2H71A

Crystal structure of thioredoxin mutant d47e in hexagonal (p61) space group
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
107
structure length
107
Chain Sequence
DKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIAEEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Thioredoxin
publication title Crystal Structure of Thioredoxin Mutant D47E in Hexagonal (p61) Space Group
rcsb
source organism Escherichia coli
total genus 33
structure length 107
sequence length 107
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2h71A00
2GQKA 5ECIB 1FB6A 2VLUA 4JE1A 1HNAA 4KA0A 5CRGA 3KH9A 2HSYA 2CV4A 3KTLA 1USBA 4V2NA 3CXGA 1H75A 4KNDA 1EZKA 1GLQA 2WULA 2PMTA 3GH9A 4POMA 1WPIA 2RM6A 2PPTA 2WZ9A 6GSWA 3K8NA 3EU4A 2CX4A 4K7IA 5ID2A 3HYPA 2C8UA 2H1BA 4J2FA 1AIUA 4PQIA 3TUEA 3TJBA 4ZBDA 3TKPA 3I69A 1MD3A 3DRNA 4POLA 3G7JA 1JZOA 1PN9A 5L71A 2YANA 3P2AA 1VF3A 3A2WA 1M7TA 3CSJA 2GSQA 2KP1A 3FRCA 4KE3A 3GTUA 1MDJA 5COHA 3ZL5A 2JSYA 2OACA 5GSSA 3SBCA 1GTBA 1Z3EA 3TKSA 1X5CA 4FO5A 4X43A 3QMXA 1WJKA 3HVSA 2JL4A 1EP8A 22GSA 3CYNA 4AF2A 1GSFA 4QQ7A 2IMIA 1NW2A 4GXZA 1GSQA 4XS6A 4K0NA 2TRXA 1GTUA 2GGTA 3N5OA 4PNGA 3PR8A 3E0UA 4ACSA 1GNWA 3IBHA 1UVZA 2PUKC 2OKAA 2P5RA 2FWGA 2JSZA 4K7OA 2F8FA 4ZIJA 1B4PA 1OAZA 5IMAA 1AXDA 2L59A 1SK0A 2LV3A 1K0OA 4TR3A 4CW9A 4POKA 1E6BA 5CREA 2DIZA 4P3YB 5IQYA 4MF5A 1JZWA 5DCHA 2X8CA 3LSZA 2C0GA 3TKSE 1GLPA 4JR6A 3IXRA 2VD0A 2H71A 2GT6A 4WF4A 5J4UA 2HRNA 4IKHA 3M0FA 3VFIA 4TR4A 1VF4A 1QGVA 2EC4A 4RQXA 3EE2A 5G5FA 2LRCA 2ZCTA 3A2XA 1A0RP 3ZTLA 3IV4A 3ZFBA 2IFQA 5IMFA 1T4YA 1Z6MA 1R26A 2KOKA 5IIZA 3WGEA 4LMVA 3WYWA 1OC9A 3F6DA 4DVCA 4IHUA 1EGOA 1Y6EA 2L6DA 1ERVA 3GNJA 1FVJA 3ZMLA 4V1Ap 6GSXA 4OWYA 4IS0A 1V98A 2L5OA 2VCZA 3P7XA 1KTEA 3W8JA 1GSYA 3IE3A 3LG6A 3APOA 1K0DA 3JCML 9GSSA 3UIWA 1SK1A 4NAXA 3QDNA 2IL3A 3GL5A 2B7JA 3KIJA 1LJRA 1LBKA 2YWNA 3G9BA 3GYKA 3LORA 4YQVA 5HFGA 3ZZXA 4ULXA 4J57E 1K0AA 2N5AA 3ZITA 1RW1A 3ZMKA 4ZL8A 1TOFA 3I43A 1TK5B 1M2DA 1O8XA 2PWJA 2AV4A 1ML6A 3VPTA 1YDKA 5LCZA 5AIVA 18GSA 4IGJA 1F3AA 3LXTA 4HI7A 1WRYA 4AJ7A 4RI6A 2M72A 2QSIA 4V2LA 1YZXA 2VIMA 4MDCA 1EWXA 4F2IA 5KN2A 3GIXA 3ERFA 2CVDA 3GHAA 2MYGA 2VL2C 4HU7A 5JCGA 1BAYA 2JZTA 2VM2A 5A4UA 3HJMA 4O92A 3QD9A 4MCUA 1TRWA 3PINA 4RI7A 4GLTA 5D9VA 1I5GA 5HFKA 1ERTA 3HY2A 5ECKB 2F8AA 4L0UA 5AIXA 3EURA 3KP9A 5G1LA 3FYGA 3L4NA 1GP1A 5F0GA 5ECQB 3MAKA 1A8LA 2IWTA 4BPYA 3Q18A 10GSA 3F3QA 1A0FA 1O7UA 3TDGA 3H4KA 1G7OA 5H5QA 4KDYA 1T8EB 1DUGA 5ELAA 4XIHA 4TOPA 5F05A 3TJGA 4EKZA 2VAFA 4N0VA 2PBJA 2E7PA 3A2VA 3APSA 2FD3A 1ACVA 1KNGA 2C0DA 3BOAA 1EOHA 4AJ8A 1AQXA 2M80A 5AN1A 1K0NA 3GKKA 4HOJA 4TN8A 5EL8A 3DXBA 3ZYWA 4KCAA 3RAZA 3L9UA 3CBUA 4TKYA 2HZEA 2O87A 1K3YA 3GSSA 2DJ2A 3L9VA 4KH7A 3F63A 3M3MA 3TRQA 1GULA 2C0FA 3IAM2 2HFDA 2V32A 3GRXA 3KM6A 1C72A 4HZ4A 3GKMA 3LYPA 4MF6A 2O7KA 1IYIA 2VCVA 3FR3A 5CRWA 2LJAA 2NDOA 1QXHA 1BG5A 5DAKA 1YEPA 2VD1A 2FWEA 3IPZA 3D22A 2MMOA 5IMDA 1YF1A 12GSA 3RPPA 1U6TA 3FK8A 5CYYA 4ISDA 4POBA 4FH8A 4HJ2A 1MD4A 3HVVA 4QL9A 2H66A 3TCOA 2P0GA 2JACA 5G31A 3GFKA 1B8XA 1ZYQB 1UC7A 1K0BA 2P31A 4JR4A 4PURA 4TVEA 1TXXA 2VL9A 3QAGA 2H72A 4ZB9A 2L4QA 1MDIA 1T4ZA 2HE3A 2R6KA 3KD0A 5CO3A 2KUCA 3QAVA 2H73A 2LNTA 2GZPA 1TU7A 3LXZA 4YAPA 2C80A 3TJFA 3HXSA 2VO4A 5CRDA 2LNSA 3TRPA 2I9HA 4N0ZA 1F6MC 1HNCA 2OE1A 1QK8A 1PA3A 4WXTA 1HNBA 2WDUA 5D93A 1SJ6A 5A4VA 3V1WA 2LRTA 5EPFA 2A2RA 2PU9C 1F9MA 4O5RA 1QMVA 4O32A 4WR4A 1FB0A 2YOIA 2C3TA 3ERWA 4LA1A 4EC0A 1XPVA 3A3TA 1B48A 3MNGA 2JZSA 3LQ7A 2R3XA 2AUVA 4MABA 4MPGA 2YWOA 2OBKA 4IP1A 1ZOFA 3ZIVA 3CRUA 5IMVA 3LYKA 1G6YA 2VCTA 2MBSA 1TP9A 1GNEA 1XXUA 4YAVA 1M9BA 4TXOB 5H5RA 1TRUA 3CSIA 3FZAA 7GSSA 5D8IA 4DSSB 1TK8B 2XC2A 2HRFA 2LJRA 3HCZA 4GRFA 3Q19A 5INYA 4ZXGA 1A2LA 1W4VA 5B6NA 20GSA 1T1VA 1Y25A 1Z7RA 1R5AA 1ZL9A 4JZQA 3F6FA 2LS5A 2H6YA 1Q4JA 2O85A 1GUKA 1TKDB 5B8BA 2YCDA 4EVMA 3QOUA 4WETA 1U3AA 5G5EA 3GSTA 1SKRB 4AGSA 3PH9A 4Z7XA 1TW9A 1GUMA 4EF0A 2OJLA 4BVYA 5KN3A 4ZILA 3ZVJD 3KH7A 4N11A 1FO5A 1R4WA 3J7Yk 4KCEA 2VL2A 3LGCA 5ECPB 2DIYA 3H8QA 2LSTA 4NHWA 2VLVA 2XHFA 3O3TA 1SKSB 1K3LA 2FGXA 1HYUA 1KBNA 4L5OA 2H1GA 1KEBA 5ELGA 2YPMA 1GRXA 5ABRA 4J56E 3VWXA 2QC7A 4K8MA 2RIIA 4WEYA 1OC8A 2AHEA 3ZFLA 1ILOA 1PQNA 1AUCA 2NBSA 4IN0A 2B1LA 1PX6A 2YWIA 3F4SA 4KX4A 3VWVA 2K8VA 3GV1A 4KUNA 4F9ZA 4MJBA 5D9TA 1MDKA 5J3RA 1V9WA 2WFCA 1E2YA 3S9FA 2PN8A 2WRTA 4KDUA 2CA8A 2YN1A 2GSTA 2YV9A 3F0IA 1CQGA 1XVWA 1K3OA 4G10A 4ZL7A 1OKDA 3D6IA 1X9MB 1QQ2A 1TRVA 4PGTA 3ZREA 4MJEA 1OC3A 3C73A 1EGRA 4HU9A 4G19A 5DALB 1AW9A 3C71A 4LL4B 5FWGA 4MH2A 2HLSA 2C4JA 1NHYA 5B7CA 5HQPA 2LEGA 2DJ0A 2H70A 1T3BA 2ZNMA 4Q5QA 1I9DA 5LD0A 1O8WA 1NSWA 3GX0A 2DMLA 4ECJA 4MMMA 1YEXA 4KDXA 5B8AA 4GTUA 1GTIA 4MH3A 3VWUA 2GZYA 2H01A 2QKEA 4OMVA 4XHMA 3KGKA 1EV4A 1SU9A 2F3MA 3PGTA 1JLVA 2YV7A 3DVXA 4ZB6A 2FWHA 2GTUA 3QPMA 2C1YA 4I2UA 3DMLA 3BCIA 4HQZA 5J9BA 3UL3A 5FT3A 3DWVA 1XVQA 2C0EA 2B1KA 2FWFA 2V1MA 2CAIA 1EOGA 3UOMA 3GA4A 1GTAA 3H1NA 2CZ3A 3VURA 1R7HA 4MA9A 2NVLA 4DSSA 5GZZB 1YF0A 4E8HA 2DLXA 3QFBC 4PNFA 3KEBA 4K2DA 4MK3A 6GSUA 5LNKe 3NIVA 4CDOA 4FIWA 2I81A 4PQ1A 4EUYA 1UN2A 2K18A 3KMOA 2GQLA 3EU3A 4WBJA 2MZCA 3VK9A 2ZUPA 2VLTA 2CVBA 2Z9SA 1PL1A 5FHIA 2X8GA 1M99A 2WS2A 6GSVA 4JRRA 1OKTA 3EC3A 1X5DA 3WT1A 2ON7A 1O73A 1XZOA 3NOFA 2JADA 2I1UA 1PD21 5GAND 4F0CA 2XPEA 5IMCA 1AQWA 4CHSA 2MBTA 4RQRA 2GLRA 2GSRA 1QUWA 1ABAA 1UA5A 2MMNA 3FKFA 3IDVA 1MEKA 5CNWA 2CT6A 5ECMB 2H0GA 1XW9A 2O8VB 5DVBA 2DJJA 3KMNA 2XBQA 2AJQB 3MDKA 1G7EA 4OFMA 5IPGA 5F8BA 4IQAA 2J23A 2DBCA 1GUHA 3IAS2 4KSOA 1X9WB 4XCSA 4IW9A 3ZLPA 3F4RA 2LUSA 4MF7A 5H5SA 4F82A 3P90A 1M2BA 4PX1A 3FR6A 4GCIA 3SWLA 3RDWA 4K0GA 2HT9A 3IOSA 4MZCA 3VWWA 4TR1B 1Z5YE 5GAPD 2D2ZA 2R37A 4ZB8A 3KXOA 2H0HA 4OO4A 1XCCA 4EE0A 17GSA 3U6VA 2N5FA 2DC5A 4TR0A 1O6JA 4Q5RA 5ECHB 3TB2A 4ECIA 3FZ9A 5DALA 3G7YA 4GQCA 4OFNA 4MZBA 2WJUA 5A4WA 1DE1A 3TOUA 2LKUA 5HR2A 2FUG2 2FNOA 3IC4A 3LEFA 2MMAA 1S3DA 5EY6A 2IMKA 1GSEA 2H6XA 2AYTA 4PUFC 3I6AA 3Q74A 1GH2A 2FA4A 4WKWA 4ID0A 3GX8A 5F06A 3KJYA 1X0RA 4NV5A 1GL8A 4Q5FA 3IRAA 5AGYA 2LJKA 2R4VA 3EYTA 4PQHA 2YWMA 3EMXA 2AB6A 4BL7A 1FOVA 5IM9A 5IPHA 3BD2A 2PVOC 3L9SA 2FLSA 2HXKA 1G6WA 1N2AA 4I6XA 5DJLA 2IN3A 1SL1B 1B4QA 1A2JA 4FYUA 3GKXA 2B5YA 2I3YA 2DJ1A 2GT5A 4NWYA 2F9SA 2H8LA 2IJYA 2N5BA 1WMJA 4IELA 3UJ1A 3KCMA 3L0HA 1X9SB 1FHEA 1F2EA 4X1UA 4I8BA 3HKRA 2H0IA 2OA7A 3TOTA 1A23A 19GSA 5ECOB 2K9FA 2TRCP 2VL3A 3EWLA 1T7PB 1J0FA 1JFUA 5JWRB 3FEUA 2L5LA 2B7KA 4GF0A 4Q5NA 2YZUA 1JHBA 2H6ZA 2YP6A 2H19A 5D9XA 2H74A 5CP1A 1HQOA 1S3AA 5KN1A 1TDIA 2CZ2A 1OE7A 5DJMA 1ERUA 2K6VA 1SJIA 2C3NA 2JU5A 1Z9HA 3LWAA 3VI5A 1NHOA 1WWJA 4I5QA 4GQFA 3LJRA 2BJXA 4GSNA 1V2AA 5ENUA 3ED3A 3N9JA 2YZHA 4I2TA 2RLIA 5KEJA 2HZFA 2HSHA 2CX3A 4ZBAA 5G2ZA 2AAWA 3HJPA 4K7NA 4MP4A 4F0BA 3CTGA 5ECRB 1XFLA 2YJ7A 2F51A 4HQSA 3U5RE 1SL0B 1BYEA 1PKWA 2IMEA 5JWOB 3ERGA 3D5JA 3RHBA 2H30A 3FHKA 4KGIA 3EVIA 4KW6A 2GS3A 2RUFA 1YY7A 1S3CA 4XS4B 3TJKA 2CAQA 2KLXA 3W6GA 1VF1A 3I9V2 5IMZA 3ZRDA 5E4WA 5HR3A 3HJOA 1Z7PA 4MZWA 1IYHA 1J08A 2B5XA 5HFIA 1XIYA 3QCPA 1ERWA 1XWBA 4O7HA 2DMMA 1PKZA 1NM3A 4E8EA 1GSDA 1X5EA 2L57A 3R2QA 2DSAA 1EV9A 4XTSA 3VLNA 4MJCA 5F07A 5J9CA 1SL2B 5DBQA 3UBLA 5KN0A 4EDYA 2LRNA 2X64A 4TRXA 3TGZA 3C1RA 1EP7A 3CSHA 4N30A 1THOA 2OE3A 5CAXA 3OR5A 14GSA 4OCFA 2FY6A 4IP6A 1SD9A 4DSQA 6GSSA 2E2GA 4IJIA 1VF2A 4OO5A 1XWGA 1ZMAA 3GKNA 6GSYA 1DBYA 3CTFA 3D21A 2V6KA 5G1KA 4BWSA 3IHQA 1SJZA 1YKCA 2IPAA 4XS1A 4ML6A 4BVXA 1VGLA 1U87A 4IQ1A 3GMFA 1AQVA 3HZ4A 1XBSA 4HUAA 4L5LA 2P5QA 1OE8A 1PRXA 1V58A 1WP0A 4AJ6A 4L0WA 3UAPA 4GWRA 2EIRA 3O6TA 3O76A 2GVPA 3QAWA 5IOWA 3FZ5A 3HA9A 4FYBA 4X0XA 8GSSA 1F37A 2OE0A 2K8SA 5CRHA 2C3QA 1YKAA 1TJDA 1JLWA 3WT2A 2FCHA 5DQSA 3WD6A 4FYCA 3P8WA 4HEA2 1PL2A 3APQA 2IIYA 5IOXA 1ON4A 3BBYA 5AISA 3KP8A 1THXA 1OYJA 2GSSA 2IMFA 4OFTA 4QL7A 3HDCA 2FHEA 1M9AA 2FA8A 5J41A 4YQMA 1V40A 5JCWA 3VPQA 2GZZA 4JU5A 5D9WA 1LU4A 4OCEA 1W89A 1RQMA 1XWAA 1YQ1A 4YH2A 3IK7A 2VOCA 5JCUA 3J7Yb 2ALBA 1GSUA 1VRSD 1BEDA 4MPFA 2HZEB 11GSA 4BA7A 2X99A 1K0MA 4JBBA 3ME8A 4PXOA 4XS4A 3DVWA 1M2AA 2E2MA 4TXOA 3UARA 3GN3A 1PX7A 5DAKB 2I4AA 2CQ9A 1FAAA 4IVFA 3UVHA 3GURA 3F9UA 4XRDA 1XWKA 2QGVA 1XW5A 1WE0A 3D4MA 1O85A 1T00A 4WF5A 2OBIA 3HD5A 5GSTA 2MMZA 1DSBA 2YNXA 3D0ZA 2L4CA 1G0TA 3D4TA 3FY7A 4BWQA 4LL1B 1PSQA 1URMA 1Z6NA 1XWCA 1JZRA 4D73B 4G9HA 1BQ7A 1K0CA 3MSZA 3IK9A 1OVNA 3C8EA 3HVXA 1PGTA 4EO3A 3AY8A 5C04A 3ZVJA 3UEMA 1SYXA 1WOUA 5ECNB 5EVOA 1AC1A 3ISOA 1A8YA 1EEJA 4NXIA 2HNLA 3BJ5A 2WCIA 3HZ8A 2DJKA 1ZGNA 3C7MA 3M8NA 3ZIJA 16GSA 4ZL9A 4ILFA 4MLYA 4HZ2A 1MTCA 2PVQA 2BMXA 4V1Ag 4K9ZA 2LQOA 2DJ3A 4EL1A 1Q98A 4EDZA 2YJHA 3VI7A 4F03A 1TK0B 2XPDA 4V2MA 2E0QA 2J9HA 1A2MA 2PERA 2NTOA 3M1GA 2KHPA 3GUSA 5IO0A 4IBPA 13GSA 2LQQA 5B6MA 4DSRA 2HYXA 2G2QA 2VM1A 4DEJA 3GL3A 4ECCA 3US3A 5D96A 3TKSC 3H93A 2WGRA 1GWCA 1RK4A 3UVTA 2H1AA 2HI7A 2EIQA 4ML1A 3E9JB 1AAZA 1ZCPA 3DEXA 1F3BA 2A2SA 1TI3A 5JWQB 1SKWB 3M9KA 4PUAA 1EEMA 4I97A 3TRXA 3F3RA 3M9JA 3QR6A 2H76A 1ST9A 4NHZA 4NMUA 4N10A 3C1SA 1H4OA 2JZRA 3IA1A 3BCKA 5A5KA 3ME7A 4XRAA 5DCGA 3DKSA 1TU8A 5ECSA 3DIEA 2B3SA 1SD8A 4HJMA 5ID2B 3W8SA 1DE2A 4WR5A 5ECLB 4NV2A 4LMWA 1O81A 2B6MA 2EIOA 3EINA 1XW6A 3FZ4A 4MJAA 2BTOT 1TTZA 4G2EA 5DQYA 3TKQA 1XOAA 2B5EA 4LLRA 1JZDA 2H1DA 2XBIA 2ON5A 5HR0A 1BX9A 4IJ3A 5IO2A 1FG4A 3GTUB 3F8UA 4YQUA 1FVKA 2PGTA 4L8EA 1HD2A 3IR4A 1PMTA 2O89A 3FW2A 5G30A 3HHVA 2KP2A 1BJXA 3F4TA 4JEDA 3Q6OA 1TI1A 5J5NA 1B9XC 2L6CA 3RHCA 5HR1A 3GH6A 2R5GA 3RPNA 1SENA 4KSMA 3DYRA 6GSTA 3FR9A 5DDLA 2M46A 2V41A 3KTBA 1ZZYA 4ZBBA 3QFAC 1SK2A 4H86A 2X8HA 2IMDA 5E59A 2NPBA 1U88A 3DD3A 4D73A 4OD7A 4RUVA 3H79A 1YJ6A 2GDRA 2R2JA 4K1FA 1A24A 1U3IA 4HS1A 2A4VA 2GQMA 3CRTA 3EMPA 1WIKA 1ZYEA 3L78A 3WGXA 1B9YC 1SYRA 4GSSA 2RUEA 1FW1A 2ES7A 2VUPA 1GSSA 3G7IA 2CVKA 4KB3A 1R5PA 2VCQA 2V2GA 3E3EA 1M0UA 3UBKA 4HDEA 4KAEA 4K6XA 4TW5A 3A5WA 2LTKA 3DGQA 4EXJA 3MWHA 2TIRA 1V57A 4TR1A 2VCXA 2WB9A 5C00A 2G0FA 1CQHA 4ECBA 2IFQB 1N8JA 3TJJA 2RM5A 3KZQA 1QFNA 3UMAA 3RBTA 4WBRD 3WGDA 1OC9B 4GSTA 2REMA 2VCWA 1TRSA 2V6OA 2H75A 3CMIA 4TXVA 1XOBA 5D73A 1J9BA 3TKRA 4NPBA 3LFLA 3NZNA 2OADA
