2PWJA

Structure of a mitochondrial type ii peroxiredoxin from pisum sativum
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
162
structure length
162
Chain Sequence
LSAASNVSLQKARTWDEGVESKFSTTPVNDIFKDKKVVIFGLPGAYTGVCSSKHVPPYKHNIDKFKAKGVDSVICVAINDPYTVNAWAEKIQAKDAIEFYGDFDGSFHKSLELTTDLSAGLLGIRSERWSAYVVDGKVKALNVEESPSDVKVSGAETILGQI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitochondrial peroxiredoxin
publication title Structure of a mitochondrial type II peroxiredoxin from Pisum sativum
rcsb
source organism Pisum sativum
molecule tags Oxidoreductase
total genus 39
structure length 162
sequence length 162
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2007-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08534 Redoxin Redoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2pwjA00
4PURA 4GQFA 2X99A 4O92A 2LJAA 2PUKC 2FD3A 3L9VA 1H4OA 4F0BA 1GSSA 3P90A 6GSUA 4Q5FA 1R26A 3FKFA 2PN8A 2PPTA 4WBRD 1TU8A 3CTGA 2REMA 4TR0A 1MEKA 3FY7A 2CV4A 1I5GA 3KCMA 3I43A 2MMAA 3V1WA 2F8AA 3S9FA 2H6XA 2KHPA 2YNXA 2L4QA 2FLSA 4RUVA 3CTFA 2VD1A 5J9BA 1GNWA 5CYYA 5LCZA 1YJ6A 4OCFA 5F07A 3ZREA 2YJ7A 4XS6A 1T4YA 3GL5A 4K7OA 2CAIA 3H93A 1ERTA 1Y25A 2CA8A 2E2GA 2L59A 3DYRA 2RM6A 2O87A 2M72A 3CYNA 3APSA 3QCPA 4KH7A 1K3OA 2FCHA 4MF6A 3ZZXA 1RK4A 1USBA 3EVIA 4L0WA 1AW9A 3GSTA 1FVJA 2G0FA 1R5PA 4PQHA 2WZ9A 2IL3A 1R5AA 2K6VA 1SKWB 1BX9A 4K7IA 5DVBA 4MK3A 4Q5RA 1VF1A 2AYTA 5C00A 1OE7A 3ZMLA 2TIRA 4X1UA 3KIJA 1A2LA 2EIQA 5IMDA 3QAWA 2NDOA 4HQZA 3LWAA 2FA8A 4GTUA 4NPBA 3TJJA 5FWGA 4OD7A 3SWLA 4GSTA 2GQMA 3HY2A 1TRVA 2L4CA 2VCTA 3QOUA 5IMFA 1GTUA 19GSA 1TI3A 2C1YA 5FT3A 2DSAA 4K0NA 3ZFLA 2PBJA 2I3YA 1TK0B 1SENA 2FWGA 1SK0A 5EVOA 1EEMA 3IBHA 4V2MA 5GZZB 8GSSA 3U5RE 1EOHA 5KN3A 1B4PA 1MTCA 2B3SA 2WRTA 1RQMA 3FW2A 1U6TA 2E2MA 1S3CA 1Y6EA 1GSDA 1XW6A 2VCQA 3F63A 4P3YB 4ZL7A 2DJJA 4L8EA 1FB6A 1Z7RA 3GX0A 3LFLA 2VCZA 2IMKA 4MF5A 3E9JB 5C04A 4MH3A 2GTUA 1G7EA 18GSA 4NV2A 1A23A 1URMA 4NHZA 4WR4A 4WXTA 4OFTA 1TRUA 3F6FA 3TJFA 4ACSA 3IE3A 3L0HA 2H73A 1Q98A 4MZBA 3ZIVA 1GTBA 2VM2A 1Z9HA 2KUCA 1EP7A 2XC2A 1Z5YE 5A4UA 1DE2A 1E2YA 5KEJA 16GSA 4XS1A 4IKHA 3VWWA 1BQ7A 3IAS2 1LU4A 1LJRA 3VI7A 2L57A 3BOAA 2F51A 3D4TA 3DIEA 5IOXA 4IBPA 1TDIA 1V98A 4D73B 2LV3A 3ZMKA 4LLRA 2WB9A 1OAZA 3GUSA 3VWXA 5ECRB 3KP9A 2RLIA 3Q19A 5DJLA 3RPPA 2B5XA 4MH2A 2YJHA 2IMDA 3KMOA 4XTSA 1UA5A 3D5JA 4XS4A 5FHIA 4ID0A 3F3QA 2CX3A 2YN1A 3G7YA 1T1VA 4YQVA 3GTUB 3UOMA 2MBSA 4JBBA 5IIZA 1XXUA 2HZEB 11GSA 4N30A 3WGXA 4WR5A 5CRHA 1PRXA 20GSA 2CAQA 4DSQA 2I4AA 2HLSA 1HNAA 5DQSA 2R37A 3H8QA 3CXGA 2TRXA 3DEXA 5ECNB 2VCVA 2VM1A 4F03A 3UARA 2I9HA 3KZQA 5ECPB 3D22A 1Z3EA 1ERVA 1GSFA 3QFAC 3W8JA 1XVWA 3GH9A 4ZB9A 5HFGA 2DC5A 2H70A 1JZWA 2OBKA 2WFCA 4ISDA 4WBJA 3ZIJA 4PXOA 2H30A 1M9AA 4IN0A 2H1AA 2JACA 3M0FA 4ECIA 4HZ2A 4KW6A 1Z6NA 2DIZA 2H66A 4IQ1A 2HRFA 3F9UA 3IHQA 2YZUA 1SJZA 2B5EA 1HNBA 5HR3A 4IW9A 2IMEA 5IQYA 4XRDA 2M46A 3ZTLA 3US3A 4LL4B 2GQKA 4N0VA 3CSIA 3G7JA 1ZYEA 2VLVA 3DKSA 4F82A 1JZRA 3MNGA 4Q5NA 5D8IA 2VCXA 4KDYA 1X9SB 1V57A 2FGXA 1GH2A 3KTBA 1A2JA 1GULA 1PD21 1UC7A 4O32A 4G10A 5D9WA 1PL1A 2DJKA 2LS5A 3FEUA 2L6DA 5H5SA 1THXA 4ZBAA 3TUEA 3TJKA 5IPGA 4Z7XA 4JR4A 1O85A 1WMJA 1ACVA 2H0HA 1ZOFA 4H86A 1M2DA 4E8HA 1VF2A 2YCDA 1SU9A 1A8YA 3LQ7A 2VO4A 1VRSD 2MMNA 2LTKA 2GQLA 5F0GA 1DUGA 2CT6A 3ZLPA 2H74A 1WWJA 2LNTA 2LNSA 4NHWA 4KCEA 2Z9SA 1GUMA 4IP6A 2GLRA 5LD0A 5G31A 2H1DA 3ZVJD 2YP6A 3KH7A 3VPQA 4XRAA 5COHA 1CQHA 1FO5A 5D9XA 17GSA 1EEJA 1OKDA 1TRWA 5D73A 4TXOA 4LA1A 4HUAA 5HFKA 3FRCA 4I97A 1HNCA 1WJKA 2H72A 3IRAA 1W89A 2BTOT 3W8SA 2GS3A 2YWNA 4EF0A 3IPZA 1QQ2A 2LSTA 2GZZA 2DMMA 4TN8A 4EO3A 2VL2A 3CSHA 3HHVA 4K2DA 3F4SA 2LUSA 4TW5A 4GRFA 4GQCA 4LL1B 4MJEA 2WJUA 1B9YC 2V1MA 5G5EA 2CVKA 1ON4A 2WCIA 4Q5QA 2OE1A 5CREA 3UEMA 3K8NA 6GSXA 2GZYA 3FZ9A 4DEJA 3GA4A 2GZPA 2VIMA 3LYKA 3C1SA 1K0CA 4WF5A 2NTOA 4RI7A 4TOPA 4IVFA 2X64A 4G19A 1YF0A 1NW2A 1ERUA 4KAEA 3RBTA 1JLWA 3GN3A 1XOAA 3IDVA 4F0CA 2R4VA 2L5OA 3GRXA 2HT9A 4HQSA 2C3QA 5D9TA 4EVMA 4IJIA 2IPAA 4K8MA 1AUCA 2X8HA 3DWVA 4J2FA 4MP4A 1OE8A 2HE3A 5CRWA 5JWRB 4GSSA 2NPBA 1G0TA 3A5WA 3P2AA 3D0ZA 2LRCA 1T3BA 3ME7A 4J56E 4MABA 1BYEA 4MPGA 5ECKB 1NSWA 2VAFA 1PX6A 1BEDA 1EV4A 4FYUA 2YZHA 2IN3A 3MDKA 2PERA 3QAVA 2GDRA 1SJ6A 5B6NA 4QL9A 5G30A 4EE0A 2OJLA 4OMVA 5IPHA 4NMUA 5A4WA 3DVXA 2YV7A 1KNGA 1VF3A 2IWTA 1ZYQB 1FVKA 1N8JA 5AISA 4HJMA 2ALBA 4V1Ag 4TKYA 3IK7A 4CW9A 1GSYA 2O8VB 1A2MA 2KP1A 5B6MA 2WGRA 4GSNA 2CZ2A 4TRXA 3GFKA 1LBKA 5IO2A 2RUEA 2B7KA 4K9ZA 2CX4A 1O81A 4IGJA 4O5RA 4F2IA 2EIRA 1U3IA 3EU3A 4HOJA 1YEXA 3HJMA 3M1GA 1OC9B 1A8LA 5F8BA 2R3XA 1NHYA 2VCWA 2MBTA 2H1GA 2DJ3A 4YAVA 5G5FA 4OCEA 12GSA 1WPIA 3KJYA 4NAXA 4ILFA 1OVNA 4N0ZA 4HDEA 4KCAA 2HSHA 3J7Yk 4XS4B 1XW9A 2NVLA 4L5LA 2P31A 4BVYA 3CRUA 3NZNA 4TR3A 1QK8A 1NHOA 1TI1A 1X9WB 3F0IA 3N9JA 4MMMA 2HNLA 5HR0A 2B6MA 3M9KA 2YOIA 3EURA 3TKSC 3OR5A 1EZKA 2GVPA 1O8XA 3FYGA 2GGTA 1FB0A 1AXDA 1I9DA 1MDIA 2LRTA 2VUPA 1GUHA 4X0XA 4ZL9A 2XBQA 1KEBA 1S3DA 4I2UA 1ZCPA 1THOA 3BD2A 1SL2B 3H4KA 1UN2A 1T8EB 2NBSA 1ABAA 1EP8A 1M9BA 1Z6MA 4F9ZA 3TGZA 3WYWA 1XWKA 3EWLA 1QFNA 3C73A 1TJDA 4I5QA 2JADA 2ZUPA 4YH2A 3E3EA 4KDXA 5IO0A 2GSSA 4L0UA 2V6OA 3TJGA 1F6MC 1NM3A 3LXTA 5F05A 3PGTA 3FR3A 4GCIA 3HVXA 1X5CA 4KE3A 3DXBA 2YV9A 2N5FA 1OKTA 5DAKA 1EGOA 3HYPA 2A2SA 1G6YA 3Q6OA 5DCGA 3NOFA 1Z7PA 2ON7A 1F9MA 4KDUA 3LG6A 1T7PB 2DBCA 1FOVA 4MA9A 1PKWA 4KX4A 4BA7A 1AAZA 4MZWA 5HQPA 1DE1A 3QMXA 2AHEA 1N2AA 4NV5A 2V41A 1V2AA 2C8UA 3UVHA 3TKPA 3HZ4A 4JZQA 2H6YA 1KBNA 2H0GA 1K3LA 1PA3A 4RI6A 3GKNA 5IM9A 1YEPA 4ZB6A 4I8BA 2GT6A 3F4RA 2AAWA 3C7MA 1KTEA 3U6VA 3KEBA 3HVSA 5KN0A 2YWIA 2AUVA 5LNKe 4RQRA 4DSRA 4V1Ap 3IV4A 2H19A 1WP0A 4K6XA 3EC3A 4TXOB 2C0EA 2YWOA 4I2TA 5G2ZA 1IYIA 1OC8A 1ZL9A 2V2GA 4PQIA 1ZGNA 4MF7A 1OC3A 5CNWA 3UL3A 4PUFC 2DMLA 1EWXA 2C4JA 5ECMB 1U88A 2KLXA 2X8GA 1X5EA 4BPYA 3GH6A 3VWUA 1RW1A 1C72A 1V58A 2OE0A 4IS0A 3UJ1A 3F4TA 2HFDA 1GLQA 3TKQA 5IMZA 1G7OA 3G7IA 2FA4A 3QFBC 4MCUA 1X5DA 4KUNA 1AQWA 7GSSA 5JCWA 2B5YA 3BCKA 3UBKA 3HD5A 4QL7A 3I6AA 4O7HA 4PGTA 1FAAA 5JCGA 1XFLA 1VF4A 2ZNMA 5J4UA 4MJBA 3EE2A 5G1KA 2F8FA 2PMTA 4MLYA 1TKDB 1TTZA 1A0FA 1V9WA 5AIVA 5E59A 10GSA 4N10A 2DLXA 2I81A 1FW1A 1DSBA 5ELAA 3UAPA 1GRXA 1SL0B 1TW9A 4WF4A 2XBIA 2FWFA 4PNFA 1PL2A 4ZIJA 4WEYA 4AJ7A 1GWCA 1AC1A 1MD4A 3WGEA 4ZXGA 1R4WA 3H1NA 2EIOA 4ECBA 5GSTA 4WKWA 5D9VA 1TP9A 1ST9A 6GSSA 1GSUA 4IQAA 2AV4A 2QKEA 2R5GA 1K0OA 1FG4A 2K9FA 2P5QA 4E8EA 2IJYA 3M9JA 4XCSA 4JRRA 2HI7A 3CMIA 4HU7A 6GSVA 3TRXA 5IMVA 5CAXA 3HXSA 5D93A 2H1BA 3UIWA 3LJRA 5EL8A 2ES7A 2J23A 4HU9A 4POBA 4LMWA 2JZSA 1JLVA 3CRTA 2V6KA 4HS1A 4KGIA 5A4VA 1WOUA 3FK8A 4GXZA 4TXVA 2R2JA 5JWQB 4I6XA 1V40A 4V2LA 3TKRA 4DSSA 9GSSA 4K1FA 1M99A 2LKUA 4POMA 4N11A 2RM5A 3GURA 3TCOA 2ON5A 1MDKA 1ML6A 2DIYA 3KP8A 5ELGA 5HR1A 3NIVA 1K0AA 3L9UA 1R7HA 2OKAA 1A0RP 3RHBA 3SBCA 5L71A 2LEGA 2H8LA 1K0DA 1GTIA 1XWAA 1SYXA 5KN2A 2MMZA 4OWYA 3FR6A 5JCUA 3Q18A 2BJXA 3C8EA 2HSYA 3RHCA 4NXIA 3KD0A 3F8UA 4V2NA 2PWJA 3DRNA 5HR2A 3VWVA 3PH9A 22GSA 1GSQA 6GSWA 5B8BA 3KGKA 3MAKA 3O6TA 1JZOA 3EMPA 3GKKA 1TRSA 4BWQA 3IR4A 4AF2A 4FO5A 2C80A 2AB6A 3APOA 4POKA 1G6WA 2QSIA 1W4VA 4TR4A 5D96A 1VGLA 3QPMA 2G2QA 1K0NA 2FHEA 1PKZA 3ISOA 1YZXA 1Q4JA 2IMFA 1YDKA 1YKCA 5AIXA 4DVCA 3L4NA 3Q74A 5AN1A 3HJPA 3R2QA 1AQVA 3FZ5A 4MJAA 3M3MA 5H5QA 5DJMA 4YQMA 5DALA 3F6DA 5DCHA 3GKXA 3HDCA 2YWMA 14GSA 1PGTA 5DAKB 4KSOA 4MZCA 5ID2A 3FHKA 2LQQA 1PX7A 3IXRA 2PVQA 3HZ8A 1YKAA 3D6IA 2IIYA 3PR8A 2FWEA 2JZRA 2MMOA 2H71A 1QUWA 3E0UA 1O6JA 1HQOA 2DJ0A 3KMNA 1F37A 4OO5A 3JCML 4ZBBA 5F06A 4PX1A 3A3TA 4CHSA 3P8WA 1B4QA 2IMIA 3ZL5A 3GSSA 1X0RA 1YY7A 4ULXA 5G1LA 2WS2A 6GSTA 5GAPD 1TOFA 5E4WA 4IJ3A 2F3MA 2PU9C 4ZBDA 4EL1A 2VL9A 2XHFA 4FYCA 1XZOA 2IFQA 3WT2A 4GWRA 5EPFA 4TR1A 1XW5A 2HRNA 4FYBA 4IHUA 5EY6A 2VL3A 2D2ZA 2L6CA 4BWSA 4PNGA 1YF1A 1F3BA 5ECOB 5B8AA 2GT5A 5GAND 5ECLB 1J9BA 2VL2C 3L9SA 1HD2A 2A2RA 3ZYWA 1XPVA 4IELA 2H75A 3A2VA 3I9V2 1SYRA 2XPDA 4ML6A 4BL7A 3QR6A 13GSA 1BJXA 5ABRA 4EC0A 3IA1A 2M80A 4GLTA 1XBSA 2JU5A 1J08A 2K8SA 4EUYA 1XVQA 4X43A 5IOWA 3GL3A 2JSZA 2CVDA 3C1RA 3RPNA 5ENUA 2RUFA 4HZ4A 2KOKA 4TVEA 1SJIA 2RIIA 4JU5A 2L5LA 4JEDA 5ECQB 2QC7A 4J57E 2CQ9A 1F3AA 2C3NA 1K0BA 3FZ4A 3KH9A 1GLPA 1XIYA 1SKSB 1T4ZA 1ERWA 1PQNA 2HYXA 1PMTA 3WD6A 4KA0A 4OFNA 3GHAA 5DBQA 2VLUA 2CZ3A 2LQOA 3VFIA 1BAYA 3WGDA 1A24A 3H79A 4MDCA 1EGRA 1M0UA 2H76A 3FR9A 1F2EA 3HCZA 1M2AA 1YQ1A 2K8VA 3QD9A 2GSTA 5B7CA 1WRYA 1TXXA 3ERFA 2JSYA 3A2WA 3DVWA 3TOTA 5J5NA 3GV1A 3TKSE 1EV9A 4FH8A 5ECSA 4RQXA 4JR6A 1CQGA 2QGVA 2VLTA 3A2XA 3TJBA 2H01A 2VD0A 5INYA 4ML1A 3RAZA 3ZVJA 2OA7A 4G2EA 3BCIA 3QAGA 3ERWA 4KNDA 3HA9A 5DDLA 2FY6A 3HKRA 3BBYA 3TRQA 2WULA 3BJ5A 2E7PA 2GSRA 4WETA 4HJ2A 3LXZA 1MDJA 4KSMA 2YANA 3VI5A 2O7KA 3CBUA 5IMCA 1SD9A 2N5BA 1OC9A 4EDZA 1XCCA 4ZL8A 1XOBA 6GSYA 4AJ8A 3HVVA 2BMXA 1M7TA 2O85A 2OADA 2YPMA 3WT1A 5J3RA 3M8NA 3LSZA 3FZAA 1B9XC 5A5KA 4EXJA 4LMVA 1M2BA 1AQXA 5AGYA 3D4MA 5HFIA 4HI7A 3VURA 1O8WA 5CP1A 5CO3A 4EKZA 1S3AA 1TK5B 3UMAA 1SK1A 1FHEA 4ZB8A 2C3TA 1B8XA 2P5RA 1GNEA 3QDNA 1O73A 4POLA 2ZCTA 1MD3A 2R6KA 1WE0A 4ZILA 3VPTA 2KP2A 3J7Yb 3CSJA 4K7NA 5CRDA 3ED3A 4DSSB 1U87A 3D21A 2J9HA 1AIUA 2EC4A 5H5RA 3PINA 3KM6A 2LJRA 2OBIA 3O76A 1GSEA 3G9BA 3ERGA 1EOGA 2VOCA 3ZFBA 4GF0A 3DMLA 5J9CA 3DGQA 4OO4A 4QQ7A 3MWHA 1K3YA 2I1UA 4BVXA 1QXHA 2PVOC 3ZITA 5DQYA 3TRPA 4PUAA 5CRGA 5JWOB 3KTLA 4AGSA 3MSZA 3TOUA 2K18A 3UVTA 3LYPA 2H0IA 3DD3A 4PQ1A 2C0DA 4OFMA 1WIKA 2JZTA 1O7UA 2B1LA 3IOSA 4G9HA 3L78A 2WDUA 5KN1A 1B48A 1J0FA 3EINA 1SL1B 1IYHA 2V32A 3GKMA 5ECHB 2TRCP 1PN9A 4YAPA 4NWYA 3EU4A 1XWCA 1BG5A 2P0GA 1GUKA 1UVZA 2H6ZA 2E0QA 3EMXA 1JZDA 5GSSA 4MPFA 4XHMA 5J41A 3GYKA 3GMFA 4KB3A 2O89A 1HYUA 4D73A 4K0GA 4XIHA 4JE1A 5IMAA 2LRNA 5DALB 2LJKA 3F3RA 1XWBA 3KXOA 3UBLA 5ID2B 2X8CA 1K0MA 4AJ6A 2C0FA 1U3AA 3EYTA 1ZZYA 2B1KA 3VK9A 3ZRDA 3IAM2 2DJ2A 3GTUA 2N5AA 2HZEA 1E6BA 2FNOA 3ME8A 3LGCA 1ZMAA 3TDGA 3IK9A 4ECCA 3LEFA 4L5OA 3GNJA 3GX8A 2MZCA 2C0GA 1XWGA 3O3TA 4IP1A 1GL8A 3APQA 2B7JA 4FIWA 1DBYA 1TU7A 2OE3A 1OYJA 1H75A 2XPEA 3AY8A 3N5OA 1GTAA 1JHBA 3I69A 3IC4A 4ECJA 2IFQB 2PGTA 3P7XA 4TR1B 1SD8A 2MYGA 1QGVA 4YQUA 2FUG2 3TKSA 1SK2A 1GP1A 1TK8B 2GSQA 2CVBA 1ILOA 1JFUA 1X9MB 2FWHA 4EDYA 5ECIB 1SKRB 2A4VA 3HJOA 4CDOA 3RDWA 2HXKA 3GIXA 2DJ1A 3LORA 2OACA 2AJQB 2HZFA 3TB2A 1QMVA 3C71A 3VLNA 1T00A 4MJCA 1PSQA 3W6GA 2F9SA 2JL4A 4HEA2
