2PWJA

Structure of a mitochondrial type ii peroxiredoxin from pisum sativum
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
162
structure length
162
Chain Sequence
b'LSAASNVSLQKARTWDEGVESKFSTTPVNDIFKDKKVVIFGLPGAYTGVCSSKHVPPYKHNIDKFKAKGVDSVICVAINDPYTVNAWAEKIQAKDAIEFYGDFDGSFHKSLELTTDLSAGLLGIRSERWSAYVVDGKVKALNVEESPSDVKVSGAETILGQI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitochondrial peroxiredoxin
publication title Structure of a mitochondrial type II peroxiredoxin from Pisum sativum
rcsb
source organism Pisum sativum
molecule tags Oxidoreductase
total genus 39
structure length 162
sequence length 162
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2007-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08534 Redoxin Redoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2pwjA00
3QCPA 1GSQA 1M99A 2I9HA 1SU9A 3MWHA 5J9CA 3LGCA 2C3NA 3LXZA 4WEYA 1B8XA 4JU5A 3VK9A 4CW9A 3FR3A 4K7NA 1GSYA 4TW5A 1WJKA 4G10A 3HVXA 4KDYA 4OFMA 2DIYA 2P31A 1TKDB 5A4VA 5A5KA 3C7MA 5HFKA 4HJ2A 1OC8A 1V98A 1TTZA 1PX6A 4BVXA 1GULA 4TXOA 4I2UA 3MDKA 5ECOB 2GSTA 1ACVA 4ECIA 4ZB9A 4K7IA 1DUGA 1G0TA 1KBNA 1WRYA 4OCEA 3TRPA 3S9FA 2WGRA 4NWYA 4K1FA 1S3DA 2NDOA 4EDYA 1ZL9A 4MH3A 5D9TA 2A2RA 3EC3A 4MZBA 3VPQA 1ON4A 1JLWA 1WOUA 2AYTA 2GT5A 2ZCTA 3FR9A 2KUCA 4JRRA 3I6AA 5HR2A 4N0ZA 1FB0A 3KMNA 3TJKA 4GSTA 3E0UA 1FOVA 2B3SA 5ENUA 2CVDA 3DKSA 2OE3A 4LA1A 2C1YA 3HYPA 3FYGA 1GP1A 3GL5A 4GSSA 1GSSA 3GFKA 2FNOA 3KD0A 2VCWA 1QGVA 1TDIA 3CBUA 4ZBAA 5KN0A 4WF5A 2H6ZA 4EO3A 1RK4A 1HNBA 4Q5RA 3FR6A 4EUYA 4PXOA 1SK0A 2YNXA 1TK8B 3UJ1A 1M2AA 5EPFA 1YEPA 4JEDA 4KSOA 2BTOT 4O92A 1FVKA 4IKHA 3KCMA 2FGXA 2N5BA 2LJAA 4F0CA 1PD21 1OKTA 2WJUA 3HHVA 2AHEA 3H4KA 4HU7A 1K0CA 1JZOA 2LRNA 2L6DA 4YH2A 1XVQA 3M3MA 5DCGA 2F3MA 1EEMA 3Q18A 4TRXA 4YAVA 4QQ7A 2VLVA 5A4WA 3A2WA 4KW6A 2C0EA 4IQAA 3UOMA 2OA7A 5ECSA 5HR0A 1XXUA 2L4CA 4K2DA 3GTUA 4ISDA 5B7CA 1E2YA 2YCDA 2IL3A 2QKEA 4KA0A 5E59A 1HYUA 2H1BA 3TUEA 1QFNA 3ZREA 2WS2A 3MNGA 2K8SA 4JBBA 1H75A 2GQMA 3M9KA 2GSQA 1A2LA 2H6YA 2YJ7A 5F06A 2IMEA 3C1SA 3HDCA 3QFAC 4XS1A 3IA1A 3TOUA 3FZ4A 2YV9A 2DSAA 2IPAA 4D73A 4HI7A 2H0IA 3TJBA 3FHKA 5DJMA 2CAQA 3VLNA 5D9XA 22GSA 4MK3A 4ZXGA 2WDUA 1JLVA 2H8LA 3KP9A 3VURA 1HNAA 3LG6A 2Z9SA 5H5QA 1VRSD 3EMPA 3EU3A 4ILFA 1X5DA 2OBIA 1TRWA 2KP1A 1IYHA 2MBSA 2DJKA 3WT2A 2WFCA 2GQLA 1MEKA 5ELAA 4EVMA 2IMKA 1GUMA 4I2TA 2F51A 3LYPA 4EL1A 1HD2A 2PERA 3APSA 3F3QA 4KB3A 3P2AA 3C1RA 2R6KA 4ECJA 2FWEA 4F2IA 2DJ0A 3DD3A 2GZYA 1KTEA 1FHEA 1EV9A 5CO3A 5GSSA 4N0VA 2HZEA 3KIJA 5ELGA 1EOHA 4L5OA 2HYXA 2DJ3A 3F4RA 5ECKB 1AXDA 2C8UA 4OWYA 5G1KA 1UN2A 4MDCA 4GTUA 3C71A 2C0DA 2CQ9A 5IPHA 2KOKA 5H5RA 1OKDA 4KDUA 2WRTA 1PL1A 3TKSA 1GUKA 2KP2A 1A0RP 3ZZXA 5GSTA 5DAKA 4PUAA 4HEA2 3HKRA 1USBA 1TK5B 2L5LA 1O73A 3A5WA 4K9ZA 3HVSA 3CSHA 4P3YB 1M2DA 1W4VA 4HS1A 5AIVA 3GN3A 2ON7A 2X99A 3F63A 3PGTA 2TRCP 3WYWA 3A3TA 4XHMA 1SJZA 2RUFA 4FH8A 1PN9A 4XS4B 1BEDA 1GTAA 3KZQA 4MJCA 2I1UA 3G7YA 2XBIA 4POLA 2AJQB 1GRXA 12GSA 4TR4A 2LTKA 5IIZA 4F9ZA 4HDEA 4PQIA 5JCWA 1XBSA 2HRNA 4Q5FA 2FUG2 2VD1A 1GSEA 4V1Ap 3Q19A 1Z6NA 1EGRA 5IO2A 3ZIJA 2GZZA 3IXRA 4J56E 5J9BA 2I3YA 3HVVA 2RM6A 3F4SA 4KCEA 4WXTA 4AJ7A 2KLXA 5EVOA 1XVWA 1OYJA 2H1GA 5G2ZA 2VCZA 2K8VA 2N5FA 2YV7A 3L4NA 4TOPA 2H1AA 3GA4A 4F03A 3BCKA 5AGYA 5IQYA 1Z3EA 4FIWA 4HOJA 2VCTA 3ZYWA 7GSSA 3GH6A 2MYGA 1K3LA 3FZAA 1TK0B 1XWCA 4G2EA 3R2QA 2CX3A 2OACA 2PU9C 9GSSA 3CYNA 4IJIA 5J41A 5IO0A 2LRTA 2K18A 2JZRA 2RIIA 5DALB 5B8AA 1B9YC 20GSA 3FZ5A 3IBHA 1XWKA 3W6GA 3NOFA 3UIWA 2HT9A 2OADA 4V1Ag 4IJ3A 2B6MA 3P90A 2O8VB 3W8SA 2H70A 2E7PA 3DMLA 4BL7A 1JZRA 1O85A 2E2MA 1EOGA 1VF4A 2A4VA 2BJXA 4TXVA 4KX4A 3F3RA 4TXOB 5HR1A 3EE2A 1YY7A 4TR1A 1TP9A 4FYBA 2AUVA 2L4QA 1LU4A 5ECPB 2DJJA 4GLTA 2WCIA 5F0GA 1B4PA 3TRQA 2H71A 1V40A 5ECQB 1T1VA 5ECLB 1O8WA 4IELA 2IMDA 1HNCA 2F8FA 2H01A 3P7XA 4TR3A 3RBTA 3RHCA 2HLSA 2H72A 4MABA 3RAZA 2GSRA 2H74A 2HRFA 2HSHA 5IOWA 4OFTA 1A23A 3EINA 2EIOA 3GX0A 2DMLA 2C80A 2CT6A 1BX9A 4NXIA 1OE7A 1XPVA 4BA7A 3GMFA 1TOFA 1U87A 1YJ6A 3UEMA 3RHBA 3KP8A 1K3OA 1W89A 5KEJA 1ML6A 2VM1A 3IOSA 3UBKA 3GIXA 4HZ4A 4HU9A 4OCFA 1YF1A 3BOAA 3RPNA 5CP1A 4WBRD 4OO5A 4K7OA 3HZ4A 1F3BA 2QSIA 2H0GA 4PQHA 4MJAA 4LMWA 3A2VA 14GSA 5ECRB 1YKAA 3ZL5A 2G2QA 3M9JA 4MJEA 3UMAA 3ISOA 1YDKA 4PURA 2AAWA 3LYKA 4MP4A 5CRWA 3TJFA 3GURA 5IMFA 4MLYA 4IP1A 1SD8A 1T4ZA 4WETA 1VF3A 3IR4A 2PMTA 2O85A 2GZPA 3LXTA 2C0FA 3GX8A 4GSNA 3CSIA 1RQMA 4LL1B 1X9MB 4I6XA 1N2AA 2I81A 2QGVA 3TKSE 4FO5A 2FCHA 1TRSA 1B48A 1BYEA 1WWJA 3GTUB 4MZCA 1AQVA 1EGOA 1GSDA 4JE1A 1K3YA 1MDJA 1ABAA 3GH9A 3N5OA 3BBYA 3WGEA 1TI3A 3GV1A 4X1UA 1DSBA 2CA8A 1R26A 4L0UA 3O76A 3QOUA 4PUFC 2R2JA 3D0ZA 1V58A 1TW9A 3EURA 4PQ1A 1AQXA 1XWAA 2DJ1A 2XBQA 1XWGA 4XIHA 4IVFA 5F07A 2PVOC 2HI7A 4D73B 5KN1A 4GF0A 2H30A 4LMVA 5H5SA 1A24A 2VCQA 2J9HA 1GTBA 5G1LA 3TB2A 3L0HA 1ERVA 2DIZA 2V1MA 1TRUA 3KH9A 5D96A 4Z7XA 3QAGA 5G31A 4AJ6A 2R4VA 2PBJA 2FD3A 1AC1A 4KH7A 1B4QA 2VCVA 4KNDA 3HY2A 2N5AA 3GUSA 1OVNA 3D5JA 4ZL7A 3CRUA 5GAPD 1I5GA 4XS6A 5A4UA 1O8XA 2L5OA 4I5QA 2XHFA 2V6KA 4KCAA 2LNSA 4N10A 5FT3A 5IPGA 3QPMA 1ZYQB 3UAPA 2IFQA 3W8JA 6GSSA 2YWNA 5E4WA 4XRDA 2HZEB 2NPBA 3ZTLA 1NW2A 3SBCA 4IBPA 4ACSA 1JZWA 4K0GA 2K6VA 3EVIA 4WR4A 2V41A 5HFGA 2YANA 1K0MA 2H6XA 3ZVJD 1VGLA 3M1GA 1Y6EA 3IK9A 5D9WA 2H76A 3ZLPA 1WMJA 4O32A 1EZKA 4Q5NA 2DLXA 1O81A 4KGIA 2FLSA 1JHBA 1PQNA 3JCML 2HNLA 3VWXA 1QMVA 1J0FA 4CHSA 3Q74A 2WB9A 3TJGA 4PX1A 5ID2A 4JZQA 1XW9A 1MD3A 2YZUA 5DAKB 2VCXA 4TVEA 3DRNA 5COHA 2E2GA 3QAVA 3TGZA 4ZB6A 2OJLA 4HQZA 4H86A 3IPZA 3D22A 3ED3A 2DBCA 4WF4A 3F0IA 3GKKA 1ERTA 3D21A 3PINA 1AAZA 1MDKA 1XFLA 3ERGA 2H19A 2LQQA 2YP6A 3IHQA 3TCOA 4PNGA 4IS0A 3APOA 2NBSA 1PL2A 4KSMA 3GL3A 5AISA 2LKUA 3SWLA 2FA8A 4DEJA 1J9BA 3CXGA 3O3TA 2V32A 3D6IA 1T00A 1ZYEA 3DWVA 4KUNA 5J5NA 1TU8A 2LQOA 2GVPA 1GNEA 1EP8A 1NHYA 1G7EA 5DBQA 2M80A 2PUKC 3HJMA 4EXJA 1TI1A 1CQHA 3C8EA 3F8UA 2H66A 4I97A 5CYYA 3GKNA 3L9SA 3M0FA 1ST9A 2ES7A 2LEGA 4QL7A 2HSYA 4ZB8A 1F3AA 2M46A 3IAM2 1X9WB 3UL3A 2R5GA 4IGJA 2V6OA 3ZVJA 2P5RA 2CVKA 3CMIA 1NM3A 4XRAA 1R5PA 4ZL9A 3I9V2 3KEBA 5J3RA 5LD0A 3LWAA 4HQSA 2O7KA 4AJ8A 1Z7PA 5CREA 3FEUA 3EWLA 1B9XC 1GWCA 2VLUA 3M8NA 3ME8A 1WIKA 2IN3A 1GTIA 3E9JB 2CX4A 2MMOA 1FAAA 2C3TA 1F2EA 5JCUA 1DE2A 2O87A 4IHUA 4MPGA 1YQ1A 5DCHA 3J7Yk 4EC0A 1OC9A 5G5EA 2OE0A 3CTFA 1GH2A 5AIXA 2LJRA 2P0GA 1VF2A 4ID0A 2MBTA 2C0GA 3CSJA 6GSWA 4ZILA 3UBLA 1I9DA 4KDXA 1ERWA 3G7JA 4HJMA 3IAS2 4TR1B 3UVTA 2CAIA 5CRHA 4OMVA 2GQKA 1SYRA 2ZUPA 2TRXA 1G7OA 2YZHA 3TRXA 2ON5A 2PPTA 4IP6A 3VWWA 2VLTA 5CAXA 4ECCA 3ZFBA 4AF2A 2VL2C 4F0BA 5DQYA 3DYRA 3VI5A 1DE1A 2B5EA 4IN0A 2LSTA 4E8HA 4RI7A 1LJRA 3F6DA 1C72A 3PR8A 5J4UA 5CRDA 3L78A 2FWFA 3ERWA 3L9UA 4MPFA 2WZ9A 1K0OA 1T3BA 2NVLA 5F05A 4G19A 1PX7A 4ML6A 1NHOA 3TKRA 5JCGA 1SKWB 5DVBA 1SL2B 4K0NA 2V2GA 1V9WA 3HJPA 1BAYA 5HR3A 2YN1A 1SD9A 2O89A 2YJHA 2YWIA 2GTUA 1A2JA 1V57A 6GSTA 1FB6A 5C04A 4OO4A 1T8EB 3BD2A 2KHPA 1R7HA 4Q5QA 1UVZA 5G30A 4YQVA 1V2AA 1U6TA 3L9VA 3GSTA 1K0NA 5FWGA 1Y25A 4OD7A 3APQA 3N9JA 4MF5A 2DC5A 2VAFA 4V2NA 1HQOA 2JSYA 5INYA 2B7KA 1PRXA 3MSZA 3TOTA 1M9BA 1JZDA 5GAND 2LNTA 1O6JA 2FWGA 1GLPA 3J7Yb 2YWOA 3KGKA 4GQCA 2XPDA 5GZZB 13GSA 2H75A 4POMA 2HFDA 1SKRB 5D8IA 2VIMA 3KJYA 3D4TA 2EIRA 5D73A 1BG5A 3DIEA 4HZ2A 1EV4A 2GS3A 1FO5A 1U88A 1QUWA 4NHZA 2RM5A 2GSSA 4FYUA 3GNJA 3DEXA 4NMUA 1EEJA 2GGTA 1XZOA 1ERUA 5C00A 2TIRA 3HCZA 2IIYA 5D93A 4L8EA 3K8NA 5D9VA 5CRGA 1AUCA 2JZSA 5IOXA 3IE3A 1S3AA 5FHIA 3I69A 3EMXA 3TDGA 5DQSA 3UARA 5IMZA 3C73A 1BJXA 2GT6A 3VFIA 4K6XA 4NAXA 3IRAA 4XCSA 3KTBA 3LEFA 3TKPA 1PMTA 1K0DA 5IMCA 2B1KA 4G9HA 5ABRA 2YPMA 2PVQA 6GSYA 4DVCA 4BWSA 1H4OA 1X9SB 3H93A 4EKZA 1AW9A 3FZ9A 1X5CA 1Z7RA 2MZCA 6GSVA 1FG4A 3D4MA 2IFQB 3NZNA 3G9BA 4NHWA 3KTLA 3CRTA 1M7TA 2X8CA 3ZRDA 2B1LA 1A8LA 2JADA 3IC4A 1ZOFA 1N8JA 1A8YA 4WKWA 3LQ7A 4EDZA 2X64A 2IWTA 1MD4A 2OE1A 1GNWA 3GRXA 3LORA 4IW9A 1ZZYA 2B7JA 5ECHB 4LLRA 1G6WA 2CZ3A 1A2MA 6GSXA 4TN8A 16GSA 2CV4A 4X0XA 2JU5A 5IMVA 5B8BA 3PH9A 3GYKA 3VPTA 3GHAA 1J08A 4JR6A 4ZBBA 2DJ2A 4MF6A 3GKXA 2EC4A 1O7UA 4RQXA 1XCCA 3IV4A 1WPIA 5ID2B 2LRCA 5IMDA 5ECNB 2LUSA 4WR5A 3BJ5A 4PNFA 2NTOA 2HXKA 4IQ1A 3QDNA 1F6MC 1FVJA 1THOA 1MTCA 3GSSA 5JWRB 1XOAA 18GSA 1THXA 4MJBA 3A2XA 3ZMKA 2RUEA 2GDRA 2XPEA 1Z6MA 4MCUA 1LBKA 2I4AA 3DXBA 3AY8A 1TRVA 5ECMB 1BQ7A 3E3EA 2L59A 4GRFA 2AB6A 1UA5A 2OKAA 1R4WA 1XW6A 2PN8A 4WBJA 5IMAA 1GTUA 4YQUA 5AN1A 4TKYA 3FW2A 1AQWA 2MMAA 4BVYA 1TJDA 3QR6A 3IK7A 5B6NA 1F9MA 2VL3A 2RLIA 4N30A 2FA4A 4EF0A 3CTGA 2CZ2A 3DVXA 5HFIA 4J2FA 2C4JA 3RDWA 3FY7A 4F82A 3HD5A 1T7PB 5KN3A 3KM6A 1Q4JA 5JWOB 2VL9A 2LV3A 1E6BA 2IMIA 1R5AA 2IJYA 2VOCA 3ME7A 4CDOA 3Q6OA 3KMOA 3DGQA 1PA3A 2K9FA 2AV4A 1PKZA 1M2BA 2WULA 4MH2A 1OE8A 2X8GA 1SJIA 3F9UA 2FHEA 4KE3A 5F8BA 3WGDA 1S3CA 2YOIA 2VO4A 3OR5A 1NSWA 1SENA 3QD9A 1OC3A 2H0HA 3NIVA 4V2LA 2D2ZA 4X43A 4O5RA 2IMFA 3TKQA 1U3AA 3KH7A 2VM2A 4ML1A 4I8BA 4KAEA 1OC9B 2VL2A 2P5QA 5DDLA 1ZCPA 3G7IA 5LNKe 1AIUA 1PKWA 4XTSA 11GSA 4O7HA 3P8WA 3WGXA 1KNGA 1U3IA 5IM9A 4ZL8A 1IYIA 4GXZA 1QK8A 2F8AA 4ULXA 4GCIA 2PGTA 1YF0A 4NV2A 2JZTA 1SK2A 3US3A 1SK1A 2ALBA 4RQRA 5HQPA 1GL8A 4POKA 1URMA 2J23A 1PSQA 4OFNA 3HZ8A 4ZBDA 1VF1A 2C3QA 3LSZA 1XOBA 3ZMLA 1M0UA 1YKCA 3FRCA 1XIYA 3QAWA 4L5LA 1M9AA 3TJJA 3WD6A 2JSZA 2B5YA 1GLQA 2DMMA 1MDIA 1X5EA 1QQ2A 3LJRA 2CVBA 1PGTA 2G0FA 3U6VA 1XWBA 1JFUA 3H8QA 1SL1B 2L6CA 2QC7A 4FYCA 1RW1A 2E0QA 5EY6A 2XC2A 3KXOA 4POBA 3VI7A 1SL0B 1K0BA 4HUAA 4J57E 17GSA 3DVWA 1YEXA 4RI6A 4NPBA 1QXHA 2MMZA 3QFBC 2MMNA 3GKMA 2B5XA 3H1NA 3I43A 4EE0A 1X0RA 2VD0A 5G5FA 1Z5YE 1TU7A 2PWJA 4BWQA 1GUHA 1SKSB 3HXSA 4DSSB 4PGTA 3EYTA 3H79A 4TR0A 4GWRA 1EWXA 4RUVA 10GSA 3WT1A 2EIQA 5KN2A 3IDVA 4XS4A 4BPYA 3HA9A 3EU4A 5ECIB 1WP0A 4YAPA 1Q98A 1F37A 1ZMAA 1FW1A 2REMA 5LCZA 2M72A 2JL4A 5EL8A 2F9SA 3FK8A 2FY6A 1KEBA 3F4TA 2H1DA 4MA9A 4MF7A 2A2SA 4N11A 2H73A 3HJOA 1ILOA 3TKSC 4ECBA 4E8EA 2LS5A 3MAKA 3O6TA 3LFLA 3RPPA 2HE3A 1UC7A 3V1WA 5DJLA 2R3XA 1GSFA 5B6MA 2L57A 1Z9HA 3FKFA 4QL9A 3ZITA 1OAZA 4LL4B 4NV5A 4DSSA 2FWHA 2YWMA 3VWUA 2JACA 8GSSA 5CNWA 1ZGNA 4AGSA 4ZIJA 3F6FA 1SJ6A 4DSRA 3ERFA 4K8MA 2LJKA 2BMXA 2ZNMA 3UVHA 4L0WA 1T4YA 3ZIVA 4GQFA 2HZFA 2VUPA 1GSUA 1WE0A 4JR4A 6GSUA 1CQGA 2R37A 4MZWA 1K0AA 1TXXA 3QMXA 1XW5A 1G6YA 3ZFLA 4V2MA 1YZXA 2OBKA 1SYXA 3VWVA 2X8HA 5L71A 2GLRA 5DALA 19GSA 4MMMA 1EP7A 1A0FA 1DBYA 4YQMA 3BCIA 3U5RE 4DSQA 5JWQB
