2PWJA

Structure of a mitochondrial type ii peroxiredoxin from pisum sativum
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
162
structure length
162
Chain Sequence
LSAASNVSLQKARTWDEGVESKFSTTPVNDIFKDKKVVIFGLPGAYTGVCSSKHVPPYKHNIDKFKAKGVDSVICVAINDPYTVNAWAEKIQAKDAIEFYGDFDGSFHKSLELTTDLSAGLLGIRSERWSAYVVDGKVKALNVEESPSDVKVSGAETILGQI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitochondrial peroxiredoxin
publication title Structure of a mitochondrial type II peroxiredoxin from Pisum sativum
rcsb
source organism Pisum sativum
molecule tags Oxidoreductase
total genus 39
structure length 162
sequence length 162
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2007-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08534 Redoxin Redoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2pwjA00
5J3RA 1WIKA 6GSYA 2BJXA 1GLPA 2VCQA 4GQCA 4DSRA 20GSA 4J56E 2GDRA 3HXSA 2IMDA 3ZYWA 1I9DA 1R7HA 3UJ1A 2DIYA 5IIZA 1SD9A 4D73B 3CRTA 1WE0A 3KZQA 4BVYA 3LORA 3EMPA 3MDKA 4TN8A 4IELA 3D4MA 5IOXA 3D5JA 3EYTA 4KAEA 2HSHA 4KNDA 3QFBC 3UL3A 2ON5A 4V2LA 1LBKA 2I3YA 2IJYA 1EEMA 1GRXA 1K0NA 2YWNA 1TK5B 4XTSA 2R3XA 4GCIA 1N2AA 1YEPA 2YZHA 4P3YB 4KSMA 3GH9A 3BCKA 2H6ZA 5ELAA 2GSQA 3IV4A 4JE1A 4L8EA 3ERFA 4O92A 2P5QA 4V2NA 3KJYA 1ERTA 3GA4A 3AY8A 3VPQA 4GQFA 1O81A 6GSTA 1PQNA 1S3DA 3DYRA 2OBKA 3PH9A 4HS1A 2K9FA 2QGVA 1WWJA 3GKMA 1O8XA 2X8GA 4KE3A 5L71A 2VUPA 3WGDA 4ZB8A 3F4RA 5G1KA 2DJ2A 5KN1A 1G6WA 3ZMKA 5KN2A 4CW9A 4GSTA 2NPBA 2B1LA 4TXOB 5GZZB 1T8EB 4EDZA 4OMVA 3ZLPA 3WD6A 4TR0A 3KP9A 4PNGA 2IMKA 2VL2A 2H6XA 5J41A 3E3EA 5CRHA 5ENUA 2ALBA 4Q5QA 4QL7A 4TR4A 2E7PA 3VWUA 3F3RA 4OD7A 3ME7A 2OE3A 1Q4JA 1TP9A 5CRDA 5HR0A 2FNOA 3F0IA 3GKNA 3WGXA 3VI5A 5HR3A 2H70A 1K0AA 2CT6A 3BOAA 1XVWA 2H76A 5DALA 3QFAC 4V1Ag 2DC5A 1JLWA 2D2ZA 5B6NA 2WZ9A 2H8LA 1YY7A 2LRNA 3GURA 4POMA 4OO5A 1V57A 4ECJA 3TJJA 2K18A 4JEDA 3U5RE 1Z5YE 2FD3A 3L9UA 3N9JA 3C1RA 2GSRA 3I9V2 3TB2A 2IPAA 3VK9A 1B9XC 4ECBA 4ML6A 1ZOFA 2PMTA 3APSA 5D96A 2A2RA 4JZQA 3RBTA 3IK7A 5AIVA 1ML6A 3PR8A 3RAZA 3VWXA 1WJKA 2FA4A 4H86A 1JHBA 2PWJA 3O6TA 3ZVJA 1QXHA 5HFKA 1F6MC 3M0FA 2NDOA 1XCCA 4J2FA 4YQVA 1TXXA 1TI1A 5D8IA 5H5SA 1T4YA 5J4UA 3ED3A 1PD21 3CSJA 3G7YA 4YH2A 4MK3A 1K0OA 2A4VA 2DIZA 1FAAA 3A2VA 4O5RA 2YN1A 2VAFA 4MPFA 4F03A 3FYGA 3BCIA 1SJZA 5HR1A 4TVEA 1SK1A 4HZ2A 1VF1A 5A4UA 4YAVA 2E2GA 3FZ9A 4KSOA 2F3MA 3L9SA 3CMIA 4GF0A 3KP8A 6GSVA 2MBSA 1G0TA 1SU9A 2MMOA 3O76A 4WETA 4YQMA 1TTZA 1CQHA 2H30A 3FR3A 2VLTA 3BBYA 1MDKA 2KOKA 2C3NA 3KMNA 1WP0A 2H0HA 2XPDA 5IMFA 3Q18A 3V1WA 4OWYA 3TJBA 4TKYA 1GH2A 2C3QA 1M9BA 2QKEA 1V40A 1DSBA 1J08A 3HDCA 4ISDA 2YZUA 2V32A 4MCUA 5J9CA 1GSDA 3TJKA 4PX1A 3J7Yk 2H73A 3LXZA 4N0VA 2DBCA 2LNSA 4ZBDA 5DALB 3WGEA 2YWMA 5IPGA 2V1MA 3LYKA 5IQYA 3EURA 5HQPA 2GQKA 3TKQA 1VRSD 1JZRA 3IBHA 3M9JA 4TRXA 1THOA 4KCAA 2GT5A 1HQOA 4Q5FA 1XOAA 3HJPA 5DCHA 3RPPA 3DEXA 6GSWA 3KXOA 4MF6A 3EWLA 3A5WA 1PSQA 1FG4A 4PQHA 2LS5A 3DD3A 1AUCA 5G2ZA 2CAQA 3LWAA 2RUEA 2F8AA 1A2LA 3DKSA 2OBIA 3APQA 4N11A 3VLNA 5J5NA 1SJIA 1TW9A 4IQAA 4CHSA 1EEJA 4PQ1A 4KCEA 4IGJA 3IA1A 2LQOA 3BJ5A 1XW9A 2I9HA 1XXUA 2JSYA 4MZBA 4WF5A 4IN0A 4TR3A 2IN3A 1T7PB 4QL9A 4IP1A 5CO3A 5G5EA 4JU5A 1PKWA 2AB6A 3HVVA 2LSTA 2EIRA 2H74A 5AGYA 1XWAA 5B6MA 3C8EA 4KW6A 4OFTA 1RQMA 2KP1A 5KN3A 3FKFA 3UBLA 3IXRA 2GSSA 1AXDA 2L5OA 4HQSA 3KH7A 2IMIA 2PU9C 3CYNA 7GSSA 3F6DA 4POLA 2GT6A 3HA9A 1EZKA 3LYPA 1K0CA 4KA0A 2MBTA 2M80A 2NVLA 4WXTA 8GSSA 3HHVA 1V9WA 3ERGA 4X1UA 5D9XA 1OC9A 3APOA 3BD2A 4O32A 1XVQA 3P90A 1ST9A 4PXOA 2YV7A 1O6JA 1F2EA 2GZYA 3R2QA 2ON7A 5CREA 1AQVA 2GGTA 4ACSA 1MD4A 1YJ6A 2C0EA 2R37A 1ZCPA 3TJGA 1OVNA 4LMWA 1ERUA 4EF0A 3ZIJA 5ECIB 3EVIA 5E59A 1PX7A 1DE1A 6GSUA 1M99A 1ZGNA 2IIYA 1O85A 5IPHA 4RUVA 4KDUA 3G7IA 1THXA 2NTOA 4MDCA 4MZWA 5ECSA 1TRSA 3TKSC 3HJOA 1UN2A 4ILFA 5C00A 5JCWA 4OCFA 5JWQB 3ZRDA 5EY6A 4ZBBA 1TRWA 3UAPA 3WT2A 1USBA 2L5LA 5ECPB 3IRAA 1R5PA 1FW1A 1JZWA 3KTLA 3MAKA 4EKZA 2P0GA 2B6MA 2V6KA 2DJ3A 2PVQA 2VM2A 3QR6A 1SL0B 4RQRA 1YQ1A 2O85A 4IJ3A 2Z9SA 2H75A 2FWFA 3LEFA 1BJXA 4L5LA 5F05A 1UC7A 2VL2C 1A2JA 2HZFA 1GTBA 3M3MA 3M8NA 2H66A 2GQLA 1IYHA 1WPIA 2YNXA 2FWGA 3C73A 4XS4A 1Z6MA 3TOTA 4I6XA 1QK8A 3PINA 2KUCA 3LXTA 3ZMLA 2VCZA 3GNJA 1KTEA 3LG6A 1GTUA 5CP1A 5G5FA 1HNBA 1OC9B 3F63A 4J57E 1DBYA 3QAVA 2BTOT 3D22A 2RUFA 1PL2A 1EOGA 2L59A 5B7CA 1XW6A 2DJ1A 4GSSA 5D9WA 1TU8A 1RK4A 4ZBAA 2VIMA 5ID2A 2C3TA 4HJ2A 1M2BA 1SENA 4LA1A 1ZZYA 1Y25A 1B4PA 1F3BA 2H1BA 4POBA 3TKSA 4PURA 1YEXA 4HOJA 3F4TA 3CXGA 1OKTA 1GTIA 3UARA 2I1UA 2O7KA 3ZFBA 1HYUA 2B3SA 2CA8A 1X5DA 1UA5A 16GSA 1JZOA 1TKDB 13GSA 5IO2A 1WRYA 1XIYA 2L57A 2WCIA 2K6VA 5J9BA 1SYRA 3VPTA 1QMVA 4IVFA 4PNFA 1S3CA 4OFNA 5ECRB 5EL8A 2GZPA 2O8VB 2O87A 2GVPA 3LQ7A 1FHEA 4XCSA 3A3TA 2F51A 2LKUA 2EIQA 1OYJA 3VWWA 1SJ6A 3RHCA 5ECLB 4WEYA 2GQMA 3DXBA 1PRXA 1TOFA 3I69A 5KN0A 1B48A 4FIWA 1X9MB 1FVJA 4F0BA 5INYA 1ACVA 3GL5A 5IMCA 5GAPD 3FY7A 2LQQA 1ZYQB 9GSSA 3UVTA 1M9AA 1T4ZA 4IP6A 2H01A 2YWIA 2VO4A 3TOUA 4L0UA 2IMEA 2XC2A 3TDGA 2H1DA 4F9ZA 1NHYA 2V6OA 3ZTLA 1V98A 1VF3A 4FYCA 2J23A 3LJRA 4KDYA 1VGLA 5ECKB 1GSUA 4XS4B 1EP8A 5D73A 3GL3A 5CRWA 4MH2A 3EC3A 2MYGA 2VCTA 2G0FA 2VL9A 1MTCA 4ECCA 1JLVA 5IMAA 5DAKA 2AV4A 3GX0A 3G9BA 1GNEA 3RPNA 1XW5A 3HJMA 2H1GA 3IAS2 5G31A 3WT1A 4N10A 1GUMA 4OO4A 1GP1A 3D0ZA 5FT3A 2RIIA 1SD8A 3DVXA 1LJRA 5IMZA 4IQ1A 5JWOB 5A4WA 1BYEA 2CQ9A 2JADA 5IM9A 6GSXA 5ID2B 3ERWA 2VLUA 5CAXA 2FWHA 3ZZXA 3GRXA 4K9ZA 2JL4A 4K7OA 1NSWA 2LRTA 2WFCA 4TOPA 4NMUA 3ZIVA 2OACA 1NHOA 2L6CA 4FYUA 4ZIJA 5DJMA 2OE1A 1O73A 3TJFA 14GSA 3GUSA 4RI6A 1TRUA 1FVKA 1VF2A 3QAWA 2RM6A 1XZOA 2VD0A 1EOHA 1SKWB 3O3TA 3EMXA 4G9HA 4YQUA 3EE2A 1IYIA 1GWCA 1M2DA 2LJRA 4JR4A 2E0QA 3QD9A 4MF5A 1SL2B 22GSA 2C1YA 2DJ0A 2MMAA 1B9YC 1YF0A 1TDIA 1FO5A 2YJ7A 2I4AA 1O8WA 4K6XA 1OE8A 3GTUA 3DVWA 2CVDA 4Q5NA 4L5OA 1OC8A 2C0DA 3G7JA 1GLQA 5HFGA 1PMTA 3CSIA 4RI7A 2XBQA 2L4QA 5F07A 2AYTA 2K8SA 6GSSA 1BX9A 2DMLA 3KD0A 3IPZA 1Z9HA 2HFDA 1A0FA 2XBIA 3UBKA 2DJJA 4FH8A 4QQ7A 1UVZA 2GS3A 5B8AA 4LL4B 3VFIA 4FYBA 1SKRB 2C0GA 4PUAA 3KM6A 1NW2A 1M0UA 5DAKB 1K0DA 4DVCA 4F82A 3F9UA 3D6IA 1TK8B 1B4QA 2H71A 1U6TA 2BMXA 5AISA 1DE2A 3EINA 3QDNA 4AF2A 2F9SA 4K2DA 2B5YA 4OFMA 1H75A 4HUAA 4XS6A 4F2IA 4ZB9A 5COHA 4AJ7A 3SWLA 2NBSA 1C72A 1MDIA 3M1GA 5KEJA 4ULXA 1XBSA 1CQGA 2FHEA 3GKXA 4TXVA 3UIWA 2R4VA 2O89A 5B8BA 4MJBA 1EGOA 1ZMAA 3ZVJD 3KEBA 4MABA 3M9KA 1BEDA 3F3QA 1GUHA 4BWSA 3TRQA 1OC3A 3IOSA 4BA7A 1R26A 5IMDA 19GSA 4FO5A 4HU9A 3A2WA 1SK0A 2HRNA 4I97A 2HLSA 4KX4A 1K3LA 2WRTA 2AHEA 2VCXA 4WBRD 1FOVA 1KBNA 4K8MA 2FA8A 3EU3A 3I6AA 4KDXA 2ZUPA 1X9WB 1ABAA 2K8VA 1TJDA 1SKSB 3LGCA 3QCPA 4MLYA 1X5EA 2WB9A 3TUEA 4DSQA 3MNGA 3UOMA 1PKZA 4HZ4A 4GTUA 4G2EA 4I2TA 3IDVA 1J0FA 3IK9A 1V2AA 3E9JB 1R4WA 1Z6NA 2H72A 2YV9A 3N5OA 1K3OA 5DCGA 2CX3A 3DWVA 2WDUA 1NM3A 1EGRA 2LJKA 1PX6A 1SL1B 2HI7A 1RW1A 2X64A 1TK0B 1AAZA 4GXZA 3DRNA 3GX8A 2JZSA 1J9BA 1AC1A 2XHFA 2DSAA 3HZ8A 3L9VA 4BPYA 3D4TA 5HFIA 3ME8A 2HRFA 2JSZA 3TKRA 4MF7A 3TRXA 2LTKA 1MEKA 2LRCA 2LJAA 2QC7A 4ML1A 2HT9A 1PN9A 4K1FA 4EXJA 4I5QA 3MSZA 2R2JA 3UEMA 1F9MA 2ZCTA 1BAYA 4N0ZA 3HVSA 2PPTA 1G6YA 4K7IA 2G2QA 2VL3A 2OADA 1LU4A 1QFNA 3ZFLA 1QUWA 4GLTA 4PGTA 2MZCA 4EVMA 2H19A 3EU4A 4NPBA 2L6DA 1PL1A 1N8JA 1AQWA 1HNAA 2QSIA 4IS0A 1S3AA 5ECHB 2N5FA 5F06A 2FGXA 4KGIA 4X0XA 1XWBA 2R5GA 3H93A 3H4KA 3C7MA 2CAIA 3W6GA 5A5KA 1BQ7A 3Q19A 2P31A 3W8SA 1XPVA 3GV1A 2B5XA 5ECOB 3TRPA 5LCZA 2X8CA 2B1KA 3D21A 2CZ2A 1JFUA 4I2UA 3H79A 2YWOA 2C80A 4GSNA 4G19A 3VI7A 2AAWA 1HD2A 2JZTA 5H5QA 4EL1A 3DMLA 2RLIA 1OAZA 2OJLA 5JWRB 3KH9A 4EO3A 1YDKA 4KB3A 1K0BA 3F8UA 5ABRA 3FHKA 4EDYA 2OKAA 3H8QA 1T3BA 2PN8A 3FEUA 4ZILA 1TRVA 1A8LA 5ECNB 1GSFA 4ZB6A 3ISOA 3FZ5A 5D9VA 1HNCA 3U6VA 2B7KA 5G1LA 1EP7A 5AN1A 1XWGA 2C4JA 4XRAA 4NAXA 4AJ8A 5ELGA 4HEA2 1X9SB 1E6BA 1W89A 5EVOA 1GSYA 1VF4A 5GSTA 3GKKA 2WGRA 2C8UA 5D9TA 3KCMA 1ON4A 1Z3EA 3ZITA 3RHBA 5CYYA 4MJCA 1XOBA 5ECQB 3H1NA 5JCGA 2GZZA 2LV3A 2P5RA 2YANA 2GSTA 1GNWA 2FY6A 1PA3A 3ZL5A 4TR1A 4MH3A 1XWCA 4ZL9A 2VCWA 1M7TA 2JACA 3L0HA 3CTFA 1OKDA 1EWXA 1BG5A 2KLXA 3HY2A 5CRGA 3IR4A 2KP2A 4IHUA 5C04A 3Q74A 3C71A 2IL3A 4XS1A 1Q98A 4IJIA 4AGSA 2M46A 4WR5A 4GWRA 1G7EA 3NZNA 4ZXGA 1A8YA 1EV9A 1GULA 1U88A 3F6FA 5GSSA 3CTGA 2R6KA 2LNTA 5IMVA 2PBJA 2YPMA 5F8BA 3P8WA 2KHPA 2EIOA 5EPFA 1ZL9A 3E0UA 4KH7A 4WKWA 2GLRA 3HD5A 4K0GA 1B8XA 3FZAA 3GHAA 1ZYEA 3GH6A 2FLSA 2TIRA 2MMNA 3P7XA 1U87A 5DQSA 2VM1A 2C0FA 1GSSA 3GFKA 2MMZA 4JRRA 2VD1A 4WF4A 2DLXA 4N30A 4RQXA 4ZL7A 2PGTA 3LSZA 1YKCA 5DJLA 2CVBA 4F0CA 2B5EA 4XRDA 3TGZA 4MJAA 1O7UA 3TCOA 3KTBA 4V1Ap 3P2AA 4LMVA 3HVXA 1XFLA 2HZEA 5G30A 4CDOA 3CRUA 1G7OA 4HU7A 4EE0A 4K7NA 2B7JA 3KGKA 1YF1A 2CV4A 4WBJA 1GSEA 2H0GA 1OE7A 2VLVA 2TRCP 2HNLA 1V58A 2F8FA 4HQZA 3FR6A 4JBBA 3I43A 1DUGA 4TW5A 5LNKe 1W4VA 4TR1B 2DMMA 1XWKA 2LUSA 4HJMA 4AJ6A 2VOCA 5LD0A 4HI7A 4NWYA 3GMFA 4GRFA 2N5AA 4MPGA 5DBQA 3MWHA 4YAPA 3A2XA 4Z7XA 1M2AA 3FZ4A 2IFQA 2M72A 1T00A 1YZXA 3Q6OA 2WJUA 4KUNA 2L4CA 2HE3A 1Z7RA 1GTAA 2E2MA 3C1SA 2VCVA 2OA7A 2V41A 3S9FA 4DSSA 2HSYA 1ERVA 3IAM2 2CX4A 2X8HA 4LLRA 4XHMA 5DQYA 5FWGA 1R5AA 3DGQA 4K0NA 4O7HA 2CZ3A 3NIVA 1TI3A 4Q5RA 1K0MA 5ECMB 1F37A 3HKRA 1WMJA 4LL1B 2JU5A 3W8JA 18GSA 5D93A 1AIUA 1PGTA 2RM5A 4NHZA 4ZL8A 4I8BA 3PGTA 1GUKA 2FUG2 5CNWA 1GL8A 1A24A 3KMOA 1FB0A 1QGVA 2DJKA 1JZDA 4V2MA 1KEBA 3QAGA 4MMMA 1X5CA 3CBUA 2WULA 3KIJA 5IOWA 5DVBA 4IKHA 3SBCA 1F3AA 3GIXA 2LEGA 17GSA 2YP6A 2JZRA 3UVHA 1KNGA 2A2SA 5A4VA 2FWEA 5FHIA 4PQIA 2YJHA 3F4SA 3FK8A 5IO0A 1TU7A 3WYWA 2HZEB 2PERA 2GTUA 4MJEA 1Z7PA 5F0GA 2I81A 5E4WA 1GSQA 1H4OA 1E2YA 2IMFA 1ERWA 4MP4A 5DDLA 4D73A 4XIHA 2ZNMA 4POKA 2WS2A 1T1VA 4IW9A 2AUVA 3QPMA 2N5BA 2PUKC 3VURA 2XPEA 2CVKA 1SYXA 3GSTA 3GTUB 4X43A 4BVXA 4L0WA 4E8HA 1AW9A 3HYPA 2TRXA 1A23A 3IHQA 3K8NA 4WR4A 1FB6A 2ES7A 1ILOA 1AQXA 4HDEA 2REMA 2IFQB 4G10A 3JCML 3HZ4A 3DIEA 1YKAA 3L78A 2OE0A 10GSA 3GYKA 4MA9A 1U3IA 4EUYA 4DSSB 2H1AA 2J9HA 3CSHA 3J7Yb 3ZREA 1A0RP 3FR9A 3TKPA 2YOIA 2H6YA 4NV2A 1MD3A 4ECIA 4DEJA 2V2GA 4OCEA 2AJQB 4IBPA 1WOUA 3L4NA 4ID0A 4E8EA 3IC4A 1Y6EA 5GAND 4NV5A 2YCDA 5H5RA 5HR2A 3UMAA 3GN3A 4MZCA 2HYXA 1X0RA 3OR5A 1SK2A 1EV4A 4BL7A 3GSSA 1URMA 1I5GA 1MDJA 3FW2A 3HCZA 2H0IA 2FCHA 2IWTA 4EC0A 4BWQA 1K3YA 3QOUA 1A2MA 3FRCA 1QQ2A 3US3A 3RDWA 1U3AA 5AIXA 4NXIA 2PVOC 4JR6A 11GSA 12GSA 3VWVA 3LFLA 3QMXA 4PUFC 4TXOA 3NOFA 3TKSE 5JCUA 2HXKA 4NHWA 3IE3A 2EC4A 2X99A