chains in the Genus database with same CATH superfamily
4PURA 4GQFA 2X99A 4O92A 2LJAA 2PUKC 2FD3A 3L9VA 1H4OA 4F0BA 1GSSA 3P90A 6GSUA 4Q5FA 3A5IA 1R26A 3FKFA 2PN8A 2PPTA 4WBRD 1TU8A 3CTGA 2REMA 4TR0A 1MEKA 3FY7A 2CV4A 1I5GA 3KCMA 3I43A 2MMAA 3V1WA 2F8AA 3S9FA 5KOWA 2H6XA 2KHPA 2YNXA 2L4QA 2FLSA 4RUVA 3CTFA 2VD1A 5J9BA 1GNWA 5CYYA 5LCZA 1YJ6A 4OCFA 5F07A 3ZREA 2YJ7A 4XS6A 1T4YA 3GL5A 4K7OA 2CAIA 3H93A 1ERTA 1Y25A 2CA8A 2E2GA 2L59A 3DYRA 2RM6A 2O87A 2M72A 3CYNA 3APSA 3QCPA 4KH7A 1K3OA 2FCHA 4MF6A 3ZZXA 1RK4A 1USBA 3EVIA 4L0WA 1AW9A 3GSTA 1FVJA 2G0FA 1R5PA 4PQHA 2WZ9A 2IL3A 1R5AA 2K6VA 1SKWB 1BX9A 4K7IA 5DVBA 4MK3A 4Q5RA 1VF1A 2AYTA 5C00A 1OE7A 3ZMLA 2TIRA 4X1UA 3KIJA 1A2LA 2EIQA 5IMDA 3QAWA 2NDOA 4HQZA 3LWAA 2FA8A 4GTUA 4NPBA 3TJJA 5FWGA 4OD7A 3SWLA 4GSTA 2GQMA 3HY2A 1TRVA 2L4CA 2VCTA 3QOUA 2A2PA 5IMFA 1GTUA 19GSA 1TI3A 2C1YA 2DKHA 5FT3A 2DSAA 4K0NA 3ZFLA 2PBJA 2I3YA 1TK0B 1SENA 2FWGA 1SK0A 5EVOA 1EEMA 3IBHA 4V2MA 5GZZB 8GSSA 3U5RE 1EOHA 5KN3A 1B4PA 1MTCA 2B3SA 2WRTA 1RQMA 2R0CA 3FW2A 1U6TA 2E2MA 1S3CA 1Y6EA 1GSDA 1XW6A 2VCQA 3F63A 4P3YB 4ZL7A 2DJJA 4L8EA 1FB6A 1Z7RA 3GX0A 3LFLA 2VCZA 2IMKA 4X4JA 4MF5A 3E9JB 5C04A 4MH3A 2GTUA 1G7EA 18GSA 4BVXB 4NV2A 1A23A 1URMA 4NHZA 4WR4A 4WXTA 4OFTA 1TRUA 3F6FA 3TJFA 4ACSA 3IE3A 3L0HA 2H73A 1Q98A 4MZBA 3ZIVA 1GTBA 2VM2A 1Z9HA 1PN0A 2KUCA 1EP7A 2XC2A 1Z5YE 4Z2UA 5A4UA 1DE2A 1E2YA 5KEJA 16GSA 4XS1A 4IKHA 3VWWA 1BQ7A 3IAS2 1LU4A 1LJRA 3VI7A 2L57A 3BOAA 2UZ8A 2F51A 3D4TA 3DIEA 5IOXA 4IBPA 1TDIA 1XG8A 1V98A 4D73B 2LV3A 3ZMKA 4LLRA 2WB9A 1OAZA 3GUSA 3VWXA 5ECRB 3KP9A 2RLIA 3Q19A 5DJLA 3RPPA 2B5XA 4MH2A 5KOXA 2YJHA 2IMDA 3KMOA 4XTSA 1UA5A 3D5JA 4XS4A 5FHIA 4ID0A 3F3QA 2CX3A 2YN1A 3G7YA 1T1VA 4YQVA 3GTUB 3UOMA 2MBSA 4JBBA 5IIZA 1XXUA 2HZEB 11GSA 4N30A 3WGXA 4WR5A 5CRHA 1PRXA 20GSA 2CAQA 4DSQA 2I4AA 2HLSA 1HNAA 5DQSA 2R37A 3H8QA 3CXGA 2TRXA 3DEXA 5ECNB 2VCVA 4ICYA 2VM1A 4F03A 3UARA 2I9HA 3KZQA 5ECPB 3D22A 1Z3EA 1ERVA 1GSFA 3QFAC 3W8JA 1XVWA 3GH9A 4ZB9A 5HFGA 2DC5A 2H70A 2QA1A 1JZWA 2OBKA 2WFCA 4ISDA 4WBJA 3ZIJA 4PXOA 2H30A 1M9AA 1ZYNA 4IN0A 2H1AA 2JACA 3M0FA 4ECIA 4HZ2A 4KW6A 1Z6NA 2DIZA 2H66A 4IQ1A 2HRFA 3F9UA 3IHQA 2YZUA 1SJZA 2B5EA 1HNBA 5HR3A 4IW9A 2IMEA 5IQYA 4XRDA 4BIKA 2M46A 3ZTLA 3US3A 4LL4B 2GQKA 4N0VA 3CSIA 3G7JA 1ZYEA 2VLVA 3DKSA 4F82A 1JZRA 3MNGA 4Q5NA 4G0LA 5D8IA 2VCXA 4KDYA 1X9SB 1V57A 2FGXA 1GH2A 3KTBA 1A2JA 1GULA 1PD21 1UC7A 4O32A 4G10A 5D9WA 1PL1A 2DJKA 2LS5A 3FEUA 2L6DA 5H5SA 1THXA 4ZBAA 3TUEA 3TJKA 5IPGA 4Z7XA 4JR4A 1O85A 1WMJA 1ACVA 2H0HA 1ZOFA 4H86A 1M2DA 4E8HA 1VF2A 2YCDA 1SU9A 1A8YA 3LQ7A 2VO4A 1VRSD 2MMNA 2LTKA 2GQLA 5F0GA 1DUGA 2CT6A 3ZLPA 3PPUA 2H74A 1WWJA 2LNTA 2LNSA 4NHWA 4KCEA 2Z9SA 1GUMA 4IP6A 2GLRA 5LD0A 2R0GA 5G31A 2H1DA 3ZVJD 2YP6A 3KH7A 3VPQA 4XRAA 5COHA 1CQHA 1FO5A 5D9XA 17GSA 1EEJA 1OKDA 1TRWA 5D73A 4TXOA 4LA1A 4HUAA 5HFKA 3FRCA 4I97A 1HNCA 1WJKA 4EIPA 2H72A 3IRAA 1W89A 2BTOT 3W8SA 2GS3A 2YWNA 4EF0A 3IPZA 1QQ2A 2LSTA 2GZZA 2DMMA 4TN8A 4EO3A 2VL2A 3CSHA 3HHVA 4K2DA 4K5SA 3F4SA 2LUSA 4TW5A 4GRFA 4GQCA 4LL1B 4MJEA 2WJUA 1B9YC 2V1MA 4PTSA 5G5EA 2CVKA 1ON4A 2WCIA 4Q5QA 2OE1A 5CREA 3UEMA 3K8NA 6GSXA 2GZYA 3FZ9A 4DEJA 3GA4A 2GZPA 2VIMA 3LYKA 1M3JA 3C1SA 1K0CA 4WF5A 2NTOA 4RI7A 4TOPA 4IVFA 2X64A 4G19A 1YF0A 1NW2A 1ERUA 4KAEA 3RBTA 1JLWA 3GN3A 1XOAA 3IDVA 4F0CA 2R4VA 2L5OA 3GRXA 2HT9A 4HQSA 2C3QA 5D9TA 4EVMA 4IJIA 2IPAA 4K8MA 1AUCA 2X8HA 3DWVA 4J2FA 4MP4A 1OE8A 2HE3A 5CRWA 5JWRB 4GSSA 2NPBA 1G0TA 3A5WA 3P2AA 3D0ZA 2LRCA 1T3BA 3ME7A 4J56E 4MABA 1BYEA 4MPGA 5ECKB 4G0KA 1NSWA 2VAFA 1PX6A 1BEDA 1EV4A 4FYUA 2YZHA 2IN3A 3MDKA 2PERA 3QAVA 2GDRA 1SJ6A 5B6NA 4QL9A 5G30A 4EE0A 2OJLA 4OMVA 5IPHA 4NMUA 5A4WA 3DVXA 2YV7A 1KNGA 1VF3A 2IWTA 1ZYQB 1FVKA 1N8JA 5AISA 4HJMA 2ALBA 4V1Ag 4TKYA 3IK7A 4CW9A 1GSYA 2O8VB 1A2MA 4CY6A 2KP1A 5B6MA 2WGRA 4GSNA 2CZ2A 4K2XA 4TRXA 3GFKA 1LBKA 4HSCX 5IO2A 2RUEA 2B7KA 4K9ZA 2CX4A 1O81A 4IGJA 4O5RA 2QA2A 3CQFA 4F2IA 2EIRA 1U3IA 3EU3A 4HOJA 1YEXA 3HJMA 3M1GA 1OC9B 1A8LA 5F8BA 2R3XA 3IC8A 1NHYA 2VCWA 2MBTA 2H1GA 2X49A 2DJ3A 4YAVA 3FMWA 5G5FA 4OCEA 12GSA 1WPIA 1ZYPA 3KJYA 4NAXA 4ILFA 1OVNA 4N0ZA 4HDEA 4KCAA 2HSHA 3J7Yk 4XS4B 1XW9A 2NVLA 4L5LA 2P31A 4BVYA 3CRUA 3NZNA 4KF9A 4TR3A 1QK8A 1NHOA 1TI1A 1X9WB 3F0IA 3N9JA 4MMMA 2HNLA 5BMUA 5HR0A 2B6MA 3M9KA 2YOIA 3EURA 3TKSC 3OR5A 1EZKA 2GVPA 1O8XA 3FYGA 2GGTA 1FB0A 1AXDA 1I9DA 1MDIA 2LRTA 2VUPA 1GUHA 4X0XA 4ZL9A 4I2UA 1KEBA 1S3DA 2XBQA 1ZCPA 1THOA 1S3RA 3BD2A 4G0IA 1SL2B 3H4KA 1UN2A 1T8EB 2NBSA 1ABAA 3MIXA 1EP8A 1M9BA 1Z6MA 4F9ZA 3TGZA 3WYWA 1XWKA 3EWLA 1QFNA 3C73A 1TJDA 4I5QA 2JADA 2ZUPA 4YH2A 3E3EA 4KDXA 5IO0A 2GSSA 4L0UA 2V6OA 3TJGA 1F6MC 1NM3A 3LXTA 5F05A 3PGTA 3FR3A 4GCIA 3HVXA 1X5CA 4KE3A 3DXBA 1M3IA 2YV9A 2N5FA 1OKTA 5DAKA 1EGOA 3HYPA 2A2SA 1G6YA 3Q6OA 5DCGA 3NOFA 1Z7PA 2ON7A 1F9MA 4KDUA 3LG6A 1T7PB 2DBCA 1FOVA 4MA9A 1PKWA 4KX4A 4BA7A 1AAZA 4MZWA 5HQPA 1DE1A 5BRTA 3QMXA 2AHEA 1N2AA 2HRKA 4NV5A 2V41A 1V2AA 2C8UA 3UVHA 3TKPA 3HZ4A 4JZQA 2H6YA 1KBNA 2H0GA 1K3LA 3MYDA 1PA3A 4RI6A 3GKNA 5IM9A 1YEPA 4ZB6A 4I8BA 2GT6A 3F4RA 2AAWA 3C7MA 1KTEA 3U6VA 3KEBA 3HVSA 5KN0A 2YWIA 2AUVA 5LNKe 4RQRA 4DSRA 4V1Ap 3IV4A 2H19A 1WP0A 4K6XA 3EC3A 4TXOB 2C0EA 2YWOA 4I2TA 5G2ZA 1IYIA 1OC8A 1ZL9A 2V2GA 4PQIA 1ZGNA 4MF7A 1OC3A 3R3EA 5CNWA 3UL3A 4PUFC 2DMLA 1EWXA 2C4JA 5ECMB 1U88A 2KLXA 2X8GA 1X5EA 4BPYA 3GH6A 3VWUA 1RW1A 1C72A 1V58A 2OE0A 4IS0A 3UJ1A 3F4TA 2HFDA 1GLQA 3TKQA 5IMZA 1G7OA 3G7IA 2FA4A 3QFBC 4MCUA 1X5DA 4KUNA 1AQWA 7GSSA 5JCWA 2B5YA 3BCKA 3HVNA 3UBKA 3HD5A 4QL7A 3I6AA 4O7HA 4PGTA 1FAAA 5JCGA 1XFLA 1VF4A 2ZNMA 5J4UA 4MJBA 3EE2A 5G1KA 2F8FA 2PMTA 4MLYA 1TKDB 1TTZA 1A0FA 1V9WA 5AIVA 5E59A 10GSA 4N10A 2DLXA 2I81A 1FW1A 1DSBA 5ELAA 3UAPA 1GRXA 1SL0B 1TW9A 2HSMA 2HRAA 4Z2RA 4WF4A 2XBIA 2FWFA 4PNFA 1PL2A 4ZIJA 4WEYA 4AJ7A 1GWCA 1AC1A 1MD4A 3WGEA 4ZXGA 1R4WA 3H1NA 2EIOA 4ECBA 5GSTA 4WKWA 5D9VA 1TP9A 1ST9A 6GSSA 1GSUA 4IQAA 2AV4A 2QKEA 2R5GA 1K0OA 1FG4A 2K9FA 2P5QA 4E8EA 2IJYA 3M9JA 4XCSA 4JRRA 2HI7A 3CMIA 4HU7A 6GSVA 3TRXA 5IMVA 5CAXA 3HXSA 5D93A 2H1BA 3UIWA 3LJRA 5EL8A 2ES7A 2J23A 4HU9A 4POBA 4LMWA 2JZSA 1JLVA 3CRTA 2V6KA 4HS1A 4KGIA 5A4VA 1WOUA 3FK8A 4GXZA 4TXVA 2R2JA 5JWQB 4I6XA 1V40A 4V2LA 3TKRA 4DSSA 9GSSA 4K1FA 1M99A 2LKUA 4POMA 4N11A 2RM5A 3GURA 3TCOA 2ON5A 1MDKA 1ML6A 2DIYA 3KP8A 5ELGA 5HR1A 3NIVA 1K0AA 3L9UA 1R7HA 2OKAA 1A0RP 3RHBA 3SBCA 5L71A 4BVYB 2LEGA 2H8LA 1K0DA 1GTIA 1XWAA 1SYXA 5KN2A 2MMZA 4CY8A 4OWYA 3FR6A 5JCUA 3Q18A 2BJXA 3C8EA 2HSYA 3RHCA 4NXIA 3KD0A 3F8UA 4V2NA 2PWJA 3DRNA 5HR2A 3VWVA 3PH9A 22GSA 1GSQA 6GSWA 5B8BA 3KGKA 3MAKA 3O6TA 1JZOA 3EMPA 3GKKA 1TRSA 4BWQA 3IR4A 4AF2A 4FO5A 2C80A 2AB6A 3APOA 4POKA 1G6WA 2QSIA 1W4VA 4TR4A 5D96A 1VGLA 3QPMA 2G2QA 1K0NA 2FHEA 1PKZA 3ISOA 1YZXA 1Q4JA 2IMFA 1YDKA 2A4HA 1YKCA 2R0PA 5AIXA 4DVCA 3L4NA 3Q74A 5AN1A 3HJPA 3R2QA 1AQVA 3FZ5A 4MJAA 3M3MA 5H5QA 5DJMA 4YQMA 5DALA 3F6DA 5DCHA 3GKXA 3HDCA 2YWMA 14GSA 1PGTA 5DAKB 4KSOA 4MZCA 5ID2A 3FHKA 2LQQA 1PX7A 3IXRA 2PVQA 4YKFA 3HZ8A 1YKAA 3D6IA 2IIYA 3PR8A 2FWEA 2JZRA 2MMOA 2H71A 1QUWA 3E0UA 1O6JA 1HQOA 2DJ0A 3KMNA 1F37A 4OO5A 3JCML 4ZBBA 5F06A 4PX1A 3A3TA 4CHSA 3P8WA 1B4QA 2IMIA 3ZL5A 3GSSA 1X0RA 1YY7A 4ULXA 5G1LA 2WS2A 6GSTA 5GAPD 1TOFA 5E4WA 4IJ3A 2F3MA 2PU9C 4ZBDA 4EL1A 2VL9A 2XHFA 4FYCA 1XZOA 2IFQA 3WT2A 4GWRA 5EPFA 4TR1A 1XW5A 2HRNA 4FYBA 4IHUA 5EY6A 2VL3A 2D2ZA 2L6CA 4BWSA 4PNGA 1YF1A 1F3BA 5ECOB 5B8AA 2GT5A 5GAND 5ECLB 4EIQA 1J9BA 2VL2C 3L9SA 1HD2A 2A2RA 3ZYWA 1XPVA 4IELA 2H75A 3A2VA 3I9V2 1SYRA 2XPDA 4ML6A 4BL7A 3QR6A 13GSA 1BJXA 5ABRA 4EC0A 3IA1A 2M80A 4GLTA 1XBSA 2JU5A 4USSA 1J08A 2K8SA 4EUYA 1XVQA 4X43A 5IOWA 3IHGA 3GL3A 3LW9A 2JSZA 2CVDA 3C1RA 3RPNA 5ENUA 2RUFA 4HZ4A 2KOKA 4TVEA 1SJIA 2RIIA 4JU5A 1PFOA 2L5LA 4JEDA 5ECQB 2QC7A 4J57E 2CQ9A 1F3AA 2C3NA 1K0BA 3FZ4A 3KH9A 1GLPA 1XIYA 1SKSB 1T4ZA 1ERWA 1PQNA 2HYXA 1PMTA 3WD6A 4KA0A 4OFNA 3GHAA 5DBQA 2VLUA 2CZ3A 2LQOA 3VFIA 1BAYA 3WGDA 1A24A 3H79A 4MDCA 1FOHA 1EGRA 1M0UA 2H76A 3FR9A 1F2EA 3HCZA 1M2AA 1YQ1A 2K8VA 3QD9A 2GSTA 5B7CA 1WRYA 1TXXA 3ERFA 2JSYA 3A2WA 3DVWA 3TOTA 5J5NA 3GV1A 3TKSE 1EV9A 4FH8A 5ECSA 4RQXA 4JR6A 1CQGA 2QGVA 2VLTA 3A2XA 4MNNA 3TJBA 2H01A 2VD0A 5INYA 4ML1A 4O5UA 3RAZA 3ZVJA 2OA7A 4G2EA 3BCIA 3QAGA 3ERWA 4KNDA 3HA9A 5DDLA 2FY6A 3HKRA 3BBYA 3TRQA 2WULA 3BJ5A 2E7PA 2GSRA 