2PWJA

Structure of a mitochondrial type ii peroxiredoxin from pisum sativum
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
162
structure length
162
Chain Sequence
LSAASNVSLQKARTWDEGVESKFSTTPVNDIFKDKKVVIFGLPGAYTGVCSSKHVPPYKHNIDKFKAKGVDSVICVAINDPYTVNAWAEKIQAKDAIEFYGDFDGSFHKSLELTTDLSAGLLGIRSERWSAYVVDGKVKALNVEESPSDVKVSGAETILGQI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Mitochondrial peroxiredoxin
publication title Structure of a mitochondrial type II peroxiredoxin from Pisum sativum
rcsb
source organism Pisum sativum
total genus 39
structure length 162
sequence length 162
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2007-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08534 Redoxin Redoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2pwjA00
3DYRA 1AW9A 3GHAA 5HQPA 1WOUA 1GRXA 1FB6A 4FYBA 2JZSA 1X5DA 2OACA 4MLYA 2VCWA 4IBPA 3IK9A 5ECOB 1HNCA 1U6TA 3TKSE 4MJBA 4JRRA 5IIZA 1PGTA 2WS2A 5IPHA 2DSAA 3QD9A 4MABA 4RUVA 3GNJA 1AQXA 4BPYA 2VLTA 5J9CA 3H8QA 4XRDA 3PH9A 4TR1B 1T4ZA 3EE2A 3PINA 2VOCA 5J3RA 1XVQA 2CV4A 4I97A 4ZXGA 2WDUA 1X5EA 4KSOA 4NV2A 2BMXA 2H19A 3IPZA 1TJDA 1XIYA 3RAZA 3IE3A 2JU5A 1BEDA 1SJZA 2C4JA 4EDZA 1EOHA 1OYJA 4OD7A 1K3YA 1YEPA 4PUFC 1FAAA 1NHYA 4EDYA 2GSSA 7GSSA 5GZZB 5GSSA 2V2GA 5F0GA 5ECMB 1ZZYA 2WRTA 3F4TA 1EEMA 4V1Ag 3ZFLA 1MTCA 4GWRA 2OKAA 3FK8A 1T7PB 1GWCA 3F6DA 1F3BA 3KZQA 3VWUA 2E2MA 5ENUA 4LMVA 2GDRA 4D73B 4ECJA 4F9ZA 4OWYA 2YWOA 5KN3A 2I3YA 2AB6A 2IMEA 5JWOB 5IMAA 3FR6A 4MJEA 2BJXA 2P5RA 1B9XC 1A2MA 2H74A 1A0FA 2LTKA 3ZTLA 1K0BA 3ZVJA 2CVBA 1YDKA 3F3RA 3M1GA 1CQHA 1PN9A 4OFTA 2HLSA 1DBYA 2PGTA 4EKZA 1BYEA 2R6KA 2GSRA 4GRFA 4IP6A 2MMOA 1ERTA 2XHFA 4FIWA 4IP1A 2H75A 4F82A 1XCCA 1GL8A 2QC7A 5FWGA 1ZGNA 2E2GA 5D96A 5D9XA 1T4YA 4YH2A 5LD0A 1I9DA 3ZZXA 1MDIA 4BWSA 5EL8A 2IWTA 4EL1A 4E8HA 2X8HA 4KCEA 1X5CA 5B8BA 1HNAA 4EO3A 4WF5A 1UVZA 4IKHA 2CAIA 2I4AA 2C0EA 1PKWA 1HD2A 2WCIA 4AJ7A 2B6MA 3DVWA 3CSJA 4OFNA 1N8JA 3QOUA 1QGVA 3GUSA 1E2YA 1GTIA 1GLPA 3D4MA 1TK8B 3CRTA 2YWIA 3KTBA 1T8EB 4GSTA 16GSA 3VK9A 3P90A 3E0UA 3JCML 2D2ZA 1SJ6A 3WGEA 5B8AA 2F51A 2LJRA 1LJRA 4FYUA 2R3XA 4ZBBA 1Y6EA 1XVWA 2QKEA 2RM6A 4ULXA 4N0ZA 2JACA 2HI7A 2X8CA 2R37A 1M9BA 3AY8A 5HR3A 3U5RE 3F8UA 3P8WA 4J57E 3GURA 4V2MA 2K6VA 1OC9B 4OFMA 5ELAA 4IVFA 1A24A 1TW9A 1XFLA 2OADA 2C3NA 1GLQA 1ST9A 4POMA 4OO5A 3KMNA 4IJIA 1GUKA 2LQQA 2H66A 3V1WA 2A2SA 3TKPA 3MSZA 2C80A 4MA9A 3HVSA 4PNGA 2CVDA 2R2JA 5F05A 1USBA 4JE1A 2CX3A 2DMMA 4BL7A 2LRNA 1SJIA 3ZL5A 3WYWA 4MF5A 2E7PA 3RHCA 3D5JA 3NIVA 1VF4A 1OC8A 1DE1A 3EC3A 1PRXA 3FR3A 4ML1A 2XBIA 4NHWA 2M72A 1V40A 4YQUA 1AC1A 1SL2B 5HR0A 1WP0A 2OJLA 1TOFA 1J0FA 2KUCA 3VWWA 18GSA 5IOWA 3KJYA 1GSQA 1JHBA 2IFQB 1R5PA 1JZWA 1KEBA 3P2AA 4ECBA 4ZL7A 3GFKA 2H73A 2F8AA 2B5XA 2GVPA 4GSNA 3WT2A 2I9HA 2N5AA 4PXOA 3GKKA 1F37A 1J9BA 4I6XA 4LLRA 4ZL8A 4DSQA 4F0CA 5G1LA 1K0MA 2FWGA 1U3IA 2V41A 2K18A 4MK3A 1F2EA 4L5OA 2VCZA 3DWVA 5AIVA 3KD0A 2GZZA 1Q98A 1HYUA 1U87A 3F4SA 3HXSA 4TKYA 1XW5A 5IMZA 5AIXA 1ERVA 1IYIA 3H4KA 3IK7A 3GN3A 4K0NA 3W8SA 2O85A 3VWVA 5EVOA 1ERWA 4MPGA 3QAGA 2H6XA 3L9SA 11GSA 5B7CA 1DSBA 1CQGA 3EVIA 1PSQA 4N0VA 3TOTA 1KTEA 1TDIA 3GMFA 2HE3A 6GSSA 4BWQA 3A2VA 1YQ1A 2IPAA 4NMUA 2AUVA 3WD6A 2B5EA 4X43A 1O73A 4O7HA 1T3BA 14GSA 3ZREA 2RUFA 2WB9A 2L4CA 4Q5NA 5A4UA 5DQSA 1M0UA 3L4NA 4TXOB 5ECNB 4MZWA 1G7OA 8GSSA 1WIKA 2GGTA 3IAS2 1B4QA 2R4VA 1BJXA 3PGTA 4I8BA 4MH2A 1MEKA 1TU7A 2PWJA 3QPMA 6GSYA 4KDYA 1TRSA 3DMLA 4OMVA 1O81A 4ML6A 2L4QA 2P0GA 3IV4A 4G19A 3G7YA 2CVKA 4GF0A 4J56E 3H79A 2YZHA 2DJ2A 2MMNA 4HOJA 2RIIA 5ID2B 4CHSA 1X0RA 4EUYA 4KSMA 4HZ4A 5HFIA 3I9V2 2H1DA 1YKAA 2VM2A 4YAPA 4TN8A 1ZOFA 3HJMA 2DIYA 2X8GA 3EMXA 2MMZA 3CSHA 4BVXA 5D9VA 1RW1A 4NPBA 3LG6A 1XOAA 1TK5B 1A23A 1UA5A 1A8LA 5AN1A 1GNWA 2L57A 2VUPA 2VCXA 1FVKA 1THXA 3C71A 4F2IA 3FKFA 4EXJA 4PQHA 5H5SA 1TI1A 5A4WA 5C04A 1GSUA 2YJ7A 2H01A 1LU4A 2LNTA 4MF6A 5CNWA 4ACSA 2F8FA 2QSIA 2DJJA 1BQ7A 3ZRDA 5F07A 3UL3A 4IW9A 5AGYA 3TUEA 4IN0A 1I5GA 2DMLA 4PURA 3L9VA 2REMA 2B5YA 4PGTA 2GQLA 2IMIA 1SL0B 3KTLA 2VCQA 3CBUA 4E8EA 3HZ4A 1WE0A 3GX8A 1OE8A 2GTUA 3F4RA 1HQOA 3GH6A 3MWHA 4K1FA 3TKQA 4PQ1A 1O6JA 2OBIA 2FA8A 5G30A 3UAPA 1ACVA 2CX4A 2FWEA 1W89A 3QCPA 1Z5YE 5CRGA 6GSXA 5B6MA 3GRXA 1MD4A 2IL3A 3ZIJA 1H75A 1PD21 2K8VA 3TOUA 1T1VA 2V1MA 2WULA 2PVQA 2HT9A 3FY7A 2HSYA 3A2XA 3VI5A 2GT5A 3UVTA 1XWKA 3FZ9A 3UMAA 4K7IA 3US3A 3GTUA 4ILFA 1QK8A 3LYKA 1ABAA 5ECKB 3BD2A 1SYXA 1SENA 3UVHA 2ES7A 3FHKA 4MP4A 4Q5QA 5H5RA 1BAYA 2L59A 3LFLA 3M3MA 2ZNMA 3O3TA 1XW6A 4ISDA 5IOXA 3EINA 3TJFA 4L5LA 3ZVJD 2YZUA 2YV7A 2YWNA 1KBNA 3C7MA 2HXKA 2RLIA 3F3QA 1ZL9A 3ERFA 2KP2A 3GA4A 1XWCA 3LYPA 2CA8A 3A2WA 3NOFA 1S3DA 3GKNA 3FR9A 2ON5A 2B7KA 2VM1A 1B9YC 1R7HA 4AGSA 3ED3A 22GSA 4V2LA 2JZTA 3DEXA 3KH7A 4CDOA 4TR1A 5DBQA 3C1RA 2VL2A 1XBSA 2MZCA 1EZKA 4WETA 3CMIA 5LCZA 3M9KA 4ECIA 1DE2A 4IS0A 2H1AA 1ZCPA 4IQ1A 4LL4B 3GIXA 3IR4A 1IYHA 4AF2A 2YN1A 4MCUA 2L5OA 2JZRA 4TR4A 5J4UA 4NXIA 4XS4B 4KDXA 4XHMA 1ILOA 1PX7A 5FT3A 3I6AA 5JCWA 4X0XA 2H0GA 6GSUA 1SYRA 4XCSA 1R26A 4K9ZA 5ELGA 5CAXA 2YPMA 3IDVA 2VL3A 5B6NA 5DAKB 5ECPB 3G9BA 5DALB 1ZYEA 1AQVA 1JLWA 1OKTA 1V9WA 5G5EA 1WRYA 3DRNA 1K0OA 1A2LA 3ME7A 3VPQA 2FCHA 2H0IA 3DXBA 4KDUA 2KOKA 2OE3A 2HFDA 4RQXA 5CREA 1YJ6A 2OE1A 3ZITA 4D73A 4V1Ap 1M2BA 2F3MA 2TIRA 3QFBC 2JSZA 5COHA 2FGXA 3TJJA 3ISOA 4ZIJA 3TKSA 3KH9A 2VD0A 3C73A 2Z9SA 2IIYA 4HS1A 1EP8A 3CRUA 1VF3A 2MYGA 4OCEA 4HQZA 3ZIVA 1LBKA 3HHVA 5D9TA 5IMDA 3MDKA 4CW9A 2GSTA 2YNXA 2M46A 2PPTA 1OAZA 3A5WA 2GT6A 3DIEA 2DJ1A 3TRPA 3EU4A 3VI7A 2G2QA 3Q18A 5DQYA 3DKSA 4OO4A 4NAXA 4TR0A 1K3LA 4ZBDA 3W8JA 3HD5A 1Z7RA 2C3QA 4I2TA 2V6KA 4XS1A 1A2JA 3H93A 5HR2A 4LL1B 2H1BA 2DLXA 3H1NA 3G7IA 4MMMA 5DALA 3VLNA 1MDKA 2ON7A 1G6YA 3ERGA 1HNBA 4QL9A 2VCVA 1TTZA 1YF0A 2MBTA 2X99A 4O92A 2J23A 1GTBA 3UBLA 2J9HA 2I81A 2VL2C 3F0IA 3DD3A 4KNDA 1UC7A 4JEDA 5IPGA 3APSA 3UJ1A 3TCOA 1ZMAA 4XIHA 2FHEA 2FWFA 1O8WA 2LS5A 4N30A 3HCZA 3CYNA 4IELA 2KP1A 1A8YA 3ZMKA 5ECRB 3TKRA 5E59A 5IM9A 3KM6A 4ZB9A 20GSA 1QFNA 2WFCA 4HZ2A 2VLUA 3GH9A 2C8UA 1EV9A 1QXHA 2CAQA 3QAVA 1NM3A 2M80A 3EYTA 4FH8A 2JSYA 2HSHA 2LV3A 4V2NA 1GSYA 2AV4A 2XC2A 4PUAA 1OC9A 1XPVA 4QQ7A 5KN2A 2XPDA 3J7Yb 4JBBA 2NPBA 1SD9A 1U3AA 3TRXA 2FD3A 5IMCA 4GXZA 3LSZA 4KA0A 4F0BA 3TKSC 3LJRA 2VAFA 2F9SA 3ZFBA 1WWJA 5DJLA 4HEA2 2LSTA 4HJ2A 2FUG2 12GSA 5ABRA 5CYYA 1YEXA 4KCAA 4GCIA 1R5AA 4WR4A 1C72A 1XOBA 1AUCA 1ERUA 3WT1A 5CP1A 2GZYA 3VFIA 3L9UA 5KN1A 2HZEB 3RHBA 3LGCA 4NHZA 1BG5A 1RQMA 4N10A 3IBHA 5HFKA 1GNEA 3BCKA 2L6CA 3RPPA 3KP9A 3O6TA 4WXTA 5D93A 5F06A 2MMAA 2IFQA 5ECHB 3F9UA 1S3AA 4AJ8A 1M9AA 2I1UA 3WGDA 4ZB8A 3RPNA 3D6IA 3LEFA 1EGOA 1GSDA 4MPFA 4K7OA 2H6YA 4TW5A 1GULA 3IA1A 2C3TA 1S3CA 2AYTA 1N2AA 1MDJA 1TK0B 1V2AA 3TGZA 3QFAC 2EC4A 3KGKA 3FZ4A 3CTGA 3TB2A 2YV9A 5AISA 3C1SA 3HJPA 4MF7A 1WMJA 4KW6A 1K0DA 2FWHA 4F03A 5E4WA 1FVJA 3LWAA 1NHOA 5CRHA 1EGRA 3GYKA 4RI6A 1GH2A 1FHEA 2VLVA 4ID0A 2LUSA 3FZAA 2L6DA 4I5QA 4WF4A 1Z6NA 6GSVA 4X1UA 2FNOA 1FOVA 1QQ2A 4WKWA 1SK1A 3KMOA 2G0FA 1AIUA 1EP7A 2OA7A 17GSA 4P3YB 3BBYA 3VURA 4K7NA 3MAKA 2RM5A 3TRQA 1PA3A 4O32A 3HKRA 2N5FA 1A0RP 3TJGA 2XBQA 4ZILA 3BJ5A 4PNFA 6GSTA 1EEJA 4MDCA 1M2AA 3U6VA 3E9JB 4TXOA 4RI7A 4DSSB 2LJKA 3UARA 2EIOA 5EPFA 4WBRD 3TDGA 2YJHA 1SL1B 3DVXA 2VIMA 1T00A 5INYA 3EURA 2H0HA 2GZPA 4POKA 1J08A 2K8SA 4HUAA 5JWRB 2ZCTA 4JR4A 1SU9A 3LQ7A 5ECQB 4L0WA 1XZOA 2C0DA 1GUHA 3EMPA 3CSIA 2IJYA 2CZ3A 5ID2A 4Z7XA 1WPIA 1W4VA 1V98A 3APOA 1VRSD 3E3EA 4J2FA 2BTOT 1GSEA 3KP8A 3IHQA 1G6WA 5A5KA 1PKZA 2O8VB 3HJOA 4TVEA 3UIWA 1XWBA 3GX0A 1EOGA 2ALBA 3W6GA 5ECSA 1PMTA 2LQOA 4PX1A 2FY6A 2HYXA 2O89A 3FZ5A 5IO2A 2IMKA 4HU7A 3J7Yk 5J5NA 4WBJA 1PX6A 1XW9A 3L0HA 4K8MA 1K3OA 1PQNA 2AAWA 5GSTA 3ZYWA 4GQFA 4HJMA 4KGIA 2O87A 5KN0A 4GLTA 3IXRA 3I43A 2B1KA 2QGVA 2VL9A 3BOAA 5L71A 1K0NA 3SWLA 3DGQA 2O7KA 4K6XA 4KUNA 3UOMA 2HRNA 4GSSA 4DSSA 2LNSA 1TI3A 4PQIA 3M8NA 3SBCA 1F9MA 2A2RA 4XS6A 4L0UA 3Q6OA 1BX9A 2PMTA 3D4TA 2B3SA 3RBTA 10GSA 1Z9HA 5J9BA 4POLA 1FW1A 1X9MB 4JZQA 2DJ3A 2A4VA 2PU9C 4IGJA 19GSA 2DJ0A 4H86A 2LJAA 1VF1A 2EIQA 2DIZA 3BCIA 4MZCA 1O7UA 1AXDA 4IHUA 3K8NA 5D9WA 2WJUA 4O5RA 4BA7A 5IQYA 2PERA 4Q5RA 3HA9A 3IRAA 5HR1A 2H1GA 1QUWA 1FB0A 4OCFA 2FLSA 5IMVA 3GL3A 1Q4JA 2CZ2A 3GL5A 2LRTA 2HZFA 1B48A 2LEGA 3LXTA 1V58A 4EE0A 2DJKA 3HZ8A 2AHEA 1JLVA 4JU5A 3KXOA 2ZUPA 3GKMA 1URMA 2GQMA 3ME8A 3FEUA 1F3AA 1AQWA 5IMFA 3KCMA 4TOPA 5KEJA 2OE0A 1X9SB 4KE3A 1Z7PA 4RQRA 3F63A 4XRAA 5GAPD 3EU3A 2IMDA 2XPEA 2YANA 1U88A 3UEMA 1TKDB 1WJKA 1XXUA 3ERWA 3O76A 2EIRA 2RUEA 4ZL9A 1JFUA 4G10A 3WGXA 5DDLA 1AAZA 2GS3A 1E6BA 1TRUA 3GKXA 3L78A 4XS4A 2VCTA 2OBKA 3A3TA 5G31A 2LKUA 1F6MC 2H8LA 2FA4A 2V6OA 5J41A 1JZRA 3FW2A 5D8IA 5CRWA 4WEYA 1OE7A 1YKCA 2C0GA 5DVBA 1RK4A 1SKWB 4QL7A 2GQKA 3C8EA 1OKDA 2L5LA 5JCUA 1OC3A 5DAKA 2P5QA 4MH3A 4G2EA 5LNKe 5CO3A 4ZBAA 1TP9A 4EC0A 2VD1A 5FHIA 4DEJA 5JCGA 2H72A 1M7TA 2V32A 2H71A 3ZMLA 4MZBA 4LA1A 1QMVA 3LORA 1UN2A 5G5FA 5G1KA 4EVMA 1GUMA 3MNGA 5DJMA 4DVCA 3GSTA 1MD3A 1O8XA 3HVXA 4EF0A 1M99A 2TRCP 1PL1A 3NZNA 1TRVA 1X9WB 1O85A 1VF2A 3IAM2 3N9JA 4NWYA 4POBA 2CT6A 2LRCA 1ZYQB 13GSA 4KX4A 3GSSA 3CXGA 3FRCA 4IJ3A 2KLXA 2WZ9A 1Y25A 4DSRA 1SKRB 2B1LA 3FYGA 1JZDA 1K0AA 5EY6A 2CQ9A 4XTSA 3I69A 3UBKA 5G2ZA 6GSWA 5DCGA 3D22A 3Q19A 4HI7A 2JADA 4LMWA 1GP1A 3GV1A 1ML6A 3IC4A 5A4VA 5CRDA 5F8BA 3CTFA 5H5QA 4ZB6A 4FO5A 4TXVA 2IN3A 2H70A 4MJAA 2AJQB 1GTUA 2H76A 1FG4A 2KHPA 2NDOA 4AJ6A 1GSSA 1ON4A 1TRWA 1Z6MA 3OR5A 3RDWA 3VWXA 1YY7A 2X64A 2IMFA 4HU9A 4BVYA 4KH7A 1M2DA 3LXZA 2C1YA 4YQVA 4WR5A 2E0QA 2JL4A 2PBJA 1VGLA 4KB3A 2PUKC 4K2DA 3Q74A 5ECIB 2NBSA 3EWLA 3N5OA 1SD8A 3M0FA 3TJBA 1JZOA 5D73A 1GSFA 4N11A 4TRXA 4NV5A 1B8XA 3S9FA 1SK0A 2H30A 3VPTA 2HNLA 1NSWA 3HYPA 5GAND 3D0ZA 1G7EA 5JWQB 2GSQA 2YP6A 5IO0A 3APQA 2GLRA 4MJCA 2YOIA 2MBSA 4HQSA 2R5GA 2DC5A 2TRXA 3R2QA 3M9JA 2B7JA 1G0TA 3QAWA 2C0FA 1GTAA 4GTUA 5C00A 3QR6A 1KNGA 4HDEA 3HVVA 4L8EA 1B4PA 2K9FA 1SK2A 2PN8A 4KAEA 1V57A 1SKSB 1THOA 1R4WA 9GSSA 3QDNA 2VO4A 4YAVA 4JR6A 4TR3A 5DCHA 2NTOA 1EWXA 3HY2A 3IOSA 4YQMA 1TU8A 1YZXA 3HDCA 2YCDA 4Q5FA 4FYCA 2PVOC 2WGRA 1PL2A 2N5BA 3D21A 3F6FA 2P31A 1FO5A 1NW2A 3PR8A 4K0GA 1TXXA 2DBCA 2HRFA 2YWMA 1OVNA 3ZLPA 1K0CA 1Z3EA 5ECLB 3KEBA 3QMXA 2NVLA 4G9HA 3KIJA 3P7XA 2HZEA 4IQAA 4ECCA 3G7JA 1YF1A 1XWAA 2H6ZA 3TJKA 1EV4A 4I2UA 5HFGA 4GQCA 1XWGA 3GTUB 1DUGA 1H4OA