chains in the Genus database with same CATH superfamily
5J3RA 1WIKA 3HVNA 6GSYA 2BJXA 1GLPA 3MYDA 2VCQA 4GQCA 4DSRA 20GSA 4J56E 2GDRA 3HXSA 2IMDA 3ZYWA 1I9DA 1R7HA 3UJ1A 2DIYA 5IIZA 1SD9A 4D73B 3CRTA 1WE0A 3KZQA 4BVYA 3LORA 3EMPA 2X49A 3MDKA 4TN8A 4IELA 3D4MA 5IOXA 3D5JA 3EYTA 4KAEA 2HSHA 4KNDA 3QFBC 3UL3A 2ON5A 4BVXB 4V2LA 1LBKA 2I3YA 2IJYA 1EEMA 1GRXA 1K0NA 3LW9A 2YWNA 1TK5B 4XTSA 2R3XA 4GCIA 1N2AA 4G0KA 1YEPA 2YZHA 4P3YB 4KSMA 3GH9A 3BCKA 2H6ZA 4PTSA 4EIQA 5ELAA 4A5PA 2GSQA 3IV4A 4JE1A 4L8EA 3ERFA 4O92A 2P5QA 4V2NA 3KJYA 1ERTA 3GA4A 3AY8A 3VPQA 4GQFA 1O81A 4BL7B 6GSTA 1PQNA 1S3DA 3DYRA 2OBKA 3PH9A 4HS1A 2K9FA 2QGVA 1WWJA 3GKMA 1O8XA 2X8GA 5KOXA 4KE3A 5L71A 2VUPA 3WGDA 4ZB8A 3F4RA 5G1KA 2DJ2A 5KN1A 1G6WA 3ZMKA 5KN2A 4CW9A 4GSTA 2NPBA 2B1LA 4TXOB 5GZZB 1T8EB 4EDZA 4OMVA 3ZLPA 3WD6A 4TR0A 3KP9A 4PNGA 4G0LA 2IMKA 2VL2A 4O5QA 2H6XA 5J41A 3E3EA 5CRHA 5ENUA 2ALBA 4Q5QA 4FQUA 4QL7A 4TR4A 2E7PA 3VWUA 3F3RA 4OD7A 3ME7A 2OE3A 1Q4JA 1TP9A 5CRDA 5HR0A 2FNOA 3F0IA 3GKNA 3WGXA 3VI5A 5HR3A 2H70A 2DKIA 1ZYNA 1K0AA 2CT6A 3BOAA 4BVYB 1XVWA 4YKGA 2H76A 5DALA 3QFAC 4V1Ag 2DC5A 1JLWA 2D2ZA 5B6NA 2WZ9A 2H8LA 1YY7A 2LRNA 3GURA 4POMA 4OO5A 1V57A 4ECJA 3TJJA 2K18A 4JEDA 3U5RE 1Z5YE 2R0PA 2FD3A 3L9UA 3N9JA 3C1RA 2GSRA 3I9V2 3TB2A 2IPAA 3VK9A 1B9XC 4ECBA 4ML6A 1ZOFA 2PMTA 3APSA 5D96A 2A2RA 4JZQA 3RBTA 3IK7A 5AIVA 1ML6A 3PR8A 3RAZA 3VWXA 1WJKA 2FA4A 4H86A 1JHBA 2PWJA 3O6TA 3ZVJA 1QXHA 5HFKA 1F6MC 3M0FA 2NDOA 1XCCA 4J2FA 4YQVA 1TXXA 1TI1A 5D8IA 2QA1A 5H5SA 1T4YA 5J4UA 3ED3A 1PD21 3CSJA 3G7YA 4YH2A 4MK3A 1K0OA 2A4VA 2DIZA 1FAAA 3A2VA 4O5RA 2YN1A 2VAFA 4MPFA 4F03A 3FYGA 3BCIA 1SJZA 5HR1A 4TVEA 1SK1A 4HZ2A 1VF1A 5A4UA 4YAVA 1M3JA 2E2GA 3FZ9A 4KSOA 2F3MA 3L9SA 3CMIA 4GF0A 3KP8A 6GSVA 2MBSA 1G0TA 1SU9A 2MMOA 3O76A 4WETA 4YQMA 1TTZA 1CQHA 2H30A 3FR3A 2VLTA 3BBYA 1MDKA 2KOKA 2C3NA 5BRTA 2A2PA 3KMNA 1WP0A 2H0HA 2XPDA 5IMFA 3Q18A 3V1WA 4OWYA 3TJBA 4TKYA 1GH2A 2C3QA 1M9BA 2QKEA 1V40A 1DSBA 1J08A 3HDCA 4G0IA 4ISDA 2YZUA 2V32A 4MCUA 5J9CA 1GSDA 3TJKA 4PX1A 3J7Yk 2H73A 3LXZA 4N0VA 2DBCA 2LNSA 4ZBDA 5DALB 3WGEA 2YWMA 5IPGA 2V1MA 3LYKA 5IQYA 3EURA 5HQPA 2GQKA 3TKQA 1VRSD 1JZRA 3IBHA 3M9JA 4TRXA 1THOA 4KCAA 2GT5A 1HQOA 4Q5FA 1XOAA 3HJPA 5DCHA 3RPPA 3DEXA 4Z2UA 6GSWA 3KXOA 4MF6A 3EWLA 3A5WA 1PSQA 2R0CA 1FG4A 4PQHA 2LS5A 3DD3A 1AUCA 5G2ZA 2CAQA 3LWAA 2RUEA 2F8AA 1A2LA 3DKSA 2OBIA 3APQA 4N11A 3VLNA 5J5NA 1SJIA 1TW9A 4IQAA 4CHSA 1EEJA 4PQ1A 4KCEA 4IGJA 3IA1A 2LQOA 3BJ5A 1XW9A 2I9HA 1XXUA 2JSYA 4MZBA 4WF5A 4IN0A 4TR3A 3PPUA 2IN3A 1T7PB 4QL9A 4IP1A 4Z2TA 5CO3A 5G5EA 4JU5A 1PKWA 2AB6A 3HVVA 2LSTA 2EIRA 2H74A 5AGYA 1XWAA 5B6MA 3C8EA 4KW6A 4OFTA 1RQMA 2KP1A 5KN3A 3FKFA 3UBLA 3IXRA 2GSSA 1AXDA 2L5OA 4HQSA 3KH7A 2IMIA 2PU9C 3CYNA 7GSSA 3F6DA 4POLA 2GT6A 3HA9A 1EZKA 3LYPA 1K0CA 4KA0A 2MBTA 2M80A 2NVLA 4WXTA 8GSSA 3HHVA 1V9WA 3ERGA 4X1UA 5D9XA 1OC9A 3APOA 3BD2A 4O32A 1XVQA 3P90A 1ST9A 4PXOA 2YV7A 1O6JA 1F2EA 2GZYA 3R2QA 2ON7A 5CREA 1AQVA 2GGTA 4ACSA 1MD4A 1YJ6A 2C0EA 2R37A 1ZCPA 3TJGA 1OVNA 4LMWA 1ERUA 4EF0A 3ZIJA 5ECIB 3EVIA 5E59A 1PX7A 1DE1A 6GSUA 1M99A 1ZGNA 2IIYA 1O85A 5IPHA 4RUVA 4KDUA 3G7IA 1THXA 2NTOA 4MDCA 4MZWA 5ECSA 1TRSA 3TKSC 3HJOA 1UN2A 4ILFA 3MIXA 5C00A 5JCWA 4OCFA 5JWQB 3ZRDA 5EY6A 4ZBBA 1TRWA 3UAPA 3WT2A 1USBA 2L5LA 5ECPB 3IRAA 5KOWA 1R5PA 1FW1A 1JZWA 3KTLA 3MAKA 4EKZA 2P0GA 2B6MA 2V6KA 2DJ3A 2PVQA 2VM2A 3QR6A 1SL0B 4RQRA 1YQ1A 2O85A 4IJ3A 2Z9SA 2H75A 2FWFA 3LEFA 1BJXA 4L5LA 5F05A 1UC7A 2VL2C 1A2JA 2HZFA 1GTBA 3M3MA 3M8NA 2H66A 2GQLA 1IYHA 1WPIA 2YNXA 2FWGA 3C73A 4XS4A 1Z6MA 3TOTA 4I6XA 1QK8A 3PINA 2KUCA 3LXTA 4USSA 3ZMLA 2VCZA 3GNJA 1KTEA 3LG6A 1GTUA 5CP1A 5G5FA 1HNBA 1OC9B 3F63A 4J57E 1DBYA 3QAVA 2BTOT 3D22A 2RUFA 1PL2A 1EOGA 2L59A 5B7CA 1XW6A 2DJ1A 4GSSA 5D9WA 1TU8A 1RK4A 4ZBAA 2VIMA 5ID2A 2C3TA 4HJ2A 1M2BA 1SENA 4LA1A 1ZZYA 1Y25A 1B4PA 1F3BA 2H1BA 4POBA 3TKSA 4PURA 1YEXA 4HOJA 3F4TA 3CXGA 1OKTA 1GTIA 3UARA 2I1UA 2O7KA 3ZFBA 1HYUA 2B3SA 2CA8A 1X5DA 1UA5A 16GSA 1JZOA 1TKDB 4BIKA 13GSA 5IO2A 1WRYA 1XIYA 2L57A 2WCIA 2K6VA 5J9BA 1SYRA 3VPTA 1QMVA 4IVFA 4PNFA 1S3CA 4OFNA 5ECRB 5EL8A 2GZPA 2O8VB 2O87A 2GVPA 3LQ7A 1FHEA 4XCSA 3A3TA 2F51A 2LKUA 2EIQA 1OYJA 3VWWA 1SJ6A 3RHCA 5ECLB 4WEYA 2GQMA 3DXBA 1PRXA 1TOFA 3I69A 5KN0A 1B48A 4FIWA 1X9MB 1FVJA 4F0BA 5INYA 1ACVA 3GL5A 5IMCA 5GAPD 3FY7A 2LQQA 1ZYQB 9GSSA 3UVTA 1M9AA 1T4ZA 4IP6A 2H01A 2YWIA 2VO4A 3TOUA 4L0UA 2IMEA 2XC2A 3TDGA 2H1DA 4F9ZA 1NHYA 2V6OA 3ZTLA 1V98A 1VF3A 4FYCA 2J23A 3LJRA 4KDYA 1VGLA 5ECKB 1GSUA 4XS4B 1EP8A 5D73A 3GL3A 5CRWA 4MH2A 3EC3A 2MYGA 2VCTA 2G0FA 2VL9A 1MTCA 3CQFA 4ECCA 1JLVA 5IMAA 5DAKA 2AV4A 3GX0A 3IC8A 3G9BA 1GNEA 3RPNA 1XW5A 3HJMA 2H1GA 3IAS2 5G31A 3WT1A 4N10A 1GUMA 4OO4A 1GP1A 3D0ZA 5FT3A 2RIIA 1SD8A 3DVXA 1LJRA 5IMZA 4IQ1A 5JWOB 5A4WA 1BYEA 2CQ9A 2JADA 5IM9A 6GSXA 5ID2B 3ERWA 2VLUA 5CAXA 2FWHA 3ZZXA 3GRXA 4K9ZA 2JL4A 4K7OA 1NSWA 2LRTA 2WFCA 4ICYA 4TOPA 4NMUA 3ZIVA 2OACA 1NHOA 2L6CA 4FYUA 4ZIJA 5DJMA 2OE1A 1O73A 3TJFA 14GSA 3GUSA 4O5UA 4RI6A 1TRUA 1FVKA 1VF2A 3QAWA 2RM6A 1XZOA 2VD0A 1EOHA 1SKWB 3O3TA 3EMXA 4G9HA 4YQUA 3EE2A 1IYIA 1GWCA 1M2DA 2LJRA 4JR4A 2R0GA 2E0QA 3QD9A 4MF5A 1SL2B 22GSA 2C1YA 2DJ0A 2MMAA 1B9YC 1YF0A 1TDIA 1FO5A 2YJ7A 2I4AA 1O8WA 4K6XA 1OE8A 3GTUA 3DVWA 2CVDA 4Q5NA 4L5OA 1OC8A 2C0DA 3G7JA 1GLQA 5HFGA 1PMTA 3CSIA 4RI7A 2XBQA 2L4QA 5F07A 2AYTA 2K8SA 6GSSA 1BX9A 2DMLA 3KD0A 3IPZA 1Z9HA 2HFDA 1A0FA 2XBIA 3UBKA 2DJJA 4FH8A 4QQ7A 1UVZA 2GS3A 5B8AA 4LL4B 3VFIA 4FYBA 1SKRB 2C0GA 4PUAA 3KM6A 1NW2A 1M0UA 5DAKB 1K0DA 4DVCA 4F82A 3F9UA 3D6IA 1TK8B 1B4QA 2H71A 1U6TA 2BMXA 5AISA 1DE2A 3EINA 3QDNA 4AF2A 2F9SA 4K2DA 2B5YA 4OFMA 1H75A 4HUAA 5BMUA 4XS6A 4F2IA 4ZB9A 5COHA 4AJ7A 3SWLA 2NBSA 1C72A 1MDIA 3M1GA 5KEJA 4ULXA 1XBSA 1CQGA 2FHEA 3GKXA 4TXVA 3UIWA 2R4VA 2O89A 5B8BA 4MJBA 1EGOA 1ZMAA 3ZVJD 3KEBA 4MABA 3M9KA 1BEDA 3F3QA 1GUHA 4BWSA 3TRQA 1OC3A 3IOSA 4BA7A 1R26A 5IMDA 19GSA 4FO5A 4HU9A 3A2WA 1SK0A 2HRNA 4I97A 2HLSA 4KX4A 1K3LA 2WRTA 4CY6A 2AHEA 2VCXA 4WBRD 1FOVA 1KBNA 3R3EA 4K8MA 2FA8A 3EU3A 3I6AA 4KDXA 2ZUPA 1X9WB 1ABAA 2K8VA 1TJDA 1SKSB 3LGCA 3QCPA 4MLYA 1X5EA 2WB9A 3TUEA 4DSQA 3MNGA 3UOMA 1PKZA 4HZ4A 4GTUA 4G2EA 1M3IA 4I2TA 3IDVA 1J0FA 1ZYPA 3IK9A 1V2AA 3E9JB 1R4WA 1Z6NA 2H72A 2YV9A 3N5OA 1K3OA 5DCGA 2CX3A 3DWVA 2WDUA 1NM3A 1EGRA 2LJKA 1PX6A 1SL1B 2HI7A 1RW1A 2X64A 1TK0B 4K5SA 1AAZA 4GXZA 3DRNA 3GX8A 2JZSA 1J9BA 1AC1A 4CY8A 2XHFA 2DSAA 2HRKA 3HZ8A 3L9VA 4BPYA 3D4TA 2A4HA 5HFIA 3ME8A 2DKHA 2HRFA 2JSZA 3TKRA 4MF7A 3TRXA 2LTKA 1MEKA 2LRCA 2LJAA 2QC7A 4ML1A 2HT9A 1PN9A 4K1FA 4EXJA 4I5QA 3MSZA 1PN0A 2R2JA 3UEMA 1F9MA 2ZCTA 1BAYA 4N0ZA 3HVSA 2PPTA 1G6YA 4K7IA 2G2QA 2VL3A 2OADA 1LU4A 1QFNA 1PFOA 3ZFLA 1QUWA 4GLTA 4PGTA 2MZCA 2HSMA 4EVMA 2H19A 3EU4A 4NPBA 2L6DA 1PL1A 1N8JA 1AQWA 1HNAA 2QSIA 4IS0A 1S3AA 5ECHB 2N5FA 5F06A 2FGXA 4KGIA 4X0XA 1XWBA 2R5GA 3H93A 3H4KA 3C7MA 2CAIA 3W6GA 5A5KA 1BQ7A 3Q19A 2P31A 3W8SA 1XPVA 3GV1A 2B5XA 5ECOB 3TRPA 5LCZA 2X8CA 2B1KA 3D21A 2CZ2A 1JFUA 4I2UA 3H79A 2YWOA 2C80A 4GSNA 4G19A 3VI7A 2AAWA 1HD2A 2JZTA 5H5QA 4EL1A 3DMLA 2RLIA 1OAZA 2OJLA 5JWRB 3KH9A 4EO3A 1YDKA 4KB3A 1K0BA 3F8UA 5ABRA 3FHKA 4EDYA 2OKAA 3H8QA 1T3BA 2PN8A 3FEUA 4ZILA 1TRVA 1A8LA 5ECNB 1GSFA 4ZB6A 3ISOA 3FZ5A 1S3RA 5D9VA 1HNCA 3U6VA 2B7KA 5G1LA 1EP7A 5AN1A 1XWGA 2C4JA 4XRAA 4NAXA 4AJ8A 5ELGA 4HEA2 1X9SB 1E6BA 4K5RA 1W89A 5EVOA 1GSYA 1VF4A 5GSTA 3GKKA 2WGRA 4Z2RA 2C8UA 5D9TA 3KCMA 1ON4A 1Z3EA 3ZITA 3RHBA 5CYYA 4MJCA 1XOBA 5ECQB 3H1NA 5JCGA 2GZZA 2LV3A 2P5RA 2YANA 2GSTA 1GNWA 2FY6A 1PA3A 2HRAA 3ZL5A 4TR1A 2UZ8A 4MH3A 1XWCA 4YKFA 4ZL9A 2VCWA 1M7TA 2JACA 3L0HA 3CTFA 1OKDA 1EWXA 1BG5A 2KLXA 3HY2A 5CRGA 3IR4A 2KP2A 4IHUA 5C04A 3Q74A 3C71A 2IL3A 4XS1A 1Q98A 4IJIA 4AGSA 2M46A 3EPTA 4WR5A 4GWRA 1G7EA 3NZNA 4ZXGA 1A8YA 1EV9A 1GULA 2X4AA 1U88A 3F6FA 5GSSA 3CTGA 2R6KA 2LNTA 5IMVA 2PBJA 2YPMA 5F8BA 3P8WA 2KHPA 2EIOA 4MNNA 5EPFA 1ZL9A 3E0UA 4KH7A 4WKWA 2GLRA 3HD5A 4K0GA 1B8XA 3FZAA 3GHAA 1ZYEA 3GH6A 2FLSA 2QA2A 2TIRA 2MMNA 3P7XA 1U87A 5DQSA 2VM1A 2C0FA 1GSSA 3GFKA 2MMZA 4JRRA 2VD1A 4WF4A 2DLXA 4N30A 4RQXA 4ZL7A 2PGTA 3LSZA 1YKCA 5DJLA 2CVBA 4F0CA 2B5EA 4XRDA 3TGZA 4MJAA 1O7UA 3TCOA 3KTBA 4V1Ap 3P2AA 4LMVA 3HVXA 1XFLA 2HZEA 5G30A 4CDOA 3CRUA 1G7OA 4HU7A 4EE0A 4K7NA 4K2XA 2B7JA 3KGKA 1YF1A 2CV4A 4WBJA 1GSEA 2H0GA 1OE7A 2VLVA 