4WETA 4HJ2A 3LXZA 1MDJA 4KSMA 2YANA 3VI5A 2O7KA 3CBUA 5IMCA 1SD9A 2N5BA 1OC9A 4Z2TA 4EDZA 1XCCA 4ZL8A 1XOBA 6GSYA 4AJ8A 3HVVA 2BMXA 1M7TA 2O85A 2OADA 2YPMA 3WT1A 5J3RA 3M8NA 3LSZA 3FZAA 1B9XC 5A5KA 4EXJA 4LMVA 1M2BA 1AQXA 5AGYA 3D4MA 5HFIA 4HI7A 3VURA 1O8WA 5CP1A 5CO3A 4EKZA 1S3AA 1TK5B 3UMAA 1SK1A 1FHEA 4ZB8A 2C3TA 1B8XA 2P5RA 1GNEA 3QDNA 1O73A 4POLA 2ZCTA 1MD3A 2R6KA 4O5QA 1WE0A 4ZILA 3VPTA 2KP2A 3J7Yb 3CSJA 4K7NA 5CRDA 3ED3A 4DSSB 1U87A 3D21A 2J9HA 1AIUA 2EC4A 5H5RA 3PINA 3EPTA 3KM6A 2LJRA 2OBIA 3O76A 1GSEA 3G9BA 4K5RA 3ERGA 1EOGA 2VOCA 3ZFBA 4GF0A 3DMLA 5J9CA 3DGQA 4OO4A 4QQ7A 3MWHA 1K3YA 2I1UA 4BVXA 1QXHA 2PVOC 3ZITA 5DQYA 3TRPA 4PUAA 5CRGA 5JWOB 3KTLA 4AGSA 3MSZA 3TOUA 2K18A 3UVTA 3LYPA 2H0IA 3DD3A 4PQ1A 2C0DA 4OFMA 1WIKA 2JZTA 1O7UA 2B1LA 3IOSA 4G9HA 3L78A 2WDUA 5KN1A 1B48A 4YKGA 1J0FA 3EINA 1SL1B 1IYHA 2X4AA 2V32A 3GKMA 5ECHB 2TRCP 1PN9A 4YAPA 4NWYA 3EU4A 1XWCA 1BG5A 2P0GA 1GUKA 1UVZA 2H6ZA 2E0QA 3EMXA 1JZDA 5GSSA 4MPFA 4XHMA 5J41A 3GYKA 3GMFA 4KB3A 2O89A 1HYUA 4D73A 4K0GA 4XIHA 4JE1A 5IMAA 2LRNA 5DALB 2LJKA 3F3RA 1XWBA 3KXOA 3UBLA 5ID2B 2X8CA 1K0MA 4AJ6A 2C0FA 1U3AA 3EYTA 1ZZYA 2B1KA 3VK9A 3ZRDA 3IAM2 2DJ2A 3GTUA 2N5AA 2HZEA 1E6BA 2FNOA 3ME8A 3LGCA 1ZMAA 3TDGA 3IK9A 4ECCA 3LEFA 4L5OA 3GNJA 3GX8A 2MZCA 2C0GA 1XWGA 3O3TA 4IP1A 1GL8A 3APQA 2B7JA 4FIWA 4FQUA 1DBYA 1TU7A 2OE3A 1OYJA 1H75A 2XPEA 3AY8A 3N5OA 1GTAA 1JHBA 3I69A 3IC4A 4ECJA 2IFQB 2PGTA 3P7XA 4TR1B 1SD8A 2MYGA 2DKIA 1QGVA 4YQUA 2FUG2 3TKSA 1SK2A 1GP1A 4A5PA 1TK8B 2GSQA 2CVBA 1ILOA 1JFUA 1X9MB 2FWHA 4EDYA 5ECIB 1SKRB 2A4VA 3HJOA 4CDOA 3RDWA 2HXKA 3GIXA 2DJ1A 3LORA 2OACA 2AJQB 2HZFA 3TB2A 1QMVA 3C71A 4BL7B 3VLNA 1T00A 4MJCA 1PSQA 3W6GA 2F9SA 2JL4A 4HEA2
chains in the Genus database with same CATH topology
4PURA 4GQFA 2X99A 4O92A 2LJAA 2PUKC 2FD3A 3L9VA 1H4OA 4F0BA 1GSSA 3P90A 6GSUA 4Q5FA 3A5IA 1R26A 3FKFA 2PN8A 2PPTA 4WBRD 1TU8A 3CTGA 2REMA 4TR0A 1MEKA 3FY7A 2CV4A 1I5GA 3KCMA 3I43A 2MMAA 3V1WA 2F8AA 3S9FA 5KOWA 2H6XA 2KHPA 2YNXA 2L4QA 2FLSA 4RUVA 3CTFA 2VD1A 5J9BA 1GNWA 5CYYA 5LCZA 1YJ6A 4OCFA 5F07A 3ZREA 2YJ7A 4XS6A 1T4YA 3GL5A 4K7OA 2CAIA 3H93A 1ERTA 1Y25A 2CA8A 2E2GA 2L59A 3DYRA 2RM6A 2O87A 2M72A 3CYNA 3APSA 3QCPA 4KH7A 1K3OA 2FCHA 4MF6A 3ZZXA 1RK4A 1USBA 3EVIA 4L0WA 1AW9A 3GSTA 1FVJA 2G0FA 1R5PA 4PQHA 2WZ9A 2IL3A 1R5AA 2K6VA 1SKWB 1BX9A 4K7IA 5DVBA 4MK3A 4Q5RA 1VF1A 2AYTA 5C00A 1OE7A 3ZMLA 2TIRA 4X1UA 3KIJA 1A2LA 2EIQA 5IMDA 3QAWA 2NDOA 4HQZA 3LWAA 2FA8A 4GTUA 4NPBA 3TJJA 5FWGA 4OD7A 3SWLA 4GSTA 2GQMA 3HY2A 1TRVA 2L4CA 2VCTA 3QOUA 2A2PA 5IMFA 1GTUA 19GSA 1TI3A 2C1YA 2DKHA 5FT3A 2DSAA 4K0NA 3ZFLA 2PBJA 2I3YA 1TK0B 1SENA 2FWGA 1SK0A 5EVOA 1EEMA 3IBHA 4V2MA 5GZZB 8GSSA 3U5RE 1EOHA 5KN3A 1B4PA 1MTCA 2B3SA 2WRTA 1RQMA 2R0CA 3FW2A 1U6TA 2E2MA 1S3CA 1Y6EA 1GSDA 1XW6A 2VCQA 3F63A 4P3YB 4ZL7A 2DJJA 4L8EA 1FB6A 1Z7RA 3GX0A 3LFLA 2VCZA 2IMKA 4X4JA 4MF5A 3E9JB 5C04A 4MH3A 2GTUA 1G7EA 18GSA 4BVXB 4NV2A 1A23A 1URMA 4NHZA 4WR4A 4WXTA 4OFTA 1TRUA 3F6FA 3TJFA 4ACSA 3IE3A 3L0HA 2H73A 1Q98A 4MZBA 3ZIVA 1GTBA 2VM2A 1Z9HA 1PN0A 2KUCA 1EP7A 2XC2A 1Z5YE 4Z2UA 5A4UA 1DE2A 1E2YA 5KEJA 16GSA 4XS1A 4IKHA 3VWWA 1BQ7A 3IAS2 1LU4A 1LJRA 3VI7A 2L57A 3BOAA 2UZ8A 2F51A 3D4TA 3DIEA 5IOXA 4IBPA 1TDIA 1V98A 4D73B 2LV3A 3ZMKA 4LLRA 2WB9A 1OAZA 3GUSA 3VWXA 5ECRB 3KP9A 2RLIA 3Q19A 5DJLA 3RPPA 2B5XA 4MH2A 5KOXA 2YJHA 2IMDA 3KMOA 4XTSA 1UA5A 3D5JA 4XS4A 5FHIA 4ID0A 3F3QA 2CX3A 2YN1A 3G7YA 1T1VA 4YQVA 3GTUB 3UOMA 2MBSA 4JBBA 5IIZA 1XXUA 2HZEB 11GSA 4N30A 3WGXA 4WR5A 5CRHA 1PRXA 20GSA 2CAQA 4DSQA 2I4AA 2HLSA 1HNAA 5DQSA 2R37A 3H8QA 3CXGA 2TRXA 3DEXA 5ECNB 2VCVA 4ICYA 2VM1A 4F03A 3UARA 2I9HA 3KZQA 5ECPB 3D22A 1Z3EA 1ERVA 1GSFA 3QFAC 3W8JA 1XVWA 3GH9A 4ZB9A 5HFGA 2DC5A 2H70A 2QA1A 1JZWA 2OBKA 2WFCA 4ISDA 4WBJA 3ZIJA 4PXOA 2H30A 1M9AA 1ZYNA 4IN0A 2H1AA 2JACA 3M0FA 4ECIA 4HZ2A 4KW6A 1Z6NA 2DIZA 2H66A 4IQ1A 2HRFA 3F9UA 3IHQA 2YZUA 1SJZA 2B5EA 1HNBA 5HR3A 4IW9A 2IMEA 5IQYA 4XRDA 2M46A 3ZTLA 3US3A 4LL4B 2GQKA 4N0VA 3CSIA 3G7JA 1ZYEA 2VLVA 3DKSA 4F82A 1JZRA 3MNGA 4Q5NA 4G0LA 5D8IA 2VCXA 4KDYA 1X9SB 1V57A 2FGXA 1GH2A 3KTBA 1A2JA 1GULA 1PD21 1UC7A 4O32A 4G10A 5D9WA 1PL1A 2DJKA 2LS5A 3FEUA 2L6DA 5H5SA 1THXA 4ZBAA 3TUEA 3TJKA 5IPGA 4Z7XA 4JR4A 1O85A 1WMJA 1ACVA 2H0HA 1ZOFA 4H86A 1M2DA 4E8HA 1VF2A 2YCDA 1SU9A 1A8YA 3LQ7A 2VO4A 1VRSD 2MMNA 2LTKA 2GQLA 5F0GA 1DUGA 2CT6A 3ZLPA 3PPUA 2H74A 1WWJA 2LNTA 2LNSA 4NHWA 4KCEA 2Z9SA 1GUMA 4IP6A 2GLRA 5LD0A 2R0GA 5G31A 2H1DA 3ZVJD 2YP6A 3KH7A 3VPQA 4XRAA 5COHA 1CQHA 1FO5A 5D9XA 17GSA 1EEJA 1OKDA 1TRWA 5D73A 4TXOA 4LA1A 4HUAA 5HFKA 3FRCA 4I97A 1HNCA 1WJKA 4EIPA 2H72A 3IRAA 1W89A 2BTOT 3W8SA 2GS3A 2YWNA 4EF0A 3IPZA 1QQ2A 2LSTA 2GZZA 2DMMA 4TN8A 4EO3A 2VL2A 3CSHA 3HHVA 4K2DA 4K5SA 3F4SA 2LUSA 4TW5A 4GRFA 4GQCA 4LL1B 4MJEA 2WJUA 1B9YC 2V1MA 4PTSA 5G5EA 2CVKA 1ON4A 2WCIA 4Q5QA 2OE1A 5CREA 3UEMA 3K8NA 6GSXA 2GZYA 3FZ9A 4DEJA 3GA4A 2GZPA 2VIMA 3LYKA 3C1SA 1K0CA 4WF5A 2NTOA 4RI7A 4TOPA 4IVFA 2X64A 4G19A 1YF0A 1NW2A 1ERUA 4KAEA 3RBTA 1JLWA 3GN3A 1XOAA 3IDVA 4F0CA 2R4VA 2L5OA 3GRXA 2HT9A 4HQSA 2C3QA 5D9TA 4EVMA 4IJIA 2IPAA 4K8MA 1AUCA 2X8HA 3DWVA 4J2FA 4MP4A 1OE8A 2HE3A 5CRWA 5JWRB 4GSSA 2NPBA 1G0TA 3A5WA 3P2AA 3D0ZA 2LRCA 1T3BA 3ME7A 4J56E 4MABA 1BYEA 4MPGA 5ECKB 4G0KA 1NSWA 2VAFA 1PX6A 1BEDA 1EV4A 4FYUA 2YZHA 2IN3A 3MDKA 2PERA 3QAVA 2GDRA 1SJ6A 5B6NA 4QL9A 5G30A 4EE0A 2OJLA 4OMVA 5IPHA 4NMUA 5A4WA 3DVXA 2YV7A 1KNGA 1VF3A 2IWTA 1ZYQB 1FVKA 1N8JA 5AISA 4HJMA 2ALBA 4V1Ag 4TKYA 3IK7A 4CW9A 1GSYA 2O8VB 1A2MA 4CY6A 2KP1A 5B6MA 2WGRA 4GSNA 2CZ2A 4K2XA 4TRXA 3GFKA 1LBKA 5IO2A 2RUEA 2B7KA 4K9ZA 2CX4A 1O81A 4IGJA 4O5RA 2QA2A 4F2IA 2EIRA 1U3IA 3EU3A 4HOJA 1YEXA 3HJMA 3M1GA 1OC9B 1A8LA 5F8BA 2R3XA 3IC8A 1NHYA 2VCWA 2MBTA 2H1GA 2X49A 2DJ3A 4YAVA 3FMWA 5G5FA 4OCEA 12GSA 1WPIA 1ZYPA 3KJYA 4NAXA 4ILFA 1OVNA 4N0ZA 4HDEA 4KCAA 2HSHA 3J7Yk 4XS4B 1XW9A 2NVLA 4L5LA 2P31A 4BVYA 3CRUA 3NZNA 4KF9A 4TR3A 1QK8A 1NHOA 1TI1A 1X9WB 3F0IA 3N9JA 4MMMA 2HNLA 5BMUA 5HR0A 2B6MA 3M9KA 2YOIA 3EURA 3TKSC 3OR5A 1EZKA 2GVPA 1O8XA 3FYGA 2GGTA 1FB0A 1AXDA 1I9DA 1MDIA 2LRTA 2VUPA 1GUHA 4X0XA 4ZL9A 2XBQA 1KEBA 1S3DA 4I2UA 1ZCPA 1THOA 3BD2A 4G0IA 1SL2B 3H4KA 1UN2A 1T8EB 2NBSA 1ABAA 3MIXA 1EP8A 1M9BA 1Z6MA 4F9ZA 3TGZA 3WYWA 1XWKA 3EWLA 1QFNA 3C73A 1TJDA 4I5QA 2JADA 2ZUPA 4YH2A 3E3EA 4KDXA 5IO0A 2GSSA 4L0UA 2V6OA 3TJGA 1F6MC 1NM3A 3LXTA 5F05A 3PGTA 3FR3A 4GCIA 3HVXA 1X5CA 4KE3A 3DXBA 2YV9A 2N5FA 1OKTA 5DAKA 1EGOA 3HYPA 2A2SA 1G6YA 3Q6OA 5DCGA 3NOFA 1Z7PA 2ON7A 1F9MA 4KDUA 3LG6A 1T7PB 2DBCA 1FOVA 4MA9A 1PKWA 4KX4A 4BA7A 1AAZA 4MZWA 5HQPA 1DE1A 5BRTA 3QMXA 2AHEA 1N2AA 2HRKA 4NV5A 2V41A 1V2AA 2C8UA 3UVHA 3TKPA 3HZ4A 4JZQA 2H6YA 1KBNA 2H0GA 1K3LA 3MYDA 1PA3A 4RI6A 3GKNA 5IM9A 1YEPA 4ZB6A 4I8BA 2GT6A 3F4RA 2AAWA 3C7MA 1KTEA 3U6VA 3KEBA 3HVSA 5KN0A 2YWIA 2AUVA 5LNKe 4RQRA 4DSRA 4V1Ap 3IV4A 2H19A 1WP0A 4K6XA 3EC3A 4TXOB 2C0EA 2YWOA 4I2TA 5G2ZA 1IYIA 1OC8A 1ZL9A 2V2GA 4PQIA 1ZGNA 4MF7A 1OC3A 3R3EA 5CNWA 3UL3A 4PUFC 2DMLA 1EWXA 2C4JA 5ECMB 1U88A 2KLXA 2X8GA 1X5EA 4BPYA 3GH6A 3VWUA 1RW1A 1C72A 1V58A 2OE0A 4IS0A 3UJ1A 3F4TA 2HFDA 1GLQA 3TKQA 5IMZA 1G7OA 3G7IA 2FA4A 3QFBC 4MCUA 1X5DA 4KUNA 1AQWA 7GSSA 5JCWA 2B5YA 3BCKA 3UBKA 3HD5A 4QL7A 3I6AA 4O7HA 4PGTA 1FAAA 5JCGA 1XFLA 1VF4A 2ZNMA 5J4UA 4MJBA 3EE2A 5G1KA 2F8FA 2PMTA 4MLYA 1TKDB 1TTZA 1A0FA 1V9WA 5AIVA 5E59A 10GSA 4N10A 2DLXA 2I81A 1FW1A 1DSBA 5ELAA 3UAPA 1GRXA 1SL0B 1TW9A 2HSMA 2HRAA 4Z2RA 4WF4A 2XBIA 2FWFA 4PNFA 1PL2A 4ZIJA 4WEYA 4AJ7A 1GWCA 1AC1A 1MD4A 3WGEA 4ZXGA 1R4WA 3H1NA 2EIOA 4ECBA 5GSTA 4WKWA 5D9VA 1TP9A 1ST9A 6GSSA 1GSUA 4IQAA 2AV4A 2QKEA 2R5GA 1K0OA 1FG4A 2K9FA 2P5QA 4E8EA 2IJYA 3M9JA 4XCSA 4JRRA 2HI7A 3CMIA 4HU7A 6GSVA 3TRXA 5IMVA 5CAXA 3HXSA 5D93A 2H1BA 3UIWA 3LJRA 5EL8A 2ES7A 2J23A 4HU9A 4POBA 4LMWA 2JZSA 1JLVA 3CRTA 2V6KA 4HS1A 4KGIA 5A4VA 1WOUA 3FK8A 4GXZA 4TXVA 2R2JA 5JWQB 4I6XA 1V40A 4V2LA 3TKRA 4DSSA 9GSSA 4K1FA 1M99A 2LKUA 4POMA 4N11A 2RM5A 3GURA 3TCOA 2ON5A 1MDKA 1ML6A 2DIYA 3KP8A 5ELGA 5HR1A 3NIVA 1K0AA 3L9UA 1R7HA 2OKAA 1A0RP 3RHBA 3SBCA 5L71A 4BVYB 2LEGA 2H8LA 1K0DA 1GTIA 1XWAA 1SYXA 5KN2A 2MMZA 4CY8A 4OWYA 3FR6A 5JCUA 3Q18A 2BJXA 3C8EA 2HSYA 3RHCA 4NXIA 3KD0A 3F8UA 4V2NA 2PWJA 3DRNA 5HR2A 3VWVA 3PH9A 22GSA 1GSQA 6GSWA 5B8BA 3KGKA 3MAKA 3O6TA 1JZOA 3EMPA 3GKKA 1TRSA 4BWQA 3IR4A 4AF2A 4FO5A 2C80A 2AB6A 3APOA 4POKA 1G6WA 2QSIA 1W4VA 4TR4A 5D96A 1VGLA 3QPMA 2G2QA 1K0NA 2FHEA 1PKZA 3ISOA 1YZXA 1Q4JA 2IMFA 1YDKA 2A4HA 1YKCA 2R0PA 5AIXA 4DVCA 3L4NA 3Q74A 5AN1A 3HJPA 3R2QA 1AQVA 3FZ5A 4MJAA 3M3MA 5H5QA 5DJMA 4YQMA 5DALA 3F6DA 5DCHA 3GKXA 3HDCA 2YWMA 14GSA 1PGTA 5DAKB 4KSOA 4MZCA 5ID2A 3FHKA 2LQQA 1PX7A 3IXRA 2PVQA 4YKFA 3HZ8A 1YKAA 3D6IA 2IIYA 3PR8A 2FWEA 2JZRA 2MMOA 2H71A 1QUWA 3E0UA 1O6JA 1HQOA 2DJ0A 3KMNA 1F37A 4OO5A 3JCML 4ZBBA 5F06A 4PX1A 3A3TA 4CHSA 3P8WA 1B4QA 2IMIA 3ZL5A 3GSSA 1X0RA 1YY7A 4ULXA 5G1LA 2WS2A 6GSTA 5GAPD 1TOFA 5E4WA 4IJ3A 2F3MA 2PU9C 4ZBDA 4EL1A 2VL9A 2XHFA 4FYCA 1XZOA 2IFQA 3WT2A 4GWRA 5EPFA 4TR1A 1XW5A 2HRNA 4FYBA 4IHUA 5EY6A 2VL3A 2D2ZA 2L6CA 4BWSA 4PNGA 1YF1A 1F3BA 5ECOB 5B8AA 2GT5A 5GAND 5ECLB 4EIQA 1J9BA 2VL2C 3L9SA 1HD2A 2A2RA 3ZYWA 1XPVA 4IELA 2H75A 3A2VA 3I9V2 1SYRA 2XPDA 4ML6A 4BL7A 3QR6A 13GSA 1BJXA 5ABRA 4EC0A 3IA1A 2M80A 4GLTA 1XBSA 2JU5A 4USSA 1J08A 2K8SA 4EUYA 1XVQA 4X43A 5IOWA 3IHGA 3GL3A 3LW9A 2JSZA 2CVDA 3C1RA 