;  2AUV A;  1XOB A;  1QQ2 A;  5DJM A;  4MLY A;  4NAX A;  5ECI B;  4IW9 A;  1I9D A;  2L4C A;  1K0C A;  5FT3 A;  1JHB A;  1G6Y A;  4EL1 A;  3NIV A;  1U6T A;  2R3X A;  1K0B A;  4F0C A;  4POK A;  3FMW A;  8GSS A;  1JFU A;  4XCS A;  1T4Z A;  2BTO T;  4HSC X;  3I6A A;  5F05 A;  5IMC A;  1BG5 A;  2C0F A;  3LOR A;  3ED3 A;  3GL3 A;  2N5F A;  4JRR A;  1DE1 A;  2DJ3 A;  3GKK A;  4HEA 2;  1ZZY A;  2L59 A;  3IDV A;  2PU9 C;  1YKA A;  2L5O A;  3HZ4 A;  2DML A;  4NHW A;  4N0Z A;  2DJ1 A;  4GSN A;  4LMW A;  1WJK A;  5DQS A;  1HYU A;  2WZ9 A;  2FGX A;  1X9S B;  3UOM A;  5AIX A;  2LNT A;  4EC0 A;  2M80 A;  1YJ6 A;  3TJJ A;  1PFO A;  3H79 A;  1PMT A;  4YAV A;  2YJH A;  1FOH A;  3H4K A;  2LRC A;  4NV5 A;  2VCZ A;  5EY6 A;  4IN0 A;  3QDN A;  1AW9 A;  1EWX A;  3KTB A;  3VLN A;  3ZVJ A;  3ZIV A;  3HVX A;  2KOK A;  2YWI A;  3DIE A;  4ECB A;  1M3J A;  3FZ4 A;  3KM6 A;  2C3Q A;  1XW6 A;  9GSS A;  2K8V A;  2GVP A;  4V1A g;  2KLX A;  5H5Q A;  3CMI A;  1GUH A;  3DYR A;  2PWJ A;  1UC7 A;  2HT9 A;  4L0U A;  5D93 A;  5G2Z A;  4TR3 A;  2RII A;  3F4S A;  3N5O A;  5IMD A;  2KP1 A;  5ABR A;  4MDC A;  3FZA A;  3H93 A;  4AJ8 A;  4IJI A;  4DEJ A;  5JCG A;  7GSS A;  3A2V A;  1JZD A;  4QL7 A;  1TRS A;  1R5P A;  4MNN A;  11GS A;  3FYG A;  2DJ2 A;  2P31 A;  2ON5 A;  1W89 A;  2WFC A;  2PVQ A;  1KEB A;  1OE8 A;  4MH3 A;  1SKW B;  4O5R A;  1GSF A;  1MDI A;  3KZQ A;  3ERG A;  2E2G A;  4MPF A;  4TVE A;  1GNW A;  1M3I A;  1SJ6 A;  5AN1 A;  1JLW A;  2DJJ A;  2GGT A;  4OFM A;  3M8N A;  5DCH A;  4KH7 A;  4KDX A;  4J2F A;  1USB A;  3U6V A;  2IN3 A;  1T1V A;  3IE3 A;  4X43 A;  2OBI A;  3F63 A;  5LCZ A;  1N8J A;  1F9M A;  1HNA A;  3PR8 A;  4HU9 A;  3ZFL A;  4JR6 A;  3TJB A;  2CAI A;  1XVW A;  1U3A A;  3IC8 A;  4K2X A;  3GIX A;  2ZUP A;  5LD0 A;  3UJ1 A;  3P2A A;  2H73 A;  4EKZ A;  3QAW A;  2HZE A;  1BX9 A;  1SK1 A;  4MK3 A;  1B4P A;  1FG4 A;  4ML1 A;  3ZFB A;  5B6M A;  4YH2 A;  1TK8 B;  4KND A;  1BYE A;  6GSU A;  2H6X A;  1GLP A;  2RM6 A;  3WGE A;  3DD3 A;  2XC2 A;  2VCQ A;  4FH8 A;  1GTB A;  2R0P A;  2EIO A;  3VPQ A;  1OC3 A;  2YV7 A;  5JCW A;  2GDR A;  3EMP A;  3TOT A;  1F2E A;  4G0K A;  3CBU A;  3WT1 A;  5D9W A;  2HSH A;  4ID0 A;  