2TRCP 2HNLA 4KF9A 1V58A 2F8FA 4HQZA 3FR6A 4JBBA 3IHGA 3I43A 1DUGA 4TW5A 5LNKe 1W4VA 4TR1B 2DMMA 1XWKA 2LUSA 4HJMA 4AJ6A 2VOCA 5LD0A 4HI7A 4NWYA 3GMFA 4GRFA 2N5AA 4MPGA 5DBQA 3MWHA 4YAPA 3A2XA 4Z7XA 1M2AA 3FZ4A 2IFQA 2M72A 1T00A 1YZXA 3Q6OA 2WJUA 4KUNA 2L4CA 2HE3A 1Z7RA 1GTAA 2E2MA 3C1SA 2VCVA 2OA7A 2V41A 3S9FA 4DSSA 2HSYA 1ERVA 3IAM2 2CX4A 2X8HA 4LLRA 4XHMA 5DQYA 5FWGA 1R5AA 3DGQA 4K0NA 4O7HA 2CZ3A 3NIVA 1TI3A 4Q5RA 1K0MA 5ECMB 1F37A 3HKRA 1WMJA 4LL1B 4EIPA 2JU5A 3W8JA 3A5IA 18GSA 5D93A 1AIUA 1PGTA 2RM5A 4NHZA 4ZL8A 4I8BA 3PGTA 1GUKA 2FUG2 5CNWA 1GL8A 1A24A 3KMOA 1FB0A 1QGVA 2DJKA 1JZDA 4V2MA 1KEBA 3QAGA 4MMMA 1X5CA 3CBUA 2WULA 3KIJA 5IOWA 5DVBA 4IKHA 3SBCA 1F3AA 3GIXA 2LEGA 17GSA 2YP6A 2JZRA 3UVHA 1KNGA 2A2SA 5A4VA 2FWEA 5FHIA 4PQIA 2YJHA 3F4SA 3FK8A 5IO0A 1TU7A 3WYWA 2HZEB 2PERA 2GTUA 4MJEA 1Z7PA 5F0GA 2I81A 5E4WA 1GSQA 1H4OA 4X4JA 1E2YA 2IMFA 1ERWA 4MP4A 5DDLA 4D73A 4XIHA 2ZNMA 4POKA 2WS2A 1T1VA 4IW9A 2AUVA 3QPMA 2N5BA 2PUKC 3VURA 2XPEA 4HSCX 2CVKA 1SYXA 3GSTA 3GTUB 4X43A 4BVXA 4L0WA 4E8HA 1AW9A 3HYPA 2TRXA 1A23A 3IHQA 3K8NA 4WR4A 1FB6A 2ES7A 1ILOA 1AQXA 4HDEA 2REMA 2IFQB 4G10A 3JCML 3HZ4A 3DIEA 1YKAA 3L78A 2OE0A 10GSA 3GYKA 1FOHA 4MA9A 1U3IA 4EUYA 4DSSB 2H1AA 2J9HA 3CSHA 3J7Yb 3ZREA 1A0RP 3FR9A 3TKPA 2YOIA 2H6YA 4NV2A 1MD3A 4ECIA 4DEJA 2V2GA 4OCEA 2AJQB 4IBPA 1WOUA 3L4NA 4ID0A 4E8EA 3IC4A 1Y6EA 5GAND 4NV5A 2YCDA 5H5RA 5HR2A 3UMAA 3GN3A 4MZCA 2HYXA 1X0RA 3OR5A 1SK2A 1EV4A 4BL7A 3GSSA 1URMA 1I5GA 1MDJA 3FW2A 3HCZA 2H0IA 2FCHA 2IWTA 4EC0A 4BWQA 1K3YA 3QOUA 1A2MA 3FRCA 1QQ2A 3US3A 3RDWA 1U3AA 5AIXA 4NXIA 2PVOC 4JR6A 11GSA 12GSA 3VWVA 3LFLA 3FMWA 3QMXA 4PUFC 4TXOA 3NOFA 3TKSE 5JCUA 1XG8A 2HXKA 4NHWA 3IE3A 2EC4A 2X99A
chains in the Genus database with same CATH topology
5J3RA 1WIKA 6GSYA 2BJXA 1GLPA 3MYDA 2VCQA 4GQCA 4DSRA 20GSA 4J56E 2GDRA 3HXSA 2IMDA 3ZYWA 1I9DA 1R7HA 3UJ1A 2DIYA 5IIZA 1SD9A 4D73B 3CRTA 1WE0A 3KZQA 4BVYA 3LORA 3EMPA 2X49A 3MDKA 4TN8A 4IELA 3D4MA 5IOXA 3D5JA 3EYTA 4KAEA 2HSHA 4KNDA 3QFBC 3UL3A 2ON5A 4BVXB 4V2LA 1LBKA 2I3YA 2IJYA 1EEMA 1GRXA 1K0NA 3LW9A 2YWNA 1TK5B 4XTSA 2R3XA 4GCIA 1N2AA 4G0KA 1YEPA 2YZHA 4P3YB 4KSMA 3GH9A 3BCKA 2H6ZA 4PTSA 4EIQA 5ELAA 4A5PA 2GSQA 3IV4A 4JE1A 4L8EA 3ERFA 4O92A 2P5QA 4V2NA 3KJYA 1ERTA 3GA4A 3AY8A 3VPQA 4GQFA 1O81A 4BL7B 6GSTA 1PQNA 1S3DA 3DYRA 2OBKA 3PH9A 4HS1A 2K9FA 2QGVA 1WWJA 3GKMA 1O8XA 2X8GA 5KOXA 4KE3A 5L71A 2VUPA 3WGDA 4ZB8A 3F4RA 5G1KA 2DJ2A 5KN1A 1G6WA 3ZMKA 5KN2A 4CW9A 4GSTA 2NPBA 2B1LA 4TXOB 5GZZB 1T8EB 4EDZA 4OMVA 3ZLPA 3WD6A 4TR0A 3KP9A 4PNGA 4G0LA 2IMKA 2VL2A 4O5QA 2H6XA 5J41A 3E3EA 5CRHA 5ENUA 2ALBA 4Q5QA 4FQUA 4QL7A 4TR4A 2E7PA 3VWUA 3F3RA 4OD7A 3ME7A 2OE3A 1Q4JA 1TP9A 5CRDA 5HR0A 2FNOA 3F0IA 3GKNA 3WGXA 3VI5A 5HR3A 2H70A 2DKIA 1ZYNA 1K0AA 2CT6A 3BOAA 4BVYB 1XVWA 4YKGA 2H76A 5DALA 3QFAC 4V1Ag 2DC5A 1JLWA 2D2ZA 5B6NA 2WZ9A 2H8LA 1YY7A 2LRNA 3GURA 4POMA 4OO5A 1V57A 4ECJA 3TJJA 2K18A 4JEDA 3U5RE 1Z5YE 2R0PA 2FD3A 3L9UA 3N9JA 3C1RA 2GSRA 3I9V2 3TB2A 2IPAA 3VK9A 1B9XC 4ECBA 4ML6A 1ZOFA 2PMTA 3APSA 5D96A 2A2RA 4JZQA 3RBTA 3IK7A 5AIVA 1ML6A 3PR8A 3RAZA 3VWXA 1WJKA 2FA4A 4H86A 1JHBA 2PWJA 3O6TA 3ZVJA 1QXHA 5HFKA 1F6MC 3M0FA 2NDOA 1XCCA 4J2FA 4YQVA 1TXXA 1TI1A 5D8IA 2QA1A 5H5SA 1T4YA 5J4UA 3ED3A 1PD21 3CSJA 3G7YA 4YH2A 4MK3A 1K0OA 2A4VA 2DIZA 1FAAA 3A2VA 4O5RA 2YN1A 2VAFA 4MPFA 4F03A 3FYGA 3BCIA 1SJZA 5HR1A 4TVEA 1SK1A 4HZ2A 1VF1A 5A4UA 4YAVA 2E2GA 3FZ9A 4KSOA 2F3MA 3L9SA 3CMIA 4GF0A 3KP8A 6GSVA 2MBSA 1G0TA 1SU9A 2MMOA 3O76A 4WETA 4YQMA 1TTZA 1CQHA 2H30A 3FR3A 2VLTA 3BBYA 1MDKA 2KOKA 2C3NA 5BRTA 2A2PA 3KMNA 1WP0A 2H0HA 2XPDA 5IMFA 3Q18A 3V1WA 4OWYA 3TJBA 4TKYA 1GH2A 2C3QA 1M9BA 2QKEA 1V40A 1DSBA 1J08A 3HDCA 4G0IA 4ISDA 2YZUA 2V32A 4MCUA 5J9CA 1GSDA 3TJKA 4PX1A 3J7Yk 2H73A 3LXZA 4N0VA 2DBCA 2LNSA 4ZBDA 5DALB 3WGEA 2YWMA 5IPGA 2V1MA 3LYKA 5IQYA 3EURA 5HQPA 2GQKA 3TKQA 1VRSD 1JZRA 3IBHA 3M9JA 4TRXA 1THOA 4KCAA 2GT5A 1HQOA 4Q5FA 1XOAA 3HJPA 5DCHA 3RPPA 3DEXA 4Z2UA 6GSWA 3KXOA 4MF6A 3EWLA 3A5WA 1PSQA 2R0CA 1FG4A 4PQHA 2LS5A 3DD3A 1AUCA 5G2ZA 2CAQA 3LWAA 2RUEA 2F8AA 1A2LA 3DKSA 2OBIA 3APQA 4N11A 3VLNA 5J5NA 1SJIA 1TW9A 4IQAA 4CHSA 1EEJA 4PQ1A 4KCEA 4IGJA 3IA1A 2LQOA 3BJ5A 1XW9A 2I9HA 1XXUA 2JSYA 4MZBA 4WF5A 4IN0A 4TR3A 3PPUA 2IN3A 1T7PB 4QL9A 4IP1A 4Z2TA 5CO3A 5G5EA 4JU5A 1PKWA 2AB6A 3HVVA 2LSTA 2EIRA 2H74A 5AGYA 1XWAA 5B6MA 3C8EA 4KW6A 4OFTA 1RQMA 2KP1A 5KN3A 3FKFA 3UBLA 3IXRA 2GSSA 1AXDA 2L5OA 4HQSA 3KH7A 2IMIA 2PU9C 3CYNA 7GSSA 3F6DA 4POLA 2GT6A 3HA9A 1EZKA 3LYPA 1K0CA 4KA0A 2MBTA 2M80A 2NVLA 4WXTA 8GSSA 3HHVA 1V9WA 3ERGA 4X1UA 5D9XA 1OC9A 3APOA 3BD2A 4O32A 1XVQA 3P90A 1ST9A 4PXOA 2YV7A 1O6JA 1F2EA 2GZYA 3R2QA 2ON7A 5CREA 1AQVA 2GGTA 4ACSA 1MD4A 1YJ6A 2C0EA 2R37A 1ZCPA 3TJGA 1OVNA 4LMWA 1ERUA 4EF0A 3ZIJA 5ECIB 3EVIA 5E59A 1PX7A 1DE1A 6GSUA 1M99A 1ZGNA 2IIYA 1O85A 5IPHA 4RUVA 4KDUA 3G7IA 1THXA 2NTOA 4MDCA 4MZWA 5ECSA 1TRSA 3TKSC 3HJOA 1UN2A 4ILFA 3MIXA 5C00A 5JCWA 4OCFA 5JWQB 3ZRDA 5EY6A 4ZBBA 1TRWA 3UAPA 3WT2A 1USBA 2L5LA 5ECPB 3IRAA 5KOWA 1R5PA 1FW1A 1JZWA 3KTLA 3MAKA 4EKZA 2P0GA 2B6MA 2V6KA 2DJ3A 2PVQA 2VM2A 3QR6A 1SL0B 4RQRA 1YQ1A 2O85A 4IJ3A 2Z9SA 2H75A 2FWFA 3LEFA 1BJXA 4L5LA 5F05A 1UC7A 2VL2C 1A2JA 2HZFA 1GTBA 3M3MA 3M8NA 2H66A 2GQLA 1IYHA 1WPIA 2YNXA 2FWGA 3C73A 4XS4A 1Z6MA 3TOTA 4I6XA 1QK8A 3PINA 2KUCA 3LXTA 4USSA 3ZMLA 2VCZA 3GNJA 1KTEA 3LG6A 1GTUA 5CP1A 5G5FA 1HNBA 1OC9B 3F63A 4J57E 1DBYA 3QAVA 2BTOT 3D22A 2RUFA 1PL2A 1EOGA 2L59A 5B7CA 1XW6A 2DJ1A 4GSSA 5D9WA 1TU8A 1RK4A 4ZBAA 2VIMA 5ID2A 2C3TA 4HJ2A 1M2BA 1SENA 4LA1A 1ZZYA 1Y25A 1B4PA 1F3BA 2H1BA 4POBA 3TKSA 4PURA 1YEXA 4HOJA 3F4TA 3CXGA 1OKTA 1GTIA 3UARA 2I1UA 2O7KA 3ZFBA 1HYUA 2B3SA 2CA8A 1X5DA 1UA5A 16GSA 1JZOA 1TKDB 13GSA 5IO2A 1WRYA 1XIYA 2L57A 2WCIA 2K6VA 5J9BA 1SYRA 3VPTA 1QMVA 4IVFA 4PNFA 1S3CA 4OFNA 5ECRB 5EL8A 2GZPA 2O8VB 2O87A 2GVPA 3LQ7A 1FHEA 4XCSA 3A3TA 2F51A 2LKUA 2EIQA 1OYJA 3VWWA 1SJ6A 3RHCA 5ECLB 4WEYA 2GQMA 3DXBA 1PRXA 1TOFA 3I69A 5KN0A 1B48A 4FIWA 1X9MB 1FVJA 4F0BA 5INYA 1ACVA 3GL5A 5IMCA 5GAPD 3FY7A 2LQQA 1ZYQB 9GSSA 3UVTA 1M9AA 1T4ZA 4IP6A 2H01A 2YWIA 2VO4A 3TOUA 4L0UA 2IMEA 2XC2A 3TDGA 2H1DA 4F9ZA 1NHYA 2V6OA 3ZTLA 1V98A 1VF3A 4FYCA 2J23A 3LJRA 4KDYA 1VGLA 5ECKB 1GSUA 4XS4B 1EP8A 5D73A 3GL3A 5CRWA 4MH2A 3EC3A 2MYGA 2VCTA 2G0FA 2VL9A 1MTCA 4ECCA 1JLVA 5IMAA 5DAKA 2AV4A 3GX0A 3IC8A 3G9BA 1GNEA 3RPNA 1XW5A 3HJMA 2H1GA 3IAS2 5G31A 3WT1A 4N10A 1GUMA 4OO4A 1GP1A 3D0ZA 5FT3A 2RIIA 1SD8A 3DVXA 1LJRA 5IMZA 4IQ1A 5JWOB 5A4WA 1BYEA 2CQ9A 2JADA 5IM9A 6GSXA 5ID2B 3ERWA 2VLUA 5CAXA 2FWHA 3ZZXA 3GRXA 4K9ZA 2JL4A 4K7OA 1NSWA 2LRTA 2WFCA 4ICYA 4TOPA 4NMUA 3ZIVA 2OACA 1NHOA 2L6CA 4FYUA 4ZIJA 5DJMA 2OE1A 1O73A 3TJFA 14GSA 3GUSA 4O5UA 4RI6A 1TRUA 1FVKA 1VF2A 3QAWA 2RM6A 1XZOA 2VD0A 1EOHA 1SKWB 3O3TA 3EMXA 4G9HA 4YQUA 3EE2A 1IYIA 1GWCA 1M2DA 2LJRA 4JR4A 2R0GA 2E0QA 3QD9A 4MF5A 1SL2B 22GSA 2C1YA 2DJ0A 2MMAA 1B9YC 1YF0A 1TDIA 1FO5A 2YJ7A 2I4AA 1O8WA 4K6XA 1OE8A 3GTUA 3DVWA 2CVDA 4Q5NA 4L5OA 1OC8A 2C0DA 3G7JA 1GLQA 5HFGA 1PMTA 3CSIA 4RI7A 2XBQA 2L4QA 5F07A 2AYTA 2K8SA 6GSSA 1BX9A 2DMLA 3KD0A 3IPZA 1Z9HA 2HFDA 1A0FA 2XBIA 3UBKA 2DJJA 4FH8A 4QQ7A 1UVZA 2GS3A 5B8AA 4LL4B 3VFIA 4FYBA 1SKRB 2C0GA 4PUAA 3KM6A 1NW2A 1M0UA 5DAKB 1K0DA 4DVCA 4F82A 3F9UA 3D6IA 1TK8B 1B4QA 2H71A 1U6TA 2BMXA 5AISA 1DE2A 3EINA 3QDNA 4AF2A 2F9SA 4K2DA 2B5YA 4OFMA 1H75A 4HUAA 5BMUA 4XS6A 4F2IA 4ZB9A 5COHA 4AJ7A 3SWLA 2NBSA 1C72A 1MDIA 3M1GA 5KEJA 4ULXA 1XBSA 1CQGA 2FHEA 3GKXA 4TXVA 3UIWA 2R4VA 2O89A 5B8BA 4MJBA 1EGOA 1ZMAA 3ZVJD 3KEBA 4MABA 3M9KA 1BEDA 3F3QA 1GUHA 4BWSA 3TRQA 1OC3A 3IOSA 4BA7A 1R26A 5IMDA 19GSA 4FO5A 4HU9A 3A2WA 1SK0A 2HRNA 4I97A 2HLSA 4KX4A 1K3LA 2WRTA 4CY6A 2AHEA 2VCXA 4WBRD 1FOVA 1KBNA 3R3EA 4K8MA 2FA8A 3EU3A 3I6AA 4KDXA 2ZUPA 1X9WB 1ABAA 2K8VA 1TJDA 1SKSB 3LGCA 3QCPA 4MLYA 1X5EA 2WB9A 3TUEA 4DSQA 3MNGA 3UOMA 1PKZA 4HZ4A 4GTUA 4G2EA 4I2TA 3IDVA 1J0FA 1ZYPA 3IK9A 1V2AA 3E9JB 1R4WA 1Z6NA 2H72A 2YV9A 3N5OA 1K3OA 5DCGA 2CX3A 3DWVA 2WDUA 1NM3A 1EGRA 2LJKA 1PX6A 1SL1B 2HI7A 1RW1A 2X64A 1TK0B 4K5SA 1AAZA 4GXZA 3DRNA 3GX8A 2JZSA 1J9BA 1AC1A 4CY8A 2XHFA 2DSAA 2HRKA 3HZ8A 3L9VA 4BPYA 3D4TA 2A4HA 5HFIA 3ME8A 2DKHA 2HRFA 2JSZA 3TKRA 4MF7A 3TRXA 2LTKA 1MEKA 2LRCA 2LJAA 2QC7A 4ML1A 2HT9A 1PN9A 4K1FA 4EXJA 4I5QA 3MSZA 1PN0A 2R2JA 3UEMA 1F9MA 2ZCTA 1BAYA 4N0ZA 3HVSA 2PPTA 1G6YA 4K7IA 2G2QA 2VL3A 2OADA 1LU4A 1QFNA 3ZFLA 1QUWA 4GLTA 4PGTA 2MZCA 2HSMA 4EVMA 2H19A 3EU4A 4NPBA 2L6DA 1PL1A 1N8JA 1AQWA 1HNAA 2QSIA 4IS0A 1S3AA 5ECHB 2N5FA 5F06A 2FGXA 4KGIA 4X0XA 1XWBA 2R5GA 3H93A 3H4KA 3C7MA 2CAIA 3W6GA 5A5KA 1BQ7A 3Q19A 2P31A 3W8SA 1XPVA 3GV1A 2B5XA 5ECOB 3TRPA 5LCZA 2X8CA 2B1KA 3D21A 2CZ2A 1JFUA 4I2UA 3H79A 2YWOA 2C80A 4GSNA 4G19A 3VI7A 2AAWA 1HD2A 2JZTA 5H5QA 4EL1A 3DMLA 2RLIA 1OAZA 2OJLA 5JWRB 3KH9A 4EO3A 1YDKA 4KB3A 1K0BA 3F8UA 5ABRA 3FHKA 4EDYA 2OKAA 3H8QA 1T3BA 2PN8A 3FEUA 4ZILA 1TRVA 1A8LA 5ECNB 1GSFA 4ZB6A 3ISOA 3FZ5A 5D9VA 1HNCA 3U6VA 2B7KA 5G1LA 1EP7A 5AN1A 1XWGA 2C4JA 4XRAA 4NAXA 4AJ8A 5ELGA 4HEA2 1X9SB 1E6BA 4K5RA 1W89A 5EVOA 1GSYA 1VF4A 5GSTA 3GKKA 2WGRA 4Z2RA 2C8UA 5D9TA 3KCMA 1ON4A 1Z3EA 3ZITA 3RHBA 5CYYA 4MJCA 1XOBA 5ECQB 3H1NA 5JCGA 2GZZA 2LV3A 2P5RA 2YANA 2GSTA 1GNWA 2FY6A 1PA3A 2HRAA 3ZL5A 4TR1A 2UZ8A 4MH3A 1XWCA 4YKFA 4ZL9A 2VCWA 1M7TA 2JACA 3L0HA 3CTFA 1OKDA 1EWXA 1BG5A 2KLXA 3HY2A 5CRGA 3IR4A 2KP2A 4IHUA 