3RPNA 5ENUA 2RUFA 4HZ4A 2KOKA 4TVEA 1SJIA 2RIIA 4JU5A 2L5LA 4JEDA 5ECQB 2QC7A 4J57E 2CQ9A 1F3AA 2C3NA 1K0BA 3FZ4A 3KH9A 1GLPA 1XIYA 1SKSB 1T4ZA 1ERWA 1PQNA 2HYXA 1PMTA 3WD6A 4KA0A 4OFNA 3GHAA 5DBQA 2VLUA 2CZ3A 2LQOA 3VFIA 1BAYA 3WGDA 1A24A 3H79A 4MDCA 1FOHA 1EGRA 1M0UA 2H76A 3FR9A 1F2EA 3HCZA 1M2AA 1YQ1A 2K8VA 3QD9A 2GSTA 5B7CA 1WRYA 1TXXA 3ERFA 2JSYA 3A2WA 3DVWA 3TOTA 5J5NA 3GV1A 3TKSE 1EV9A 4FH8A 5ECSA 4RQXA 4JR6A 1CQGA 2QGVA 2VLTA 3A2XA 4MNNA 3TJBA 2H01A 2VD0A 5INYA 4ML1A 4O5UA 3RAZA 3ZVJA 2OA7A 4G2EA 3BCIA 3QAGA 3ERWA 4KNDA 3HA9A 5DDLA 2FY6A 3HKRA 3BBYA 3TRQA 2WULA 3BJ5A 2E7PA 2GSRA 4WETA 4HJ2A 3LXZA 1MDJA 4KSMA 2YANA 3VI5A 2O7KA 3CBUA 5IMCA 1SD9A 2N5BA 1OC9A 4Z2TA 4EDZA 1XCCA 4ZL8A 1XOBA 6GSYA 4AJ8A 3HVVA 2BMXA 1M7TA 2O85A 2OADA 2YPMA 3WT1A 5J3RA 3M8NA 3LSZA 3FZAA 1B9XC 5A5KA 4EXJA 4LMVA 1M2BA 1AQXA 5AGYA 3D4MA 5HFIA 4HI7A 3VURA 1O8WA 5CP1A 5CO3A 4EKZA 1S3AA 1TK5B 3UMAA 1SK1A 1FHEA 4ZB8A 2C3TA 1B8XA 2P5RA 1GNEA 3QDNA 1O73A 4POLA 2ZCTA 1MD3A 2R6KA 4O5QA 1WE0A 4ZILA 3VPTA 2KP2A 3J7Yb 3CSJA 4K7NA 5CRDA 3ED3A 4DSSB 1U87A 3D21A 2J9HA 1AIUA 2EC4A 5H5RA 3PINA 3EPTA 3KM6A 2LJRA 2OBIA 3O76A 1GSEA 3G9BA 4K5RA 3ERGA 1EOGA 2VOCA 3ZFBA 4GF0A 3DMLA 5J9CA 3DGQA 4OO4A 4QQ7A 3MWHA 1K3YA 2I1UA 4BVXA 1QXHA 2PVOC 3ZITA 5DQYA 3TRPA 4PUAA 5CRGA 5JWOB 3KTLA 4AGSA 3MSZA 3TOUA 2K18A 3UVTA 3LYPA 2H0IA 3DD3A 4PQ1A 2C0DA 4OFMA 1WIKA 2JZTA 1O7UA 2B1LA 3IOSA 4G9HA 3L78A 2WDUA 5KN1A 1B48A 4YKGA 1J0FA 3EINA 1SL1B 1IYHA 2X4AA 2V32A 3GKMA 5ECHB 2TRCP 1PN9A 4YAPA 4NWYA 3EU4A 1XWCA 1BG5A 2P0GA 1GUKA 1UVZA 2H6ZA 2E0QA 3EMXA 1JZDA 5GSSA 4MPFA 4XHMA 5J41A 3GYKA 3GMFA 4KB3A 2O89A 1HYUA 4D73A 4K0GA 4XIHA 4JE1A 5IMAA 2LRNA 5DALB 2LJKA 3F3RA 1XWBA 3KXOA 3UBLA 5ID2B 2X8CA 1K0MA 4AJ6A 2C0FA 1U3AA 3EYTA 1ZZYA 2B1KA 3VK9A 3ZRDA 3IAM2 2DJ2A 3GTUA 2N5AA 2HZEA 1E6BA 2FNOA 3ME8A 3LGCA 1ZMAA 3TDGA 3IK9A 4ECCA 3LEFA 4L5OA 3GNJA 3GX8A 2MZCA 2C0GA 1XWGA 3O3TA 4IP1A 1GL8A 3APQA 2B7JA 4FIWA 4FQUA 1DBYA 1TU7A 2OE3A 1OYJA 1H75A 2XPEA 3AY8A 3N5OA 1GTAA 1JHBA 3I69A 3IC4A 4ECJA 2IFQB 2PGTA 3P7XA 4TR1B 1SD8A 2MYGA 2DKIA 1QGVA 4YQUA 2FUG2 3TKSA 1SK2A 1GP1A 4A5PA 1TK8B 2GSQA 2CVBA 1ILOA 1JFUA 1X9MB 2FWHA 4EDYA 5ECIB 1SKRB 2A4VA 3HJOA 4CDOA 3RDWA 2HXKA 3GIXA 2DJ1A 3LORA 2OACA 2AJQB 2HZFA 3TB2A 1QMVA 3C71A 4BL7B 3VLNA 1T00A 4MJCA 1PSQA 3W6GA 2F9SA 2JL4A 4HEA2
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PUR A;  4GQF A;  2X99 A;  4O92 A;  2LJA A;  2PUK C;  2FD3 A;  3L9V A;  1H4O A;  4F0B A;  1GSS A;  3P90 A;  6GSU A;  4Q5F A;  1R26 A;  3FKF A;  2PN8 A;  2PPT A;  4WBR D;  1TU8 A;  3CTG A;  2REM A;  4TR0 A;  1MEK A;  3FY7 A;  2CV4 A;  1I5G A;  3KCM A;  3I43 A;  2MMA A;  3V1W A;  2F8A A;  3S9F A;  2H6X A;  2KHP A;  2YNX A;  2L4Q A;  2FLS A;  4RUV A;  3CTF A;  2VD1 A;  5J9B A;  1GNW A;  5CYY A;  5LCZ A;  1YJ6 A;  4OCF A;  5F07 A;  3ZRE A;  2YJ7 A;  4XS6 A;  1T4Y A;  3GL5 A;  4K7O A;  2CAI A;  3H93 A;  1ERT A;  1Y25 A;  2CA8 A;  2E2G A;  2L59 A;  3DYR A;  2RM6 A;  2O87 A;  2M72 A;  3CYN A;  3APS A;  3QCP A;  4KH7 A;  1K3O A;  2FCH A;  4MF6 A;  3ZZX A;  1RK4 A;  1USB A;  3EVI A;  4L0W A;  1AW9 A;  3GST A;  1FVJ A;  2G0F A;  1R5P A;  4PQH A;  2WZ9 A;  2IL3 A;  1R5A A;  2K6V A;  1SKW B;  1BX9 A;  4K7I A;  5DVB A;  4MK3 A;  4Q5R A;  1VF1 A;  2AYT A;  5C00 A;  1OE7 A;  3ZML A;  2TIR A;  4X1U A;  3KIJ A;  1A2L A;  2EIQ A;  5IMD A;  3QAW A;  2NDO A;  4HQZ A;  3LWA A;  2FA8 A;  4GTU A;  4NPB A;  3TJJ A;  5FWG A;  4OD7 A;  3SWL A;  4GST A;  2GQM A;  3HY2 A;  1TRV A;  2L4C A;  2VCT A;  3QOU A;  5IMF A;  1GTU A;  19GS A;  1TI3 A;  2C1Y A;  5FT3 A;  2DSA A;  4K0N A;  3ZFL A;  2PBJ A;  2I3Y A;  1TK0 B;  1SEN A;  2FWG A;  1SK0 A;  5EVO A;  1EEM A;  3IBH A;  4V2M A;  5GZZ B;  8GSS A;  3U5R E;  1EOH A;  5KN3 A;  1B4P A;  1MTC A;  2B3S A;  2WRT A;  1RQM A;  3FW2 A;  1U6T A;  2E2M A;  1S3C A;  1Y6E A;  1GSD A;  1XW6 A;  2VCQ A;  3F63 A;  4P3Y B;  4ZL7 A;  2DJJ A;  4L8E A;  1FB6 A;  1Z7R A;  3GX0 A;  3LFL A;  2VCZ A;  2IMK A;  4MF5 A;  3E9J B;  5C04 A;  4MH3 A;  2GTU A;  1G7E A;  18GS A;  4NV2 A;  1A23 A;  1URM A;  4NHZ A;  4WR4 A;  4WXT A;  4OFT A;  1TRU A;  3F6F A;  3TJF A;  4ACS A;  3IE3 A;  3L0H A;  2H73 A;  1Q98 A;  4MZB A;  3ZIV A;  1GTB A;  2VM2 A;  1Z9H A;  2KUC A;  1EP7 A;  2XC2 A;  1Z5Y E;  5A4U A;  1DE2 A;  1E2Y A;  5KEJ A;  16GS A;  4XS1 A;  4IKH A;  3VWW A;  1BQ7 A;  3IAS 2;  1LU4 A;  1LJR A;  3VI7 A;  2L57 A;  3BOA A;  2F51 A;  3D4T A;  3DIE A;  5IOX A;  4IBP A;  1TDI A;  1V98 A;  4D73 B;  2LV3 A;  3ZMK A;  4LLR A;  2WB9 A;  1OAZ A;  3GUS A;  3VWX A;  5ECR B;  3KP9 A;  2RLI A;  3Q19 A;  5DJL A;  3RPP A;  2B5X A;  4MH2 A;  2YJH A;  2IMD A;  3KMO A;  4XTS A;  1UA5 A;  3D5J A;  4XS4 A;  5FHI A;  4ID0 A;  3F3Q A;  2CX3 A;  2YN1 A;  3G7Y A;  1T1V A;  4YQV A;  3GTU B;  3UOM A;  2MBS A;  4JBB A;  5IIZ A;  1XXU A;  2HZE B;  11GS A;  4N30 A;  3WGX A;  4WR5 A;  5CRH A;  1PRX A;  20GS A;  2CAQ A;  4DSQ A;  2I4A A;  2HLS A;  1HNA A;  5DQS A;  2R37 A;  3H8Q A;  3CXG A;  2TRX A;  3DEX A;  5ECN B;  2VCV A;  2VM1 A;  4F03 A;  3UAR A;  2I9H A;  3KZQ A;  5ECP B;  3D22 A;  1Z3E A;  1ERV A;  1GSF A;  3QFA C;  3W8J A;  1XVW A;  3GH9 A;  4ZB9 A;  5HFG A;  2DC5 A;  2H70 A;  1JZW A;  2OBK A;  2WFC A;  4ISD A;  4WBJ A;  3ZIJ A;  4PXO A;  2H30 A;  1M9A A;  4IN0 A;  2H1A A;  2JAC A;  3M0F A;  4ECI A;  4HZ2 A;  4KW6 A;  1Z6N A;  2DIZ A;  2H66 A;  4IQ1 A;  2HRF A;  3F9U A;  3IHQ A;  2YZU A;  1SJZ A;  2B5E A;  1HNB A;  5HR3 A;  4IW9 A;  2IME A;  5IQY A;  4XRD A;  2M46 A;  3ZTL A;  3US3 A;  4LL4 B;  2GQK A;  4N0V A;  3CSI A;  3G7J A;  1ZYE A;  2VLV A;  3DKS A;  4F82 A;  1JZR A;  3MNG A;  4Q5N A;  5D8I A;  2VCX A;  4KDY A;  1X9S B;  1V57 A;  2FGX A;  1GH2 A;  3KTB A;  1A2J A;  1GUL A;  1PD2 1;  1UC7 A;  4O32 A;  4G10 A;  5D9W A;  1PL1 A;  2DJK A;  2LS5 A;  3FEU A;  2L6D A;  5H5S A;  1THX A;  4ZBA A;  3TUE A;  3TJK A;  5IPG A;  4Z7X A;  4JR4 A;  1O85 A;  1WMJ A;  1ACV A;  2H0H A;  1ZOF A;  4H86 A;  1M2D A;  4E8H A;  1VF2 A;  2YCD A;  1SU9 A;  1A8Y A;  3LQ7 A;  2VO4 A;  1VRS D;  2MMN A;  2LTK A;  2GQL A;  5F0G A;  1DUG A;  2CT6 A;  3ZLP A;  2H74 A;  1WWJ A;  2LNT A;  2LNS A;  4NHW A;  4KCE A;  2Z9S A;  1GUM A;  4IP6 A;  2GLR A;  5LD0 A;  5G31 A;  2H1D A;  3ZVJ D;  2YP6 A;  3KH7 A;  3VPQ A;  4XRA A;  5COH A;  1CQH A;  1FO5 A;  5D9X A;  17GS A;  1EEJ A;  1OKD A;  1TRW A;  5D73 A;  4TXO A;  4LA1 A;  4HUA A;  5HFK A;  3FRC A;  4I97 A;  1HNC A;  1WJK A;  2H72 A;  3IRA A;  1W89 A;  2BTO T;  3W8S A;  2GS3 A;  2YWN A;  4EF0 A;  3IPZ A;  1QQ2 A;  2LST A;  2GZZ A;  2DMM A;  4TN8 A;  4EO3 A;  2VL2 A;  3CSH A;  3HHV A;  4K2D A;  3F4S A;  2LUS A;  4TW5 A;  4GRF A;  4GQC A;  4LL1 B;  4MJE A;  2WJU A;  1B9Y C;  2V1M A;  5G5E A;  2CVK A;  1ON4 A;  2WCI A;  4Q5Q A;  2OE1 A;  5CRE A;  3UEM A;  3K8N A;  6GSX A;  2GZY A;  3FZ9 A;  4DEJ A;  3GA4 A;  2GZP A;  2VIM A;  3LYK A;  3C1S A;  1K0C A;  4WF5 A;  2NTO A;  4RI7 A;  4TOP A;  4IVF A;  2X64 A;  4G19 A;  1YF0 A;  1NW2 A;  1ERU A;  4KAE A;  3RBT A;  1JLW A;  3GN3 A;  1XOA A;  3IDV A;  4F0C A;  2R4V A;  2L5O A;  3GRX A;  2HT9 A;  4HQS A;  2C3Q A;  5D9T A;  4EVM A;  4IJI A;  2IPA A;  4K8M A;  1AUC A;  2X8H A;  3DWV A;  4J2F A;  4MP4 A;  1OE8 A;  2HE3 A;  5CRW A;  5JWR B;  4GSS A;  2NPB A;  1G0T A;  3A5W A;  3P2A A;  3D0Z A;  2LRC A;  1T3B A;  3ME7 A;  4J56 E;  4MAB A;  1BYE A;  4MPG A;  5ECK B;  1NSW A;  2VAF A;  1PX6 A;  1BED A;  1EV4 A;  4FYU A;  2YZH A;  2IN3 A;  3MDK A;  2PER A;  3QAV A;  2GDR A;  1SJ6 A;  5B6N A;  4QL9 A;  5G30 A;  4EE0 A;  2OJL A;  4OMV A;  5IPH A;  4NMU A;  5A4W A;  3DVX A;  2YV7 A;  1KNG A;  1VF3 A;  2IWT A;  1ZYQ B;  1FVK A;  1N8J A;  5AIS A;  4HJM A;  2ALB A;  4V1A g;  4TKY A;  3IK7 A;  4CW9 A;  1GSY A;  2O8V B;  1A2M A;  2KP1 A;  5B6M A;  2WGR A;  4GSN A;  2CZ2 A;  4TRX A;  3GFK A;  1LBK A;  5IO2 A;  2RUE A;  2B7K A;  4K9Z A;  2CX4 A;  1O81 A;  4IGJ A;  4O5R A;  4F2I A;  2EIR A;  1U3I A;  3EU3 A;  4HOJ A;  1YEX A;  3HJM A;  3M1G A;  1OC9 B;  1A8L A;  5F8B A;  2R3X A;  1NHY A;  2VCW A;  2MBT A;  2H1G A;  2DJ3 A;  4YAV A;  5G5F A;  4OCE A;  12GS A;  1WPI A;  3KJY A;  4NAX A;  4ILF A;  1OVN A;  4N0Z A;  4HDE A;  4KCA A;  2HSH A;  3J7Y k;  4XS4 B;  1XW9 A;  2NVL A;  4L5L A;  2P31 A;  4BVY A;  3CRU A;  3NZN A;  4TR3 A;  1QK8 A;  1NHO A;  1TI1 A;  1X9W B;  3F0I A;  3N9J A;  4MMM A;  2HNL A;  5HR0 A;  2B6M A;  3M9K A;  2YOI A;  3EUR A;  3TKS C;  3OR5 A;  1EZK A;  2GVP A;  1O8X A;  3FYG A;  2GGT A;  1FB0 A;  1AXD A;  1I9D A;  1MDI A;  2LRT A;  2VUP A;  1GUH A;  4X0X A;  4ZL9 A;  2XBQ A;  1KEB A;  1S3D A;  4I2U A;  1ZCP A;  1THO A;  3BD2 A;  1SL2 B;  3H4K A;  1UN2 A;  1T8E B;  2NBS A;  1ABA A;  1EP8 A;  1M9B A;  1Z6M A;  4F9Z A;  3TGZ A;  3WYW A;  1XWK A;  3EWL A;  1QFN A;  3C73 A;  1TJD A;  4I5Q A;  2JAD A;  2ZUP A;  4YH2 A;  3E3E A;  4KDX A;  5IO0 A;  2GSS A;  4L0U A;  2V6O A;  3TJG A;  1F6M C;  1NM3 A;  3LXT A;  5F05 A;  3PGT A;  3FR3 A;  4GCI A;  3HVX A;  1X5C A;  4KE3 A;  3DXB A;  2YV9 A;  2N5F A;  1OKT A;  5DAK A;  1EGO A;  3HYP A;  2A2S A;  1G6Y A;  3Q6O A;  5DCG A;  3NOF A;  1Z7P A;  2ON7 A;  1F9M A;  4KDU A;  3LG6 A;  1T7P B;  2DBC A;  1FOV A;  4MA9 A;  1PKW A;  4KX4 A;  4BA7 A;  1AAZ A;  4MZW A;  5HQP A;  1DE1 A;  3QMX A;  2AHE A;  1N2A A;  