chains in the Genus database with same CATH superfamily
3DYRA 1AW9A 3GHAA 5HQPA 1WOUA 1GRXA 1FB6A 4FYBA 2JZSA 1X5DA 2OACA 4MLYA 2VCWA 4IBPA 3IK9A 5ECOB 1HNCA 1U6TA 3TKSE 4MJBA 4JRRA 5IIZA 1PGTA 2WS2A 5IPHA 2DSAA 3QD9A 4MABA 4RUVA 3GNJA 1AQXA 4BPYA 2VLTA 5J9CA 3H8QA 4XRDA 3PH9A 4TR1B 1T4ZA 3EE2A 3PINA 2VOCA 5J3RA 1XVQA 2CV4A 4I97A 4ZXGA 2WDUA 1X5EA 4KSOA 4NV2A 2BMXA 2H19A 3IPZA 1TJDA 1XIYA 3RAZA 3IE3A 2JU5A 1M3JA 1BEDA 1SJZA 2C4JA 4EDZA 1EOHA 1OYJA 4OD7A 1K3YA 1YEPA 4PUFC 1FAAA 1NHYA 4EDYA 2GSSA 7GSSA 5GZZB 5GSSA 2V2GA 5F0GA 5ECMB 1ZZYA 2WRTA 4BIKA 3F4TA 1EEMA 4V1Ag 3ZFLA 1MTCA 4GWRA 2OKAA 3FK8A 1T7PB 1GWCA 3F6DA 1F3BA 3KZQA 3VWUA 5KOXA 2E2MA 5ENUA 4LMVA 2GDRA 4D73B 4ECJA 4F9ZA 4OWYA 2YWOA 5KN3A 2I3YA 2UZ8A 2AB6A 3MIXA 2IMEA 5JWOB 5IMAA 3FR6A 1XG8A 4MJEA 2BJXA 2P5RA 1B9XC 1A2MA 2H74A 1A0FA 2LTKA 3ZTLA 1K0BA 3ZVJA 2CVBA 1YDKA 3F3RA 3M1GA 1CQHA 1PN9A 4OFTA 2HLSA 1DBYA 2PGTA 4EKZA 1BYEA 2R6KA 2GSRA 4GRFA 4IP6A 2MMOA 1ERTA 2XHFA 4FIWA 5KOWA 4IP1A 2H75A 4F82A 1XCCA 1GL8A 2QC7A 4YKFA 5FWGA 1ZGNA 2E2GA 5D96A 5D9XA 1T4YA 4YH2A 5LD0A 1I9DA 3ZZXA 1MDIA 4BWSA 5EL8A 2IWTA 4EL1A 4E8HA 2X8HA 4KCEA 1X5CA 5B8BA 1HNAA 4EO3A 4WF5A 1UVZA 4IKHA 2CAIA 2I4AA 2C0EA 1PKWA 1HD2A 2QA2A 2WCIA 4AJ7A 2B6MA 3DVWA 3CSJA 4OFNA 1N8JA 3QOUA 1QGVA 3GUSA 1E2YA 1GTIA 1GLPA 3D4MA 1TK8B 3CRTA 2YWIA 3KTBA 1T8EB 4GSTA 16GSA 3VK9A 3P90A 3A5IA 3E0UA 3JCML 2D2ZA 1SJ6A 3WGEA 5B8AA 2F51A 2LJRA 1LJRA 4FYUA 2R3XA 4ZBBA 1Y6EA 1XVWA 2QKEA 2RM6A 4ULXA 4N0ZA 2JACA 2HI7A 2X8CA 2R37A 1M9BA 3AY8A 5HR3A 3U5RE 3F8UA 3P8WA 4J57E 3GURA 4V2MA 2K6VA 1OC9B 4OFMA 5ELAA 4IVFA 1A24A 1TW9A 1XFLA 4HSCX 2OADA 2C3NA 1GLQA 1ST9A 4POMA 4OO5A 3KMNA 4IJIA 1GUKA 2LQQA 2H66A 3V1WA 2A2SA 3TKPA 3MSZA 2C80A 4MA9A 3HVSA 4PNGA 2CVDA 2R2JA 5F05A 1USBA 4JE1A 2CX3A 2DMMA 4BL7A 2LRNA 1SJIA 3ZL5A 3WYWA 4MF5A 2E7PA 3RHCA 3D5JA 3NIVA 1VF4A 1OC8A 1DE1A 3EC3A 1PRXA 3FR3A 4ML1A 2XBIA 4NHWA 2M72A 1V40A 4YQUA 1AC1A 1SL2B 5HR0A 1WP0A 2OJLA 1TOFA 1J0FA 2KUCA 3VWWA 18GSA 5IOWA 3KJYA 1GSQA 1JHBA 2IFQB 1R5PA 1JZWA 1KEBA 3P2AA 4ECBA 4ZL7A 3GFKA 2H73A 2F8AA 2B5XA 2GVPA 4GSNA 3WT2A 2I9HA 2N5AA 4PXOA 3GKKA 1F37A 1J9BA 4I6XA 4LLRA 4ZL8A 1M3IA 4DSQA 4F0CA 5G1LA 1K0MA 2FWGA 1U3IA 2V41A 2K18A 4MK3A 1F2EA 4L5OA 2VCZA 3DWVA 5AIVA 3KD0A 2GZZA 1Q98A 1HYUA 1U87A 3F4SA 3HXSA 4TKYA 1XW5A 5IMZA 5AIXA 1ERVA 1IYIA 3H4KA 3IK7A 3GN3A 4K0NA 3W8SA 2O85A 3VWVA 5EVOA 1ERWA 2DKIA 3QAGA 2H6XA 4MPGA 3L9SA 11GSA 5B7CA 1DSBA 1CQGA 3EVIA 1PSQA 4N0VA 3TOTA 1KTEA 1TDIA 3GMFA 4EIPA 2HE3A 6GSSA 4BWQA 3A2VA 1YQ1A 2IPAA 4NMUA 2AUVA 3WD6A 2B5EA 4X43A 1O73A 4O7HA 1T3BA 14GSA 3ZREA 2RUFA 2WB9A 2L4CA 4Q5NA 5A4UA 2QA1A 5DQSA 1M0UA 2HRKA 3L4NA 4TXOB 5ECNB 4MZWA 1G7OA 8GSSA 1WIKA 2GGTA 3IAS2 1B4QA 2R4VA 1BJXA 3PGTA 4I8BA 4MH2A 1MEKA 1TU7A 2PWJA 3QPMA 6GSYA 2R0GA 4KDYA 1TRSA 3DMLA 4OMVA 1O81A 4ML6A 2L4QA 2P0GA 3IV4A 4G19A 3G7YA 2CVKA 4GF0A 4J56E 3H79A 2YZHA 2DJ2A 2MMNA 4HOJA 2RIIA 5ID2B 4CHSA 1X0RA 4EUYA 4KSMA 4HZ4A 5HFIA 3I9V2 2H1DA 1YKAA 2VM2A 4YAPA 4TN8A 1ZOFA 3HJMA 2DIYA 2X8GA 4Z2TA 3EMXA 2MMZA 3CSHA 4BVXA 5D9VA 1RW1A 4NPBA 3LG6A 1XOAA 1TK5B 1A23A 1UA5A 1A8LA 3MYDA 5AN1A 1GNWA 2L57A 2VUPA 2VCXA 1FVKA 1THXA 3C71A 4F2IA 3FKFA 4EXJA 2X4AA 4PQHA 5H5SA 5BMUA 1TI1A 5A4WA 5C04A 1GSUA 2YJ7A 2H01A 4K2XA 1LU4A 2LNTA 4MF6A 5CNWA 4ACSA 2F8FA 2QSIA 2DJJA 1BQ7A 3ZRDA 5F07A 3UL3A 4IW9A 5AGYA 3TUEA 4IN0A 1I5GA 2DMLA 4PURA 3L9VA 2REMA 2B5YA 4PGTA 2GQLA 2IMIA 1SL0B 3KTLA 2VCQA 3CBUA 4E8EA 2A2PA 3HZ4A 1WE0A 3GX8A 1OE8A 2GTUA 3F4RA 1HQOA 3GH6A 3MWHA 4K1FA 3TKQA 4PQ1A 1O6JA 2OBIA 2FA8A 5G30A 3UAPA 1ACVA 2CX4A 2FWEA 1W89A 4G0IA 3QCPA 1Z5YE 3PPUA 5CRGA 6GSXA 5B6MA 3GRXA 1MD4A 2IL3A 3ZIJA 1H75A 1PD21 2K8VA 3TOUA 1T1VA 1S3RA 2V1MA 2WULA 2PVQA 2HT9A 3FY7A 2HSYA 3A2XA 3VI5A 2GT5A 3UVTA 1XWKA 3FZ9A 3UMAA 4K7IA 3US3A 3GTUA 4ILFA 1FOHA 1QK8A 1ABAA 3LYKA 5ECKB 3BD2A 1SYXA 1SENA 3UVHA 2ES7A 3FHKA 4CY8A 4MP4A 4Q5QA 5H5RA 1BAYA 2L59A 3LFLA 3M3MA 2ZNMA 3O3TA 1XW6A 4ISDA 5IOXA 3EINA 3TJFA 4L5LA 3ZVJD 2YZUA 2YV7A 5BRTA 2YWNA 1KBNA 3C7MA 2HXKA 2RLIA 3F3QA 1ZL9A 3ERFA 2KP2A 3GA4A 1XWCA 3LYPA 2CA8A 3A2WA 3NOFA 1ZYPA 1S3DA 3GKNA 3FR9A 2ON5A 2B7KA 2VM1A 1B9YC 1R7HA 4AGSA 3ED3A 22GSA 4V2LA 2JZTA 3DEXA 3KH7A 4CDOA 4TR1A 5DBQA 3C1RA 2VL2A 1XBSA 2MZCA 1EZKA 4WETA 3CMIA 5LCZA 3M9KA 4ECIA 1DE2A 4IS0A 2H1AA 1ZCPA 4IQ1A 3EPTA 4LL4B 3GIXA 3IR4A 1IYHA 4AF2A 2YN1A 4MCUA 2L5OA 2JZRA 4TR4A 5J4UA 4NXIA 4XS4B 4KDXA 4XHMA 1ILOA 1PX7A 5FT3A 3I6AA 5JCWA 4X0XA 2H0GA 6GSUA 1SYRA 4XCSA 4CY6A 1R26A 4K9ZA 5ELGA 5CAXA 2YPMA 3IDVA 2VL3A 5B6NA 5DAKB 5ECPB 3G9BA 5DALB 1ZYEA 1AQVA 1JLWA 1OKTA 1V9WA 4FQUA 5G5EA 1WRYA 3DRNA 1K0OA 1A2LA 3ME7A 3VPQA 2FCHA 2H0IA 3DXBA 4KDUA 2KOKA 2OE3A 2HFDA 4RQXA 5CREA 1YJ6A 2OE1A 3ZITA 4D73A 4V1Ap 1M2BA 2F3MA 2TIRA 3QFBC 2JSZA 5COHA 2FGXA 3TJJA 3ISOA 4ZIJA 3TKSA 3KH9A 2VD0A 3C73A 2Z9SA 2IIYA 4HS1A 1EP8A 3CRUA 1VF3A 2MYGA 4OCEA 4HQZA 3ZIVA 1LBKA 3HHVA 5D9TA 5IMDA 3MDKA 4CW9A 2GSTA 2YNXA 2M46A 2PPTA 1OAZA 3A5WA 2GT6A 2A4HA 3DIEA 2DJ1A 3IHGA 3TRPA 3EU4A 3VI7A 2G2QA 3Q18A 5DQYA 3DKSA 4OO4A 4NAXA 4TR0A 1K3LA 4ZBDA 3W8JA 3HD5A 1Z7RA 2C3QA 4I2TA 2HRAA 2V6KA 4XS1A 1A2JA 3H93A 5HR2A 4LL1B 2H1BA 2DLXA 3H1NA 3G7IA 4MMMA 5DALA 3VLNA 1MDKA 2ON7A 1G6YA 3ERGA 1HNBA 4QL9A 2VCVA 1TTZA 1YF0A 2MBTA 4BVYB 2X99A 4O92A 2J23A 1GTBA 3UBLA 2J9HA 2I81A 2VL2C 3F0IA 3DD3A 4KNDA 1UC7A 4JEDA 5IPGA 3APSA 3UJ1A 3TCOA 4EIQA 1ZMAA 4XIHA 2FHEA 2FWFA 1O8WA 2LS5A 4N30A 3HCZA 3CYNA 1PN0A 4IELA 2KP1A 4Z2UA 1A8YA 3ZMKA 5ECRB 3TKRA 5E59A 4YKGA 5IM9A 3KM6A 4ZB9A 20GSA 2HSMA 1QFNA 2WFCA 4HZ2A 2VLUA 3GH9A 2C8UA 3CQFA 1EV9A 1QXHA 2CAQA 3QAVA 1NM3A 2M80A 3EYTA 4FH8A 2JSYA 2HSHA 2LV3A 4V2NA 1GSYA 2AV4A 2XC2A 4PUAA 1OC9A 1XPVA 4QQ7A 5KN2A 2XPDA 3J7Yb 4JBBA 2NPBA 1SD9A 1U3AA 3TRXA 2FD3A 5IMCA 4GXZA 3LSZA 4KA0A 4F0BA 3TKSC 3LJRA 2VAFA 2F9SA 3ZFBA 1WWJA 5DJLA 4HEA2 2LSTA 4HJ2A 2FUG2 12GSA 5ABRA 5CYYA 1YEXA 4KCAA 4GCIA 1R5AA 4WR4A 1C72A 1XOBA 1AUCA 1ERUA 3WT1A 5CP1A 2GZYA 3VFIA 3L9UA 5KN1A 2HZEB 3RHBA 3LGCA 4NHZA 1BG5A 1RQMA 4N10A 3IBHA 5HFKA 4K5SA 4X4JA 1GNEA 3BCKA 2L6CA 3RPPA 3KP9A 3O6TA 4O5QA 4WXTA 5D93A 5F06A 2MMAA 2IFQA 5ECHB 3F9UA 1S3AA 4AJ8A 1M9AA 2I1UA 3WGDA 4ZB8A 3RPNA 3D6IA 3LEFA 1EGOA 1GSDA 4MPFA 4K7OA 2H6YA 4TW5A 1GULA 3IA1A 2C3TA 1S3CA 2AYTA 1N2AA 1MDJA 1TK0B 1V2AA 3TGZA 3QFAC 2EC4A 3KGKA 3FZ4A 3CTGA 3TB2A 2YV9A 5AISA 3C1SA 3HJPA 4MF7A 1WMJA 4KW6A 1K0DA 2FWHA 4F03A 5E4WA 1FVJA 3LWAA 1NHOA 5CRHA 1EGRA 3GYKA 4RI6A 1GH2A 1FHEA 2VLVA 4ID0A 2LUSA 3FZAA 4G0LA 2L6DA 4I5QA 4WF4A 1Z6NA 6GSVA 4X1UA 2FNOA 1FOVA 1QQ2A 4WKWA 1SK1A 3KMOA 2G0FA 1AIUA 1EP7A 4G0KA 2OA7A 17GSA 4P3YB 3BBYA 4MNNA 3VURA 4K7NA 3MAKA 2RM5A 3TRQA 1PA3A 4O32A 3HKRA 2DKHA 2N5FA 1A0RP 3TJGA 2XBQA 4ZILA 3BJ5A 4PNFA 6GSTA 1EEJA 4MDCA 1M2AA 3U6VA 3E9JB 4TXOA 4RI7A 2X49A 4DSSB 2LJKA 3UARA 2EIOA 5EPFA 4WBRD 4K5RA 3TDGA 2YJHA 1SL1B 3DVXA 2VIMA 1T00A 5INYA 3EURA 2H0HA 2GZPA 4POKA 1J08A 2K8SA 4HUAA 5JWRB 2ZCTA 4JR4A 1SU9A 3LQ7A 5ECQB 4L0WA 1XZOA 2C0DA 1GUHA 3EMPA 3CSIA 2IJYA 2CZ3A 5ID2A 4Z7XA 1WPIA 1W4VA 1V98A 3APOA 1VRSD 3E3EA 4J2FA 2BTOT 1GSEA 3KP8A 3IHQA 1G6WA 5A5KA 1PKZA 2O8VB 3HJOA 4TVEA 3UIWA 1XWBA 3GX0A 1EOGA 2ALBA 3W6GA 5ECSA 1PMTA 2LQOA 4PX1A 2FY6A 2HYXA 2O89A 3FZ5A 5IO2A 2IMKA 4Z2RA 4HU7A 3J7Yk 5J5NA 4WBJA 1PX6A 1XW9A 3L0HA 4K8MA 1K3OA 1PQNA 2AAWA 5GSTA 3ZYWA 4GQFA 4HJMA 4KGIA 2O87A 5KN0A 4GLTA 3IXRA 3I43A 2B1KA 2QGVA 2VL9A 3BOAA 5L71A 1K0NA 4A5PA 3SWLA 3DGQA 2O7KA 4K6XA 4KUNA 3UOMA 2HRNA 4GSSA 4DSSA 2LNSA 1TI3A 4PQIA 3M8NA 3SBCA 1F9MA 2A2RA 4XS6A 2R0PA 4L0UA 3Q6OA 1BX9A 2PMTA 3D4TA 2B3SA 3RBTA 10GSA 1Z9HA 5J9BA 4POLA 1FW1A 1X9MB 4JZQA 2DJ3A 2A4VA 2PU9C 4IGJA 19GSA 2DJ0A 3FMWA 4H86A 2LJAA 1VF1A 2EIQA 2DIZA 3BCIA 4MZCA 1O7UA 1AXDA 4IHUA 3K8NA 5D9WA 2WJUA 4O5RA 4BA7A 5IQYA 2PERA 4Q5RA 3HA9A 3IRAA 5HR1A 2H1GA 1QUWA 1FB0A 4OCFA 2FLSA 5IMVA 3GL3A 1Q4JA 2CZ2A 3GL5A 2LRTA 2HZFA 1B48A 2LEGA 3LXTA 1V58A 4EE0A 2DJKA 4KF9A 3HZ8A 2AHEA 1JLVA 4JU5A 3KXOA 2ZUPA 3GKMA 1URMA 2GQMA 3ME8A 3FEUA 1F3AA 1AQWA 5IMFA 3KCMA 4TOPA 5KEJA 2OE0A 1X9SB 4KE3A 1Z7PA 4RQRA 3F63A 4XRAA 5GAPD 3EU3A 2IMDA 2XPEA 4BL7B 2YANA 1U88A 3UEMA 1TKDB 1WJKA 1XXUA 3ERWA 3O76A 2EIRA 2RUEA 4ZL9A 1JFUA 4G10A 3WGXA 5DDLA 1AAZA 2GS3A 1E6BA 1TRUA 3GKXA 3L78A 4XS4A 2VCTA 2OBKA 3A3TA 5G31A 2LKUA 3LW9A 1F6MC 2H8LA 2FA4A 2V6OA 5J41A 1JZRA 3FW2A 5D8IA 5CRWA 