5C04A 3Q74A 3C71A 2IL3A 4XS1A 1Q98A 4IJIA 4AGSA 2M46A 3EPTA 4WR5A 4GWRA 1G7EA 3NZNA 4ZXGA 1A8YA 1EV9A 1GULA 2X4AA 1U88A 3F6FA 5GSSA 3CTGA 2R6KA 2LNTA 5IMVA 2PBJA 2YPMA 5F8BA 3P8WA 2KHPA 2EIOA 4MNNA 5EPFA 1ZL9A 3E0UA 4KH7A 4WKWA 2GLRA 3HD5A 4K0GA 1B8XA 3FZAA 3GHAA 1ZYEA 3GH6A 2FLSA 2QA2A 2TIRA 2MMNA 3P7XA 1U87A 5DQSA 2VM1A 2C0FA 1GSSA 3GFKA 2MMZA 4JRRA 2VD1A 4WF4A 2DLXA 4N30A 4RQXA 4ZL7A 2PGTA 3LSZA 1YKCA 5DJLA 2CVBA 4F0CA 2B5EA 4XRDA 3TGZA 4MJAA 1O7UA 3TCOA 3KTBA 4V1Ap 3P2AA 4LMVA 3HVXA 1XFLA 2HZEA 5G30A 4CDOA 3CRUA 1G7OA 4HU7A 4EE0A 4K7NA 4K2XA 2B7JA 3KGKA 1YF1A 2CV4A 4WBJA 1GSEA 2H0GA 1OE7A 2VLVA 2TRCP 2HNLA 4KF9A 1V58A 2F8FA 4HQZA 3FR6A 4JBBA 3IHGA 3I43A 1DUGA 4TW5A 5LNKe 1W4VA 4TR1B 2DMMA 1XWKA 2LUSA 4HJMA 4AJ6A 2VOCA 5LD0A 4HI7A 4NWYA 3GMFA 4GRFA 2N5AA 4MPGA 5DBQA 3MWHA 4YAPA 3A2XA 4Z7XA 1M2AA 3FZ4A 2IFQA 2M72A 1T00A 1YZXA 3Q6OA 2WJUA 4KUNA 2L4CA 2HE3A 1Z7RA 1GTAA 2E2MA 3C1SA 2VCVA 2OA7A 2V41A 3S9FA 4DSSA 2HSYA 1ERVA 3IAM2 2CX4A 2X8HA 4LLRA 4XHMA 5DQYA 5FWGA 1R5AA 3DGQA 4K0NA 4O7HA 2CZ3A 3NIVA 1TI3A 4Q5RA 1K0MA 5ECMB 1F37A 3HKRA 1WMJA 4LL1B 4EIPA 2JU5A 3W8JA 3A5IA 18GSA 5D93A 1AIUA 1PGTA 2RM5A 4NHZA 4ZL8A 4I8BA 3PGTA 1GUKA 2FUG2 5CNWA 1GL8A 1A24A 3KMOA 1FB0A 1QGVA 2DJKA 1JZDA 4V2MA 1KEBA 3QAGA 4MMMA 1X5CA 3CBUA 2WULA 3KIJA 5IOWA 5DVBA 4IKHA 3SBCA 1F3AA 3GIXA 2LEGA 17GSA 2YP6A 2JZRA 3UVHA 1KNGA 2A2SA 5A4VA 2FWEA 5FHIA 4PQIA 2YJHA 3F4SA 3FK8A 5IO0A 1TU7A 3WYWA 2HZEB 2PERA 2GTUA 4MJEA 1Z7PA 5F0GA 2I81A 5E4WA 1GSQA 1H4OA 4X4JA 1E2YA 2IMFA 1ERWA 4MP4A 5DDLA 4D73A 4XIHA 2ZNMA 4POKA 2WS2A 1T1VA 4IW9A 2AUVA 3QPMA 2N5BA 2PUKC 3VURA 2XPEA 2CVKA 1SYXA 3GSTA 3GTUB 4X43A 4BVXA 4L0WA 4E8HA 1AW9A 3HYPA 2TRXA 1A23A 3IHQA 3K8NA 4WR4A 1FB6A 2ES7A 1ILOA 1AQXA 4HDEA 2REMA 2IFQB 4G10A 3JCML 3HZ4A 3DIEA 1YKAA 3L78A 2OE0A 10GSA 3GYKA 1FOHA 4MA9A 1U3IA 4EUYA 4DSSB 2H1AA 2J9HA 3CSHA 3J7Yb 3ZREA 1A0RP 3FR9A 3TKPA 2YOIA 2H6YA 4NV2A 1MD3A 4ECIA 4DEJA 2V2GA 4OCEA 2AJQB 4IBPA 1WOUA 3L4NA 4ID0A 4E8EA 3IC4A 1Y6EA 5GAND 4NV5A 2YCDA 5H5RA 5HR2A 3UMAA 3GN3A 4MZCA 2HYXA 1X0RA 3OR5A 1SK2A 1EV4A 4BL7A 3GSSA 1URMA 1I5GA 1MDJA 3FW2A 3HCZA 2H0IA 2FCHA 2IWTA 4EC0A 4BWQA 1K3YA 3QOUA 1A2MA 3FRCA 1QQ2A 3US3A 3RDWA 1U3AA 5AIXA 4NXIA 2PVOC 4JR6A 11GSA 12GSA 3VWVA 3LFLA 3FMWA 3QMXA 4PUFC 4TXOA 3NOFA 3TKSE 5JCUA 2HXKA 4NHWA 3IE3A 2EC4A 2X99A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5J3R A;  1WIK A;  6GSY A;  2BJX A;  1GLP A;  2VCQ A;  4GQC A;  4DSR A;  20GS A;  4J56 E;  2GDR A;  3HXS A;  2IMD A;  3ZYW A;  1I9D A;  1R7H A;  3UJ1 A;  2DIY A;  5IIZ A;  1SD9 A;  4D73 B;  3CRT A;  1WE0 A;  3KZQ A;  4BVY A;  3LOR A;  3EMP A;  3MDK A;  4TN8 A;  4IEL A;  3D4M A;  5IOX A;  3D5J A;  3EYT A;  4KAE A;  2HSH A;  4KND A;  3QFB C;  3UL3 A;  2ON5 A;  4V2L A;  1LBK A;  2I3Y A;  2IJY A;  1EEM A;  1GRX A;  1K0N A;  2YWN A;  1TK5 B;  4XTS A;  2R3X A;  4GCI A;  1N2A A;  1YEP A;  2YZH A;  4P3Y B;  4KSM A;  3GH9 A;  3BCK A;  2H6Z A;  5ELA A;  2GSQ A;  3IV4 A;  4JE1 A;  4L8E A;  3ERF A;  4O92 A;  2P5Q A;  4V2N A;  3KJY A;  1ERT A;  3GA4 A;  3AY8 A;  3VPQ A;  4GQF A;  1O81 A;  6GST A;  1PQN A;  1S3D A;  3DYR A;  2OBK A;  3PH9 A;  4HS1 A;  2K9F A;  2QGV A;  1WWJ A;  3GKM A;  1O8X A;  2X8G A;  4KE3 A;  5L71 A;  2VUP A;  3WGD A;  4ZB8 A;  3F4R A;  5G1K A;  2DJ2 A;  5KN1 A;  1G6W A;  3ZMK A;  5KN2 A;  4CW9 A;  4GST A;  2NPB A;  2B1L A;  4TXO B;  5GZZ B;  1T8E B;  4EDZ A;  4OMV A;  3ZLP A;  3WD6 A;  4TR0 A;  3KP9 A;  4PNG A;  2IMK A;  2VL2 A;  2H6X A;  5J41 A;  3E3E A;  5CRH A;  5ENU A;  2ALB A;  4Q5Q A;  4QL7 A;  4TR4 A;  2E7P A;  3VWU A;  3F3R A;  4OD7 A;  3ME7 A;  2OE3 A;  1Q4J A;  1TP9 A;  5CRD A;  5HR0 A;  2FNO A;  3F0I A;  3GKN A;  3WGX A;  3VI5 A;  5HR3 A;  2H70 A;  1K0A A;  2CT6 A;  3BOA A;  1XVW A;  2H76 A;  5DAL A;  3QFA C;  4V1A g;  2DC5 A;  1JLW A;  2D2Z A;  5B6N A;  2WZ9 A;  2H8L A;  1YY7 A;  2LRN A;  3GUR A;  4POM A;  4OO5 A;  1V57 A;  4ECJ A;  3TJJ A;  2K18 A;  4JED A;  3U5R E;  1Z5Y E;  2FD3 A;  3L9U A;  3N9J A;  3C1R A;  2GSR A;  3I9V 2;  3TB2 A;  2IPA A;  3VK9 A;  1B9X C;  4ECB A;  4ML6 A;  1ZOF A;  2PMT A;  3APS A;  5D96 A;  2A2R A;  4JZQ A;  3RBT A;  3IK7 A;  5AIV A;  1ML6 A;  3PR8 A;  3RAZ A;  3VWX A;  1WJK A;  2FA4 A;  4H86 A;  1JHB A;  2PWJ A;  3O6T A;  3ZVJ A;  1QXH A;  5HFK A;  1F6M C;  3M0F A;  2NDO A;  1XCC A;  4J2F A;  4YQV A;  1TXX A;  1TI1 A;  5D8I A;  5H5S A;  1T4Y A;  5J4U A;  3ED3 A;  1PD2 1;  3CSJ A;  3G7Y A;  4YH2 A;  4MK3 A;  1K0O A;  2A4V A;  2DIZ A;  1FAA A;  3A2V A;  4O5R A;  2YN1 A;  2VAF A;  4MPF A;  4F03 A;  3FYG A;  3BCI A;  1SJZ A;  5HR1 A;  4TVE A;  1SK1 A;  4HZ2 A;  1VF1 A;  5A4U A;  4YAV A;  2E2G A;  3FZ9 A;  4KSO A;  2F3M A;  3L9S A;  3CMI A;  4GF0 A;  3KP8 A;  6GSV A;  2MBS A;  1G0T A;  1SU9 A;  2MMO A;  3O76 A;  4WET A;  4YQM A;  1TTZ A;  1CQH A;  2H30 A;  3FR3 A;  2VLT A;  3BBY A;  1MDK A;  2KOK A;  2C3N A;  3KMN A;  1WP0 A;  2H0H A;  2XPD A;  5IMF A;  3Q18 A;  3V1W A;  4OWY A;  3TJB A;  4TKY A;  1GH2 A;  2C3Q A;  1M9B A;  2QKE A;  1V40 A;  1DSB A;  1J08 A;  3HDC A;  4ISD A;  2YZU A;  2V32 A;  4MCU A;  5J9C A;  1GSD A;  3TJK A;  4PX1 A;  3J7Y k;  2H73 A;  3LXZ A;  4N0V A;  2DBC A;  2LNS A;  4ZBD A;  5DAL B;  3WGE A;  2YWM A;  5IPG A;  2V1M A;  3LYK A;  5IQY A;  3EUR A;  5HQP A;  2GQK A;  3TKQ A;  1VRS D;  1JZR A;  3IBH A;  3M9J A;  4TRX A;  1THO A;  4KCA A;  2GT5 A;  1HQO A;  4Q5F A;  1XOA A;  3HJP A;  5DCH A;  3RPP A;  3DEX A;  6GSW A;  3KXO A;  4MF6 A;  3EWL A;  3A5W A;  1PSQ A;  1FG4 A;  4PQH A;  2LS5 A;  3DD3 A;  1AUC A;  5G2Z A;  2CAQ A;  3LWA A;  2RUE A;  2F8A A;  1A2L A;  3DKS A;  2OBI A;  3APQ A;  4N11 A;  3VLN A;  5J5N A;  1SJI A;  1TW9 A;  4IQA A;  4CHS A;  1EEJ A;  4PQ1 A;  4KCE A;  4IGJ A;  3IA1 A;  2LQO A;  3BJ5 A;  1XW9 A;  2I9H A;  1XXU A;  2JSY A;  4MZB A;  4WF5 A;  4IN0 A;  4TR3 A;  2IN3 A;  1T7P B;  4QL9 A;  4IP1 A;  5CO3 A;  5G5E A;  4JU5 A;  1PKW A;  2AB6 A;  3HVV A;  2LST A;  2EIR A;  2H74 A;  5AGY A;  1XWA A;  5B6M A;  3C8E A;  4KW6 A;  4OFT A;  1RQM A;  2KP1 A;  5KN3 A;  3FKF A;  3UBL A;  3IXR A;  2GSS A;  1AXD A;  2L5O A;  4HQS A;  3KH7 A;  2IMI A;  2PU9 C;  3CYN A;  7GSS A;  3F6D A;  4POL A;  2GT6 A;  3HA9 A;  1EZK A;  3LYP A;  1K0C A;  4KA0 A;  2MBT A;  2M80 A;  2NVL A;  4WXT A;  8GSS A;  3HHV A;  1V9W A;  3ERG A;  4X1U A;  5D9X A;  1OC9 A;  3APO A;  3BD2 A;  4O32 A;  1XVQ A;  3P90 A;  1ST9 A;  4PXO A;  2YV7 A;  1O6J A;  1F2E A;  2GZY A;  3R2Q A;  2ON7 A;  5CRE A;  1AQV A;  2GGT A;  4ACS A;  1MD4 A;  1YJ6 A;  2C0E A;  2R37 A;  1ZCP A;  3TJG A;  1OVN A;  4LMW A;  1ERU A;  4EF0 A;  3ZIJ A;  5ECI B;  3EVI A;  5E59 A;  1PX7 A;  1DE1 A;  6GSU A;  1M99 A;  1ZGN A;  2IIY A;  1O85 A;  5IPH A;  4RUV A;  4KDU A;  3G7I A;  1THX A;  2NTO A;  4MDC A;  4MZW A;  5ECS A;  1TRS A;  3TKS C;  3HJO A;  1UN2 A;  4ILF A;  5C00 A;  5JCW A;  4OCF A;  5JWQ B;  3ZRD A;  5EY6 A;  4ZBB A;  1TRW A;  3UAP A;  3WT2 A;  1USB A;  2L5L A;  5ECP B;  3IRA A;  1R5P A;  1FW1 A;  1JZW A;  3KTL A;  3MAK A;  4EKZ A;  2P0G A;  2B6M A;  2V6K A;  2DJ3 A;  2PVQ A;  2VM2 A;  3QR6 A;  1SL0 B;  4RQR A;  1YQ1 A;  2O85 A;  4IJ3 A;  2Z9S A;  2H75 A;  2FWF A;  3LEF A;  1BJX A;  4L5L A;  5F05 A;  1UC7 A;  2VL2 C;  1A2J A;  2HZF A;  1GTB A;  3M3M A;  3M8N A;  2H66 A;  2GQL A;  1IYH A;  1WPI A;  2YNX A;  2FWG A;  3C73 A;  4XS4 A;  1Z6M A;  3TOT A;  4I6X A;  1QK8 A;  3PIN A;  2KUC A;  3LXT A;  3ZML A;  2VCZ A;  3GNJ A;  1KTE A;  3LG6 A;  1GTU A;  5CP1 A;  5G5F A;  1HNB A;  1OC9 B;  3F63 A;  4J57 E;  1DBY A;  3QAV A;  2BTO T;  3D22 A;  2RUF A;  1PL2 A;  1EOG A;  2L59 A;  5B7C A;  1XW6 A;  2DJ1 A;  4GSS A;  5D9W A;  1TU8 A;  1RK4 A;  4ZBA A;  2VIM A;  5ID2 A;  2C3T A;  4HJ2 A;  1M2B A;  1SEN A;  4LA1 A;  1ZZY A;  1Y25 A;  1B4P A;  1F3B A;  2H1B A;  4POB A;  3TKS A;  4PUR A;  1YEX A;  4HOJ A;  3F4T A;  3CXG A;  1OKT A;  1GTI A;  3UAR A;  2I1U A;  2O7K A;  3ZFB A;  1HYU A;  2B3S A;  2CA8 A;  1X5D A;  1UA5 A;  16GS A;  1JZO A;  1TKD B;  13GS A;  5IO2 A;  1WRY A;  1XIY A;  2L57 A;  2WCI A;  2K6V A;  5J9B A;  1SYR A;  3VPT A;  1QMV A;  4IVF A;  4PNF A;  1S3C A;  4OFN A;  5ECR B;  5EL8 A;  2GZP A;  2O8V B;  2O87 A;  2GVP A;  3LQ7 A;  1FHE A;  4XCS A;  3A3T A;  2F51 A;  2LKU A;  2EIQ A;  1OYJ A;  3VWW A;  1SJ6 A;  3RHC A;  5ECL B;  4WEY A;  2GQM A;  3DXB A;  1PRX A;  1TOF A;  3I69 A;  5KN0 A;  1B48 A;  4FIW A;  1X9M B;  1FVJ A;  4F0B A;  5INY A;  1ACV A;  3GL5 A;  5IMC A;  5GAP D;  3FY7 A;  2LQQ A;  1ZYQ B;  9GSS A;  3UVT A;  1M9A A;  1T4Z A;  4IP6 A;  2H01 A;  2YWI A;  2VO4 A;  3TOU A;  4L0U A;  2IME A;  2XC2 A;  3TDG A;  2H1D A;  4F9Z A;  1NHY A;  2V6O A;  3ZTL A;  1V98 A;  1VF3 A;  4FYC A;  2J23 A;  3LJR A;  4KDY A;  1VGL A;  5ECK B;  1GSU A;  4XS4 B;  1EP8 A;  5D73 A;  3GL3 A;  5CRW A;  4MH2 A;  3EC3 A;  2MYG A;  2VCT A;  2G0F A;  2VL9 A;  1MTC A;  4ECC A;  1JLV A;  5IMA A;  5DAK A;  2AV4 A;  3GX0 A;  3G9B A;  1GNE A;  3RPN A;  1XW5 A;  3HJM A;  2H1G A;  3IAS 2;  5G31 A;  3WT1 A;  4N10 A;  1GUM A;  4OO4 A;  1GP1 A;  3D0Z A;  5FT3 A;  2RII A;  1SD8 A;  3DVX A;  1LJR A;  5IMZ A;  4IQ1 A;  5JWO B;  5A4W A;  1BYE A;  2CQ9 A;  2JAD A;  5IM9 A;  6GSX A;  5ID2 B;  3ERW A;  2VLU A;  5CAX A;  2FWH A;  3ZZX A;  3GRX A;  4K9Z A;  2JL4 A;  4K7O A;  1NSW A;  