chains in the Genus database with same CATH superfamily
2GQKA 5ECIB 2R0PA 1FB6A 2VLUA 4JE1A 1HNAA 4KA0A 4G0IA 5CRGA 3KH9A 2HSYA 2CV4A 3KTLA 1USBA 4V2NA 3CXGA 1H75A 4KNDA 1EZKA 1GLQA 2WULA 2PMTA 3GH9A 4POMA 1WPIA 2RM6A 2PPTA 2WZ9A 6GSWA 3K8NA 3EU4A 2CX4A 4K7IA 3CQFA 5ID2A 3HYPA 2C8UA 2H1BA 4J2FA 1AIUA 4PQIA 3TUEA 3TJBA 4ZBDA 3TKPA 3I69A 1MD3A 3DRNA 4POLA 3G7JA 1JZOA 1PN9A 5L71A 2YANA 3P2AA 1VF3A 5BRTA 3A2WA 1M7TA 3CSJA 2GSQA 2KP1A 3FRCA 4KE3A 3GTUA 1MDJA 5COHA 3ZL5A 2JSYA 2OACA 5GSSA 3SBCA 1GTBA 1Z3EA 3TKSA 1X5CA 4FO5A 4X43A 3QMXA 1WJKA 3HVSA 2JL4A 1EP8A 22GSA 3CYNA 4AF2A 1GSFA 4QQ7A 2IMIA 2X49A 1NW2A 4GXZA 1GSQA 4XS6A 4K0NA 2TRXA 1GTUA 2GGTA 3N5OA 4PNGA 3PR8A 3E0UA 4ACSA 1GNWA 3IBHA 1UVZA 2PUKC 4Z2UA 2OKAA 2P5RA 2FWGA 2JSZA 4K7OA 2F8FA 4ZIJA 1B4PA 1OAZA 5IMAA 1AXDA 2L59A 1SK0A 2LV3A 1K0OA 4TR3A 4CW9A 4POKA 1E6BA 5CREA 2DIZA 4P3YB 5IQYA 4MF5A 1JZWA 5DCHA 2X8CA 3LSZA 2C0GA 3TKSE 1GLPA 4JR6A 1PFOA 3IXRA 2VD0A 2H71A 2GT6A 4WF4A 5J4UA 2HRNA 4IKHA 3M0FA 3VFIA 4TR4A 1VF4A 1QGVA 2EC4A 4RQXA 3EE2A 5G5FA 2R0CA 2LRCA 2ZCTA 3A2XA 1A0RP 3ZTLA 3IV4A 3ZFBA 2IFQA 5IMFA 1T4YA 1Z6MA 1R26A 2KOKA 5IIZA 3WGEA 4LMVA 3WYWA 1OC9A 3F6DA 4DVCA 4IHUA 1EGOA 1Y6EA 2L6DA 1ERVA 3GNJA 1FVJA 3ZMLA 4V1Ap 6GSXA 4OWYA 4IS0A 4O5UA 1V98A 2L5OA 2VCZA 3P7XA 1KTEA 3W8JA 1GSYA 3IE3A 3LG6A 3APOA 1K0DA 3JCML 9GSSA 3UIWA 1SK1A 4NAXA 3QDNA 2IL3A 3GL5A 2B7JA 3KIJA 1LJRA 1LBKA 2YWNA 3G9BA 3GYKA 3LORA 4YQVA 5HFGA 3ZZXA 4ULXA 4J57E 1K0AA 2N5AA 3ZITA 1RW1A 3ZMKA 4ZL8A 1TOFA 3I43A 1TK5B 1M2DA 1O8XA 2PWJA 2AV4A 1ML6A 4KF9A 3VPTA 1YDKA 5LCZA 5AIVA 18GSA 4IGJA 1F3AA 3LXTA 4HI7A 1WRYA 4AJ7A 4RI6A 2M72A 2QSIA 4V2LA 1YZXA 2VIMA 4MDCA 1EWXA 4F2IA 5KN2A 3GIXA 3ERFA 2CVDA 3GHAA 2MYGA 2VL2C 4HU7A 5JCGA 1BAYA 2JZTA 2VM2A 5A4UA 3HJMA 4O92A 3QD9A 4MCUA 1TRWA 3PINA 4RI7A 4GLTA 5D9VA 1I5GA 5HFKA 1ERTA 3HY2A 5ECKB 2F8AA 4L0UA 5AIXA 3EURA 3KP9A 5G1LA 3A5IA 3FYGA 3L4NA 1GP1A 5F0GA 5ECQB 4YKFA 1XG8A 3MAKA 1A8LA 2IWTA 4BPYA 3Q18A 10GSA 3F3QA 1A0FA 1O7UA 3TDGA 3H4KA 1G7OA 5H5QA 4KDYA 1T8EB 1DUGA 5ELAA 4XIHA 4TOPA 5F05A 3TJGA 4EKZA 2VAFA 4N0VA 2PBJA 2E7PA 3A2VA 3APSA 2FD3A 1ACVA 1KNGA 2C0DA 3BOAA 1EOHA 4AJ8A 1AQXA 2M80A 5AN1A 1K0NA 3GKKA 4HOJA 4TN8A 5EL8A 3DXBA 3ZYWA 4KCAA 3RAZA 2A2PA 3L9UA 3CBUA 4TKYA 2HZEA 2O87A 1K3YA 3GSSA 2DJ2A 3L9VA 4KH7A 3F63A 3M3MA 3TRQA 1GULA 2C0FA 3IAM2 2HFDA 2V32A 3GRXA 3KM6A 1C72A 4HZ4A 3GKMA 3LYPA 4MF6A 2O7KA 1IYIA 2VCVA 3FR3A 5CRWA 2LJAA 2NDOA 1QXHA 1BG5A 5DAKA 1YEPA 2VD1A 2FWEA 3IPZA 3D22A 2MMOA 5IMDA 1YF1A 4BVXB 12GSA 3RPPA 1U6TA 3FK8A 5CYYA 4ISDA 4POBA 4FH8A 5BMUA 4HJ2A 1MD4A 3HVVA 4QL9A 2H66A 3TCOA 2P0GA 2JACA 5G31A 3GFKA 1B8XA 1ZYQB 1UC7A 1K0BA 2P31A 4JR4A 4PURA 4TVEA 1TXXA 2VL9A 3QAGA 2H72A 4ZB9A 2L4QA 1MDIA 1T4ZA 2HE3A 2R6KA 3KD0A 5CO3A 2KUCA 3QAVA 2H73A 2LNTA 2GZPA 1TU7A 3LXZA 4YAPA 2C80A 3TJFA 3HXSA 2VO4A 5CRDA 2LNSA 3TRPA 2I9HA 3R3EA 4N0ZA 1F6MC 1HNCA 2OE1A 1QK8A 1PA3A 4WXTA 1HNBA 2WDUA 5D93A 1SJ6A 5A4VA 3V1WA 2LRTA 5EPFA 2A2RA 2PU9C 1F9MA 4O5RA 1QMVA 4O32A 4WR4A 1FB0A 2YOIA 2C3TA 3ERWA 2DKIA 4LA1A 4EC0A 1XPVA 3A3TA 1B48A 3MNGA 2JZSA 3LQ7A 2R3XA 2AUVA 4MABA 4MPGA 2YWOA 2OBKA 4IP1A 1ZOFA 3ZIVA 3CRUA 5IMVA 3LYKA 1G6YA 2VCTA 2MBSA 1TP9A 1GNEA 1XXUA 4YAVA 1M9BA 4TXOB 5H5RA 1TRUA 3CSIA 3FZAA 7GSSA 5D8IA 4FQUA 4DSSB 2HRKA 1TK8B 2XC2A 2HRFA 2LJRA 3HCZA 4GRFA 3Q19A 4Z2TA 5INYA 4ZXGA 1A2LA 1W4VA 5B6NA 20GSA 1T1VA 1Y25A 1Z7RA 1R5AA 1ZL9A 4JZQA 3F6FA 2LS5A 2H6YA 1Q4JA 2O85A 1GUKA 1TKDB 5B8BA 2YCDA 4EVMA 3QOUA 4WETA 1U3AA 5G5EA 3GSTA 1SKRB 4AGSA 3PH9A 4Z7XA 1TW9A 1GUMA 4EF0A 2OJLA 4BVYA 5KN3A 4ZILA 4BIKA 3ZVJD 3KH7A 4N11A 1FO5A 1R4WA 3J7Yk 4KCEA 2VL2A 3LGCA 5ECPB 2DIYA 3H8QA 2LSTA 4NHWA 2VLVA 2XHFA 3O3TA 1SKSB 1K3LA 2FGXA 1HYUA 1KBNA 4L5OA 2H1GA 1KEBA 5ELGA 2YPMA 1GRXA 5ABRA 4ICYA 4J56E 3VWXA 2QC7A 4K8MA 2RIIA 4WEYA 1OC8A 2AHEA 3ZFLA 1ILOA 1PQNA 1AUCA 2NBSA 4IN0A 2B1LA 1PX6A 2YWIA 3F4SA 4KX4A 3VWVA 2K8VA 3GV1A 4KUNA 4F9ZA 3IHGA 4MJBA 5D9TA 1MDKA 5J3RA 1V9WA 2WFCA 1E2YA 3S9FA 2PN8A 2WRTA 4KDUA 2CA8A 2YN1A 2GSTA 2YV9A 3F0IA 1CQGA 1XVWA 4CY6A 1K3OA 4G10A 4A5PA 1OKDA 4ZL7A 3D6IA 1X9MB 1QQ2A 1TRVA 4PGTA 3ZREA 4MJEA 1OC3A 3C73A 1EGRA 4HU9A 4G19A 5DALB 1AW9A 3C71A 2DKHA 4LL4B 5FWGA 5KOXA 4MH2A 2HLSA 2C4JA 1NHYA 5B7CA 5HQPA 2LEGA 2DJ0A 2H70A 1T3BA 2ZNMA 4Q5QA 1I9DA 5LD0A 1O8WA 1NSWA 3GX0A 2DMLA 4ECJA 4MMMA 1YEXA 4KDXA 5B8AA 4GTUA 1GTIA 4MH3A 3VWUA 2GZYA 2H01A 3EPTA 2QKEA 4OMVA 4XHMA 3KGKA 1M3IA 1EV4A 1SU9A 2F3MA 3PGTA 1JLVA 2YV7A 3DVXA 4ZB6A 4BL7B 2FWHA 2GTUA 3QPMA 2C1YA 4I2UA 3DMLA 3BCIA 4HQZA 5J9BA 3UL3A 5FT3A 3DWVA 1XVQA 2C0EA 4K2XA 2B1KA 2FWFA 1ZYNA 2V1MA 2CAIA 1EOGA 3UOMA 3GA4A 1GTAA 2A4HA 3H1NA 2CZ3A 3VURA 1R7HA 4MA9A 2NVLA 4DSSA 5GZZB 1YF0A 4E8HA 2DLXA 3QFBC 4PNFA 3KEBA 4K2DA 4MK3A 6GSUA 5LNKe 3NIVA 4CDOA 4FIWA 2I81A 4PQ1A 4EUYA 1UN2A 2K18A 3KMOA 2GQLA 3EU3A 4WBJA 2MZCA 3VK9A 2ZUPA 2VLTA 2CVBA 2Z9SA 1PL1A 5FHIA 2X8GA 1M99A 2WS2A 6GSVA 4JRRA 1OKTA 3EC3A 1X5DA 3WT1A 2ON7A 1O73A 1XZOA 3NOFA 2JADA 2I1UA 1PD21 5GAND 4F0CA 2XPEA 5IMCA 1AQWA 4CHSA 2MBTA 4RQRA 2GLRA 2GSRA 1QUWA 1ABAA 1UA5A 2MMNA 3FKFA 3IDVA 1MEKA 5CNWA 2CT6A 5ECMB 2H0GA 1XW9A 2X4AA 2O8VB 5DVBA 2DJJA 3KMNA 2XBQA 2AJQB 3MDKA 1G7EA 4OFMA 5IPGA 5F8BA 4IQAA 2J23A 2DBCA 1GUHA 3IAS2 4KSOA 1X9WB 4XCSA 4IW9A 3ZLPA 3F4RA 4PTSA 2LUSA 4MF7A 5H5SA 4F82A 3P90A 1M2BA 4PX1A 3FR6A 4GCIA 3SWLA 3RDWA 4K0GA 2HT9A 3IOSA 4MZCA 3VWWA 4TR1B 1Z5YE 5GAPD 2D2ZA 2R37A 4ZB8A 3KXOA 2H0HA 4OO4A 1XCCA 4EE0A 17GSA 3U6VA 2N5FA 2DC5A 4TR0A 1O6JA 4Q5RA 5ECHB 3TB2A 4ECIA 3FZ9A 5DALA 3G7YA 4GQCA 4OFNA 4MZBA 2WJUA 5A4WA 1DE1A 3TOUA 2LKUA 4USSA 5HR2A 2FUG2 2FNOA 3IC4A 3LEFA 2MMAA 1S3DA 5EY6A 2IMKA 4K5SA 1GSEA 2H6XA 2AYTA 4PUFC 3I6AA 3Q74A 1GH2A 2FA4A 4WKWA 4ID0A 3GX8A 5F06A 3KJYA 1X0RA 4NV5A 1GL8A 4EIPA 4Q5FA 3IRAA 5AGYA 2LJKA 2R4VA 3EYTA 4PQHA 2YWMA 3EMXA 2AB6A 4BL7A 1FOVA 5IM9A 5IPHA 3BD2A 2PVOC 3L9SA 2FLSA 2HXKA 1G6WA 1N2AA 4I6XA 5DJLA 2IN3A 1SL1B 1B4QA 1A2JA 4FYUA 3GKXA 2B5YA 2I3YA 2DJ1A 2GT5A 4NWYA 2F9SA 2H8LA 2IJYA 2N5BA 1WMJA 4IELA 3UJ1A 3KCMA 3L0HA 1X9SB 1FHEA 1F2EA 4X1UA 4MNNA 3MYDA 4I8BA 3HKRA 2H0IA 2OA7A 3TOTA 1A23A 19GSA 5ECOB 2K9FA 2TRCP 2VL3A 3EWLA 1T7PB 1J0FA 1JFUA 5JWRB 3FEUA 2L5LA 3FMWA 4YKGA 2B7KA 4GF0A 4Q5NA 2YZUA 1JHBA 2H6ZA 2YP6A 2H19A 5D9XA 2H74A 5CP1A 2UZ8A 1HQOA 1S3AA 5KN1A 1TDIA 2CZ2A 1OE7A 5DJMA 1ERUA 2K6VA 1SJIA 2C3NA 2JU5A 1Z9HA 1PN0A 3LWAA 3VI5A 1NHOA 1WWJA 4I5QA 4GQFA 3LJRA 2BJXA 4GSNA 1V2AA 5ENUA 3ED3A 3N9JA 2YZHA 4I2TA 2RLIA 5KEJA 2HZFA 2HSHA 2CX3A 4ZBAA 5G2ZA 2AAWA 3HJPA 4K7NA 4MP4A 4F0BA 3CTGA 5ECRB 1XFLA 2YJ7A 2F51A 4HQSA 3U5RE 1SL0B 1BYEA 1PKWA 2IMEA 5JWOB 3ERGA 3D5JA 3RHBA 2H30A 3FHKA 4KGIA 3EVIA 4KW6A 2GS3A 2RUFA 1YY7A 1S3CA 4XS4B 3IC8A 3TJKA 2CAQA 2KLXA 3W6GA 1VF1A 3I9V2 5IMZA 3ZRDA 5E4WA 5HR3A 3HJOA 1Z7PA 4MZWA 1IYHA 1J08A 2B5XA 5HFIA 1XIYA 3QCPA 1ERWA 1XWBA 4O7HA 2DMMA 1PKZA 1NM3A 4E8EA 1GSDA 1X5EA 2L57A 3R2QA 2DSAA 1EV9A 4XTSA 3VLNA 4MJCA 5F07A 5J9CA 1SL2B 5DBQA 3UBLA 5KN0A 4EDYA 2LRNA 2X64A 4TRXA 3TGZA 3C1RA 1EP7A 3CSHA 5KOWA 4N30A 1THOA 2OE3A 4Z2RA 5CAXA 3OR5A 14GSA 4OCFA 2FY6A 4IP6A 1ZYPA 1SD9A 4DSQA 6GSSA 2E2GA 4IJIA 1VF2A 4OO5A 3MIXA 1XWGA 1ZMAA 3GKNA 6GSYA 1DBYA 3CTFA 3D21A 2V6KA 5G1KA 4BWSA 3IHQA 1SJZA 1YKCA 2IPAA 4XS1A 4ML6A 4BVXA 1VGLA 1U87A 4IQ1A 3GMFA 1AQVA 1FOHA 3HZ4A 1XBSA 4HUAA 2QA2A 4L5LA 2P5QA 1OE8A 1PRXA 1V58A 1WP0A 4AJ6A 4L0WA 3UAPA 4GWRA 2EIRA 3O6TA 3O76A 2GVPA 3QAWA 5IOWA 3FZ5A 3HA9A 4FYBA 4X0XA 8GSSA 1F37A 2OE0A 2K8SA 5CRHA 2C3QA 1YKAA 1TJDA 1JLWA 3WT2A 2FCHA 5DQSA 3WD6A 4FYCA 3LW9A 3P8WA 4HEA2 1PL2A 3APQA 2IIYA 5IOXA 1ON4A 3BBYA 5AISA 3KP8A 1THXA 2HRAA 1OYJA 2GSSA 2IMFA 4OFTA 4QL7A 3HDCA 2FHEA 1M9AA 2FA8A 5J41A 4YQMA 1V40A 5JCWA 3VPQA 2GZZA 4JU5A 5D9WA 1LU4A 4OCEA 4CY8A 1W89A 1RQMA 1XWAA 1YQ1A 4YH2A 3IK7A 2R0GA 2VOCA 5JCUA 3J7Yb 2ALBA 1GSUA 1VRSD 1BEDA 4MPFA 2HZEB 11GSA 4BA7A 2X99A 1K0MA 4JBBA 3ME8A 4PXOA 4XS4A 3DVWA 1M2AA 2E2MA 1S3RA 4TXOA 3UARA 3GN3A 1PX7A 5DAKB 2I4AA 2CQ9A 1FAAA 4IVFA 3UVHA 3GURA 3F9UA 4XRDA 1XWKA 2QGVA 1XW5A 1WE0A 