chains in the Genus database with same CATH superfamily
3QCPA 1GSQA 1M99A 2I9HA 1SU9A 3MWHA 5J9CA 3LGCA 2C3NA 3LXZA 4WEYA 1B8XA 4JU5A 3VK9A 4X4JA 4CW9A 3FR3A 4K7NA 1GSYA 4TW5A 1WJKA 4G10A 3HVXA 4KDYA 4OFMA 2DIYA 2P31A 1TKDB 5A4VA 5A5KA 3C7MA 5HFKA 4HJ2A 1OC8A 1V98A 2HRKA 1TTZA 1PX6A 4BVXA 1GULA 4TXOA 4I2UA 3CQFA 3MDKA 5ECOB 2GSTA 1ACVA 4ECIA 4ZB9A 4K7IA 1DUGA 1G0TA 1KBNA 1WRYA 4OCEA 3TRPA 3S9FA 2WGRA 4NWYA 4Z2TA 4K1FA 1S3DA 2NDOA 4EDYA 1ZL9A 4MH3A 5D9TA 2A2RA 3EC3A 4MZBA 3VPQA 1ON4A 1JLWA 1WOUA 2AYTA 2GT5A 2ZCTA 3FR9A 2KUCA 4JRRA 3I6AA 5HR2A 4N0ZA 1FB0A 3KMNA 3TJKA 4GSTA 3E0UA 1FOVA 2B3SA 5ENUA 2CVDA 3DKSA 2OE3A 4LA1A 2C1YA 3HYPA 3FYGA 1GP1A 3GL5A 4GSSA 1GSSA 3GFKA 2FNOA 3KD0A 2VCWA 1QGVA 1TDIA 3CBUA 4ZBAA 5KN0A 4WF5A 2H6ZA 4EO3A 1RK4A 1HNBA 4Q5RA 3FR6A 4EUYA 4PXOA 1SK0A 2YNXA 1TK8B 3UJ1A 1M2AA 5EPFA 1YEPA 4JEDA 4KSOA 2BTOT 4O92A 1FVKA 4FQUA 4IKHA 3KCMA 2FGXA 2N5BA 2LJAA 4F0CA 1PD21 1OKTA 2WJUA 3HHVA 2AHEA 1XG8A 3H4KA 4HU7A 1K0CA 1JZOA 2LRNA 2L6DA 4YH2A 1XVQA 4BVYB 3M3MA 5DCGA 4O5QA 2F3MA 1EEMA 3Q18A 4TRXA 4YAVA 4QQ7A 2VLVA 5A4WA 3A2WA 4KW6A 2C0EA 4IQAA 3UOMA 2OA7A 5ECSA 5HR0A 1XXUA 2L4CA 4K2DA 3GTUA 4ISDA 5B7CA 1E2YA 1M3JA 2YCDA 2IL3A 2QKEA 4KA0A 5E59A 1HYUA 2H1BA 3TUEA 1QFNA 3ZREA 2WS2A 3MNGA 2K8SA 4JBBA 1H75A 2GQMA 3M9KA 2GSQA 1A2LA 2H6YA 2YJ7A 5F06A 2IMEA 3C1SA 3HDCA 3QFAC 4XS1A 3IA1A 3TOUA 3FZ4A 2YV9A 2DSAA 2A2PA 2IPAA 4D73A 4HI7A 2H0IA 3TJBA 3FHKA 4KF9A 5DJMA 2CAQA 3VLNA 5D9XA 22GSA 4MK3A 4ZXGA 2WDUA 1JLVA 2H8LA 3KP9A 3VURA 1HNAA 3LG6A 2Z9SA 5H5QA 1VRSD 3EMPA 3EU3A 4ILFA 1X5DA 2OBIA 1TRWA 2KP1A 1IYHA 2MBSA 2DJKA 3WT2A 2WFCA 2GQLA 1MEKA 5ELAA 4EVMA 2IMKA 1GUMA 4I2TA 2F51A 3LYPA 4EL1A 1HD2A 2PERA 3APSA 2QA2A 3F3QA 4KB3A 3P2AA 3C1RA 2R6KA 4ECJA 2FWEA 4F2IA 2DJ0A 3DD3A 2GZYA 1KTEA 1FHEA 1EV9A 5CO3A 5GSSA 4N0VA 2HZEA 3KIJA 5ELGA 1EOHA 4L5OA 2HYXA 2DJ3A 3F4RA 5ECKB 1AXDA 2C8UA 4OWYA 5G1KA 1UN2A 4MDCA 4GTUA 3C71A 2C0DA 2CQ9A 5IPHA 2KOKA 5H5RA 1OKDA 4KDUA 2WRTA 1PL1A 3TKSA 1GUKA 2KP2A 1A0RP 3ZZXA 5GSTA 3HVNA 5DAKA 4PUAA 4HEA2 3HKRA 1USBA 1TK5B 2L5LA 1O73A 3A5WA 4K9ZA 3HVSA 3CSHA 4P3YB 1M2DA 1W4VA 4HS1A 5AIVA 3GN3A 2ON7A 2X99A 3F63A 3PGTA 2TRCP 3WYWA 3A3TA 4XHMA 1SJZA 2RUFA 4FH8A 1PN9A 1PN0A 4XS4B 1BEDA 1GTAA 3KZQA 4MJCA 2A4HA 2I1UA 3G7YA 2XBIA 4POLA 2AJQB 1GRXA 12GSA 4TR4A 2LTKA 5IIZA 4F9ZA 4HDEA 4PQIA 5JCWA 1XBSA 2HRNA 4Q5FA 2FUG2 2VD1A 1GSEA 4V1Ap 3Q19A 1Z6NA 1EGRA 5IO2A 3ZIJA 2GZZA 3IXRA 4J56E 5J9BA 2I3YA 3HVVA 2RM6A 3F4SA 4KCEA 4WXTA 4AJ7A 2KLXA 5EVOA 1XVWA 1OYJA 2H1GA 5G2ZA 2VCZA 2K8VA 2N5FA 2YV7A 3L4NA 4TOPA 2H1AA 3GA4A 4F03A 3BCKA 5AGYA 5IQYA 1Z3EA 4FIWA 4HOJA 2VCTA 3ZYWA 7GSSA 3GH6A 2MYGA 1K3LA 3FZAA 1TK0B 5KOWA 1XWCA 4G2EA 3R2QA 2CX3A 2OACA 2PU9C 9GSSA 3CYNA 4IJIA 5J41A 5IO0A 2LRTA 2K18A 2JZRA 2RIIA 5DALB 5B8AA 1B9YC 20GSA 3FZ5A 3IBHA 1XWKA 3W6GA 3NOFA 3UIWA 2HT9A 2OADA 4V1Ag 4IJ3A 2B6MA 3P90A 2O8VB 3W8SA 2H70A 2E7PA 3DMLA 4BL7A 2QA1A 1JZRA 4MNNA 1O85A 2E2MA 1EOGA 1VF4A 2A4VA 2BJXA 4TXVA 1FOHA 4KX4A 3F3RA 4BVXB 4TXOB 5HR1A 3EE2A 1YY7A 4TR1A 1TP9A 4FYBA 2AUVA 2L4QA 1LU4A 5ECPB 2DJJA 4GLTA 2WCIA 5F0GA 1B4PA 4K5SA 3TRQA 2H71A 1V40A 5ECQB 1T1VA 4K2XA 5ECLB 1O8WA 4IELA 2IMDA 1HNCA 2F8FA 2H01A 3P7XA 4TR3A 3RBTA 3RHCA 2HLSA 2H72A 4MABA 3RAZA 2GSRA 2H74A 2X4AA 2HRFA 2HSHA 5IOWA 4OFTA 1A23A 3EINA 2EIOA 3GX0A 2DMLA 2C80A 3LW9A 2CT6A 1BX9A 4NXIA 1OE7A 1XPVA 4BA7A 3GMFA 1TOFA 1U87A 1YJ6A 3UEMA 2DKHA 3RHBA 3KP8A 1K3OA 1W89A 3IC8A 5KEJA 1ML6A 2VM1A 3IOSA 3UBKA 3GIXA 3MYDA 4HZ4A 4HU9A 4OCFA 1YF1A 3BOAA 3RPNA 5CP1A 4WBRD 4OO5A 4K7OA 3HZ4A 1F3BA 2QSIA 2H0GA 4PQHA 4MJAA 4LMWA 3A2VA 14GSA 5ECRB 1YKAA 3ZL5A 2G2QA 3M9JA 4MJEA 3UMAA 3ISOA 1YDKA 4PURA 2AAWA 3LYKA 4MP4A 5CRWA 3TJFA 3GURA 5IMFA 4MLYA 4IP1A 1SD8A 4G0LA 1T4ZA 4WETA 1VF3A 3IR4A 2PMTA 2O85A 2GZPA 3LXTA 2C0FA 3GX8A 4GSNA 3CSIA 3R3EA 1RQMA 4LL1B 1X9MB 4I6XA 1N2AA 2I81A 2QGVA 3TKSE 4FO5A 2FCHA 1TRSA 1B48A 1BYEA 1WWJA 3GTUB 4MZCA 1AQVA 1EGOA 1GSDA 4JE1A 1K3YA 1MDJA 1ABAA 3GH9A 3N5OA 3BBYA 3WGEA 1TI3A 3GV1A 4X1UA 1DSBA 2CA8A 1R26A 4L0UA 3O76A 3QOUA 4PUFC 2R2JA 3D0ZA 1V58A 1TW9A 3EURA 4PQ1A 1AQXA 1XWAA 2DJ1A 2XBQA 1XWGA 4XIHA 4IVFA 5F07A 2PVOC 2HI7A 4D73B 1S3RA 5KN1A 4GF0A 2H30A 4LMVA 5H5SA 1A24A 4PTSA 2VCQA 2J9HA 1GTBA 5G1LA 3TB2A 3L0HA 1ERVA 2DIZA 2V1MA 1TRUA 3KH9A 5D96A 4Z7XA 3QAGA 5G31A 4AJ6A 2R4VA 2PBJA 2FD3A 1AC1A 4KH7A 4BIKA 1B4QA 2VCVA 4KNDA 3HY2A 2N5AA 3GUSA 1OVNA 3D5JA 4ZL7A 3CRUA 5GAPD 1I5GA 4XS6A 5A4UA 1O8XA 2L5OA 4I5QA 2XHFA 2V6KA 4KCAA 2LNSA 4N10A 5FT3A 5IPGA 3QPMA 1ZYQB 5BRTA 3UAPA 2IFQA 3W8JA 6GSSA 2YWNA 5E4WA 4XRDA 2HZEB 2NPBA 3ZTLA 1NW2A 3SBCA 4HSCX 4G0KA 4IBPA 4ACSA 1JZWA 4K0GA 2K6VA 3EVIA 4WR4A 2V41A 5HFGA 3EPTA 2YANA 1K0MA 2H6XA 3ZVJD 1VGLA 3M1GA 1Y6EA 3IK9A 4CY8A 5D9WA 2H76A 3ZLPA 1WMJA 4O32A 1EZKA 4Q5NA 2DLXA 1O81A 4KGIA 2FLSA 1JHBA 1PQNA 3JCML 2HNLA 3VWXA 1QMVA 1J0FA 4CHSA 3Q74A 2WB9A 3TJGA 4PX1A 4EIQA 5ID2A 4JZQA 1XW9A 1MD3A 2YZUA 5DAKB 2VCXA 4TVEA 3DRNA 5COHA 2E2GA 3QAVA 3TGZA 4ZB6A 2OJLA 4HQZA 4H86A 3IPZA 3D22A 3ED3A 2DBCA 4WF4A 3F0IA 3GKKA 1ERTA 3D21A 3PINA 1AAZA 1MDKA 1XFLA 3ERGA 2H19A 2LQQA 2YP6A 3IHQA 3TCOA 4PNGA 4IS0A 4O5UA 3APOA 2NBSA 1PL2A 4KSMA 3GL3A 5AISA 2LKUA 4Z2UA 3SWLA 2FA8A 4DEJA 1J9BA 3CXGA 3O3TA 2V32A 3D6IA 1T00A 1ZYEA 4ICYA 4USSA 3DWVA 4KUNA 5J5NA 1TU8A 2LQOA 2GVPA 4K5RA 1GNEA 1EP8A 2R0GA 1NHYA 1G7EA 5DBQA 2M80A 2PUKC 3HJMA 4EXJA 1TI1A 1CQHA 3C8EA 3F8UA 2H66A 4I97A 5CYYA 3GKNA 3L9SA 3M0FA 1ST9A 2ES7A 2LEGA 4QL7A 2HSYA 4ZB8A 1F3AA 2M46A 3IAM2 1X9WB 3MIXA 2R5GA 3UL3A 4IGJA 2V6OA 3ZVJA 2P5RA 2CVKA 3CMIA 1NM3A 4XRAA 1R5PA 4ZL9A 3I9V2 3KEBA 5J3RA 1PFOA 5LD0A 3LWAA 4HQSA 2O7KA 4AJ8A 1Z7PA 5CREA 3FEUA 3EWLA 1B9XC 1GWCA 2VLUA 3IHGA 3M8NA 2UZ8A 3ME8A 1WIKA 2IN3A 1GTIA 3E9JB 2CX4A 2MMOA 1FAAA 2C3TA 1F2EA 5JCUA 1DE2A 2O87A 4IHUA 4MPGA 1YQ1A 5DCHA 3J7Yk 4EC0A 1OC9A 5G5EA 2OE0A 3CTFA 1GH2A 5AIXA 2LJRA 4BL7B 2P0GA 1VF2A 4ID0A 2MBTA 2C0GA 3CSJA 6GSWA 4ZILA 3UBLA 1I9DA 4KDXA 1ERWA 3G7JA 4HJMA 3IAS2 4TR1B 3UVTA 2CAIA 5CRHA 4OMVA 2DKIA 2GQKA 1SYRA 2ZUPA 2TRXA 1G7OA 2YZHA 3TRXA 2ON5A 2PPTA 4IP6A 3VWWA 2VLTA 5CAXA 4ECCA 3ZFBA 4AF2A 2R0CA 2VL2C 4F0BA 5DQYA 3DYRA 3VI5A 1DE1A 2B5EA 4IN0A 2LSTA 4E8HA 4RI7A 1LJRA 3F6DA 1C72A 3PR8A 5J4UA 5CRDA 3L78A 2FWFA 3ERWA 3L9UA 4MPFA 2WZ9A 1K0OA 1T3BA 2NVLA 5F05A 4G19A 1PX7A 2HSMA 4ML6A 1NHOA 3TKRA 5JCGA 1SKWB 5DVBA 1SL2B 4K0NA 2V2GA 1V9WA 3HJPA 1BAYA 5HR3A 2YN1A 1SD9A 2O89A 2YJHA 2YWIA 2GTUA 1A2JA 1V57A 6GSTA 1FB6A 5C04A 4OO4A 1T8EB 3BD2A 2KHPA 1R7HA 4Q5QA 1UVZA 5G30A 4YQVA 1V2AA 1U6TA 3L9VA 3GSTA 1K0NA 5FWGA 1Y25A 1ZYPA 4OD7A 3APQA 3N9JA 4MF5A 4CY6A 2DC5A 2VAFA 4V2NA 1HQOA 2JSYA 5INYA 2B7KA 1PRXA 3MSZA 3TOTA 1M9BA 1JZDA 5GAND 2LNTA 1O6JA 2FWGA 1GLPA 3J7Yb 2YWOA 3KGKA 4GQCA 2XPDA 5GZZB 13GSA 2H75A 4POMA 2HFDA 1SKRB 5D8IA 2VIMA 3KJYA 3D4TA 2EIRA 5D73A 1BG5A 3DIEA 4HZ2A 1EV4A 2GS3A 1FO5A 1U88A 1QUWA 4NHZA 2RM5A 2GSSA 4FYUA 3GNJA 3DEXA 4NMUA 1EEJA 2GGTA 1XZOA 1ERUA 5C00A 2TIRA 3HCZA 2IIYA 5D93A 4L8EA 3K8NA 5D9VA 5CRGA 1AUCA 3FMWA 2JZSA 5IOXA 3IE3A 1S3AA 5FHIA 3I69A 3EMXA 3TDGA 5DQSA 3UARA 5IMZA 3C73A 1ZYNA 1BJXA 3A5IA 2GT6A 4Z2RA 3VFIA 4K6XA 4NAXA 3IRAA 4XCSA 3KTBA 3LEFA 3TKPA 1PMTA 1K0DA 5IMCA 2B1KA 4G9HA 5ABRA 2YPMA 2PVQA 6GSYA 5BMUA 4DVCA 4BWSA 1M3IA 1H4OA 1X9SB 3H93A 4EKZA 1AW9A 3FZ9A 1X5CA 1Z7RA 2MZCA 6GSVA 1FG4A 3D4MA 2IFQB 3NZNA 3G9BA 4NHWA 3KTLA 3CRTA 1M7TA 2X8CA 3ZRDA 2B1LA 1A8LA 2JADA 3IC4A 1ZOFA 1N8JA 1A8YA 4WKWA 3LQ7A 4EDZA 2X64A 2IWTA 1MD4A 2OE1A 1GNWA 3GRXA 3LORA 4IW9A 1ZZYA 2B7JA 5ECHB 4LLRA 1G6WA 2CZ3A 1A2MA 6GSXA 4TN8A 16GSA 2CV4A 4X0XA 2JU5A 5KOXA 5IMVA 5B8BA 3PH9A 3GYKA 3VPTA 3GHAA 1J08A 4JR6A 4ZBBA 2DJ2A 4MF6A 3GKXA 2EC4A 1O7UA 4RQXA 1XCCA 3IV4A 1WPIA 5ID2B 2LRCA 5IMDA 5ECNB 2LUSA 4WR5A 3BJ5A 4PNFA 2NTOA 2HXKA 4IQ1A 4YKFA 3QDNA 1F6MC 1FVJA 1THOA 1MTCA 3GSSA 5JWRB 1XOAA 18GSA 1THXA 4MJBA 3A2XA 3ZMKA 2X49A 2RUEA 2GDRA 2XPEA 1Z6MA 4MCUA 1LBKA 2I4AA 3DXBA 3AY8A 1TRVA 5ECMB 1BQ7A 3E3EA 2L59A 4GRFA 2AB6A 1UA5A 2OKAA 1R4WA 1XW6A 2PN8A 4WBJA 5IMAA 1GTUA 4YQUA 5AN1A 4TKYA 3FW2A 1AQWA 2MMAA 4BVYA 1TJDA 3QR6A 3IK7A 5B6NA 1F9MA 2VL3A 2RLIA 4N30A 2FA4A 4EF0A 3CTGA 2CZ2A 4YKGA 3DVXA 5HFIA 4J2FA 2C4JA 3RDWA 3FY7A 4F82A 3HD5A 1T7PB 5KN3A 3KM6A 1Q4JA 5JWOB 2VL9A 2LV3A 1E6BA 2IMIA 1R5AA 2R0PA 2IJYA 2VOCA 3ME7A 4CDOA 3Q6OA 3KMOA 3DGQA 