2LRT A;  2WFC A;  4TOP A;  4NMU A;  3ZIV A;  2OAC A;  1NHO A;  2L6C A;  4FYU A;  4ZIJ A;  5DJM A;  2OE1 A;  1O73 A;  3TJF A;  14GS A;  3GUS A;  4RI6 A;  1TRU A;  1FVK A;  1VF2 A;  3QAW A;  2RM6 A;  1XZO A;  2VD0 A;  1EOH A;  1SKW B;  3O3T A;  3EMX A;  4G9H A;  4YQU A;  3EE2 A;  1IYI A;  1GWC A;  1M2D A;  2LJR A;  4JR4 A;  2E0Q A;  3QD9 A;  4MF5 A;  1SL2 B;  22GS A;  2C1Y A;  2DJ0 A;  2MMA A;  1B9Y C;  1YF0 A;  1TDI A;  1FO5 A;  2YJ7 A;  2I4A A;  1O8W A;  4K6X A;  1OE8 A;  3GTU A;  3DVW A;  2CVD A;  4Q5N A;  4L5O A;  1OC8 A;  2C0D A;  3G7J A;  1GLQ A;  5HFG A;  1PMT A;  3CSI A;  4RI7 A;  2XBQ A;  2L4Q A;  5F07 A;  2AYT A;  2K8S A;  6GSS A;  1BX9 A;  2DML A;  3KD0 A;  3IPZ A;  1Z9H A;  2HFD A;  1A0F A;  2XBI A;  3UBK A;  2DJJ A;  4FH8 A;  4QQ7 A;  1UVZ A;  2GS3 A;  5B8A A;  4LL4 B;  3VFI A;  4FYB A;  1SKR B;  2C0G A;  4PUA A;  3KM6 A;  1NW2 A;  1M0U A;  5DAK B;  1K0D A;  4DVC A;  4F82 A;  3F9U A;  3D6I A;  1TK8 B;  1B4Q A;  2H71 A;  1U6T A;  2BMX A;  5AIS A;  1DE2 A;  3EIN A;  3QDN A;  4AF2 A;  2F9S A;  4K2D A;  2B5Y A;  4OFM A;  1H75 A;  4HUA A;  4XS6 A;  4F2I A;  4ZB9 A;  5COH A;  4AJ7 A;  3SWL A;  2NBS A;  1C72 A;  1MDI A;  3M1G A;  5KEJ A;  4ULX A;  1XBS A;  1CQG A;  2FHE A;  3GKX A;  4TXV A;  3UIW A;  2R4V A;  2O89 A;  5B8B A;  4MJB A;  1EGO A;  1ZMA A;  3ZVJ D;  3KEB A;  4MAB A;  3M9K A;  1BED A;  3F3Q A;  1GUH A;  4BWS A;  3TRQ A;  1OC3 A;  3IOS A;  4BA7 A;  1R26 A;  5IMD A;  19GS A;  4FO5 A;  4HU9 A;  3A2W A;  1SK0 A;  2HRN A;  4I97 A;  2HLS A;  4KX4 A;  1K3L A;  2WRT A;  2AHE A;  2VCX A;  4WBR D;  1FOV A;  1KBN A;  4K8M A;  2FA8 A;  3EU3 A;  3I6A A;  4KDX A;  2ZUP A;  1X9W B;  1ABA A;  2K8V A;  1TJD A;  1SKS B;  3LGC A;  3QCP A;  4MLY A;  1X5E A;  2WB9 A;  3TUE A;  4DSQ A;  3MNG A;  3UOM A;  1PKZ A;  4HZ4 A;  4GTU A;  4G2E A;  4I2T A;  3IDV A;  1J0F A;  3IK9 A;  1V2A A;  3E9J B;  1R4W A;  1Z6N A;  2H72 A;  2YV9 A;  3N5O A;  1K3O A;  5DCG A;  2CX3 A;  3DWV A;  2WDU A;  1NM3 A;  1EGR A;  2LJK A;  1PX6 A;  1SL1 B;  2HI7 A;  1RW1 A;  2X64 A;  1TK0 B;  1AAZ A;  4GXZ A;  3DRN A;  3GX8 A;  2JZS A;  1J9B A;  1AC1 A;  2XHF A;  2DSA A;  3HZ8 A;  3L9V A;  4BPY A;  3D4T A;  5HFI A;  3ME8 A;  2HRF A;  2JSZ A;  3TKR A;  4MF7 A;  3TRX A;  2LTK A;  1MEK A;  2LRC A;  2LJA A;  2QC7 A;  4ML1 A;  2HT9 A;  1PN9 A;  4K1F A;  4EXJ A;  4I5Q A;  3MSZ A;  2R2J A;  3UEM A;  1F9M A;  2ZCT A;  1BAY A;  4N0Z A;  3HVS A;  2PPT A;  1G6Y A;  4K7I A;  2G2Q A;  2VL3 A;  2OAD A;  1LU4 A;  1QFN A;  3ZFL A;  1QUW A;  4GLT A;  4PGT A;  2MZC A;  4EVM A;  2H19 A;  3EU4 A;  4NPB A;  2L6D A;  1PL1 A;  1N8J A;  1AQW A;  1HNA A;  2QSI A;  4IS0 A;  1S3A A;  5ECH B;  2N5F A;  5F06 A;  2FGX A;  4KGI A;  4X0X A;  1XWB A;  2R5G A;  3H93 A;  3H4K A;  3C7M A;  2CAI A;  3W6G A;  5A5K A;  1BQ7 A;  3Q19 A;  2P31 A;  3W8S A;  1XPV A;  3GV1 A;  2B5X A;  5ECO B;  3TRP A;  5LCZ A;  2X8C A;  2B1K A;  3D21 A;  2CZ2 A;  1JFU A;  4I2U A;  3H79 A;  2YWO A;  2C80 A;  4GSN A;  4G19 A;  3VI7 A;  2AAW A;  1HD2 A;  2JZT A;  5H5Q A;  4EL1 A;  3DML A;  2RLI A;  1OAZ A;  2OJL A;  5JWR B;  3KH9 A;  4EO3 A;  1YDK A;  4KB3 A;  1K0B A;  3F8U A;  5ABR A;  3FHK A;  4EDY A;  2OKA A;  3H8Q A;  1T3B A;  2PN8 A;  3FEU A;  4ZIL A;  1TRV A;  1A8L A;  5ECN B;  1GSF A;  4ZB6 A;  3ISO A;  3FZ5 A;  5D9V A;  1HNC A;  3U6V A;  2B7K A;  5G1L A;  1EP7 A;  5AN1 A;  1XWG A;  2C4J A;  4XRA A;  4NAX A;  4AJ8 A;  5ELG A;  4HEA 2;  1X9S B;  1E6B A;  1W89 A;  5EVO A;  1GSY A;  1VF4 A;  5GST A;  3GKK A;  2WGR A;  2C8U A;  5D9T A;  3KCM A;  1ON4 A;  1Z3E A;  3ZIT A;  3RHB A;  5CYY A;  4MJC A;  1XOB A;  5ECQ B;  3H1N A;  5JCG A;  2GZZ A;  2LV3 A;  2P5R A;  2YAN A;  2GST A;  1GNW A;  2FY6 A;  1PA3 A;  3ZL5 A;  4TR1 A;  4MH3 A;  1XWC A;  4ZL9 A;  2VCW A;  1M7T A;  2JAC A;  3L0H A;  3CTF A;  1OKD A;  1EWX A;  1BG5 A;  2KLX A;  3HY2 A;  5CRG A;  3IR4 A;  2KP2 A;  4IHU A;  5C04 A;  3Q74 A;  3C71 A;  2IL3 A;  4XS1 A;  1Q98 A;  4IJI A;  4AGS A;  2M46 A;  4WR5 A;  4GWR A;  1G7E A;  3NZN A;  4ZXG A;  1A8Y A;  1EV9 A;  1GUL A;  1U88 A;  3F6F A;  5GSS A;  3CTG A;  2R6K A;  2LNT A;  5IMV A;  2PBJ A;  2YPM A;  5F8B A;  3P8W A;  2KHP A;  2EIO A;  5EPF A;  1ZL9 A;  3E0U A;  4KH7 A;  4WKW A;  2GLR A;  3HD5 A;  4K0G A;  1B8X A;  3FZA A;  3GHA A;  1ZYE A;  3GH6 A;  2FLS A;  2TIR A;  2MMN A;  3P7X A;  1U87 A;  5DQS A;  2VM1 A;  2C0F A;  1GSS A;  3GFK A;  2MMZ A;  4JRR A;  2VD1 A;  4WF4 A;  2DLX A;  4N30 A;  4RQX A;  4ZL7 A;  2PGT A;  3LSZ A;  1YKC A;  5DJL A;  2CVB A;  4F0C A;  2B5E A;  4XRD A;  3TGZ A;  4MJA A;  1O7U A;  3TCO A;  3KTB A;  4V1A p;  3P2A A;  4LMV A;  3HVX A;  1XFL A;  2HZE A;  5G30 A;  4CDO A;  3CRU A;  1G7O A;  4HU7 A;  4EE0 A;  4K7N A;  2B7J A;  3KGK A;  1YF1 A;  2CV4 A;  4WBJ A;  1GSE A;  2H0G A;  1OE7 A;  2VLV A;  2TRC P;  2HNL A;  1V58 A;  2F8F A;  4HQZ A;  3FR6 A;  4JBB A;  3I43 A;  1DUG A;  4TW5 A;  5LNK e;  1W4V A;  4TR1 B;  2DMM A;  1XWK A;  2LUS A;  4HJM A;  4AJ6 A;  2VOC A;  5LD0 A;  4HI7 A;  4NWY A;  3GMF A;  4GRF A;  2N5A A;  4MPG A;  5DBQ A;  3MWH A;  4YAP A;  3A2X A;  4Z7X A;  1M2A A;  3FZ4 A;  2IFQ A;  2M72 A;  1T00 A;  1YZX A;  3Q6O A;  2WJU A;  4KUN A;  2L4C A;  2HE3 A;  1Z7R A;  1GTA A;  2E2M A;  3C1S A;  2VCV A;  2OA7 A;  2V41 A;  3S9F A;  4DSS A;  2HSY A;  1ERV A;  3IAM 2;  2CX4 A;  2X8H A;  4LLR A;  4XHM A;  5DQY A;  5FWG A;  1R5A A;  3DGQ A;  4K0N A;  4O7H A;  2CZ3 A;  3NIV A;  1TI3 A;  4Q5R A;  1K0M A;  5ECM B;  1F37 A;  3HKR A;  1WMJ A;  4LL1 B;  2JU5 A;  3W8J A;  18GS A;  5D93 A;  1AIU A;  1PGT A;  2RM5 A;  4NHZ A;  4ZL8 A;  4I8B A;  3PGT A;  1GUK A;  2FUG 2;  5CNW A;  1GL8 A;  1A24 A;  3KMO A;  1FB0 A;  1QGV A;  2DJK A;  1JZD A;  4V2M A;  1KEB A;  3QAG A;  4MMM A;  1X5C A;  3CBU A;  2WUL A;  3KIJ A;  5IOW A;  5DVB A;  4IKH A;  3SBC A;  1F3A A;  3GIX A;  2LEG A;  17GS A;  2YP6 A;  2JZR A;  3UVH A;  1KNG A;  2A2S A;  5A4V A;  2FWE A;  5FHI A;  4PQI A;  2YJH A;  3F4S A;  3FK8 A;  5IO0 A;  1TU7 A;  3WYW A;  2HZE B;  2PER A;  2GTU A;  4MJE A;  1Z7P A;  5F0G A;  2I81 A;  5E4W A;  1GSQ A;  1H4O A;  1E2Y A;  2IMF A;  1ERW A;  4MP4 A;  5DDL A;  4D73 A;  4XIH A;  2ZNM A;  4POK A;  2WS2 A;  1T1V A;  4IW9 A;  2AUV A;  3QPM A;  2N5B A;  2PUK C;  3VUR A;  2XPE A;  2CVK A;  1SYX A;  3GST A;  3GTU B;  4X43 A;  4BVX A;  4L0W A;  4E8H A;  1AW9 A;  3HYP A;  2TRX A;  1A23 A;  3IHQ A;  3K8N A;  4WR4 A;  1FB6 A;  2ES7 A;  1ILO A;  1AQX A;  4HDE A;  2REM A;  2IFQ B;  4G10 A;  3JCM L;  3HZ4 A;  3DIE A;  1YKA A;  3L78 A;  2OE0 A;  10GS A;  3GYK A;  4MA9 A;  1U3I A;  4EUY A;  4DSS B;  2H1A A;  2J9H A;  3CSH A;  3J7Y b;  3ZRE A;  1A0R P;  3FR9 A;  3TKP A;  2YOI A;  2H6Y A;  4NV2 A;  1MD3 A;  4ECI A;  4DEJ A;  2V2G A;  4OCE A;  2AJQ B;  4IBP A;  1WOU A;  3L4N A;  4ID0 A;  4E8E A;  3IC4 A;  1Y6E A;  5GAN D;  4NV5 A;  2YCD A;  5H5R A;  5HR2 A;  3UMA A;  3GN3 A;  4MZC A;  2HYX A;  1X0R A;  3OR5 A;  1SK2 A;  1EV4 A;  4BL7 A;  3GSS A;  1URM A;  1I5G A;  1MDJ A;  3FW2 A;  3HCZ A;  2H0I A;  2FCH A;  2IWT A;  4EC0 A;  4BWQ A;  1K3Y A;  3QOU A;  1A2M A;  3FRC A;  1QQ2 A;  3US3 A;  3RDW A;  1U3A A;  5AIX A;  4NXI A;  2PVO C;  4JR6 A;  11GS A;  12GS A;  3VWV A;  3LFL A;  3QMX A;  4PUF C;  4TXO A;  3NOF A;  3TKS E;  5JCU A;  2HXK A;  4NHW A;  3IE3 A;  2EC4 A;  2X99 A; 
#chains in the Genus database with same CATH topology
 5J3R A;  1WIK A;  3HVN A;  6GSY A;  2BJX A;  1GLP A;  3MYD A;  2VCQ A;  4GQC A;  4DSR A;  20GS A;  4J56 E;  2GDR A;  3HXS A;  2IMD A;  3ZYW A;  1I9D A;  1R7H A;  3UJ1 A;  2DIY A;  5IIZ A;  1SD9 A;  4D73 B;  3CRT A;  1WE0 A;  3KZQ A;  4BVY A;  3LOR A;  3EMP A;  2X49 A;  3MDK A;  4TN8 A;  4IEL A;  3D4M A;  5IOX A;  3D5J A;  3EYT A;  4KAE A;  2HSH A;  4KND A;  3QFB C;  3UL3 A;  2ON5 A;  4BVX B;  4V2L A;  1LBK A;  2I3Y A;  2IJY A;  1EEM A;  1GRX A;  1K0N A;  3LW9 A;  2YWN A;  1TK5 B;  4XTS A;  2R3X A;  4GCI A;  1N2A A;  4G0K A;  1YEP A;  2YZH A;  4P3Y B;  4KSM A;  3GH9 A;  3BCK A;  2H6Z A;  4PTS A;  4EIQ A;  5ELA A;  4A5P A;  2GSQ A;  3IV4 A;  4JE1 A;  4L8E A;  3ERF A;  4O92 A;  2P5Q A;  4V2N A;  3KJY A;  1ERT A;  3GA4 A;  3AY8 A;  3VPQ A;  4GQF A;  1O81 A;  4BL7 B;  6GST A;  1PQN A;  1S3D A;  3DYR A;  2OBK A;  3PH9 A;  4HS1 A;  2K9F A;  2QGV A;  1WWJ A;  3GKM A;  1O8X A;  2X8G A;  5KOX A;  4KE3 A;  5L71 A;  2VUP A;  3WGD A;  4ZB8 A;  3F4R A;  5G1K A;  2DJ2 A;  5KN1 A;  1G6W A;  3ZMK A;  5KN2 A;  4CW9 A;  4GST A;  2NPB A;  2B1L A;  4TXO B;  5GZZ B;  1T8E B;  4EDZ A;  4OMV A;  3ZLP A;  3WD6 A;  4TR0 A;  3KP9 A;  4PNG A;  4G0L A;  2IMK A;  2VL2 A;  4O5Q A;  2H6X A;  5J41 A;  3E3E A;  5CRH A;  5ENU A;  2ALB A;  4Q5Q A;  4FQU A;  4QL7 A;  4TR4 A;  2E7P A;  3VWU A;  3F3R A;  4OD7 A;  3ME7 A;  2OE3 A;  1Q4J A;  1TP9 A;  5CRD A;  5HR0 A;  2FNO A;  3F0I A;  3GKN A;  3WGX A;  3VI5 A;  5HR3 A;  2H70 A;  2DKI A;  1ZYN A;  1K0A A;  2CT6 A;  3BOA A;  4BVY B;  1XVW A;  4YKG A;  2H76 A;  5DAL A;  3QFA C;  4V1A g;  2DC5 A;  1JLW A;  2D2Z A;  5B6N A;  2WZ9 A;  2H8L A;  1YY7 A;  2LRN A;  3GUR A;  4POM A;  4OO5 A;  1V57 A;  4ECJ A;  3TJJ A;  2K18 A;  4JED A;  3U5R E;  1Z5Y E;  2R0P A;  2FD3 A;  3L9U A;  3N9J A;  3C1R A;  2GSR A;  3I9V 2;  3TB2 A;  2IPA A;  3VK9 A;  1B9X C;  4ECB A;  4ML6 A;  1ZOF A;  2PMT A;  