3D4MA 1O85A 1T00A 4WF5A 2OBIA 3HD5A 5GSTA 2MMZA 1DSBA 2YNXA 3D0ZA 2L4CA 1M3JA 1G0TA 3D4TA 3FY7A 4BWQA 4LL1B 1PSQA 1URMA 1Z6NA 1XWCA 1JZRA 4D73B 4G9HA 4K5RA 1BQ7A 1K0CA 3MSZA 3IK9A 4G0KA 1OVNA 3C8EA 3HVXA 1PGTA 4EO3A 3AY8A 5C04A 3ZVJA 3UEMA 1SYXA 1WOUA 5ECNB 3HVNA 5EVOA 1AC1A 3ISOA 1A8YA 1EEJA 4NXIA 2HNLA 3BJ5A 2WCIA 3HZ8A 2DJKA 1ZGNA 3C7MA 3M8NA 3ZIJA 16GSA 4ZL9A 4ILFA 4MLYA 4HZ2A 1MTCA 2PVQA 2BMXA 4V1Ag 4K9ZA 3PPUA 2LQOA 2DJ3A 4EL1A 1Q98A 4EDZA 2YJHA 3VI7A 4F03A 1TK0B 2XPDA 4V2MA 2E0QA 2J9HA 1A2MA 2PERA 2NTOA 3M1GA 2KHPA 3GUSA 4HSCX 5IO0A 4IBPA 13GSA 2LQQA 5B6MA 4DSRA 2HYXA 2G2QA 2VM1A 4DEJA 3GL3A 4ECCA 3US3A 5D96A 3TKSC 3H93A 2WGRA 1GWCA 1RK4A 3UVTA 2H1AA 2HI7A 2EIQA 4ML1A 3E9JB 1AAZA 1ZCPA 3DEXA 1F3BA 2A2SA 1TI3A 5JWQB 1SKWB 3M9KA 2QA1A 4PUAA 1EEMA 4I97A 4X4JA 3TRXA 3F3RA 2HSMA 3M9JA 3QR6A 2H76A 1ST9A 4NHZA 4NMUA 4N10A 3C1SA 1H4OA 2JZRA 3IA1A 3BCKA 5A5KA 3ME7A 4XRAA 5DCGA 3DKSA 1TU8A 5ECSA 3DIEA 2B3SA 1SD8A 4HJMA 5ID2B 3W8SA 1DE2A 4WR5A 5ECLB 4NV2A 4LMWA 1O81A 2B6MA 2EIOA 3EINA 1XW6A 3FZ4A 4MJAA 2BTOT 1TTZA 4G2EA 4BVYB 5DQYA 3TKQA 1XOAA 2B5EA 4LLRA 1JZDA 2H1DA 2XBIA 2ON5A 5HR0A 1BX9A 4IJ3A 5IO2A 1FG4A 3GTUB 3F8UA 4YQUA 1FVKA 2PGTA 4L8EA 1HD2A 3IR4A 1PMTA 2O89A 3FW2A 5G30A 3HHVA 2KP2A 1BJXA 3F4TA 4JEDA 3Q6OA 1TI1A 5J5NA 1B9XC 2L6CA 3RHCA 5HR1A 3GH6A 2R5GA 3RPNA 1SENA 4KSMA 3DYRA 6GSTA 3FR9A 5DDLA 2M46A 2V41A 3KTBA 1ZZYA 4ZBBA 3QFAC 4EIQA 1SK2A 4H86A 2X8HA 2IMDA 5E59A 2NPBA 1U88A 3DD3A 4D73A 4OD7A 4RUVA 3H79A 1YJ6A 2GDRA 2R2JA 4K1FA 1A24A 1U3IA 4HS1A 2A4VA 2GQMA 3CRTA 3EMPA 1WIKA 1ZYEA 3L78A 3WGXA 1B9YC 1SYRA 4GSSA 2RUEA 1FW1A 2ES7A 2VUPA 1GSSA 3G7IA 2CVKA 4KB3A 1R5PA 2VCQA 2V2GA 3E3EA 4O5QA 1M0UA 3UBKA 4HDEA 4KAEA 4K6XA 4TW5A 3A5WA 2LTKA 3DGQA 4EXJA 3MWHA 2TIRA 1V57A 4TR1A 2VCXA 2WB9A 5C00A 2G0FA 1CQHA 4ECBA 2IFQB 1N8JA 3TJJA 2RM5A 3KZQA 1QFNA 3UMAA 3RBTA 4G0LA 4WBRD 3WGDA 1OC9B 4GSTA 2REMA 2VCWA 1TRSA 2V6OA 2H75A 3CMIA 4TXVA 1XOBA 5D73A 1J9BA 3TKRA 4NPBA 3LFLA 3NZNA 2OADA
chains in the Genus database with same CATH topology
2GQKA 5ECIB 2R0PA 1FB6A 2VLUA 4JE1A 1HNAA 4KA0A 4G0IA 5CRGA 3KH9A 2HSYA 2CV4A 3KTLA 1USBA 4V2NA 3CXGA 1H75A 4KNDA 1EZKA 1GLQA 2WULA 2PMTA 3GH9A 4POMA 1WPIA 2RM6A 2PPTA 2WZ9A 6GSWA 3K8NA 3EU4A 2CX4A 4K7IA 5ID2A 3HYPA 2C8UA 2H1BA 4J2FA 1AIUA 4PQIA 3TUEA 3TJBA 4ZBDA 3TKPA 3I69A 1MD3A 3DRNA 4POLA 3G7JA 1JZOA 1PN9A 5L71A 2YANA 3P2AA 1VF3A 5BRTA 3A2WA 1M7TA 3CSJA 2GSQA 2KP1A 3FRCA 4KE3A 3GTUA 1MDJA 5COHA 3ZL5A 2JSYA 2OACA 5GSSA 3SBCA 1GTBA 1Z3EA 3TKSA 1X5CA 4FO5A 4X43A 3QMXA 1WJKA 3HVSA 2JL4A 1EP8A 22GSA 3CYNA 4AF2A 1GSFA 4QQ7A 2IMIA 2X49A 1NW2A 4GXZA 1GSQA 4XS6A 4K0NA 2TRXA 1GTUA 2GGTA 3N5OA 4PNGA 3PR8A 3E0UA 4ACSA 1GNWA 3IBHA 1UVZA 2PUKC 4Z2UA 2OKAA 2P5RA 2FWGA 2JSZA 4K7OA 2F8FA 4ZIJA 1B4PA 1OAZA 5IMAA 1AXDA 2L59A 1SK0A 2LV3A 1K0OA 4TR3A 4CW9A 4POKA 1E6BA 5CREA 2DIZA 4P3YB 5IQYA 4MF5A 1JZWA 5DCHA 2X8CA 3LSZA 2C0GA 3TKSE 1GLPA 4JR6A 3IXRA 2VD0A 2H71A 2GT6A 4WF4A 5J4UA 2HRNA 4IKHA 3M0FA 3VFIA 4TR4A 1VF4A 1QGVA 2EC4A 4RQXA 3EE2A 5G5FA 2R0CA 2LRCA 2ZCTA 3A2XA 1A0RP 3ZTLA 3IV4A 3ZFBA 2IFQA 5IMFA 1T4YA 1Z6MA 1R26A 2KOKA 5IIZA 3WGEA 4LMVA 3WYWA 1OC9A 3F6DA 4DVCA 4IHUA 1EGOA 1Y6EA 2L6DA 1ERVA 3GNJA 1FVJA 3ZMLA 4V1Ap 6GSXA 4OWYA 4IS0A 4O5UA 1V98A 2L5OA 2VCZA 3P7XA 1KTEA 3W8JA 1GSYA 3IE3A 3LG6A 3APOA 1K0DA 3JCML 9GSSA 3UIWA 1SK1A 4NAXA 3QDNA 2IL3A 3GL5A 2B7JA 3KIJA 1LJRA 1LBKA 2YWNA 3G9BA 3GYKA 3LORA 4YQVA 5HFGA 3ZZXA 4ULXA 4J57E 1K0AA 2N5AA 3ZITA 1RW1A 3ZMKA 4ZL8A 1TOFA 3I43A 1TK5B 1M2DA 1O8XA 2PWJA 2AV4A 1ML6A 4KF9A 3VPTA 1YDKA 5LCZA 5AIVA 18GSA 4IGJA 1F3AA 3LXTA 4HI7A 1WRYA 4AJ7A 4RI6A 2M72A 2QSIA 4V2LA 1YZXA 2VIMA 4MDCA 1EWXA 4F2IA 5KN2A 3GIXA 3ERFA 2CVDA 3GHAA 2MYGA 2VL2C 4HU7A 5JCGA 1BAYA 2JZTA 2VM2A 5A4UA 3HJMA 4O92A 3QD9A 4MCUA 1TRWA 3PINA 4RI7A 4GLTA 5D9VA 1I5GA 5HFKA 1ERTA 3HY2A 5ECKB 2F8AA 4L0UA 5AIXA 3EURA 3KP9A 5G1LA 3A5IA 3FYGA 3L4NA 1GP1A 5F0GA 5ECQB 4YKFA 3MAKA 1A8LA 2IWTA 4BPYA 3Q18A 10GSA 3F3QA 1A0FA 1O7UA 3TDGA 3H4KA 1G7OA 5H5QA 4KDYA 1T8EB 1DUGA 5ELAA 4XIHA 4TOPA 5F05A 3TJGA 4EKZA 2VAFA 4N0VA 2PBJA 2E7PA 3A2VA 3APSA 2FD3A 1ACVA 1KNGA 2C0DA 3BOAA 1EOHA 4AJ8A 1AQXA 2M80A 5AN1A 1K0NA 3GKKA 4HOJA 4TN8A 5EL8A 3DXBA 3ZYWA 4KCAA 3RAZA 2A2PA 3L9UA 3CBUA 4TKYA 2HZEA 2O87A 1K3YA 3GSSA 2DJ2A 3L9VA 4KH7A 3F63A 3M3MA 3TRQA 1GULA 2C0FA 3IAM2 2HFDA 2V32A 3GRXA 3KM6A 1C72A 4HZ4A 3GKMA 3LYPA 4MF6A 2O7KA 1IYIA 2VCVA 3FR3A 5CRWA 2LJAA 2NDOA 1QXHA 1BG5A 5DAKA 1YEPA 2VD1A 2FWEA 3IPZA 3D22A 2MMOA 5IMDA 1YF1A 4BVXB 12GSA 3RPPA 1U6TA 3FK8A 5CYYA 4ISDA 4POBA 4FH8A 5BMUA 4HJ2A 1MD4A 3HVVA 4QL9A 2H66A 3TCOA 2P0GA 2JACA 5G31A 3GFKA 1B8XA 1ZYQB 1UC7A 1K0BA 2P31A 4JR4A 4PURA 4TVEA 1TXXA 2VL9A 3QAGA 2H72A 4ZB9A 2L4QA 1MDIA 1T4ZA 2HE3A 2R6KA 3KD0A 5CO3A 2KUCA 3QAVA 2H73A 2LNTA 2GZPA 1TU7A 3LXZA 4YAPA 2C80A 3TJFA 3HXSA 2VO4A 5CRDA 2LNSA 3TRPA 2I9HA 3R3EA 4N0ZA 1F6MC 1HNCA 2OE1A 1QK8A 1PA3A 4WXTA 1HNBA 2WDUA 5D93A 1SJ6A 5A4VA 3V1WA 2LRTA 5EPFA 2A2RA 2PU9C 1F9MA 4O5RA 1QMVA 4O32A 4WR4A 1FB0A 2YOIA 2C3TA 3ERWA 2DKIA 4LA1A 4EC0A 1XPVA 3A3TA 1B48A 3MNGA 2JZSA 3LQ7A 2R3XA 2AUVA 4MABA 4MPGA 2YWOA 2OBKA 4IP1A 1ZOFA 3ZIVA 3CRUA 5IMVA 3LYKA 1G6YA 2VCTA 2MBSA 1TP9A 1GNEA 1XXUA 4YAVA 1M9BA 4TXOB 5H5RA 1TRUA 3CSIA 3FZAA 7GSSA 5D8IA 4FQUA 4DSSB 2HRKA 1TK8B 2XC2A 2HRFA 2LJRA 3HCZA 4GRFA 3Q19A 4Z2TA 5INYA 4ZXGA 1A2LA 1W4VA 5B6NA 20GSA 1T1VA 1Y25A 1Z7RA 1R5AA 1ZL9A 4JZQA 3F6FA 2LS5A 2H6YA 1Q4JA 2O85A 1GUKA 1TKDB 5B8BA 2YCDA 4EVMA 3QOUA 4WETA 1U3AA 5G5EA 3GSTA 1SKRB 4AGSA 3PH9A 4Z7XA 1TW9A 1GUMA 4EF0A 2OJLA 4BVYA 5KN3A 4ZILA 3ZVJD 3KH7A 4N11A 1FO5A 1R4WA 3J7Yk 4KCEA 2VL2A 3LGCA 5ECPB 2DIYA 3H8QA 2LSTA 4NHWA 2VLVA 2XHFA 3O3TA 1SKSB 1K3LA 2FGXA 1HYUA 1KBNA 4L5OA 2H1GA 1KEBA 5ELGA 2YPMA 1GRXA 5ABRA 4ICYA 4J56E 3VWXA 2QC7A 4K8MA 2RIIA 4WEYA 1OC8A 2AHEA 3ZFLA 1ILOA 1PQNA 1AUCA 2NBSA 4IN0A 2B1LA 1PX6A 2YWIA 3F4SA 4KX4A 3VWVA 2K8VA 3GV1A 4KUNA 4F9ZA 3IHGA 4MJBA 5D9TA 1MDKA 5J3RA 1V9WA 2WFCA 1E2YA 3S9FA 2PN8A 2WRTA 4KDUA 2CA8A 2YN1A 2GSTA 2YV9A 3F0IA 1CQGA 1XVWA 4CY6A 1K3OA 4G10A 4A5PA 1OKDA 4ZL7A 3D6IA 1X9MB 1QQ2A 1TRVA 4PGTA 3ZREA 4MJEA 1OC3A 3C73A 1EGRA 4HU9A 4G19A 5DALB 1AW9A 3C71A 2DKHA 4LL4B 5FWGA 5KOXA 4MH2A 2HLSA 2C4JA 1NHYA 5B7CA 5HQPA 2LEGA 2DJ0A 2H70A 1T3BA 2ZNMA 4Q5QA 1I9DA 5LD0A 1O8WA 1NSWA 3GX0A 2DMLA 4ECJA 4MMMA 1YEXA 4KDXA 5B8AA 4GTUA 1GTIA 4MH3A 3VWUA 2GZYA 2H01A 3EPTA 2QKEA 4OMVA 4XHMA 3KGKA 1EV4A 1SU9A 2F3MA 3PGTA 1JLVA 2YV7A 3DVXA 4ZB6A 4BL7B 2FWHA 2GTUA 3QPMA 2C1YA 4I2UA 3DMLA 3BCIA 4HQZA 5J9BA 3UL3A 5FT3A 3DWVA 1XVQA 2C0EA 4K2XA 2B1KA 2FWFA 1ZYNA 2V1MA 2CAIA 1EOGA 3UOMA 3GA4A 1GTAA 2A4HA 3H1NA 2CZ3A 3VURA 1R7HA 4MA9A 2NVLA 4DSSA 5GZZB 1YF0A 4E8HA 2DLXA 3QFBC 4PNFA 3KEBA 4K2DA 4MK3A 6GSUA 5LNKe 3NIVA 4CDOA 4FIWA 2I81A 4PQ1A 4EUYA 1UN2A 2K18A 3KMOA 2GQLA 3EU3A 4WBJA 2MZCA 3VK9A 2ZUPA 2VLTA 2CVBA 2Z9SA 1PL1A 5FHIA 2X8GA 1M99A 2WS2A 6GSVA 4JRRA 1OKTA 3EC3A 1X5DA 3WT1A 2ON7A 1O73A 1XZOA 3NOFA 2JADA 2I1UA 1PD21 5GAND 4F0CA 2XPEA 5IMCA 1AQWA 4CHSA 2MBTA 4RQRA 2GLRA 2GSRA 1QUWA 1ABAA 1UA5A 2MMNA 3FKFA 3IDVA 1MEKA 5CNWA 2CT6A 5ECMB 2H0GA 1XW9A 2X4AA 2O8VB 5DVBA 2DJJA 3KMNA 2XBQA 2AJQB 3MDKA 1G7EA 4OFMA 5IPGA 5F8BA 4IQAA 2J23A 2DBCA 1GUHA 3IAS2 4KSOA 1X9WB 4XCSA 4IW9A 3ZLPA 3F4RA 4PTSA 2LUSA 4MF7A 5H5SA 4F82A 3P90A 1M2BA 4PX1A 3FR6A 4GCIA 3SWLA 3RDWA 4K0GA 2HT9A 3IOSA 4MZCA 3VWWA 4TR1B 1Z5YE 5GAPD 2D2ZA 2R37A 4ZB8A 3KXOA 2H0HA 4OO4A 1XCCA 4EE0A 17GSA 3U6VA 2N5FA 2DC5A 4TR0A 1O6JA 4Q5RA 5ECHB 3TB2A 4ECIA 3FZ9A 5DALA 3G7YA 4GQCA 4OFNA 4MZBA 2WJUA 5A4WA 1DE1A 3TOUA 2LKUA 4USSA 5HR2A 2FUG2 2FNOA 3IC4A 3LEFA 2MMAA 1S3DA 5EY6A 2IMKA 4K5SA 1GSEA 2H6XA 2AYTA 4PUFC 3I6AA 3Q74A 1GH2A 2FA4A 4WKWA 4ID0A 3GX8A 5F06A 3KJYA 1X0RA 4NV5A 1GL8A 4EIPA 4Q5FA 3IRAA 5AGYA 2LJKA 2R4VA 3EYTA 4PQHA 2YWMA 3EMXA 2AB6A 4BL7A 1FOVA 5IM9A 5IPHA 3BD2A 2PVOC 3L9SA 2FLSA 2HXKA 1G6WA 1N2AA 4I6XA 5DJLA 2IN3A 1SL1B 1B4QA 1A2JA 4FYUA 3GKXA 2B5YA 2I3YA 2DJ1A 2GT5A 4NWYA 2F9SA 2H8LA 2IJYA 2N5BA 1WMJA 4IELA 3UJ1A 3KCMA 3L0HA 1X9SB 1FHEA 1F2EA 4X1UA 4MNNA 3MYDA 4I8BA 3HKRA 2H0IA 2OA7A 3TOTA 1A23A 19GSA 5ECOB 2K9FA 2TRCP 2VL3A 3EWLA 1T7PB 1J0FA 1JFUA 5JWRB 3FEUA 2L5LA 3FMWA 4YKGA 2B7KA 4GF0A 4Q5NA 2YZUA 1JHBA 2H6ZA 2YP6A 2H19A 5D9XA 2H74A 5CP1A 2UZ8A 1HQOA 1S3AA 5KN1A 1TDIA 2CZ2A 1OE7A 5DJMA 1ERUA 2K6VA 1SJIA 2C3NA 2JU5A 1Z9HA 1PN0A 3LWAA 3VI5A 1NHOA 1WWJA 4I5QA 4GQFA 3LJRA 2BJXA 4GSNA 1V2AA 5ENUA 3ED3A 3N9JA 2YZHA 4I2TA 2RLIA 5KEJA 2HZFA 2HSHA 2CX3A 4ZBAA 5G2ZA 2AAWA 3HJPA 4K7NA 4MP4A 4F0BA 3CTGA 5ECRB 1XFLA 2YJ7A 2F51A 4HQSA 3U5RE 1SL0B 1BYEA 1PKWA 2IMEA 5JWOB 3ERGA 3D5JA 3RHBA 2H30A 3FHKA 4KGIA 3EVIA 4KW6A 2GS3A 2RUFA 1YY7A 1S3CA 4XS4B 3IC8A 3TJKA 2CAQA 2KLXA 3W6GA 1VF1A 3I9V2 5IMZA 3ZRDA 5E4WA 5HR3A 3HJOA 1Z7PA 4MZWA 1IYHA 1J08A 2B5XA 5HFIA 1XIYA 3QCPA 1ERWA 1XWBA 4O7HA 2DMMA 1PKZA 1NM3A 4E8EA 1GSDA 1X5EA 2L57A 3R2QA 2DSAA 1EV9A 4XTSA 3VLNA 4MJCA 5F07A 5J9CA 1SL2B 5DBQA 3UBLA 5KN0A 4EDYA 2LRNA 2X64A 4TRXA 3TGZA 3C1RA 1EP7A 3CSHA 5KOWA 4N30A 1THOA 2OE3A 4Z2RA 5CAXA 3OR5A 14GSA 4OCFA 2FY6A 4IP6A 1ZYPA 