1PA3A 2K9FA 2AV4A 1PKZA 1M2BA 2WULA 4MH2A 1OE8A 2X8GA 1SJIA 3F9UA 2FHEA 4KE3A 5F8BA 3WGDA 1S3CA 2YOIA 2VO4A 3OR5A 1NSWA 1SENA 3QD9A 1OC3A 2H0HA 3NIVA 4V2LA 4EIPA 2D2ZA 4X43A 4O5RA 2IMFA 3TKQA 1U3AA 3KH7A 2VM2A 4ML1A 4I8BA 4KAEA 1OC9B 2VL2A 2P5QA 5DDLA 1ZCPA 3G7IA 5LNKe 1AIUA 1PKWA 4XTSA 11GSA 4O7HA 3P8WA 3WGXA 1KNGA 1U3IA 5IM9A 4ZL8A 1IYIA 4G0IA 2HRAA 1QK8A 2F8AA 4GXZA 4ULXA 4GCIA 2PGTA 1YF0A 4NV2A 2JZTA 1SK2A 3US3A 1SK1A 2ALBA 4RQRA 5HQPA 1GL8A 4POKA 1URMA 2J23A 1PSQA 4OFNA 3HZ8A 4ZBDA 1VF1A 2C3QA 3PPUA 3LSZA 1XOBA 3ZMLA 1M0UA 1YKCA 3FRCA 1XIYA 3QAWA 4L5LA 1M9AA 3TJJA 3WD6A 2JSZA 2B5YA 1GLQA 2DMMA 1MDIA 1X5EA 1QQ2A 3LJRA 2CVBA 1PGTA 2G0FA 3U6VA 1XWBA 1JFUA 3H8QA 1SL1B 2L6CA 2QC7A 4FYCA 1RW1A 2E0QA 5EY6A 2XC2A 3KXOA 4POBA 3VI7A 1SL0B 1K0BA 4HUAA 4J57E 17GSA 3DVWA 1YEXA 4RI6A 4NPBA 1QXHA 2MMZA 3QFBC 2MMNA 4A5PA 3GKMA 2B5XA 3H1NA 3I43A 4EE0A 1X0RA 2VD0A 5G5FA 1Z5YE 1TU7A 2PWJA 4BWQA 1GUHA 1SKSB 3HXSA 4DSSB 4PGTA 3EYTA 3H79A 4TR0A 4GWRA 1EWXA 4RUVA 10GSA 3WT1A 2EIQA 5KN2A 3IDVA 4XS4A 4BPYA 3HA9A 3EU4A 5ECIB 1WP0A 4YAPA 1Q98A 1F37A 1ZMAA 1FW1A 2REMA 5LCZA 2M72A 2JL4A 5EL8A 2F9SA 3FK8A 2FY6A 1KEBA 3F4TA 2H1DA 4MA9A 4MF7A 2A2SA 4N11A 2H73A 3HJOA 1ILOA 3TKSC 4ECBA 4E8EA 2LS5A 3MAKA 3O6TA 3LFLA 3RPPA 2HE3A 1UC7A 3V1WA 5DJLA 2R3XA 1GSFA 5B6MA 2L57A 1Z9HA 3FKFA 4QL9A 3ZITA 1OAZA 4LL4B 4NV5A 4DSSA 2FWHA 2YWMA 3VWUA 2JACA 8GSSA 5CNWA 1ZGNA 4AGSA 4ZIJA 3F6FA 1SJ6A 4DSRA 3ERFA 4K8MA 2LJKA 2BMXA 2ZNMA 3UVHA 4L0WA 1T4YA 3ZIVA 4GQFA 2HZFA 2VUPA 1GSUA 1WE0A 4JR4A 6GSUA 1CQGA 2R37A 4MZWA 1K0AA 1TXXA 3QMXA 1XW5A 1G6YA 3ZFLA 4V2MA 1YZXA 2OBKA 1SYXA 3VWVA 2X8HA 5L71A 2GLRA 5DALA 19GSA 4MMMA 1EP7A 1A0FA 1DBYA 4YQMA 3BCIA 3U5RE 4DSQA 5JWQB
chains in the Genus database with same CATH topology
3QCPA 1GSQA 1M99A 2I9HA 1SU9A 3MWHA 5J9CA 3LGCA 2C3NA 3LXZA 4WEYA 1B8XA 4JU5A 3VK9A 4X4JA 4CW9A 3FR3A 4K7NA 1GSYA 4TW5A 1WJKA 4G10A 3HVXA 4KDYA 4OFMA 2DIYA 2P31A 1TKDB 5A4VA 5A5KA 3C7MA 5HFKA 4HJ2A 1OC8A 1V98A 2HRKA 1TTZA 1PX6A 4BVXA 1GULA 4TXOA 4I2UA 3MDKA 5ECOB 2GSTA 1ACVA 4ECIA 4ZB9A 4K7IA 1DUGA 1G0TA 1KBNA 1WRYA 4OCEA 3TRPA 3S9FA 2WGRA 4NWYA 4Z2TA 4K1FA 1S3DA 2NDOA 4EDYA 1ZL9A 4MH3A 5D9TA 2A2RA 3EC3A 4MZBA 3VPQA 1ON4A 1JLWA 1WOUA 2AYTA 2GT5A 2ZCTA 3FR9A 2KUCA 4JRRA 3I6AA 5HR2A 4N0ZA 1FB0A 3KMNA 3TJKA 4GSTA 3E0UA 1FOVA 2B3SA 5ENUA 2CVDA 3DKSA 2OE3A 4LA1A 2C1YA 3HYPA 3FYGA 1GP1A 3GL5A 4GSSA 1GSSA 3GFKA 2FNOA 3KD0A 2VCWA 1QGVA 1TDIA 3CBUA 4ZBAA 5KN0A 4WF5A 2H6ZA 4EO3A 1RK4A 1HNBA 4Q5RA 3FR6A 4EUYA 4PXOA 1SK0A 2YNXA 1TK8B 3UJ1A 1M2AA 5EPFA 1YEPA 4JEDA 4KSOA 2BTOT 4O92A 1FVKA 4FQUA 4IKHA 3KCMA 2FGXA 2N5BA 2LJAA 4F0CA 1PD21 1OKTA 2WJUA 3HHVA 2AHEA 3H4KA 4HU7A 1K0CA 1JZOA 2LRNA 2L6DA 4YH2A 1XVQA 4BVYB 3M3MA 5DCGA 4O5QA 2F3MA 1EEMA 3Q18A 4TRXA 4YAVA 4QQ7A 2VLVA 5A4WA 3A2WA 4KW6A 2C0EA 4IQAA 3UOMA 2OA7A 5ECSA 5HR0A 1XXUA 2L4CA 4K2DA 3GTUA 4ISDA 5B7CA 1E2YA 2YCDA 2IL3A 2QKEA 4KA0A 5E59A 1HYUA 2H1BA 3TUEA 1QFNA 3ZREA 2WS2A 3MNGA 2K8SA 4JBBA 1H75A 2GQMA 3M9KA 2GSQA 1A2LA 2H6YA 2YJ7A 5F06A 2IMEA 3C1SA 3HDCA 3QFAC 4XS1A 3IA1A 3TOUA 3FZ4A 2YV9A 2DSAA 2A2PA 2IPAA 4D73A 4HI7A 2H0IA 3TJBA 3FHKA 4KF9A 5DJMA 2CAQA 3VLNA 5D9XA 22GSA 4MK3A 4ZXGA 2WDUA 1JLVA 2H8LA 3KP9A 3VURA 1HNAA 3LG6A 2Z9SA 5H5QA 1VRSD 3EMPA 3EU3A 4ILFA 1X5DA 2OBIA 1TRWA 2KP1A 1IYHA 2MBSA 2DJKA 3WT2A 2WFCA 2GQLA 1MEKA 5ELAA 4EVMA 2IMKA 1GUMA 4I2TA 2F51A 3LYPA 4EL1A 1HD2A 2PERA 3APSA 2QA2A 3F3QA 4KB3A 3P2AA 3C1RA 2R6KA 4ECJA 2FWEA 4F2IA 2DJ0A 3DD3A 2GZYA 1KTEA 1FHEA 1EV9A 5CO3A 5GSSA 4N0VA 2HZEA 3KIJA 5ELGA 1EOHA 4L5OA 2HYXA 2DJ3A 3F4RA 5ECKB 1AXDA 2C8UA 4OWYA 5G1KA 1UN2A 4MDCA 4GTUA 3C71A 2C0DA 2CQ9A 5IPHA 2KOKA 5H5RA 1OKDA 4KDUA 2WRTA 1PL1A 3TKSA 1GUKA 2KP2A 1A0RP 3ZZXA 5GSTA 5DAKA 4PUAA 4HEA2 3HKRA 1USBA 1TK5B 2L5LA 1O73A 3A5WA 4K9ZA 3HVSA 3CSHA 4P3YB 1M2DA 1W4VA 4HS1A 5AIVA 3GN3A 2ON7A 2X99A 3F63A 3PGTA 2TRCP 3WYWA 3A3TA 4XHMA 1SJZA 2RUFA 4FH8A 1PN9A 1PN0A 4XS4B 1BEDA 1GTAA 3KZQA 4MJCA 2A4HA 2I1UA 3G7YA 2XBIA 4POLA 2AJQB 1GRXA 12GSA 4TR4A 2LTKA 5IIZA 4F9ZA 4HDEA 4PQIA 5JCWA 1XBSA 2HRNA 4Q5FA 2FUG2 2VD1A 1GSEA 4V1Ap 3Q19A 1Z6NA 1EGRA 5IO2A 3ZIJA 2GZZA 3IXRA 4J56E 5J9BA 2I3YA 3HVVA 2RM6A 3F4SA 4KCEA 4WXTA 4AJ7A 2KLXA 5EVOA 1XVWA 1OYJA 2H1GA 5G2ZA 2VCZA 2K8VA 2N5FA 2YV7A 3L4NA 4TOPA 2H1AA 3GA4A 4F03A 3BCKA 5AGYA 5IQYA 1Z3EA 4FIWA 4HOJA 2VCTA 3ZYWA 7GSSA 3GH6A 2MYGA 1K3LA 3FZAA 1TK0B 5KOWA 1XWCA 4G2EA 3R2QA 2CX3A 2OACA 2PU9C 9GSSA 3CYNA 4IJIA 5J41A 5IO0A 2LRTA 2K18A 2JZRA 2RIIA 5DALB 5B8AA 1B9YC 20GSA 3FZ5A 3IBHA 1XWKA 3W6GA 3NOFA 3UIWA 2HT9A 2OADA 4V1Ag 4IJ3A 2B6MA 3P90A 2O8VB 3W8SA 2H70A 2E7PA 3DMLA 4BL7A 2QA1A 1JZRA 4MNNA 1O85A 2E2MA 1EOGA 1VF4A 2A4VA 2BJXA 4TXVA 1FOHA 4KX4A 3F3RA 4BVXB 4TXOB 5HR1A 3EE2A 1YY7A 4TR1A 1TP9A 4FYBA 2AUVA 2L4QA 1LU4A 5ECPB 2DJJA 4GLTA 2WCIA 5F0GA 1B4PA 4K5SA 3TRQA 2H71A 1V40A 5ECQB 1T1VA 4K2XA 5ECLB 1O8WA 4IELA 2IMDA 1HNCA 2F8FA 2H01A 3P7XA 4TR3A 3RBTA 3RHCA 2HLSA 2H72A 4MABA 3RAZA 2GSRA 2H74A 2X4AA 2HRFA 2HSHA 5IOWA 4OFTA 1A23A 3EINA 2EIOA 3GX0A 2DMLA 2C80A 3LW9A 2CT6A 1BX9A 4NXIA 1OE7A 1XPVA 4BA7A 3GMFA 1TOFA 1U87A 1YJ6A 3UEMA 2DKHA 3RHBA 3KP8A 1K3OA 1W89A 3IC8A 5KEJA 1ML6A 2VM1A 3IOSA 3UBKA 3GIXA 3MYDA 4HZ4A 4HU9A 4OCFA 1YF1A 3BOAA 3RPNA 5CP1A 4WBRD 4OO5A 4K7OA 3HZ4A 1F3BA 2QSIA 2H0GA 4PQHA 4MJAA 4LMWA 3A2VA 14GSA 5ECRB 1YKAA 3ZL5A 2G2QA 3M9JA 4MJEA 3UMAA 3ISOA 1YDKA 4PURA 2AAWA 3LYKA 4MP4A 5CRWA 3TJFA 3GURA 5IMFA 4MLYA 4IP1A 1SD8A 4G0LA 1T4ZA 4WETA 1VF3A 3IR4A 2PMTA 2O85A 2GZPA 3LXTA 2C0FA 3GX8A 4GSNA 3CSIA 3R3EA 1RQMA 4LL1B 1X9MB 4I6XA 1N2AA 2I81A 2QGVA 3TKSE 4FO5A 2FCHA 1TRSA 1B48A 1BYEA 1WWJA 3GTUB 4MZCA 1AQVA 1EGOA 1GSDA 4JE1A 1K3YA 1MDJA 1ABAA 3GH9A 3N5OA 3BBYA 3WGEA 1TI3A 3GV1A 4X1UA 1DSBA 2CA8A 1R26A 4L0UA 3O76A 3QOUA 4PUFC 2R2JA 3D0ZA 1V58A 1TW9A 3EURA 4PQ1A 1AQXA 1XWAA 2DJ1A 2XBQA 1XWGA 4XIHA 4IVFA 5F07A 2PVOC 2HI7A 4D73B 5KN1A 4GF0A 2H30A 4LMVA 5H5SA 1A24A 4PTSA 2VCQA 2J9HA 1GTBA 5G1LA 3TB2A 3L0HA 1ERVA 2DIZA 2V1MA 1TRUA 3KH9A 5D96A 4Z7XA 3QAGA 5G31A 4AJ6A 2R4VA 2PBJA 2FD3A 1AC1A 4KH7A 1B4QA 2VCVA 4KNDA 3HY2A 2N5AA 3GUSA 1OVNA 3D5JA 4ZL7A 3CRUA 5GAPD 1I5GA 4XS6A 5A4UA 1O8XA 2L5OA 4I5QA 2XHFA 2V6KA 4KCAA 2LNSA 4N10A 5FT3A 5IPGA 3QPMA 1ZYQB 5BRTA 3UAPA 2IFQA 3W8JA 6GSSA 2YWNA 5E4WA 4XRDA 2HZEB 2NPBA 3ZTLA 1NW2A 3SBCA 4G0KA 4IBPA 4ACSA 1JZWA 4K0GA 2K6VA 3EVIA 4WR4A 2V41A 5HFGA 3EPTA 2YANA 1K0MA 2H6XA 3ZVJD 1VGLA 3M1GA 1Y6EA 3IK9A 4CY8A 5D9WA 2H76A 3ZLPA 1WMJA 4O32A 1EZKA 4Q5NA 2DLXA 1O81A 4KGIA 2FLSA 1JHBA 1PQNA 3JCML 2HNLA 3VWXA 1QMVA 1J0FA 4CHSA 3Q74A 2WB9A 3TJGA 4PX1A 4EIQA 5ID2A 4JZQA 1XW9A 1MD3A 2YZUA 5DAKB 2VCXA 4TVEA 3DRNA 5COHA 2E2GA 3QAVA 3TGZA 4ZB6A 2OJLA 4HQZA 4H86A 3IPZA 3D22A 3ED3A 2DBCA 4WF4A 3F0IA 3GKKA 1ERTA 3D21A 3PINA 1AAZA 1MDKA 1XFLA 3ERGA 2H19A 2LQQA 2YP6A 3IHQA 3TCOA 4PNGA 4IS0A 4O5UA 3APOA 2NBSA 1PL2A 4KSMA 3GL3A 5AISA 2LKUA 4Z2UA 3SWLA 2FA8A 4DEJA 1J9BA 3CXGA 3O3TA 2V32A 3D6IA 1T00A 1ZYEA 4ICYA 4USSA 3DWVA 4KUNA 5J5NA 1TU8A 2LQOA 2GVPA 4K5RA 1GNEA 1EP8A 2R0GA 1NHYA 1G7EA 5DBQA 2M80A 2PUKC 3HJMA 4EXJA 1TI1A 1CQHA 3C8EA 3F8UA 2H66A 4I97A 5CYYA 3GKNA 3L9SA 3M0FA 1ST9A 2ES7A 2LEGA 4QL7A 2HSYA 4ZB8A 1F3AA 2M46A 3IAM2 1X9WB 3MIXA 2R5GA 3UL3A 4IGJA 2V6OA 3ZVJA 2P5RA 2CVKA 3CMIA 1NM3A 4XRAA 1R5PA 4ZL9A 3I9V2 3KEBA 5J3RA 5LD0A 3LWAA 4HQSA 2O7KA 4AJ8A 1Z7PA 5CREA 3FEUA 3EWLA 1B9XC 1GWCA 2VLUA 3IHGA 3M8NA 2UZ8A 3ME8A 1WIKA 2IN3A 1GTIA 3E9JB 2CX4A 2MMOA 1FAAA 2C3TA 1F2EA 5JCUA 1DE2A 2O87A 4IHUA 4MPGA 1YQ1A 5DCHA 3J7Yk 4EC0A 1OC9A 5G5EA 2OE0A 3CTFA 1GH2A 5AIXA 2LJRA 4BL7B 2P0GA 1VF2A 4ID0A 2MBTA 2C0GA 3CSJA 6GSWA 4ZILA 3UBLA 1I9DA 4KDXA 1ERWA 3G7JA 4HJMA 3IAS2 4TR1B 3UVTA 2CAIA 5CRHA 4OMVA 2DKIA 2GQKA 1SYRA 2ZUPA 2TRXA 1G7OA 2YZHA 3TRXA 2ON5A 2PPTA 4IP6A 3VWWA 2VLTA 5CAXA 4ECCA 3ZFBA 4AF2A 2R0CA 2VL2C 4F0BA 5DQYA 3DYRA 3VI5A 1DE1A 2B5EA 4IN0A 2LSTA 4E8HA 4RI7A 1LJRA 3F6DA 1C72A 3PR8A 5J4UA 5CRDA 3L78A 2FWFA 3ERWA 3L9UA 4MPFA 2WZ9A 1K0OA 1T3BA 2NVLA 5F05A 4G19A 1PX7A 2HSMA 4ML6A 1NHOA 3TKRA 5JCGA 1SKWB 5DVBA 1SL2B 4K0NA 2V2GA 1V9WA 3HJPA 1BAYA 5HR3A 2YN1A 1SD9A 2O89A 2YJHA 2YWIA 2GTUA 1A2JA 1V57A 6GSTA 1FB6A 5C04A 4OO4A 1T8EB 3BD2A 2KHPA 1R7HA 4Q5QA 1UVZA 5G30A 4YQVA 1V2AA 1U6TA 3L9VA 3GSTA 1K0NA 5FWGA 1Y25A 1ZYPA 4OD7A 3APQA 3N9JA 4MF5A 4CY6A 2DC5A 2VAFA 4V2NA 1HQOA 2JSYA 5INYA 2B7KA 1PRXA 3MSZA 3TOTA 1M9BA 1JZDA 5GAND 2LNTA 1O6JA 2FWGA 1GLPA 3J7Yb 2YWOA 3KGKA 4GQCA 2XPDA 5GZZB 13GSA 2H75A 4POMA 2HFDA 1SKRB 5D8IA 2VIMA 3KJYA 3D4TA 2EIRA 5D73A 1BG5A 3DIEA 4HZ2A 1EV4A 2GS3A 1FO5A 1U88A 1QUWA 4NHZA 2RM5A 2GSSA 4FYUA 3GNJA 3DEXA 4NMUA 1EEJA 2GGTA 1XZOA 1ERUA 5C00A 2TIRA 3HCZA 2IIYA 5D93A 4L8EA 3K8NA 5D9VA 5CRGA 1AUCA 3FMWA 2JZSA 5IOXA 3IE3A 1S3AA 5FHIA 3I69A 3EMXA 3TDGA 5DQSA 3UARA 5IMZA 3C73A 1ZYNA 1BJXA 3A5IA 2GT6A 4Z2RA 3VFIA 4K6XA 4NAXA 3IRAA 4XCSA 3KTBA 3LEFA 3TKPA 1PMTA 1K0DA 5IMCA 2B1KA 4G9HA 5ABRA 2YPMA 2PVQA 6GSYA 5BMUA 4DVCA 4BWSA 1H4OA 1X9SB 3H93A 4EKZA 1AW9A 3FZ9A 1X5CA 1Z7RA 2MZCA 6GSVA 1FG4A 3D4MA 2IFQB 3NZNA 3G9BA 4NHWA 3KTLA 3CRTA 1M7TA 2X8CA 3ZRDA 2B1LA 1A8LA 2JADA 3IC4A 1ZOFA 1N8JA 1A8YA 4WKWA 3LQ7A 4EDZA 2X64A 2IWTA 1MD4A 2OE1A 1GNWA 3GRXA 3LORA 4IW9A 1ZZYA 2B7JA 5ECHB 4LLRA 1G6WA 2CZ3A 1A2MA 6GSXA 4TN8A 16GSA 2CV4A 4X0XA 2JU5A 5KOXA 5IMVA 5B8BA 3PH9A 3GYKA 3VPTA 3GHAA 1J08A 4JR6A 4ZBBA 2DJ2A 4MF6A 3GKXA 2EC4A 1O7UA 