4WEYA 1OE7A 1YKCA 2C0GA 5DVBA 1RK4A 1SKWB 4QL7A 2GQKA 3C8EA 1OKDA 2L5LA 5JCUA 1OC3A 5DAKA 2P5QA 4MH3A 4G2EA 5LNKe 5CO3A 4ZBAA 1TP9A 4EC0A 2VD1A 5FHIA 4DEJA 5JCGA 2H72A 1M7TA 2V32A 2H71A 3ZMLA 4MZBA 4LA1A 1QMVA 3LORA 1UN2A 5G5FA 3IC8A 5G1KA 4EVMA 1GUMA 3MNGA 5DJMA 4DVCA 3GSTA 1MD3A 1O8XA 3HVXA 4EF0A 1M99A 2TRCP 1PL1A 3NZNA 1TRVA 1X9WB 1O85A 1VF2A 3IAM2 3N9JA 4NWYA 4POBA 2CT6A 2LRCA 1ZYQB 13GSA 4KX4A 3GSSA 3CXGA 3FRCA 4IJ3A 2KLXA 2WZ9A 1Y25A 4DSRA 1ZYNA 3R3EA 1SKRB 2B1LA 3FYGA 1JZDA 1K0AA 5EY6A 2CQ9A 4XTSA 3I69A 3UBKA 5G2ZA 6GSWA 2R0CA 5DCGA 3D22A 3Q19A 4HI7A 2JADA 4LMWA 1GP1A 3GV1A 1ML6A 3IC4A 5A4VA 5CRDA 5F8BA 3CTFA 5H5QA 4ZB6A 4FO5A 4TXVA 2IN3A 2H70A 4MJAA 3HVNA 2AJQB 1GTUA 2H76A 1FG4A 2KHPA 2NDOA 4PTSA 4AJ6A 1GSSA 1ON4A 1TRWA 1Z6MA 3OR5A 3RDWA 3VWXA 1YY7A 2X64A 2IMFA 4HU9A 4BVYA 4KH7A 1M2DA 3LXZA 2C1YA 4YQVA 4WR5A 2E0QA 2JL4A 2PBJA 1VGLA 4KB3A 2PUKC 4K2DA 3Q74A 5ECIB 2NBSA 3EWLA 3N5OA 4BVXB 1SD8A 3M0FA 3TJBA 1JZOA 5D73A 1GSFA 4N11A 4TRXA 4NV5A 1B8XA 3S9FA 1SK0A 2H30A 3VPTA 2HNLA 1NSWA 3HYPA 5GAND 3D0ZA 1G7EA 5JWQB 2GSQA 2YP6A 5IO0A 3APQA 2GLRA 4MJCA 2YOIA 2MBSA 4HQSA 2R5GA 2DC5A 2TRXA 3R2QA 3M9JA 2B7JA 4USSA 1G0TA 4O5UA 3QAWA 2C0FA 1GTAA 4GTUA 5C00A 3QR6A 1KNGA 4HDEA 3HVVA 4L8EA 1B4PA 2K9FA 1SK2A 2PN8A 4KAEA 1V57A 1SKSB 1THOA 1R4WA 9GSSA 3QDNA 2VO4A 4YAVA 4JR6A 1PFOA 4TR3A 5DCHA 2NTOA 1EWXA 3HY2A 3IOSA 4YQMA 1TU8A 1YZXA 3HDCA 2YCDA 4Q5FA 4FYCA 2PVOC 2WGRA 1PL2A 2N5BA 3D21A 3F6FA 2P31A 1FO5A 1NW2A 3PR8A 4K0GA 1TXXA 2DBCA 2HRFA 2YWMA 1OVNA 4ICYA 3ZLPA 1K0CA 1Z3EA 5ECLB 3KEBA 3QMXA 2NVLA 4G9HA 3KIJA 3P7XA 2HZEA 4IQAA 4ECCA 3G7JA 1YF1A 1XWAA 2H6ZA 3TJKA 1EV4A 4I2UA 5HFGA 4GQCA 1XWGA 3GTUB 1DUGA 1H4OA
chains in the Genus database with same CATH topology
3DYRA 1AW9A 3GHAA 5HQPA 1WOUA 1GRXA 1FB6A 4FYBA 2JZSA 1X5DA 2OACA 4MLYA 2VCWA 4IBPA 3IK9A 5ECOB 1HNCA 1U6TA 3TKSE 4MJBA 4JRRA 5IIZA 1PGTA 2WS2A 5IPHA 2DSAA 3QD9A 4MABA 4RUVA 3GNJA 1AQXA 4BPYA 2VLTA 5J9CA 3H8QA 4XRDA 3PH9A 4TR1B 1T4ZA 3EE2A 3PINA 2VOCA 5J3RA 1XVQA 2CV4A 4I97A 4ZXGA 2WDUA 1X5EA 4KSOA 4NV2A 2BMXA 2H19A 3IPZA 1TJDA 1XIYA 3RAZA 3IE3A 2JU5A 1BEDA 1SJZA 2C4JA 4EDZA 1EOHA 1OYJA 4OD7A 1K3YA 1YEPA 4PUFC 1FAAA 1NHYA 4EDYA 2GSSA 7GSSA 5GZZB 5GSSA 2V2GA 5F0GA 5ECMB 1ZZYA 2WRTA 3F4TA 1EEMA 4V1Ag 3ZFLA 1MTCA 4GWRA 2OKAA 3FK8A 1T7PB 1GWCA 3F6DA 1F3BA 3KZQA 3VWUA 5KOXA 2E2MA 5ENUA 4LMVA 2GDRA 4D73B 4ECJA 4F9ZA 4OWYA 2YWOA 5KN3A 2I3YA 2UZ8A 2AB6A 3MIXA 2IMEA 5JWOB 5IMAA 3FR6A 4MJEA 2BJXA 2P5RA 1B9XC 1A2MA 2H74A 1A0FA 2LTKA 3ZTLA 1K0BA 3ZVJA 2CVBA 1YDKA 3F3RA 3M1GA 1CQHA 1PN9A 4OFTA 2HLSA 1DBYA 2PGTA 4EKZA 1BYEA 2R6KA 2GSRA 4GRFA 4IP6A 2MMOA 1ERTA 2XHFA 4FIWA 5KOWA 4IP1A 2H75A 4F82A 1XCCA 1GL8A 2QC7A 4YKFA 5FWGA 1ZGNA 2E2GA 5D96A 5D9XA 1T4YA 4YH2A 5LD0A 1I9DA 3ZZXA 1MDIA 4BWSA 5EL8A 2IWTA 4EL1A 4E8HA 2X8HA 4KCEA 1X5CA 5B8BA 1HNAA 4EO3A 4WF5A 1UVZA 4IKHA 2CAIA 2I4AA 2C0EA 1PKWA 1HD2A 2QA2A 2WCIA 4AJ7A 2B6MA 3DVWA 3CSJA 4OFNA 1N8JA 3QOUA 1QGVA 3GUSA 1E2YA 1GTIA 1GLPA 3D4MA 1TK8B 3CRTA 2YWIA 3KTBA 1T8EB 4GSTA 16GSA 3VK9A 3P90A 3A5IA 3E0UA 3JCML 2D2ZA 1SJ6A 3WGEA 5B8AA 2F51A 2LJRA 1LJRA 4FYUA 2R3XA 4ZBBA 1Y6EA 1XVWA 2QKEA 2RM6A 4ULXA 4N0ZA 2JACA 2HI7A 2X8CA 2R37A 1M9BA 3AY8A 5HR3A 3U5RE 3F8UA 3P8WA 4J57E 3GURA 4V2MA 2K6VA 1OC9B 4OFMA 5ELAA 4IVFA 1A24A 1TW9A 1XFLA 2OADA 2C3NA 1GLQA 1ST9A 4POMA 4OO5A 3KMNA 4IJIA 1GUKA 2LQQA 2H66A 3V1WA 2A2SA 3TKPA 3MSZA 2C80A 4MA9A 3HVSA 4PNGA 2CVDA 2R2JA 5F05A 1USBA 4JE1A 2CX3A 2DMMA 4BL7A 2LRNA 1SJIA 3ZL5A 3WYWA 4MF5A 2E7PA 3RHCA 3D5JA 3NIVA 1VF4A 1OC8A 1DE1A 3EC3A 1PRXA 3FR3A 4ML1A 2XBIA 4NHWA 2M72A 1V40A 4YQUA 1AC1A 1SL2B 5HR0A 1WP0A 2OJLA 1TOFA 1J0FA 2KUCA 3VWWA 18GSA 5IOWA 3KJYA 1GSQA 1JHBA 2IFQB 1R5PA 1JZWA 1KEBA 3P2AA 4ECBA 4ZL7A 3GFKA 2H73A 2F8AA 2B5XA 2GVPA 4GSNA 3WT2A 2I9HA 2N5AA 4PXOA 3GKKA 1F37A 1J9BA 4I6XA 4LLRA 4ZL8A 4DSQA 4F0CA 5G1LA 1K0MA 2FWGA 1U3IA 2V41A 2K18A 4MK3A 1F2EA 4L5OA 2VCZA 3DWVA 5AIVA 3KD0A 2GZZA 1Q98A 1HYUA 1U87A 3F4SA 3HXSA 4TKYA 1XW5A 5IMZA 5AIXA 1ERVA 1IYIA 3H4KA 3IK7A 3GN3A 4K0NA 3W8SA 2O85A 3VWVA 5EVOA 1ERWA 2DKIA 3QAGA 2H6XA 4MPGA 3L9SA 11GSA 5B7CA 1DSBA 1CQGA 3EVIA 1PSQA 4N0VA 3TOTA 1KTEA 1TDIA 3GMFA 4EIPA 2HE3A 6GSSA 4BWQA 3A2VA 1YQ1A 2IPAA 4NMUA 2AUVA 3WD6A 2B5EA 4X43A 1O73A 4O7HA 1T3BA 14GSA 3ZREA 2RUFA 2WB9A 2L4CA 4Q5NA 5A4UA 2QA1A 5DQSA 1M0UA 2HRKA 3L4NA 4TXOB 5ECNB 4MZWA 1G7OA 8GSSA 1WIKA 2GGTA 3IAS2 1B4QA 2R4VA 1BJXA 3PGTA 4I8BA 4MH2A 1MEKA 1TU7A 2PWJA 3QPMA 6GSYA 2R0GA 4KDYA 1TRSA 3DMLA 4OMVA 1O81A 4ML6A 2L4QA 2P0GA 3IV4A 4G19A 3G7YA 2CVKA 4GF0A 4J56E 3H79A 2YZHA 2DJ2A 2MMNA 4HOJA 2RIIA 5ID2B 4CHSA 1X0RA 4EUYA 4KSMA 4HZ4A 5HFIA 3I9V2 2H1DA 1YKAA 2VM2A 4YAPA 4TN8A 1ZOFA 3HJMA 2DIYA 2X8GA 4Z2TA 3EMXA 2MMZA 3CSHA 4BVXA 5D9VA 1RW1A 4NPBA 3LG6A 1XOAA 1TK5B 1A23A 1UA5A 1A8LA 3MYDA 5AN1A 1GNWA 2L57A 2VUPA 2VCXA 1FVKA 1THXA 3C71A 4F2IA 3FKFA 4EXJA 2X4AA 4PQHA 5H5SA 5BMUA 1TI1A 5A4WA 5C04A 1GSUA 2YJ7A 2H01A 4K2XA 1LU4A 2LNTA 4MF6A 5CNWA 4ACSA 2F8FA 2QSIA 2DJJA 1BQ7A 3ZRDA 5F07A 3UL3A 4IW9A 5AGYA 3TUEA 4IN0A 1I5GA 2DMLA 4PURA 3L9VA 2REMA 2B5YA 4PGTA 2GQLA 2IMIA 1SL0B 3KTLA 2VCQA 3CBUA 4E8EA 2A2PA 3HZ4A 1WE0A 3GX8A 1OE8A 2GTUA 3F4RA 1HQOA 3GH6A 3MWHA 4K1FA 3TKQA 4PQ1A 1O6JA 2OBIA 2FA8A 5G30A 3UAPA 1ACVA 2CX4A 2FWEA 1W89A 4G0IA 3QCPA 1Z5YE 3PPUA 5CRGA 6GSXA 5B6MA 3GRXA 1MD4A 2IL3A 3ZIJA 1H75A 1PD21 2K8VA 3TOUA 1T1VA 2V1MA 2WULA 2PVQA 2HT9A 3FY7A 2HSYA 3A2XA 3VI5A 2GT5A 3UVTA 1XWKA 3FZ9A 3UMAA 4K7IA 3US3A 3GTUA 4ILFA 1FOHA 1QK8A 1ABAA 3LYKA 5ECKB 3BD2A 1SYXA 1SENA 3UVHA 2ES7A 3FHKA 4CY8A 4MP4A 4Q5QA 5H5RA 1BAYA 2L59A 3LFLA 3M3MA 2ZNMA 3O3TA 1XW6A 4ISDA 5IOXA 3EINA 3TJFA 4L5LA 3ZVJD 2YZUA 2YV7A 5BRTA 2YWNA 1KBNA 3C7MA 2HXKA 2RLIA 3F3QA 1ZL9A 3ERFA 2KP2A 3GA4A 1XWCA 3LYPA 2CA8A 3A2WA 3NOFA 1ZYPA 1S3DA 3GKNA 3FR9A 2ON5A 2B7KA 2VM1A 1B9YC 1R7HA 4AGSA 3ED3A 22GSA 4V2LA 2JZTA 3DEXA 3KH7A 4CDOA 4TR1A 5DBQA 3C1RA 2VL2A 1XBSA 2MZCA 1EZKA 4WETA 3CMIA 5LCZA 3M9KA 4ECIA 1DE2A 4IS0A 2H1AA 1ZCPA 4IQ1A 3EPTA 4LL4B 3GIXA 3IR4A 1IYHA 4AF2A 2YN1A 4MCUA 2L5OA 2JZRA 4TR4A 5J4UA 4NXIA 4XS4B 4KDXA 4XHMA 1ILOA 1PX7A 5FT3A 3I6AA 5JCWA 4X0XA 2H0GA 6GSUA 1SYRA 4XCSA 4CY6A 1R26A 4K9ZA 5ELGA 5CAXA 2YPMA 3IDVA 2VL3A 5B6NA 5DAKB 5ECPB 3G9BA 5DALB 1ZYEA 1AQVA 1JLWA 1OKTA 1V9WA 4FQUA 5G5EA 1WRYA 3DRNA 1K0OA 1A2LA 3ME7A 3VPQA 2FCHA 2H0IA 3DXBA 4KDUA 2KOKA 2OE3A 2HFDA 4RQXA 5CREA 1YJ6A 2OE1A 3ZITA 4D73A 4V1Ap 1M2BA 2F3MA 2TIRA 3QFBC 2JSZA 5COHA 2FGXA 3TJJA 3ISOA 4ZIJA 3TKSA 3KH9A 2VD0A 3C73A 2Z9SA 2IIYA 4HS1A 1EP8A 3CRUA 1VF3A 2MYGA 4OCEA 4HQZA 3ZIVA 1LBKA 3HHVA 5D9TA 5IMDA 3MDKA 4CW9A 2GSTA 2YNXA 2M46A 2PPTA 1OAZA 3A5WA 2GT6A 2A4HA 3DIEA 2DJ1A 3IHGA 3TRPA 3EU4A 3VI7A 2G2QA 3Q18A 5DQYA 3DKSA 4OO4A 4NAXA 4TR0A 1K3LA 4ZBDA 3W8JA 3HD5A 1Z7RA 2C3QA 4I2TA 2HRAA 2V6KA 4XS1A 1A2JA 3H93A 5HR2A 4LL1B 2H1BA 2DLXA 3H1NA 3G7IA 4MMMA 5DALA 3VLNA 1MDKA 2ON7A 1G6YA 3ERGA 1HNBA 4QL9A 2VCVA 1TTZA 1YF0A 2MBTA 4BVYB 2X99A 4O92A 2J23A 1GTBA 3UBLA 2J9HA 2I81A 2VL2C 3F0IA 3DD3A 4KNDA 1UC7A 4JEDA 5IPGA 3APSA 3UJ1A 3TCOA 4EIQA 1ZMAA 4XIHA 2FHEA 2FWFA 1O8WA 2LS5A 4N30A 3HCZA 3CYNA 1PN0A 4IELA 2KP1A 4Z2UA 1A8YA 3ZMKA 5ECRB 3TKRA 5E59A 4YKGA 5IM9A 3KM6A 4ZB9A 20GSA 2HSMA 1QFNA 2WFCA 4HZ2A 2VLUA 3GH9A 2C8UA 1EV9A 1QXHA 2CAQA 3QAVA 1NM3A 2M80A 3EYTA 4FH8A 2JSYA 2HSHA 2LV3A 4V2NA 1GSYA 2AV4A 2XC2A 4PUAA 1OC9A 1XPVA 4QQ7A 5KN2A 2XPDA 3J7Yb 4JBBA 2NPBA 1SD9A 1U3AA 3TRXA 2FD3A 5IMCA 4GXZA 3LSZA 4KA0A 4F0BA 3TKSC 3LJRA 2VAFA 2F9SA 3ZFBA 1WWJA 5DJLA 4HEA2 2LSTA 4HJ2A 2FUG2 12GSA 5ABRA 5CYYA 1YEXA 4KCAA 4GCIA 1R5AA 4WR4A 1C72A 1XOBA 1AUCA 1ERUA 3WT1A 5CP1A 2GZYA 3VFIA 3L9UA 5KN1A 2HZEB 3RHBA 3LGCA 4NHZA 1BG5A 1RQMA 4N10A 3IBHA 5HFKA 4K5SA 4X4JA 1GNEA 3BCKA 2L6CA 3RPPA 3KP9A 3O6TA 4O5QA 4WXTA 5D93A 5F06A 2MMAA 2IFQA 5ECHB 3F9UA 1S3AA 4AJ8A 1M9AA 2I1UA 3WGDA 4ZB8A 3RPNA 3D6IA 3LEFA 1EGOA 1GSDA 4MPFA 4K7OA 2H6YA 4TW5A 1GULA 3IA1A 2C3TA 1S3CA 2AYTA 1N2AA 1MDJA 1TK0B 1V2AA 3TGZA 3QFAC 2EC4A 3KGKA 3FZ4A 3CTGA 3TB2A 2YV9A 5AISA 3C1SA 3HJPA 4MF7A 1WMJA 4KW6A 1K0DA 2FWHA 4F03A 5E4WA 1FVJA 3LWAA 1NHOA 5CRHA 1EGRA 3GYKA 4RI6A 1GH2A 1FHEA 2VLVA 4ID0A 2LUSA 3FZAA 4G0LA 2L6DA 4I5QA 4WF4A 1Z6NA 6GSVA 4X1UA 2FNOA 1FOVA 1QQ2A 4WKWA 1SK1A 3KMOA 2G0FA 1AIUA 1EP7A 4G0KA 2OA7A 17GSA 4P3YB 3BBYA 4MNNA 3VURA 4K7NA 3MAKA 2RM5A 3TRQA 1PA3A 4O32A 3HKRA 2DKHA 2N5FA 1A0RP 3TJGA 2XBQA 4ZILA 3BJ5A 4PNFA 6GSTA 1EEJA 4MDCA 1M2AA 3U6VA 3E9JB 4TXOA 4RI7A 2X49A 4DSSB 2LJKA 3UARA 2EIOA 5EPFA 4WBRD 4K5RA 3TDGA 2YJHA 1SL1B 3DVXA 2VIMA 1T00A 5INYA 3EURA 2H0HA 2GZPA 4POKA 1J08A 2K8SA 4HUAA 5JWRB 2ZCTA 4JR4A 1SU9A 3LQ7A 5ECQB 4L0WA 1XZOA 2C0DA 1GUHA 3EMPA 3CSIA 2IJYA 2CZ3A 5ID2A 4Z7XA 1WPIA 1W4VA 1V98A 3APOA 1VRSD 3E3EA 4J2FA 2BTOT 1GSEA 3KP8A 3IHQA 1G6WA 5A5KA 1PKZA 2O8VB 3HJOA 4TVEA 3UIWA 1XWBA 3GX0A 1EOGA 2ALBA 3W6GA 5ECSA 1PMTA 2LQOA 4PX1A 2FY6A 2HYXA 2O89A 3FZ5A 5IO2A 2IMKA 4Z2RA 4HU7A 3J7Yk 5J5NA 4WBJA 1PX6A 1XW9A 3L0HA 4K8MA 1K3OA 1PQNA 2AAWA 5GSTA 3ZYWA 4GQFA 4HJMA 4KGIA 2O87A 5KN0A 4GLTA 3IXRA 3I43A 2B1KA 2QGVA 2VL9A 3BOAA 5L71A 1K0NA 4A5PA 3SWLA 3DGQA 2O7KA 4K6XA 4KUNA 3UOMA 2HRNA 4GSSA 4DSSA 2LNSA 1TI3A 4PQIA 3M8NA 3SBCA 1F9MA 2A2RA 4XS6A 2R0PA 4L0UA 3Q6OA 1BX9A 2PMTA 3D4TA 2B3SA 3RBTA 10GSA 1Z9HA 5J9BA 4POLA 1FW1A 1X9MB 4JZQA 2DJ3A 2A4VA 2PU9C 4IGJA 19GSA 2DJ0A 3FMWA 4H86A 2LJAA 1VF1A 2EIQA 