4K5R A;  4KF9 A;  3UVH A;  2VL3 A;  4FQU A;  4ZB8 A;  5KN1 A;  1H4O A;  1I5G A;  2VCT A;  1PA3 A;  1Z7P A;  1TK5 B;  4Q5R A;  2VCX A;  2WB9 A;  2IWT A;  2LQO A;  4BWS A;  4MZB A;  19GS A;  2O87 A;  4V1A p;  3W8S A;  1AC1 A;  2H6Z A;  2LQQ A;  2MBS A;  1AQW A;  3M3M A;  2FHE A;  4GQC A;  3MIX A;  3F9U A;  1X0R A;  3UAR A;  1XWB A;  3QOU A;  1O8W A;  4I5Q A;  1GP1 A;  5IMA A;  2XPD A;  3Q6O A;  3R2Q A;  2H74 A;  5JWO B;  1DE2 A;  5KOX A;  4USS A;  2NVL A;  1T4Y A;  2HE3 A;  2VIM A;  1X5E A;  1OC8 A;  1V58 A;  2EIR A;  3D0Z A;  2X8H A;  4HDE A;  2IMF A;  5IIZ A;  2WDU A;  3A5W A; 
#chains in the Genus database with same CATH homology
 4ZIL A;  3TKP A;  4F9Z A;  5FHI A;  2HZE B;  2JZR A;  3TKQ A;  2DKH A;  3WYW A;  4EIP A;  1HNB A;  2VAF A;  3VI7 A;  4HS1 A;  2FLS A;  2K9F A;  2WUL A;  4K6X A;  4ISD A;  1TDI A;  3MDK A;  3SBC A;  3G7J A;  4IVF A;  3ZZX A;  2YNX A;  5HFI A;  2H66 A;  3UAP A;  2Z9S A;  3JCM L;  6GSY A;  2DLX A;  1WWJ A;  4MCU A;  3GV1 A;  1GTA A;  1MTC A;  5H5S A;  3APQ A;  22GS A;  3ME7 A;  2B1L A;  3BOA A;  1URM A;  5ENU A;  2LRT A;  5IO0 A;  2O8V B;  2RUE A;  2L57 A;  1DUG A;  2EIQ A;  2X64 A;  1RK4 A;  1Y6E A;  6GSW A;  2VO4 A;  3HVV A;  2X99 A;  4JR4 A;  4OD7 A;  4GCI A;  2F3M A;  4K8M A;  4K7N A;  3BJ5 A;  3RPN A;  3CSI A;  1G6W A;  2R37 A;  3QAG A;  2YV9 A;  4KSO A;  1Z6M A;  1LBK A;  1SD9 A;  1A0F A;  1VF4 A;  4ML6 A;  2TRC P;  3TJG A;  4JU5 A;  4IQA A;  2IPA A;  3H8Q A;  2HSY A;  1Q4J A;  1XIY A;  2H8L A;  1AQX A;  2YWO A;  2K18 A;  2WS2 A;  2J23 A;  3CSH A;  2HRK A;  2PVO C;  4KA0 A;  2VLT A;  1K0N A;  4ECC A;  2CT6 A;  4G0L A;  2PMT A;  5J41 A;  2TRX A;  5J9C A;  4BPY A;  3D4M A;  2J9H A;  4V2L A;  4MZC A;  4J56 E;  1A23 A;  2P5Q A;  2B7K A;  3TDG A;  2XPE A;  4MJC A;  1JZW A;  4E8E A;  1ERT A;  2ES7 A;  5INY A;  4AGS A;  3TRQ A;  3QMX A;  5ELG A;  2NDO A;  5EVO A;  4EDZ A;  1OC9 A;  4JE1 A;  2V41 A;  2GZP A;  4RQR A;  2C80 A;  3IK9 A;  2R0G A;  1K0O A;  4ULX A;  1HD2 A;  5G5F A;  1ST9 A;  4AF2 A;  3ZRD A;  1Q98 A;  2PN8 A;  3KTL A;  1O8X A;  2LTK A;  2YPM A;  4GXZ A;  4KSM A;  5D9T A;  1WE0 A;  3C71 A;  5CYY A;  3IAS 2;  3EMX A;  1H75 A;  4NHZ A;  2VM1 A;  