4RQXA 1XCCA 3IV4A 1WPIA 5ID2B 2LRCA 5IMDA 5ECNB 2LUSA 4WR5A 3BJ5A 4PNFA 2NTOA 2HXKA 4IQ1A 4YKFA 3QDNA 1F6MC 1FVJA 1THOA 1MTCA 3GSSA 5JWRB 1XOAA 18GSA 1THXA 4MJBA 3A2XA 3ZMKA 2X49A 2RUEA 2GDRA 2XPEA 1Z6MA 4MCUA 1LBKA 2I4AA 3DXBA 3AY8A 1TRVA 5ECMB 1BQ7A 3E3EA 2L59A 4GRFA 2AB6A 1UA5A 2OKAA 1R4WA 1XW6A 2PN8A 4WBJA 5IMAA 1GTUA 4YQUA 5AN1A 4TKYA 3FW2A 1AQWA 2MMAA 4BVYA 1TJDA 3QR6A 3IK7A 5B6NA 1F9MA 2VL3A 2RLIA 4N30A 2FA4A 4EF0A 3CTGA 2CZ2A 4YKGA 3DVXA 5HFIA 4J2FA 2C4JA 3RDWA 3FY7A 4F82A 3HD5A 1T7PB 5KN3A 3KM6A 1Q4JA 5JWOB 2VL9A 2LV3A 1E6BA 2IMIA 1R5AA 2R0PA 2IJYA 2VOCA 3ME7A 4CDOA 3Q6OA 3KMOA 3DGQA 1PA3A 2K9FA 2AV4A 1PKZA 1M2BA 2WULA 4MH2A 1OE8A 2X8GA 1SJIA 3F9UA 2FHEA 4KE3A 5F8BA 3WGDA 1S3CA 2YOIA 2VO4A 3OR5A 1NSWA 1SENA 3QD9A 1OC3A 2H0HA 3NIVA 4V2LA 4EIPA 2D2ZA 4X43A 4O5RA 2IMFA 3TKQA 1U3AA 3KH7A 2VM2A 4ML1A 4I8BA 4KAEA 1OC9B 2VL2A 2P5QA 5DDLA 1ZCPA 3G7IA 5LNKe 1AIUA 1PKWA 4XTSA 11GSA 4O7HA 3P8WA 3WGXA 1KNGA 1U3IA 5IM9A 4ZL8A 1IYIA 4G0IA 2HRAA 1QK8A 2F8AA 4GXZA 4ULXA 4GCIA 2PGTA 1YF0A 4NV2A 2JZTA 1SK2A 3US3A 1SK1A 2ALBA 4RQRA 5HQPA 1GL8A 4POKA 1URMA 2J23A 1PSQA 4OFNA 3HZ8A 4ZBDA 1VF1A 2C3QA 3PPUA 3LSZA 1XOBA 3ZMLA 1M0UA 1YKCA 3FRCA 1XIYA 3QAWA 4L5LA 1M9AA 3TJJA 3WD6A 2JSZA 2B5YA 1GLQA 2DMMA 1MDIA 1X5EA 1QQ2A 3LJRA 2CVBA 1PGTA 2G0FA 3U6VA 1XWBA 1JFUA 3H8QA 1SL1B 2L6CA 2QC7A 4FYCA 1RW1A 2E0QA 5EY6A 2XC2A 3KXOA 4POBA 3VI7A 1SL0B 1K0BA 4HUAA 4J57E 17GSA 3DVWA 1YEXA 4RI6A 4NPBA 1QXHA 2MMZA 3QFBC 2MMNA 4A5PA 3GKMA 2B5XA 3H1NA 3I43A 4EE0A 1X0RA 2VD0A 5G5FA 1Z5YE 1TU7A 2PWJA 4BWQA 1GUHA 1SKSB 3HXSA 4DSSB 4PGTA 3EYTA 3H79A 4TR0A 4GWRA 1EWXA 4RUVA 10GSA 3WT1A 2EIQA 5KN2A 3IDVA 4XS4A 4BPYA 3HA9A 3EU4A 5ECIB 1WP0A 4YAPA 1Q98A 1F37A 1ZMAA 1FW1A 2REMA 5LCZA 2M72A 2JL4A 5EL8A 2F9SA 3FK8A 2FY6A 1KEBA 3F4TA 2H1DA 4MA9A 4MF7A 2A2SA 4N11A 2H73A 3HJOA 1ILOA 3TKSC 4ECBA 4E8EA 2LS5A 3MAKA 3O6TA 3LFLA 3RPPA 2HE3A 1UC7A 3V1WA 5DJLA 2R3XA 1GSFA 5B6MA 2L57A 1Z9HA 3FKFA 4QL9A 3ZITA 1OAZA 4LL4B 4NV5A 4DSSA 2FWHA 2YWMA 3VWUA 2JACA 8GSSA 5CNWA 1ZGNA 4AGSA 4ZIJA 3F6FA 1SJ6A 4DSRA 3ERFA 4K8MA 2LJKA 2BMXA 2ZNMA 3UVHA 4L0WA 1T4YA 3ZIVA 4GQFA 2HZFA 2VUPA 1GSUA 1WE0A 4JR4A 6GSUA 1CQGA 2R37A 4MZWA 1K0AA 1TXXA 3QMXA 1XW5A 1G6YA 3ZFLA 4V2MA 1YZXA 2OBKA 1SYXA 3VWVA 2X8HA 5L71A 2GLRA 5DALA 19GSA 4MMMA 1EP7A 1A0FA 1DBYA 4YQMA 3BCIA 3U5RE 4DSQA 5JWQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QCP A;  1GSQ A;  1M99 A;  2I9H A;  1SU9 A;  3MWH A;  5J9C A;  3LGC A;  2C3N A;  3LXZ A;  4WEY A;  1B8X A;  4JU5 A;  3VK9 A;  4CW9 A;  3FR3 A;  4K7N A;  1GSY A;  4TW5 A;  1WJK A;  4G10 A;  3HVX A;  4KDY A;  4OFM A;  2DIY A;  2P31 A;  1TKD B;  5A4V A;  5A5K A;  3C7M A;  5HFK A;  4HJ2 A;  1OC8 A;  1V98 A;  1TTZ A;  1PX6 A;  4BVX A;  1GUL A;  4TXO A;  4I2U A;  3MDK A;  5ECO B;  2GST A;  1ACV A;  4ECI A;  4ZB9 A;  4K7I A;  1DUG A;  1G0T A;  1KBN A;  1WRY A;  4OCE A;  3TRP A;  3S9F A;  2WGR A;  4NWY A;  4K1F A;  1S3D A;  2NDO A;  4EDY A;  1ZL9 A;  4MH3 A;  5D9T A;  2A2R A;  3EC3 A;  4MZB A;  3VPQ A;  1ON4 A;  1JLW A;  1WOU A;  2AYT A;  2GT5 A;  2ZCT A;  3FR9 A;  2KUC A;  4JRR A;  3I6A A;  5HR2 A;  4N0Z A;  1FB0 A;  3KMN A;  3TJK A;  4GST A;  3E0U A;  1FOV A;  2B3S A;  5ENU A;  2CVD A;  3DKS A;  2OE3 A;  4LA1 A;  2C1Y A;  3HYP A;  3FYG A;  1GP1 A;  3GL5 A;  4GSS A;  1GSS A;  3GFK A;  2FNO A;  3KD0 A;  2VCW A;  1QGV A;  1TDI A;  3CBU A;  4ZBA A;  5KN0 A;  4WF5 A;  2H6Z A;  4EO3 A;  1RK4 A;  1HNB A;  4Q5R A;  3FR6 A;  4EUY A;  4PXO A;  1SK0 A;  2YNX A;  1TK8 B;  3UJ1 A;  1M2A A;  5EPF A;  1YEP A;  4JED A;  4KSO A;  2BTO T;  4O92 A;  1FVK A;  4IKH A;  3KCM A;  2FGX A;  2N5B A;  2LJA A;  4F0C A;  1PD2 1;  1OKT A;  2WJU A;  3HHV A;  2AHE A;  3H4K A;  4HU7 A;  1K0C A;  1JZO A;  2LRN A;  2L6D A;  4YH2 A;  1XVQ A;  3M3M A;  5DCG A;  2F3M A;  1EEM A;  3Q18 A;  4TRX A;  4YAV A;  4QQ7 A;  2VLV A;  5A4W A;  3A2W A;  4KW6 A;  2C0E A;  4IQA A;  3UOM A;  2OA7 A;  5ECS A;  5HR0 A;  1XXU A;  2L4C A;  4K2D A;  3GTU A;  4ISD A;  5B7C A;  1E2Y A;  2YCD A;  2IL3 A;  2QKE A;  4KA0 A;  5E59 A;  1HYU A;  2H1B A;  3TUE A;  1QFN A;  3ZRE A;  2WS2 A;  3MNG A;  2K8S A;  4JBB A;  1H75 A;  2GQM A;  3M9K A;  2GSQ A;  1A2L A;  2H6Y A;  2YJ7 A;  5F06 A;  2IME A;  3C1S A;  3HDC A;  3QFA C;  4XS1 A;  3IA1 A;  3TOU A;  3FZ4 A;  2YV9 A;  2DSA A;  2IPA A;  4D73 A;  4HI7 A;  2H0I A;  3TJB A;  3FHK A;  5DJM A;  2CAQ A;  3VLN A;  5D9X A;  22GS A;  4MK3 A;  4ZXG A;  2WDU A;  1JLV A;  2H8L A;  3KP9 A;  3VUR A;  1HNA A;  3LG6 A;  2Z9S A;  5H5Q A;  1VRS D;  3EMP A;  3EU3 A;  4ILF A;  1X5D A;  2OBI A;  1TRW A;  2KP1 A;  1IYH A;  2MBS A;  2DJK A;  3WT2 A;  2WFC A;  2GQL A;  1MEK A;  5ELA A;  4EVM A;  2IMK A;  1GUM A;  4I2T A;  2F51 A;  3LYP A;  4EL1 A;  1HD2 A;  2PER A;  3APS A;  3F3Q A;  4KB3 A;  3P2A A;  3C1R A;  2R6K A;  4ECJ A;  2FWE A;  4F2I A;  2DJ0 A;  3DD3 A;  2GZY A;  1KTE A;  1FHE A;  1EV9 A;  5CO3 A;  5GSS A;  4N0V A;  2HZE A;  3KIJ A;  5ELG A;  1EOH A;  4L5O A;  2HYX A;  2DJ3 A;  3F4R A;  5ECK B;  1AXD A;  2C8U A;  4OWY A;  5G1K A;  1UN2 A;  4MDC A;  4GTU A;  3C71 A;  2C0D A;  2CQ9 A;  5IPH A;  2KOK A;  5H5R A;  1OKD A;  4KDU A;  2WRT A;  1PL1 A;  3TKS A;  1GUK A;  2KP2 A;  1A0R P;  3ZZX A;  5GST A;  5DAK A;  4PUA A;  4HEA 2;  3HKR A;  1USB A;  1TK5 B;  2L5L A;  1O73 A;  3A5W A;  4K9Z A;  3HVS A;  3CSH A;  4P3Y B;  1M2D A;  1W4V A;  4HS1 A;  5AIV A;  3GN3 A;  2ON7 A;  2X99 A;  3F63 A;  3PGT A;  2TRC P;  3WYW A;  3A3T A;  4XHM A;  1SJZ A;  2RUF A;  4FH8 A;  1PN9 A;  4XS4 B;  1BED A;  1GTA A;  3KZQ A;  4MJC A;  2I1U A;  3G7Y A;  2XBI A;  4POL A;  2AJQ B;  1GRX A;  12GS A;  4TR4 A;  2LTK A;  5IIZ A;  4F9Z A;  4HDE A;  4PQI A;  5JCW A;  1XBS A;  2HRN A;  4Q5F A;  2FUG 2;  2VD1 A;  1GSE A;  4V1A p;  3Q19 A;  1Z6N A;  1EGR A;  5IO2 A;  3ZIJ A;  2GZZ A;  3IXR A;  4J56 E;  5J9B A;  2I3Y A;  3HVV A;  2RM6 A;  3F4S A;  4KCE A;  4WXT A;  4AJ7 A;  2KLX A;  5EVO A;  1XVW A;  1OYJ A;  2H1G A;  5G2Z A;  2VCZ A;  2K8V A;  2N5F A;  2YV7 A;  3L4N A;  4TOP A;  2H1A A;  3GA4 A;  4F03 A;  3BCK A;  5AGY A;  5IQY A;  1Z3E A;  4FIW A;  4HOJ A;  2VCT A;  3ZYW A;  7GSS A;  3GH6 A;  2MYG A;  1K3L A;  3FZA A;  1TK0 B;  1XWC A;  4G2E A;  3R2Q A;  2CX3 A;  2OAC A;  2PU9 C;  9GSS A;  3CYN A;  4IJI A;  5J41 A;  5IO0 A;  2LRT A;  2K18 A;  2JZR A;  2RII A;  5DAL B;  5B8A A;  1B9Y C;  20GS A;  3FZ5 A;  3IBH A;  1XWK A;  3W6G A;  3NOF A;  3UIW A;  2HT9 A;  2OAD A;  4V1A g;  4IJ3 A;  2B6M A;  3P90 A;  2O8V B;  3W8S A;  2H70 A;  2E7P A;  3DML A;  4BL7 A;  1JZR A;  1O85 A;  2E2M A;  1EOG A;  1VF4 A;  2A4V A;  2BJX A;  4TXV A;  4KX4 A;  3F3R A;  4TXO B;  5HR1 A;  3EE2 A;  1YY7 A;  4TR1 A;  1TP9 A;  4FYB A;  2AUV A;  2L4Q A;  1LU4 A;  5ECP B;  2DJJ A;  4GLT A;  2WCI A;  5F0G A;  1B4P A;  3TRQ A;  2H71 A;  1V40 A;  5ECQ B;  1T1V A;  5ECL B;  1O8W A;  4IEL A;  2IMD A;  1HNC A;  2F8F A;  2H01 A;  3P7X A;  4TR3 A;  3RBT A;  3RHC A;  2HLS A;  2H72 A;  4MAB A;  3RAZ A;  2GSR A;  2H74 A;  2HRF A;  2HSH A;  5IOW A;  4OFT A;  1A23 A;  3EIN A;  2EIO A;  3GX0 A;  2DML A;  2C80 A;  2CT6 A;  1BX9 A;  4NXI A;  1OE7 A;  1XPV A;  4BA7 A;  3GMF A;  1TOF A;  1U87 A;  1YJ6 A;  3UEM A;  3RHB A;  3KP8 A;  1K3O A;  1W89 A;  5KEJ A;  1ML6 A;  2VM1 A;  3IOS A;  3UBK A;  3GIX A;  4HZ4 A;  4HU9 A;  4OCF A;  1YF1 A;  3BOA A;  3RPN A;  5CP1 A;  4WBR D;  4OO5 A;  4K7O A;  3HZ4 A;  1F3B A;  2QSI A;  2H0G A;  4PQH A;  4MJA A;  4LMW A;  3A2V A;  14GS A;  5ECR B;  1YKA A;  3ZL5 A;  2G2Q A;  3M9J A;  4MJE A;  3UMA A;  3ISO A;  1YDK A;  4PUR A;  2AAW A;  3LYK A;  4MP4 A;  5CRW A;  3TJF A;  3GUR A;  5IMF A;  4MLY A;  4IP1 A;  1SD8 A;  1T4Z A;  4WET A;  1VF3 A;  3IR4 A;  2PMT A;  2O85 A;  2GZP A;  3LXT A;  2C0F A;  3GX8 A;  4GSN A;  3CSI A;  1RQM A;  4LL1 B;  1X9M B;  4I6X A;  1N2A A;  2I81 A;  2QGV A;  3TKS E;  4FO5 A;  2FCH A;  1TRS A;  1B48 A;  1BYE A;  1WWJ A;  3GTU B;  4MZC A;  1AQV A;  1EGO A;  1GSD A;  4JE1 A;  1K3Y A;  1MDJ A;  1ABA A;  3GH9 A;  3N5O A;  3BBY A;  3WGE A;  1TI3 A;  3GV1 A;  4X1U A;  1DSB A;  2CA8 A;  1R26 A;  4L0U A;  3O76 A;  3QOU A;  4PUF C;  2R2J A;  3D0Z A;  1V58 A;  1TW9 A;  3EUR A;  4PQ1 A;  1AQX A;  1XWA A;  2DJ1 A;  2XBQ A;  1XWG A;  4XIH A;  4IVF A;  5F07 A;  2PVO C;  2HI7 A;  4D73 B;  5KN1 A;  4GF0 A;  2H30 A;  4LMV A;  5H5S A;  1A24 A;  2VCQ A;  2J9H A;  1GTB A;  5G1L A;  3TB2 A;  3L0H A;  1ERV A;  2DIZ A;  2V1M A;  1TRU A;  3KH9 A;  5D96 A;  4Z7X A;  3QAG A;  5G31 A;  4AJ6 A;  2R4V A;  2PBJ A;  2FD3 A;  1AC1 A;  4KH7 A;  1B4Q A;  2VCV A;  4KND A;  3HY2 A;  2N5A A;  3GUS A;  1OVN A;  3D5J A;  4ZL7 A;  3CRU A;  5GAP D;  1I5G A;  4XS6 A;  5A4U A;  1O8X A;  2L5O A;  4I5Q A;  2XHF A;  2V6K A;  4KCA A;  2LNS A;  4N10 A;  5FT3 A;  5IPG A;  3QPM A;  1ZYQ B;  3UAP A;  2IFQ A;  3W8J A;  6GSS A;  2YWN A;  5E4W A;  4XRD A;  2HZE B;  2NPB A;  3ZTL A;  1NW2 A;  3SBC A;  4IBP A;  4ACS A;  1JZW A;  4K0G A;  2K6V A;  3EVI A;  4WR4 A;  2V41 A;  5HFG A;  2YAN A;  1K0M A;  2H6X A;  3ZVJ D;  1VGL A;  3M1G A;  1Y6E A;  3IK9 A;  5D9W A;  2H76 A;  3ZLP A;  1WMJ A;  4O32 A;  1EZK A;  4Q5N A;  2DLX A;  1O81 A;  4KGI A;  2FLS A;  1JHB A;  1PQN A;  3JCM L;  2HNL A;  3VWX A;  1QMV A;  1J0F A;  4CHS A;  3Q74 A;  2WB9 A;  3TJG A;  4PX1 A;  5ID2 A;  4JZQ A;  1XW9 