2DIZA 3BCIA 4MZCA 1O7UA 1AXDA 4IHUA 3K8NA 5D9WA 2WJUA 4O5RA 4BA7A 5IQYA 2PERA 4Q5RA 3HA9A 3IRAA 5HR1A 2H1GA 1QUWA 1FB0A 4OCFA 2FLSA 5IMVA 3GL3A 1Q4JA 2CZ2A 3GL5A 2LRTA 2HZFA 1B48A 2LEGA 3LXTA 1V58A 4EE0A 2DJKA 4KF9A 3HZ8A 2AHEA 1JLVA 4JU5A 3KXOA 2ZUPA 3GKMA 1URMA 2GQMA 3ME8A 3FEUA 1F3AA 1AQWA 5IMFA 3KCMA 4TOPA 5KEJA 2OE0A 1X9SB 4KE3A 1Z7PA 4RQRA 3F63A 4XRAA 5GAPD 3EU3A 2IMDA 2XPEA 4BL7B 2YANA 1U88A 3UEMA 1TKDB 1WJKA 1XXUA 3ERWA 3O76A 2EIRA 2RUEA 4ZL9A 1JFUA 4G10A 3WGXA 5DDLA 1AAZA 2GS3A 1E6BA 1TRUA 3GKXA 3L78A 4XS4A 2VCTA 2OBKA 3A3TA 5G31A 2LKUA 3LW9A 1F6MC 2H8LA 2FA4A 2V6OA 5J41A 1JZRA 3FW2A 5D8IA 5CRWA 4WEYA 1OE7A 1YKCA 2C0GA 5DVBA 1RK4A 1SKWB 4QL7A 2GQKA 3C8EA 1OKDA 2L5LA 5JCUA 1OC3A 5DAKA 2P5QA 4MH3A 4G2EA 5LNKe 5CO3A 4ZBAA 1TP9A 4EC0A 2VD1A 5FHIA 4DEJA 5JCGA 2H72A 1M7TA 2V32A 2H71A 3ZMLA 4MZBA 4LA1A 1QMVA 3LORA 1UN2A 5G5FA 3IC8A 5G1KA 4EVMA 1GUMA 3MNGA 5DJMA 4DVCA 3GSTA 1MD3A 1O8XA 3HVXA 4EF0A 1M99A 2TRCP 1PL1A 3NZNA 1TRVA 1X9WB 1O85A 1VF2A 3IAM2 3N9JA 4NWYA 4POBA 2CT6A 2LRCA 1ZYQB 13GSA 4KX4A 3GSSA 3CXGA 3FRCA 4IJ3A 2KLXA 2WZ9A 1Y25A 4DSRA 1ZYNA 3R3EA 1SKRB 2B1LA 3FYGA 1JZDA 1K0AA 5EY6A 2CQ9A 4XTSA 3I69A 3UBKA 5G2ZA 6GSWA 2R0CA 5DCGA 3D22A 3Q19A 4HI7A 2JADA 4LMWA 1GP1A 3GV1A 1ML6A 3IC4A 5A4VA 5CRDA 5F8BA 3CTFA 5H5QA 4ZB6A 4FO5A 4TXVA 2IN3A 2H70A 4MJAA 2AJQB 1GTUA 2H76A 1FG4A 2KHPA 2NDOA 4PTSA 4AJ6A 1GSSA 1ON4A 1TRWA 1Z6MA 3OR5A 3RDWA 3VWXA 1YY7A 2X64A 2IMFA 4HU9A 4BVYA 4KH7A 1M2DA 3LXZA 2C1YA 4YQVA 4WR5A 2E0QA 2JL4A 2PBJA 1VGLA 4KB3A 2PUKC 4K2DA 3Q74A 5ECIB 2NBSA 3EWLA 3N5OA 4BVXB 1SD8A 3M0FA 3TJBA 1JZOA 5D73A 1GSFA 4N11A 4TRXA 4NV5A 1B8XA 3S9FA 1SK0A 2H30A 3VPTA 2HNLA 1NSWA 3HYPA 5GAND 3D0ZA 1G7EA 5JWQB 2GSQA 2YP6A 5IO0A 3APQA 2GLRA 4MJCA 2YOIA 2MBSA 4HQSA 2R5GA 2DC5A 2TRXA 3R2QA 3M9JA 2B7JA 4USSA 1G0TA 4O5UA 3QAWA 2C0FA 1GTAA 4GTUA 5C00A 3QR6A 1KNGA 4HDEA 3HVVA 4L8EA 1B4PA 2K9FA 1SK2A 2PN8A 4KAEA 1V57A 1SKSB 1THOA 1R4WA 9GSSA 3QDNA 2VO4A 4YAVA 4JR6A 4TR3A 5DCHA 2NTOA 1EWXA 3HY2A 3IOSA 4YQMA 1TU8A 1YZXA 3HDCA 2YCDA 4Q5FA 4FYCA 2PVOC 2WGRA 1PL2A 2N5BA 3D21A 3F6FA 2P31A 1FO5A 1NW2A 3PR8A 4K0GA 1TXXA 2DBCA 2HRFA 2YWMA 1OVNA 4ICYA 3ZLPA 1K0CA 1Z3EA 5ECLB 3KEBA 3QMXA 2NVLA 4G9HA 3KIJA 3P7XA 2HZEA 4IQAA 4ECCA 3G7JA 1YF1A 1XWAA 2H6ZA 3TJKA 1EV4A 4I2UA 5HFGA 4GQCA 1XWGA 3GTUB 1DUGA 1H4OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DYR A;  1AW9 A;  3GHA A;  5HQP A;  1WOU A;  1GRX A;  1FB6 A;  4FYB A;  2JZS A;  1X5D A;  2OAC A;  4MLY A;  2VCW A;  4IBP A;  3IK9 A;  5ECO B;  1HNC A;  1U6T A;  3TKS E;  4MJB A;  4JRR A;  5IIZ A;  1PGT A;  2WS2 A;  5IPH A;  2DSA A;  3QD9 A;  4MAB A;  4RUV A;  3GNJ A;  1AQX A;  4BPY A;  2VLT A;  5J9C A;  3H8Q A;  4XRD A;  3PH9 A;  4TR1 B;  1T4Z A;  3EE2 A;  3PIN A;  2VOC A;  5J3R A;  1XVQ A;  2CV4 A;  4I97 A;  4ZXG A;  2WDU A;  1X5E A;  4KSO A;  4NV2 A;  2BMX A;  2H19 A;  3IPZ A;  1TJD A;  1XIY A;  3RAZ A;  3IE3 A;  2JU5 A;  1BED A;  1SJZ A;  2C4J A;  4EDZ A;  1EOH A;  1OYJ A;  4OD7 A;  1K3Y A;  1YEP A;  4PUF C;  1FAA A;  1NHY A;  4EDY A;  2GSS A;  7GSS A;  5GZZ B;  5GSS A;  2V2G A;  5F0G A;  5ECM B;  1ZZY A;  2WRT A;  3F4T A;  1EEM A;  4V1A g;  3ZFL A;  1MTC A;  4GWR A;  2OKA A;  3FK8 A;  1T7P B;  1GWC A;  3F6D A;  1F3B A;  3KZQ A;  3VWU A;  2E2M A;  5ENU A;  4LMV A;  2GDR A;  4D73 B;  4ECJ A;  4F9Z A;  4OWY A;  2YWO A;  5KN3 A;  2I3Y A;  2AB6 A;  2IME A;  5JWO B;  5IMA A;  3FR6 A;  4MJE A;  2BJX A;  2P5R A;  1B9X C;  1A2M A;  2H74 A;  1A0F A;  2LTK A;  3ZTL A;  1K0B A;  3ZVJ A;  2CVB A;  1YDK A;  3F3R A;  3M1G A;  1CQH A;  1PN9 A;  4OFT A;  2HLS A;  1DBY A;  2PGT A;  4EKZ A;  1BYE A;  2R6K A;  2GSR A;  4GRF A;  4IP6 A;  2MMO A;  1ERT A;  2XHF A;  4FIW A;  4IP1 A;  2H75 A;  4F82 A;  1XCC A;  1GL8 A;  2QC7 A;  5FWG A;  1ZGN A;  2E2G A;  5D96 A;  5D9X A;  1T4Y A;  4YH2 A;  5LD0 A;  1I9D A;  3ZZX A;  1MDI A;  4BWS A;  5EL8 A;  2IWT A;  4EL1 A;  4E8H A;  2X8H A;  4KCE A;  1X5C A;  5B8B A;  1HNA A;  4EO3 A;  4WF5 A;  1UVZ A;  4IKH A;  2CAI A;  2I4A A;  2C0E A;  1PKW A;  1HD2 A;  2WCI A;  4AJ7 A;  2B6M A;  3DVW A;  3CSJ A;  4OFN A;  1N8J A;  3QOU A;  1QGV A;  3GUS A;  1E2Y A;  1GTI A;  1GLP A;  3D4M A;  1TK8 B;  3CRT A;  2YWI A;  3KTB A;  1T8E B;  4GST A;  16GS A;  3VK9 A;  3P90 A;  3E0U A;  3JCM L;  2D2Z A;  1SJ6 A;  3WGE A;  5B8A A;  2F51 A;  2LJR A;  1LJR A;  4FYU A;  2R3X A;  4ZBB A;  1Y6E A;  1XVW A;  2QKE A;  2RM6 A;  4ULX A;  4N0Z A;  2JAC A;  2HI7 A;  2X8C A;  2R37 A;  1M9B A;  3AY8 A;  5HR3 A;  3U5R E;  3F8U A;  3P8W A;  4J57 E;  3GUR A;  4V2M A;  2K6V A;  1OC9 B;  4OFM A;  5ELA A;  4IVF A;  1A24 A;  1TW9 A;  1XFL A;  2OAD A;  2C3N A;  1GLQ A;  1ST9 A;  4POM A;  4OO5 A;  3KMN A;  4IJI A;  1GUK A;  2LQQ A;  2H66 A;  3V1W A;  2A2S A;  3TKP A;  3MSZ A;  2C80 A;  4MA9 A;  3HVS A;  4PNG A;  2CVD A;  2R2J A;  5F05 A;  1USB A;  4JE1 A;  2CX3 A;  2DMM A;  4BL7 A;  2LRN A;  1SJI A;  3ZL5 A;  3WYW A;  4MF5 A;  2E7P A;  3RHC A;  3D5J A;  3NIV A;  1VF4 A;  1OC8 A;  1DE1 A;  3EC3 A;  1PRX A;  3FR3 A;  4ML1 A;  2XBI A;  4NHW A;  2M72 A;  1V40 A;  4YQU A;  1AC1 A;  1SL2 B;  5HR0 A;  1WP0 A;  2OJL A;  1TOF A;  1J0F A;  2KUC A;  3VWW A;  18GS A;  5IOW A;  3KJY A;  1GSQ A;  1JHB A;  2IFQ B;  1R5P A;  1JZW A;  1KEB A;  3P2A A;  4ECB A;  4ZL7 A;  3GFK A;  2H73 A;  2F8A A;  2B5X A;  2GVP A;  4GSN A;  3WT2 A;  2I9H A;  2N5A A;  4PXO A;  3GKK A;  1F37 A;  1J9B A;  4I6X A;  4LLR A;  4ZL8 A;  4DSQ A;  4F0C A;  5G1L A;  1K0M A;  2FWG A;  1U3I A;  2V41 A;  2K18 A;  4MK3 A;  1F2E A;  4L5O A;  2VCZ A;  3DWV A;  5AIV A;  3KD0 A;  2GZZ A;  1Q98 A;  1HYU A;  1U87 A;  3F4S A;  3HXS A;  4TKY A;  1XW5 A;  5IMZ A;  5AIX A;  1ERV A;  1IYI A;  3H4K A;  3IK7 A;  3GN3 A;  4K0N A;  3W8S A;  2O85 A;  3VWV A;  5EVO A;  1ERW A;  4MPG A;  3QAG A;  2H6X A;  3L9S A;  11GS A;  5B7C A;  1DSB A;  1CQG A;  3EVI A;  1PSQ A;  4N0V A;  3TOT A;  1KTE A;  1TDI A;  3GMF A;  2HE3 A;  6GSS A;  4BWQ A;  3A2V A;  1YQ1 A;  2IPA A;  4NMU A;  2AUV A;  3WD6 A;  2B5E A;  4X43 A;  1O73 A;  4O7H A;  1T3B A;  14GS A;  3ZRE A;  2RUF A;  2WB9 A;  2L4C A;  4Q5N A;  5A4U A;  5DQS A;  1M0U A;  3L4N A;  4TXO B;  5ECN B;  4MZW A;  1G7O A;  8GSS A;  1WIK A;  2GGT A;  3IAS 2;  1B4Q A;  2R4V A;  1BJX A;  3PGT A;  4I8B A;  4MH2 A;  1MEK A;  1TU7 A;  2PWJ A;  3QPM A;  6GSY A;  4KDY A;  1TRS A;  3DML A;  4OMV A;  1O81 A;  4ML6 A;  2L4Q A;  2P0G A;  3IV4 A;  4G19 A;  3G7Y A;  2CVK A;  4GF0 A;  4J56 E;  3H79 A;  2YZH A;  2DJ2 A;  2MMN A;  4HOJ A;  2RII A;  5ID2 B;  4CHS A;  1X0R A;  4EUY A;  4KSM A;  4HZ4 A;  5HFI A;  3I9V 2;  2H1D A;  1YKA A;  2VM2 A;  4YAP A;  4TN8 A;  1ZOF A;  3HJM A;  2DIY A;  2X8G A;  3EMX A;  2MMZ A;  3CSH A;  4BVX A;  5D9V A;  1RW1 A;  4NPB A;  3LG6 A;  1XOA A;  1TK5 B;  1A23 A;  1UA5 A;  1A8L A;  5AN1 A;  1GNW A;  2L57 A;  2VUP A;  2VCX A;  1FVK A;  1THX A;  3C71 A;  4F2I A;  3FKF A;  4EXJ A;  4PQH A;  5H5S A;  1TI1 A;  5A4W A;  5C04 A;  1GSU A;  2YJ7 A;  2H01 A;  1LU4 A;  2LNT A;  4MF6 A;  5CNW A;  4ACS A;  2F8F A;  2QSI A;  2DJJ A;  1BQ7 A;  3ZRD A;  5F07 A;  3UL3 A;  4IW9 A;  5AGY A;  3TUE A;  4IN0 A;  1I5G A;  2DML A;  4PUR A;  3L9V A;  2REM A;  2B5Y A;  4PGT A;  2GQL A;  2IMI A;  1SL0 B;  3KTL A;  2VCQ A;  3CBU A;  4E8E A;  3HZ4 A;  1WE0 A;  3GX8 A;  1OE8 A;  2GTU A;  3F4R A;  1HQO A;  3GH6 A;  3MWH A;  4K1F A;  3TKQ A;  4PQ1 A;  1O6J A;  2OBI A;  2FA8 A;  5G30 A;  3UAP A;  1ACV A;  2CX4 A;  2FWE A;  1W89 A;  3QCP A;  1Z5Y E;  5CRG A;  6GSX A;  5B6M A;  3GRX A;  1MD4 A;  2IL3 A;  3ZIJ A;  1H75 A;  1PD2 1;  2K8V A;  3TOU A;  1T1V A;  2V1M A;  2WUL A;  2PVQ A;  2HT9 A;  3FY7 A;  2HSY A;  3A2X A;  3VI5 A;  2GT5 A;  3UVT A;  1XWK A;  3FZ9 A;  3UMA A;  4K7I A;  3US3 A;  3GTU A;  4ILF A;  1QK8 A;  3LYK A;  1ABA A;  5ECK B;  3BD2 A;  1SYX A;  1SEN A;  3UVH A;  2ES7 A;  3FHK A;  4MP4 A;  4Q5Q A;  5H5R A;  1BAY A;  2L59 A;  3LFL A;  3M3M A;  2ZNM A;  3O3T A;  1XW6 A;  4ISD A;  5IOX A;  3EIN A;  3TJF A;  4L5L A;  3ZVJ D;  2YZU A;  2YV7 A;  2YWN A;  1KBN A;  3C7M A;  2HXK A;  2RLI A;  3F3Q A;  1ZL9 A;  3ERF A;  2KP2 A;  3GA4 A;  1XWC A;  3LYP A;  2CA8 A;  3A2W A;  3NOF A;  1S3D A;  3GKN A;  3FR9 A;  2ON5 A;  2B7K A;  2VM1 A;  1B9Y C;  1R7H A;  4AGS A;  3ED3 A;  22GS A;  4V2L A;  2JZT A;  3DEX A;  3KH7 A;  4CDO A;  4TR1 A;  5DBQ A;  3C1R A;  2VL2 A;  1XBS A;  2MZC A;  1EZK A;  4WET A;  3CMI A;  5LCZ A;  3M9K A;  4ECI A;  1DE2 A;  4IS0 A;  2H1A A;  1ZCP A;  4IQ1 A;  4LL4 B;  3GIX A;  3IR4 A;  1IYH A;  4AF2 A;  2YN1 A;  4MCU A;  2L5O A;  2JZR A;  4TR4 A;  5J4U A;  4NXI A;  4XS4 B;  4KDX A;  4XHM A;  1ILO A;  1PX7 A;  5FT3 A;  3I6A A;  5JCW A;  4X0X A;  2H0G A;  6GSU A;  1SYR A;  4XCS A;  1R26 A;  4K9Z A;  5ELG A;  5CAX A;  2YPM A;  3IDV A;  2VL3 A;  5B6N A;  5DAK B;  5ECP B;  3G9B A;  5DAL B;  1ZYE A;  1AQV A;  1JLW A;  1OKT A;  1V9W A;  5G5E A;  1WRY A;  3DRN A;  1K0O A;  1A2L A;  3ME7 A;  3VPQ A;  2FCH A;  2H0I A;  3DXB A;  4KDU A;  2KOK A;  2OE3 A;  2HFD A;  4RQX A;  5CRE A;  1YJ6 A;  2OE1 A;  3ZIT A;  4D73 A;  4V1A p;  1M2B A;  2F3M A;  2TIR A;  3QFB C;  2JSZ A;  5COH A;  2FGX A;  3TJJ A;  3ISO A;  4ZIJ A;  3TKS A;  3KH9 A;  2VD0 A;  3C73 A;  2Z9S A;  2IIY A;  4HS1 A;  1EP8 A;  3CRU A;  1VF3 A;  2MYG A;  4OCE A;  4HQZ A;  3ZIV