1SD9A 4DSQA 6GSSA 2E2GA 4IJIA 1VF2A 4OO5A 3MIXA 1XWGA 1ZMAA 3GKNA 6GSYA 1DBYA 3CTFA 3D21A 2V6KA 5G1KA 4BWSA 3IHQA 1SJZA 1YKCA 2IPAA 4XS1A 4ML6A 4BVXA 1VGLA 1U87A 4IQ1A 3GMFA 1AQVA 1FOHA 3HZ4A 1XBSA 4HUAA 2QA2A 4L5LA 2P5QA 1OE8A 1PRXA 1V58A 1WP0A 4AJ6A 4L0WA 3UAPA 4GWRA 2EIRA 3O6TA 3O76A 2GVPA 3QAWA 5IOWA 3FZ5A 3HA9A 4FYBA 4X0XA 8GSSA 1F37A 2OE0A 2K8SA 5CRHA 2C3QA 1YKAA 1TJDA 1JLWA 3WT2A 2FCHA 5DQSA 3WD6A 4FYCA 3LW9A 3P8WA 4HEA2 1PL2A 3APQA 2IIYA 5IOXA 1ON4A 3BBYA 5AISA 3KP8A 1THXA 2HRAA 1OYJA 2GSSA 2IMFA 4OFTA 4QL7A 3HDCA 2FHEA 1M9AA 2FA8A 5J41A 4YQMA 1V40A 5JCWA 3VPQA 2GZZA 4JU5A 5D9WA 1LU4A 4OCEA 4CY8A 1W89A 1RQMA 1XWAA 1YQ1A 4YH2A 3IK7A 2R0GA 2VOCA 5JCUA 3J7Yb 2ALBA 1GSUA 1VRSD 1BEDA 4MPFA 2HZEB 11GSA 4BA7A 2X99A 1K0MA 4JBBA 3ME8A 4PXOA 4XS4A 3DVWA 1M2AA 2E2MA 4TXOA 3UARA 3GN3A 1PX7A 5DAKB 2I4AA 2CQ9A 1FAAA 4IVFA 3UVHA 3GURA 3F9UA 4XRDA 1XWKA 2QGVA 1XW5A 1WE0A 3D4MA 1O85A 1T00A 4WF5A 2OBIA 3HD5A 5GSTA 2MMZA 1DSBA 2YNXA 3D0ZA 2L4CA 1G0TA 3D4TA 3FY7A 4BWQA 4LL1B 1PSQA 1URMA 1Z6NA 1XWCA 1JZRA 4D73B 4G9HA 4K5RA 1BQ7A 1K0CA 3MSZA 3IK9A 4G0KA 1OVNA 3C8EA 3HVXA 1PGTA 4EO3A 3AY8A 5C04A 3ZVJA 3UEMA 1SYXA 1WOUA 5ECNB 5EVOA 1AC1A 3ISOA 1A8YA 1EEJA 4NXIA 2HNLA 3BJ5A 2WCIA 3HZ8A 2DJKA 1ZGNA 3C7MA 3M8NA 3ZIJA 16GSA 4ZL9A 4ILFA 4MLYA 4HZ2A 1MTCA 2PVQA 2BMXA 4V1Ag 4K9ZA 3PPUA 2LQOA 2DJ3A 4EL1A 1Q98A 4EDZA 2YJHA 3VI7A 4F03A 1TK0B 2XPDA 4V2MA 2E0QA 2J9HA 1A2MA 2PERA 2NTOA 3M1GA 2KHPA 3GUSA 5IO0A 4IBPA 13GSA 2LQQA 5B6MA 4DSRA 2HYXA 2G2QA 2VM1A 4DEJA 3GL3A 4ECCA 3US3A 5D96A 3TKSC 3H93A 2WGRA 1GWCA 1RK4A 3UVTA 2H1AA 2HI7A 2EIQA 4ML1A 3E9JB 1AAZA 1ZCPA 3DEXA 1F3BA 2A2SA 1TI3A 5JWQB 1SKWB 3M9KA 2QA1A 4PUAA 1EEMA 4I97A 4X4JA 3TRXA 3F3RA 2HSMA 3M9JA 3QR6A 2H76A 1ST9A 4NHZA 4NMUA 4N10A 3C1SA 1H4OA 2JZRA 3IA1A 3BCKA 5A5KA 3ME7A 4XRAA 5DCGA 3DKSA 1TU8A 5ECSA 3DIEA 2B3SA 1SD8A 4HJMA 5ID2B 3W8SA 1DE2A 4WR5A 5ECLB 4NV2A 4LMWA 1O81A 2B6MA 2EIOA 3EINA 1XW6A 3FZ4A 4MJAA 2BTOT 1TTZA 4G2EA 4BVYB 5DQYA 3TKQA 1XOAA 2B5EA 4LLRA 1JZDA 2H1DA 2XBIA 2ON5A 5HR0A 1BX9A 4IJ3A 5IO2A 1FG4A 3GTUB 3F8UA 4YQUA 1FVKA 2PGTA 4L8EA 1HD2A 3IR4A 1PMTA 2O89A 3FW2A 5G30A 3HHVA 2KP2A 1BJXA 3F4TA 4JEDA 3Q6OA 1TI1A 5J5NA 1B9XC 2L6CA 3RHCA 5HR1A 3GH6A 2R5GA 3RPNA 1SENA 4KSMA 3DYRA 6GSTA 3FR9A 5DDLA 2M46A 2V41A 3KTBA 1ZZYA 4ZBBA 3QFAC 4EIQA 1SK2A 4H86A 2X8HA 2IMDA 5E59A 2NPBA 1U88A 3DD3A 4D73A 4OD7A 4RUVA 3H79A 1YJ6A 2GDRA 2R2JA 4K1FA 1A24A 1U3IA 4HS1A 2A4VA 2GQMA 3CRTA 3EMPA 1WIKA 1ZYEA 3L78A 3WGXA 1B9YC 1SYRA 4GSSA 2RUEA 1FW1A 2ES7A 2VUPA 1GSSA 3G7IA 2CVKA 4KB3A 1R5PA 2VCQA 2V2GA 3E3EA 4O5QA 1M0UA 3UBKA 4HDEA 4KAEA 4K6XA 4TW5A 3A5WA 2LTKA 3DGQA 4EXJA 3MWHA 2TIRA 1V57A 4TR1A 2VCXA 2WB9A 5C00A 2G0FA 1CQHA 4ECBA 2IFQB 1N8JA 3TJJA 2RM5A 3KZQA 1QFNA 3UMAA 3RBTA 4G0LA 4WBRD 3WGDA 1OC9B 4GSTA 2REMA 2VCWA 1TRSA 2V6OA 2H75A 3CMIA 4TXVA 1XOBA 5D73A 1J9BA 3TKRA 4NPBA 3LFLA 3NZNA 2OADA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GQK A;  5ECI B;  1FB6 A;  2VLU A;  4JE1 A;  1HNA A;  4KA0 A;  5CRG A;  3KH9 A;  2HSY A;  2CV4 A;  3KTL A;  1USB A;  4V2N A;  3CXG A;  1H75 A;  4KND A;  1EZK A;  1GLQ A;  2WUL A;  2PMT A;  3GH9 A;  4POM A;  1WPI A;  2RM6 A;  2PPT A;  2WZ9 A;  6GSW A;  3K8N A;  3EU4 A;  2CX4 A;  4K7I A;  5ID2 A;  3HYP A;  2C8U A;  2H1B A;  4J2F A;  1AIU A;  4PQI A;  3TUE A;  3TJB A;  4ZBD A;  3TKP A;  3I69 A;  1MD3 A;  3DRN A;  4POL A;  3G7J A;  1JZO A;  1PN9 A;  5L71 A;  2YAN A;  3P2A A;  1VF3 A;  3A2W A;  1M7T A;  3CSJ A;  2GSQ A;  2KP1 A;  3FRC A;  4KE3 A;  3GTU A;  1MDJ A;  5COH A;  3ZL5 A;  2JSY A;  2OAC A;  5GSS A;  3SBC A;  1GTB A;  1Z3E A;  3TKS A;  1X5C A;  4FO5 A;  4X43 A;  3QMX A;  1WJK A;  3HVS A;  2JL4 A;  1EP8 A;  22GS A;  3CYN A;  4AF2 A;  1GSF A;  4QQ7 A;  2IMI A;  1NW2 A;  4GXZ A;  1GSQ A;  4XS6 A;  4K0N A;  2TRX A;  1GTU A;  2GGT A;  3N5O A;  4PNG A;  3PR8 A;  3E0U A;  4ACS A;  1GNW A;  3IBH A;  1UVZ A;  2PUK C;  2OKA A;  2P5R A;  2FWG A;  2JSZ A;  4K7O A;  2F8F A;  4ZIJ A;  1B4P A;  1OAZ A;  5IMA A;  1AXD A;  2L59 A;  1SK0 A;  2LV3 A;  1K0O A;  4TR3 A;  4CW9 A;  4POK A;  1E6B A;  5CRE A;  2DIZ A;  4P3Y B;  5IQY A;  4MF5 A;  1JZW A;  5DCH A;  2X8C A;  3LSZ A;  2C0G A;  3TKS E;  1GLP A;  4JR6 A;  3IXR A;  2VD0 A;  2H71 A;  2GT6 A;  4WF4 A;  5J4U A;  2HRN A;  4IKH A;  3M0F A;  3VFI A;  4TR4 A;  1VF4 A;  1QGV A;  2EC4 A;  4RQX A;  3EE2 A;  5G5F A;  2LRC A;  2ZCT A;  3A2X A;  1A0R P;  3ZTL A;  3IV4 A;  3ZFB A;  2IFQ A;  5IMF A;  1T4Y A;  1Z6M A;  1R26 A;  2KOK A;  5IIZ A;  3WGE A;  4LMV A;  3WYW A;  1OC9 A;  3F6D A;  4DVC A;  4IHU A;  1EGO A;  1Y6E A;  2L6D A;  1ERV A;  3GNJ A;  1FVJ A;  3ZML A;  4V1A p;  6GSX A;  4OWY A;  4IS0 A;  1V98 A;  2L5O A;  2VCZ A;  3P7X A;  1KTE A;  3W8J A;  1GSY A;  3IE3 A;  3LG6 A;  3APO A;  1K0D A;  3JCM L;  9GSS A;  3UIW A;  1SK1 A;  4NAX A;  3QDN A;  2IL3 A;  3GL5 A;  2B7J A;  3KIJ A;  1LJR A;  1LBK A;  2YWN A;  3G9B A;  3GYK A;  3LOR A;  4YQV A;  5HFG A;  3ZZX A;  4ULX A;  4J57 E;  1K0A A;  2N5A A;  3ZIT A;  1RW1 A;  3ZMK A;  4ZL8 A;  1TOF A;  3I43 A;  1TK5 B;  1M2D A;  1O8X A;  2PWJ A;  2AV4 A;  1ML6 A;  3VPT A;  1YDK A;  5LCZ A;  5AIV A;  18GS A;  4IGJ A;  1F3A A;  3LXT A;  4HI7 A;  1WRY A;  4AJ7 A;  4RI6 A;  2M72 A;  2QSI A;  4V2L A;  1YZX A;  2VIM A;  4MDC A;  1EWX A;  4F2I A;  5KN2 A;  3GIX A;  3ERF A;  2CVD A;  3GHA A;  2MYG A;  2VL2 C;  4HU7 A;  5JCG A;  1BAY A;  2JZT A;  2VM2 A;  5A4U A;  3HJM A;  4O92 A;  3QD9 A;  4MCU A;  1TRW A;  3PIN A;  4RI7 A;  4GLT A;  5D9V A;  1I5G A;  5HFK A;  1ERT A;  3HY2 A;  5ECK B;  2F8A A;  4L0U A;  5AIX A;  3EUR A;  3KP9 A;  5G1L A;  3FYG A;  3L4N A;  1GP1 A;  5F0G A;  5ECQ B;  3MAK A;  1A8L A;  2IWT A;  4BPY A;  3Q18 A;  10GS A;  3F3Q A;  1A0F A;  1O7U A;  3TDG A;  3H4K A;  1G7O A;  5H5Q A;  4KDY A;  1T8E B;  1DUG A;  5ELA A;  4XIH A;  4TOP A;  5F05 A;  3TJG A;  4EKZ A;  2VAF A;  4N0V A;  2PBJ A;  2E7P A;  3A2V A;  3APS A;  2FD3 A;  1ACV A;  1KNG A;  2C0D A;  3BOA A;  1EOH A;  4AJ8 A;  1AQX A;  2M80 A;  5AN1 A;  1K0N A;  3GKK A;  4HOJ A;  4TN8 A;  5EL8 A;  3DXB A;  3ZYW A;  4KCA A;  3RAZ A;  3L9U A;  3CBU A;  4TKY A;  2HZE A;  2O87 A;  1K3Y A;  3GSS A;  2DJ2 A;  3L9V A;  4KH7 A;  3F63 A;  3M3M A;  3TRQ A;  1GUL A;  2C0F A;  3IAM 2;  2HFD A;  2V32 A;  3GRX A;  3KM6 A;  1C72 A;  4HZ4 A;  3GKM A;  3LYP A;  4MF6 A;  2O7K A;  1IYI A;  2VCV A;  3FR3 A;  5CRW A;  2LJA A;  2NDO A;  1QXH A;  1BG5 A;  5DAK A;  1YEP A;  2VD1 A;  2FWE A;  3IPZ A;  3D22 A;  2MMO A;  5IMD A;  1YF1 A;  12GS A;  3RPP A;  1U6T A;  3FK8 A;  5CYY A;  4ISD A;  4POB A;  4FH8 A;  4HJ2 A;  1MD4 A;  3HVV A;  4QL9 A;  2H66 A;  3TCO A;  2P0G A;  2JAC A;  5G31 A;  3GFK A;  1B8X A;  1ZYQ B;  1UC7 A;  1K0B A;  2P31 A;  4JR4 A;  4PUR A;  4TVE A;  1TXX A;  2VL9 A;  3QAG A;  2H72 A;  4ZB9 A;  2L4Q A;  1MDI A;  1T4Z A;  2HE3 A;  2R6K A;  3KD0 A;  5CO3 A;  2KUC A;  3QAV A;  2H73 A;  2LNT A;  2GZP A;  1TU7 A;  3LXZ A;  4YAP A;  2C80 A;  3TJF A;  3HXS A;  2VO4 A;  5CRD A;  2LNS A;  3TRP A;  2I9H A;  4N0Z A;  1F6M C;  1HNC A;  2OE1 A;  1QK8 A;  1PA3 A;  4WXT A;  1HNB A;  2WDU A;  5D93 A;  1SJ6 A;  5A4V A;  3V1W A;  2LRT A;  5EPF A;  2A2R A;  2PU9 C;  1F9M A;  4O5R A;  1QMV A;  4O32 A;  4WR4 A;  1FB0 A;  2YOI A;  2C3T A;  3ERW A;  4LA1 A;  4EC0 A;  1XPV A;  3A3T A;  1B48 A;  3MNG A;  2JZS A;  3LQ7 A;  2R3X A;  2AUV A;  4MAB A;  4MPG A;  2YWO A;  2OBK A;  4IP1 A;  1ZOF A;  3ZIV A;  3CRU A;  5IMV A;  3LYK A;  1G6Y A;  2VCT A;  2MBS A;  1TP9 A;  1GNE A;  1XXU A;  4YAV A;  1M9B A;  4TXO B;  5H5R A;  1TRU A;  3CSI A;  3FZA A;  7GSS A;  5D8I A;  4DSS B;  1TK8 B;  2XC2 A;  2HRF A;  2LJR A;  3HCZ A;  4GRF A;  3Q19 A;  5INY A;  4ZXG A;  1A2L A;  1W4V A;  5B6N A;  20GS A;  1T1V A;  1Y25 A;  1Z7R A;  1R5A A;  1ZL9 A;  4JZQ A;  3F6F A;  2LS5 A;  2H6Y A;  1Q4J A;  2O85 A;  1GUK A;  1TKD B;  5B8B A;  2YCD A;  4EVM A;  3QOU A;  4WET A;  1U3A A;  5G5E A;  3GST A;  1SKR B;  4AGS A;  3PH9 A;  4Z7X A;  1TW9 A;  1GUM A;  4EF0 A;  2OJL A;  4BVY A;  5KN3 A;  4ZIL A;  3ZVJ D;  3KH7 A;  4N11 A;  1FO5 A;  1R4W A;  3J7Y k;  4KCE A;  2VL2 A;  3LGC A;  5ECP B;  2DIY A;  3H8Q A;  2LST A;  4NHW A;  2VLV A;  2XHF A;  3O3T A;  1SKS B;  1K3L A;  2FGX A;  1HYU A;  1KBN A;  4L5O A;  2H1G A;  1KEB A;  5ELG A;  2YPM A;  1GRX A;  5ABR A;  4J56 E;  3VWX A;  2QC7 A;  4K8M A;  2RII A;  4WEY A;  1OC8 A;  2AHE A;  3ZFL A;  1ILO A;  1PQN A;  1AUC A;  2NBS A;  4IN0 A;  2B1L A;  1PX6 A;  2YWI A;  3F4S A;  4KX4 A;  3VWV A;  2K8V A;  3GV1 A;  4KUN A;  4F9Z A;  4MJB A;  5D9T A;  1MDK A;  5J3R A;  1V9W A;  2WFC A;  1E2Y A;  3S9F A;  2PN8 A;  2WRT A;  4KDU A;  2CA8 A;  2YN1 A;  2GST A;  2YV9 A;  3F0I A;  1CQG A;  1XVW A;  1K3O A;  4G10 A;  4ZL7 A;  1OKD A;  3D6I A;  1X9M B;  1QQ2 A;  1TRV A;  4PGT A;  3ZRE A;  4MJE A;  1OC3 A;  3C73 A;  1EGR A;  4HU9 A;  4G19 A;  5DAL B;  1AW9 A;  3C71 A;  4LL4 B;  5FWG A;  4MH2 A;  2HLS A;  2C4J A;  1NHY A;  5B7C A;  5HQP A;  2LEG A;  2DJ0 A;  2H70 A;  1T3B A;  2ZNM A;  4Q5Q A;  1I9D