A;  1MD3 A;  2YZU A;  5DAK B;  2VCX A;  4TVE A;  3DRN A;  5COH A;  2E2G A;  3QAV A;  3TGZ A;  4ZB6 A;  2OJL A;  4HQZ A;  4H86 A;  3IPZ A;  3D22 A;  3ED3 A;  2DBC A;  4WF4 A;  3F0I A;  3GKK A;  1ERT A;  3D21 A;  3PIN A;  1AAZ A;  1MDK A;  1XFL A;  3ERG A;  2H19 A;  2LQQ A;  2YP6 A;  3IHQ A;  3TCO A;  4PNG A;  4IS0 A;  3APO A;  2NBS A;  1PL2 A;  4KSM A;  3GL3 A;  5AIS A;  2LKU A;  3SWL A;  2FA8 A;  4DEJ A;  1J9B A;  3CXG A;  3O3T A;  2V32 A;  3D6I A;  1T00 A;  1ZYE A;  3DWV A;  4KUN A;  5J5N A;  1TU8 A;  2LQO A;  2GVP A;  1GNE A;  1EP8 A;  1NHY A;  1G7E A;  5DBQ A;  2M80 A;  2PUK C;  3HJM A;  4EXJ A;  1TI1 A;  1CQH A;  3C8E A;  3F8U A;  2H66 A;  4I97 A;  5CYY A;  3GKN A;  3L9S A;  3M0F A;  1ST9 A;  2ES7 A;  2LEG A;  4QL7 A;  2HSY A;  4ZB8 A;  1F3A A;  2M46 A;  3IAM 2;  1X9W B;  3UL3 A;  2R5G A;  4IGJ A;  2V6O A;  3ZVJ A;  2P5R A;  2CVK A;  3CMI A;  1NM3 A;  4XRA A;  1R5P A;  4ZL9 A;  3I9V 2;  3KEB A;  5J3R A;  5LD0 A;  3LWA A;  4HQS A;  2O7K A;  4AJ8 A;  1Z7P A;  5CRE A;  3FEU A;  3EWL A;  1B9X C;  1GWC A;  2VLU A;  3M8N A;  3ME8 A;  1WIK A;  2IN3 A;  1GTI A;  3E9J B;  2CX4 A;  2MMO A;  1FAA A;  2C3T A;  1F2E A;  5JCU A;  1DE2 A;  2O87 A;  4IHU A;  4MPG A;  1YQ1 A;  5DCH A;  3J7Y k;  4EC0 A;  1OC9 A;  5G5E A;  2OE0 A;  3CTF A;  1GH2 A;  5AIX A;  2LJR A;  2P0G A;  1VF2 A;  4ID0 A;  2MBT A;  2C0G A;  3CSJ A;  6GSW A;  4ZIL A;  3UBL A;  1I9D A;  4KDX A;  1ERW A;  3G7J A;  4HJM A;  3IAS 2;  4TR1 B;  3UVT A;  2CAI A;  5CRH A;  4OMV A;  2GQK A;  1SYR A;  2ZUP A;  2TRX A;  1G7O A;  2YZH A;  3TRX A;  2ON5 A;  2PPT A;  4IP6 A;  3VWW A;  2VLT A;  5CAX A;  4ECC A;  3ZFB A;  4AF2 A;  2VL2 C;  4F0B A;  5DQY A;  3DYR A;  3VI5 A;  1DE1 A;  2B5E A;  4IN0 A;  2LST A;  4E8H A;  4RI7 A;  1LJR A;  3F6D A;  1C72 A;  3PR8 A;  5J4U A;  5CRD A;  3L78 A;  2FWF A;  3ERW A;  3L9U A;  4MPF A;  2WZ9 A;  1K0O A;  1T3B A;  2NVL A;  5F05 A;  4G19 A;  1PX7 A;  4ML6 A;  1NHO A;  3TKR A;  5JCG A;  1SKW B;  5DVB A;  1SL2 B;  4K0N A;  2V2G A;  1V9W A;  3HJP A;  1BAY A;  5HR3 A;  2YN1 A;  1SD9 A;  2O89 A;  2YJH A;  2YWI A;  2GTU A;  1A2J A;  1V57 A;  6GST A;  1FB6 A;  5C04 A;  4OO4 A;  1T8E B;  3BD2 A;  2KHP A;  1R7H A;  4Q5Q A;  1UVZ A;  5G30 A;  4YQV A;  1V2A A;  1U6T A;  3L9V A;  3GST A;  1K0N A;  5FWG A;  1Y25 A;  4OD7 A;  3APQ A;  3N9J A;  4MF5 A;  2DC5 A;  2VAF A;  4V2N A;  1HQO A;  2JSY A;  5INY A;  2B7K A;  1PRX A;  3MSZ A;  3TOT A;  1M9B A;  1JZD A;  5GAN D;  2LNT A;  1O6J A;  2FWG A;  1GLP A;  3J7Y b;  2YWO A;  3KGK A;  4GQC A;  2XPD A;  5GZZ B;  13GS A;  2H75 A;  4POM A;  2HFD A;  1SKR B;  5D8I A;  2VIM A;  3KJY A;  3D4T A;  2EIR A;  5D73 A;  1BG5 A;  3DIE A;  4HZ2 A;  1EV4 A;  2GS3 A;  1FO5 A;  1U88 A;  1QUW A;  4NHZ A;  2RM5 A;  2GSS A;  4FYU A;  3GNJ A;  3DEX A;  4NMU A;  1EEJ A;  2GGT A;  1XZO A;  1ERU A;  5C00 A;  2TIR A;  3HCZ A;  2IIY A;  5D93 A;  4L8E A;  3K8N A;  5D9V A;  5CRG A;  1AUC A;  2JZS A;  5IOX A;  3IE3 A;  1S3A A;  5FHI A;  3I69 A;  3EMX A;  3TDG A;  5DQS A;  3UAR A;  5IMZ A;  3C73 A;  1BJX A;  2GT6 A;  3VFI A;  4K6X A;  4NAX A;  3IRA A;  4XCS A;  3KTB A;  3LEF A;  3TKP A;  1PMT A;  1K0D A;  5IMC A;  2B1K A;  4G9H A;  5ABR A;  2YPM A;  2PVQ A;  6GSY A;  4DVC A;  4BWS A;  1H4O A;  1X9S B;  3H93 A;  4EKZ A;  1AW9 A;  3FZ9 A;  1X5C A;  1Z7R A;  2MZC A;  6GSV A;  1FG4 A;  3D4M A;  2IFQ B;  3NZN A;  3G9B A;  4NHW A;  3KTL A;  3CRT A;  1M7T A;  2X8C A;  3ZRD A;  2B1L A;  1A8L A;  2JAD A;  3IC4 A;  1ZOF A;  1N8J A;  1A8Y A;  4WKW A;  3LQ7 A;  4EDZ A;  2X64 A;  2IWT A;  1MD4 A;  2OE1 A;  1GNW A;  3GRX A;  3LOR A;  4IW9 A;  1ZZY A;  2B7J A;  5ECH B;  4LLR A;  1G6W A;  2CZ3 A;  1A2M A;  6GSX A;  4TN8 A;  16GS A;  2CV4 A;  4X0X A;  2JU5 A;  5IMV A;  5B8B A;  3PH9 A;  3GYK A;  3VPT A;  3GHA A;  1J08 A;  4JR6 A;  4ZBB A;  2DJ2 A;  4MF6 A;  3GKX A;  2EC4 A;  1O7U A;  4RQX A;  1XCC A;  3IV4 A;  1WPI A;  5ID2 B;  2LRC A;  5IMD A;  5ECN B;  2LUS A;  4WR5 A;  3BJ5 A;  4PNF A;  2NTO A;  2HXK A;  4IQ1 A;  3QDN A;  1F6M C;  1FVJ A;  1THO A;  1MTC A;  3GSS A;  5JWR B;  1XOA A;  18GS A;  1THX A;  4MJB A;  3A2X A;  3ZMK A;  2RUE A;  2GDR A;  2XPE A;  1Z6M A;  4MCU A;  1LBK A;  2I4A A;  3DXB A;  3AY8 A;  1TRV A;  5ECM B;  1BQ7 A;  3E3E A;  2L59 A;  4GRF A;  2AB6 A;  1UA5 A;  2OKA A;  1R4W A;  1XW6 A;  2PN8 A;  4WBJ A;  5IMA A;  1GTU A;  4YQU A;  5AN1 A;  4TKY A;  3FW2 A;  1AQW A;  2MMA A;  4BVY A;  1TJD A;  3QR6 A;  3IK7 A;  5B6N A;  1F9M A;  2VL3 A;  2RLI A;  4N30 A;  2FA4 A;  4EF0 A;  3CTG A;  2CZ2 A;  3DVX A;  5HFI A;  4J2F A;  2C4J A;  3RDW A;  3FY7 A;  4F82 A;  3HD5 A;  1T7P B;  5KN3 A;  3KM6 A;  1Q4J A;  5JWO B;  2VL9 A;  2LV3 A;  1E6B A;  2IMI A;  1R5A A;  2IJY A;  2VOC A;  3ME7 A;  4CDO A;  3Q6O A;  3KMO A;  3DGQ A;  1PA3 A;  2K9F A;  2AV4 A;  1PKZ A;  1M2B A;  2WUL A;  4MH2 A;  1OE8 A;  2X8G A;  1SJI A;  3F9U A;  2FHE A;  4KE3 A;  5F8B A;  3WGD A;  1S3C A;  2YOI A;  2VO4 A;  3OR5 A;  1NSW A;  1SEN A;  3QD9 A;  1OC3 A;  2H0H A;  3NIV A;  4V2L A;  2D2Z A;  4X43 A;  4O5R A;  2IMF A;  3TKQ A;  1U3A A;  3KH7 A;  2VM2 A;  4ML1 A;  4I8B A;  4KAE A;  1OC9 B;  2VL2 A;  2P5Q A;  5DDL A;  1ZCP A;  3G7I A;  5LNK e;  1AIU A;  1PKW A;  4XTS A;  11GS A;  4O7H A;  3P8W A;  3WGX A;  1KNG A;  1U3I A;  5IM9 A;  4ZL8 A;  1IYI A;  4GXZ A;  1QK8 A;  2F8A A;  4ULX A;  4GCI A;  2PGT A;  1YF0 A;  4NV2 A;  2JZT A;  1SK2 A;  3US3 A;  1SK1 A;  2ALB A;  4RQR A;  5HQP A;  1GL8 A;  4POK A;  1URM A;  2J23 A;  1PSQ A;  4OFN A;  3HZ8 A;  4ZBD A;  1VF1 A;  2C3Q A;  3LSZ A;  1XOB A;  3ZML A;  1M0U A;  1YKC A;  3FRC A;  1XIY A;  3QAW A;  4L5L A;  1M9A A;  3TJJ A;  3WD6 A;  2JSZ A;  2B5Y A;  1GLQ A;  2DMM A;  1MDI A;  1X5E A;  1QQ2 A;  3LJR A;  2CVB A;  1PGT A;  2G0F A;  3U6V A;  1XWB A;  1JFU A;  3H8Q A;  1SL1 B;  2L6C A;  2QC7 A;  4FYC A;  1RW1 A;  2E0Q A;  5EY6 A;  2XC2 A;  3KXO A;  4POB A;  3VI7 A;  1SL0 B;  1K0B A;  4HUA A;  4J57 E;  17GS A;  3DVW A;  1YEX A;  4RI6 A;  4NPB A;  1QXH A;  2MMZ A;  3QFB C;  2MMN A;  3GKM A;  2B5X A;  3H1N A;  3I43 A;  4EE0 A;  1X0R A;  2VD0 A;  5G5F A;  1Z5Y E;  1TU7 A;  2PWJ A;  4BWQ A;  1GUH A;  1SKS B;  3HXS A;  4DSS B;  4PGT A;  3EYT A;  3H79 A;  4TR0 A;  4GWR A;  1EWX A;  4RUV A;  10GS A;  3WT1 A;  2EIQ A;  5KN2 A;  3IDV A;  4XS4 A;  4BPY A;  3HA9 A;  3EU4 A;  5ECI B;  1WP0 A;  4YAP A;  1Q98 A;  1F37 A;  1ZMA A;  1FW1 A;  2REM A;  5LCZ A;  2M72 A;  2JL4 A;  5EL8 A;  2F9S A;  3FK8 A;  2FY6 A;  1KEB A;  3F4T A;  2H1D A;  4MA9 A;  4MF7 A;  2A2S A;  4N11 A;  2H73 A;  3HJO A;  1ILO A;  3TKS C;  4ECB A;  4E8E A;  2LS5 A;  3MAK A;  3O6T A;  3LFL A;  3RPP A;  2HE3 A;  1UC7 A;  3V1W A;  5DJL A;  2R3X A;  1GSF A;  5B6M A;  2L57 A;  1Z9H A;  3FKF A;  4QL9 A;  3ZIT A;  1OAZ A;  4LL4 B;  4NV5 A;  4DSS A;  2FWH A;  2YWM A;  3VWU A;  2JAC A;  8GSS A;  5CNW A;  1ZGN A;  4AGS A;  4ZIJ A;  3F6F A;  1SJ6 A;  4DSR A;  3ERF A;  4K8M A;  2LJK A;  2BMX A;  2ZNM A;  3UVH A;  4L0W A;  1T4Y A;  3ZIV A;  4GQF A;  2HZF A;  2VUP A;  1GSU A;  1WE0 A;  4JR4 A;  6GSU A;  1CQG A;  2R37 A;  4MZW A;  1K0A A;  1TXX A;  3QMX A;  1XW5 A;  1G6Y A;  3ZFL A;  4V2M A;  1YZX A;  2OBK A;  1SYX A;  3VWV A;  2X8H A;  5L71 A;  2GLR A;  5DAL A;  19GS A;  4MMM A;  1EP7 A;  1A0F A;  1DBY A;  4YQM A;  3BCI A;  3U5R E;  4DSQ A;  5JWQ B; 
#chains in the Genus database with same CATH topology
 3QCP A;  1GSQ A;  1M99 A;  2I9H A;  1SU9 A;  3MWH A;  5J9C A;  3LGC A;  2C3N A;  3LXZ A;  4WEY A;  1B8X A;  4JU5 A;  3VK9 A;  4X4J A;  4CW9 A;  3FR3 A;  4K7N A;  1GSY A;  4TW5 A;  1WJK A;  4G10 A;  3HVX A;  4KDY A;  4OFM A;  2DIY A;  2P31 A;  1TKD B;  5A4V A;  5A5K A;  3C7M A;  5HFK A;  4HJ2 A;  1OC8 A;  1V98 A;  2HRK A;  1TTZ A;  1PX6 A;  4BVX A;  1GUL A;  4TXO A;  4I2U A;  3CQF A;  3MDK A;  5ECO B;  2GST A;  1ACV A;  4ECI A;  4ZB9 A;  4K7I A;  1DUG A;  1G0T A;  1KBN A;  1WRY A;  4OCE A;  3TRP A;  3S9F A;  2WGR A;  4NWY A;  4Z2T A;  4K1F A;  1S3D A;  2NDO A;  4EDY A;  1ZL9 A;  4MH3 A;  5D9T A;  2A2R A;  3EC3 A;  4MZB A;  3VPQ A;  1ON4 A;  1JLW A;  1WOU A;  2AYT A;  2GT5 A;  2ZCT A;  3FR9 A;  2KUC A;  4JRR A;  3I6A A;  5HR2 A;  4N0Z A;  1FB0 A;  3KMN A;  3TJK A;  4GST A;  3E0U A;  1FOV A;  2B3S A;  5ENU A;  2CVD A;  3DKS A;  2OE3 A;  4LA1 A;  2C1Y A;  3HYP A;  3FYG A;  1GP1 A;  3GL5 A;  4GSS A;  1GSS A;  3GFK A;  2FNO A;  3KD0 A;  2VCW A;  1QGV A;  1TDI A;  3CBU A;  4ZBA A;  5KN0 A;  4WF5 A;  2H6Z A;  4EO3 A;  1RK4 A;  1HNB A;  4Q5R A;  3FR6 A;  4EUY A;  4PXO A;  1SK0 A;  2YNX A;  1TK8 B;  3UJ1 A;  1M2A A;  5EPF A;  1YEP A;  4JED A;  4KSO A;  2BTO T;  4O92 A;  1FVK A;  4FQU A;  4IKH A;  3KCM A;  2FGX A;  2N5B A;  2LJA A;  4F0C A;  1PD2 1;  1OKT A;  2WJU A;  3HHV A;  2AHE A;  1XG8 A;  3H4K A;  4HU7 A;  1K0C A;  1JZO A;  2LRN A;  2L6D A;  4YH2 A;  1XVQ A;  4BVY B;  3M3M A;  5DCG A;  4O5Q A;  2F3M A;  1EEM A;  3Q18 A;  4TRX A;  4YAV A;  4QQ7 A;  2VLV A;  5A4W A;  3A2W A;  4KW6 A;  2C0E A;  4IQA A;  3UOM A;  2OA7 A;  5ECS A;  5HR0 A;  1XXU A;  2L4C A;  4K2D A;  3GTU A;  4ISD A;  5B7C A;  1E2Y A;  1M3J A;  2YCD A;  2IL3 A;  2QKE A;  4KA0 A;  5E59 A;  1HYU A;  2H1B A;  3TUE A;  1QFN A;  3ZRE A;  2WS2 A;  3MNG A;  2K8S A;  4JBB A;  1H75 A;  2GQM A;  3M9K A;  2GSQ A;  1A2L A;  2H6Y A;  2YJ7 A;  