A;  1LBK A;  3HHV A;  5D9T A;  5IMD A;  3MDK A;  4CW9 A;  2GST A;  2YNX A;  2M46 A;  2PPT A;  1OAZ A;  3A5W A;  2GT6 A;  3DIE A;  2DJ1 A;  3TRP A;  3EU4 A;  3VI7 A;  2G2Q A;  3Q18 A;  5DQY A;  3DKS A;  4OO4 A;  4NAX A;  4TR0 A;  1K3L A;  4ZBD A;  3W8J A;  3HD5 A;  1Z7R A;  2C3Q A;  4I2T A;  2V6K A;  4XS1 A;  1A2J A;  3H93 A;  5HR2 A;  4LL1 B;  2H1B A;  2DLX A;  3H1N A;  3G7I A;  4MMM A;  5DAL A;  3VLN A;  1MDK A;  2ON7 A;  1G6Y A;  3ERG A;  1HNB A;  4QL9 A;  2VCV A;  1TTZ A;  1YF0 A;  2MBT A;  2X99 A;  4O92 A;  2J23 A;  1GTB A;  3UBL A;  2J9H A;  2I81 A;  2VL2 C;  3F0I A;  3DD3 A;  4KND A;  1UC7 A;  4JED A;  5IPG A;  3APS A;  3UJ1 A;  3TCO A;  1ZMA A;  4XIH A;  2FHE A;  2FWF A;  1O8W A;  2LS5 A;  4N30 A;  3HCZ A;  3CYN A;  4IEL A;  2KP1 A;  1A8Y A;  3ZMK A;  5ECR B;  3TKR A;  5E59 A;  5IM9 A;  3KM6 A;  4ZB9 A;  20GS A;  1QFN A;  2WFC A;  4HZ2 A;  2VLU A;  3GH9 A;  2C8U A;  1EV9 A;  1QXH A;  2CAQ A;  3QAV A;  1NM3 A;  2M80 A;  3EYT A;  4FH8 A;  2JSY A;  2HSH A;  2LV3 A;  4V2N A;  1GSY A;  2AV4 A;  2XC2 A;  4PUA A;  1OC9 A;  1XPV A;  4QQ7 A;  5KN2 A;  2XPD A;  3J7Y b;  4JBB A;  2NPB A;  1SD9 A;  1U3A A;  3TRX A;  2FD3 A;  5IMC A;  4GXZ A;  3LSZ A;  4KA0 A;  4F0B A;  3TKS C;  3LJR A;  2VAF A;  2F9S A;  3ZFB A;  1WWJ A;  5DJL A;  4HEA 2;  2LST A;  4HJ2 A;  2FUG 2;  12GS A;  5ABR A;  5CYY A;  1YEX A;  4KCA A;  4GCI A;  1R5A A;  4WR4 A;  1C72 A;  1XOB A;  1AUC A;  1ERU A;  3WT1 A;  5CP1 A;  2GZY A;  3VFI A;  3L9U A;  5KN1 A;  2HZE B;  3RHB A;  3LGC A;  4NHZ A;  1BG5 A;  1RQM A;  4N10 A;  3IBH A;  5HFK A;  1GNE A;  3BCK A;  2L6C A;  3RPP A;  3KP9 A;  3O6T A;  4WXT A;  5D93 A;  5F06 A;  2MMA A;  2IFQ A;  5ECH B;  3F9U A;  1S3A A;  4AJ8 A;  1M9A A;  2I1U A;  3WGD A;  4ZB8 A;  3RPN A;  3D6I A;  3LEF A;  1EGO A;  1GSD A;  4MPF A;  4K7O A;  2H6Y A;  4TW5 A;  1GUL A;  3IA1 A;  2C3T A;  1S3C A;  2AYT A;  1N2A A;  1MDJ A;  1TK0 B;  1V2A A;  3TGZ A;  3QFA C;  2EC4 A;  3KGK A;  3FZ4 A;  3CTG A;  3TB2 A;  2YV9 A;  5AIS A;  3C1S A;  3HJP A;  4MF7 A;  1WMJ A;  4KW6 A;  1K0D A;  2FWH A;  4F03 A;  5E4W A;  1FVJ A;  3LWA A;  1NHO A;  5CRH A;  1EGR A;  3GYK A;  4RI6 A;  1GH2 A;  1FHE A;  2VLV A;  4ID0 A;  2LUS A;  3FZA A;  2L6D A;  4I5Q A;  4WF4 A;  1Z6N A;  6GSV A;  4X1U A;  2FNO A;  1FOV A;  1QQ2 A;  4WKW A;  1SK1 A;  3KMO A;  2G0F A;  1AIU A;  1EP7 A;  2OA7 A;  17GS A;  4P3Y B;  3BBY A;  3VUR A;  4K7N A;  3MAK A;  2RM5 A;  3TRQ A;  1PA3 A;  4O32 A;  3HKR A;  2N5F A;  1A0R P;  3TJG A;  2XBQ A;  4ZIL A;  3BJ5 A;  4PNF A;  6GST A;  1EEJ A;  4MDC A;  1M2A A;  3U6V A;  3E9J B;  4TXO A;  4RI7 A;  4DSS B;  2LJK A;  3UAR A;  2EIO A;  5EPF A;  4WBR D;  3TDG A;  2YJH A;  1SL1 B;  3DVX A;  2VIM A;  1T00 A;  5INY A;  3EUR A;  2H0H A;  2GZP A;  4POK A;  1J08 A;  2K8S A;  4HUA A;  5JWR B;  2ZCT A;  4JR4 A;  1SU9 A;  3LQ7 A;  5ECQ B;  4L0W A;  1XZO A;  2C0D A;  1GUH A;  3EMP A;  3CSI A;  2IJY A;  2CZ3 A;  5ID2 A;  4Z7X A;  1WPI A;  1W4V A;  1V98 A;  3APO A;  1VRS D;  3E3E A;  4J2F A;  2BTO T;  1GSE A;  3KP8 A;  3IHQ A;  1G6W A;  5A5K A;  1PKZ A;  2O8V B;  3HJO A;  4TVE A;  3UIW A;  1XWB A;  3GX0 A;  1EOG A;  2ALB A;  3W6G A;  5ECS A;  1PMT A;  2LQO A;  4PX1 A;  2FY6 A;  2HYX A;  2O89 A;  3FZ5 A;  5IO2 A;  2IMK A;  4HU7 A;  3J7Y k;  5J5N A;  4WBJ A;  1PX6 A;  1XW9 A;  3L0H A;  4K8M A;  1K3O A;  1PQN A;  2AAW A;  5GST A;  3ZYW A;  4GQF A;  4HJM A;  4KGI A;  2O87 A;  5KN0 A;  4GLT A;  3IXR A;  3I43 A;  2B1K A;  2QGV A;  2VL9 A;  3BOA A;  5L71 A;  1K0N A;  3SWL A;  3DGQ A;  2O7K A;  4K6X A;  4KUN A;  3UOM A;  2HRN A;  4GSS A;  4DSS A;  2LNS A;  1TI3 A;  4PQI A;  3M8N A;  3SBC A;  1F9M A;  2A2R A;  4XS6 A;  4L0U A;  3Q6O A;  1BX9 A;  2PMT A;  3D4T A;  2B3S A;  3RBT A;  10GS A;  1Z9H A;  5J9B A;  4POL A;  1FW1 A;  1X9M B;  4JZQ A;  2DJ3 A;  2A4V A;  2PU9 C;  4IGJ A;  19GS A;  2DJ0 A;  4H86 A;  2LJA A;  1VF1 A;  2EIQ A;  2DIZ A;  3BCI A;  4MZC A;  1O7U A;  1AXD A;  4IHU A;  3K8N A;  5D9W A;  2WJU A;  4O5R A;  4BA7 A;  5IQY A;  2PER A;  4Q5R A;  3HA9 A;  3IRA A;  5HR1 A;  2H1G A;  1QUW A;  1FB0 A;  4OCF A;  2FLS A;  5IMV A;  3GL3 A;  1Q4J A;  2CZ2 A;  3GL5 A;  2LRT A;  2HZF A;  1B48 A;  2LEG A;  3LXT A;  1V58 A;  4EE0 A;  2DJK A;  3HZ8 A;  2AHE A;  1JLV A;  4JU5 A;  3KXO A;  2ZUP A;  3GKM A;  1URM A;  2GQM A;  3ME8 A;  3FEU A;  1F3A A;  1AQW A;  5IMF A;  3KCM A;  4TOP A;  5KEJ A;  2OE0 A;  1X9S B;  4KE3 A;  1Z7P A;  4RQR A;  3F63 A;  4XRA A;  5GAP D;  3EU3 A;  2IMD A;  2XPE A;  2YAN A;  1U88 A;  3UEM A;  1TKD B;  1WJK A;  1XXU A;  3ERW A;  3O76 A;  2EIR A;  2RUE A;  4ZL9 A;  1JFU A;  4G10 A;  3WGX A;  5DDL A;  1AAZ A;  2GS3 A;  1E6B A;  1TRU A;  3GKX A;  3L78 A;  4XS4 A;  2VCT A;  2OBK A;  3A3T A;  5G31 A;  2LKU A;  1F6M C;  2H8L A;  2FA4 A;  2V6O A;  5J41 A;  1JZR A;  3FW2 A;  5D8I A;  5CRW A;  4WEY A;  1OE7 A;  1YKC A;  2C0G A;  5DVB A;  1RK4 A;  1SKW B;  4QL7 A;  2GQK A;  3C8E A;  1OKD A;  2L5L A;  5JCU A;  1OC3 A;  5DAK A;  2P5Q A;  4MH3 A;  4G2E A;  5LNK e;  5CO3 A;  4ZBA A;  1TP9 A;  4EC0 A;  2VD1 A;  5FHI A;  4DEJ A;  5JCG A;  2H72 A;  1M7T A;  2V32 A;  2H71 A;  3ZML A;  4MZB A;  4LA1 A;  1QMV A;  3LOR A;  1UN2 A;  5G5F A;  5G1K A;  4EVM A;  1GUM A;  3MNG A;  5DJM A;  4DVC A;  3GST A;  1MD3 A;  1O8X A;  3HVX A;  4EF0 A;  1M99 A;  2TRC P;  1PL1 A;  3NZN A;  1TRV A;  1X9W B;  1O85 A;  1VF2 A;  3IAM 2;  3N9J A;  4NWY A;  4POB A;  2CT6 A;  2LRC A;  1ZYQ B;  13GS A;  4KX4 A;  3GSS A;  3CXG A;  3FRC A;  4IJ3 A;  2KLX A;  2WZ9 A;  1Y25 A;  4DSR A;  1SKR B;  2B1L A;  3FYG A;  1JZD A;  1K0A A;  5EY6 A;  2CQ9 A;  4XTS A;  3I69 A;  3UBK A;  5G2Z A;  6GSW A;  5DCG A;  3D22 A;  3Q19 A;  4HI7 A;  2JAD A;  4LMW A;  1GP1 A;  3GV1 A;  1ML6 A;  3IC4 A;  5A4V A;  5CRD A;  5F8B A;  3CTF A;  5H5Q A;  4ZB6 A;  4FO5 A;  4TXV A;  2IN3 A;  2H70 A;  4MJA A;  2AJQ B;  1GTU A;  2H76 A;  1FG4 A;  2KHP A;  2NDO A;  4AJ6 A;  1GSS A;  1ON4 A;  1TRW A;  1Z6M A;  3OR5 A;  3RDW A;  3VWX A;  1YY7 A;  2X64 A;  2IMF A;  4HU9 A;  4BVY A;  4KH7 A;  1M2D A;  3LXZ A;  2C1Y A;  4YQV A;  4WR5 A;  2E0Q A;  2JL4 A;  2PBJ A;  1VGL A;  4KB3 A;  2PUK C;  4K2D A;  3Q74 A;  5ECI B;  2NBS A;  3EWL A;  3N5O A;  1SD8 A;  3M0F A;  3TJB A;  1JZO A;  5D73 A;  1GSF A;  4N11 A;  4TRX A;  4NV5 A;  1B8X A;  3S9F A;  1SK0 A;  2H30 A;  3VPT A;  2HNL A;  1NSW A;  3HYP A;  5GAN D;  3D0Z A;  1G7E A;  5JWQ B;  2GSQ A;  2YP6 A;  5IO0 A;  3APQ A;  2GLR A;  4MJC A;  2YOI A;  2MBS A;  4HQS A;  2R5G A;  2DC5 A;  2TRX A;  3R2Q A;  3M9J A;  2B7J A;  1G0T A;  3QAW A;  2C0F A;  1GTA A;  4GTU A;  5C00 A;  3QR6 A;  1KNG A;  4HDE A;  3HVV A;  4L8E A;  1B4P A;  2K9F A;  1SK2 A;  2PN8 A;  4KAE A;  1V57 A;  1SKS B;  1THO A;  1R4W A;  9GSS A;  3QDN A;  2VO4 A;  4YAV A;  4JR6 A;  4TR3 A;  5DCH A;  2NTO A;  1EWX A;  3HY2 A;  3IOS A;  4YQM A;  1TU8 A;  1YZX A;  3HDC A;  2YCD A;  4Q5F A;  4FYC A;  2PVO C;  2WGR A;  1PL2 A;  2N5B A;  3D21 A;  3F6F A;  2P31 A;  1FO5 A;  1NW2 A;  3PR8 A;  4K0G A;  1TXX A;  2DBC A;  2HRF A;  2YWM A;  1OVN A;  3ZLP A;  1K0C A;  1Z3E A;  5ECL B;  3KEB A;  3QMX A;  2NVL A;  4G9H A;  3KIJ A;  3P7X A;  2HZE A;  4IQA A;  4ECC A;  3G7J A;  1YF1 A;  1XWA A;  2H6Z A;  3TJK A;  1EV4 A;  4I2U A;  5HFG A;  4GQC A;  1XWG A;  3GTU B;  1DUG A;  1H4O A; 
#chains in the Genus database with same CATH topology
 3DYR A;  1AW9 A;  3GHA A;  5HQP A;  1WOU A;  1GRX A;  1FB6 A;  4FYB A;  2JZS A;  1X5D A;  2OAC A;  4MLY A;  2VCW A;  4IBP A;  3IK9 A;  5ECO B;  1HNC A;  1U6T A;  3TKS E;  4MJB A;  4JRR A;  5IIZ A;  1PGT A;  2WS2 A;  5IPH A;  2DSA A;  3QD9 A;  4MAB A;  4RUV A;  3GNJ A;  1AQX A;  4BPY A;  2VLT A;  5J9C A;  3H8Q A;  4XRD A;  3PH9 A;  4TR1 B;  1T4Z A;  3EE2 A;  3PIN A;  2VOC A;  5J3R A;  1XVQ A;  2CV4 A;  4I97 A;  4ZXG A;  2WDU A;  1X5E A;  4KSO A;  4NV2 A;  2BMX A;  2H19 A;  3IPZ A;  1TJD A;  1XIY A;  3RAZ A;  3IE3 A;  2JU5 A;  1M3J A;  1BED A;  1SJZ A;  2C4J A;  4EDZ A;  1EOH A;  1OYJ A;  4OD7 A;  1K3Y A;  1YEP A;  4PUF C;  1FAA A;  1NHY A;  4EDY A;  2GSS A;  7GSS A;  5GZZ B;  5GSS A;  2V2G A;  5F0G A;  5ECM B;  1ZZY A;  2WRT A;  4BIK A;  3F4T A;  1EEM A;  4V1A g;  3ZFL A;  1MTC A;  4GWR A;  2OKA A;  3FK8 A;  1T7P B;  1GWC A;  3F6D A;  1F3B A;  3KZQ A;  3VWU A;  5KOX A;  2E2M A;  5ENU A;  4LMV A;  2GDR A;  4D73 B;  4ECJ A;  4F9Z A;  4OWY A;  2YWO A;  5KN3 A;  2I3Y A;  2UZ8 A;  2AB6 A;  3MIX A;  2IME A;  5JWO B;  5IMA A;  3FR6 A;  1XG8 A;  4MJE A;  2BJX A;  2P5R A;  1B9X C;  1A2M A;  2H74 A;  1A0F A;  2LTK A;  3ZTL A;  1K0B A;  3ZVJ A;  2CVB A;  1YDK A;  3F3R A;  3M1G A;  1CQH A;  1PN9 A;  4OFT A;  2HLS A;  1DBY A;  2PGT A;  4EKZ A;  1BYE A;  2R6K A;  2GSR A;  4GRF A;  4IP6 A;  2MMO A;  1ERT A;  2XHF A;  4FIW A;  5KOW A;  4IP1 A;  2H75 A;  4F82 A;  1XCC A;  1GL8 A;  2QC7 A;  4YKF A;  5FWG A;  1ZGN A;  2E2G A;  5D96 A;  5D9X A;  1T4Y A;  4YH2 A;  5LD0 A;  1I9D A;  3ZZX A;  1MDI A;  4BWS A;  5EL8 A;  2IWT A;  4EL1 A;  4E8H A;  2X8H A;  4KCE A;  1X5C A;  5B8B A;  1HNA A;  4EO3 A;  4WF5 A;  1UVZ A;  4IKH A;  2CAI A;  2I4A A;  2C0E A;  1PKW A;  1HD2 A;  2QA2 A;  2WCI A;  4AJ7 A;  2B6M A;  3DVW A;  3CSJ A;  4OFN A;  1N8J A;  3QOU A;  1QGV A;  3GUS A;  1E2Y A;  1GTI A;  1GLP A;  3D4M A;  1TK8 B;  3CRT A;  2YWI