4NV5 A;  2V41 A;  1V2A A;  2C8U A;  3UVH A;  3TKP A;  3HZ4 A;  4JZQ A;  2H6Y A;  1KBN A;  2H0G A;  1K3L A;  1PA3 A;  4RI6 A;  3GKN A;  5IM9 A;  1YEP A;  4ZB6 A;  4I8B A;  2GT6 A;  3F4R A;  2AAW A;  3C7M A;  1KTE A;  3U6V A;  3KEB A;  3HVS A;  5KN0 A;  2YWI A;  2AUV A;  5LNK e;  4RQR A;  4DSR A;  4V1A p;  3IV4 A;  2H19 A;  1WP0 A;  4K6X A;  3EC3 A;  4TXO B;  2C0E A;  2YWO A;  4I2T A;  5G2Z A;  1IYI A;  1OC8 A;  1ZL9 A;  2V2G A;  4PQI A;  1ZGN A;  4MF7 A;  1OC3 A;  5CNW A;  3UL3 A;  4PUF C;  2DML A;  1EWX A;  2C4J A;  5ECM B;  1U88 A;  2KLX A;  2X8G A;  1X5E A;  4BPY A;  3GH6 A;  3VWU A;  1RW1 A;  1C72 A;  1V58 A;  2OE0 A;  4IS0 A;  3UJ1 A;  3F4T A;  2HFD A;  1GLQ A;  3TKQ A;  5IMZ A;  1G7O A;  3G7I A;  2FA4 A;  3QFB C;  4MCU A;  1X5D A;  4KUN A;  1AQW A;  7GSS A;  5JCW A;  2B5Y A;  3BCK A;  3UBK A;  3HD5 A;  4QL7 A;  3I6A A;  4O7H A;  4PGT A;  1FAA A;  5JCG A;  1XFL A;  1VF4 A;  2ZNM A;  5J4U A;  4MJB A;  3EE2 A;  5G1K A;  2F8F A;  2PMT A;  4MLY A;  1TKD B;  1TTZ A;  1A0F A;  1V9W A;  5AIV A;  5E59 A;  10GS A;  4N10 A;  2DLX A;  2I81 A;  1FW1 A;  1DSB A;  5ELA A;  3UAP A;  1GRX A;  1SL0 B;  1TW9 A;  4WF4 A;  2XBI A;  2FWF A;  4PNF A;  1PL2 A;  4ZIJ A;  4WEY A;  4AJ7 A;  1GWC A;  1AC1 A;  1MD4 A;  3WGE A;  4ZXG A;  1R4W A;  3H1N A;  2EIO A;  4ECB A;  5GST A;  4WKW A;  5D9V A;  1TP9 A;  1ST9 A;  6GSS A;  1GSU A;  4IQA A;  2AV4 A;  2QKE A;  2R5G A;  1K0O A;  1FG4 A;  2K9F A;  2P5Q A;  4E8E A;  2IJY A;  3M9J A;  4XCS A;  4JRR A;  2HI7 A;  3CMI A;  4HU7 A;  6GSV A;  3TRX A;  5IMV A;  5CAX A;  3HXS A;  5D93 A;  2H1B A;  3UIW A;  3LJR A;  5EL8 A;  2ES7 A;  2J23 A;  4HU9 A;  4POB A;  4LMW A;  2JZS A;  1JLV A;  3CRT A;  2V6K A;  4HS1 A;  4KGI A;  5A4V A;  1WOU A;  3FK8 A;  4GXZ A;  4TXV A;  2R2J A;  5JWQ B;  4I6X A;  1V40 A;  4V2L A;  3TKR A;  4DSS A;  9GSS A;  4K1F A;  1M99 A;  2LKU A;  4POM A;  4N11 A;  2RM5 A;  3GUR A;  3TCO A;  2ON5 A;  1MDK A;  1ML6 A;  2DIY A;  3KP8 A;  5ELG A;  5HR1 A;  3NIV A;  1K0A A;  3L9U A;  1R7H A;  2OKA A;  1A0R P;  3RHB A;  3SBC A;  5L71 A;  2LEG A;  2H8L A;  1K0D A;  1GTI A;  1XWA A;  1SYX A;  5KN2 A;  2MMZ A;  4OWY A;  3FR6 A;  5JCU A;  3Q18 A;  2BJX A;  3C8E A;  2HSY A;  3RHC A;  4NXI A;  3KD0 A;  3F8U A;  4V2N A;  2PWJ A;  3DRN A;  5HR2 A;  3VWV A;  3PH9 A;  22GS A;  1GSQ A;  6GSW A;  5B8B A;  3KGK A;  3MAK A;  3O6T A;  1JZO A;  3EMP A;  3GKK A;  1TRS A;  4BWQ A;  3IR4 A;  4AF2 A;  4FO5 A;  2C80 A;  2AB6 A;  3APO A;  4POK A;  1G6W A;  2QSI A;  1W4V A;  4TR4 A;  5D96 A;  1VGL A;  3QPM A;  2G2Q A;  1K0N A;  2FHE A;  1PKZ A;  3ISO A;  1YZX A;  1Q4J A;  2IMF A;  1YDK A;  1YKC A;  5AIX A;  4DVC A;  3L4N A;  3Q74 A;  5AN1 A;  3HJP A;  3R2Q A;  1AQV A;  3FZ5 A;  4MJA A;  3M3M A;  5H5Q A;  5DJM A;  4YQM A;  5DAL A;  3F6D A;  5DCH A;  3GKX A;  3HDC A;  2YWM A;  14GS A;  1PGT A;  5DAK B;  4KSO A;  4MZC A;  5ID2 A;  3FHK A;  2LQQ A;  1PX7 A;  3IXR A;  2PVQ A;  3HZ8 A;  1YKA A;  3D6I A;  2IIY A;  3PR8 A;  2FWE A;  2JZR A;  2MMO A;  2H71 A;  1QUW A;  3E0U A;  1O6J A;  1HQO A;  2DJ0 A;  3KMN A;  1F37 A;  4OO5 A;  3JCM L;  4ZBB A;  5F06 A;  4PX1 A;  3A3T A;  4CHS A;  3P8W A;  1B4Q A;  2IMI A;  3ZL5 A;  3GSS A;  1X0R A;  1YY7 A;  4ULX A;  5G1L A;  2WS2 A;  6GST A;  5GAP D;  1TOF A;  5E4W A;  4IJ3 A;  2F3M A;  2PU9 C;  4ZBD A;  4EL1 A;  2VL9 A;  2XHF A;  4FYC A;  1XZO A;  2IFQ A;  3WT2 A;  4GWR A;  5EPF A;  4TR1 A;  1XW5 A;  2HRN A;  4FYB A;  4IHU A;  5EY6 A;  2VL3 A;  2D2Z A;  2L6C A;  4BWS A;  4PNG A;  1YF1 A;  1F3B A;  5ECO B;  5B8A A;  2GT5 A;  5GAN D;  5ECL B;  1J9B A;  2VL2 C;  3L9S A;  1HD2 A;  2A2R A;  3ZYW A;  1XPV A;  4IEL A;  2H75 A;  3A2V A;  3I9V 2;  1SYR A;  2XPD A;  4ML6 A;  4BL7 A;  3QR6 A;  13GS A;  1BJX A;  5ABR A;  4EC0 A;  3IA1 A;  2M80 A;  4GLT A;  1XBS A;  2JU5 A;  1J08 A;  2K8S A;  4EUY A;  1XVQ A;  4X43 A;  5IOW A;  3GL3 A;  2JSZ A;  2CVD A;  3C1R A;  3RPN A;  5ENU A;  2RUF A;  4HZ4 A;  2KOK A;  4TVE A;  1SJI A;  2RII A;  4JU5 A;  2L5L A;  4JED A;  5ECQ B;  2QC7 A;  4J57 E;  2CQ9 A;  1F3A A;  2C3N A;  1K0B A;  3FZ4 A;  3KH9 A;  1GLP A;  1XIY A;  1SKS B;  1T4Z A;  1ERW A;  1PQN A;  2HYX A;  1PMT A;  3WD6 A;  4KA0 A;  4OFN A;  3GHA A;  5DBQ A;  2VLU A;  2CZ3 A;  2LQO A;  3VFI A;  1BAY A;  3WGD A;  1A24 A;  3H79 A;  4MDC A;  1EGR A;  1M0U A;  2H76 A;  3FR9 A;  1F2E A;  3HCZ A;  1M2A A;  1YQ1 A;  2K8V A;  3QD9 A;  2GST A;  5B7C A;  1WRY A;  1TXX A;  3ERF A;  2JSY A;  3A2W A;  3DVW A;  3TOT A;  5J5N A;  3GV1 A;  3TKS E;  1EV9 A;  4FH8 A;  5ECS A;  4RQX A;  4JR6 A;  1CQG A;  2QGV A;  2VLT A;  3A2X A;  3TJB A;  2H01 A;  2VD0 A;  5INY A;  4ML1 A;  3RAZ A;  3ZVJ A;  2OA7 A;  4G2E A;  3BCI A;  3QAG A;  3ERW A;  4KND A;  3HA9 A;  5DDL A;  2FY6 A;  3HKR A;  3BBY A;  3TRQ A;  2WUL A;  3BJ5 A;  2E7P A;  2GSR A;  4WET A;  4HJ2 A;  3LXZ A;  1MDJ A;  4KSM A;  2YAN A;  3VI5 A;  2O7K A;  3CBU A;  5IMC A;  1SD9 A;  2N5B A;  1OC9 A;  4EDZ A;  1XCC A;  4ZL8 A;  1XOB A;  6GSY A;  4AJ8 A;  3HVV A;  2BMX A;  1M7T A;  2O85 A;  2OAD A;  2YPM A;  3WT1 A;  5J3R A;  3M8N A;  3LSZ A;  3FZA A;  1B9X C;  5A5K A;  4EXJ A;  4LMV A;  1M2B A;  1AQX A;  5AGY A;  3D4M A;  5HFI A;  4HI7 A;  3VUR A;  1O8W A;  5CP1 A;  5CO3 A;  4EKZ A;  1S3A A;  1TK5 B;  3UMA A;  1SK1 A;  1FHE A;  4ZB8 A;  2C3T A;  1B8X A;  2P5R A;  1GNE A;  3QDN A;  1O73 A;  4POL A;  2ZCT A;  1MD3 A;  2R6K A;  1WE0 A;  4ZIL A;  3VPT A;  2KP2 A;  3J7Y b;  3CSJ A;  4K7N A;  5CRD A;  3ED3 A;  4DSS B;  1U87 A;  3D21 A;  2J9H A;  1AIU A;  2EC4 A;  5H5R A;  3PIN A;  3KM6 A;  2LJR A;  2OBI A;  3O76 A;  1GSE A;  3G9B A;  3ERG A;  1EOG A;  2VOC A;  3ZFB A;  4GF0 A;  3DML A;  5J9C A;  3DGQ A;  4OO4 A;  4QQ7 A;  3MWH A;  1K3Y A;  2I1U A;  4BVX A;  1QXH A;  2PVO C;  3ZIT A;  5DQY A;  3TRP A;  4PUA A;  5CRG A;  5JWO B;  3KTL A;  4AGS A;  3MSZ A;  3TOU A;  2K18 A;  3UVT A;  3LYP A;  2H0I A;  3DD3 A;  4PQ1 A;  2C0D A;  4OFM A;  1WIK A;  2JZT A;  1O7U A;  2B1L A;  3IOS A;  4G9H A;  3L78 A;  2WDU A;  5KN1 A;  1B48 A;  1J0F A;  3EIN A;  1SL1 B;  1IYH A;  2V32 A;  3GKM A;  5ECH B;  2TRC P;  1PN9 A;  4YAP A;  4NWY A;  3EU4 A;  1XWC A;  1BG5 A;  2P0G A;  1GUK A;  1UVZ A;  2H6Z A;  2E0Q A;  3EMX A;  1JZD A;  5GSS A;  4MPF A;  4XHM A;  5J41 A;  3GYK A;  3GMF A;  4KB3 A;  2O89 A;  1HYU A;  4D73 A;  4K0G A;  4XIH A;  4JE1 A;  5IMA A;  2LRN A;  5DAL B;  2LJK A;  3F3R A;  1XWB A;  3KXO A;  3UBL A;  5ID2 B;  2X8C A;  1K0M A;  4AJ6 A;  2C0F A;  1U3A A;  3EYT A;  1ZZY A;  2B1K A;  3VK9 A;  3ZRD A;  3IAM 2;  2DJ2 A;  3GTU A;  2N5A A;  2HZE A;  1E6B A;  2FNO A;  3ME8 A;  3LGC A;  1ZMA A;  3TDG A;  3IK9 A;  4ECC A;  3LEF A;  4L5O A;  3GNJ A;  3GX8 A;  2MZC A;  2C0G A;  1XWG A;  3O3T A;  4IP1 A;  1GL8 A;  3APQ A;  2B7J A;  4FIW A;  1DBY A;  1TU7 A;  2OE3 A;  1OYJ A;  1H75 A;  2XPE A;  3AY8 A;  3N5O A;  1GTA A;  1JHB A;  3I69 A;  3IC4 A;  4ECJ A;  2IFQ B;  2PGT A;  3P7X A;  4TR1 B;  1SD8 A;  2MYG A;  1QGV A;  4YQU A;  2FUG 2;  3TKS A;  1SK2 A;  1GP1 A;  1TK8 B;  2GSQ A;  2CVB A;  1ILO A;  1JFU A;  1X9M B;  2FWH A;  4EDY A;  5ECI B;  1SKR B;  2A4V A;  3HJO A;  4CDO A;  3RDW A;  2HXK A;  3GIX A;  2DJ1 A;  3LOR A;  2OAC A;  2AJQ B;  2HZF A;  3TB2 A;  1QMV A;  3C71 A;  3VLN A;  1T00 A;  4MJC A;  1PSQ A;  3W6G A;  2F9S A;  2JL4 A;  4HEA 2; 
#chains in the Genus database with same CATH topology
 4PUR A;  4GQF A;  2X99 A;  4O92 A;  2LJA A;  2PUK C;  2FD3 A;  3L9V A;  1H4O A;  4F0B A;  1GSS A;  3P90 A;  6GSU A;  4Q5F A;  3A5I A;  1R26 A;  3FKF A;  2PN8 A;  2PPT A;  4WBR D;  1TU8 A;  3CTG A;  2REM A;  4TR0 A;  1MEK A;  3FY7 A;  2CV4 A;  1I5G A;  3KCM A;  3I43 A;  2MMA A;  3V1W A;  2F8A A;  3S9F A;  5KOW A;  2H6X A;  2KHP A;  2YNX A;  2L4Q A;  2FLS A;  4RUV A;  3CTF A;  2VD1 A;  5J9B A;  1GNW A;  5CYY A;  5LCZ A;  1YJ6 A;  4OCF A;  5F07 A;  3ZRE A;  2YJ7 A;  4XS6 A;  1T4Y A;  3GL5 A;  4K7O A;  2CAI A;  3H93 A;  1ERT A;  1Y25 A;  2CA8 A;  2E2G A;  2L59 A;  3DYR A;  2RM6 A;  2O87 A;  2M72 A;  3CYN A;  3APS A;  3QCP A;  4KH7 A;  1K3O A;  2FCH A;  4MF6 A;  3ZZX A;  1RK4 A;  1USB A;  3EVI A;  4L0W A;  1AW9 A;  3GST A;  1FVJ A;  2G0F A;  1R5P A;  4PQH A;  2WZ9 A;  2IL3 A;  1R5A A;  2K6V A;  1SKW B;  1BX9 A;  4K7I A;  5DVB A;  4MK3 A;  4Q5R A;  1VF1 A;  2AYT A;  5C00 A;  1OE7 A;  3ZML A;  2TIR A;  4X1U A;  3KIJ A;  1A2L A;  2EIQ A;  5IMD A;  3QAW A;  2NDO A;  4HQZ A;  3LWA A;  2FA8 A;  4GTU A;  4NPB A;  3TJJ A;  5FWG A;  4OD7 A;  3SWL A;  4GST A;  2GQM A;  3HY2 A;  1TRV A;  2L4C A;  2VCT A;  3QOU A;  2A2P A;  5IMF A;  1GTU A;  19GS A;  1TI3 A;  2C1Y A;  2DKH A;  5FT3 A;  2DSA A;  4K0N A;  3ZFL A;  2PBJ A;  2I3Y A;  1TK0 B;  1SEN A;  2FWG A;  1SK0 A;  5EVO A;  1EEM A;  3IBH A;  4V2M A;  5GZZ B;  8GSS A;  3U5R E;  1EOH A;  5KN3 A;  1B4P A;  1MTC A;  2B3S A;  2WRT A;  1RQM A;  2R0C A;  3FW2 A;  1U6T A;  2E2M A;  1S3C A;  1Y6E A;  1GSD A;  1XW6 A;  2VCQ A;  3F63 A;  4P3Y B;  4ZL7 A;  2DJJ A;  4L8E A;  1FB6 A;  1Z7R A;  3GX0 A;  3LFL A;  2VCZ A;  2IMK A;  4X4J A;  4MF5 A;  3E9J B;  5C04 A;  4MH3 A;  2GTU A;  1G7E A;  18GS A;  4BVX B;  4NV2 A;  1A23 A;  1URM A;  4NHZ A;  4WR4 A;  4WXT A;  4OFT A;  1TRU A;  3F6F A;  3TJF A;  4ACS A;  3IE3 A;  3L0H A;  2H73 A;  1Q98 A;  4MZB A;  3ZIV A;  1GTB A;  2VM2 