5F06 A;  2IME A;  3C1S A;  3HDC A;  3QFA C;  4XS1 A;  3IA1 A;  3TOU A;  3FZ4 A;  2YV9 A;  2DSA A;  2A2P A;  2IPA A;  4D73 A;  4HI7 A;  2H0I A;  3TJB A;  3FHK A;  4KF9 A;  5DJM A;  2CAQ A;  3VLN A;  5D9X A;  22GS A;  4MK3 A;  4ZXG A;  2WDU A;  1JLV A;  2H8L A;  3KP9 A;  3VUR A;  1HNA A;  3LG6 A;  2Z9S A;  5H5Q A;  1VRS D;  3EMP A;  3EU3 A;  4ILF A;  1X5D A;  2OBI A;  1TRW A;  2KP1 A;  1IYH A;  2MBS A;  2DJK A;  3WT2 A;  2WFC A;  2GQL A;  1MEK A;  5ELA A;  4EVM A;  2IMK A;  1GUM A;  4I2T A;  2F51 A;  3LYP A;  4EL1 A;  1HD2 A;  2PER A;  3APS A;  2QA2 A;  3F3Q A;  4KB3 A;  3P2A A;  3C1R A;  2R6K A;  4ECJ A;  2FWE A;  4F2I A;  2DJ0 A;  3DD3 A;  2GZY A;  1KTE A;  1FHE A;  1EV9 A;  5CO3 A;  5GSS A;  4N0V A;  2HZE A;  3KIJ A;  5ELG A;  1EOH A;  4L5O A;  2HYX A;  2DJ3 A;  3F4R A;  5ECK B;  1AXD A;  2C8U A;  4OWY A;  5G1K A;  1UN2 A;  4MDC A;  4GTU A;  3C71 A;  2C0D A;  2CQ9 A;  5IPH A;  2KOK A;  5H5R A;  1OKD A;  4KDU A;  2WRT A;  1PL1 A;  3TKS A;  1GUK A;  2KP2 A;  1A0R P;  3ZZX A;  5GST A;  3HVN A;  5DAK A;  4PUA A;  4HEA 2;  3HKR A;  1USB A;  1TK5 B;  2L5L A;  1O73 A;  3A5W A;  4K9Z A;  3HVS A;  3CSH A;  4P3Y B;  1M2D A;  1W4V A;  4HS1 A;  5AIV A;  3GN3 A;  2ON7 A;  2X99 A;  3F63 A;  3PGT A;  2TRC P;  3WYW A;  3A3T A;  4XHM A;  1SJZ A;  2RUF A;  4FH8 A;  1PN9 A;  1PN0 A;  4XS4 B;  1BED A;  1GTA A;  3KZQ A;  4MJC A;  2A4H A;  2I1U A;  3G7Y A;  2XBI A;  4POL A;  2AJQ B;  1GRX A;  12GS A;  4TR4 A;  2LTK A;  5IIZ A;  4F9Z A;  4HDE A;  4PQI A;  5JCW A;  1XBS A;  2HRN A;  4Q5F A;  2FUG 2;  2VD1 A;  1GSE A;  4V1A p;  3Q19 A;  1Z6N A;  1EGR A;  5IO2 A;  3ZIJ A;  2GZZ A;  3IXR A;  4J56 E;  5J9B A;  2I3Y A;  3HVV A;  2RM6 A;  3F4S A;  4KCE A;  4WXT A;  4AJ7 A;  2KLX A;  5EVO A;  1XVW A;  1OYJ A;  2H1G A;  5G2Z A;  2VCZ A;  2K8V A;  2N5F A;  2YV7 A;  3L4N A;  4TOP A;  2H1A A;  3GA4 A;  4F03 A;  3BCK A;  5AGY A;  5IQY A;  1Z3E A;  4FIW A;  4HOJ A;  2VCT A;  3ZYW A;  7GSS A;  3GH6 A;  2MYG A;  1K3L A;  3FZA A;  1TK0 B;  5KOW A;  1XWC A;  4G2E A;  3R2Q A;  2CX3 A;  2OAC A;  2PU9 C;  9GSS A;  3CYN A;  4IJI A;  5J41 A;  5IO0 A;  2LRT A;  2K18 A;  2JZR A;  2RII A;  5DAL B;  5B8A A;  1B9Y C;  20GS A;  3FZ5 A;  3IBH A;  1XWK A;  3W6G A;  3NOF A;  3UIW A;  2HT9 A;  2OAD A;  4V1A g;  4IJ3 A;  2B6M A;  3P90 A;  2O8V B;  3W8S A;  2H70 A;  2E7P A;  3DML A;  4BL7 A;  2QA1 A;  1JZR A;  4MNN A;  1O85 A;  2E2M A;  1EOG A;  1VF4 A;  2A4V A;  2BJX A;  4TXV A;  1FOH A;  4KX4 A;  3F3R A;  4BVX B;  4TXO B;  5HR1 A;  3EE2 A;  1YY7 A;  4TR1 A;  1TP9 A;  4FYB A;  2AUV A;  2L4Q A;  1LU4 A;  5ECP B;  2DJJ A;  4GLT A;  2WCI A;  5F0G A;  1B4P A;  4K5S A;  3TRQ A;  2H71 A;  1V40 A;  5ECQ B;  1T1V A;  4K2X A;  5ECL B;  1O8W A;  4IEL A;  2IMD A;  1HNC A;  2F8F A;  2H01 A;  3P7X A;  4TR3 A;  3RBT A;  3RHC A;  2HLS A;  2H72 A;  4MAB A;  3RAZ A;  2GSR A;  2H74 A;  2X4A A;  2HRF A;  2HSH A;  5IOW A;  4OFT A;  1A23 A;  3EIN A;  2EIO A;  3GX0 A;  2DML A;  2C80 A;  3LW9 A;  2CT6 A;  1BX9 A;  4NXI A;  1OE7 A;  1XPV A;  4BA7 A;  3GMF A;  1TOF A;  1U87 A;  1YJ6 A;  3UEM A;  2DKH A;  3RHB A;  3KP8 A;  1K3O A;  1W89 A;  3IC8 A;  5KEJ A;  1ML6 A;  2VM1 A;  3IOS A;  3UBK A;  3GIX A;  3MYD A;  4HZ4 A;  4HU9 A;  4OCF A;  1YF1 A;  3BOA A;  3RPN A;  5CP1 A;  4WBR D;  4OO5 A;  4K7O A;  3HZ4 A;  1F3B A;  2QSI A;  2H0G A;  4PQH A;  4MJA A;  4LMW A;  3A2V A;  14GS A;  5ECR B;  1YKA A;  3ZL5 A;  2G2Q A;  3M9J A;  4MJE A;  3UMA A;  3ISO A;  1YDK A;  4PUR A;  2AAW A;  3LYK A;  4MP4 A;  5CRW A;  3TJF A;  3GUR A;  5IMF A;  4MLY A;  4IP1 A;  1SD8 A;  4G0L A;  1T4Z A;  4WET A;  1VF3 A;  3IR4 A;  2PMT A;  2O85 A;  2GZP A;  3LXT A;  2C0F A;  3GX8 A;  4GSN A;  3CSI A;  3R3E A;  1RQM A;  4LL1 B;  1X9M B;  4I6X A;  1N2A A;  2I81 A;  2QGV A;  3TKS E;  4FO5 A;  2FCH A;  1TRS A;  1B48 A;  1BYE A;  1WWJ A;  3GTU B;  4MZC A;  1AQV A;  1EGO A;  1GSD A;  4JE1 A;  1K3Y A;  1MDJ A;  1ABA A;  3GH9 A;  3N5O A;  3BBY A;  3WGE A;  1TI3 A;  3GV1 A;  4X1U A;  1DSB A;  2CA8 A;  1R26 A;  4L0U A;  3O76 A;  3QOU A;  4PUF C;  2R2J A;  3D0Z A;  1V58 A;  1TW9 A;  3EUR A;  4PQ1 A;  1AQX A;  1XWA A;  2DJ1 A;  2XBQ A;  1XWG A;  4XIH A;  4IVF A;  5F07 A;  2PVO C;  2HI7 A;  4D73 B;  1S3R A;  5KN1 A;  4GF0 A;  2H30 A;  4LMV A;  5H5S A;  1A24 A;  4PTS A;  2VCQ A;  2J9H A;  1GTB A;  5G1L A;  3TB2 A;  3L0H A;  1ERV A;  2DIZ A;  2V1M A;  1TRU A;  3KH9 A;  5D96 A;  4Z7X A;  3QAG A;  5G31 A;  4AJ6 A;  2R4V A;  2PBJ A;  2FD3 A;  1AC1 A;  4KH7 A;  4BIK A;  1B4Q A;  2VCV A;  4KND A;  3HY2 A;  2N5A A;  3GUS A;  1OVN A;  3D5J A;  4ZL7 A;  3CRU A;  5GAP D;  1I5G A;  4XS6 A;  5A4U A;  1O8X A;  2L5O A;  4I5Q A;  2XHF A;  2V6K A;  4KCA A;  2LNS A;  4N10 A;  5FT3 A;  5IPG A;  3QPM A;  1ZYQ B;  5BRT A;  3UAP A;  2IFQ A;  3W8J A;  6GSS A;  2YWN A;  5E4W A;  4XRD A;  2HZE B;  2NPB A;  3ZTL A;  1NW2 A;  3SBC A;  4HSC X;  4G0K A;  4IBP A;  4ACS A;  1JZW A;  4K0G A;  2K6V A;  3EVI A;  4WR4 A;  2V41 A;  5HFG A;  3EPT A;  2YAN A;  1K0M A;  2H6X A;  3ZVJ D;  1VGL A;  3M1G A;  1Y6E A;  3IK9 A;  4CY8 A;  5D9W A;  2H76 A;  3ZLP A;  1WMJ A;  4O32 A;  1EZK A;  4Q5N A;  2DLX A;  1O81 A;  4KGI A;  2FLS A;  1JHB A;  1PQN A;  3JCM L;  2HNL A;  3VWX A;  1QMV A;  1J0F A;  4CHS A;  3Q74 A;  2WB9 A;  3TJG A;  4PX1 A;  4EIQ A;  5ID2 A;  4JZQ A;  1XW9 A;  1MD3 A;  2YZU A;  5DAK B;  2VCX A;  4TVE A;  3DRN A;  5COH A;  2E2G A;  3QAV A;  3TGZ A;  4ZB6 A;  2OJL A;  4HQZ A;  4H86 A;  3IPZ A;  3D22 A;  3ED3 A;  2DBC A;  4WF4 A;  3F0I A;  3GKK A;  1ERT A;  3D21 A;  3PIN A;  1AAZ A;  1MDK A;  1XFL A;  3ERG A;  2H19 A;  2LQQ A;  2YP6 A;  3IHQ A;  3TCO A;  4PNG A;  4IS0 A;  4O5U A;  3APO A;  2NBS A;  1PL2 A;  4KSM A;  3GL3 A;  5AIS A;  2LKU A;  4Z2U A;  3SWL A;  2FA8 A;  4DEJ A;  1J9B A;  3CXG A;  3O3T A;  2V32 A;  3D6I A;  1T00 A;  1ZYE A;  4ICY A;  4USS A;  3DWV A;  4KUN A;  5J5N A;  1TU8 A;  2LQO A;  2GVP A;  4K5R A;  1GNE A;  1EP8 A;  2R0G A;  1NHY A;  1G7E A;  5DBQ A;  2M80 A;  2PUK C;  3HJM A;  4EXJ A;  1TI1 A;  1CQH A;  3C8E A;  3F8U A;  2H66 A;  4I97 A;  5CYY A;  3GKN A;  3L9S A;  3M0F A;  1ST9 A;  2ES7 A;  2LEG A;  4QL7 A;  2HSY A;  4ZB8 A;  1F3A A;  2M46 A;  3IAM 2;  1X9W B;  3MIX A;  2R5G A;  3UL3 A;  4IGJ A;  2V6O A;  3ZVJ A;  2P5R A;  2CVK A;  3CMI A;  1NM3 A;  4XRA A;  1R5P A;  4ZL9 A;  3I9V 2;  3KEB A;  5J3R A;  1PFO A;  5LD0 A;  3LWA A;  4HQS A;  2O7K A;  4AJ8 A;  1Z7P A;  5CRE A;  3FEU A;  3EWL A;  1B9X C;  1GWC A;  2VLU A;  3IHG A;  3M8N A;  2UZ8 A;  3ME8 A;  1WIK A;  2IN3 A;  1GTI A;  3E9J B;  2CX4 A;  2MMO A;  1FAA A;  2C3T A;  1F2E A;  5JCU A;  1DE2 A;  2O87 A;  4IHU A;  4MPG A;  1YQ1 A;  5DCH A;  3J7Y k;  4EC0 A;  1OC9 A;  5G5E A;  2OE0 A;  3CTF A;  1GH2 A;  5AIX A;  2LJR A;  4BL7 B;  2P0G A;  1VF2 A;  4ID0 A;  2MBT A;  2C0G A;  3CSJ A;  6GSW A;  4ZIL A;  3UBL A;  1I9D A;  4KDX A;  1ERW A;  3G7J A;  4HJM A;  3IAS 2;  4TR1 B;  3UVT A;  2CAI A;  5CRH A;  4OMV A;  2DKI A;  2GQK A;  1SYR A;  2ZUP A;  2TRX A;  1G7O A;  2YZH A;  3TRX A;  2ON5 A;  2PPT A;  4IP6 A;  3VWW A;  2VLT A;  5CAX A;  4ECC A;  3ZFB A;  4AF2 A;  2R0C A;  2VL2 C;  4F0B A;  5DQY A;  3DYR A;  3VI5 A;  1DE1 A;  2B5E A;  4IN0 A;  2LST A;  4E8H A;  4RI7 A;  1LJR A;  3F6D A;  1C72 A;  3PR8 A;  5J4U A;  5CRD A;  3L78 A;  2FWF A;  3ERW A;  3L9U A;  4MPF A;  2WZ9 A;  1K0O A;  1T3B A;  2NVL A;  5F05 A;  4G19 A;  1PX7 A;  2HSM A;  4ML6 A;  1NHO A;  3TKR A;  5JCG A;  1SKW B;  5DVB A;  1SL2 B;  4K0N A;  2V2G A;  1V9W A;  3HJP A;  1BAY A;  5HR3 A;  2YN1 A;  1SD9 A;  2O89 A;  2YJH A;  2YWI A;  2GTU A;  1A2J A;  1V57 A;  6GST A;  1FB6 A;  5C04 A;  4OO4 A;  1T8E B;  3BD2 A;  2KHP A;  1R7H A;  4Q5Q A;  1UVZ A;  5G30 A;  4YQV A;  1V2A A;  1U6T A;  3L9V A;  3GST A;  1K0N A;  5FWG A;  1Y25 A;  1ZYP A;  4OD7 A;  3APQ A;  3N9J A;  4MF5 A;  4CY6 A;  2DC5 A;  2VAF A;  4V2N A;  1HQO A;  2JSY A;  5INY A;  2B7K A;  1PRX A;  3MSZ A;  3TOT A;  1M9B A;  1JZD A;  5GAN D;  2LNT A;  1O6J A;  2FWG A;  1GLP A;  3J7Y b;  2YWO A;  3KGK A;  4GQC A;  2XPD A;  5GZZ B;  13GS A;  2H75 A;  4POM A;  2HFD A;  1SKR B;  5D8I A;  2VIM A;  3KJY A;  3D4T A;  2EIR A;  5D73 A;  1BG5 A;  3DIE A;  4HZ2 A;  1EV4 A;  2GS3 A;  1FO5 A;  1U88 A;  1QUW A;  4NHZ A;  2RM5 A;  2GSS A;  4FYU A;  3GNJ A;  3DEX A;  4NMU A;  1EEJ A;  2GGT A;  1XZO A;  1ERU A;  5C00 A;  2TIR A;  3HCZ A;  2IIY A;  5D93 A;  4L8E A;  3K8N A;  5D9V A;  5CRG A;  1AUC A;  3FMW A;  2JZS A;  5IOX A;  3IE3 A;  1S3A A;  5FHI A;  3I69 A;  3EMX A;  3TDG A;  5DQS A;  3UAR A;  5IMZ A;  3C73 A;  1ZYN A;  1BJX A;  3A5I A;  2GT6 A;  4Z2R A;  3VFI A;  4K6X A;  4NAX A;  3IRA A;  4XCS A;  3KTB A;  3LEF A;  3TKP A;  1PMT A;  1K0D A;  5IMC A;  2B1K A;  4G9H A;  5ABR A;  2YPM A;  2PVQ A;  6GSY A;  5BMU A;  4DVC A;  4BWS A;  1M3I A;  1H4O A;  1X9S B;  3H93 A;  4EKZ A;  1AW9 A;  3FZ9 A;  1X5C A;  1Z7R A;  2MZC A;  6GSV A;  1FG4 A;  3D4M A;  2IFQ B;  3NZN A;  3G9B A;  4NHW A;  3KTL A;  3CRT A;  1M7T A;  2X8C A;  3ZRD A;  2B1L A;  1A8L A;  2JAD A;  3IC4 A;  1ZOF A;  1N8J A;  1A8Y A;  4WKW A;  3LQ7 A;  4EDZ A;  2X64 A;  2IWT A;  1MD4 A;  2OE1 A;  1GNW A;  3GRX A;  3LOR A;  4IW9 A;  1ZZY A;  2B7J A;  5ECH B;  4LLR A;  1G6W A;  2CZ3 A;  1A2M A;  6GSX A;  4TN8 A;  16GS A;  2CV4 A;  4X0X