A;  3KTB A;  1T8E B;  4GST A;  16GS A;  3VK9 A;  3P90 A;  3A5I A;  3E0U A;  3JCM L;  2D2Z A;  1SJ6 A;  3WGE A;  5B8A A;  2F51 A;  2LJR A;  1LJR A;  4FYU A;  2R3X A;  4ZBB A;  1Y6E A;  1XVW A;  2QKE A;  2RM6 A;  4ULX A;  4N0Z A;  2JAC A;  2HI7 A;  2X8C A;  2R37 A;  1M9B A;  3AY8 A;  5HR3 A;  3U5R E;  3F8U A;  3P8W A;  4J57 E;  3GUR A;  4V2M A;  2K6V A;  1OC9 B;  4OFM A;  5ELA A;  4IVF A;  1A24 A;  1TW9 A;  1XFL A;  4HSC X;  2OAD A;  2C3N A;  1GLQ A;  1ST9 A;  4POM A;  4OO5 A;  3KMN A;  4IJI A;  1GUK A;  2LQQ A;  2H66 A;  3V1W A;  2A2S A;  3TKP A;  3MSZ A;  2C80 A;  4MA9 A;  3HVS A;  4PNG A;  2CVD A;  2R2J A;  5F05 A;  1USB A;  4JE1 A;  2CX3 A;  2DMM A;  4BL7 A;  2LRN A;  1SJI A;  3ZL5 A;  3WYW A;  4MF5 A;  2E7P A;  3RHC A;  3D5J A;  3NIV A;  1VF4 A;  1OC8 A;  1DE1 A;  3EC3 A;  1PRX A;  3FR3 A;  4ML1 A;  2XBI A;  4NHW A;  2M72 A;  1V40 A;  4YQU A;  1AC1 A;  1SL2 B;  5HR0 A;  1WP0 A;  2OJL A;  1TOF A;  1J0F A;  2KUC A;  3VWW A;  18GS A;  5IOW A;  3KJY A;  1GSQ A;  1JHB A;  2IFQ B;  1R5P A;  1JZW A;  1KEB A;  3P2A A;  4ECB A;  4ZL7 A;  3GFK A;  2H73 A;  2F8A A;  2B5X A;  2GVP A;  4GSN A;  3WT2 A;  2I9H A;  2N5A A;  4PXO A;  3GKK A;  1F37 A;  1J9B A;  4I6X A;  4LLR A;  4ZL8 A;  1M3I A;  4DSQ A;  4F0C A;  5G1L A;  1K0M A;  2FWG A;  1U3I A;  2V41 A;  2K18 A;  4MK3 A;  1F2E A;  4L5O A;  2VCZ A;  3DWV A;  5AIV A;  3KD0 A;  2GZZ A;  1Q98 A;  1HYU A;  1U87 A;  3F4S A;  3HXS A;  4TKY A;  1XW5 A;  5IMZ A;  5AIX A;  1ERV A;  1IYI A;  3H4K A;  3IK7 A;  3GN3 A;  4K0N A;  3W8S A;  2O85 A;  3VWV A;  5EVO A;  1ERW A;  2DKI A;  3QAG A;  2H6X A;  4MPG A;  3L9S A;  11GS A;  5B7C A;  1DSB A;  1CQG A;  3EVI A;  1PSQ A;  4N0V A;  3TOT A;  1KTE A;  1TDI A;  3GMF A;  4EIP A;  2HE3 A;  6GSS A;  4BWQ A;  3A2V A;  1YQ1 A;  2IPA A;  4NMU A;  2AUV A;  3WD6 A;  2B5E A;  4X43 A;  1O73 A;  4O7H A;  1T3B A;  14GS A;  3ZRE A;  2RUF A;  2WB9 A;  2L4C A;  4Q5N A;  5A4U A;  2QA1 A;  5DQS A;  1M0U A;  2HRK A;  3L4N A;  4TXO B;  5ECN B;  4MZW A;  1G7O A;  8GSS A;  1WIK A;  2GGT A;  3IAS 2;  1B4Q A;  2R4V A;  1BJX A;  3PGT A;  4I8B A;  4MH2 A;  1MEK A;  1TU7 A;  2PWJ A;  3QPM A;  6GSY A;  2R0G A;  4KDY A;  1TRS A;  3DML A;  4OMV A;  1O81 A;  4ML6 A;  2L4Q A;  2P0G A;  3IV4 A;  4G19 A;  3G7Y A;  2CVK A;  4GF0 A;  4J56 E;  3H79 A;  2YZH A;  2DJ2 A;  2MMN A;  4HOJ A;  2RII A;  5ID2 B;  4CHS A;  1X0R A;  4EUY A;  4KSM A;  4HZ4 A;  5HFI A;  3I9V 2;  2H1D A;  1YKA A;  2VM2 A;  4YAP A;  4TN8 A;  1ZOF A;  3HJM A;  2DIY A;  2X8G A;  4Z2T A;  3EMX A;  2MMZ A;  3CSH A;  4BVX A;  5D9V A;  1RW1 A;  4NPB A;  3LG6 A;  1XOA A;  1TK5 B;  1A23 A;  1UA5 A;  1A8L A;  3MYD A;  5AN1 A;  1GNW A;  2L57 A;  2VUP A;  2VCX A;  1FVK A;  1THX A;  3C71 A;  4F2I A;  3FKF A;  4EXJ A;  2X4A A;  4PQH A;  5H5S A;  5BMU A;  1TI1 A;  5A4W A;  5C04 A;  1GSU A;  2YJ7 A;  2H01 A;  4K2X A;  1LU4 A;  2LNT A;  4MF6 A;  5CNW A;  4ACS A;  2F8F A;  2QSI A;  2DJJ A;  1BQ7 A;  3ZRD A;  5F07 A;  3UL3 A;  4IW9 A;  5AGY A;  3TUE A;  4IN0 A;  1I5G A;  2DML A;  4PUR A;  3L9V A;  2REM A;  2B5Y A;  4PGT A;  2GQL A;  2IMI A;  1SL0 B;  3KTL A;  2VCQ A;  3CBU A;  4E8E A;  2A2P A;  3HZ4 A;  1WE0 A;  3GX8 A;  1OE8 A;  2GTU A;  3F4R A;  1HQO A;  3GH6 A;  3MWH A;  4K1F A;  3TKQ A;  4PQ1 A;  1O6J A;  2OBI A;  2FA8 A;  5G30 A;  3UAP A;  1ACV A;  2CX4 A;  2FWE A;  1W89 A;  4G0I A;  3QCP A;  1Z5Y E;  3PPU A;  5CRG A;  6GSX A;  5B6M A;  3GRX A;  1MD4 A;  2IL3 A;  3ZIJ A;  1H75 A;  1PD2 1;  2K8V A;  3TOU A;  1T1V A;  1S3R A;  2V1M A;  2WUL A;  2PVQ A;  2HT9 A;  3FY7 A;  2HSY A;  3A2X A;  3VI5 A;  2GT5 A;  3UVT A;  1XWK A;  3FZ9 A;  3UMA A;  4K7I A;  3US3 A;  3GTU A;  4ILF A;  1FOH A;  1QK8 A;  1ABA A;  3LYK A;  5ECK B;  3BD2 A;  1SYX A;  1SEN A;  3UVH A;  2ES7 A;  3FHK A;  4CY8 A;  4MP4 A;  4Q5Q A;  5H5R A;  1BAY A;  2L59 A;  3LFL A;  3M3M A;  2ZNM A;  3O3T A;  1XW6 A;  4ISD A;  5IOX A;  3EIN A;  3TJF A;  4L5L A;  3ZVJ D;  2YZU A;  2YV7 A;  5BRT A;  2YWN A;  1KBN A;  3C7M A;  2HXK A;  2RLI A;  3F3Q A;  1ZL9 A;  3ERF A;  2KP2 A;  3GA4 A;  1XWC A;  3LYP A;  2CA8 A;  3A2W A;  3NOF A;  1ZYP A;  1S3D A;  3GKN A;  3FR9 A;  2ON5 A;  2B7K A;  2VM1 A;  1B9Y C;  1R7H A;  4AGS A;  3ED3 A;  22GS A;  4V2L A;  2JZT A;  3DEX A;  3KH7 A;  4CDO A;  4TR1 A;  5DBQ A;  3C1R A;  2VL2 A;  1XBS A;  2MZC A;  1EZK A;  4WET A;  3CMI A;  5LCZ A;  3M9K A;  4ECI A;  1DE2 A;  4IS0 A;  2H1A A;  1ZCP A;  4IQ1 A;  3EPT A;  4LL4 B;  3GIX A;  3IR4 A;  1IYH A;  4AF2 A;  2YN1 A;  4MCU A;  2L5O A;  2JZR A;  4TR4 A;  5J4U A;  4NXI A;  4XS4 B;  4KDX A;  4XHM A;  1ILO A;  1PX7 A;  5FT3 A;  3I6A A;  5JCW A;  4X0X A;  2H0G A;  6GSU A;  1SYR A;  4XCS A;  4CY6 A;  1R26 A;  4K9Z A;  5ELG A;  5CAX A;  2YPM A;  3IDV A;  2VL3 A;  5B6N A;  5DAK B;  5ECP B;  3G9B A;  5DAL B;  1ZYE A;  1AQV A;  1JLW A;  1OKT A;  1V9W A;  4FQU A;  5G5E A;  1WRY A;  3DRN A;  1K0O A;  1A2L A;  3ME7 A;  3VPQ A;  2FCH A;  2H0I A;  3DXB A;  4KDU A;  2KOK A;  2OE3 A;  2HFD A;  4RQX A;  5CRE A;  1YJ6 A;  2OE1 A;  3ZIT A;  4D73 A;  4V1A p;  1M2B A;  2F3M A;  2TIR A;  3QFB C;  2JSZ A;  5COH A;  2FGX A;  3TJJ A;  3ISO A;  4ZIJ A;  3TKS A;  3KH9 A;  2VD0 A;  3C73 A;  2Z9S A;  2IIY A;  4HS1 A;  1EP8 A;  3CRU A;  1VF3 A;  2MYG A;  4OCE A;  4HQZ A;  3ZIV A;  1LBK A;  3HHV A;  5D9T A;  5IMD A;  3MDK A;  4CW9 A;  2GST A;  2YNX A;  2M46 A;  2PPT A;  1OAZ A;  3A5W A;  2GT6 A;  2A4H A;  3DIE A;  2DJ1 A;  3IHG A;  3TRP A;  3EU4 A;  3VI7 A;  2G2Q A;  3Q18 A;  5DQY A;  3DKS A;  4OO4 A;  4NAX A;  4TR0 A;  1K3L A;  4ZBD A;  3W8J A;  3HD5 A;  1Z7R A;  2C3Q A;  4I2T A;  2HRA A;  2V6K A;  4XS1 A;  1A2J A;  3H93 A;  5HR2 A;  4LL1 B;  2H1B A;  2DLX A;  3H1N A;  3G7I A;  4MMM A;  5DAL A;  3VLN A;  1MDK A;  2ON7 A;  1G6Y A;  3ERG A;  1HNB A;  4QL9 A;  2VCV A;  1TTZ A;  1YF0 A;  2MBT A;  4BVY B;  2X99 A;  4O92 A;  2J23 A;  1GTB A;  3UBL A;  2J9H A;  2I81 A;  2VL2 C;  3F0I A;  3DD3 A;  4KND A;  1UC7 A;  4JED A;  5IPG A;  3APS A;  3UJ1 A;  3TCO A;  4EIQ A;  1ZMA A;  4XIH A;  2FHE A;  2FWF A;  1O8W A;  2LS5 A;  4N30 A;  3HCZ A;  3CYN A;  1PN0 A;  4IEL A;  2KP1 A;  4Z2U A;  1A8Y A;  3ZMK A;  5ECR B;  3TKR A;  5E59 A;  4YKG A;  5IM9 A;  3KM6 A;  4ZB9 A;  20GS A;  2HSM A;  1QFN A;  2WFC A;  4HZ2 A;  2VLU A;  3GH9 A;  2C8U A;  3CQF A;  1EV9 A;  1QXH A;  2CAQ A;  3QAV A;  1NM3 A;  2M80 A;  3EYT A;  4FH8 A;  2JSY A;  2HSH A;  2LV3 A;  4V2N A;  1GSY A;  2AV4 A;  2XC2 A;  4PUA A;  1OC9 A;  1XPV A;  4QQ7 A;  5KN2 A;  2XPD A;  3J7Y b;  4JBB A;  2NPB A;  1SD9 A;  1U3A A;  3TRX A;  2FD3 A;  5IMC A;  4GXZ A;  3LSZ A;  4KA0 A;  4F0B A;  3TKS C;  3LJR A;  2VAF A;  2F9S A;  3ZFB A;  1WWJ A;  5DJL A;  4HEA 2;  2LST A;  4HJ2 A;  2FUG 2;  12GS A;  5ABR A;  5CYY A;  1YEX A;  4KCA A;  4GCI A;  1R5A A;  4WR4 A;  1C72 A;  1XOB A;  1AUC A;  1ERU A;  3WT1 A;  5CP1 A;  2GZY A;  3VFI A;  3L9U A;  5KN1 A;  2HZE B;  3RHB A;  3LGC A;  4NHZ A;  1BG5 A;  1RQM A;  4N10 A;  3IBH A;  5HFK A;  4K5S A;  4X4J A;  1GNE A;  3BCK A;  2L6C A;  3RPP A;  3KP9 A;  3O6T A;  4O5Q A;  4WXT A;  5D93 A;  5F06 A;  2MMA A;  2IFQ A;  5ECH B;  3F9U A;  1S3A A;  4AJ8 A;  1M9A A;  2I1U A;  3WGD A;  4ZB8 A;  3RPN A;  3D6I A;  3LEF A;  1EGO A;  1GSD A;  4MPF A;  4K7O A;  2H6Y A;  4TW5 A;  1GUL A;  3IA1 A;  2C3T A;  1S3C A;  2AYT A;  1N2A A;  1MDJ A;  1TK0 B;  1V2A A;  3TGZ A;  3QFA C;  2EC4 A;  3KGK A;  3FZ4 A;  3CTG A;  3TB2 A;  2YV9 A;  5AIS A;  3C1S A;  3HJP A;  4MF7 A;  1WMJ A;  4KW6 A;  1K0D A;  2FWH A;  4F03 A;  5E4W A;  1FVJ A;  3LWA A;  1NHO A;  5CRH A;  1EGR A;  3GYK A;  4RI6 A;  1GH2 A;  1FHE A;  2VLV A;  4ID0 A;  2LUS A;  3FZA A;  4G0L A;  2L6D A;  4I5Q A;  4WF4 A;  1Z6N A;  6GSV A;  4X1U A;  2FNO A;  1FOV A;  1QQ2 A;  4WKW A;  1SK1 A;  3KMO A;  2G0F A;  1AIU A;  1EP7 A;  4G0K A;  2OA7 A;  17GS A;  4P3Y B;  3BBY A;  4MNN A;  3VUR A;  4K7N A;  3MAK A;  2RM5 A;  3TRQ A;  1PA3 A;  4O32 A;  3HKR A;  2DKH A;  2N5F A;  1A0R P;  3TJG A;  2XBQ A;  4ZIL A;  3BJ5 A;  4PNF A;  6GST A;  1EEJ A;  4MDC A;  1M2A A;  3U6V A;  3E9J B;  4TXO A;  4RI7 A;  2X49 A;  4DSS B;  2LJK A;  3UAR A;  2EIO A;  5EPF A;  4WBR D;  4K5R A;  3TDG A;  2YJH A;  1SL1 B;  3DVX A;  2VIM A;  1T00 A;  5INY A;  3EUR A;  2H0H A;  2GZP A;  4POK A;  1J08 A;  2K8S A;  4HUA A;  5JWR B;  2ZCT A;  4JR4 A;  1SU9 A;  3LQ7 A;  5ECQ B;  4L0W A;  1XZO A;  2C0D A;  1GUH A;  3EMP A;  3CSI A;  2IJY A;  2CZ3 A;  5ID2 A;  4Z7X A;  1WPI A;  1W4V A;  1V98 A;  3APO A;  1VRS D;  3E3E A;  4J2F A;  2BTO T;  1GSE A;  3KP8 A;  3IHQ A;  1G6W A;  5A5K A;  1PKZ A;  2O8V B;  3HJO A;  4TVE A;  3UIW A;  1XWB A;  3GX0 A;  1EOG A;  2ALB A;  3W6G A;  5ECS A;  1PMT A;  2LQO A;  4PX1 A;  2FY6 A;  2HYX A;  2O89 A;  3FZ5 A;  5IO2 A;  2IMK A;  4Z2R A;  4HU7 A;  3J7Y k;  5J5N A;  4WBJ A;  1PX6 A;  1XW9 A;  3L0H A;  4K8M A;  1K3O A;  1PQN A;  2AAW A;  5GST A;  3ZYW A;  4GQF A;  4HJM A;  4KGI A;  2O87 A;  5KN0 A;  4GLT A;  3IXR A;  3I43 A;  2B1K A;  2QGV A;  2VL9 A;  3BOA A;  5L71 A;  1K0N A;  4A5P A;  3SWL A;  3DGQ A;  2O7K A;  4K6X A;  4KUN A;  3UOM A;  2HRN A;  4GSS A;  4DSS A;  2LNS A;  1TI3 A;  4PQI A;  3M8N A;  3SBC A;  1F9M A;  2A2R A;  4XS6 A;  2R0P A;  4L0U A;  3Q6O A;  1BX9 A;  2PMT A;  3D4T A;  2B3S A;  3RBT A;  10GS A;  1Z9H