A;  5LD0 A;  1O8W A;  1NSW A;  3GX0 A;  2DML A;  4ECJ A;  4MMM A;  1YEX A;  4KDX A;  5B8A A;  4GTU A;  1GTI A;  4MH3 A;  3VWU A;  2GZY A;  2H01 A;  2QKE A;  4OMV A;  4XHM A;  3KGK A;  1EV4 A;  1SU9 A;  2F3M A;  3PGT A;  1JLV A;  2YV7 A;  3DVX A;  4ZB6 A;  2FWH A;  2GTU A;  3QPM A;  2C1Y A;  4I2U A;  3DML A;  3BCI A;  4HQZ A;  5J9B A;  3UL3 A;  5FT3 A;  3DWV A;  1XVQ A;  2C0E A;  2B1K A;  2FWF A;  2V1M A;  2CAI A;  1EOG A;  3UOM A;  3GA4 A;  1GTA A;  3H1N A;  2CZ3 A;  3VUR A;  1R7H A;  4MA9 A;  2NVL A;  4DSS A;  5GZZ B;  1YF0 A;  4E8H A;  2DLX A;  3QFB C;  4PNF A;  3KEB A;  4K2D A;  4MK3 A;  6GSU A;  5LNK e;  3NIV A;  4CDO A;  4FIW A;  2I81 A;  4PQ1 A;  4EUY A;  1UN2 A;  2K18 A;  3KMO A;  2GQL A;  3EU3 A;  4WBJ A;  2MZC A;  3VK9 A;  2ZUP A;  2VLT A;  2CVB A;  2Z9S A;  1PL1 A;  5FHI A;  2X8G A;  1M99 A;  2WS2 A;  6GSV A;  4JRR A;  1OKT A;  3EC3 A;  1X5D A;  3WT1 A;  2ON7 A;  1O73 A;  1XZO A;  3NOF A;  2JAD A;  2I1U A;  1PD2 1;  5GAN D;  4F0C A;  2XPE A;  5IMC A;  1AQW A;  4CHS A;  2MBT A;  4RQR A;  2GLR A;  2GSR A;  1QUW A;  1ABA A;  1UA5 A;  2MMN A;  3FKF A;  3IDV A;  1MEK A;  5CNW A;  2CT6 A;  5ECM B;  2H0G A;  1XW9 A;  2O8V B;  5DVB A;  2DJJ A;  3KMN A;  2XBQ A;  2AJQ B;  3MDK A;  1G7E A;  4OFM A;  5IPG A;  5F8B A;  4IQA A;  2J23 A;  2DBC A;  1GUH A;  3IAS 2;  4KSO A;  1X9W B;  4XCS A;  4IW9 A;  3ZLP A;  3F4R A;  2LUS A;  4MF7 A;  5H5S A;  4F82 A;  3P90 A;  1M2B A;  4PX1 A;  3FR6 A;  4GCI A;  3SWL A;  3RDW A;  4K0G A;  2HT9 A;  3IOS A;  4MZC A;  3VWW A;  4TR1 B;  1Z5Y E;  5GAP D;  2D2Z A;  2R37 A;  4ZB8 A;  3KXO A;  2H0H A;  4OO4 A;  1XCC A;  4EE0 A;  17GS A;  3U6V A;  2N5F A;  2DC5 A;  4TR0 A;  1O6J A;  4Q5R A;  5ECH B;  3TB2 A;  4ECI A;  3FZ9 A;  5DAL A;  3G7Y A;  4GQC A;  4OFN A;  4MZB A;  2WJU A;  5A4W A;  1DE1 A;  3TOU A;  2LKU A;  5HR2 A;  2FUG 2;  2FNO A;  3IC4 A;  3LEF A;  2MMA A;  1S3D A;  5EY6 A;  2IMK A;  1GSE A;  2H6X A;  2AYT A;  4PUF C;  3I6A A;  3Q74 A;  1GH2 A;  2FA4 A;  4WKW A;  4ID0 A;  3GX8 A;  5F06 A;  3KJY A;  1X0R A;  4NV5 A;  1GL8 A;  4Q5F A;  3IRA A;  5AGY A;  2LJK A;  2R4V A;  3EYT A;  4PQH A;  2YWM A;  3EMX A;  2AB6 A;  4BL7 A;  1FOV A;  5IM9 A;  5IPH A;  3BD2 A;  2PVO C;  3L9S A;  2FLS A;  2HXK A;  1G6W A;  1N2A A;  4I6X A;  5DJL A;  2IN3 A;  1SL1 B;  1B4Q A;  1A2J A;  4FYU A;  3GKX A;  2B5Y A;  2I3Y A;  2DJ1 A;  2GT5 A;  4NWY A;  2F9S A;  2H8L A;  2IJY A;  2N5B A;  1WMJ A;  4IEL A;  3UJ1 A;  3KCM A;  3L0H A;  1X9S B;  1FHE A;  1F2E A;  4X1U A;  4I8B A;  3HKR A;  2H0I A;  2OA7 A;  3TOT A;  1A23 A;  19GS A;  5ECO B;  2K9F A;  2TRC P;  2VL3 A;  3EWL A;  1T7P B;  1J0F A;  1JFU A;  5JWR B;  3FEU A;  2L5L A;  2B7K A;  4GF0 A;  4Q5N A;  2YZU A;  1JHB A;  2H6Z A;  2YP6 A;  2H19 A;  5D9X A;  2H74 A;  5CP1 A;  1HQO A;  1S3A A;  5KN1 A;  1TDI A;  2CZ2 A;  1OE7 A;  5DJM A;  1ERU A;  2K6V A;  1SJI A;  2C3N A;  2JU5 A;  1Z9H A;  3LWA A;  3VI5 A;  1NHO A;  1WWJ A;  4I5Q A;  4GQF A;  3LJR A;  2BJX A;  4GSN A;  1V2A A;  5ENU A;  3ED3 A;  3N9J A;  2YZH A;  4I2T A;  2RLI A;  5KEJ A;  2HZF A;  2HSH A;  2CX3 A;  4ZBA A;  5G2Z A;  2AAW A;  3HJP A;  4K7N A;  4MP4 A;  4F0B A;  3CTG A;  5ECR B;  1XFL A;  2YJ7 A;  2F51 A;  4HQS A;  3U5R E;  1SL0 B;  1BYE A;  1PKW A;  2IME A;  5JWO B;  3ERG A;  3D5J A;  3RHB A;  2H30 A;  3FHK A;  4KGI A;  3EVI A;  4KW6 A;  2GS3 A;  2RUF A;  1YY7 A;  1S3C A;  4XS4 B;  3TJK A;  2CAQ A;  2KLX A;  3W6G A;  1VF1 A;  3I9V 2;  5IMZ A;  3ZRD A;  5E4W A;  5HR3 A;  3HJO A;  1Z7P A;  4MZW A;  1IYH A;  1J08 A;  2B5X A;  5HFI A;  1XIY A;  3QCP A;  1ERW A;  1XWB A;  4O7H A;  2DMM A;  1PKZ A;  1NM3 A;  4E8E A;  1GSD A;  1X5E A;  2L57 A;  3R2Q A;  2DSA A;  1EV9 A;  4XTS A;  3VLN A;  4MJC A;  5F07 A;  5J9C A;  1SL2 B;  5DBQ A;  3UBL A;  5KN0 A;  4EDY A;  2LRN A;  2X64 A;  4TRX A;  3TGZ A;  3C1R A;  1EP7 A;  3CSH A;  4N30 A;  1THO A;  2OE3 A;  5CAX A;  3OR5 A;  14GS A;  4OCF A;  2FY6 A;  4IP6 A;  1SD9 A;  4DSQ A;  6GSS A;  2E2G A;  4IJI A;  1VF2 A;  4OO5 A;  1XWG A;  1ZMA A;  3GKN A;  6GSY A;  1DBY A;  3CTF A;  3D21 A;  2V6K A;  5G1K A;  4BWS A;  3IHQ A;  1SJZ A;  1YKC A;  2IPA A;  4XS1 A;  4ML6 A;  4BVX A;  1VGL A;  1U87 A;  4IQ1 A;  3GMF A;  1AQV A;  3HZ4 A;  1XBS A;  4HUA A;  4L5L A;  2P5Q A;  1OE8 A;  1PRX A;  1V58 A;  1WP0 A;  4AJ6 A;  4L0W A;  3UAP A;  4GWR A;  2EIR A;  3O6T A;  3O76 A;  2GVP A;  3QAW A;  5IOW A;  3FZ5 A;  3HA9 A;  4FYB A;  4X0X A;  8GSS A;  1F37 A;  2OE0 A;  2K8S A;  5CRH A;  2C3Q A;  1YKA A;  1TJD A;  1JLW A;  3WT2 A;  2FCH A;  5DQS A;  3WD6 A;  4FYC A;  3P8W A;  4HEA 2;  1PL2 A;  3APQ A;  2IIY A;  5IOX A;  1ON4 A;  3BBY A;  5AIS A;  3KP8 A;  1THX A;  1OYJ A;  2GSS A;  2IMF A;  4OFT A;  4QL7 A;  3HDC A;  2FHE A;  1M9A A;  2FA8 A;  5J41 A;  4YQM A;  1V40 A;  5JCW A;  3VPQ A;  2GZZ A;  4JU5 A;  5D9W A;  1LU4 A;  4OCE A;  1W89 A;  1RQM A;  1XWA A;  1YQ1 A;  4YH2 A;  3IK7 A;  2VOC A;  5JCU A;  3J7Y b;  2ALB A;  1GSU A;  1VRS D;  1BED A;  4MPF A;  2HZE B;  11GS A;  4BA7 A;  2X99 A;  1K0M A;  4JBB A;  3ME8 A;  4PXO A;  4XS4 A;  3DVW A;  1M2A A;  2E2M A;  4TXO A;  3UAR A;  3GN3 A;  1PX7 A;  5DAK B;  2I4A A;  2CQ9 A;  1FAA A;  4IVF A;  3UVH A;  3GUR A;  3F9U A;  4XRD A;  1XWK A;  2QGV A;  1XW5 A;  1WE0 A;  3D4M A;  1O85 A;  1T00 A;  4WF5 A;  2OBI A;  3HD5 A;  5GST A;  2MMZ A;  1DSB A;  2YNX A;  3D0Z A;  2L4C A;  1G0T A;  3D4T A;  3FY7 A;  4BWQ A;  4LL1 B;  1PSQ A;  1URM A;  1Z6N A;  1XWC A;  1JZR A;  4D73 B;  4G9H A;  1BQ7 A;  1K0C A;  3MSZ A;  3IK9 A;  1OVN A;  3C8E A;  3HVX A;  1PGT A;  4EO3 A;  3AY8 A;  5C04 A;  3ZVJ A;  3UEM A;  1SYX A;  1WOU A;  5ECN B;  5EVO A;  1AC1 A;  3ISO A;  1A8Y A;  1EEJ A;  4NXI A;  2HNL A;  3BJ5 A;  2WCI A;  3HZ8 A;  2DJK A;  1ZGN A;  3C7M A;  3M8N A;  3ZIJ A;  16GS A;  4ZL9 A;  4ILF A;  4MLY A;  4HZ2 A;  1MTC A;  2PVQ A;  2BMX A;  4V1A g;  4K9Z A;  2LQO A;  2DJ3 A;  4EL1 A;  1Q98 A;  4EDZ A;  2YJH A;  3VI7 A;  4F03 A;  1TK0 B;  2XPD A;  4V2M A;  2E0Q A;  2J9H A;  1A2M A;  2PER A;  2NTO A;  3M1G A;  2KHP A;  3GUS A;  5IO0 A;  4IBP A;  13GS A;  2LQQ A;  5B6M A;  4DSR A;  2HYX A;  2G2Q A;  2VM1 A;  4DEJ A;  3GL3 A;  4ECC A;  3US3 A;  5D96 A;  3TKS C;  3H93 A;  2WGR A;  1GWC A;  1RK4 A;  3UVT A;  2H1A A;  2HI7 A;  2EIQ A;  4ML1 A;  3E9J B;  1AAZ A;  1ZCP A;  3DEX A;  1F3B A;  2A2S A;  1TI3 A;  5JWQ B;  1SKW B;  3M9K A;  4PUA A;  1EEM A;  4I97 A;  3TRX A;  3F3R A;  3M9J A;  3QR6 A;  2H76 A;  1ST9 A;  4NHZ A;  4NMU A;  4N10 A;  3C1S A;  1H4O A;  2JZR A;  3IA1 A;  3BCK A;  5A5K A;  3ME7 A;  4XRA A;  5DCG A;  3DKS A;  1TU8 A;  5ECS A;  3DIE A;  2B3S A;  1SD8 A;  4HJM A;  5ID2 B;  3W8S A;  1DE2 A;  4WR5 A;  5ECL B;  4NV2 A;  4LMW A;  1O81 A;  2B6M A;  2EIO A;  3EIN A;  1XW6 A;  3FZ4 A;  4MJA A;  2BTO T;  1TTZ A;  4G2E A;  5DQY A;  3TKQ A;  1XOA A;  2B5E A;  4LLR A;  1JZD A;  2H1D A;  2XBI A;  2ON5 A;  5HR0 A;  1BX9 A;  4IJ3 A;  5IO2 A;  1FG4 A;  3GTU B;  3F8U A;  4YQU A;  1FVK A;  2PGT A;  4L8E A;  1HD2 A;  3IR4 A;  1PMT A;  2O89 A;  3FW2 A;  5G30 A;  3HHV A;  2KP2 A;  1BJX A;  3F4T A;  4JED A;  3Q6O A;  1TI1 A;  5J5N A;  1B9X C;  2L6C A;  3RHC A;  5HR1 A;  3GH6 A;  2R5G A;  3RPN A;  1SEN A;  4KSM A;  3DYR A;  6GST A;  3FR9 A;  5DDL A;  2M46 A;  2V41 A;  3KTB A;  1ZZY A;  4ZBB A;  3QFA C;  1SK2 A;  4H86 A;  2X8H A;  2IMD A;  5E59 A;  2NPB A;  1U88 A;  3DD3 A;  4D73 A;  4OD7 A;  4RUV A;  3H79 A;  1YJ6 A;  2GDR A;  2R2J A;  4K1F A;  1A24 A;  1U3I A;  4HS1 A;  2A4V A;  2GQM A;  3CRT A;  3EMP A;  1WIK A;  1ZYE A;  3L78 A;  3WGX A;  1B9Y C;  1SYR A;  4GSS A;  2RUE A;  1FW1 A;  2ES7 A;  2VUP A;  1GSS A;  3G7I A;  2CVK A;  4KB3 A;  1R5P A;  2VCQ A;  2V2G A;  3E3E A;  1M0U A;  3UBK A;  4HDE A;  4KAE A;  4K6X A;  4TW5 A;  3A5W A;  2LTK A;  3DGQ A;  4EXJ A;  3MWH A;  2TIR A;  1V57 A;  4TR1 A;  2VCX A;  2WB9 A;  5C00 A;  2G0F A;  1CQH A;  4ECB A;  2IFQ B;  1N8J A;  3TJJ A;  2RM5 A;  3KZQ A;  1QFN A;  3UMA A;  3RBT A;  4WBR D;  3WGD A;  1OC9 B;  4GST A;  2REM A;  2VCW A;  1TRS A;  2V6O A;  2H75 A;  3CMI A;  4TXV A;  1XOB A;  5D73 A;  1J9B A;  3TKR A;  4NPB A;  3LFL A;  3NZN A;  2OAD A; 
#chains in the Genus database with same CATH topology