A;  1Z9H A;  1PN0 A;  2KUC A;  1EP7 A;  2XC2 A;  1Z5Y E;  4Z2U A;  5A4U A;  1DE2 A;  1E2Y A;  5KEJ A;  16GS A;  4XS1 A;  4IKH A;  3VWW A;  1BQ7 A;  3IAS 2;  1LU4 A;  1LJR A;  3VI7 A;  2L57 A;  3BOA A;  2UZ8 A;  2F51 A;  3D4T A;  3DIE A;  5IOX A;  4IBP A;  1TDI A;  1XG8 A;  1V98 A;  4D73 B;  2LV3 A;  3ZMK A;  4LLR A;  2WB9 A;  1OAZ A;  3GUS A;  3VWX A;  5ECR B;  3KP9 A;  2RLI A;  3Q19 A;  5DJL A;  3RPP A;  2B5X A;  4MH2 A;  5KOX A;  2YJH A;  2IMD A;  3KMO A;  4XTS A;  1UA5 A;  3D5J A;  4XS4 A;  5FHI A;  4ID0 A;  3F3Q A;  2CX3 A;  2YN1 A;  3G7Y A;  1T1V A;  4YQV A;  3GTU B;  3UOM A;  2MBS A;  4JBB A;  5IIZ A;  1XXU A;  2HZE B;  11GS A;  4N30 A;  3WGX A;  4WR5 A;  5CRH A;  1PRX A;  20GS A;  2CAQ A;  4DSQ A;  2I4A A;  2HLS A;  1HNA A;  5DQS A;  2R37 A;  3H8Q A;  3CXG A;  2TRX A;  3DEX A;  5ECN B;  2VCV A;  4ICY A;  2VM1 A;  4F03 A;  3UAR A;  2I9H A;  3KZQ A;  5ECP B;  3D22 A;  1Z3E A;  1ERV A;  1GSF A;  3QFA C;  3W8J A;  1XVW A;  3GH9 A;  4ZB9 A;  5HFG A;  2DC5 A;  2H70 A;  2QA1 A;  1JZW A;  2OBK A;  2WFC A;  4ISD A;  4WBJ A;  3ZIJ A;  4PXO A;  2H30 A;  1M9A A;  1ZYN A;  4IN0 A;  2H1A A;  2JAC A;  3M0F A;  4ECI A;  4HZ2 A;  4KW6 A;  1Z6N A;  2DIZ A;  2H66 A;  4IQ1 A;  2HRF A;  3F9U A;  3IHQ A;  2YZU A;  1SJZ A;  2B5E A;  1HNB A;  5HR3 A;  4IW9 A;  2IME A;  5IQY A;  4XRD A;  4BIK A;  2M46 A;  3ZTL A;  3US3 A;  4LL4 B;  2GQK A;  4N0V A;  3CSI A;  3G7J A;  1ZYE A;  2VLV A;  3DKS A;  4F82 A;  1JZR A;  3MNG A;  4Q5N A;  4G0L A;  5D8I A;  2VCX A;  4KDY A;  1X9S B;  1V57 A;  2FGX A;  1GH2 A;  3KTB A;  1A2J A;  1GUL A;  1PD2 1;  1UC7 A;  4O32 A;  4G10 A;  5D9W A;  1PL1 A;  2DJK A;  2LS5 A;  3FEU A;  2L6D A;  5H5S A;  1THX A;  4ZBA A;  3TUE A;  3TJK A;  5IPG A;  4Z7X A;  4JR4 A;  1O85 A;  1WMJ A;  1ACV A;  2H0H A;  1ZOF A;  4H86 A;  1M2D A;  4E8H A;  1VF2 A;  2YCD A;  1SU9 A;  1A8Y A;  3LQ7 A;  2VO4 A;  1VRS D;  2MMN A;  2LTK A;  2GQL A;  5F0G A;  1DUG A;  2CT6 A;  3ZLP A;  3PPU A;  2H74 A;  1WWJ A;  2LNT A;  2LNS A;  4NHW A;  4KCE A;  2Z9S A;  1GUM A;  4IP6 A;  2GLR A;  5LD0 A;  2R0G A;  5G31 A;  2H1D A;  3ZVJ D;  2YP6 A;  3KH7 A;  3VPQ A;  4XRA A;  5COH A;  1CQH A;  1FO5 A;  5D9X A;  17GS A;  1EEJ A;  1OKD A;  1TRW A;  5D73 A;  4TXO A;  4LA1 A;  4HUA A;  5HFK A;  3FRC A;  4I97 A;  1HNC A;  1WJK A;  4EIP A;  2H72 A;  3IRA A;  1W89 A;  2BTO T;  3W8S A;  2GS3 A;  2YWN A;  4EF0 A;  3IPZ A;  1QQ2 A;  2LST A;  2GZZ A;  2DMM A;  4TN8 A;  4EO3 A;  2VL2 A;  3CSH A;  3HHV A;  4K2D A;  4K5S A;  3F4S A;  2LUS A;  4TW5 A;  4GRF A;  4GQC A;  4LL1 B;  4MJE A;  2WJU A;  1B9Y C;  2V1M A;  4PTS A;  5G5E A;  2CVK A;  1ON4 A;  2WCI A;  4Q5Q A;  2OE1 A;  5CRE A;  3UEM A;  3K8N A;  6GSX A;  2GZY A;  3FZ9 A;  4DEJ A;  3GA4 A;  2GZP A;  2VIM A;  3LYK A;  1M3J A;  3C1S A;  1K0C A;  4WF5 A;  2NTO A;  4RI7 A;  4TOP A;  4IVF A;  2X64 A;  4G19 A;  1YF0 A;  1NW2 A;  1ERU A;  4KAE A;  3RBT A;  1JLW A;  3GN3 A;  1XOA A;  3IDV A;  4F0C A;  2R4V A;  2L5O A;  3GRX A;  2HT9 A;  4HQS A;  2C3Q A;  5D9T A;  4EVM A;  4IJI A;  2IPA A;  4K8M A;  1AUC A;  2X8H A;  3DWV A;  4J2F A;  4MP4 A;  1OE8 A;  2HE3 A;  5CRW A;  5JWR B;  4GSS A;  2NPB A;  1G0T A;  3A5W A;  3P2A A;  3D0Z A;  2LRC A;  1T3B A;  3ME7 A;  4J56 E;  4MAB A;  1BYE A;  4MPG A;  5ECK B;  4G0K A;  1NSW A;  2VAF A;  1PX6 A;  1BED A;  1EV4 A;  4FYU A;  2YZH A;  2IN3 A;  3MDK A;  2PER A;  3QAV A;  2GDR A;  1SJ6 A;  5B6N A;  4QL9 A;  5G30 A;  4EE0 A;  2OJL A;  4OMV A;  5IPH A;  4NMU A;  5A4W A;  3DVX A;  2YV7 A;  1KNG A;  1VF3 A;  2IWT A;  1ZYQ B;  1FVK A;  1N8J A;  5AIS A;  4HJM A;  2ALB A;  4V1A g;  4TKY A;  3IK7 A;  4CW9 A;  1GSY A;  2O8V B;  1A2M A;  4CY6 A;  2KP1 A;  5B6M A;  2WGR A;  4GSN A;  2CZ2 A;  4K2X A;  4TRX A;  3GFK A;  1LBK A;  4HSC X;  5IO2 A;  2RUE A;  2B7K A;  4K9Z A;  2CX4 A;  1O81 A;  4IGJ A;  4O5R A;  2QA2 A;  3CQF A;  4F2I A;  2EIR A;  1U3I A;  3EU3 A;  4HOJ A;  1YEX A;  3HJM A;  3M1G A;  1OC9 B;  1A8L A;  5F8B A;  2R3X A;  3IC8 A;  1NHY A;  2VCW A;  2MBT A;  2H1G A;  2X49 A;  2DJ3 A;  4YAV A;  3FMW A;  5G5F A;  4OCE A;  12GS A;  1WPI A;  1ZYP A;  3KJY A;  4NAX A;  4ILF A;  1OVN A;  4N0Z A;  4HDE A;  4KCA A;  2HSH A;  3J7Y k;  4XS4 B;  1XW9 A;  2NVL A;  4L5L A;  2P31 A;  4BVY A;  3CRU A;  3NZN A;  4KF9 A;  4TR3 A;  1QK8 A;  1NHO A;  1TI1 A;  1X9W B;  3F0I A;  3N9J A;  4MMM A;  2HNL A;  5BMU A;  5HR0 A;  2B6M A;  3M9K A;  2YOI A;  3EUR A;  3TKS C;  3OR5 A;  1EZK A;  2GVP A;  1O8X A;  3FYG A;  2GGT A;  1FB0 A;  1AXD A;  1I9D A;  1MDI A;  2LRT A;  2VUP A;  1GUH A;  4X0X A;  4ZL9 A;  4I2U A;  1KEB A;  1S3D A;  2XBQ A;  1ZCP A;  1THO A;  1S3R A;  3BD2 A;  4G0I A;  1SL2 B;  3H4K A;  1UN2 A;  1T8E B;  2NBS A;  1ABA A;  3MIX A;  1EP8 A;  1M9B A;  1Z6M A;  4F9Z A;  3TGZ A;  3WYW A;  1XWK A;  3EWL A;  1QFN A;  3C73 A;  1TJD A;  4I5Q A;  2JAD A;  2ZUP A;  4YH2 A;  3E3E A;  4KDX A;  5IO0 A;  2GSS A;  4L0U A;  2V6O A;  3TJG A;  1F6M C;  1NM3 A;  3LXT A;  5F05 A;  3PGT A;  3FR3 A;  4GCI A;  3HVX A;  1X5C A;  4KE3 A;  3DXB A;  1M3I A;  2YV9 A;  2N5F A;  1OKT A;  5DAK A;  1EGO A;  3HYP A;  2A2S A;  1G6Y A;  3Q6O A;  5DCG A;  3NOF A;  1Z7P A;  2ON7 A;  1F9M A;  4KDU A;  3LG6 A;  1T7P B;  2DBC A;  1FOV A;  4MA9 A;  1PKW A;  4KX4 A;  4BA7 A;  1AAZ A;  4MZW A;  5HQP A;  1DE1 A;  5BRT A;  3QMX A;  2AHE A;  1N2A A;  2HRK A;  4NV5 A;  2V41 A;  1V2A A;  2C8U A;  3UVH A;  3TKP A;  3HZ4 A;  4JZQ A;  2H6Y A;  1KBN A;  2H0G A;  1K3L A;  3MYD A;  1PA3 A;  4RI6 A;  3GKN A;  5IM9 A;  1YEP A;  4ZB6 A;  4I8B A;  2GT6 A;  3F4R A;  2AAW A;  3C7M A;  1KTE A;  3U6V A;  3KEB A;  3HVS A;  5KN0 A;  2YWI A;  2AUV A;  5LNK e;  4RQR A;  4DSR A;  4V1A p;  3IV4 A;  2H19 A;  1WP0 A;  4K6X A;  3EC3 A;  4TXO B;  2C0E A;  2YWO A;  4I2T A;  5G2Z A;  1IYI A;  1OC8 A;  1ZL9 A;  2V2G A;  4PQI A;  1ZGN A;  4MF7 A;  1OC3 A;  3R3E A;  5CNW A;  3UL3 A;  4PUF C;  2DML A;  1EWX A;  2C4J A;  5ECM B;  1U88 A;  2KLX A;  2X8G A;  1X5E A;  4BPY A;  3GH6 A;  3VWU A;  1RW1 A;  1C72 A;  1V58 A;  2OE0 A;  4IS0 A;  3UJ1 A;  3F4T A;  2HFD A;  1GLQ A;  3TKQ A;  5IMZ A;  1G7O A;  3G7I A;  2FA4 A;  3QFB C;  4MCU A;  1X5D A;  4KUN A;  1AQW A;  7GSS A;  5JCW A;  2B5Y A;  3BCK A;  3HVN A;  3UBK A;  3HD5 A;  4QL7 A;  3I6A A;  4O7H A;  4PGT A;  1FAA A;  5JCG A;  1XFL A;  1VF4 A;  2ZNM A;  5J4U A;  4MJB A;  3EE2 A;  5G1K A;  2F8F A;  2PMT A;  4MLY A;  1TKD B;  1TTZ A;  1A0F A;  1V9W A;  5AIV A;  5E59 A;  10GS A;  4N10 A;  2DLX A;  2I81 A;  1FW1 A;  1DSB A;  5ELA A;  3UAP A;  1GRX A;  1SL0 B;  1TW9 A;  2HSM A;  2HRA A;  4Z2R A;  4WF4 A;  2XBI A;  2FWF A;  4PNF A;  1PL2 A;  4ZIJ A;  4WEY A;  4AJ7 A;  1GWC A;  1AC1 A;  1MD4 A;  3WGE A;  4ZXG A;  1R4W A;  3H1N A;  2EIO A;  4ECB A;  5GST A;  4WKW A;  5D9V A;  1TP9 A;  1ST9 A;  6GSS A;  1GSU A;  4IQA A;  2AV4 A;  2QKE A;  2R5G A;  1K0O A;  1FG4 A;  2K9F A;  2P5Q A;  4E8E A;  2IJY A;  3M9J A;  4XCS A;  4JRR A;  2HI7 A;  3CMI A;  4HU7 A;  6GSV A;  3TRX A;  5IMV A;  5CAX A;  3HXS A;  5D93 A;  2H1B A;  3UIW A;  3LJR A;  5EL8 A;  2ES7 A;  2J23 A;  4HU9 A;  4POB A;  4LMW A;  2JZS A;  1JLV A;  3CRT A;  2V6K A;  4HS1 A;  4KGI A;  5A4V A;  1WOU A;  3FK8 A;  4GXZ A;  4TXV A;  2R2J A;  5JWQ B;  4I6X A;  1V40 A;  4V2L A;  3TKR A;  4DSS A;  9GSS A;  4K1F A;  1M99 A;  2LKU A;  4POM A;  4N11 A;  2RM5 A;  3GUR A;  3TCO A;  2ON5 A;  1MDK A;  1ML6 A;  2DIY A;  3KP8 A;  5ELG A;  5HR1 A;  3NIV A;  1K0A A;  3L9U A;  1R7H A;  2OKA A;  1A0R P;  3RHB A;  3SBC A;  5L71 A;  4BVY B;  2LEG A;  2H8L A;  1K0D A;  1GTI A;  1XWA A;  1SYX A;  5KN2 A;  2MMZ A;  4CY8 A;  4OWY A;  3FR6 A;  5JCU A;  3Q18 A;  2BJX A;  3C8E A;  2HSY A;  3RHC A;  4NXI A;  3KD0 A;  3F8U A;  4V2N A;  2PWJ A;  3DRN A;  5HR2 A;  3VWV A;  3PH9 A;  22GS A;  1GSQ A;  6GSW A;  5B8B A;  3KGK A;  3MAK A;  3O6T A;  1JZO A;  3EMP A;  3GKK A;  1TRS A;  4BWQ A;  3IR4 A;  4AF2 A;  4FO5 A;  2C80 A;  2AB6 A;  3APO A;  4POK A;  1G6W A;  2QSI A;  1W4V A;  4TR4 A;  5D96 A;  1VGL A;  3QPM A;  2G2Q A;  1K0N A;  2FHE A;  1PKZ A;  3ISO A;  1YZX A;  1Q4J A;  2IMF A;  1YDK A;  2A4H A;  1YKC A;  2R0P A;  5AIX A;  4DVC A;  3L4N A;  3Q74 A;  5AN1 A;  3HJP A;  3R2Q A;  1AQV A;  3FZ5 A;  4MJA A;  3M3M A;  5H5Q A;  5DJM A;  4YQM A;  5DAL A;  3F6D A;  5DCH A;  3GKX A;  3HDC A;  2YWM A;  14GS A;  1PGT A;  5DAK B;  4KSO A;  4MZC A;  5ID2 A;  3FHK A;  2LQQ A;  1PX7 A;  3IXR A;  2PVQ A;  4YKF A;  3HZ8 A;  1YKA A;  3D6I A;  2IIY A;  3PR8 A;  2FWE A;  2JZR A;  2MMO A;  2H71 A;  1QUW A;  3E0U A;  1O6J A;  1HQO A;  2DJ0 A;  3KMN A;  1F37 A;  4OO5 A;  3JCM L;  4ZBB A;  5F06 A;  4PX1 A;  3A3T A;  4CHS A;  3P8W A;  1B4Q A;  2IMI A;  3ZL5 A;  3GSS A;  1X0R A;  1YY7 A;  4ULX A;  5G1L A;  2WS2 A;  6GST A;  5GAP D;  1TOF A;  5E4W A;  4IJ3 A;  2F3M A;  2PU9 C;  4ZBD A;  4EL1 A;  2VL9 A;  2XHF A;  4FYC A;  1XZO A;  2IFQ A;  3WT2 A;  4GWR A;  5EPF A;  4TR1 A;  1XW5 A;  2HRN A;  4FYB A;  4IHU A;  5EY6 A;  2VL3 A;  2D2Z A;  2L6C A;  4BWS A;  4PNG A;  1YF1 A;  1F3B A;  5ECO B;  5B8A A;  2GT5 A;  5GAN D;  5ECL B;  4EIQ A;  1J9B A;  2VL2 C;  3L9S A;  1HD2 A;  2A2R A;  3ZYW A;  1XPV A;  4IEL A;  2H75 A;  3A2V A;  3I9V 2;  1SYR A;  2XPD A;  4ML6 A;  4BL7 A;  3QR6 A;  13GS A;  1BJX A;  5ABR A;  4EC0 A;  3IA1 A;  2M80 A;  