4P3Y B;  3K8N A;  3LQ7 A;  3KP8 A;  4Z2U A;  2LRN A;  4NPB A;  1TK0 B;  2R4V A;  3BCK A;  2O85 A;  3IHG A;  5CRG A;  1IYH A;  4IKH A;  5KN2 A;  5C04 A;  1WIK A;  2P5R A;  3CTG A;  2R5G A;  2GS3 A;  5DBQ A;  4YAP A;  3UIW A;  2OA7 A;  3QFA C;  5IOW A;  2GQK A;  3FW2 A;  2LKU A;  5HQP A;  3P8W A;  2I4A A;  2YJ7 A;  1OAZ A;  5F8B A;  1J08 A;  1TI3 A;  1M7T A;  3UL3 A;  3SWL A;  1R26 A;  4MP4 A;  4ZL8 A;  3M1G A;  1ZYN A;  1QFN A;  1U87 A;  2A2R A;  2C1Y A;  4IEL A;  1OC9 B;  4FIW A;  4G19 A;  4ZBA A;  3BBY A;  4TXO A;  2QGV A;  3KCM A;  1A24 A;  3W8J A;  3EWL A;  2KHP A;  1XW5 A;  1B9X C;  2B7J A;  4OFT A;  3VWV A;  5HR1 A;  3FK8 A;  3ZRE A;  2PUK C;  1XWG A;  1F6M C;  4K0N A;  5GZZ B;  2F9S A;  3GKN A;  1Z3E A;  1PN9 A;  4HZ4 A;  1UA5 A;  1NW2 A;  2V1M A;  3RHC A;  2AYT A;  5ID2 A;  1GUK A;  3DKS A;  4HU7 A;  5AIS A;  4TR1 A;  3ZML A;  3ZLP A;  1GSY A;  6GSS A;  1DSB A;  2DC5 A;  3GFK A;  3GL5 A;  1OKT A;  3ZTL A;  4PTS A;  2KUC A;  2R0C A;  5E4W A;  1QGV A;  2FY6 A;  4PUF C;  1PKW A;  2MMN A;  1ABA A;  4WBJ A;  3LSZ A;  1TRW A;  3QPM A;  4NWY A;  3M9K A;  4JED A;  2ALB A;  3HY2 A;  4PQ1 A;  5BMU A;  4K5S A;  2MBT A;  1RW1 A;  3CTF A;  5D9V A;  3DEX A;  1X5C A;  3WD6 A;  1V57 A;  4N10 A;  12GS A;  2HRF A;  3E0U A;  1A2J A;  3Q74 A;  3LFL A;  2GQM A;  3C7M A;  4XS4 A;  1ILO A;  1GSS A;  2WJU A;  4TR0 A;  4TXO B;  3FHK A;  3F4R A;  3EVI A;  4PUA A;  2C4J A;  1TTZ A;  1VGL A;  4TRX A;  1TU7 A;  3KIJ A;  4Z7X A;  1K3O A;  3KGK A;  2IMK A;  3ZIT A;  3IAM 2;  3WGD A;  2G2Q A;  2FUG 2;  4RUV A;  5DAL A;  5B8A A;  1EGO A;  4ILF A;  5B7C A;  3QFB C;  2R2J A;  1V40 A;  1ZOF A;  4KAE A;  2LS5 A;  4IP1 A;  2XBI A;  3GX0 A;  1ZYE A;  1M2B A;  1VRS D;  4DVC A;  5ID2 B;  1HQO A;  4TR1 B;  3TKR A;  1MD4 A;  3QCP A;  5HFG A;  1M9A A;  2AHE A;  4NXI A;  4POL A;  4ACS A;  4MMM A;  5F06 A;  4MA9 A;  3WT2 A;  2REM A;  4XTS A;  4E8H A;  3IV4 A;  4EO3 A;  1SD8 A;  3EYT A;  3IOS A;  1TRU A;  2GSR A;  3FR3 A;  2GZY A;  1LU4 A;  4YQM A;  3EC3 A;  2MZC A;  4BL7 A;  2GSS A;  2EC4 A;  2CA8 A;  4EDY A;  3AY8 A;  1EOG A;  3LG6 A;  4OO5 A;  4KB3 A;  4GST A;  2VD0 A;  1E2Y A;  3C8E A;  3A3T A;  3PH9 A;  2BMX A;  