 2GQK A;  5ECI B;  2R0P A;  1FB6 A;  2VLU A;  4JE1 A;  1HNA A;  4KA0 A;  4G0I A;  5CRG A;  3KH9 A;  2HSY A;  2CV4 A;  3KTL A;  1USB A;  4V2N A;  3CXG A;  1H75 A;  4KND A;  1EZK A;  1GLQ A;  2WUL A;  2PMT A;  3GH9 A;  4POM A;  1WPI A;  2RM6 A;  2PPT A;  2WZ9 A;  6GSW A;  3K8N A;  3EU4 A;  2CX4 A;  4K7I A;  3CQF A;  5ID2 A;  3HYP A;  2C8U A;  2H1B A;  4J2F A;  1AIU A;  4PQI A;  3TUE A;  3TJB A;  4ZBD A;  3TKP A;  3I69 A;  1MD3 A;  3DRN A;  4POL A;  3G7J A;  1JZO A;  1PN9 A;  5L71 A;  2YAN A;  3P2A A;  1VF3 A;  5BRT A;  3A2W A;  1M7T A;  3CSJ A;  2GSQ A;  2KP1 A;  3FRC A;  4KE3 A;  3GTU A;  1MDJ A;  5COH A;  3ZL5 A;  2JSY A;  2OAC A;  5GSS A;  3SBC A;  1GTB A;  1Z3E A;  3TKS A;  1X5C A;  4FO5 A;  4X43 A;  3QMX A;  1WJK A;  3HVS A;  2JL4 A;  1EP8 A;  22GS A;  3CYN A;  4AF2 A;  1GSF A;  4QQ7 A;  2IMI A;  2X49 A;  1NW2 A;  4GXZ A;  1GSQ A;  4XS6 A;  4K0N A;  2TRX A;  1GTU A;  2GGT A;  3N5O A;  4PNG A;  3PR8 A;  3E0U A;  4ACS A;  1GNW A;  3IBH A;  1UVZ A;  2PUK C;  4Z2U A;  2OKA A;  2P5R A;  2FWG A;  2JSZ A;  4K7O A;  2F8F A;  4ZIJ A;  1B4P A;  1OAZ A;  5IMA A;  1AXD A;  2L59 A;  1SK0 A;  2LV3 A;  1K0O A;  4TR3 A;  4CW9 A;  4POK A;  1E6B A;  5CRE A;  2DIZ A;  4P3Y B;  5IQY A;  4MF5 A;  1JZW A;  5DCH A;  2X8C A;  3LSZ A;  2C0G A;  3TKS E;  1GLP A;  4JR6 A;  1PFO A;  3IXR A;  2VD0 A;  2H71 A;  2GT6 A;  4WF4 A;  5J4U A;  2HRN A;  4IKH A;  3M0F A;  3VFI A;  4TR4 A;  1VF4 A;  1QGV A;  2EC4 A;  4RQX A;  3EE2 A;  5G5F A;  2R0C A;  2LRC A;  2ZCT A;  3A2X A;  1A0R P;  3ZTL A;  3IV4 A;  3ZFB A;  2IFQ A;  5IMF A;  1T4Y A;  1Z6M A;  1R26 A;  2KOK A;  5IIZ A;  3WGE A;  4LMV A;  3WYW A;  1OC9 A;  3F6D A;  4DVC A;  4IHU A;  1EGO A;  1Y6E A;  2L6D A;  1ERV A;  3GNJ A;  1FVJ A;  3ZML A;  4V1A p;  6GSX A;  4OWY A;  4IS0 A;  4O5U A;  1V98 A;  2L5O A;  2VCZ A;  3P7X A;  1KTE A;  3W8J A;  1GSY A;  3IE3 A;  3LG6 A;  3APO A;  1K0D A;  3JCM L;  9GSS A;  3UIW A;  1SK1 A;  4NAX A;  3QDN A;  2IL3 A;  3GL5 A;  2B7J A;  3KIJ A;  1LJR A;  1LBK A;  2YWN A;  3G9B A;  3GYK A;  3LOR A;  4YQV A;  5HFG A;  3ZZX A;  4ULX A;  4J57 E;  1K0A A;  2N5A A;  3ZIT A;  1RW1 A;  3ZMK A;  4ZL8 A;  1TOF A;  3I43 A;  1TK5 B;  1M2D A;  1O8X A;  2PWJ A;  2AV4 A;  1ML6 A;  4KF9 A;  3VPT A;  1YDK A;  5LCZ A;  5AIV A;  18GS A;  4IGJ A;  1F3A A;  3LXT A;  4HI7 A;  1WRY A;  4AJ7 A;  4RI6 A;  2M72 A;  2QSI A;  4V2L A;  1YZX A;  2VIM A;  4MDC A;  1EWX A;  4F2I A;  5KN2 A;  3GIX A;  3ERF A;  2CVD A;  3GHA A;  2MYG A;  2VL2 C;  4HU7 A;  5JCG A;  1BAY A;  2JZT A;  2VM2 A;  5A4U A;  3HJM A;  4O92 A;  3QD9 A;  4MCU A;  1TRW A;  3PIN A;  4RI7 A;  4GLT A;  5D9V A;  1I5G A;  5HFK A;  1ERT A;  3HY2 A;  5ECK B;  2F8A A;  4L0U A;  5AIX A;  3EUR A;  3KP9 A;  5G1L A;  3A5I A;  3FYG A;  3L4N A;  1GP1 A;  5F0G A;  5ECQ B;  4YKF A;  1XG8 A;  3MAK A;  1A8L A;  2IWT A;  4BPY A;  3Q18 A;  10GS A;  3F3Q A;  1A0F A;  1O7U A;  3TDG A;  3H4K A;  1G7O A;  5H5Q A;  4KDY A;  1T8E B;  1DUG A;  5ELA A;  4XIH A;  4TOP A;  5F05 A;  3TJG A;  4EKZ A;  2VAF A;  4N0V A;  2PBJ A;  2E7P A;  3A2V A;  3APS A;  2FD3 A;  1ACV A;  1KNG A;  2C0D A;  3BOA A;  1EOH A;  4AJ8 A;  1AQX A;  2M80 A;  5AN1 A;  1K0N A;  3GKK A;  4HOJ A;  4TN8 A;  5EL8 A;  3DXB A;  3ZYW A;  4KCA A;  3RAZ A;  2A2P A;  3L9U A;  3CBU A;  4TKY A;  2HZE A;  2O87 A;  1K3Y A;  3GSS A;  2DJ2 A;  3L9V A;  4KH7 A;  3F63 A;  3M3M A;  3TRQ A;  1GUL A;  2C0F A;  3IAM 2;  2HFD A;  2V32 A;  3GRX A;  3KM6 A;  1C72 A;  4HZ4 A;  3GKM A;  3LYP A;  4MF6 A;  2O7K A;  1IYI A;  2VCV A;  3FR3 A;  5CRW A;  2LJA A;  2NDO A;  1QXH A;  1BG5 A;  5DAK A;  1YEP A;  2VD1 A;  2FWE A;  3IPZ A;  3D22 A;  2MMO A;  5IMD A;  1YF1 A;  4BVX B;  12GS A;  3RPP A;  1U6T A;  3FK8 A;  5CYY A;  4ISD A;  4POB A;  4FH8 A;  5BMU A;  4HJ2 A;  1MD4 A;  3HVV A;  4QL9 A;  2H66 A;  3TCO A;  2P0G A;  2JAC A;  5G31 A;  3GFK A;  1B8X A;  1ZYQ B;  1UC7 A;  1K0B A;  2P31 A;  4JR4 A;  4PUR A;  4TVE A;  1TXX A;  2VL9 A;  3QAG A;  2H72 A;  4ZB9 A;  2L4Q A;  1MDI A;  1T4Z A;  2HE3 A;  2R6K A;  3KD0 A;  5CO3 A;  2KUC A;  3QAV A;  2H73 A;  2LNT A;  2GZP A;  1TU7 A;  3LXZ A;  4YAP A;  2C80 A;  3TJF A;  3HXS A;  2VO4 A;  5CRD A;  2LNS A;  3TRP A;  2I9H A;  3R3E A;  4N0Z A;  1F6M C;  1HNC A;  2OE1 A;  1QK8 A;  1PA3 A;  4WXT A;  1HNB A;  2WDU A;  5D93 A;  1SJ6 A;  5A4V A;  3V1W A;  2LRT A;  5EPF A;  2A2R A;  2PU9 C;  1F9M A;  4O5R A;  1QMV A;  4O32 A;  4WR4 A;  1FB0 A;  2YOI A;  2C3T A;  3ERW A;  2DKI A;  4LA1 A;  4EC0 A;  1XPV A;  3A3T A;  1B48 A;  3MNG A;  2JZS A;  3LQ7 A;  2R3X A;  2AUV A;  4MAB A;  4MPG A;  2YWO A;  2OBK A;  4IP1 A;  1ZOF A;  3ZIV A;  3CRU A;  5IMV A;  3LYK A;  1G6Y A;  2VCT A;  2MBS A;  1TP9 A;  1GNE A;  1XXU A;  4YAV A;  1M9B A;  4TXO B;  5H5R A;  1TRU A;  3CSI A;  3FZA A;  7GSS A;  5D8I A;  4FQU A;  4DSS B;  2HRK A;  1TK8 B;  2XC2 A;  2HRF A;  2LJR A;  3HCZ A;  4GRF A;  3Q19 A;  4Z2T A;  5INY A;  4ZXG A;  1A2L A;  1W4V A;  5B6N A;  20GS A;  1T1V A;  1Y25 A;  1Z7R A;  1R5A A;  1ZL9 A;  4JZQ A;  3F6F A;  2LS5 A;  2H6Y A;  1Q4J A;  2O85 A;  1GUK A;  1TKD B;  5B8B A;  2YCD A;  4EVM A;  3QOU A;  4WET A;  1U3A A;  5G5E A;  3GST A;  1SKR B;  4AGS A;  3PH9 A;  4Z7X A;  1TW9 A;  1GUM A;  4EF0 A;  2OJL A;  4BVY A;  5KN3 A;  4ZIL A;  4BIK A;  3ZVJ D;  3KH7 A;  4N11 A;  1FO5 A;  1R4W A;  3J7Y k;  4KCE A;  2VL2 A;  3LGC A;  5ECP B;  2DIY A;  3H8Q A;  2LST A;  4NHW A;  2VLV A;  2XHF A;  3O3T A;  1SKS B;  1K3L A;  2FGX A;  1HYU A;  1KBN A;  4L5O A;  2H1G A;  1KEB A;  5ELG A;  2YPM A;  1GRX A;  5ABR A;  4ICY A;  4J56 E;  3VWX A;  2QC7 A;  4K8M A;  2RII A;  4WEY A;  1OC8 A;  2AHE A;  3ZFL A;  1ILO A;  1PQN A;  1AUC A;  2NBS A;  4IN0 A;  2B1L A;  1PX6 A;  2YWI A;  3F4S A;  4KX4 A;  3VWV A;  2K8V A;  3GV1 A;  4KUN A;  4F9Z A;  3IHG A;  4MJB A;  5D9T A;  1MDK A;  5J3R A;  1V9W A;  2WFC A;  1E2Y A;  3S9F A;  2PN8 A;  2WRT A;  4KDU A;  2CA8 A;  2YN1 A;  2GST A;  2YV9 A;  3F0I A;  1CQG A;  1XVW A;  4CY6 A;  1K3O A;  4G10 A;  4A5P A;  1OKD A;  4ZL7 A;  3D6I A;  1X9M B;  1QQ2 A;  1TRV A;  4PGT A;  3ZRE A;  4MJE A;  1OC3 A;  3C73 A;  1EGR A;  4HU9 A;  4G19 A;  5DAL B;  1AW9 A;  3C71 A;  2DKH A;  4LL4 B;  5FWG A;  5KOX A;  4MH2 A;  2HLS A;  2C4J A;  1NHY A;  5B7C A;  5HQP A;  2LEG A;  2DJ0 A;  2H70 A;  1T3B A;  2ZNM A;  4Q5Q A;  1I9D A;  5LD0 A;  1O8W A;  1NSW A;  3GX0 A;  2DML A;  4ECJ A;  4MMM A;  1YEX A;  4KDX A;  5B8A A;  4GTU A;  1GTI A;  4MH3 A;  3VWU A;  2GZY A;  2H01 A;  3EPT A;  2QKE A;  4OMV A;  4XHM A;  3KGK A;  1M3I A;  1EV4 A;  1SU9 A;  2F3M A;  3PGT A;  1JLV A;  2YV7 A;  3DVX A;  4ZB6 A;  4BL7 B;  2FWH A;  2GTU A;  3QPM A;  2C1Y A;  4I2U A;  3DML A;  3BCI A;  4HQZ A;  5J9B A;  3UL3 A;  5FT3 A;  3DWV A;  1XVQ A;  2C0E A;  4K2X A;  2B1K A;  2FWF A;  1ZYN A;  2V1M A;  2CAI A;  1EOG A;  3UOM A;  3GA4 A;  1GTA A;  2A4H A;  3H1N A;  2CZ3 A;  3VUR A;  1R7H A;  4MA9 A;  2NVL A;  4DSS A;  5GZZ B;  1YF0 A;  4E8H A;  2DLX A;  3QFB C;  4PNF A;  3KEB A;  4K2D A;  4MK3 A;  6GSU A;  5LNK e;  3NIV A;  4CDO A;  4FIW A;  2I81 A;  4PQ1 A;  4EUY A;  1UN2 A;  2K18 A;  3KMO A;  2GQL A;  3EU3 A;  4WBJ A;  2MZC A;  3VK9 A;  2ZUP A;  2VLT A;  2CVB A;  2Z9S A;  1PL1 A;  5FHI A;  2X8G A;  1M99 A;  2WS2 A;  6GSV A;  4JRR A;  1OKT A;  3EC3 A;  1X5D A;  3WT1 A;  2ON7 A;  1O73 A;  1XZO A;  3NOF A;  2JAD A;  2I1U A;  1PD2 1;  5GAN D;  4F0C A;  2XPE A;  5IMC A;  1AQW A;  4CHS A;  2MBT A;  4RQR A;  2GLR A;  2GSR A;  1QUW A;  1ABA A;  1UA5 A;  2MMN A;  3FKF A;  3IDV A;  1MEK A;  5CNW A;  2CT6 A;  5ECM B;  2H0G A;  1XW9 A;  2X4A A;  2O8V B;  5DVB A;  2DJJ A;  3KMN A;  2XBQ A;  2AJQ B;  3MDK A;  1G7E A;  4OFM A;  5IPG A;  5F8B A;  4IQA A;  2J23 A;  2DBC A;  1GUH A;  3IAS 2;  4KSO A;  1X9W B;  4XCS A;  4IW9 A;  3ZLP A;  3F4R A;  4PTS A;  2LUS A;  4MF7 A;  5H5S A;  4F82 A;  3P90 A;  1M2B A;  4PX1 A;  3FR6 A;  4GCI A;  3SWL A;  3RDW A;  4K0G A;  2HT9 A;  3IOS A;  4MZC A;  3VWW A;  4TR1 B;  1Z5Y E;  5GAP D;  2D2Z A;  2R37 A;  4ZB8 A;  3KXO A;  2H0H A;  4OO4 A;  1XCC A;  4EE0 A;  17GS A;  3U6V A;  2N5F A;  2DC5 A;  4TR0 A;  1O6J A;  4Q5R A;  5ECH B;  3TB2 A;  4ECI A;  3FZ9 A;  5DAL A;  3G7Y A;  4GQC A;  4OFN A;  4MZB A;  2WJU A;  5A4W A;  1DE1 A;  3TOU A;  2LKU A;  4USS A;  5HR2 A;  2FUG 2;  2FNO A;  3IC4 A;  3LEF A;  2MMA A;  1S3D A;  5EY6 A;  2IMK A;  4K5S A;  1GSE A;  2H6X A;  2AYT A;  4PUF C;  3I6A A;  3Q74 A;  1GH2 A;  2FA4 A;  4WKW A;  4ID0 A;  3GX8 A;  5F06 A;  3KJY A;  1X0R A;  4NV5 A;  1GL8 A;  4EIP A;  4Q5F A;  3IRA A;  5AGY A;  2LJK A;  2R4V A;  3EYT A;  4PQH A;  2YWM A;  3EMX A;  2AB6 A;  4BL7 A;  1FOV A;  5IM9 A;  5IPH A;  3BD2 A;  2PVO C;  3L9S A;  2FLS A;  2HXK A;  1G6W A;  1N2A A;  4I6X A;  5DJL A;  2IN3 A;  1SL1 B;  1B4Q A;  1A2J A;  4FYU A;  3GKX A;  2B5Y A;  2I3Y A;  2DJ1 A;  2GT5 A;  4NWY A;  2F9S A;  2H8L A;  2IJY A;  2N5B A;  1WMJ A;  4IEL A;  3UJ1 A;  3KCM A;  3L0H A;  1X9S B;  1FHE A;  1F2E A;  4X1U A;  4MNN A;  3MYD A;  4I8B A;  3HKR A;  2H0I A;  2OA7 A;  3TOT A;  1A23 A;  19GS A;  5ECO B;  2K9F A;  2TRC P;  2VL3 A;  3EWL A;  1T7P B;  1J0F A;  1JFU A;  5JWR B;  3FEU A;  2L5L A;  3FMW A;  4YKG A;  2B7K A;  4GF0 A;  4Q5N A;  2YZU A;  1JHB A;  2H6Z A;  2YP6 A;  2H19 A;  5D9X A;  2H74 A;  5CP1 A;  2UZ8 A;  1HQO A;  1S3A A;  5KN1 A;  1TDI A;  2CZ2 A;  1OE7 A;  5DJM A;  1ERU A;  2K6V A;  1SJI A;  2C3N A;  2JU5 A;  1Z9H A;  1PN0 A;  3LWA A;  3VI5 A;  1NHO A;  1WWJ A;  4I5Q A;  4GQF A;  3LJR A;  2BJX A;  4GSN A;  1V2A A;  5ENU A;  3ED3 A;  3N9J A;  2YZH A;  4I2T A;  2RLI A;  5KEJ A;  2HZF A;  2HSH A;  2CX3 A;  4ZBA A;  5G2Z A;  2AAW A;  3HJP A;  4K7N A;  4MP4 A;  4F0B A;  3CTG A;  5ECR B;  1XFL A;  2YJ7 A;  2F51 A;  4HQS A;  3U5R E;  1SL0 B;  1BYE A;  1PKW A;  2IME A;  5JWO B;  3ERG A;  3D5J A;  3RHB A;  2H30 A;  3FHK A;  4KGI A;  3EVI A;  4KW6 A;  2GS3 A;  2RUF A;  1YY7 A;  1S3C A;  4XS4 B;  3IC8 A;  3TJK A;  2CAQ A;  2KLX A;  3W6G A;  1VF1 A;  3I9V 2;  5IMZ A;  3ZRD A;  5E4W A;  5HR3 A;  3HJO A;  1Z7P A;  4MZW A;  1IYH A;  1J08 A;  2B5X A;  5HFI A;  1XIY A;  3QCP A;  1ERW A;  1XWB A;  4O7H A;  2DMM A;  1PKZ A;  1NM3 A;  4E8E A;  1GSD A;  1X5E A;  2L57 A;  3R2Q A;  2DSA A;  1EV9 A;  4XTS A;  3VLN A;  4MJC A;  5F07 A;  5J9C A;  1SL2 B;  5DBQ A;  3UBL A;  5KN0 A;  4EDY A;  2LRN A;  2X64 A;  4TRX A;  3TGZ A;  3C1R A;  1EP7 A;  3CSH A;  5KOW A;  4N30 A;  1THO A;  2OE3 A;  4Z2R A;  5CAX A;  3OR5 A;  14GS A;  4OCF A;  2FY6 A;  4IP6 A;  1ZYP A;  1SD9 A;  4DSQ A;  6GSS A;  2E2G A;  4IJI A;  1VF2 A;  4OO5 A;  3MIX A;  1XWG A;  1ZMA A;  3GKN A;  6GSY A;  1DBY A;  3CTF A;  3D21 A;  2V6K A;  5G1K A;  4BWS A;  3IHQ A;  1SJZ A;  1YKC A;  2IPA A;  4XS1 A;  4ML6 A;  4BVX A;  1VGL A;  1U87 A;  4IQ1 A;  3GMF A;  1AQV A;  1FOH A;  3HZ4 A;  1XBS A;  4HUA A;  2QA2 A;  4L5L A;  2P5Q A;  1OE8 A;  1PRX A;  1V58 A;  1WP0 A;  4AJ6 A;  4L0W A;  3UAP A;  4GWR A;  2EIR A;  3O6T A;  3O76 A;  2GVP A;  3QAW A;  5IOW A;  3FZ5 A;  3HA9 A;  4FYB A;  4X0X A;  8GSS A;  1F37 A;  2OE0 A;  2K8S A;  5CRH A;  2C3Q A;  1YKA A;  1TJD A;  1JLW A;  3WT2 A;  2FCH A;  5DQS A;  3WD6 A;  4FYC A;  3LW9 A;  3P8W A;  4HEA 2;  1PL2 A;  3APQ A;  2IIY A;  5IOX A;  1ON4 A;  3BBY A;  5AIS A;  3KP8 A;  1THX A;  2HRA A;  1OYJ A;  2GSS A;  2IMF A;  4OFT A;  4QL7 A;  3HDC A;  2FHE A;  1M9A A;  2FA8 A;  5J41 A;  4YQM A;  1V40 A;  5JCW A;  3VPQ A;  2GZZ A;  4JU5 A;  5D9W A;  1LU4 A;  4OCE A;  4CY8 A;  1W89 A;  1RQM A;  1XWA A;  1YQ1 A;  4YH2 A;  3IK7 A;  2R0G A;  2VOC A;  5JCU A;  3J7Y b;  2ALB A;  1GSU A;  1VRS D;  1BED A;  4MPF A;  2HZE B;  11GS A;  4BA7 A;  2X99 A;  1K0M A;  4JBB A;  3ME8 A;  4PXO A;  4XS4 A;  3DVW A;  1M2A A;  2E2M A;  1S3R A;  4TXO A;  3UAR A;  3GN3 A;  1PX7 A;  5DAK B;  2I4A A;  2CQ9 A;  1FAA A;  4IVF A;  3UVH A;  3GUR A;  3F9U A;  4XRD A;  1XWK A;  2QGV A;  1XW5 A;  1WE0 A;  3D4M A;  1O85 A;  1T00 A;  4WF5 A;  2OBI A;  3HD5 A;  5GST A;  2MMZ A;  1DSB A;  2YNX A;  3D0Z A;  2L4C A;  1M3J A;  1G0T A;  3D4T A;  3FY7 A;  4BWQ A;  4LL1 B;  1PSQ A;  1URM A;  1Z6N A;  1XWC A;  1JZR A;  4D73 B;  4G9H A;  4K5R A;  1BQ7 A;  1K0C A;  3MSZ A;  3IK9 A;  4G0K A;  1OVN A;  3C8E A;  3HVX A;  1PGT A;  4EO3 A;  3AY8 A;  5C04 A;  3ZVJ A;  3UEM A;  1SYX A;  1WOU A;  5ECN B;  3HVN A;  5EVO A;  1AC1 A;  3ISO A;  1A8Y A;  1EEJ A;  4NXI A;  2HNL A;  3BJ5 A;  2WCI A;  3HZ8 A;  2DJK A;  1ZGN A;  3C7M A;  3M8N A;  3ZIJ A;  16GS A;  4ZL9 A;  4ILF A;  4MLY A;  4HZ2 A;  1MTC A;  2PVQ A;  2BMX A;  4V1A g;  4K9Z A;  3PPU A;  2LQO A;  2DJ3 A;  4EL1 A;  1Q98 A;  4EDZ A;  2YJH A;  3VI7 A;  4F03 A;  1TK0 B;  2XPD A;  4V2M A;  2E0Q A;  2J9H A;  1A2M A;  2PER A;  2NTO A;  3M1G A;  2KHP A;  3GUS A;  4HSC X;  5IO0 A;  4IBP A;  13GS A;  2LQQ A;  5B6M A;  4DSR A;  2HYX A;  2G2Q A;  2VM1 A;  4DEJ A;  3GL3 A;  4ECC A;  3US3 A;  5D96 A;  3TKS C;  3H93 A;  2WGR A;  1GWC A;  1RK4 A;  3UVT A;  2H1A A;  2HI7 A;  2EIQ A;  4ML1 A;  3E9J B;  1AAZ A;  1ZCP A;  3DEX A;  1F3B A;  2A2S A;  1TI3 A;  5JWQ B;  1SKW B;  3M9K A;  2QA1 A;  4PUA A;  1EEM A;  4I97 A;  4X4J A;  3TRX A;  3F3R A;  2HSM A;  3M9J A;  3QR6 A;  2H76 A;  1ST9 A;  4NHZ A;  4NMU A;  4N10 A;  3C1S A;  1H4O A;  2JZR A;  3IA1 A;  3BCK A;  5A5K A;  3ME7 A;  4XRA A;  5DCG A;  3DKS A;  1TU8 A;  5ECS A;  3DIE A;  2B3S A;  1SD8 A;  4HJM A;  5ID2 B;  3W8S A;  1DE2 A;  4WR5 A;  5ECL B;  4NV2 A;  4LMW A;  1O81 A;  2B6M A;  2EIO A;  3EIN A;  1XW6 A;  3FZ4 A;  4MJA A;  2BTO T;  1TTZ A;  4G2E A;  4BVY B;  5DQY A;  3TKQ A;  1XOA A;  2B5E A;  4LLR A;  1JZD A;  2H1D A;  2XBI A;  2ON5 A;  5HR0 A;  1BX9 A;  4IJ3 A;  5IO2 A;  1FG4 A;  3GTU B;  3F8U A;  4YQU A;  1FVK A;  2PGT A;  4L8E A;  1HD2 A;  3IR4 A;  1PMT A;  2O89 A;  3FW2 A;  5G30 A;  3HHV A;  2KP2 A;  1BJX A;  3F4T A;  4JED A;  3Q6O A;  1TI1 A;  5J5N A;  1B9X C;  2L6C A;  3RHC A;  5HR1 A;  3GH6 A;  2R5G A;  3RPN A;  1SEN A;  4KSM A;  3DYR A;  6GST A;  3FR9 A;  5DDL A;  2M46 A;  2V41 A;  3KTB A;  1ZZY A;  4ZBB A;  3QFA C;  4EIQ A;  1SK2 A;  4H86 A;  2X8H A;  2IMD A;  5E59 A;  2NPB A;  1U88 A;  3DD3 A;  4D73 A;  4OD7 A;  4RUV A;  3H79 A;  1YJ6 A;  2GDR A;  2R2J A;  4K1F A;  1A24 A;  1U3I A;  4HS1 A;  2A4V A;  2GQM A;  3CRT A;  3EMP A;  1WIK A;  1ZYE A;  3L78 A;  3WGX A;  1B9Y C;  1SYR A;  4GSS A;  2RUE A;  1FW1 A;  2ES7 A;  2VUP A;  1GSS A;  3G7I A;  2CVK A;  4KB3 A;  1R5P A;  2VCQ A;  2V2G A;  3E3E A;  4O5Q A;  1M0U A;  3UBK A;  4HDE A;  4KAE A;  4K6X A;  4TW5 A;  3A5W A;  2LTK A;  3DGQ A;  4EXJ A;  3MWH A;  2TIR A;  1V57 A;  4TR1 A;  2VCX A;  2WB9 A;  5C00 A;  2G0F A;  1CQH A;  4ECB A;  2IFQ B;  1N8J A;  3TJJ A;  2RM5 A;  3KZQ A;  1QFN A;  3UMA A;  3RBT A;  4G0L A;  4WBR D;  3WGD A;  1OC9 B;  4GST A;  2REM A;  2VCW A;  1TRS A;  2V6O A;  2H75 A;  3CMI A;  4TXV A;  1XOB A;  5D73 A;  1J9B A;  3TKR A;  4NPB A;  3LFL A;  3NZN A;  2OAD A; 
#chains in the Genus database with same CATH homology
 2GQK A;  5ECI B;  2R0P A;  1FB6 A;  2VLU A;  4JE1 A;  1HNA A;  4KA0 A;  4G0I A;  5CRG A;  3KH9 A;  2HSY A;  2CV4 A;  3KTL A;  1USB A;  4V2N A;  3CXG A;  1H75 A;  4KND A;  1EZK A;  1GLQ A;  2WUL A;  2PMT A;  3GH9 A;  4POM A;  1WPI A;  2RM6 A;  2PPT A;  2WZ9 A;  6GSW A;  3K8N A;  3EU4 A;  2CX4 A;  4K7I A;  5ID2 A;  3HYP A;  2C8U A;  2H1B A;  4J2F A;  1AIU A;  4PQI A;  3TUE A;  3TJB A;  4ZBD A;  3TKP A;  3I69 A;  1MD3 A;  3DRN A;  4POL A;  3G7J A;  1JZO A;  1PN9 A;  5L71 A;  2YAN A;  3P2A A;  1VF3 A;  5BRT A;  3A2W A;  1M7T A;  3CSJ A;  2GSQ A;  2KP1 A;  3FRC A;  4KE3 A;  3GTU A;  1MDJ A;  5COH A;  3ZL5 A;  2JSY A;  2OAC A;  5GSS A;  3SBC A;  1GTB A;  1Z3E A;  3TKS A;  1X5C A;  4FO5 A;  4X43 A;  3QMX A;  1WJK A;  3HVS A;  2JL4 A;  1EP8 A;  22GS A;  3CYN A;  4AF2 A;  1GSF A;  4QQ7 A;  2IMI A;  2X49 A;  1NW2 A;  4GXZ A;  1GSQ A;  4XS6 A;  4K0N A;  2TRX A;  1GTU A;  2GGT A;  3N5O A;  4PNG A;  3PR8 A;  3E0U A;  4ACS A;  1GNW A;  3IBH A;  1UVZ A;  2PUK C;  4Z2U A;  2OKA A;  2P5R A;  2FWG A;  2JSZ A;  4K7O A;  2F8F A;  4ZIJ A;  1B4P A;  1OAZ A;  5IMA A;  1AXD A;  2L59 A;  1SK0 A;  2LV3 A;  1K0O A;  4TR3 A;  4CW9 A;  4POK A;  1E6B A;  5CRE A;  2DIZ A;  4P3Y B;  5IQY A;  4MF5 A;  1JZW A;  5DCH A;  2X8C A;  3LSZ A;  2C0G A;  3TKS E;  1GLP A;  4JR6 A;  3IXR A;  2VD0 A;  2H71 A;  2GT6 A;  4WF4 A;  5J4U A;  2HRN A;  4IKH A;  3M0F A;  3VFI A;  4TR4 A;  1VF4 A;  1QGV A;  2EC4 A;  4RQX A;  3EE2 A;  5G5F A;  2R0C A;  2LRC A;  2ZCT A;  3A2X A;  1A0R P;  3ZTL A;  3IV4 A;  3ZFB A;  2IFQ A;  5IMF A;  1T4Y A;  1Z6M A;  1R26 A;  2KOK A;  5IIZ A;  3WGE A;  4LMV A;  3WYW A;  1OC9 A;  3F6D A;  4DVC A;  4IHU A;  1EGO A;  1Y6E A;  2L6D A;  1ERV A;  3GNJ A;  1FVJ A;  3ZML A;  4V1A p;  6GSX A;  4OWY A;  4IS0 A;  4O5U A;  1V98 A;  2L5O A;  2VCZ A;  3P7X A;  1KTE A;  3W8J A;  1GSY A;  3IE3 A;  3LG6 A;  3APO A;  1K0D A;  3JCM L;  9GSS A;  3UIW A;  1SK1 A;  4NAX A;  3QDN A;  2IL3 A;  3GL5 A;  2B7J A;  3KIJ A;  1LJR A;  1LBK A;  2YWN A;  3G9B A;  3GYK A;  3LOR A;  4YQV A;  5HFG A;  3ZZX A;  4ULX A;  4J57 E;  1K0A A;  2N5A A;  3ZIT A;  1RW1 A;  3ZMK A;  4ZL8 A;  1TOF A;  3I43 A;  1TK5 B;  1M2D A;  1O8X A;  2PWJ A;  2AV4 A;  1ML6 A;  4KF9 A;  3VPT A;  1YDK A;  5LCZ A;  5AIV A;  18GS A;  4IGJ A;  1F3A A;  3LXT A;  4HI7 A;  1WRY A;  4AJ7 A;  4RI6 A;  2M72 A;  2QSI A;  4V2L A;  1YZX A;  2VIM A;  4MDC A;  1EWX A;  4F2I A;  5KN2 A;  3GIX A;  3ERF A;  2CVD A;  3GHA A;  2MYG A;  2VL2 C;  4HU7 A;  5JCG A;  1BAY A;  2JZT A;  2VM2 A;  5A4U A;  3HJM A;  4O92 A;  3QD9 A;  4MCU A;  1TRW A;  3PIN A;  4RI7 A;  4GLT A;  5D9V A;  1I5G A;  5HFK A;  1ERT A;  3HY2 A;  5ECK B;  2F8A A;  4L0U A;  5AIX A;  3EUR A;  3KP9 A;  5G1L A;  3A5I A;  3FYG A;  3L4N A;  1GP1 A;  5F0G A;  5ECQ B;  4YKF A;  3MAK A;  1A8L A;  2IWT A;  4BPY A;  3Q18 A;  10GS A;  3F3Q A;  1A0F A;  1O7U A;  3TDG A;  3H4K A;  1G7O A;  5H5Q A;  4KDY A;  1T8E B;  1DUG A;  5ELA A;  4XIH A;  4TOP A;  5F05 A;  3TJG A;  4EKZ A;  2VAF A;  4N0V A;  2PBJ A;  2E7P A;  3A2V A;  3APS A;  2FD3 A;  1ACV A;  1KNG A;  2C0D A;  3BOA A;  1EOH A;  4AJ8 A;  1AQX A;  2M80 A;  5AN1 A;  1K0N A;  3GKK A;  4HOJ A;  4TN8 A;  5EL8 A;  3DXB A;  3ZYW A;  4KCA A;  3RAZ A;  2A2P A;  3L9U A;  3CBU A;  4TKY A;  2HZE A;  2O87 A;  1K3Y A;  3GSS A;  2DJ2 A;  3L9V A;  4KH7 A;  3F63 A;  3M3M A;  3TRQ A;  1GUL A;  2C0F A;  3IAM 2;  2HFD A;  2V32 A;  3GRX A;  3KM6 A;  1C72 A;  4HZ4 A;  3GKM A;  3LYP A;  4MF6 A;  2O7K A;  1IYI A;  2VCV A;  3FR3 A;  5CRW A;  2LJA A;  2NDO A;  1QXH A;  1BG5 A;  5DAK A;  1YEP A;  2VD1 A;  2FWE A;  3IPZ A;  3D22 A;  2MMO A;  5IMD A;  1YF1 A;  4BVX B;  12GS A;  3RPP A;  1U6T A;  3FK8 A;  5CYY A;  4ISD A;  4POB A;  4FH8 A;  5BMU A;  4HJ2 A;  1MD4 A;  3HVV A;  4QL9 A;  2H66 A;  3TCO A;  2P0G A;  2JAC A;  5G31 A;  3GFK A;  1B8X A;  1ZYQ B;  1UC7 A;  1K0B A;  2P31 A;  4JR4 