4GLT A;  1XBS A;  2JU5 A;  4USS A;  1J08 A;  2K8S A;  4EUY A;  1XVQ A;  4X43 A;  5IOW A;  3IHG A;  3GL3 A;  3LW9 A;  2JSZ A;  2CVD A;  3C1R A;  3RPN A;  5ENU A;  2RUF A;  4HZ4 A;  2KOK A;  4TVE A;  1SJI A;  2RII A;  4JU5 A;  1PFO A;  2L5L A;  4JED A;  5ECQ B;  2QC7 A;  4J57 E;  2CQ9 A;  1F3A A;  2C3N A;  1K0B A;  3FZ4 A;  3KH9 A;  1GLP A;  1XIY A;  1SKS B;  1T4Z A;  1ERW A;  1PQN A;  2HYX A;  1PMT A;  3WD6 A;  4KA0 A;  4OFN A;  3GHA A;  5DBQ A;  2VLU A;  2CZ3 A;  2LQO A;  3VFI A;  1BAY A;  3WGD A;  1A24 A;  3H79 A;  4MDC A;  1FOH A;  1EGR A;  1M0U A;  2H76 A;  3FR9 A;  1F2E A;  3HCZ A;  1M2A A;  1YQ1 A;  2K8V A;  3QD9 A;  2GST A;  5B7C A;  1WRY A;  1TXX A;  3ERF A;  2JSY A;  3A2W A;  3DVW A;  3TOT A;  5J5N A;  3GV1 A;  3TKS E;  1EV9 A;  4FH8 A;  5ECS A;  4RQX A;  4JR6 A;  1CQG A;  2QGV A;  2VLT A;  3A2X A;  4MNN A;  3TJB A;  2H01 A;  2VD0 A;  5INY A;  4ML1 A;  4O5U A;  3RAZ A;  3ZVJ A;  2OA7 A;  4G2E A;  3BCI A;  3QAG A;  3ERW A;  4KND A;  3HA9 A;  5DDL A;  2FY6 A;  3HKR A;  3BBY A;  3TRQ A;  2WUL A;  3BJ5 A;  2E7P A;  2GSR A;  4WET A;  4HJ2 A;  3LXZ A;  1MDJ A;  4KSM A;  2YAN A;  3VI5 A;  2O7K A;  3CBU A;  5IMC A;  1SD9 A;  2N5B A;  1OC9 A;  4Z2T A;  4EDZ A;  1XCC A;  4ZL8 A;  1XOB A;  6GSY A;  4AJ8 A;  3HVV A;  2BMX A;  1M7T A;  2O85 A;  2OAD A;  2YPM A;  3WT1 A;  5J3R A;  3M8N A;  3LSZ A;  3FZA A;  1B9X C;  5A5K A;  4EXJ A;  4LMV A;  1M2B A;  1AQX A;  5AGY A;  3D4M A;  5HFI A;  4HI7 A;  3VUR A;  1O8W A;  5CP1 A;  5CO3 A;  4EKZ A;  1S3A A;  1TK5 B;  3UMA A;  1SK1 A;  1FHE A;  4ZB8 A;  2C3T A;  1B8X A;  2P5R A;  1GNE A;  3QDN A;  1O73 A;  4POL A;  2ZCT A;  1MD3 A;  2R6K A;  4O5Q A;  1WE0 A;  4ZIL A;  3VPT A;  2KP2 A;  3J7Y b;  3CSJ A;  4K7N A;  5CRD A;  3ED3 A;  4DSS B;  1U87 A;  3D21 A;  2J9H A;  1AIU A;  2EC4 A;  5H5R A;  3PIN A;  3EPT A;  3KM6 A;  2LJR A;  2OBI A;  3O76 A;  1GSE A;  3G9B A;  4K5R A;  3ERG A;  1EOG A;  2VOC A;  3ZFB A;  4GF0 A;  3DML A;  5J9C A;  3DGQ A;  4OO4 A;  4QQ7 A;  3MWH A;  1K3Y A;  2I1U A;  4BVX A;  1QXH A;  2PVO C;  3ZIT A;  5DQY A;  3TRP A;  4PUA A;  5CRG A;  5JWO B;  3KTL A;  4AGS A;  3MSZ A;  3TOU A;  2K18 A;  3UVT A;  3LYP A;  2H0I A;  3DD3 A;  4PQ1 A;  2C0D A;  4OFM A;  1WIK A;  2JZT A;  1O7U A;  2B1L A;  3IOS A;  4G9H A;  3L78 A;  2WDU A;  5KN1 A;  1B48 A;  4YKG A;  1J0F A;  3EIN A;  1SL1 B;  1IYH A;  2X4A A;  2V32 A;  3GKM A;  5ECH B;  2TRC P;  1PN9 A;  4YAP A;  4NWY A;  3EU4 A;  1XWC A;  1BG5 A;  2P0G A;  1GUK A;  1UVZ A;  2H6Z A;  2E0Q A;  3EMX A;  1JZD A;  5GSS A;  4MPF A;  4XHM A;  5J41 A;  3GYK A;  3GMF A;  4KB3 A;  2O89 A;  1HYU A;  4D73 A;  4K0G A;  4XIH A;  4JE1 A;  5IMA A;  2LRN A;  5DAL B;  2LJK A;  3F3R A;  1XWB A;  3KXO A;  3UBL A;  5ID2 B;  2X8C A;  1K0M A;  4AJ6 A;  2C0F A;  1U3A A;  3EYT A;  1ZZY A;  2B1K A;  3VK9 A;  3ZRD A;  3IAM 2;  2DJ2 A;  3GTU A;  2N5A A;  2HZE A;  1E6B A;  2FNO A;  3ME8 A;  3LGC A;  1ZMA A;  3TDG A;  3IK9 A;  4ECC A;  3LEF A;  4L5O A;  3GNJ A;  3GX8 A;  2MZC A;  2C0G A;  1XWG A;  3O3T A;  4IP1 A;  1GL8 A;  3APQ A;  2B7J A;  4FIW A;  4FQU A;  1DBY A;  1TU7 A;  2OE3 A;  1OYJ A;  1H75 A;  2XPE A;  3AY8 A;  3N5O A;  1GTA A;  1JHB A;  3I69 A;  3IC4 A;  4ECJ A;  2IFQ B;  2PGT A;  3P7X A;  4TR1 B;  1SD8 A;  2MYG A;  2DKI A;  1QGV A;  4YQU A;  2FUG 2;  3TKS A;  1SK2 A;  1GP1 A;  4A5P A;  1TK8 B;  2GSQ A;  2CVB A;  1ILO A;  1JFU A;  1X9M B;  2FWH A;  4EDY A;  5ECI B;  1SKR B;  2A4V A;  3HJO A;  4CDO A;  3RDW A;  2HXK A;  3GIX A;  2DJ1 A;  3LOR A;  2OAC A;  2AJQ B;  2HZF A;  3TB2 A;  1QMV A;  3C71 A;  4BL7 B;  3VLN A;  1T00 A;  4MJC A;  1PSQ A;  3W6G A;  2F9S A;  2JL4 A;  4HEA 2; 
#chains in the Genus database with same CATH homology
 4PUR A;  4GQF A;  2X99 A;  4O92 A;  2LJA A;  2PUK C;  2FD3 A;  3L9V A;  1H4O A;  4F0B A;  1GSS A;  3P90 A;  6GSU A;  4Q5F A;  3A5I A;  1R26 A;  3FKF A;  2PN8 A;  2PPT A;  4WBR D;  1TU8 A;  3CTG A;  2REM A;  4TR0 A;  1MEK A;  3FY7 A;  2CV4 A;  1I5G A;  3KCM A;  3I43 A;  2MMA A;  3V1W A;  2F8A A;  3S9F A;  5KOW A;  2H6X A;  2KHP A;  2YNX A;  2L4Q A;  2FLS A;  4RUV A;  3CTF A;  2VD1 A;  5J9B A;  1GNW A;  5CYY A;  5LCZ A;  1YJ6 A;  4OCF A;  5F07 A;  3ZRE A;  2YJ7 A;  4XS6 A;  1T4Y A;  3GL5 A;  4K7O A;  2CAI A;  3H93 A;  1ERT A;  1Y25 A;  2CA8 A;  2E2G A;  2L59 A;  3DYR A;  2RM6 A;  2O87 A;  2M72 A;  3CYN A;  3APS A;  3QCP A;  4KH7 A;  1K3O A;  2FCH A;  4MF6 A;  3ZZX A;  1RK4 A;  1USB A;  3EVI A;  4L0W A;  1AW9 A;  3GST A;  1FVJ A;  2G0F A;  1R5P A;  4PQH A;  2WZ9 A;  2IL3 A;  1R5A A;  2K6V A;  1SKW B;  1BX9 A;  4K7I A;  5DVB A;  4MK3 A;  4Q5R A;  1VF1 A;  2AYT A;  5C00 A;  1OE7 A;  3ZML A;  2TIR A;  4X1U A;  3KIJ A;  1A2L A;  2EIQ A;  5IMD A;  3QAW A;  2NDO A;  4HQZ A;  3LWA A;  2FA8 A;  4GTU A;  4NPB A;  3TJJ A;  5FWG A;  4OD7 A;  3SWL A;  4GST A;  2GQM A;  3HY2 A;  1TRV A;  2L4C A;  2VCT A;  3QOU A;  2A2P A;  5IMF A;  1GTU A;  19GS A;  1TI3 A;  2C1Y A;  2DKH A;  5FT3 A;  2DSA A;  4K0N A;  3ZFL A;  2PBJ A;  2I3Y A;  1TK0 B;  1SEN A;  2FWG A;  1SK0 A;  5EVO A;  1EEM A;  3IBH A;  4V2M A;  5GZZ B;  8GSS A;  3U5R E;  1EOH A;  5KN3 A;  1B4P A;  1MTC A;  2B3S A;  2WRT A;  1RQM A;  2R0C A;  3FW2 A;  1U6T A;  2E2M A;  1S3C A;  1Y6E A;  1GSD A;  1XW6 A;  2VCQ A;  3F63 A;  4P3Y B;  4ZL7 A;  2DJJ A;  4L8E A;  1FB6 A;  1Z7R A;  3GX0 A;  3LFL A;  2VCZ A;  2IMK A;  4X4J A;  4MF5 A;  3E9J B;  5C04 A;  4MH3 A;  2GTU A;  1G7E A;  18GS A;  4BVX B;  4NV2 A;  1A23 A;  1URM A;  4NHZ A;  4WR4 A;  4WXT A;  4OFT A;  1TRU A;  3F6F A;  3TJF A;  4ACS A;  3IE3 A;  3L0H A;  2H73 A;  1Q98 A;  4MZB A;  3ZIV A;  1GTB A;  2VM2 A;  1Z9H A;  1PN0 A;  2KUC A;  1EP7 A;  2XC2 A;  1Z5Y E;  4Z2U A;  5A4U A;  1DE2 A;  1E2Y A;  5KEJ A;  16GS A;  4XS1 A;  4IKH A;  3VWW A;  1BQ7 A;  3IAS 2;  1LU4 A;  1LJR A;  3VI7 A;  2L57 A;  3BOA A;  2UZ8 A;  2F51 A;  3D4T A;  3DIE A;  5IOX A;  4IBP A;  1TDI A;  1V98 A;  4D73 B;  2LV3 A;  3ZMK A;  4LLR A;  2WB9 A;  1OAZ A;  3GUS A;  3VWX A;  5ECR B;  3KP9 A;  2RLI A;  3Q19 A;  5DJL A;  3RPP A;  2B5X A;  4MH2 A;  5KOX A;  2YJH A;  2IMD A;  3KMO A;  4XTS A;  1UA5 A;  3D5J A;  4XS4 A;  5FHI A;  4ID0 A;  3F3Q A;  2CX3 A;  2YN1 A;  3G7Y A;  1T1V A;  4YQV A;  3GTU B;  3UOM A;  2MBS A;  4JBB A;  5IIZ A;  1XXU A;  2HZE B;  11GS A;  4N30 A;  3WGX A;  4WR5 A;  5CRH A;  1PRX A;  20GS A;  2CAQ A;  4DSQ A;  2I4A A;  2HLS A;  1HNA A;  5DQS A;  2R37 A;  3H8Q A;  3CXG A;  2TRX A;  3DEX A;  5ECN B;  2VCV A;  4ICY A;  2VM1 A;  4F03 A;  3UAR A;  2I9H A;  3KZQ A;  5ECP B;  3D22 A;  1Z3E A;  1ERV A;  1GSF A;  3QFA C;  3W8J A;  1XVW A;  3GH9 A;  4ZB9 A;  5HFG A;  2DC5 A;  2H70 A;  2QA1 A;  1JZW A;  2OBK A;  2WFC A;  4ISD A;  4WBJ A;  3ZIJ A;  4PXO A;  2H30 A;  1M9A A;  1ZYN A;  4IN0 A;  2H1A A;  2JAC A;  3M0F A;  4ECI A;  4HZ2 A;  4KW6 A;  1Z6N A;  2DIZ A;  2H66 A;  4IQ1 A;  2HRF A;  3F9U A;  3IHQ A;  2YZU A;  1SJZ A;  2B5E A;  1HNB A;  5HR3 A;  4IW9 A;  2IME A;  5IQY A;  4XRD A;  2M46 A;  3ZTL A;  3US3 A;  4LL4 B;  2GQK A;  4N0V A;  3CSI A;  3G7J A;  1ZYE A;  2VLV A;  3DKS A;  4F82 A;  1JZR A;  3MNG A;  4Q5N A;  4G0L A;  5D8I A;  2VCX A;  4KDY A;  1X9S B;  1V57 A;  2FGX A;  1GH2 A;  3KTB A;  1A2J A;  1GUL A;  1PD2 1;  1UC7 A;  4O32 A;  4G10 A;  5D9W A;  1PL1 A;  2DJK A;  2LS5 A;  3FEU A;  2L6D A;  5H5S A;  1THX A;  4ZBA A;  3TUE A;  3TJK A;  5IPG A;  4Z7X A;  4JR4 A;  1O85 A;  1WMJ A;  1ACV A;  2H0H A;  1ZOF A;  4H86 A;  1M2D A;  4E8H A;  1VF2 A;  2YCD A;  1SU9 A;  1A8Y A;  3LQ7 A;  2VO4 A;  1VRS D;  2MMN A;  2LTK A;  2GQL A;  5F0G A;  1DUG A;  2CT6 A;  3ZLP A;  3PPU A;  2H74 A;  1WWJ A;  2LNT A;  2LNS A;  4NHW A;  4KCE A;  2Z9S A;  1GUM A;  4IP6 A;  2GLR A;  5LD0 A;  2R0G A;  5G31 A;  2H1D A;  3ZVJ D;  2YP6 A;  3KH7 A;  3VPQ A;  4XRA A;  5COH A;  1CQH A;  1FO5 A;  5D9X A;  17GS A;  1EEJ A;  1OKD A;  1TRW A;  5D73 A;  4TXO A;  4LA1 A;  4HUA A;  5HFK A;  3FRC A;  4I97 A;  1HNC A;  1WJK A;  4EIP A;  2H72 A;  3IRA A;  1W89 A;  2BTO T;  3W8S A;  2GS3 A;  2YWN A;  4EF0 A;  3IPZ A;  1QQ2 A;  2LST A;  2GZZ A;  2DMM A;  4TN8 A;  4EO3 A;  2VL2 A;  3CSH A;  3HHV A;  4K2D A;  4K5S A;  3F4S A;  2LUS A;  4TW5 A;  4GRF A;  4GQC A;  4LL1 B;  4MJE A;  2WJU A;  1B9Y C;  2V1M A;  4PTS A;  5G5E A;  2CVK A;  1ON4 A;  2WCI A;  4Q5Q A;  2OE1 A;  5CRE A;  3UEM A;  3K8N A;  6GSX A;  2GZY A;  3FZ9 A;  4DEJ A;  3GA4 A;  2GZP A;  2VIM A;  3LYK A;  3C1S A;  1K0C A;  4WF5 A;  2NTO A;  4RI7 A;  4TOP A;  4IVF A;  2X64 A;  4G19 A;  1YF0 A;  1NW2 A;  1ERU A;  4KAE A;  3RBT A;  1JLW A;  3GN3 A;  1XOA A;  3IDV A;  4F0C A;  2R4V A;  2L5O A;  3GRX A;  2HT9 A;  4HQS A;  2C3Q A;  5D9T A;  4EVM A;  4IJI A;  2IPA A;  4K8M A;  1AUC A;  2X8H A;  3DWV A;  4J2F A;  4MP4 A;  1OE8 A;  2HE3 A;  5CRW A;  5JWR B;  4GSS A;  2NPB A;  1G0T A;  3A5W A;  3P2A A;  3D0Z A;  2LRC A;  1T3B A;  3ME7 A;  4J56 E;  4MAB A;  1BYE A;  4MPG A;  5ECK B;  4G0K A;  1NSW A;  2VAF A;  1PX6 A;  1BED A;  1EV4 A;  4FYU A;  2YZH A;  2IN3 A;  3MDK A;  2PER A;  3QAV A;  2GDR A;  1SJ6 A;  5B6N A;  4QL9 A;  5G30 A;  4EE0 A;  2OJL A;  4OMV A;  5IPH A;  4NMU A;  5A4W A;  3DVX A;  2YV7 A;  1KNG A;  1VF3 A;  2IWT A;  1ZYQ B;  1FVK A;  1N8J A;  5AIS A;  4HJM A;  2ALB A;  4V1A g;  4TKY A;  3IK7 A;  4CW9 A;  1GSY A;  2O8V