1M9B A;  4O32 A;  1YY7 A;  3CYN A;  4BWQ A;  3EUR A;  2X49 A;  4EIQ A;  4MPG A;  3RHB A;  4POB A;  4MF6 A;  4YKG A;  1V9W A;  1WRY A;  2VUP A;  4HZ2 A;  4QL9 A;  1VF3 A;  2CAQ A;  2B5X A;  5DAL B;  4F2I A;  3DRN A;  5IMZ A;  3N9J A;  3APS A;  5G31 A;  3DML A;  3H1N A;  5ELA A;  2ZCT A;  5JWR B;  3FR6 A;  3NZN A;  3GH9 A;  1W4V A;  1TJD A;  2DSA A;  3UBK A;  4DSQ A;  2O89 A;  2C0D A;  2YAN A;  2GST A;  1M2A A;  3I9V 2;  4I6X A;  5IMF A;  4PUR A;  4MAB A;  4BVY A;  1B4Q A;  5IMV A;  1A8Y A;  14GS A;  4YQV A;  3CRT A;  4PQH A;  4MF5 A;  1GUL A;  2JZT A;  1A2M A;  2FA8 A;  1YEP A;  1LJR A;  1SJI A;  1BED A;  3FKF A;  2OE1 A;  3ZL5 A;  1O7U A;  3MAK A;  1C72 A;  1TOF A;  3RPP A;  4TXV A;  3PPU A;  2L6D A;  4EXJ A;  2JZS A;  5B6N A;  2VLV A;  3GHA A;  2AV4 A;  1GL8 A;  5KN0 A;  1G7E A;  4O5Q A;  5J9B A;  3F4T A;  1A0R P;  2PER A;  4ECJ A;  3DWV A;  5KOW A;  2HNL A;  1EOH A;  5J4U A;  4CY8 A;  5KEJ A;  2V32 A;  1XVQ A;  3GKX A;  5ECH B;  1MEK A;  1SK2 A;  1EGR A;  2LJR A;  4Q5N A;  5GAN D;  4G2E A;  2CZ3 A;  2LUS A;  2CX4 A;  4LL1 B;  2OE0 A;  3P90 A;  2H0H A;  3C73 A;  2DIZ A;  4K2D A;  1ZCP A;  3LXZ A;  4BVY B;  1B8X A;  3F3Q A;  5L71 A;  2PGT A;  4HQS A;  1PGT A;  3IBH A;  4TW5 A;  1QK8 A;  4NV2 A;  3D6I A;  1X9W B;  2C3N A;  2JSZ A;  1NSW A;  1PL2 A;  4F03 A;  2FWG A;  3LWA A;  4GQF A;  5COH A;  4GLT A;  3ZIJ A;  4KGI A;  1S3C A;  1ZMA A;  4GF0 A;  5CAX A;  4WEY A;  2H01 A;  1GTU A;  5ECL B;  3NOF A;  1XZO A;  4BVX A;  3UEM A;  1V98 A;  1T00 A;  3KP9 A;  1B9Y C;  4XIH A;  5HR0 A;  2CVB A;  2L6C A;  2GSQ A;  3FZ9 A;  1ZL9 A;  5ECR B;  1EP8 A;  3LGC A;  2FNO A;  4TOP A;  2OBK A;  4O92 A;  2L4Q A;  2UZ8 A;  2LST A;  4LL4 B;  3BD2 A;  5F0G A;  3L4N A;  2OJL A;  2PPT A;  3GMF A;  5IPG A;  3FR9 A;  3E9J B;  3IR4 A;  2VLU A;  2H1G A;  2H75 A;  1KTE A;  4MJE A;  5D96 A;  3R3E A;  1GSD A;  2OAD A;  4WKW A;  4HUA A;  4XHM A;  4G10 A;  4N11 A;  5CRH A;  3DVW A;  5A4V A;  3FRC A;  1EP7 A;  3DXB A;  3CRU A;  3HDC A;  2P0G A;  1S3D A;  3FY7 A;  2WRT A;  4X4J A;  1U3I A;  2B5Y A;  2R6K A;  3O76 A;  3CSJ A;  1IYI A;  2HSM A;  2FD3 A;  3UVT A;  5HFK A;  1PSQ A;  4F0B A;  2QC7 A;  1Z9H A;  4G9H A;  