A;  2JU5 A;  5KOX A;  5IMV A;  5B8B A;  3PH9 A;  3GYK A;  3VPT A;  3GHA A;  1J08 A;  4JR6 A;  4ZBB A;  2DJ2 A;  4MF6 A;  3GKX A;  2EC4 A;  1O7U A;  4RQX A;  1XCC A;  3IV4 A;  1WPI A;  5ID2 B;  2LRC A;  5IMD A;  5ECN B;  2LUS A;  4WR5 A;  3BJ5 A;  4PNF A;  2NTO A;  2HXK A;  4IQ1 A;  4YKF A;  3QDN A;  1F6M C;  1FVJ A;  1THO A;  1MTC A;  3GSS A;  5JWR B;  1XOA A;  18GS A;  1THX A;  4MJB A;  3A2X A;  3ZMK A;  2X49 A;  2RUE A;  2GDR A;  2XPE A;  1Z6M A;  4MCU A;  1LBK A;  2I4A A;  3DXB A;  3AY8 A;  1TRV A;  5ECM B;  1BQ7 A;  3E3E A;  2L59 A;  4GRF A;  2AB6 A;  1UA5 A;  2OKA A;  1R4W A;  1XW6 A;  2PN8 A;  4WBJ A;  5IMA A;  1GTU A;  4YQU A;  5AN1 A;  4TKY A;  3FW2 A;  1AQW A;  2MMA A;  4BVY A;  1TJD A;  3QR6 A;  3IK7 A;  5B6N A;  1F9M A;  2VL3 A;  2RLI A;  4N30 A;  2FA4 A;  4EF0 A;  3CTG A;  2CZ2 A;  4YKG A;  3DVX A;  5HFI A;  4J2F A;  2C4J A;  3RDW A;  3FY7 A;  4F82 A;  3HD5 A;  1T7P B;  5KN3 A;  3KM6 A;  1Q4J A;  5JWO B;  2VL9 A;  2LV3 A;  1E6B A;  2IMI A;  1R5A A;  2R0P A;  2IJY A;  2VOC A;  3ME7 A;  4CDO A;  3Q6O A;  3KMO A;  3DGQ A;  1PA3 A;  2K9F A;  2AV4 A;  1PKZ A;  1M2B A;  2WUL A;  4MH2 A;  1OE8 A;  2X8G A;  1SJI A;  3F9U A;  2FHE A;  4KE3 A;  5F8B A;  3WGD A;  1S3C A;  2YOI A;  2VO4 A;  3OR5 A;  1NSW A;  1SEN A;  3QD9 A;  1OC3 A;  2H0H A;  3NIV A;  4V2L A;  4EIP A;  2D2Z A;  4X43 A;  4O5R A;  2IMF A;  3TKQ A;  1U3A A;  3KH7 A;  2VM2 A;  4ML1 A;  4I8B A;  4KAE A;  1OC9 B;  2VL2 A;  2P5Q A;  5DDL A;  1ZCP A;  3G7I A;  5LNK e;  1AIU A;  1PKW A;  4XTS A;  11GS A;  4O7H A;  3P8W A;  3WGX A;  1KNG A;  1U3I A;  5IM9 A;  4ZL8 A;  1IYI A;  4G0I A;  2HRA A;  1QK8 A;  2F8A A;  4GXZ A;  4ULX A;  4GCI A;  2PGT A;  1YF0 A;  4NV2 A;  2JZT A;  1SK2 A;  3US3 A;  1SK1 A;  2ALB A;  4RQR A;  5HQP A;  1GL8 A;  4POK A;  1URM A;  2J23 A;  1PSQ A;  4OFN A;  3HZ8 A;  4ZBD A;  1VF1 A;  2C3Q A;  3PPU A;  3LSZ A;  1XOB A;  3ZML A;  1M0U A;  1YKC A;  3FRC A;  1XIY A;  3QAW A;  4L5L A;  1M9A A;  3TJJ A;  3WD6 A;  2JSZ A;  2B5Y A;  1GLQ A;  2DMM A;  1MDI A;  1X5E A;  1QQ2 A;  3LJR A;  2CVB A;  1PGT A;  2G0F A;  3U6V A;  1XWB A;  1JFU A;  3H8Q A;  1SL1 B;  2L6C A;  2QC7 A;  4FYC A;  1RW1 A;  2E0Q A;  5EY6 A;  2XC2 A;  3KXO A;  4POB A;  3VI7 A;  1SL0 B;  1K0B A;  4HUA A;  4J57 E;  17GS A;  3DVW A;  1YEX A;  4RI6 A;  4NPB A;  1QXH A;  2MMZ A;  3QFB C;  2MMN A;  4A5P A;  3GKM A;  2B5X A;  3H1N A;  3I43 A;  4EE0 A;  1X0R A;  2VD0 A;  5G5F A;  1Z5Y E;  1TU7 A;  2PWJ A;  4BWQ A;  1GUH A;  1SKS B;  3HXS A;  4DSS B;  4PGT A;  3EYT A;  3H79 A;  4TR0 A;  4GWR A;  1EWX A;  4RUV A;  10GS A;  3WT1 A;  2EIQ A;  5KN2 A;  3IDV A;  4XS4 A;  4BPY A;  3HA9 A;  3EU4 A;  5ECI B;  1WP0 A;  4YAP A;  1Q98 A;  1F37 A;  1ZMA A;  1FW1 A;  2REM A;  5LCZ A;  2M72 A;  2JL4 A;  5EL8 A;  2F9S A;  3FK8 A;  2FY6 A;  1KEB A;  3F4T A;  2H1D A;  4MA9 A;  4MF7 A;  2A2S A;  4N11 A;  2H73 A;  3HJO A;  1ILO A;  3TKS C;  4ECB A;  4E8E A;  2LS5 A;  3MAK A;  3O6T A;  3LFL A;  3RPP A;  2HE3 A;  1UC7 A;  3V1W A;  5DJL A;  2R3X A;  1GSF A;  5B6M A;  2L57 A;  1Z9H A;  3FKF A;  4QL9 A;  3ZIT A;  1OAZ A;  4LL4 B;  4NV5 A;  4DSS A;  2FWH A;  2YWM A;  3VWU A;  2JAC A;  8GSS A;  5CNW A;  1ZGN A;  4AGS A;  4ZIJ A;  3F6F A;  1SJ6 A;  4DSR A;  3ERF A;  4K8M A;  2LJK A;  2BMX A;  2ZNM A;  3UVH A;  4L0W A;  1T4Y A;  3ZIV A;  4GQF A;  2HZF A;  2VUP A;  1GSU A;  1WE0 A;  4JR4 A;  6GSU A;  1CQG A;  2R37 A;  4MZW A;  1K0A A;  1TXX A;  3QMX A;  1XW5 A;  1G6Y A;  3ZFL A;  4V2M A;  1YZX A;  2OBK A;  1SYX A;  3VWV A;  2X8H A;  5L71 A;  2GLR A;  5DAL A;  19GS A;  4MMM A;  1EP7 A;  1A0F A;  1DBY A;  4YQM A;  3BCI A;  3U5R E;  4DSQ A;  5JWQ B; 
#chains in the Genus database with same CATH homology
 3QCP A;  1GSQ A;  1M99 A;  2I9H A;  1SU9 A;  3MWH A;  5J9C A;  3LGC A;  2C3N A;  3LXZ A;  4WEY A;  1B8X A;  4JU5 A;  3VK9 A;  4X4J A;  4CW9 A;  3FR3 A;  4K7N A;  1GSY A;  4TW5 A;  1WJK A;  4G10 A;  3HVX A;  4KDY A;  4OFM A;  2DIY A;  2P31 A;  1TKD B;  5A4V A;  5A5K A;  3C7M A;  5HFK A;  4HJ2 A;  1OC8 A;  1V98 A;  2HRK A;  1TTZ A;  1PX6 A;  4BVX A;  1GUL A;  4TXO A;  4I2U A;  3MDK A;  5ECO B;  2GST A;  1ACV A;  4ECI A;  4ZB9 A;  4K7I A;  1DUG A;  1G0T A;  1KBN A;  1WRY A;  4OCE A;  3TRP A;  3S9F A;  2WGR A;  4NWY A;  4Z2T A;  4K1F A;  1S3D A;  2NDO A;  4EDY A;  1ZL9 A;  4MH3 A;  5D9T A;  2A2R A;  3EC3 A;  4MZB A;  3VPQ A;  1ON4 A;  1JLW A;  1WOU A;  2AYT A;  2GT5 A;  2ZCT A;  3FR9 A;  2KUC A;  4JRR A;  3I6A A;  5HR2 A;  4N0Z A;  1FB0 A;  3KMN A;  3TJK A;  4GST A;  3E0U A;  1FOV A;  2B3S A;  5ENU A;  2CVD A;  3DKS A;  2OE3 A;  4LA1 A;  2C1Y A;  3HYP A;  3FYG A;  1GP1 A;  3GL5 A;  4GSS A;  1GSS A;  3GFK A;  2FNO A;  3KD0 A;  2VCW A;  1QGV A;  1TDI A;  3CBU A;  4ZBA A;  5KN0 A;  4WF5 A;  2H6Z A;  4EO3 A;  1RK4 A;  1HNB A;  4Q5R A;  3FR6 A;  4EUY A;  4PXO A;  1SK0 A;  2YNX A;  1TK8 B;  3UJ1 A;  1M2A A;  5EPF A;  1YEP A;  4JED A;  4KSO A;  2BTO T;  4O92 A;  1FVK A;  4FQU A;  4IKH A;  3KCM A;  2FGX A;  2N5B A;  2LJA A;  4F0C A;  1PD2 1;  1OKT A;  2WJU A;  3HHV A;  2AHE A;  3H4K A;  4HU7 A;  1K0C A;  1JZO A;  2LRN A;  2L6D A;  4YH2 A;  1XVQ A;  4BVY B;  3M3M A;  5DCG A;  4O5Q A;  2F3M A;  1EEM A;  3Q18 A;  4TRX A;  4YAV A;  4QQ7 A;  2VLV A;  5A4W A;  3A2W A;  4KW6 A;  2C0E A;  4IQA A;  3UOM A;  2OA7 A;  5ECS A;  5HR0 A;  1XXU A;  2L4C A;  4K2D A;  3GTU A;  4ISD A;  5B7C A;  1E2Y A;  2YCD A;  2IL3 A;  2QKE A;  4KA0 A;  5E59 A;  1HYU A;  2H1B A;  3TUE A;  1QFN A;  3ZRE A;  2WS2 A;  3MNG A;  2K8S A;  4JBB A;  1H75 A;  2GQM A;  3M9K A;  2GSQ A;  1A2L A;  2H6Y A;  2YJ7 A;  5F06 A;  2IME A;  3C1S A;  3HDC A;  3QFA C;  4XS1 A;  3IA1 A;  3TOU A;  3FZ4 A;  2YV9 A;  2DSA A;  2A2P A;  2IPA A;  4D73 A;  4HI7 A;  2H0I A;  3TJB A;  3FHK A;  4KF9 A;  5DJM A;  2CAQ A;  3VLN A;  5D9X A;  22GS A;  4MK3 A;  4ZXG A;  2WDU A;  1JLV A;  2H8L A;  3KP9 A;  3VUR A;  1HNA A;  3LG6 A;  2Z9S A;  5H5Q A;  1VRS D;  3EMP A;  3EU3 A;  4ILF A;  1X5D A;  2OBI A;  1TRW A;  2KP1 A;  1IYH A;  2MBS A;  2DJK A;  3WT2 A;  2WFC A;  2GQL A;  1MEK A;  5ELA A;  4EVM A;  2IMK A;  1GUM A;  4I2T A;  2F51 A;  3LYP A;  4EL1 A;  1HD2 A;  2PER A;  3APS A;  2QA2 A;  3F3Q A;  4KB3 A;  3P2A A;  3C1R A;  2R6K A;  4ECJ A;  2FWE A;  4F2I A;  2DJ0 A;  3DD3 A;  2GZY A;  1KTE A;  1FHE A;  1EV9 A;  5CO3 A;  5GSS A;  4N0V A;  2HZE A;  3KIJ A;  5ELG A;  1EOH A;  4L5O A;  2HYX A;  2DJ3 A;  3F4R A;  5ECK B;  1AXD A;  2C8U A;  4OWY A;  5G1K A;  1UN2 A;  4MDC A;  4GTU A;  3C71 A;  2C0D A;  2CQ9 A;  5IPH A;  2KOK A;  5H5R A;  1OKD A;  4KDU A;  2WRT A;  1PL1 A;  3TKS A;  1GUK A;  2KP2 A;  1A0R P;  3ZZX A;  5GST A;  5DAK A;  4PUA A;  4HEA 2;  3HKR A;  1USB A;  1TK5 B;  2L5L A;  1O73 A;  3A5W A;  4K9Z A;  3HVS A;  3CSH A;  4P3Y B;  1M2D A;  1W4V A;  4HS1 A;  5AIV A;  3GN3 A;  2ON7 A;  2X99 A;  3F63 A;  3PGT A;  2TRC P;  3WYW A;  3A3T A;  4XHM A;  1SJZ A;  2RUF A;  4FH8 A;  1PN9 A;  1PN0 A;  4XS4 B;  1BED A;  1GTA A;  3KZQ A;  4MJC A;  2A4H A;  2I1U A;  3G7Y A;  2XBI A;  4POL A;  2AJQ B;  1GRX A;  12GS A;  4TR4 A;  2LTK A;  5IIZ A;  4F9Z A;  4HDE A;  4PQI A;  5JCW A;  1XBS A;  2HRN A;  4Q5F A;  2FUG 2;  2VD1 A;  1GSE A;  4V1A p;  3Q19 A;  1Z6N A;  1EGR A;  5IO2 A;  3ZIJ A;  2GZZ A;  3IXR A;  4J56 E;  5J9B A;  2I3Y A;  3HVV A;  2RM6 A;  3F4S A;  4KCE A;  4WXT A;  4AJ7 A;  2KLX A;  5EVO A;  1XVW A;  1OYJ A;  2H1G A;  5G2Z A;  2VCZ A;  2K8V A;  2N5F A;  2YV7 A;  3L4N A;  4TOP A;  2H1A A;  3GA4 A;  4F03 A;  3BCK A;  5AGY A;  5IQY A;  1Z3E A;  4FIW A;  4HOJ A;  2VCT A;  3ZYW A;  7GSS A;  3GH6 A;  2MYG A;  1K3L A;  3FZA A;  1TK0 B;  5KOW A;  1XWC A;  4G2E A;  3R2Q A;  2CX3 A;  2OAC A;  2PU9 C;  9GSS A;  3CYN A;  4IJI A;  5J41 A;  5IO0 A;  2LRT A;  2K18 A;  2JZR A;  2RII A;  5DAL B;  5B8A A;  1B9Y C;  20GS A;  3FZ5 A;  3IBH A;  1XWK A;  3W6G A;  3NOF A;  3UIW A;  2HT9 A;  2OAD A;  4V1A g;  4IJ3 A;  2B6M A;  3P90 A;  2O8V B;  3W8S A;  2H70 A;  2E7P A;  3DML A;  4BL7 A;  2QA1 A;  1JZR A;  4MNN A;  1O85 A;  2E2M A;  1EOG A;  1VF4 A;  2A4V A;  2BJX A;  4TXV A;  1FOH A;  4KX4 A;  3F3R A;  4BVX B;  4TXO B;  5HR1 A;  3EE2 A;  1YY7 A;  4TR1 A;  1TP9 A;  4FYB A;  2AUV A;  2L4Q A;  1LU4 A;  5ECP B;  2DJJ A;  4GLT A;  2WCI A;  5F0G A;  1B4P A;  4K5S A;  3TRQ A;  2H71 A;  1V40 A;  5ECQ B;  1T1V A;  4K2X A;  5ECL B;  1O8W A;  4IEL A;  2IMD A;  1HNC A;  2F8F A;  2H01 A;  3P7X A;  4TR3 A;  3RBT A;  3RHC A;  2HLS A;  2H72 A;  4MAB A;  3RAZ A;  2GSR A;  2H74 A;  2X4A A;  2HRF A;  2HSH A;  5IOW A;  4OFT A;  1A23 A;  3EIN A;  2EIO A;  3GX0 A;  2DML A;  2C80 A;  3LW9 A;  2CT6 A;  1BX9 A;  4NXI A;  1OE7 A;  1XPV A;  4BA7 A;  3GMF A;  1TOF A;  1U87 A;  1YJ6 A;  3UEM A;  2DKH A;  3RHB A;  3KP8 A;  1K3O A;  1W89 A;  3IC8 A;  5KEJ A;  1ML6 A;  2VM1 A;  3IOS A;  3UBK A;  3GIX A;  3MYD A;  4HZ4 A;  4HU9 A;  4OCF A;  1YF1 A;  3BOA A;  3RPN A;  5CP1 A;  4WBR D;  4OO5 A;  4K7O A;  3HZ4 A;  1F3B A;  2QSI A;  2H0G A;  4PQH A;  4MJA A;  4LMW A;  3A2V A;  14GS A;  5ECR B;  1YKA A;  3ZL5 A;  2G2Q A;  3M9J A;  4MJE A;  3UMA A;  3ISO A;  1YDK A;  4PUR A;  2AAW A;  3LYK A;  4MP4 A;  5CRW A;  3TJF A;  3GUR A;  5IMF A;  4MLY A;  4IP1 A;  1SD8 A;  4G0L A;  1T4Z A;  4WET A;  1VF3 A;  3IR4 A;  2PMT A;  2O85 A;  2GZP A;  3LXT A;  