3APS A;  5D96 A;  2A2R A;  4JZQ A;  3RBT A;  3IK7 A;  5AIV A;  1ML6 A;  3PR8 A;  3RAZ A;  3VWX A;  1WJK A;  2FA4 A;  4H86 A;  1JHB A;  2PWJ A;  3O6T A;  3ZVJ A;  1QXH A;  5HFK A;  1F6M C;  3M0F A;  2NDO A;  1XCC A;  4J2F A;  4YQV A;  1TXX A;  1TI1 A;  5D8I A;  2QA1 A;  5H5S A;  1T4Y A;  5J4U A;  3ED3 A;  1PD2 1;  3CSJ A;  3G7Y A;  4YH2 A;  4MK3 A;  1K0O A;  2A4V A;  2DIZ A;  1FAA A;  3A2V A;  4O5R A;  2YN1 A;  2VAF A;  4MPF A;  4F03 A;  3FYG A;  3BCI A;  1SJZ A;  5HR1 A;  4TVE A;  1SK1 A;  4HZ2 A;  1VF1 A;  5A4U A;  4YAV A;  1M3J A;  2E2G A;  3FZ9 A;  4KSO A;  2F3M A;  3L9S A;  3CMI A;  4GF0 A;  3KP8 A;  6GSV A;  2MBS A;  1G0T A;  1SU9 A;  2MMO A;  3O76 A;  4WET A;  4YQM A;  1TTZ A;  1CQH A;  2H30 A;  3FR3 A;  2VLT A;  3BBY A;  1MDK A;  2KOK A;  2C3N A;  5BRT A;  2A2P A;  3KMN A;  1WP0 A;  2H0H A;  2XPD A;  5IMF A;  3Q18 A;  3V1W A;  4OWY A;  3TJB A;  4TKY A;  1GH2 A;  2C3Q A;  1M9B A;  2QKE A;  1V40 A;  1DSB A;  1J08 A;  3HDC A;  4G0I A;  4ISD A;  2YZU A;  2V32 A;  4MCU A;  5J9C A;  1GSD A;  3TJK A;  4PX1 A;  3J7Y k;  2H73 A;  3LXZ A;  4N0V A;  2DBC A;  2LNS A;  4ZBD A;  5DAL B;  3WGE A;  2YWM A;  5IPG A;  2V1M A;  3LYK A;  5IQY A;  3EUR A;  5HQP A;  2GQK A;  3TKQ A;  1VRS D;  1JZR A;  3IBH A;  3M9J A;  4TRX A;  1THO A;  4KCA A;  2GT5 A;  1HQO A;  4Q5F A;  1XOA A;  3HJP A;  5DCH A;  3RPP A;  3DEX A;  4Z2U A;  6GSW A;  3KXO A;  4MF6 A;  3EWL A;  3A5W A;  1PSQ A;  2R0C A;  1FG4 A;  4PQH A;  2LS5 A;  3DD3 A;  1AUC A;  5G2Z A;  2CAQ A;  3LWA A;  2RUE A;  2F8A A;  1A2L A;  3DKS A;  2OBI A;  3APQ A;  4N11 A;  3VLN A;  5J5N A;  1SJI A;  1TW9 A;  4IQA A;  4CHS A;  1EEJ A;  4PQ1 A;  4KCE A;  4IGJ A;  3IA1 A;  2LQO A;  3BJ5 A;  1XW9 A;  2I9H A;  1XXU A;  2JSY A;  4MZB A;  4WF5 A;  4IN0 A;  4TR3 A;  3PPU A;  2IN3 A;  1T7P B;  4QL9 A;  4IP1 A;  4Z2T A;  5CO3 A;  5G5E A;  4JU5 A;  1PKW A;  2AB6 A;  3HVV A;  2LST A;  2EIR A;  2H74 A;  5AGY A;  1XWA A;  5B6M A;  3C8E A;  4KW6 A;  4OFT A;  1RQM A;  2KP1 A;  5KN3 A;  3FKF A;  3UBL A;  3IXR A;  2GSS A;  1AXD A;  2L5O A;  4HQS A;  3KH7 A;  2IMI A;  2PU9 C;  3CYN A;  7GSS A;  3F6D A;  4POL A;  2GT6 A;  3HA9 A;  1EZK A;  3LYP A;  1K0C A;  4KA0 A;  2MBT A;  2M80 A;  2NVL A;  4WXT A;  8GSS A;  3HHV A;  1V9W A;  3ERG A;  4X1U A;  5D9X A;  1OC9 A;  3APO A;  3BD2 A;  4O32 A;  1XVQ A;  3P90 A;  1ST9 A;  4PXO A;  2YV7 A;  1O6J A;  1F2E A;  2GZY A;  3R2Q A;  2ON7 A;  5CRE A;  1AQV A;  2GGT A;  4ACS A;  1MD4 A;  1YJ6 A;  2C0E A;  2R37 A;  1ZCP A;  3TJG A;  1OVN A;  4LMW A;  1ERU A;  4EF0 A;  3ZIJ A;  5ECI B;  3EVI A;  5E59 A;  1PX7 A;  1DE1 A;  6GSU A;  1M99 A;  1ZGN A;  2IIY A;  1O85 A;  5IPH A;  4RUV A;  4KDU A;  3G7I A;  1THX A;  2NTO A;  4MDC A;  4MZW A;  5ECS A;  1TRS A;  3TKS C;  3HJO A;  1UN2 A;  4ILF A;  3MIX A;  5C00 A;  5JCW A;  4OCF A;  5JWQ B;  3ZRD A;  5EY6 A;  4ZBB A;  1TRW A;  3UAP A;  3WT2 A;  1USB A;  2L5L A;  5ECP B;  3IRA A;  5KOW A;  1R5P A;  1FW1 A;  1JZW A;  3KTL A;  3MAK A;  4EKZ A;  2P0G A;  2B6M A;  2V6K A;  2DJ3 A;  2PVQ A;  2VM2 A;  3QR6 A;  1SL0 B;  4RQR A;  1YQ1 A;  2O85 A;  4IJ3 A;  2Z9S A;  2H75 A;  2FWF A;  3LEF A;  1BJX A;  4L5L A;  5F05 A;  1UC7 A;  2VL2 C;  1A2J A;  2HZF A;  1GTB A;  3M3M A;  3M8N A;  2H66 A;  2GQL A;  1IYH A;  1WPI A;  2YNX A;  2FWG A;  3C73 A;  4XS4 A;  1Z6M A;  3TOT A;  4I6X A;  1QK8 A;  3PIN A;  2KUC A;  3LXT A;  4USS A;  3ZML A;  2VCZ A;  3GNJ A;  1KTE A;  3LG6 A;  1GTU A;  5CP1 A;  5G5F A;  1HNB A;  1OC9 B;  3F63 A;  4J57 E;  1DBY A;  3QAV A;  2BTO T;  3D22 A;  2RUF A;  1PL2 A;  1EOG A;  2L59 A;  5B7C A;  1XW6 A;  2DJ1 A;  4GSS A;  5D9W A;  1TU8 A;  1RK4 A;  4ZBA A;  2VIM A;  5ID2 A;  2C3T A;  4HJ2 A;  1M2B A;  1SEN A;  4LA1 A;  1ZZY A;  1Y25 A;  1B4P A;  1F3B A;  2H1B A;  4POB A;  3TKS A;  4PUR A;  1YEX A;  4HOJ A;  3F4T A;  3CXG A;  1OKT A;  1GTI A;  3UAR A;  2I1U A;  2O7K A;  3ZFB A;  1HYU A;  2B3S A;  2CA8 A;  1X5D A;  1UA5 A;  16GS A;  1JZO A;  1TKD B;  4BIK A;  13GS A;  5IO2 A;  1WRY A;  1XIY A;  2L57 A;  2WCI A;  2K6V A;  5J9B A;  1SYR A;  3VPT A;  1QMV A;  4IVF A;  4PNF A;  1S3C A;  4OFN A;  5ECR B;  5EL8 A;  2GZP A;  2O8V B;  2O87 A;  2GVP A;  3LQ7 A;  1FHE A;  4XCS A;  3A3T A;  2F51 A;  2LKU A;  2EIQ A;  1OYJ A;  3VWW A;  1SJ6 A;  3RHC A;  5ECL B;  4WEY A;  2GQM A;  3DXB A;  1PRX A;  1TOF A;  3I69 A;  5KN0 A;  1B48 A;  4FIW A;  1X9M B;  1FVJ A;  4F0B A;  5INY A;  1ACV A;  3GL5 A;  5IMC A;  5GAP D;  3FY7 A;  2LQQ A;  1ZYQ B;  9GSS A;  3UVT A;  1M9A A;  1T4Z A;  4IP6 A;  2H01 A;  2YWI A;  2VO4 A;  3TOU A;  4L0U A;  2IME A;  2XC2 A;  3TDG A;  2H1D A;  4F9Z A;  1NHY A;  2V6O A;  3ZTL A;  1V98 A;  1VF3 A;  4FYC A;  2J23 A;  3LJR A;  4KDY A;  1VGL A;  5ECK B;  1GSU A;  4XS4 B;  1EP8 A;  5D73 A;  3GL3 A;  5CRW A;  4MH2 A;  3EC3 A;  2MYG A;  2VCT A;  2G0F A;  2VL9 A;  1MTC A;  3CQF A;  4ECC A;  1JLV A;  5IMA A;  5DAK A;  2AV4 A;  3GX0 A;  3IC8 A;  3G9B A;  1GNE A;  3RPN A;  1XW5 A;  3HJM A;  2H1G A;  3IAS 2;  5G31 A;  3WT1 A;  4N10 A;  1GUM A;  4OO4 A;  1GP1 A;  3D0Z A;  5FT3 A;  2RII A;  1SD8 A;  3DVX A;  1LJR A;  5IMZ A;  4IQ1 A;  5JWO B;  5A4W A;  1BYE A;  2CQ9 A;  2JAD A;  5IM9 A;  6GSX A;  5ID2 B;  3ERW A;  2VLU A;  5CAX A;  2FWH A;  3ZZX A;  3GRX A;  4K9Z A;  2JL4 A;  4K7O A;  1NSW A;  2LRT A;  2WFC A;  4ICY A;  4TOP A;  4NMU A;  3ZIV A;  2OAC A;  1NHO A;  2L6C A;  4FYU A;  4ZIJ A;  5DJM A;  2OE1 A;  1O73 A;  3TJF A;  14GS A;  3GUS A;  4O5U A;  4RI6 A;  1TRU A;  1FVK A;  1VF2 A;  3QAW A;  2RM6 A;  1XZO A;  2VD0 A;  1EOH A;  1SKW B;  3O3T A;  3EMX A;  4G9H A;  4YQU A;  3EE2 A;  1IYI A;  1GWC A;  1M2D A;  2LJR A;  4JR4 A;  2R0G A;  2E0Q A;  3QD9 A;  4MF5 A;  1SL2 B;  22GS A;  2C1Y A;  2DJ0 A;  2MMA A;  1B9Y C;  1YF0 A;  1TDI A;  1FO5 A;  2YJ7 A;  2I4A A;  1O8W A;  4K6X A;  1OE8 A;  3GTU A;  3DVW A;  2CVD A;  4Q5N A;  4L5O A;  1OC8 A;  2C0D A;  3G7J A;  1GLQ A;  5HFG A;  1PMT A;  3CSI A;  4RI7 A;  2XBQ A;  2L4Q A;  5F07 A;  2AYT A;  2K8S A;  6GSS A;  1BX9 A;  2DML A;  3KD0 A;  3IPZ A;  1Z9H A;  2HFD A;  1A0F A;  2XBI A;  3UBK A;  2DJJ A;  4FH8 A;  4QQ7 A;  1UVZ A;  2GS3 A;  5B8A A;  4LL4 B;  3VFI A;  4FYB A;  1SKR B;  2C0G A;  4PUA A;  3KM6 A;  1NW2 A;  1M0U A;  5DAK B;  1K0D A;  4DVC A;  4F82 A;  3F9U A;  3D6I A;  1TK8 B;  1B4Q A;  2H71 A;  1U6T A;  2BMX A;  5AIS A;  1DE2 A;  3EIN A;  3QDN A;  4AF2 A;  2F9S A;  4K2D A;  2B5Y A;  4OFM A;  1H75 A;  4HUA A;  5BMU A;  4XS6 A;  4F2I A;  4ZB9 A;  5COH A;  4AJ7 A;  3SWL A;  2NBS A;  1C72 A;  1MDI A;  3M1G A;  5KEJ A;  4ULX A;  1XBS A;  1CQG A;  2FHE A;  3GKX A;  4TXV A;  3UIW A;  2R4V A;  2O89 A;  5B8B A;  4MJB A;  1EGO A;  1ZMA A;  3ZVJ D;  3KEB A;  4MAB A;  3M9K A;  1BED A;  3F3Q A;  1GUH A;  4BWS A;  3TRQ A;  1OC3 A;  3IOS A;  4BA7 A;  1R26 A;  5IMD A;  19GS A;  4FO5 A;  4HU9 A;  3A2W A;  1SK0 A;  2HRN A;  4I97 A;  2HLS A;  4KX4 A;  1K3L A;  2WRT A;  4CY6 A;  2AHE A;  2VCX A;  4WBR D;  1FOV A;  1KBN A;  3R3E A;  4K8M A;  2FA8 A;  3EU3 A;  3I6A A;  4KDX A;  2ZUP A;  1X9W B;  1ABA A;  2K8V A;  1TJD A;  1SKS B;  3LGC A;  3QCP A;  4MLY A;  1X5E A;  2WB9 A;  3TUE A;  4DSQ A;  3MNG A;  3UOM A;  1PKZ A;  4HZ4 A;  4GTU A;  4G2E A;  1M3I A;  4I2T A;  3IDV A;  1J0F A;  1ZYP A;  3IK9 A;  1V2A A;  3E9J B;  1R4W A;  1Z6N A;  2H72 A;  2YV9 A;  3N5O A;  1K3O A;  5DCG A;  2CX3 A;  3DWV A;  2WDU A;  1NM3 A;  1EGR A;  2LJK A;  1PX6 A;  1SL1 B;  2HI7 A;  1RW1 A;  2X64 A;  1TK0 B;  4K5S A;  1AAZ A;  4GXZ A;  3DRN A;  3GX8 A;  2JZS A;  1J9B A;  1AC1 A;  4CY8 A;  2XHF A;  2DSA A;  2HRK A;  3HZ8 A;  3L9V A;  4BPY A;  3D4T A;  2A4H A;  5HFI A;  3ME8 A;  2DKH A;  2HRF A;  2JSZ A;  3TKR A;  4MF7 A;  3TRX A;  2LTK A;  1MEK A;  2LRC A;  2LJA A;  2QC7 A;  4ML1 A;  2HT9 A;  1PN9 A;  4K1F A;  4EXJ A;  4I5Q A;  3MSZ A;  1PN0 A;  2R2J A;  3UEM A;  1F9M A;  2ZCT A;  1BAY A;  4N0Z A;  3HVS A;  2PPT A;  1G6Y A;  4K7I A;  2G2Q A;  2VL3 A;  2OAD A;  1LU4 A;  1QFN A;  1PFO A;  3ZFL A;  1QUW A;  4GLT A;  4PGT A;  2MZC A;  2HSM A;  4EVM A;  2H19 A;  3EU4 A;  4NPB A;  2L6D A;  1PL1 A;  1N8J A;  1AQW A;  1HNA A;  2QSI A;  4IS0 A;  1S3A A;  5ECH B;  2N5F A;  5F06 A;  2FGX A;  4KGI A;  4X0X A;  1XWB A;  2R5G A;  3H93 A;  3H4K A;  3C7M A;  2CAI A;  3W6G A;  5A5K A;  1BQ7 A;  3Q19 A;  2P31 A;  3W8S A;  1XPV A;  3GV1 A;  2B5X A;  5ECO B;  3TRP A;  5LCZ A;  2X8C A;  2B1K A;  3D21 A;  2CZ2 A;  1JFU A;  4I2U A;  3H79 A;  2YWO A;  2C80 A;  4GSN A;  4G19 A;  3VI7 A;  2AAW A;  1HD2 A;  2JZT A;  5H5Q A;  4EL1 A;  3DML A;  2RLI A;  1OAZ A;  2OJL A;  5JWR B;  3KH9 A;  4EO3 A;  1YDK A;  4KB3 A;  1K0B A;  3F8U A;  5ABR A;  3FHK A;  4EDY A;  2OKA A;  3H8Q A;  1T3B A;  2PN8 A;  3FEU A;  4ZIL A;  1TRV A;  1A8L A;  5ECN B;  1GSF A;  4ZB6 A;  3ISO A;  3FZ5 A;  1S3R A;  5D9V A;  1HNC A;  3U6V A;  2B7K A;  5G1L A;  1EP7 A;  5AN1 A;  1XWG A;  2C4J A;  4XRA A;  4NAX A;  4AJ8 A;  5ELG A;  4HEA 2;  1X9S B;  1E6B A;  4K5R A;  1W89 A;  5EVO A;  1GSY A;  1VF4 A;  5GST A;  3GKK A;  2WGR A;  4Z2R A;  2C8U A;  5D9T A;  3KCM A;  1ON4 A;  1Z3E A;  3ZIT A;  3RHB A;  5CYY A;  4MJC A;  1XOB A;  5ECQ B;  3H1N A;  5JCG A;  2GZZ A;  2LV3 A;  2P5R A;  2YAN A;  2GST A;  1GNW A;  2FY6 A;  1PA3 A;  2HRA A;  3ZL5 A;  4TR1 A;  2UZ8 A;  4MH3 A;  1XWC A;  4YKF A;  4ZL9 A;  2VCW A;  1M7T A;  2JAC A;  3L0H A;  3CTF A;  1OKD A;  1EWX A;  1BG5 A;  2KLX A;  3HY2 A;  5CRG A;  3IR4 A;  2KP2 A;  4IHU A;  5C04 A;  3Q74 A;  3C71 A;  2IL3 A;  4XS1 A;  1Q98 A;  4IJI A;  4AGS A;  2M46 A;  3EPT A;  4WR5 A;  4GWR A;  1G7E A;  3NZN A;  4ZXG A;  1A8Y A;  1EV9 A;  1GUL A;  2X4A A;  1U88 A;  3F6F A;  5GSS A;  3CTG A;  2R6K A;  2LNT A;  5IMV A;  2PBJ A;  2YPM A;  5F8B A;  3P8W A;  2KHP A;  2EIO A;  4MNN A;  5EPF A;  1ZL9 A;  3E0U A;  4KH7 A;  4WKW A;  2GLR A;  3HD5 A;  4K0G A;  1B8X A;  3FZA A;  3GHA A;  1ZYE A;  3GH6 A;  2FLS A;  2QA2 A;  2TIR A;  2MMN A;  3P7X A;  1U87 A;  5DQS A;  2VM1 A;  2C0F A;  1GSS A;  3GFK A;  2MMZ A;  4JRR A;  2VD1 A;  4WF4 A;  2DLX A;  4N30 A;  4RQX A;  4ZL7 A;  2PGT A;  3LSZ A;  1YKC A;  5DJL A;  2CVB A;  4F0C A;  2B5E A;  4XRD A;  3TGZ A;  4MJA A;  1O7U A;  3TCO A;  3KTB A;  4V1A p;  3P2A A;  4LMV A;  3HVX A;  1XFL A;  2HZE A;  5G30 A;  4CDO A;  3CRU A;  1G7O A;  4HU7 A;  4EE0 A;  4K7N A;  4K2X A;  2B7J A;  3KGK A;  1YF1 A;  2CV4 A;  4WBJ A;  1GSE A;  2H0G A;  1OE7 A;  2VLV A;  2TRC P;  2HNL A;  4KF9 A;  1V58 A;  2F8F A;  4HQZ A;  3FR6 A;  4JBB A;  3IHG A;  3I43 A;  1DUG A;  4TW5 A;  5LNK e;  1W4V A;  4TR1 B;  2DMM A;  1XWK A;  2LUS A;  4HJM A;  4AJ6 A;  2VOC A;  5LD0 A;  4HI7 A;  4NWY A;  3GMF A;  4GRF A;  2N5A A;  4MPG A;  5DBQ A;  3MWH A;  4YAP A;  3A2X A;  4Z7X A;  1M2A A;  3FZ4 A;  2IFQ A;  2M72 A;  1T00 A;  1YZX A;  3Q6O A;  2WJU A;  4KUN A;  2L4C A;  2HE3 A;  1Z7R A;  1GTA A;  2E2M A;  3C1S A;  2VCV A;  2OA7 A;  2V41 A;  3S9F A;  4DSS A;  2HSY A;  1ERV A;  3IAM 2;  2CX4 A;  2X8H A;  4LLR A;  4XHM A;  5DQY A;  5FWG A;  1R5A A;  3DGQ A;  4K0N A;  4O7H A;  2CZ3 A;  3NIV A;  1TI3 A;  4Q5R A;  1K0M A;  5ECM B;  1F37 A;  3HKR A;  1WMJ A;  4LL1 B;  4EIP A;  2JU5 A;  3W8J A;  3A5I A;  18GS A;  5D93 A;  1AIU A;  1PGT A;  2RM5 A;  4NHZ A;  4ZL8 A;  4I8B A;  3PGT A;  1GUK A;  2FUG 2;  5CNW A;  1GL8 A;  1A24 A;  3KMO A;  1FB0 A;  1QGV A;  2DJK A;  1JZD A;  4V2M A;  1KEB A;  3QAG A;  4MMM A;  1X5C A;  3CBU A;  2WUL A;  3KIJ A;  5IOW A;  5DVB A;  4IKH A;  3SBC A;  1F3A A;  3GIX A;  2LEG A;  17GS A;  2YP6 A;  2JZR A;  3UVH A;  1KNG A;  2A2S A;  5A4V A;  2FWE A;  5FHI A;  4PQI A;  2YJH A;  3F4S A;  3FK8 A;  5IO0 A;  1TU7 A;  3WYW A;  2HZE B;  2PER A;  2GTU A;  4MJE A;  1Z7P A;  5F0G A;  2I81 A;  5E4W A;  1GSQ A;  1H4O A;  4X4J A;  1E2Y A;  2IMF A;  1ERW A;  4MP4 A;  5DDL A;  4D73 A;  4XIH A;  2ZNM A;  4POK A;  2WS2 A;  1T1V A;  4IW9 A;  2AUV A;  3QPM A;  2N5B A;  2PUK C;  3VUR A;  2XPE A;  4HSC X;  2CVK A;  1SYX A;  3GST A;  3GTU B;  4X43 A;  4BVX A;  4L0W A;  4E8H A;  1AW9 A;  3HYP A;  2TRX A;  1A23 A;  3IHQ A;  3K8N A;  4WR4 A;  1FB6 A;  2ES7 A;  1ILO A;  1AQX A;  4HDE A;  2REM A;  2IFQ B;  4G10 A;  3JCM L;  3HZ4 A;  3DIE A;  1YKA A;  3L78 A;  2OE0 A;  10GS A;  3GYK A;  1FOH A;  4MA9 A;  1U3I A;  4EUY A;  4DSS B;  2H1A A;  2J9H A;  3CSH A;  3J7Y b;  3ZRE A;  1A0R P;  3FR9 A;  3TKP A;  2YOI A;  2H6Y A;  4NV2 A;  1MD3 A;  4ECI A;  4DEJ A;  2V2G A;  4OCE A;  2AJQ B;  4IBP A;  1WOU A;  3L4N A;  4ID0 A;  4E8E A;  3IC4 A;  1Y6E A;  5GAN D;  4NV5 A;  2YCD A;  5H5R A;  5HR2 A;  3UMA A;  3GN3 A;  4MZC A;  2HYX A;  1X0R A;  3OR5 A;  1SK2 A;  1EV4 A;  4BL7 A;  3GSS A;  1URM A;  1I5G A;  1MDJ A;  3FW2 A;  3HCZ A;  2H0I A;  2FCH A;  2IWT A;  4EC0 A;  4BWQ A;  1K3Y A;  3QOU A;  1A2M A;  3FRC A;  1QQ2 A;  3US3 A;  3RDW A;  1U3A A;  5AIX A;  4NXI A;  2PVO C;  4JR6 A;  11GS A;  12GS A;  3VWV A;  3LFL A;  3FMW A;  3QMX A;  4PUF C;  4TXO A;  3NOF A;  3TKS E;  5JCU A;  1XG8 A;  2HXK A;  4NHW A;  3IE3 A;  2EC4 A;  2X99 A; 
#chains in the Genus database with same CATH homology
 5J3R A;  1WIK A;  6GSY A;  2BJX A;  1GLP A;  3MYD A;  2VCQ A;  4GQC A;  4DSR A;  20GS A;  4J56 E;  2GDR A;  3HXS A;  2IMD A;  3ZYW A;  1I9D A;  1R7H A;  3UJ1 A;  2DIY A;  5IIZ A;  1SD9 A;  4D73 B;  3CRT A;  1WE0 A;  3KZQ A;  4BVY A;  3LOR A;  3EMP A;  2X49 A;  3MDK A;  4TN8 A;  4IEL A;  3D4M A;  5IOX A;  3D5J A;  3EYT A;  4KAE A;  2HSH A;  4KND A;  3QFB C;  3UL3 A;  2ON5 A;  4BVX B;  4V2L A;  1LBK A;  2I3Y A;  2IJY A;  1EEM A;  1GRX A;  1K0N A;  3LW9 A;  2YWN A;  1TK5 B;  4XTS A;  2R3X A;  4GCI A;  1N2A A;  4G0K A;  1YEP A;  2YZH A;  4P3Y B;  4KSM A;  3GH9 A;  3BCK A;  2H6Z A;  4PTS A;  4EIQ A;  5ELA A;  4A5P A;  2GSQ A;  3IV4 A;  4JE1 A;  4L8E A;  3ERF A;  4O92 A;  2P5Q A;  4V2N A;  3KJY A;  1ERT A;  3GA4 A;  3AY8 A;  3VPQ A;  4GQF A;  1O81 A;  4BL7 B;  6GST A;  1PQN A;  1S3D A;  3DYR A;  2OBK A;  3PH9 A;  4HS1 A;  2K9F A;  2QGV A;  1WWJ A;  3GKM A;  1O8X A;  2X8G A;  5KOX A;  4KE3 A;  5L71 A;  2VUP A;  3WGD A;  4ZB8 A;  3F4R A;  5G1K A;  2DJ2 A;  5KN1 A;  1G6W A;  3ZMK A;  5KN2 A;  4CW9 A;  4GST A;  2NPB A;  2B1L A;  4TXO B;  5GZZ B;  1T8E B;  4EDZ A;  4OMV A;  3ZLP A;  3WD6 A;  4TR0 A;  3KP9 A;  4PNG A;  4G0L A;  2IMK A;  2VL2 A;  4O5Q A;  2H6X A;  5J41 A;  3E3E A;  5CRH A;  5ENU A;  2ALB A;  4Q5Q A;  4FQU A;  4QL7 A;  4TR4 A;  2E7P A;  3VWU A;  3F3R A;  4OD7 A;  3ME7 A;  2OE3 A;  1Q4J A;  1TP9 A;  5CRD A;  5HR0 A;  2FNO A;  3F0I A;  3GKN A;  3WGX A;  3VI5 A;  5HR3 A;  2H70 A;  2DKI A;  1ZYN A;  1K0A A;  2CT6 A;  3BOA A;  4BVY B;  1XVW A;  4YKG A;  2H76 A;  5DAL A;  3QFA C;  4V1A g;  2DC5 A;  1JLW A;  2D2Z A;  5B6N A;  2WZ9 A;  2H8L A;  1YY7 A;  2LRN A;  3GUR A;  4POM A;  4OO5 A;  1V57 A;  4ECJ A;  3TJJ A;  2K18 A;  4JED A;  3U5R E;  1Z5Y E;  2R0P A;  2FD3 A;  3L9U A;  3N9J A;  3C1R A;  2GSR A;  3I9V 2;  3TB2 A;  2IPA A;  3VK9 A;  1B9X C;  4ECB A;  4ML6 A;  1ZOF A;  2PMT A;  3APS A;  5D96 A;  2A2R A;  4JZQ A;  3RBT A;  3IK7 A;  5AIV A;  1ML6 A;  3PR8 A;  3RAZ A;  3VWX A;  1WJK A;  2FA4 A;  4H86 A;  1JHB A;  2PWJ A;  3O6T A;  3ZVJ A;  1QXH A;  5HFK A;  1F6M C;  3M0F A;  2NDO A;  1XCC A;  4J2F A;  4YQV A;  1TXX A;  1TI1 A;  5D8I A;  2QA1 A;  5H5S A;  1T4Y A;  5J4U A;  3ED3 A;  1PD2 1;  3CSJ A;  3G7Y A;  4YH2 A;  4MK3 A;  1K0O A;  2A4V A;  2DIZ A;  1FAA A;  3A2V A;  4O5R A;  2YN1 A;  2VAF A;  4MPF A;  4F03 A;  3FYG A;  3BCI A;  1SJZ A;  5HR1 A;  4TVE A;  1SK1 A;  4HZ2 A;  1VF1 A;  5A4U A;  4YAV A;  2E2G A;  3FZ9 A;  4KSO A;  2F3M A;  3L9S A;  3CMI A;  4GF0 A;  3KP8 A;  6GSV A;  2MBS A;  1G0T A;  1SU9 A;  2MMO A;  3O76 A;  4WET A;  4YQM A;  1TTZ A;  1CQH A;  2H30 A;  3FR3 A;  2VLT A;  3BBY A;  1MDK A;  2KOK A;  2C3N A;  5BRT A;  2A2P A;  3KMN A;  1WP0 A;  2H0H A;  2XPD A;  5IMF A;  3Q18 A;  3V1W A;  4OWY A;  3TJB A;  4TKY A;  1GH2 A;  2C3Q A;  1M9B A;  2QKE A;  1V40 A;  1DSB A;  1J08 A;  3HDC A;  4G0I A;  4ISD A;  2YZU A;  2V32 A;  4MCU A;  5J9C A;  1GSD A;  3TJK A;  4PX1 A;  3J7Y k;  2H73 A;  3LXZ A;  4N0V A;  2DBC A;  2LNS A;  4ZBD A;  5DAL B;  3WGE A;  2YWM A;  5IPG A;  2V1M A;  3LYK A;  5IQY A;  3EUR A;  5HQP A;  2GQK A;  3TKQ A;  1VRS D;  1JZR A;  3IBH A;  3M9J A;  4TRX A;  1THO A;  4KCA A;  2GT5 A;  1HQO A;  4Q5F A;  1XOA A;  3HJP A;  5DCH A;  3RPP A;  3DEX A;  4Z2U A;  6GSW A;  3KXO A;  4MF6 A;  3EWL A;  3A5W A;  1PSQ A;  2R0C A;  1FG4 A;  4PQH A;  2LS5 A;  3DD3 A;  1AUC A;  5G2Z A;  2CAQ A;  3LWA A;  2RUE A;  2F8A A;  1A2L A;  3DKS A;  2OBI A;  3APQ A;  4N11 A;  3VLN A;  5J5N A;  1SJI A;  1TW9 A;  4IQA A;  4CHS A;  1EEJ A;  4PQ1 A;  4KCE A;  4IGJ A;  3IA1 A;  2LQO A;  3BJ5 A;  1XW9 A;  2I9H A;  1XXU A;  2JSY A;  4MZB A;  4WF5 A;  4IN0 A;  4TR3 A;  3PPU A;  2IN3 A;  1T7P B;  4QL9 A;  4IP1 A;  4Z2T A;  5CO3 A;  5G5E A;  4JU5 A;  1PKW A;  2AB6 A;  3HVV A;  2LST A;  2EIR A;  2H74 A;  5AGY A;  1XWA A;  5B6M A;  3C8E A;  4KW6 A;  4OFT A;  1RQM A;  2KP1 A;  5KN3 A;  3FKF A;  3UBL A;  3IXR A;  2GSS A;  1AXD A;  2L5O A;  4HQS A;  3KH7 A;  2IMI A;  2PU9 C;  3CYN A;  7GSS A;  3F6D A;  4POL A;  2GT6 A;  3HA9 A;  1EZK A;  3LYP A;  1K0C A;  4KA0 A;  2MBT A;  2M80 A;  2NVL A;  4WXT A;  8GSS A;  3HHV A;  1V9W A;  3ERG A;  4X1U A;  5D9X A;  1OC9 A;  3APO A;  3BD2 A;  4O32 A;  1XVQ A;  3P90 A;  1ST9 A;  4PXO A;  2YV7 A;  1O6J A;  1F2E A;  2GZY A;  3R2Q A;  2ON7 A;  5CRE A;  1AQV A;  2GGT A;  4ACS A;  1MD4 A;  1YJ6 A;  2C0E A;  2R37 A;  1ZCP A;  3TJG A;  1OVN A;  4LMW A;  1ERU A;  4EF0 A;  3ZIJ A;  5ECI B;  3EVI A;  5E59 A;  1PX7 A;  1DE1 A;  6GSU A;  1M99 A;  1ZGN A;  2IIY A;  1O85 A;  5IPH A;  4RUV A;  4KDU A;  3G7I A;  1THX A;  2NTO A;  4MDC A;  4MZW A;  5ECS A;  1TRS A;  3TKS C;  3HJO A;  1UN2 A;  4ILF A;  3MIX A;  5C00 A;  5JCW A;  4OCF A;  5JWQ B;  3ZRD A;  5EY6 A;  4ZBB A;  1TRW A;  3UAP A;  3WT2 A;  1USB A;  2L5L A;  5ECP B;  3IRA A;  5KOW A;  1R5P A;  1FW1 A;  1JZW A;  3KTL A;  3MAK A;  4EKZ A;  2P0G A;  2B6M A;  2V6K A;  2DJ3 A;  2PVQ A;  2VM2 A;  3QR6 A;  1SL0 B;  4RQR A;  1YQ1 A;  2O85 A;  4IJ3 A;  2Z9S A;  2H75 A;  2FWF A;  3LEF A;  1BJX A;  4L5L A;  5F05 A;  1UC7 A;  2VL2 C;  1A2J A;  2HZF A;  1GTB A;  3M3M A;  3M8N A;  2H66 A;  2GQL A;  1IYH A;  1WPI A;  2YNX A;  2FWG A;  3C73 A;  4XS4 A;  1Z6M A;  3TOT A;  4I6X A;  1QK8 A;  3PIN A;  2KUC A;  3LXT A;  4USS A;  3ZML A;  2VCZ A;  3GNJ A;  1KTE A;  3LG6 A;  1GTU A;  5CP1 A;  5G5F A;  1HNB A;  1OC9 B;  3F63 A;  4J57 E;  1DBY A;  3QAV A;  2BTO T;  3D22 A;  2RUF A;  1PL2 A;  1EOG A;  2L59 A;  5B7C A;  1XW6 A;  2DJ1 A;  4GSS A;  5D9W A;  1TU8 A;  1RK4 A;  