2XBQ A;  2K8S A;  2JL4 A;  3HKR A;  3US3 A;  4Z2T A;  2VL9 A;  3HJO A;  1ML6 A;  3EU3 A;  4AJ6 A;  3A2X A;  1UVZ A;  2IJY A;  1ERV A;  4HOJ A;  4BVX B;  1VF2 A;  3ZMK A;  2VD1 A;  4L5O A;  3W6G A;  5C00 A;  4O7H A;  4OMV A;  5DVB A;  2C8U A;  3F3R A;  4ZL9 A;  3VFI A;  1K0A A;  2BJX A;  4FYB A;  1FAA A;  3IA1 A;  3GKM A;  4LA1 A;  3A2W A;  2M46 A;  3LXT A;  2DKI A;  3ME8 A;  3Q19 A;  1XW9 A;  1NHO A;  2YOI A;  2VCV A;  1Z6N A;  3GH6 A;  1R7H A;  1G0T A;  2NBS A;  3TKS C;  3IHQ A;  4GWR A;  1TU8 A;  20GS A;  18GS A;  2C3T A;  3OR5 A;  1A8L A;  5CP1 A;  1SKR B;  2AB6 A;  2X8G A;  1MDJ A;  4POM A;  1GTI A;  4PGT A;  3A5I A;  2B1K A;  3GSS A;  1EV9 A;  1XWA A;  1FB0 A;  1EEJ A;  1SK0 A;  3TKS A;  2QSI A;  1BQ7 A;  5G1L A;  2E2M A;  4EE0 A;  1XCC A;  1F37 A;  2HI7 A;  3LW9 A;  4WR5 A;  2JU5 A;  5ECM B;  6GST A;  1KNG A;  4OO4 A;  1EZK A;  1XPV A;  4I97 A;  2E0Q A;  2GT6 A;  5DAK A;  2H19 A;  3D22 A;  5BRT A;  2LJA A;  3VUR A;  1PD2 1;  5D8I A;  5D9X A;  4IHU A;  3PIN A;  2X4A A;  4G0I A;  4GRF A;  3KD0 A;  5HR3 A;  2H6Y A;  4WR4 A;  1N2A A;  4Z2R A;  3QR6 A;  3G7Y A;  3M0F A;  2D2Z A;  3VI5 A;  1KBN A;  4XRD A;  2GQL A;  4DSR A;  4CY6 A;  3MYD A;  3F6F A;  2TIR A;  3ZVJ D;  3PGT A;  3HYP A;  4KUN A;  4O5U A;  3G7I A;  4RQX A;  3ERF A;  2GTU A;  1TW9 A;  4WXT A;  1SEN A;  5DQY A;  4L5L A;  13GS A;  1T3B A;  3L9U A;  4RI6 A;  3IC4 A;  1YEX A;  2HZF A;  1AAZ A;  1AUC A;  1PL1 A;  3HD5 A;  3O3T A;  2N5A A;  1QXH A;  1B48 A;  4IGJ A;  4JZQ A;  1SYR A;  4CDO A;  1WMJ A;  5AIV A;  1WPI A;  2H0I A;  3D4T A;  4HQZ A;  2O7K A;  4HJ2 A;  2QA1 A;  1DBY A;  3HXS A;  2DJ0 A;  1ERW A;  2YZH A;  4V2M A;  2YN1 A;  4TR4 A;  3F8U A;  3TJF A;  3L9V A;  3TB2 A;  4EF0 A;  1QUW A;  3J7Y k;  1JZO A;  4Q5F A;  5DAK B;  1K0D A;  2V6K A;  2YZU A;  3D5J A;  3S9F A;  1K3L A;  1Y25 A;  3VPT A;  4KDY A;  4WET A;  5ECN B;  1J9B A;  3QAV A;  2OAC A;  4GSS A;  4ICY A;  3LEF A;  4FYU A;  1FVJ A;  4WF4 A;  2NPB A;  3GTU A;  3MSZ A;  5B8B A;  3TCO A;  3C1R A;  2H30 A;  1PN0 A;  4CHS A;  5HR2 A;  2JSY A;  5H5R A;  4OCF A;  1GLQ A;  1M0U A;  2H72 A;  1F3B A;  2A4H A;  1GSQ A;  5GAP D;  3L0H A;  1K3Y A;  2CX3 A;  1SL0 B;  