A;  5J9B A;  4POL A;  1FW1 A;  1X9M B;  4JZQ A;  2DJ3 A;  2A4V A;  2PU9 C;  4IGJ A;  19GS A;  2DJ0 A;  3FMW A;  4H86 A;  2LJA A;  1VF1 A;  2EIQ A;  2DIZ A;  3BCI A;  4MZC A;  1O7U A;  1AXD A;  4IHU A;  3K8N A;  5D9W A;  2WJU A;  4O5R A;  4BA7 A;  5IQY A;  2PER A;  4Q5R A;  3HA9 A;  3IRA A;  5HR1 A;  2H1G A;  1QUW A;  1FB0 A;  4OCF A;  2FLS A;  5IMV A;  3GL3 A;  1Q4J A;  2CZ2 A;  3GL5 A;  2LRT A;  2HZF A;  1B48 A;  2LEG A;  3LXT A;  1V58 A;  4EE0 A;  2DJK A;  4KF9 A;  3HZ8 A;  2AHE A;  1JLV A;  4JU5 A;  3KXO A;  2ZUP A;  3GKM A;  1URM A;  2GQM A;  3ME8 A;  3FEU A;  1F3A A;  1AQW A;  5IMF A;  3KCM A;  4TOP A;  5KEJ A;  2OE0 A;  1X9S B;  4KE3 A;  1Z7P A;  4RQR A;  3F63 A;  4XRA A;  5GAP D;  3EU3 A;  2IMD A;  2XPE A;  4BL7 B;  2YAN A;  1U88 A;  3UEM A;  1TKD B;  1WJK A;  1XXU A;  3ERW A;  3O76 A;  2EIR A;  2RUE A;  4ZL9 A;  1JFU A;  4G10 A;  3WGX A;  5DDL A;  1AAZ A;  2GS3 A;  1E6B A;  1TRU A;  3GKX A;  3L78 A;  4XS4 A;  2VCT A;  2OBK A;  3A3T A;  5G31 A;  2LKU A;  3LW9 A;  1F6M C;  2H8L A;  2FA4 A;  2V6O A;  5J41 A;  1JZR A;  3FW2 A;  5D8I A;  5CRW A;  4WEY A;  1OE7 A;  1YKC A;  2C0G A;  5DVB A;  1RK4 A;  1SKW B;  4QL7 A;  2GQK A;  3C8E A;  1OKD A;  2L5L A;  5JCU A;  1OC3 A;  5DAK A;  2P5Q A;  4MH3 A;  4G2E A;  5LNK e;  5CO3 A;  4ZBA A;  1TP9 A;  4EC0 A;  2VD1 A;  5FHI A;  4DEJ A;  5JCG A;  2H72 A;  1M7T A;  2V32 A;  2H71 A;  3ZML A;  4MZB A;  4LA1 A;  1QMV A;  3LOR A;  1UN2 A;  5G5F A;  3IC8 A;  5G1K A;  4EVM A;  1GUM A;  3MNG A;  5DJM A;  4DVC A;  3GST A;  1MD3 A;  1O8X A;  3HVX A;  4EF0 A;  1M99 A;  2TRC P;  1PL1 A;  3NZN A;  1TRV A;  1X9W B;  1O85 A;  1VF2 A;  3IAM 2;  3N9J A;  4NWY A;  4POB A;  2CT6 A;  2LRC A;  1ZYQ B;  13GS A;  4KX4 A;  3GSS A;  3CXG A;  3FRC A;  4IJ3 A;  2KLX A;  2WZ9 A;  1Y25 A;  4DSR A;  1ZYN A;  3R3E A;  1SKR B;  2B1L A;  3FYG A;  1JZD A;  1K0A A;  5EY6 A;  2CQ9 A;  4XTS A;  3I69 A;  3UBK A;  5G2Z A;  6GSW A;  2R0C A;  5DCG A;  3D22 A;  3Q19 A;  4HI7 A;  2JAD A;  4LMW A;  1GP1 A;  3GV1 A;  1ML6 A;  3IC4 A;  5A4V A;  5CRD A;  5F8B A;  3CTF A;  5H5Q A;  4ZB6 A;  4FO5 A;  4TXV A;  2IN3 A;  2H70 A;  4MJA A;  3HVN A;  2AJQ B;  1GTU A;  2H76 A;  1FG4 A;  2KHP A;  2NDO A;  4PTS A;  4AJ6 A;  1GSS A;  1ON4 A;  1TRW A;  1Z6M A;  3OR5 A;  3RDW A;  3VWX A;  1YY7 A;  2X64 A;  2IMF A;  4HU9 A;  4BVY A;  4KH7 A;  1M2D A;  3LXZ A;  2C1Y A;  4YQV A;  4WR5 A;  2E0Q A;  2JL4 A;  2PBJ A;  1VGL A;  4KB3 A;  2PUK C;  4K2D A;  3Q74 A;  5ECI B;  2NBS A;  3EWL A;  3N5O A;  4BVX B;  1SD8 A;  3M0F A;  3TJB A;  1JZO A;  5D73 A;  1GSF A;  4N11 A;  4TRX A;  4NV5 A;  1B8X A;  3S9F A;  1SK0 A;  2H30 A;  3VPT A;  2HNL A;  1NSW A;  3HYP A;  5GAN D;  3D0Z A;  1G7E A;  5JWQ B;  2GSQ A;  2YP6 A;  5IO0 A;  3APQ A;  2GLR A;  4MJC A;  2YOI A;  2MBS A;  4HQS A;  2R5G A;  2DC5 A;  2TRX A;  3R2Q A;  3M9J A;  2B7J A;  4USS A;  1G0T A;  4O5U A;  3QAW A;  2C0F A;  1GTA A;  4GTU A;  5C00 A;  3QR6 A;  1KNG A;  4HDE A;  3HVV A;  4L8E A;  1B4P A;  2K9F A;  1SK2 A;  2PN8 A;  4KAE A;  1V57 A;  1SKS B;  1THO A;  1R4W A;  9GSS A;  3QDN A;  2VO4 A;  4YAV A;  4JR6 A;  1PFO A;  4TR3 A;  5DCH A;  2NTO A;  1EWX A;  3HY2 A;  3IOS A;  4YQM A;  1TU8 A;  1YZX A;  3HDC A;  2YCD A;  4Q5F A;  4FYC A;  2PVO C;  2WGR A;  1PL2 A;  2N5B A;  3D21 A;  3F6F A;  2P31 A;  1FO5 A;  1NW2 A;  3PR8 A;  4K0G A;  1TXX A;  2DBC A;  2HRF A;  2YWM A;  1OVN A;  4ICY A;  3ZLP A;  1K0C A;  1Z3E A;  5ECL B;  3KEB A;  3QMX A;  2NVL A;  4G9H A;  3KIJ A;  3P7X A;  2HZE A;  4IQA A;  4ECC A;  3G7J A;  1YF1 A;  1XWA A;  2H6Z A;  3TJK A;  1EV4 A;  4I2U A;  5HFG A;  4GQC A;  1XWG A;  3GTU B;  1DUG A;  1H4O A; 
#chains in the Genus database with same CATH homology
 3DYR A;  1AW9 A;  3GHA A;  5HQP A;  1WOU A;  1GRX A;  1FB6 A;  4FYB A;  2JZS A;  1X5D A;  2OAC A;  4MLY A;  2VCW A;  4IBP A;  3IK9 A;  5ECO B;  1HNC A;  1U6T A;  3TKS E;  4MJB A;  4JRR A;  5IIZ A;  1PGT A;  2WS2 A;  5IPH A;  2DSA A;  3QD9 A;  4MAB A;  4RUV A;  3GNJ A;  1AQX A;  4BPY A;  2VLT A;  5J9C A;  3H8Q A;  4XRD A;  3PH9 A;  4TR1 B;  1T4Z A;  3EE2 A;  3PIN A;  2VOC A;  5J3R A;  1XVQ A;  2CV4 A;  4I97 A;  4ZXG A;  2WDU A;  1X5E A;  4KSO A;  4NV2 A;  2BMX A;  2H19 A;  3IPZ A;  1TJD A;  1XIY A;  3RAZ A;  3IE3 A;  2JU5 A;  1BED A;  1SJZ A;  2C4J A;  4EDZ A;  1EOH A;  1OYJ A;  4OD7 A;  1K3Y A;  1YEP A;  4PUF C;  1FAA A;  1NHY A;  4EDY A;  2GSS A;  7GSS A;  5GZZ B;  5GSS A;  2V2G A;  5F0G A;  5ECM B;  1ZZY A;  2WRT A;  3F4T A;  1EEM A;  4V1A g;  3ZFL A;  1MTC A;  4GWR A;  2OKA A;  3FK8 A;  1T7P B;  1GWC A;  3F6D A;  1F3B A;  3KZQ A;  3VWU A;  5KOX A;  2E2M A;  5ENU A;  4LMV A;  2GDR A;  4D73 B;  4ECJ A;  4F9Z A;  4OWY A;  2YWO A;  5KN3 A;  2I3Y A;  2UZ8 A;  2AB6 A;  3MIX A;  2IME A;  5JWO B;  5IMA A;  3FR6 A;  4MJE A;  2BJX A;  2P5R A;  1B9X C;  1A2M A;  2H74 A;  1A0F A;  2LTK A;  3ZTL A;  1K0B A;  3ZVJ A;  2CVB A;  1YDK A;  3F3R A;  3M1G A;  1CQH A;  1PN9 A;  4OFT A;  2HLS A;  1DBY A;  2PGT A;  4EKZ A;  1BYE A;  2R6K A;  2GSR A;  4GRF A;  4IP6 A;  2MMO A;  1ERT A;  2XHF A;  4FIW A;  5KOW A;  4IP1 A;  2H75 A;  4F82 A;  1XCC A;  1GL8 A;  2QC7 A;  4YKF A;  5FWG A;  1ZGN A;  2E2G A;  5D96 A;  5D9X A;  1T4Y A;  4YH2 A;  5LD0 A;  1I9D A;  3ZZX A;  1MDI A;  4BWS A;  5EL8 A;  2IWT A;  4EL1 A;  4E8H A;  2X8H A;  4KCE A;  1X5C A;  5B8B A;  1HNA A;  4EO3 A;  4WF5 A;  1UVZ A;  4IKH A;  2CAI A;  2I4A A;  2C0E A;  1PKW A;  1HD2 A;  2QA2 A;  2WCI A;  4AJ7 A;  2B6M A;  3DVW A;  3CSJ A;  4OFN A;  1N8J A;  3QOU A;  1QGV A;  3GUS A;  1E2Y A;  1GTI A;  1GLP A;  3D4M A;  1TK8 B;  3CRT A;  2YWI A;  3KTB A;  1T8E B;  4GST A;  16GS A;  3VK9 A;  3P90 A;  3A5I A;  3E0U A;  3JCM L;  2D2Z A;  1SJ6 A;  3WGE A;  5B8A A;  2F51 A;  2LJR A;  1LJR A;  4FYU A;  2R3X A;  4ZBB A;  1Y6E A;  1XVW A;  2QKE A;  2RM6 A;  4ULX A;  4N0Z A;  2JAC A;  2HI7 A;  2X8C A;  2R37 A;  1M9B A;  3AY8 A;  5HR3 A;  3U5R E;  3F8U A;  3P8W A;  4J57 E;  3GUR A;  4V2M A;  2K6V A;  1OC9 B;  4OFM A;  5ELA A;  4IVF A;  1A24 A;  1TW9 A;  1XFL A;  2OAD A;  2C3N A;  1GLQ A;  1ST9 A;  4POM A;  4OO5 A;  3KMN A;  4IJI A;  1GUK A;  2LQQ A;  2H66 A;  3V1W A;  2A2S A;  3TKP A;  3MSZ A;  2C80 A;  4MA9 A;  3HVS A;  4PNG A;  2CVD A;  2R2J A;  5F05 A;  1USB A;  4JE1 A;  2CX3 A;  2DMM A;  4BL7 A;  2LRN A;  1SJI A;  3ZL5 A;  3WYW A;  4MF5 A;  2E7P A;  3RHC A;  3D5J A;  3NIV A;  1VF4 A;  1OC8 A;  1DE1 A;  3EC3 A;  1PRX A;  3FR3 A;  4ML1 A;  2XBI A;  4NHW A;  2M72 A;  1V40 A;  4YQU A;  1AC1 A;  1SL2 B;  5HR0 A;  1WP0 A;  2OJL A;  1TOF A;  1J0F A;  2KUC A;  3VWW A;  18GS A;  5IOW A;  3KJY A;  1GSQ A;  1JHB A;  2IFQ B;  1R5P A;  1JZW A;  1KEB A;  3P2A A;  4ECB A;  4ZL7 A;  3GFK A;  2H73 A;  2F8A A;  2B5X A;  2GVP A;  4GSN A;  3WT2 A;  2I9H A;  2N5A A;  4PXO A;  3GKK A;  1F37 A;  1J9B A;  4I6X A;  4LLR A;  4ZL8 A;  4DSQ A;  4F0C A;  5G1L A;  1K0M A;  2FWG A;  1U3I A;  2V41 A;  2K18 A;  4MK3 A;  1F2E A;  4L5O A;  2VCZ A;  3DWV A;  5AIV A;  3KD0 A;  2GZZ A;  1Q98 A;  1HYU A;  1U87 A;  3F4S A;  3HXS A;  4TKY A;  1XW5 A;  5IMZ A;  5AIX A;  1ERV A;  1IYI A;  3H4K A;  3IK7 A;  3GN3 A;  4K0N A;  3W8S A;  2O85 A;  3VWV A;  5EVO A;  1ERW A;  2DKI A;  3QAG A;  2H6X A;  4MPG A;  3L9S A;  11GS A;  5B7C A;  1DSB A;  1CQG A;  3EVI A;  1PSQ A;  4N0V A;  3TOT A;  1KTE A;  1TDI A;  3GMF A;  4EIP A;  2HE3 A;  6GSS A;  4BWQ A;  3A2V A;  1YQ1 A;  2IPA A;  4NMU A;  2AUV A;  3WD6 A;  2B5E A;  4X43 A;  1O73 A;  4O7H A;  1T3B A;  14GS A;  3ZRE A;  2RUF A;  2WB9 A;  2L4C A;  4Q5N A;  5A4U A;  2QA1 A;  5DQS A;  1M0U A;  2HRK A;  3L4N A;  4TXO B;  5ECN B;  4MZW A;  1G7O A;  8GSS A;  1WIK A;  2GGT A;  3IAS 2;  1B4Q A;  2R4V A;  1BJX A;  3PGT A;  4I8B A;  4MH2 A;  1MEK A;  1TU7 A;  2PWJ A;  3QPM A;  6GSY A;  2R0G A;  4KDY A;  1TRS A;  3DML A;  4OMV A;  1O81 A;  4ML6 A;  2L4Q A;  2P0G A;  3IV4 A;  4G19 A;  3G7Y A;  2CVK A;  4GF0 A;  4J56 E;  3H79 A;  2YZH A;  2DJ2 A;  2MMN A;  4HOJ A;  2RII A;  5ID2 B;  4CHS A;  1X0R A;  4EUY A;  4KSM A;  4HZ4 A;  5HFI A;  3I9V 2;  2H1D A;  1YKA A;  2VM2 A;  4YAP A;  4TN8 A;  1ZOF A;  3HJM A;  2DIY A;  2X8G A;  4Z2T A;  3EMX A;  2MMZ A;  3CSH A;  4BVX A;  5D9V A;  1RW1 A;  4NPB A;  3LG6 A;  1XOA A;  1TK5 B;  1A23 A;  1UA5 A;  1A8L A;  3MYD A;  5AN1 A;  1GNW A;  2L57 A;  2VUP A;  2VCX A;  1FVK A;  1THX A;  3C71 A;  4F2I A;  3FKF A;  4EXJ A;  2X4A A;  4PQH A;  5H5S A;  5BMU A;  1TI1 A;  5A4W A;  5C04 A;  1GSU A;  2YJ7 A;  2H01 A;  4K2X A;  1LU4 A;  2LNT A;  4MF6 A;  5CNW A;  4ACS A;  2F8F A;  2QSI A;  2DJJ A;  1BQ7 A;  3ZRD A;  5F07 A;  3UL3 A;  4IW9 A;  5AGY A;  3TUE A;  4IN0 A;  1I5G A;  2DML A;  4PUR A;  3L9V A;  2REM A;  2B5Y A;  4PGT A;  2GQL A;  2IMI A;  1SL0 B;  3KTL A;  2VCQ A;  3CBU A;  4E8E A;  2A2P A;  3HZ4 A;  1WE0 A;  3GX8 A;  1OE8 A;  2GTU A;  3F4R A;  1HQO A;  3GH6 A;  3MWH A;  4K1F A;  3TKQ A;  4PQ1 A;  1O6J A;  2OBI A;  2FA8 A;  5G30 A;  3UAP A;  1ACV A;  2CX4 A;  2FWE A;  1W89 A;  4G0I A;  3QCP A;  1Z5Y E;  3PPU A;  5CRG A;  6GSX A;  5B6M A;  3GRX A;  1MD4 A;  2IL3 A;  3ZIJ A;  1H75 A;  1PD2 1;  2K8V A;  3TOU A;  1T1V A;  2V1M A;  2WUL A;  2PVQ A;  2HT9 A;  3FY7 A;  2HSY A;  3A2X A;  3VI5 A;  2GT5 A;  3UVT A;  1XWK A;  3FZ9 A;  3UMA A;  4K7I A;  3US3 A;  3GTU A;  4ILF