2C0F A;  3GX8 A;  4GSN A;  3CSI A;  3R3E A;  1RQM A;  4LL1 B;  1X9M B;  4I6X A;  1N2A A;  2I81 A;  2QGV A;  3TKS E;  4FO5 A;  2FCH A;  1TRS A;  1B48 A;  1BYE A;  1WWJ A;  3GTU B;  4MZC A;  1AQV A;  1EGO A;  1GSD A;  4JE1 A;  1K3Y A;  1MDJ A;  1ABA A;  3GH9 A;  3N5O A;  3BBY A;  3WGE A;  1TI3 A;  3GV1 A;  4X1U A;  1DSB A;  2CA8 A;  1R26 A;  4L0U A;  3O76 A;  3QOU A;  4PUF C;  2R2J A;  3D0Z A;  1V58 A;  1TW9 A;  3EUR A;  4PQ1 A;  1AQX A;  1XWA A;  2DJ1 A;  2XBQ A;  1XWG A;  4XIH A;  4IVF A;  5F07 A;  2PVO C;  2HI7 A;  4D73 B;  5KN1 A;  4GF0 A;  2H30 A;  4LMV A;  5H5S A;  1A24 A;  4PTS A;  2VCQ A;  2J9H A;  1GTB A;  5G1L A;  3TB2 A;  3L0H A;  1ERV A;  2DIZ A;  2V1M A;  1TRU A;  3KH9 A;  5D96 A;  4Z7X A;  3QAG A;  5G31 A;  4AJ6 A;  2R4V A;  2PBJ A;  2FD3 A;  1AC1 A;  4KH7 A;  1B4Q A;  2VCV A;  4KND A;  3HY2 A;  2N5A A;  3GUS A;  1OVN A;  3D5J A;  4ZL7 A;  3CRU A;  5GAP D;  1I5G A;  4XS6 A;  5A4U A;  1O8X A;  2L5O A;  4I5Q A;  2XHF A;  2V6K A;  4KCA A;  2LNS A;  4N10 A;  5FT3 A;  5IPG A;  3QPM A;  1ZYQ B;  5BRT A;  3UAP A;  2IFQ A;  3W8J A;  6GSS A;  2YWN A;  5E4W A;  4XRD A;  2HZE B;  2NPB A;  3ZTL A;  1NW2 A;  3SBC A;  4G0K A;  4IBP A;  4ACS A;  1JZW A;  4K0G A;  2K6V A;  3EVI A;  4WR4 A;  2V41 A;  5HFG A;  3EPT A;  2YAN A;  1K0M A;  2H6X A;  3ZVJ D;  1VGL A;  3M1G A;  1Y6E A;  3IK9 A;  4CY8 A;  5D9W A;  2H76 A;  3ZLP A;  1WMJ A;  4O32 A;  1EZK A;  4Q5N A;  2DLX A;  1O81 A;  4KGI A;  2FLS A;  1JHB A;  1PQN A;  3JCM L;  2HNL A;  3VWX A;  1QMV A;  1J0F A;  4CHS A;  3Q74 A;  2WB9 A;  3TJG A;  4PX1 A;  4EIQ A;  5ID2 A;  4JZQ A;  1XW9 A;  1MD3 A;  2YZU A;  5DAK B;  2VCX A;  4TVE A;  3DRN A;  5COH A;  2E2G A;  3QAV A;  3TGZ A;  4ZB6 A;  2OJL A;  4HQZ A;  4H86 A;  3IPZ A;  3D22 A;  3ED3 A;  2DBC A;  4WF4 A;  3F0I A;  3GKK A;  1ERT A;  3D21 A;  3PIN A;  1AAZ A;  1MDK A;  1XFL A;  3ERG A;  2H19 A;  2LQQ A;  2YP6 A;  3IHQ A;  3TCO A;  4PNG A;  4IS0 A;  4O5U A;  3APO A;  2NBS A;  1PL2 A;  4KSM A;  3GL3 A;  5AIS A;  2LKU A;  4Z2U A;  3SWL A;  2FA8 A;  4DEJ A;  1J9B A;  3CXG A;  3O3T A;  2V32 A;  3D6I A;  1T00 A;  1ZYE A;  4ICY A;  4USS A;  3DWV A;  4KUN A;  5J5N A;  1TU8 A;  2LQO A;  2GVP A;  4K5R A;  1GNE A;  1EP8 A;  2R0G A;  1NHY A;  1G7E A;  5DBQ A;  2M80 A;  2PUK C;  3HJM A;  4EXJ A;  1TI1 A;  1CQH A;  3C8E A;  3F8U A;  2H66 A;  4I97 A;  5CYY A;  3GKN A;  3L9S A;  3M0F A;  1ST9 A;  2ES7 A;  2LEG A;  4QL7 A;  2HSY A;  4ZB8 A;  1F3A A;  2M46 A;  3IAM 2;  1X9W B;  3MIX A;  2R5G A;  3UL3 A;  4IGJ A;  2V6O A;  3ZVJ A;  2P5R A;  2CVK A;  3CMI A;  1NM3 A;  4XRA A;  1R5P A;  4ZL9 A;  3I9V 2;  3KEB A;  5J3R A;  5LD0 A;  3LWA A;  4HQS A;  2O7K A;  4AJ8 A;  1Z7P A;  5CRE A;  3FEU A;  3EWL A;  1B9X C;  1GWC A;  2VLU A;  3IHG A;  3M8N A;  2UZ8 A;  3ME8 A;  1WIK A;  2IN3 A;  1GTI A;  3E9J B;  2CX4 A;  2MMO A;  1FAA A;  2C3T A;  1F2E A;  5JCU A;  1DE2 A;  2O87 A;  4IHU A;  4MPG A;  1YQ1 A;  5DCH A;  3J7Y k;  4EC0 A;  1OC9 A;  5G5E A;  2OE0 A;  3CTF A;  1GH2 A;  5AIX A;  2LJR A;  4BL7 B;  2P0G A;  1VF2 A;  4ID0 A;  2MBT A;  2C0G A;  3CSJ A;  6GSW A;  4ZIL A;  3UBL A;  1I9D A;  4KDX A;  1ERW A;  3G7J A;  4HJM A;  3IAS 2;  4TR1 B;  3UVT A;  2CAI A;  5CRH A;  4OMV A;  2DKI A;  2GQK A;  1SYR A;  2ZUP A;  2TRX A;  1G7O A;  2YZH A;  3TRX A;  2ON5 A;  2PPT A;  4IP6 A;  3VWW A;  2VLT A;  5CAX A;  4ECC A;  3ZFB A;  4AF2 A;  2R0C A;  2VL2 C;  4F0B A;  5DQY A;  3DYR A;  3VI5 A;  1DE1 A;  2B5E A;  4IN0 A;  2LST A;  4E8H A;  4RI7 A;  1LJR A;  3F6D A;  1C72 A;  3PR8 A;  5J4U A;  5CRD A;  3L78 A;  2FWF A;  3ERW A;  3L9U A;  4MPF A;  2WZ9 A;  1K0O A;  1T3B A;  2NVL A;  5F05 A;  4G19 A;  1PX7 A;  2HSM A;  4ML6 A;  1NHO A;  3TKR A;  5JCG A;  1SKW B;  5DVB A;  1SL2 B;  4K0N A;  2V2G A;  1V9W A;  3HJP A;  1BAY A;  5HR3 A;  2YN1 A;  1SD9 A;  2O89 A;  2YJH A;  2YWI A;  2GTU A;  1A2J A;  1V57 A;  6GST A;  1FB6 A;  5C04 A;  4OO4 A;  1T8E B;  3BD2 A;  2KHP A;  1R7H A;  4Q5Q A;  1UVZ A;  5G30 A;  4YQV A;  1V2A A;  1U6T A;  3L9V A;  3GST A;  1K0N A;  5FWG A;  1Y25 A;  1ZYP A;  4OD7 A;  3APQ A;  3N9J A;  4MF5 A;  4CY6 A;  2DC5 A;  2VAF A;  4V2N A;  1HQO A;  2JSY A;  5INY A;  2B7K A;  1PRX A;  3MSZ A;  3TOT A;  1M9B A;  1JZD A;  5GAN D;  2LNT A;  1O6J A;  2FWG A;  1GLP A;  3J7Y b;  2YWO A;  3KGK A;  4GQC A;  2XPD A;  5GZZ B;  13GS A;  2H75 A;  4POM A;  2HFD A;  1SKR B;  5D8I A;  2VIM A;  3KJY A;  3D4T A;  2EIR A;  5D73 A;  1BG5 A;  3DIE A;  4HZ2 A;  1EV4 A;  2GS3 A;  1FO5 A;  1U88 A;  1QUW A;  4NHZ A;  2RM5 A;  2GSS A;  4FYU A;  3GNJ A;  3DEX A;  4NMU A;  1EEJ A;  2GGT A;  1XZO A;  1ERU A;  5C00 A;  2TIR A;  3HCZ A;  2IIY A;  5D93 A;  4L8E A;  3K8N A;  5D9V A;  5CRG A;  1AUC A;  3FMW A;  2JZS A;  5IOX A;  3IE3 A;  1S3A A;  5FHI A;  3I69 A;  3EMX A;  3TDG A;  5DQS A;  3UAR A;  5IMZ A;  3C73 A;  1ZYN A;  1BJX A;  3A5I A;  2GT6 A;  4Z2R A;  3VFI A;  4K6X A;  4NAX A;  3IRA A;  4XCS A;  3KTB A;  3LEF A;  3TKP A;  1PMT A;  1K0D A;  5IMC A;  2B1K A;  4G9H A;  5ABR A;  2YPM A;  2PVQ A;  6GSY A;  5BMU A;  4DVC A;  4BWS A;  1H4O A;  1X9S B;  3H93 A;  4EKZ A;  1AW9 A;  3FZ9 A;  1X5C A;  1Z7R A;  2MZC A;  6GSV A;  1FG4 A;  3D4M A;  2IFQ B;  3NZN A;  3G9B A;  4NHW A;  3KTL A;  3CRT A;  1M7T A;  2X8C A;  3ZRD A;  2B1L A;  1A8L A;  2JAD A;  3IC4 A;  1ZOF A;  1N8J A;  1A8Y A;  4WKW A;  3LQ7 A;  4EDZ A;  2X64 A;  2IWT A;  1MD4 A;  2OE1 A;  1GNW A;  3GRX A;  3LOR A;  4IW9 A;  1ZZY A;  2B7J A;  5ECH B;  4LLR A;  1G6W A;  2CZ3 A;  1A2M A;  6GSX A;  4TN8 A;  16GS A;  2CV4 A;  4X0X A;  2JU5 A;  5KOX A;  5IMV A;  5B8B A;  3PH9 A;  3GYK A;  3VPT A;  3GHA A;  1J08 A;  4JR6 A;  4ZBB A;  2DJ2 A;  4MF6 A;  3GKX A;  2EC4 A;  1O7U A;  4RQX A;  1XCC A;  3IV4 A;  1WPI A;  5ID2 B;  2LRC A;  5IMD A;  5ECN B;  2LUS A;  4WR5 A;  3BJ5 A;  4PNF A;  2NTO A;  2HXK A;  4IQ1 A;  4YKF A;  3QDN A;  1F6M C;  1FVJ A;  1THO A;  1MTC A;  3GSS A;  5JWR B;  1XOA A;  18GS A;  1THX A;  4MJB A;  3A2X A;  3ZMK A;  2X49 A;  2RUE A;  2GDR A;  2XPE A;  1Z6M A;  4MCU A;  1LBK A;  2I4A A;  3DXB A;  3AY8 A;  1TRV A;  5ECM B;  1BQ7 A;  3E3E A;  2L59 A;  4GRF A;  2AB6 A;  1UA5 A;  2OKA A;  1R4W A;  1XW6 A;  2PN8 A;  4WBJ A;  5IMA A;  1GTU A;  4YQU A;  5AN1 A;  4TKY A;  3FW2 A;  1AQW A;  2MMA A;  4BVY A;  1TJD A;  3QR6 A;  3IK7 A;  5B6N A;  1F9M A;  2VL3 A;  2RLI A;  4N30 A;  2FA4 A;  4EF0 A;  3CTG A;  2CZ2 A;  4YKG A;  3DVX A;  5HFI A;  4J2F A;  2C4J A;  3RDW A;  3FY7 A;  4F82 A;  3HD5 A;  1T7P B;  5KN3 A;  3KM6 A;  1Q4J A;  5JWO B;  2VL9 A;  2LV3 A;  1E6B A;  2IMI A;  1R5A A;  2R0P A;  2IJY A;  2VOC A;  3ME7 A;  4CDO A;  3Q6O A;  3KMO A;  3DGQ A;  1PA3 A;  2K9F A;  2AV4 A;  1PKZ A;  1M2B A;  2WUL A;  4MH2 A;  1OE8 A;  2X8G A;  1SJI A;  3F9U A;  2FHE A;  4KE3 A;  5F8B A;  3WGD A;  1S3C A;  2YOI A;  2VO4 A;  3OR5 A;  1NSW A;  1SEN A;  3QD9 A;  1OC3 A;  2H0H A;  3NIV A;  4V2L A;  4EIP A;  2D2Z A;  4X43 A;  4O5R A;  2IMF A;  3TKQ A;  1U3A A;  3KH7 A;  2VM2 A;  4ML1 A;  4I8B A;  4KAE A;  1OC9 B;  2VL2 A;  2P5Q A;  5DDL A;  1ZCP A;  3G7I A;  5LNK e;  1AIU A;  1PKW A;  4XTS A;  11GS A;  4O7H A;  3P8W A;  3WGX A;  1KNG A;  1U3I A;  5IM9 A;  4ZL8 A;  1IYI A;  4G0I A;  2HRA A;  1QK8 A;  2F8A A;  4GXZ A;  4ULX A;  4GCI A;  2PGT A;  1YF0 A;  4NV2 A;  2JZT A;  1SK2 A;  3US3 A;  1SK1 A;  2ALB A;  4RQR A;  5HQP A;  1GL8 A;  4POK A;  1URM A;  2J23 A;  1PSQ A;  4OFN A;  3HZ8 A;  4ZBD A;  1VF1 A;  2C3Q A;  3PPU A;  3LSZ A;  1XOB A;  3ZML A;  1M0U A;  1YKC A;  3FRC A;  1XIY A;  3QAW A;  4L5L A;  1M9A A;  3TJJ A;  3WD6 A;  2JSZ A;  2B5Y A;  1GLQ A;  2DMM A;  1MDI A;  1X5E A;  1QQ2 A;  3LJR A;  2CVB A;  1PGT A;  2G0F A;  3U6V A;  1XWB A;  1JFU A;  3H8Q A;  1SL1 B;  2L6C A;  2QC7 A;  4FYC A;  1RW1 A;  2E0Q A;  5EY6 A;  2XC2 A;  3KXO A;  4POB A;  3VI7 A;  1SL0 B;  1K0B A;  4HUA A;  4J57 E;  17GS A;  3DVW A;  1YEX A;  4RI6 A;  4NPB A;  1QXH A;  2MMZ A;  3QFB C;  2MMN A;  4A5P A;  3GKM A;  2B5X A;  3H1N A;  3I43 A;  4EE0 A;  1X0R A;  2VD0 A;  5G5F A;  1Z5Y E;  1TU7 A;  2PWJ A;  4BWQ A;  1GUH A;  1SKS B;  3HXS A;  4DSS B;  4PGT A;  3EYT A;  3H79 A;  4TR0 A;  4GWR A;  1EWX A;  4RUV A;  10GS A;  3WT1 A;  2EIQ A;  5KN2 A;  3IDV A;  4XS4 A;  4BPY A;  3HA9 A;  3EU4 A;  5ECI B;  1WP0 A;  4YAP A;  1Q98 A;  1F37 A;  1ZMA A;  1FW1 A;  2REM A;  5LCZ A;  2M72 A;  2JL4 A;  5EL8 A;  2F9S A;  3FK8 A;  2FY6 A;  1KEB A;  3F4T A;  2H1D A;  4MA9 A;  4MF7 A;  2A2S A;  4N11 A;  2H73 A;  3HJO A;  1ILO A;  3TKS C;  4ECB A;  4E8E A;  2LS5 A;  3MAK A;  3O6T A;  3LFL A;  3RPP A;  2HE3 A;  1UC7 A;  3V1W A;  5DJL A;  2R3X A;  1GSF A;  5B6M A;  2L57 A;  1Z9H A;  3FKF A;  4QL9 A;  3ZIT A;  1OAZ A;  4LL4 B;  4NV5 A;  4DSS A;  2FWH A;  2YWM A;  3VWU A;  2JAC A;  8GSS A;  5CNW A;  1ZGN A;  4AGS A;  4ZIJ A;  3F6F A;  1SJ6 A;  4DSR A;  3ERF A;  4K8M A;  2LJK A;  2BMX A;  2ZNM A;  3UVH A;  4L0W A;  1T4Y A;  3ZIV A;  4GQF A;  2HZF A;  2VUP A;  1GSU A;  1WE0 A;  4JR4 A;  6GSU A;  1CQG A;  2R37 A;  4MZW A;  1K0A A;  1TXX A;  3QMX A;  1XW5 A;  1G6Y A;  3ZFL A;  4V2M A;  1YZX A;  2OBK A;  1SYX A;  3VWV A;  2X8H A;  5L71 A;  2GLR A;  5DAL A;  19GS A;  4MMM A;  1EP7 A;  1A0F A;  1DBY A;  4YQM A;  3BCI A;  3U5R E;  4DSQ A;  5JWQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...