B;  1A2M A;  4CY6 A;  2KP1 A;  5B6M A;  2WGR A;  4GSN A;  2CZ2 A;  4K2X A;  4TRX A;  3GFK A;  1LBK A;  5IO2 A;  2RUE A;  2B7K A;  4K9Z A;  2CX4 A;  1O81 A;  4IGJ A;  4O5R A;  2QA2 A;  4F2I A;  2EIR A;  1U3I A;  3EU3 A;  4HOJ A;  1YEX A;  3HJM A;  3M1G A;  1OC9 B;  1A8L A;  5F8B A;  2R3X A;  3IC8 A;  1NHY A;  2VCW A;  2MBT A;  2H1G A;  2X49 A;  2DJ3 A;  4YAV A;  3FMW A;  5G5F A;  4OCE A;  12GS A;  1WPI A;  1ZYP A;  3KJY A;  4NAX A;  4ILF A;  1OVN A;  4N0Z A;  4HDE A;  4KCA A;  2HSH A;  3J7Y k;  4XS4 B;  1XW9 A;  2NVL A;  4L5L A;  2P31 A;  4BVY A;  3CRU A;  3NZN A;  4KF9 A;  4TR3 A;  1QK8 A;  1NHO A;  1TI1 A;  1X9W B;  3F0I A;  3N9J A;  4MMM A;  2HNL A;  5BMU A;  5HR0 A;  2B6M A;  3M9K A;  2YOI A;  3EUR A;  3TKS C;  3OR5 A;  1EZK A;  2GVP A;  1O8X A;  3FYG A;  2GGT A;  1FB0 A;  1AXD A;  1I9D A;  1MDI A;  2LRT A;  2VUP A;  1GUH A;  4X0X A;  4ZL9 A;  2XBQ A;  1KEB A;  1S3D A;  4I2U A;  1ZCP A;  1THO A;  3BD2 A;  4G0I A;  1SL2 B;  3H4K A;  1UN2 A;  1T8E B;  2NBS A;  1ABA A;  3MIX A;  1EP8 A;  1M9B A;  1Z6M A;  4F9Z A;  3TGZ A;  3WYW A;  1XWK A;  3EWL A;  1QFN A;  3C73 A;  1TJD A;  4I5Q A;  2JAD A;  2ZUP A;  4YH2 A;  3E3E A;  4KDX A;  5IO0 A;  2GSS A;  4L0U A;  2V6O A;  3TJG A;  1F6M C;  1NM3 A;  3LXT A;  5F05 A;  3PGT A;  3FR3 A;  4GCI A;  3HVX A;  1X5C A;  4KE3 A;  3DXB A;  2YV9 A;  2N5F A;  1OKT A;  5DAK A;  1EGO A;  3HYP A;  2A2S A;  1G6Y A;  3Q6O A;  5DCG A;  3NOF A;  1Z7P A;  2ON7 A;  1F9M A;  4KDU A;  3LG6 A;  1T7P B;  2DBC A;  1FOV A;  4MA9 A;  1PKW A;  4KX4 A;  4BA7 A;  1AAZ A;  4MZW A;  5HQP A;  1DE1 A;  5BRT A;  3QMX A;  2AHE A;  1N2A A;  2HRK A;  4NV5 A;  2V41 A;  1V2A A;  2C8U A;  3UVH A;  3TKP A;  3HZ4 A;  4JZQ A;  2H6Y A;  1KBN A;  2H0G A;  1K3L A;  3MYD A;  1PA3 A;  4RI6 A;  3GKN A;  5IM9 A;  1YEP A;  4ZB6 A;  4I8B A;  2GT6 A;  3F4R A;  2AAW A;  3C7M A;  1KTE A;  3U6V A;  3KEB A;  3HVS A;  5KN0 A;  2YWI A;  2AUV A;  5LNK e;  4RQR A;  4DSR A;  4V1A p;  3IV4 A;  2H19 A;  1WP0 A;  4K6X A;  3EC3 A;  4TXO B;  2C0E A;  2YWO A;  4I2T A;  5G2Z A;  1IYI A;  1OC8 A;  1ZL9 A;  2V2G A;  4PQI A;  1ZGN A;  4MF7 A;  1OC3 A;  3R3E A;  5CNW A;  3UL3 A;  4PUF C;  2DML A;  1EWX A;  2C4J A;  5ECM B;  1U88 A;  2KLX A;  2X8G A;  1X5E A;  4BPY A;  3GH6 A;  3VWU A;  1RW1 A;  1C72 A;  1V58 A;  2OE0 A;  4IS0 A;  3UJ1 A;  3F4T A;  2HFD A;  1GLQ A;  3TKQ A;  5IMZ A;  1G7O A;  3G7I A;  2FA4 A;  3QFB C;  4MCU A;  1X5D A;  4KUN A;  1AQW A;  7GSS A;  5JCW A;  2B5Y A;  3BCK A;  3UBK A;  3HD5 A;  4QL7 A;  3I6A A;  4O7H A;  4PGT A;  1FAA A;  5JCG A;  1XFL A;  1VF4 A;  2ZNM A;  5J4U A;  4MJB A;  3EE2 A;  5G1K A;  2F8F A;  2PMT A;  4MLY A;  1TKD B;  1TTZ A;  1A0F A;  1V9W A;  5AIV A;  5E59 A;  10GS A;  4N10 A;  2DLX A;  2I81 A;  1FW1 A;  1DSB A;  5ELA A;  3UAP A;  1GRX A;  1SL0 B;  1TW9 A;  2HSM A;  2HRA A;  4Z2R A;  4WF4 A;  2XBI A;  2FWF A;  4PNF A;  1PL2 A;  4ZIJ A;  4WEY A;  4AJ7 A;  1GWC A;  1AC1 A;  1MD4 A;  3WGE A;  4ZXG A;  1R4W A;  3H1N A;  2EIO A;  4ECB A;  5GST A;  4WKW A;  5D9V A;  1TP9 A;  1ST9 A;  6GSS A;  1GSU A;  4IQA A;  2AV4 A;  2QKE A;  2R5G A;  1K0O A;  1FG4 A;  2K9F A;  2P5Q A;  4E8E A;  2IJY A;  3M9J A;  4XCS A;  4JRR A;  2HI7 A;  3CMI A;  4HU7 A;  6GSV A;  3TRX A;  5IMV A;  5CAX A;  3HXS A;  5D93 A;  2H1B A;  3UIW A;  3LJR A;  5EL8 A;  2ES7 A;  2J23 A;  4HU9 A;  4POB A;  4LMW A;  2JZS A;  1JLV A;  3CRT A;  2V6K A;  4HS1 A;  4KGI A;  5A4V A;  1WOU A;  3FK8 A;  4GXZ A;  4TXV A;  2R2J A;  5JWQ B;  4I6X A;  1V40 A;  4V2L A;  3TKR A;  4DSS A;  9GSS A;  4K1F A;  1M99 A;  2LKU A;  4POM A;  4N11 A;  2RM5 A;  3GUR A;  3TCO A;  2ON5 A;  1MDK A;  1ML6 A;  2DIY A;  3KP8 A;  5ELG A;  5HR1 A;  3NIV A;  1K0A A;  3L9U A;  1R7H A;  2OKA A;  1A0R P;  3RHB A;  3SBC A;  5L71 A;  4BVY B;  2LEG A;  2H8L A;  1K0D A;  1GTI A;  1XWA A;  1SYX A;  5KN2 A;  2MMZ A;  4CY8 A;  4OWY A;  3FR6 A;  5JCU A;  3Q18 A;  2BJX A;  3C8E A;  2HSY A;  3RHC A;  4NXI A;  3KD0 A;  3F8U A;  4V2N A;  2PWJ A;  3DRN A;  5HR2 A;  3VWV A;  3PH9 A;  22GS A;  1GSQ A;  6GSW A;  5B8B A;  3KGK A;  3MAK A;  3O6T A;  1JZO A;  3EMP A;  3GKK A;  1TRS A;  4BWQ A;  3IR4 A;  4AF2 A;  4FO5 A;  2C80 A;  2AB6 A;  3APO A;  4POK A;  1G6W A;  2QSI A;  1W4V A;  4TR4 A;  5D96 A;  1VGL A;  3QPM A;  2G2Q A;  1K0N A;  2FHE A;  1PKZ A;  3ISO A;  1YZX A;  1Q4J A;  2IMF A;  1YDK A;  2A4H A;  1YKC A;  2R0P A;  5AIX A;  4DVC A;  3L4N A;  3Q74 A;  5AN1 A;  3HJP A;  3R2Q A;  1AQV A;  3FZ5 A;  4MJA A;  3M3M A;  5H5Q A;  5DJM A;  4YQM A;  5DAL A;  3F6D A;  5DCH A;  3GKX A;  3HDC A;  2YWM A;  14GS A;  1PGT A;  5DAK B;  4KSO A;  4MZC A;  5ID2 A;  3FHK A;  2LQQ A;  1PX7 A;  3IXR A;  2PVQ A;  4YKF A;  3HZ8 A;  1YKA A;  3D6I A;  2IIY A;  3PR8 A;  2FWE A;  2JZR A;  2MMO A;  2H71 A;  1QUW A;  3E0U A;  1O6J A;  1HQO A;  2DJ0 A;  3KMN A;  1F37 A;  4OO5 A;  3JCM L;  4ZBB A;  5F06 A;  4PX1 A;  3A3T A;  4CHS A;  3P8W A;  1B4Q A;  2IMI A;  3ZL5 A;  3GSS A;  1X0R A;  1YY7 A;  4ULX A;  5G1L A;  2WS2 A;  6GST A;  5GAP D;  1TOF A;  5E4W A;  4IJ3 A;  2F3M A;  2PU9 C;  4ZBD A;  4EL1 A;  2VL9 A;  2XHF A;  4FYC A;  1XZO A;  2IFQ A;  3WT2 A;  4GWR A;  5EPF A;  4TR1 A;  1XW5 A;  2HRN A;  4FYB A;  4IHU A;  5EY6 A;  2VL3 A;  2D2Z A;  2L6C A;  4BWS A;  4PNG A;  1YF1 A;  1F3B A;  5ECO B;  5B8A A;  2GT5 A;  5GAN D;  5ECL B;  4EIQ A;  1J9B A;  2VL2 C;  3L9S A;  1HD2 A;  2A2R A;  3ZYW A;  1XPV A;  4IEL A;  2H75 A;  3A2V A;  3I9V 2;  1SYR A;  2XPD A;  4ML6 A;  4BL7 A;  3QR6 A;  13GS A;  1BJX A;  5ABR A;  4EC0 A;  3IA1 A;  2M80 A;  4GLT A;  1XBS A;  2JU5 A;  4USS A;  1J08 A;  2K8S A;  4EUY A;  1XVQ A;  4X43 A;  5IOW A;  3IHG A;  3GL3 A;  3LW9 A;  2JSZ A;  2CVD A;  3C1R A;  3RPN A;  5ENU A;  2RUF A;  4HZ4 A;  2KOK A;  4TVE A;  1SJI A;  2RII A;  4JU5 A;  2L5L A;  4JED A;  5ECQ B;  2QC7 A;  4J57 E;  2CQ9 A;  1F3A A;  2C3N A;  1K0B A;  3FZ4 A;  3KH9 A;  1GLP A;  1XIY A;  1SKS B;  1T4Z A;  1ERW A;  1PQN A;  2HYX A;  1PMT A;  3WD6 A;  4KA0 A;  4OFN A;  3GHA A;  5DBQ A;  2VLU A;  2CZ3 A;  2LQO A;  3VFI A;  1BAY A;  3WGD A;  1A24 A;  3H79 A;  4MDC A;  1FOH A;  1EGR A;  1M0U A;  2H76 A;  3FR9 A;  1F2E A;  3HCZ A;  1M2A A;  1YQ1 A;  2K8V A;  3QD9 A;  2GST A;  5B7C A;  1WRY A;  1TXX A;  3ERF A;  2JSY A;  3A2W A;  3DVW A;  3TOT A;  5J5N A;  3GV1 A;  3TKS E;  1EV9 A;  4FH8 A;  5ECS A;  4RQX A;  4JR6 A;  1CQG A;  2QGV A;  2VLT A;  3A2X A;  4MNN A;  3TJB A;  2H01 A;  2VD0 A;  5INY A;  4ML1 A;  4O5U A;  3RAZ A;  3ZVJ A;  2OA7 A;  4G2E A;  3BCI A;  3QAG A;  3ERW A;  4KND A;  3HA9 A;  5DDL A;  2FY6 A;  3HKR A;  3BBY A;  3TRQ A;  2WUL A;  3BJ5 A;  2E7P A;  2GSR A;  4WET A;  4HJ2 A;  3LXZ A;  1MDJ A;  4KSM A;  2YAN A;  3VI5 A;  2O7K A;  3CBU A;  5IMC A;  1SD9 A;  2N5B A;  1OC9 A;  4Z2T A;  4EDZ A;  1XCC A;  4ZL8 A;  1XOB A;  6GSY A;  4AJ8 A;  3HVV A;  2BMX A;  1M7T A;  2O85 A;  2OAD A;  2YPM A;  3WT1 A;  5J3R A;  3M8N A;  3LSZ A;  3FZA A;  1B9X C;  5A5K A;  4EXJ A;  4LMV A;  1M2B A;  1AQX A;  5AGY A;  3D4M A;  5HFI A;  4HI7 A;  3VUR A;  1O8W A;  5CP1 A;  5CO3 A;  4EKZ A;  1S3A A;  1TK5 B;  3UMA A;  1SK1 A;  1FHE A;  4ZB8 A;  2C3T A;  1B8X A;  2P5R A;  1GNE A;  3QDN A;  1O73 A;  4POL A;  2ZCT A;  1MD3 A;  2R6K A;  4O5Q A;  1WE0 A;  4ZIL A;  3VPT A;  2KP2 A;  3J7Y b;  3CSJ A;  4K7N A;  5CRD A;  3ED3 A;  4DSS B;  1U87 A;  3D21 A;  2J9H A;  1AIU A;  2EC4 A;  5H5R A;  3PIN A;  3EPT A;  3KM6 A;  2LJR A;  2OBI A;  3O76 A;  1GSE A;  3G9B A;  4K5R A;  3ERG A;  1EOG A;  2VOC A;  3ZFB A;  4GF0 A;  3DML A;  5J9C A;  3DGQ A;  4OO4 A;  4QQ7 A;  3MWH A;  1K3Y A;  2I1U A;  4BVX A;  1QXH A;  2PVO C;  3ZIT A;  5DQY A;  3TRP A;  4PUA A;  5CRG A;  5JWO B;  3KTL A;  4AGS A;  3MSZ A;  3TOU A;  2K18 A;  3UVT A;  3LYP A;  2H0I A;  3DD3 A;  4PQ1 A;  2C0D A;  4OFM A;  1WIK A;  2JZT A;  1O7U A;  2B1L A;  3IOS A;  4G9H A;  3L78 A;  2WDU A;  5KN1 A;  1B48 A;  4YKG A;  1J0F A;  3EIN A;  1SL1 B;  1IYH A;  2X4A A;  2V32 A;  3GKM A;  5ECH B;  2TRC P;  1PN9 A;  4YAP A;  4NWY A;  3EU4 A;  1XWC A;  1BG5 A;  2P0G A;  1GUK A;  1UVZ A;  2H6Z A;  2E0Q A;  3EMX A;  1JZD A;  5GSS A;  4MPF A;  4XHM A;  5J41 A;  3GYK A;  3GMF A;  4KB3 A;  2O89 A;  1HYU A;  4D73 A;  4K0G A;  4XIH A;  4JE1 A;  5IMA A;  2LRN A;  5DAL B;  2LJK A;  3F3R A;  1XWB A;  3KXO A;  3UBL A;  5ID2 B;  2X8C A;  1K0M A;  4AJ6 A;  2C0F A;  1U3A A;  3EYT A;  1ZZY A;  2B1K A;  3VK9 A;  3ZRD A;  3IAM 2;  2DJ2 A;  3GTU A;  2N5A A;  2HZE A;  1E6B A;  2FNO A;  3ME8 A;  3LGC A;  1ZMA A;  3TDG A;  3IK9 A;  4ECC A;  3LEF A;  4L5O A;  3GNJ A;  3GX8 A;  2MZC A;  2C0G A;  1XWG A;  3O3T A;  4IP1 A;  1GL8 A;  3APQ A;  2B7J A;  4FIW A;  4FQU A;  1DBY A;  1TU7 A;  2OE3 A;  1OYJ A;  1H75 A;  2XPE A;  3AY8 A;  3N5O A;  1GTA A;  1JHB A;  3I69 A;  3IC4 A;  4ECJ A;  2IFQ B;  2PGT A;  3P7X A;  4TR1 B;  1SD8 A;  2MYG A;  2DKI A;  1QGV A;  4YQU A;  2FUG 2;  3TKS A;  1SK2 A;  1GP1 A;  4A5P A;  1TK8 B;  2GSQ A;  2CVB A;  1ILO A;  1JFU A;  1X9M B;  2FWH A;  4EDY A;  5ECI B;  1SKR B;  2A4V A;  3HJO A;  4CDO A;  3RDW A;  2HXK A;  3GIX A;  2DJ1 A;  3LOR A;  2OAC A;  2AJQ B;  2HZF A;  3TB2 A;  1QMV A;  3C71 A;  4BL7 B;  3VLN A;  1T00 A;  4MJC A;  1PSQ A;  3W6G A;  2F9S A;  2JL4 A;  4HEA 2; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...