1SYX A;  5GST A;  4PQI A;  5KN3 A;  3RBT A;  1V2A A;  2H1D A;  2OE3 A;  5F07 A;  1TXX A;  1NM3 A;  4K0G A;  2E7P A;  2IFQ A;  3FZ5 A;  5IPH A;  2DIY A;  1FOV A;  3F0I A;  5IQY A;  1EEM A;  4H86 A;  3TGZ A;  1OKD A;  2A2S A;  3EE2 A;  4PNG A;  4LLR A;  6GSV A;  1XFL A;  2G0F A;  5CNW A;  3QD9 A;  3RAZ A;  4XS4 B;  2AJQ B;  3P7X A;  1GH2 A;  4N0V A;  5ECS A;  2B3S A;  1CQG A;  2B5E A;  3HVS A;  4ZBB A;  3VWU A;  1GUM A;  1SKS B;  5DCG A;  2YWN A;  1EV4 A;  1JZR A;  4ZB9 A;  2HXK A;  4X1U A;  4K1F A;  1SL2 B;  2LNS A;  4OCE A;  4IBP A;  2H76 A;  4K7O A;  1T7P B;  2IMI A;  1AQV A;  5ECO B;  3HA9 A;  5J5N A;  1E6B A;  1GWC A;  5DDL A;  1RQM A;  3EIN A;  4K9Z A;  1O85 A;  2JAC A;  1FVK A;  2ON7 A;  2IMD A;  3GTU B;  3MWH A;  4N30 A;  1OE7 A;  5CRW A;  4KW6 A;  2IL3 A;  3HCZ A;  4GTU A;  1FHE A;  3APO A;  3CXG A;  2C0G A;  1M99 A;  2GLR A;  2H0G A;  2WCI A;  3O6T A;  5ECQ B;  4EVM A;  2FA4 A;  3HJP A;  2F51 A;  1PKZ A;  1FW1 A;  1XOA A;  3D21 A;  3KH7 A;  4D73 A;  3L9S A;  1SJZ A;  1BAY A;  4KCA A;  3IK7 A;  3KMO A;  4IQ1 A;  3GA4 A;  2WGR A;  3I69 A;  4OFN A;  4MJB A;  4V2N A;  1O81 A;  4MJA A;  2HFD A;  2IFQ B;  3J7Y b;  2B6M A;  1J0F A;  5IM9 A;  2V2G A;  2VOC A;  2V6O A;  1R5A A;  1TP9 A;  4BL7 B;  1YQ1 A;  3KXO A;  3FEU A;  2GT5 A;  2F8A A;  2YP6 A;  4OWY A;  4MF7 A;  5FWG A;  1BJX A;  3U5R E;  1QMV A;  1U88 A;  2RM5 A;  3LYK A;  1PQN A;  4YQU A;  3E3E A;  1GNE A;  1YKC A;  4KDU A;  2MYG A;  2RUF A;  2IIY A;  3I43 A;  2QA2 A;  2VCW A;  1ZYP A;  2H70 A;  1OVN A;  1AXD A;  2GZZ A;  2JAD A;  1NHY A;  5A4U A;  1G7O A;  1TKD B;  4J57 E;  17GS A;  3V1W A;  1F3A A;  4RI7 A;  3L78 A;  1O6J A;  4FO5 A;  3KJY A;  3GRX A;  5IOX A;  3KMN A;  1TI1 A;  3BCI A;  3GX8 A;  3GST A;  2I3Y A;  3VWW A;  1JLV A;  1SL1 B;  2LEG A;  4D73 B;  1GSE A;  2K6V A;  4FYC A;  5G5E A;  4ZIJ A;  2AAW A;  1Z7R A;  3GN3 A;  4IS0 A;  1SU9 A;  2DBC A;  4X0X A;  1OYJ A;  1YZX A;  2H71 A;  2I9H A;  3LJR A;  1THO A;  3IPZ A;  1PX7 A;  1TRV A;  3TKS E;  4ZB6 A;  5JWQ B;  16GS A;  2HRA A;  3TRP A;  1GRX A;  3DGQ A;  3VWX A;  4A5P A;  1ZYQ B;  1O73 A;  2I81 A;  3DVX A;  1XWK A;  1MD3 A;  2CVK A;  4AJ7 A;  3HZ8 A;  3Q18 A;  3GNJ A;  2FWF A;  4NMU A;  4WF5 A;  5DJL A;  1T8E B;  5G1K A;  4L0W A;  3MNG A;  4XS1 A;  2CQ9 A;  2H1B A;  3TUE A;  3ERW A;  1S3A A;  4DSS A;  3C1S A;  5ECK B;  1MDK A;  5JCU A;  1CQH A;  10GS A;  3TJK A;  1YF0 A;  2CZ2 A;  2FCH A;  2FWE A;  1XWC A;  1A2L A;  3ISO A;  4I2U A;  4JBB A;  3WGX A;  3RDW A;  4BA7 A;  2M72 A;  1THX A;  5EPF A;  4XRA A;  1FO5 A;  5G30 A;  6GSX A;  2VL2 C;  2C0E A;  1K0M A;  4PXO A;  5EL8 A;  1WP0 A;  2CV4 A;  5CRE A;  2IME A;  3LYP A;  5LNK e;  2A4V A;  2F8F A;  2MMZ A;  4MH2 A;  5A4W A;  5AGY A;  4IP6 A;  5CO3 A;  2YWM A;  4F82 A;  2X8C A;  1ZGN A;  2VL2 A;  4WBR D;  1ERU A;  4YKF A;  3ZYW A;  1YF1 A;  1FB6 A;  4ZXG A;  4XS6 A;  3G9B A;  4PNF A;  3KH9 A;  4HJM A;  1UN2 A;  4EUY A;  2OKA A;  4ECI A;  3HJM A;  3IRA A;  1HNC A;  5D73 A;  4IJ3 A;  5ECP B;  4HI7 A;  3HHV A;  4I2T A;  2PBJ A;  4TN8 A;  1YDK A;  4QQ7 A;  4L8E A;  2N5B A;  1WOU A;  1XXU A;  3KEB A;  4DSS B;  2HYX A;  1ACV A;  2A2P A;  2HLS A;  2RLI A;  1X9M B;  1ON4 A;  1Z5Y E;  3EPT A;  1M2D A;  1VF1 A;  1PX6 A;  3M9J A;  1R4W A;  5A5K A;  3UBL A;  1XBS A;  1X5D A;  2VM2 A;  4KCE A;  2NTO A;  3F6D A;  4K7I A;  4KE3 A;  2XHF A;  5IO2 A;  3VK9 A;  2LJK A;  1AIU A;  3GUS A;  3UMA A;  5GSS A;  4ZL7 A;  2L5L A;  4PX1 A;  2MMA A;  2DMM A;  2YCD A;  2FWH A;  1PRX A;  3TOU A;  1GSU A;  2ZNM A;  2H1A A;  3IXR A;  2CVD A;  4CW9 A;  5E59 A;  2I1U A;  4MZW A;  4LMV A;  3EU4 A;  4I8B A;  4TKY A;  3GYK A;  5CRD A;  3TRX A;  5J3R A;  2HRN A;  2LV3 A;  4KX4 A;  2QKE A;  4ZBD A;  3GUR A;  2KP2 A;  4Q5Q A;  2DJK A;  2MMO A;  2AUV A;  1XOB A;  1QQ2 A;  5DJM A;  4MLY A;  4NAX A;  5ECI B;  4IW9 A;  1I9D A;  2L4C A;  1K0C A;  5FT3 A;  1JHB A;  1G6Y A;  4EL1 A;  3NIV A;  1U6T A;  2R3X A;  1K0B A;  4F0C A;  4POK A;  3FMW A;  8GSS A;  1JFU A;  4XCS A;  1T4Z A;  2BTO T;  3I6A A;  5F05 A;  5IMC A;  1BG5 A;  2C0F A;  3LOR A;  3ED3 A;  3GL3 A;  2N5F A;  4JRR A;  1DE1 A;  2DJ3 A;  3GKK A;  4HEA 2;  1ZZY A;  2L59 A;  3IDV A;  2PU9 C;  1YKA A;  2L5O A;  3HZ4 A;  2DML A;  4NHW A;  4N0Z A;  2DJ1 A;  4GSN A;  4LMW A;  1WJK A;  5DQS A;  1HYU A;  2WZ9 A;  2FGX A;  1X9S B;  3UOM A;  5AIX A;  2LNT A;  4EC0 A;  2M80 A;  1YJ6 A;  3TJJ A;  3H79 A;  1PMT A;  4YAV A;  2YJH A;  1FOH A;  3H4K A;  2LRC A;  4NV5 A;  2VCZ A;  5EY6 A;  4IN0 A;  3QDN A;  1AW9 A;  1EWX A;  3KTB A;  3VLN A;  3ZVJ A;  3ZIV A;  3HVX A;  2KOK A;  2YWI A;  3DIE A;  4ECB A;  3FZ4 A;  3KM6 A;  2C3Q A;  1XW6 A;  9GSS A;  2K8V A;  2GVP A;  4V1A g;  2KLX A;  5H5Q A;  3CMI A;  1GUH A;  3DYR A;  2PWJ A;  1UC7 A;  2HT9 A;  4L0U A;  5D93 A;  5G2Z A;  4TR3 A;  2RII A;  3F4S A;  3N5O A;  5IMD A;  2KP1 A;  5ABR A;  4MDC A;  3FZA A;  3H93 A;  4AJ8 A;  4IJI A;  4DEJ A;  5JCG A;  7GSS A;  3A2V A;  1JZD A;  4QL7 A;  1TRS A;  1R5P A;  4MNN A;  11GS A;  3FYG A;  2DJ2 A;  2P31 A;  2ON5 A;  1W89 A;  2WFC A;  2PVQ A;  1KEB A;  1OE8 A;  4MH3 A;  1SKW B;  4O5R A;  1GSF A;  1MDI A;  3KZQ A;  3ERG A;  2E2G A;  4MPF A;  4TVE A;  1GNW A;  1SJ6 A;  5AN1 A;  1JLW A;  2DJJ A;  2GGT A;  4OFM A;  3M8N A;  5DCH A;  4KH7 A;  4KDX A;  4J2F A;  1USB A;  3U6V A;  2IN3 A;  1T1V A;  3IE3 A;  4X43 A;  2OBI A;  3F63 A;  5LCZ A;  1N8J A;  1F9M A;  1HNA A;  3PR8 A;  4HU9 A;  3ZFL A;  4JR6 A;  3TJB A;  2CAI A;  1XVW A;  1U3A A;  3IC8 A;  4K2X A;  3GIX A;  2ZUP A;  5LD0 A;  3UJ1 A;  3P2A A;  2H73 A;  4EKZ A;  3QAW A;  2HZE A;  1BX9 A;  1SK1 A;  4MK3 A;  1B4P A;  1FG4 A;  4ML1 A;  3ZFB A;  5B6M A;  4YH2 A;  1TK8 B;  4KND A;  1BYE A;  6GSU A;  2H6X A;  1GLP A;  2RM6 A;  3WGE A;  3DD3 A;  2XC2 A;  2VCQ A;  4FH8 A;  1GTB A;  2R0P A;  2EIO A;  3VPQ A;  1OC3 A;  2YV7 A;  5JCW A;  2GDR A;  3EMP A;  3TOT A;  1F2E A;  4G0K A;  3CBU A;  3WT1 A;  5D9W A;  2HSH A;  4ID0 A;  4K5R A;  4KF9 A;  3UVH A;  2VL3 A;  4FQU A;  4ZB8 A;  5KN1 A;  1H4O A;  1I5G A;  2VCT A;  1PA3 A;  1Z7P A;  1TK5 B;  4Q5R A;  2VCX A;  2WB9 A;  2IWT A;  2LQO A;  4BWS A;  4MZB A;  19GS A;  2O87 A;  4V1A p;  3W8S A;  1AC1 A;  2H6Z A;  2LQQ A;  2MBS A;  1AQW A;  3M3M A;  2FHE A;  4GQC A;  3MIX A;  3F9U A;  1X0R A;  3UAR A;  1XWB A;  3QOU A;  1O8W A;  4I5Q A;  1GP1 A;  5IMA A;  2XPD A;  3Q6O A;  3R2Q A;  2H74 A;  5JWO B;  1DE2 A;  5KOX A;  4USS A;  2NVL A;  1T4Y A;  2HE3 A;  2VIM A;  1X5E A;  1OC8 A;  1V58 A;  2EIR A;  3D0Z A;  2X8H A;  4HDE A;  2IMF A;  5IIZ A;  2WDU A;  3A5W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...