4ZBA A;  2VIM A;  5ID2 A;  2C3T A;  4HJ2 A;  1M2B A;  1SEN A;  4LA1 A;  1ZZY A;  1Y25 A;  1B4P A;  1F3B A;  2H1B A;  4POB A;  3TKS A;  4PUR A;  1YEX A;  4HOJ A;  3F4T A;  3CXG A;  1OKT A;  1GTI A;  3UAR A;  2I1U A;  2O7K A;  3ZFB A;  1HYU A;  2B3S A;  2CA8 A;  1X5D A;  1UA5 A;  16GS A;  1JZO A;  1TKD B;  13GS A;  5IO2 A;  1WRY A;  1XIY A;  2L57 A;  2WCI A;  2K6V A;  5J9B A;  1SYR A;  3VPT A;  1QMV A;  4IVF A;  4PNF A;  1S3C A;  4OFN A;  5ECR B;  5EL8 A;  2GZP A;  2O8V B;  2O87 A;  2GVP A;  3LQ7 A;  1FHE A;  4XCS A;  3A3T A;  2F51 A;  2LKU A;  2EIQ A;  1OYJ A;  3VWW A;  1SJ6 A;  3RHC A;  5ECL B;  4WEY A;  2GQM A;  3DXB A;  1PRX A;  1TOF A;  3I69 A;  5KN0 A;  1B48 A;  4FIW A;  1X9M B;  1FVJ A;  4F0B A;  5INY A;  1ACV A;  3GL5 A;  5IMC A;  5GAP D;  3FY7 A;  2LQQ A;  1ZYQ B;  9GSS A;  3UVT A;  1M9A A;  1T4Z A;  4IP6 A;  2H01 A;  2YWI A;  2VO4 A;  3TOU A;  4L0U A;  2IME A;  2XC2 A;  3TDG A;  2H1D A;  4F9Z A;  1NHY A;  2V6O A;  3ZTL A;  1V98 A;  1VF3 A;  4FYC A;  2J23 A;  3LJR A;  4KDY A;  1VGL A;  5ECK B;  1GSU A;  4XS4 B;  1EP8 A;  5D73 A;  3GL3 A;  5CRW A;  4MH2 A;  3EC3 A;  2MYG A;  2VCT A;  2G0F A;  2VL9 A;  1MTC A;  4ECC A;  1JLV A;  5IMA A;  5DAK A;  2AV4 A;  3GX0 A;  3IC8 A;  3G9B A;  1GNE A;  3RPN A;  1XW5 A;  3HJM A;  2H1G A;  3IAS 2;  5G31 A;  3WT1 A;  4N10 A;  1GUM A;  4OO4 A;  1GP1 A;  3D0Z A;  5FT3 A;  2RII A;  1SD8 A;  3DVX A;  1LJR A;  5IMZ A;  4IQ1 A;  5JWO B;  5A4W A;  1BYE A;  2CQ9 A;  2JAD A;  5IM9 A;  6GSX A;  5ID2 B;  3ERW A;  2VLU A;  5CAX A;  2FWH A;  3ZZX A;  3GRX A;  4K9Z A;  2JL4 A;  4K7O A;  1NSW A;  2LRT A;  2WFC A;  4ICY A;  4TOP A;  4NMU A;  3ZIV A;  2OAC A;  1NHO A;  2L6C A;  4FYU A;  4ZIJ A;  5DJM A;  2OE1 A;  1O73 A;  3TJF A;  14GS A;  3GUS A;  4O5U A;  4RI6 A;  1TRU A;  1FVK A;  1VF2 A;  3QAW A;  2RM6 A;  1XZO A;  2VD0 A;  1EOH A;  1SKW B;  3O3T A;  3EMX A;  4G9H A;  4YQU A;  3EE2 A;  1IYI A;  1GWC A;  1M2D A;  2LJR A;  4JR4 A;  2R0G A;  2E0Q A;  3QD9 A;  4MF5 A;  1SL2 B;  22GS A;  2C1Y A;  2DJ0 A;  2MMA A;  1B9Y C;  1YF0 A;  1TDI A;  1FO5 A;  2YJ7 A;  2I4A A;  1O8W A;  4K6X A;  1OE8 A;  3GTU A;  3DVW A;  2CVD A;  4Q5N A;  4L5O A;  1OC8 A;  2C0D A;  3G7J A;  1GLQ A;  5HFG A;  1PMT A;  3CSI A;  4RI7 A;  2XBQ A;  2L4Q A;  5F07 A;  2AYT A;  2K8S A;  6GSS A;  1BX9 A;  2DML A;  3KD0 A;  3IPZ A;  1Z9H A;  2HFD A;  1A0F A;  2XBI A;  3UBK A;  2DJJ A;  4FH8 A;  4QQ7 A;  1UVZ A;  2GS3 A;  5B8A A;  4LL4 B;  3VFI A;  4FYB A;  1SKR B;  2C0G A;  4PUA A;  3KM6 A;  1NW2 A;  1M0U A;  5DAK B;  1K0D A;  4DVC A;  4F82 A;  3F9U A;  3D6I A;  1TK8 B;  1B4Q A;  2H71 A;  1U6T A;  2BMX A;  5AIS A;  1DE2 A;  3EIN A;  3QDN A;  4AF2 A;  2F9S A;  4K2D A;  2B5Y A;  4OFM A;  1H75 A;  4HUA A;  5BMU A;  4XS6 A;  4F2I A;  4ZB9 A;  5COH A;  4AJ7 A;  3SWL A;  2NBS A;  1C72 A;  1MDI A;  3M1G A;  5KEJ A;  4ULX A;  1XBS A;  1CQG A;  2FHE A;  3GKX A;  4TXV A;  3UIW A;  2R4V A;  2O89 A;  5B8B A;  4MJB A;  1EGO A;  1ZMA A;  3ZVJ D;  3KEB A;  4MAB A;  3M9K A;  1BED A;  3F3Q A;  1GUH A;  4BWS A;  3TRQ A;  1OC3 A;  3IOS A;  4BA7 A;  1R26 A;  5IMD A;  19GS A;  4FO5 A;  4HU9 A;  3A2W A;  1SK0 A;  2HRN A;  4I97 A;  2HLS A;  4KX4 A;  1K3L A;  2WRT A;  4CY6 A;  2AHE A;  2VCX A;  4WBR D;  1FOV A;  1KBN A;  3R3E A;  4K8M A;  2FA8 A;  3EU3 A;  3I6A A;  4KDX A;  2ZUP A;  1X9W B;  1ABA A;  2K8V A;  1TJD A;  1SKS B;  3LGC A;  3QCP A;  4MLY A;  1X5E A;  2WB9 A;  3TUE A;  4DSQ A;  3MNG A;  3UOM A;  1PKZ A;  4HZ4 A;  4GTU A;  4G2E A;  4I2T A;  3IDV A;  1J0F A;  1ZYP A;  3IK9 A;  1V2A A;  3E9J B;  1R4W A;  1Z6N A;  2H72 A;  2YV9 A;  3N5O A;  1K3O A;  5DCG A;  2CX3 A;  3DWV A;  2WDU A;  1NM3 A;  1EGR A;  2LJK A;  1PX6 A;  1SL1 B;  2HI7 A;  1RW1 A;  2X64 A;  1TK0 B;  4K5S A;  1AAZ A;  4GXZ A;  3DRN A;  3GX8 A;  2JZS A;  1J9B A;  1AC1 A;  4CY8 A;  2XHF A;  2DSA A;  2HRK A;  3HZ8 A;  3L9V A;  4BPY A;  3D4T A;  2A4H A;  5HFI A;  3ME8 A;  2DKH A;  2HRF A;  2JSZ A;  3TKR A;  4MF7 A;  3TRX A;  2LTK A;  1MEK A;  2LRC A;  2LJA A;  2QC7 A;  4ML1 A;  2HT9 A;  1PN9 A;  4K1F A;  4EXJ A;  4I5Q A;  3MSZ A;  1PN0 A;  2R2J A;  3UEM A;  1F9M A;  2ZCT A;  1BAY A;  4N0Z A;  3HVS A;  2PPT A;  1G6Y A;  4K7I A;  2G2Q A;  2VL3 A;  2OAD A;  1LU4 A;  1QFN A;  3ZFL A;  1QUW A;  4GLT A;  4PGT A;  2MZC A;  2HSM A;  4EVM A;  2H19 A;  3EU4 A;  4NPB A;  2L6D A;  1PL1 A;  1N8J A;  1AQW A;  1HNA A;  2QSI A;  4IS0 A;  1S3A A;  5ECH B;  2N5F A;  5F06 A;  2FGX A;  4KGI A;  4X0X A;  1XWB A;  2R5G A;  3H93 A;  3H4K A;  3C7M A;  2CAI A;  3W6G A;  5A5K A;  1BQ7 A;  3Q19 A;  2P31 A;  3W8S A;  1XPV A;  3GV1 A;  2B5X A;  5ECO B;  3TRP A;  5LCZ A;  2X8C A;  2B1K A;  3D21 A;  2CZ2 A;  1JFU A;  4I2U A;  3H79 A;  2YWO A;  2C80 A;  4GSN A;  4G19 A;  3VI7 A;  2AAW A;  1HD2 A;  2JZT A;  5H5Q A;  4EL1 A;  3DML A;  2RLI A;  1OAZ A;  2OJL A;  5JWR B;  3KH9 A;  4EO3 A;  1YDK A;  4KB3 A;  1K0B A;  3F8U A;  5ABR A;  3FHK A;  4EDY A;  2OKA A;  3H8Q A;  1T3B A;  2PN8 A;  3FEU A;  4ZIL A;  1TRV A;  1A8L A;  5ECN B;  1GSF A;  4ZB6 A;  3ISO A;  3FZ5 A;  5D9V A;  1HNC A;  3U6V A;  2B7K A;  5G1L A;  1EP7 A;  5AN1 A;  1XWG A;  2C4J A;  4XRA A;  4NAX A;  4AJ8 A;  5ELG A;  4HEA 2;  1X9S B;  1E6B A;  4K5R A;  1W89 A;  5EVO A;  1GSY A;  1VF4 A;  5GST A;  3GKK A;  2WGR A;  4Z2R A;  2C8U A;  5D9T A;  3KCM A;  1ON4 A;  1Z3E A;  3ZIT A;  3RHB A;  5CYY A;  4MJC A;  1XOB A;  5ECQ B;  3H1N A;  5JCG A;  2GZZ A;  2LV3 A;  2P5R A;  2YAN A;  2GST A;  1GNW A;  2FY6 A;  1PA3 A;  2HRA A;  3ZL5 A;  4TR1 A;  2UZ8 A;  4MH3 A;  1XWC A;  4YKF A;  4ZL9 A;  2VCW A;  1M7T A;  2JAC A;  3L0H A;  3CTF A;  1OKD A;  1EWX A;  1BG5 A;  2KLX A;  3HY2 A;  5CRG A;  3IR4 A;  2KP2 A;  4IHU A;  5C04 A;  3Q74 A;  3C71 A;  2IL3 A;  4XS1 A;  1Q98 A;  4IJI A;  4AGS A;  2M46 A;  3EPT A;  4WR5 A;  4GWR A;  1G7E A;  3NZN A;  4ZXG A;  1A8Y A;  1EV9 A;  1GUL A;  2X4A A;  1U88 A;  3F6F A;  5GSS A;  3CTG A;  2R6K A;  2LNT A;  5IMV A;  2PBJ A;  2YPM A;  5F8B A;  3P8W A;  2KHP A;  2EIO A;  4MNN A;  5EPF A;  1ZL9 A;  3E0U A;  4KH7 A;  4WKW A;  2GLR A;  3HD5 A;  4K0G A;  1B8X A;  3FZA A;  3GHA A;  1ZYE A;  3GH6 A;  2FLS A;  2QA2 A;  2TIR A;  2MMN A;  3P7X A;  1U87 A;  5DQS A;  2VM1 A;  2C0F A;  1GSS A;  3GFK A;  2MMZ A;  4JRR A;  2VD1 A;  4WF4 A;  2DLX A;  4N30 A;  4RQX A;  4ZL7 A;  2PGT A;  3LSZ A;  1YKC A;  5DJL A;  2CVB A;  4F0C A;  2B5E A;  4XRD A;  3TGZ A;  4MJA A;  1O7U A;  3TCO A;  3KTB A;  4V1A p;  3P2A A;  4LMV A;  3HVX A;  1XFL A;  2HZE A;  5G30 A;  4CDO A;  3CRU A;  1G7O A;  4HU7 A;  4EE0 A;  4K7N A;  4K2X A;  2B7J A;  3KGK A;  1YF1 A;  2CV4 A;  4WBJ A;  1GSE A;  2H0G A;  1OE7 A;  2VLV A;  2TRC P;  2HNL A;  4KF9 A;  1V58 A;  2F8F A;  4HQZ A;  3FR6 A;  4JBB A;  3IHG A;  3I43 A;  1DUG A;  4TW5 A;  5LNK e;  1W4V A;  4TR1 B;  2DMM A;  1XWK A;  2LUS A;  4HJM A;  4AJ6 A;  2VOC A;  5LD0 A;  4HI7 A;  4NWY A;  3GMF A;  4GRF A;  2N5A A;  4MPG A;  5DBQ A;  3MWH A;  4YAP A;  3A2X A;  4Z7X A;  1M2A A;  3FZ4 A;  2IFQ A;  2M72 A;  1T00 A;  1YZX A;  3Q6O A;  2WJU A;  4KUN A;  2L4C A;  2HE3 A;  1Z7R A;  1GTA A;  2E2M A;  3C1S A;  2VCV A;  2OA7 A;  2V41 A;  3S9F A;  4DSS A;  2HSY A;  1ERV A;  3IAM 2;  2CX4 A;  2X8H A;  4LLR A;  4XHM A;  5DQY A;  5FWG A;  1R5A A;  3DGQ A;  4K0N A;  4O7H A;  2CZ3 A;  3NIV A;  1TI3 A;  4Q5R A;  1K0M A;  5ECM B;  1F37 A;  3HKR A;  1WMJ A;  4LL1 B;  4EIP A;  2JU5 A;  3W8J A;  3A5I A;  18GS A;  5D93 A;  1AIU A;  1PGT A;  2RM5 A;  4NHZ A;  4ZL8 A;  4I8B A;  3PGT A;  1GUK A;  2FUG 2;  5CNW A;  1GL8 A;  1A24 A;  3KMO A;  1FB0 A;  1QGV A;  2DJK A;  1JZD A;  4V2M A;  1KEB A;  3QAG A;  4MMM A;  1X5C A;  3CBU A;  2WUL A;  3KIJ A;  5IOW A;  5DVB A;  4IKH A;  3SBC A;  1F3A A;  3GIX A;  2LEG A;  17GS A;  2YP6 A;  2JZR A;  3UVH A;  1KNG A;  2A2S A;  5A4V A;  2FWE A;  5FHI A;  4PQI A;  2YJH A;  3F4S A;  3FK8 A;  5IO0 A;  1TU7 A;  3WYW A;  2HZE B;  2PER A;  2GTU A;  4MJE A;  1Z7P A;  5F0G A;  2I81 A;  5E4W A;  1GSQ A;  1H4O A;  4X4J A;  1E2Y A;  2IMF A;  1ERW A;  4MP4 A;  5DDL A;  4D73 A;  4XIH A;  2ZNM A;  4POK A;  2WS2 A;  1T1V A;  4IW9 A;  2AUV A;  3QPM A;  2N5B A;  2PUK C;  3VUR A;  2XPE A;  2CVK A;  1SYX A;  3GST A;  3GTU B;  4X43 A;  4BVX A;  4L0W A;  4E8H A;  1AW9 A;  3HYP A;  2TRX A;  1A23 A;  3IHQ A;  3K8N A;  4WR4 A;  1FB6 A;  2ES7 A;  1ILO A;  1AQX A;  4HDE A;  2REM A;  2IFQ B;  4G10 A;  3JCM L;  3HZ4 A;  3DIE A;  1YKA A;  3L78 A;  2OE0 A;  10GS A;  3GYK A;  1FOH A;  4MA9 A;  1U3I A;  4EUY A;  4DSS B;  2H1A A;  2J9H A;  3CSH A;  3J7Y b;  3ZRE A;  1A0R P;  3FR9 A;  3TKP A;  2YOI A;  2H6Y A;  4NV2 A;  1MD3 A;  4ECI A;  4DEJ A;  2V2G A;  4OCE A;  2AJQ B;  4IBP A;  1WOU A;  3L4N A;  4ID0 A;  4E8E A;  3IC4 A;  1Y6E A;  5GAN D;  4NV5 A;  2YCD A;  5H5R A;  5HR2 A;  3UMA A;  3GN3 A;  4MZC A;  2HYX A;  1X0R A;  3OR5 A;  1SK2 A;  1EV4 A;  4BL7 A;  3GSS A;  1URM A;  1I5G A;  1MDJ A;  3FW2 A;  3HCZ A;  2H0I A;  2FCH A;  2IWT A;  4EC0 A;  4BWQ A;  1K3Y A;  3QOU A;  1A2M A;  3FRC A;  1QQ2 A;  3US3 A;  3RDW A;  1U3A A;  5AIX A;  4NXI A;  2PVO C;  4JR6 A;  11GS A;  12GS A;  3VWV A;  3LFL A;  3FMW A;  3QMX A;  4PUF C;  4TXO A;  3NOF A;  3TKS E;  5JCU A;  2HXK A;  4NHW A;  3IE3 A;  2EC4 A;  2X99 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...