A;  1FOH A;  1QK8 A;  1ABA A;  3LYK A;  5ECK B;  3BD2 A;  1SYX A;  1SEN A;  3UVH A;  2ES7 A;  3FHK A;  4CY8 A;  4MP4 A;  4Q5Q A;  5H5R A;  1BAY A;  2L59 A;  3LFL A;  3M3M A;  2ZNM A;  3O3T A;  1XW6 A;  4ISD A;  5IOX A;  3EIN A;  3TJF A;  4L5L A;  3ZVJ D;  2YZU A;  2YV7 A;  5BRT A;  2YWN A;  1KBN A;  3C7M A;  2HXK A;  2RLI A;  3F3Q A;  1ZL9 A;  3ERF A;  2KP2 A;  3GA4 A;  1XWC A;  3LYP A;  2CA8 A;  3A2W A;  3NOF A;  1ZYP A;  1S3D A;  3GKN A;  3FR9 A;  2ON5 A;  2B7K A;  2VM1 A;  1B9Y C;  1R7H A;  4AGS A;  3ED3 A;  22GS A;  4V2L A;  2JZT A;  3DEX A;  3KH7 A;  4CDO A;  4TR1 A;  5DBQ A;  3C1R A;  2VL2 A;  1XBS A;  2MZC A;  1EZK A;  4WET A;  3CMI A;  5LCZ A;  3M9K A;  4ECI A;  1DE2 A;  4IS0 A;  2H1A A;  1ZCP A;  4IQ1 A;  3EPT A;  4LL4 B;  3GIX A;  3IR4 A;  1IYH A;  4AF2 A;  2YN1 A;  4MCU A;  2L5O A;  2JZR A;  4TR4 A;  5J4U A;  4NXI A;  4XS4 B;  4KDX A;  4XHM A;  1ILO A;  1PX7 A;  5FT3 A;  3I6A A;  5JCW A;  4X0X A;  2H0G A;  6GSU A;  1SYR A;  4XCS A;  4CY6 A;  1R26 A;  4K9Z A;  5ELG A;  5CAX A;  2YPM A;  3IDV A;  2VL3 A;  5B6N A;  5DAK B;  5ECP B;  3G9B A;  5DAL B;  1ZYE A;  1AQV A;  1JLW A;  1OKT A;  1V9W A;  4FQU A;  5G5E A;  1WRY A;  3DRN A;  1K0O A;  1A2L A;  3ME7 A;  3VPQ A;  2FCH A;  2H0I A;  3DXB A;  4KDU A;  2KOK A;  2OE3 A;  2HFD A;  4RQX A;  5CRE A;  1YJ6 A;  2OE1 A;  3ZIT A;  4D73 A;  4V1A p;  1M2B A;  2F3M A;  2TIR A;  3QFB C;  2JSZ A;  5COH A;  2FGX A;  3TJJ A;  3ISO A;  4ZIJ A;  3TKS A;  3KH9 A;  2VD0 A;  3C73 A;  2Z9S A;  2IIY A;  4HS1 A;  1EP8 A;  3CRU A;  1VF3 A;  2MYG A;  4OCE A;  4HQZ A;  3ZIV A;  1LBK A;  3HHV A;  5D9T A;  5IMD A;  3MDK A;  4CW9 A;  2GST A;  2YNX A;  2M46 A;  2PPT A;  1OAZ A;  3A5W A;  2GT6 A;  2A4H A;  3DIE A;  2DJ1 A;  3IHG A;  3TRP A;  3EU4 A;  3VI7 A;  2G2Q A;  3Q18 A;  5DQY A;  3DKS A;  4OO4 A;  4NAX A;  4TR0 A;  1K3L A;  4ZBD A;  3W8J A;  3HD5 A;  1Z7R A;  2C3Q A;  4I2T A;  2HRA A;  2V6K A;  4XS1 A;  1A2J A;  3H93 A;  5HR2 A;  4LL1 B;  2H1B A;  2DLX A;  3H1N A;  3G7I A;  4MMM A;  5DAL A;  3VLN A;  1MDK A;  2ON7 A;  1G6Y A;  3ERG A;  1HNB A;  4QL9 A;  2VCV A;  1TTZ A;  1YF0 A;  2MBT A;  4BVY B;  2X99 A;  4O92 A;  2J23 A;  1GTB A;  3UBL A;  2J9H A;  2I81 A;  2VL2 C;  3F0I A;  3DD3 A;  4KND A;  1UC7 A;  4JED A;  5IPG A;  3APS A;  3UJ1 A;  3TCO A;  4EIQ A;  1ZMA A;  4XIH A;  2FHE A;  2FWF A;  1O8W A;  2LS5 A;  4N30 A;  3HCZ A;  3CYN A;  1PN0 A;  4IEL A;  2KP1 A;  4Z2U A;  1A8Y A;  3ZMK A;  5ECR B;  3TKR A;  5E59 A;  4YKG A;  5IM9 A;  3KM6 A;  4ZB9 A;  20GS A;  2HSM A;  1QFN A;  2WFC A;  4HZ2 A;  2VLU A;  3GH9 A;  2C8U A;  1EV9 A;  1QXH A;  2CAQ A;  3QAV A;  1NM3 A;  2M80 A;  3EYT A;  4FH8 A;  2JSY A;  2HSH A;  2LV3 A;  4V2N A;  1GSY A;  2AV4 A;  2XC2 A;  4PUA A;  1OC9 A;  1XPV A;  4QQ7 A;  5KN2 A;  2XPD A;  3J7Y b;  4JBB A;  2NPB A;  1SD9 A;  1U3A A;  3TRX A;  2FD3 A;  5IMC A;  4GXZ A;  3LSZ A;  4KA0 A;  4F0B A;  3TKS C;  3LJR A;  2VAF A;  2F9S A;  3ZFB A;  1WWJ A;  5DJL A;  4HEA 2;  2LST A;  4HJ2 A;  2FUG 2;  12GS A;  5ABR A;  5CYY A;  1YEX A;  4KCA A;  4GCI A;  1R5A A;  4WR4 A;  1C72 A;  1XOB A;  1AUC A;  1ERU A;  3WT1 A;  5CP1 A;  2GZY A;  3VFI A;  3L9U A;  5KN1 A;  2HZE B;  3RHB A;  3LGC A;  4NHZ A;  1BG5 A;  1RQM A;  4N10 A;  3IBH A;  5HFK A;  4K5S A;  4X4J A;  1GNE A;  3BCK A;  2L6C A;  3RPP A;  3KP9 A;  3O6T A;  4O5Q A;  4WXT A;  5D93 A;  5F06 A;  2MMA A;  2IFQ A;  5ECH B;  3F9U A;  1S3A A;  4AJ8 A;  1M9A A;  2I1U A;  3WGD A;  4ZB8 A;  3RPN A;  3D6I A;  3LEF A;  1EGO A;  1GSD A;  4MPF A;  4K7O A;  2H6Y A;  4TW5 A;  1GUL A;  3IA1 A;  2C3T A;  1S3C A;  2AYT A;  1N2A A;  1MDJ A;  1TK0 B;  1V2A A;  3TGZ A;  3QFA C;  2EC4 A;  3KGK A;  3FZ4 A;  3CTG A;  3TB2 A;  2YV9 A;  5AIS A;  3C1S A;  3HJP A;  4MF7 A;  1WMJ A;  4KW6 A;  1K0D A;  2FWH A;  4F03 A;  5E4W A;  1FVJ A;  3LWA A;  1NHO A;  5CRH A;  1EGR A;  3GYK A;  4RI6 A;  1GH2 A;  1FHE A;  2VLV A;  4ID0 A;  2LUS A;  3FZA A;  4G0L A;  2L6D A;  4I5Q A;  4WF4 A;  1Z6N A;  6GSV A;  4X1U A;  2FNO A;  1FOV A;  1QQ2 A;  4WKW A;  1SK1 A;  3KMO A;  2G0F A;  1AIU A;  1EP7 A;  4G0K A;  2OA7 A;  17GS A;  4P3Y B;  3BBY A;  4MNN A;  3VUR A;  4K7N A;  3MAK A;  2RM5 A;  3TRQ A;  1PA3 A;  4O32 A;  3HKR A;  2DKH A;  2N5F A;  1A0R P;  3TJG A;  2XBQ A;  4ZIL A;  3BJ5 A;  4PNF A;  6GST A;  1EEJ A;  4MDC A;  1M2A A;  3U6V A;  3E9J B;  4TXO A;  4RI7 A;  2X49 A;  4DSS B;  2LJK A;  3UAR A;  2EIO A;  5EPF A;  4WBR D;  4K5R A;  3TDG A;  2YJH A;  1SL1 B;  3DVX A;  2VIM A;  1T00 A;  5INY A;  3EUR A;  2H0H A;  2GZP A;  4POK A;  1J08 A;  2K8S A;  4HUA A;  5JWR B;  2ZCT A;  4JR4 A;  1SU9 A;  3LQ7 A;  5ECQ B;  4L0W A;  1XZO A;  2C0D A;  1GUH A;  3EMP A;  3CSI A;  2IJY A;  2CZ3 A;  5ID2 A;  4Z7X A;  1WPI A;  1W4V A;  1V98 A;  3APO A;  1VRS D;  3E3E A;  4J2F A;  2BTO T;  1GSE A;  3KP8 A;  3IHQ A;  1G6W A;  5A5K A;  1PKZ A;  2O8V B;  3HJO A;  4TVE A;  3UIW A;  1XWB A;  3GX0 A;  1EOG A;  2ALB A;  3W6G A;  5ECS A;  1PMT A;  2LQO A;  4PX1 A;  2FY6 A;  2HYX A;  2O89 A;  3FZ5 A;  5IO2 A;  2IMK A;  4Z2R A;  4HU7 A;  3J7Y k;  5J5N A;  4WBJ A;  1PX6 A;  1XW9 A;  3L0H A;  4K8M A;  1K3O A;  1PQN A;  2AAW A;  5GST A;  3ZYW A;  4GQF A;  4HJM A;  4KGI A;  2O87 A;  5KN0 A;  4GLT A;  3IXR A;  3I43 A;  2B1K A;  2QGV A;  2VL9 A;  3BOA A;  5L71 A;  1K0N A;  4A5P A;  3SWL A;  3DGQ A;  2O7K A;  4K6X A;  4KUN A;  3UOM A;  2HRN A;  4GSS A;  4DSS A;  2LNS A;  1TI3 A;  4PQI A;  3M8N A;  3SBC A;  1F9M A;  2A2R A;  4XS6 A;  2R0P A;  4L0U A;  3Q6O A;  1BX9 A;  2PMT A;  3D4T A;  2B3S A;  3RBT A;  10GS A;  1Z9H A;  5J9B A;  4POL A;  1FW1 A;  1X9M B;  4JZQ A;  2DJ3 A;  2A4V A;  2PU9 C;  4IGJ A;  19GS A;  2DJ0 A;  3FMW A;  4H86 A;  2LJA A;  1VF1 A;  2EIQ A;  2DIZ A;  3BCI A;  4MZC A;  1O7U A;  1AXD A;  4IHU A;  3K8N A;  5D9W A;  2WJU A;  4O5R A;  4BA7 A;  5IQY A;  2PER A;  4Q5R A;  3HA9 A;  3IRA A;  5HR1 A;  2H1G A;  1QUW A;  1FB0 A;  4OCF A;  2FLS A;  5IMV A;  3GL3 A;  1Q4J A;  2CZ2 A;  3GL5 A;  2LRT A;  2HZF A;  1B48 A;  2LEG A;  3LXT A;  1V58 A;  4EE0 A;  2DJK A;  4KF9 A;  3HZ8 A;  2AHE A;  1JLV A;  4JU5 A;  3KXO A;  2ZUP A;  3GKM A;  1URM A;  2GQM A;  3ME8 A;  3FEU A;  1F3A A;  1AQW A;  5IMF A;  3KCM A;  4TOP A;  5KEJ A;  2OE0 A;  1X9S B;  4KE3 A;  1Z7P A;  4RQR A;  3F63 A;  4XRA A;  5GAP D;  3EU3 A;  2IMD A;  2XPE A;  4BL7 B;  2YAN A;  1U88 A;  3UEM A;  1TKD B;  1WJK A;  1XXU A;  3ERW A;  3O76 A;  2EIR A;  2RUE A;  4ZL9 A;  1JFU A;  4G10 A;  3WGX A;  5DDL A;  1AAZ A;  2GS3 A;  1E6B A;  1TRU A;  3GKX A;  3L78 A;  4XS4 A;  2VCT A;  2OBK A;  3A3T A;  5G31 A;  2LKU A;  3LW9 A;  1F6M C;  2H8L A;  2FA4 A;  2V6O A;  5J41 A;  1JZR A;  3FW2 A;  5D8I A;  5CRW A;  4WEY A;  1OE7 A;  1YKC A;  2C0G A;  5DVB A;  1RK4 A;  1SKW B;  4QL7 A;  2GQK A;  3C8E A;  1OKD A;  2L5L A;  5JCU A;  1OC3 A;  5DAK A;  2P5Q A;  4MH3 A;  4G2E A;  5LNK e;  5CO3 A;  4ZBA A;  1TP9 A;  4EC0 A;  2VD1 A;  5FHI A;  4DEJ A;  5JCG A;  2H72 A;  1M7T A;  2V32 A;  2H71 A;  3ZML A;  4MZB A;  4LA1 A;  1QMV A;  3LOR A;  1UN2 A;  5G5F A;  3IC8 A;  5G1K A;  4EVM A;  1GUM A;  3MNG A;  5DJM A;  4DVC A;  3GST A;  1MD3 A;  1O8X A;  3HVX A;  4EF0 A;  1M99 A;  2TRC P;  1PL1 A;  3NZN A;  1TRV A;  1X9W B;  1O85 A;  1VF2 A;  3IAM 2;  3N9J A;  4NWY A;  4POB A;  2CT6 A;  2LRC A;  1ZYQ B;  13GS A;  4KX4 A;  3GSS A;  3CXG A;  3FRC A;  4IJ3 A;  2KLX A;  2WZ9 A;  1Y25 A;  4DSR A;  1ZYN A;  3R3E A;  1SKR B;  2B1L A;  3FYG A;  1JZD A;  1K0A A;  5EY6 A;  2CQ9 A;  4XTS A;  3I69 A;  3UBK A;  5G2Z A;  6GSW A;  2R0C A;  5DCG A;  3D22 A;  3Q19 A;  4HI7 A;  2JAD A;  4LMW A;  1GP1 A;  3GV1 A;  1ML6 A;  3IC4 A;  5A4V A;  5CRD A;  5F8B A;  3CTF A;  5H5Q A;  4ZB6 A;  4FO5 A;  4TXV A;  2IN3 A;  2H70 A;  4MJA A;  2AJQ B;  1GTU A;  2H76 A;  1FG4 A;  2KHP A;  2NDO A;  4PTS A;  4AJ6 A;  1GSS A;  1ON4 A;  1TRW A;  1Z6M A;  3OR5 A;  3RDW A;  3VWX A;  1YY7 A;  2X64 A;  2IMF A;  4HU9 A;  4BVY A;  4KH7 A;  1M2D A;  3LXZ A;  2C1Y A;  4YQV A;  4WR5 A;  2E0Q A;  2JL4 A;  2PBJ A;  1VGL A;  4KB3 A;  2PUK C;  4K2D A;  3Q74 A;  5ECI B;  2NBS A;  3EWL A;  3N5O A;  4BVX B;  1SD8 A;  3M0F A;  3TJB A;  1JZO A;  5D73 A;  1GSF A;  4N11 A;  4TRX A;  4NV5 A;  1B8X A;  3S9F A;  1SK0 A;  2H30 A;  3VPT A;  2HNL A;  1NSW A;  3HYP A;  5GAN D;  3D0Z A;  1G7E A;  5JWQ B;  2GSQ A;  2YP6 A;  5IO0 A;  3APQ A;  2GLR A;  4MJC A;  2YOI A;  2MBS A;  4HQS A;  2R5G A;  2DC5 A;  2TRX A;  3R2Q A;  3M9J A;  2B7J A;  4USS A;  1G0T A;  4O5U A;  3QAW A;  2C0F A;  1GTA A;  4GTU A;  5C00 A;  3QR6 A;  1KNG A;  4HDE A;  3HVV A;  4L8E A;  1B4P A;  2K9F A;  1SK2 A;  2PN8 A;  4KAE A;  1V57 A;  1SKS B;  1THO A;  1R4W A;  9GSS A;  3QDN A;  2VO4 A;  4YAV A;  4JR6 A;  4TR3 A;  5DCH A;  2NTO A;  1EWX A;  3HY2 A;  3IOS A;  4YQM A;  1TU8 A;  1YZX A;  3HDC A;  2YCD A;  4Q5F A;  4FYC A;  2PVO C;  2WGR A;  1PL2 A;  2N5B A;  3D21 A;  3F6F A;  2P31 A;  1FO5 A;  1NW2 A;  3PR8 A;  4K0G A;  1TXX A;  2DBC A;  2HRF A;  2YWM A;  1OVN A;  4ICY A;  3ZLP A;  1K0C A;  1Z3E A;  5ECL B;  3KEB A;  3QMX A;  2NVL A;  4G9H A;  3KIJ A;  3P7X A;  2HZE A;  4IQA A;  4ECC A;  3G7J A;  1YF1 A;  1XWA A;  2H6Z A;  3TJK A;  1EV4 A;  4I2U A;  5HFG A;  4GQC A;  1XWG A;  3GTU B;  1DUG A;  1H4O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...