A;  4PUR A;  4TVE A;  1TXX A;  2VL9 A;  3QAG A;  2H72 A;  4ZB9 A;  2L4Q A;  1MDI A;  1T4Z A;  2HE3 A;  2R6K A;  3KD0 A;  5CO3 A;  2KUC A;  3QAV A;  2H73 A;  2LNT A;  2GZP A;  1TU7 A;  3LXZ A;  4YAP A;  2C80 A;  3TJF A;  3HXS A;  2VO4 A;  5CRD A;  2LNS A;  3TRP A;  2I9H A;  3R3E A;  4N0Z A;  1F6M C;  1HNC A;  2OE1 A;  1QK8 A;  1PA3 A;  4WXT A;  1HNB A;  2WDU A;  5D93 A;  1SJ6 A;  5A4V A;  3V1W A;  2LRT A;  5EPF A;  2A2R A;  2PU9 C;  1F9M A;  4O5R A;  1QMV A;  4O32 A;  4WR4 A;  1FB0 A;  2YOI A;  2C3T A;  3ERW A;  2DKI A;  4LA1 A;  4EC0 A;  1XPV A;  3A3T A;  1B48 A;  3MNG A;  2JZS A;  3LQ7 A;  2R3X A;  2AUV A;  4MAB A;  4MPG A;  2YWO A;  2OBK A;  4IP1 A;  1ZOF A;  3ZIV A;  3CRU A;  5IMV A;  3LYK A;  1G6Y A;  2VCT A;  2MBS A;  1TP9 A;  1GNE A;  1XXU A;  4YAV A;  1M9B A;  4TXO B;  5H5R A;  1TRU A;  3CSI A;  3FZA A;  7GSS A;  5D8I A;  4FQU A;  4DSS B;  2HRK A;  1TK8 B;  2XC2 A;  2HRF A;  2LJR A;  3HCZ A;  4GRF A;  3Q19 A;  4Z2T A;  5INY A;  4ZXG A;  1A2L A;  1W4V A;  5B6N A;  20GS A;  1T1V A;  1Y25 A;  1Z7R A;  1R5A A;  1ZL9 A;  4JZQ A;  3F6F A;  2LS5 A;  2H6Y A;  1Q4J A;  2O85 A;  1GUK A;  1TKD B;  5B8B A;  2YCD A;  4EVM A;  3QOU A;  4WET A;  1U3A A;  5G5E A;  3GST A;  1SKR B;  4AGS A;  3PH9 A;  4Z7X A;  1TW9 A;  1GUM A;  4EF0 A;  2OJL A;  4BVY A;  5KN3 A;  4ZIL A;  3ZVJ D;  3KH7 A;  4N11 A;  1FO5 A;  1R4W A;  3J7Y k;  4KCE A;  2VL2 A;  3LGC A;  5ECP B;  2DIY A;  3H8Q A;  2LST A;  4NHW A;  2VLV A;  2XHF A;  3O3T A;  1SKS B;  1K3L A;  2FGX A;  1HYU A;  1KBN A;  4L5O A;  2H1G A;  1KEB A;  5ELG A;  2YPM A;  1GRX A;  5ABR A;  4ICY A;  4J56 E;  3VWX A;  2QC7 A;  4K8M A;  2RII A;  4WEY A;  1OC8 A;  2AHE A;  3ZFL A;  1ILO A;  1PQN A;  1AUC A;  2NBS A;  4IN0 A;  2B1L A;  1PX6 A;  2YWI A;  3F4S A;  4KX4 A;  3VWV A;  2K8V A;  3GV1 A;  4KUN A;  4F9Z A;  3IHG A;  4MJB A;  5D9T A;  1MDK A;  5J3R A;  1V9W A;  2WFC A;  1E2Y A;  3S9F A;  2PN8 A;  2WRT A;  4KDU A;  2CA8 A;  2YN1 A;  2GST A;  2YV9 A;  3F0I A;  1CQG A;  1XVW A;  4CY6 A;  1K3O A;  4G10 A;  4A5P A;  1OKD A;  4ZL7 A;  3D6I A;  1X9M B;  1QQ2 A;  1TRV A;  4PGT A;  3ZRE A;  4MJE A;  1OC3 A;  3C73 A;  1EGR A;  4HU9 A;  4G19 A;  5DAL B;  1AW9 A;  3C71 A;  2DKH A;  4LL4 B;  5FWG A;  5KOX A;  4MH2 A;  2HLS A;  2C4J A;  1NHY A;  5B7C A;  5HQP A;  2LEG A;  2DJ0 A;  2H70 A;  1T3B A;  2ZNM A;  4Q5Q A;  1I9D A;  5LD0 A;  1O8W A;  1NSW A;  3GX0 A;  2DML A;  4ECJ A;  4MMM A;  1YEX A;  4KDX A;  5B8A A;  4GTU A;  1GTI A;  4MH3 A;  3VWU A;  2GZY A;  2H01 A;  3EPT A;  2QKE A;  4OMV A;  4XHM A;  3KGK A;  1EV4 A;  1SU9 A;  2F3M A;  3PGT A;  1JLV A;  2YV7 A;  3DVX A;  4ZB6 A;  4BL7 B;  2FWH A;  2GTU A;  3QPM A;  2C1Y A;  4I2U A;  3DML A;  3BCI A;  4HQZ A;  5J9B A;  3UL3 A;  5FT3 A;  3DWV A;  1XVQ A;  2C0E A;  4K2X A;  2B1K A;  2FWF A;  1ZYN A;  2V1M A;  2CAI A;  1EOG A;  3UOM A;  3GA4 A;  1GTA A;  2A4H A;  3H1N A;  2CZ3 A;  3VUR A;  1R7H A;  4MA9 A;  2NVL A;  4DSS A;  5GZZ B;  1YF0 A;  4E8H A;  2DLX A;  3QFB C;  4PNF A;  3KEB A;  4K2D A;  4MK3 A;  6GSU A;  5LNK e;  3NIV A;  4CDO A;  4FIW A;  2I81 A;  4PQ1 A;  4EUY A;  1UN2 A;  2K18 A;  3KMO A;  2GQL A;  3EU3 A;  4WBJ A;  2MZC A;  3VK9 A;  2ZUP A;  2VLT A;  2CVB A;  2Z9S A;  1PL1 A;  5FHI A;  2X8G A;  1M99 A;  2WS2 A;  6GSV A;  4JRR A;  1OKT A;  3EC3 A;  1X5D A;  3WT1 A;  2ON7 A;  1O73 A;  1XZO A;  3NOF A;  2JAD A;  2I1U A;  1PD2 1;  5GAN D;  4F0C A;  2XPE A;  5IMC A;  1AQW A;  4CHS A;  2MBT A;  4RQR A;  2GLR A;  2GSR A;  1QUW A;  1ABA A;  1UA5 A;  2MMN A;  3FKF A;  3IDV A;  1MEK A;  5CNW A;  2CT6 A;  5ECM B;  2H0G A;  1XW9 A;  2X4A A;  2O8V B;  5DVB A;  2DJJ A;  3KMN A;  2XBQ A;  2AJQ B;  3MDK A;  1G7E A;  4OFM A;  5IPG A;  5F8B A;  4IQA A;  2J23 A;  2DBC A;  1GUH A;  3IAS 2;  4KSO A;  1X9W B;  4XCS A;  4IW9 A;  3ZLP A;  3F4R A;  4PTS A;  2LUS A;  4MF7 A;  5H5S A;  4F82 A;  3P90 A;  1M2B A;  4PX1 A;  3FR6 A;  4GCI A;  3SWL A;  3RDW A;  4K0G A;  2HT9 A;  3IOS A;  4MZC A;  3VWW A;  4TR1 B;  1Z5Y E;  5GAP D;  2D2Z A;  2R37 A;  4ZB8 A;  3KXO A;  2H0H A;  4OO4 A;  1XCC A;  4EE0 A;  17GS A;  3U6V A;  2N5F A;  2DC5 A;  4TR0 A;  1O6J A;  4Q5R A;  5ECH B;  3TB2 A;  4ECI A;  3FZ9 A;  5DAL A;  3G7Y A;  4GQC A;  4OFN A;  4MZB A;  2WJU A;  5A4W A;  1DE1 A;  3TOU A;  2LKU A;  4USS A;  5HR2 A;  2FUG 2;  2FNO A;  3IC4 A;  3LEF A;  2MMA A;  1S3D A;  5EY6 A;  2IMK A;  4K5S A;  1GSE A;  2H6X A;  2AYT A;  4PUF C;  3I6A A;  3Q74 A;  1GH2 A;  2FA4 A;  4WKW A;  4ID0 A;  3GX8 A;  5F06 A;  3KJY A;  1X0R A;  4NV5 A;  1GL8 A;  4EIP A;  4Q5F A;  3IRA A;  5AGY A;  2LJK A;  2R4V A;  3EYT A;  4PQH A;  2YWM A;  3EMX A;  2AB6 A;  4BL7 A;  1FOV A;  5IM9 A;  5IPH A;  3BD2 A;  2PVO C;  3L9S A;  2FLS A;  2HXK A;  1G6W A;  1N2A A;  4I6X A;  5DJL A;  2IN3 A;  1SL1 B;  1B4Q A;  1A2J A;  4FYU A;  3GKX A;  2B5Y A;  2I3Y A;  2DJ1 A;  2GT5 A;  4NWY A;  2F9S A;  2H8L A;  2IJY A;  2N5B A;  1WMJ A;  4IEL A;  3UJ1 A;  3KCM A;  3L0H A;  1X9S B;  1FHE A;  1F2E A;  4X1U A;  4MNN A;  3MYD A;  4I8B A;  3HKR A;  2H0I A;  2OA7 A;  3TOT A;  1A23 A;  19GS A;  5ECO B;  2K9F A;  2TRC P;  2VL3 A;  3EWL A;  1T7P B;  1J0F A;  1JFU A;  5JWR B;  3FEU A;  2L5L A;  3FMW A;  4YKG A;  2B7K A;  4GF0 A;  4Q5N A;  2YZU A;  1JHB A;  2H6Z A;  2YP6 A;  2H19 A;  5D9X A;  2H74 A;  5CP1 A;  2UZ8 A;  1HQO A;  1S3A A;  5KN1 A;  1TDI A;  2CZ2 A;  1OE7 A;  5DJM A;  1ERU A;  2K6V A;  1SJI A;  2C3N A;  2JU5 A;  1Z9H A;  1PN0 A;  3LWA A;  3VI5 A;  1NHO A;  1WWJ A;  4I5Q A;  4GQF A;  3LJR A;  2BJX A;  4GSN A;  1V2A A;  5ENU A;  3ED3 A;  3N9J A;  2YZH A;  4I2T A;  2RLI A;  5KEJ A;  2HZF A;  2HSH A;  2CX3 A;  4ZBA A;  5G2Z A;  2AAW A;  3HJP A;  4K7N A;  4MP4 A;  4F0B A;  3CTG A;  5ECR B;  1XFL A;  2YJ7 A;  2F51 A;  4HQS A;  3U5R E;  1SL0 B;  1BYE A;  1PKW A;  2IME A;  5JWO B;  3ERG A;  3D5J A;  3RHB A;  2H30 A;  3FHK A;  4KGI A;  3EVI A;  4KW6 A;  2GS3 A;  2RUF A;  1YY7 A;  1S3C A;  4XS4 B;  3IC8 A;  3TJK A;  2CAQ A;  2KLX A;  3W6G A;  1VF1 A;  3I9V 2;  5IMZ A;  3ZRD A;  5E4W A;  5HR3 A;  3HJO A;  1Z7P A;  4MZW A;  1IYH A;  1J08 A;  2B5X A;  5HFI A;  1XIY A;  3QCP A;  1ERW A;  1XWB A;  4O7H A;  2DMM A;  1PKZ A;  1NM3 A;  4E8E A;  1GSD A;  1X5E A;  2L57 A;  3R2Q A;  2DSA A;  1EV9 A;  4XTS A;  3VLN A;  4MJC A;  5F07 A;  5J9C A;  1SL2 B;  5DBQ A;  3UBL A;  5KN0 A;  4EDY A;  2LRN A;  2X64 A;  4TRX A;  3TGZ A;  3C1R A;  1EP7 A;  3CSH A;  5KOW A;  4N30 A;  1THO A;  2OE3 A;  4Z2R A;  5CAX A;  3OR5 A;  14GS A;  4OCF A;  2FY6 A;  4IP6 A;  1ZYP A;  1SD9 A;  4DSQ A;  6GSS A;  2E2G A;  4IJI A;  1VF2 A;  4OO5 A;  3MIX A;  1XWG A;  1ZMA A;  3GKN A;  6GSY A;  1DBY A;  3CTF A;  3D21 A;  2V6K A;  5G1K A;  4BWS A;  3IHQ A;  1SJZ A;  1YKC A;  2IPA A;  4XS1 A;  4ML6 A;  4BVX A;  1VGL A;  1U87 A;  4IQ1 A;  3GMF A;  1AQV A;  1FOH A;  3HZ4 A;  1XBS A;  4HUA A;  2QA2 A;  4L5L A;  2P5Q A;  1OE8 A;  1PRX A;  1V58 A;  1WP0 A;  4AJ6 A;  4L0W A;  3UAP A;  4GWR A;  2EIR A;  3O6T A;  3O76 A;  2GVP A;  3QAW A;  5IOW A;  3FZ5 A;  3HA9 A;  4FYB A;  4X0X A;  8GSS A;  1F37 A;  2OE0 A;  2K8S A;  5CRH A;  2C3Q A;  1YKA A;  1TJD A;  1JLW A;  3WT2 A;  2FCH A;  5DQS A;  3WD6 A;  4FYC A;  3LW9 A;  3P8W A;  4HEA 2;  1PL2 A;  3APQ A;  2IIY A;  5IOX A;  1ON4 A;  3BBY A;  5AIS A;  3KP8 A;  1THX A;  2HRA A;  1OYJ A;  2GSS A;  2IMF A;  4OFT A;  4QL7 A;  3HDC A;  2FHE A;  1M9A A;  2FA8 A;  5J41 A;  4YQM A;  1V40 A;  5JCW A;  3VPQ A;  2GZZ A;  4JU5 A;  5D9W A;  1LU4 A;  4OCE A;  4CY8 A;  1W89 A;  1RQM A;  1XWA A;  1YQ1 A;  4YH2 A;  3IK7 A;  2R0G A;  2VOC A;  5JCU A;  3J7Y b;  2ALB A;  1GSU A;  1VRS D;  1BED A;  4MPF A;  2HZE B;  11GS A;  4BA7 A;  2X99 A;  1K0M A;  4JBB A;  3ME8 A;  4PXO A;  4XS4 A;  3DVW A;  1M2A A;  2E2M A;  4TXO A;  3UAR A;  3GN3 A;  1PX7 A;  5DAK B;  2I4A A;  2CQ9 A;  1FAA A;  4IVF A;  3UVH A;  3GUR A;  3F9U A;  4XRD A;  1XWK A;  2QGV A;  1XW5 A;  1WE0 A;  3D4M A;  1O85 A;  1T00 A;  4WF5 A;  2OBI A;  3HD5 A;  5GST A;  2MMZ A;  1DSB A;  2YNX A;  3D0Z A;  2L4C A;  1G0T A;  3D4T A;  3FY7 A;  4BWQ A;  4LL1 B;  1PSQ A;  1URM A;  1Z6N A;  1XWC A;  1JZR A;  4D73 B;  4G9H A;  4K5R A;  1BQ7 A;  1K0C A;  3MSZ A;  3IK9 A;  4G0K A;  1OVN A;  3C8E A;  3HVX A;  1PGT A;  4EO3 A;  3AY8 A;  5C04 A;  3ZVJ A;  3UEM A;  1SYX A;  1WOU A;  5ECN B;  5EVO A;  1AC1 A;  3ISO A;  1A8Y A;  1EEJ A;  4NXI A;  2HNL A;  3BJ5 A;  2WCI A;  3HZ8 A;  2DJK A;  1ZGN A;  3C7M A;  3M8N A;  3ZIJ A;  16GS A;  4ZL9 A;  4ILF A;  4MLY A;  4HZ2 A;  1MTC A;  2PVQ A;  2BMX A;  4V1A g;  4K9Z A;  3PPU A;  2LQO A;  2DJ3 A;  4EL1 A;  1Q98 A;  4EDZ A;  2YJH A;  3VI7 A;  4F03 A;  1TK0 B;  2XPD A;  4V2M A;  2E0Q A;  2J9H A;  1A2M A;  2PER A;  2NTO A;  3M1G A;  2KHP A;  3GUS A;  5IO0 A;  4IBP A;  13GS A;  2LQQ A;  5B6M A;  4DSR A;  2HYX A;  2G2Q A;  2VM1 A;  4DEJ A;  3GL3 A;  4ECC A;  3US3 A;  5D96 A;  3TKS C;  3H93 A;  2WGR A;  1GWC A;  1RK4 A;  3UVT A;  2H1A A;  2HI7 A;  2EIQ A;  4ML1 A;  3E9J B;  1AAZ A;  1ZCP A;  3DEX A;  1F3B A;  2A2S A;  1TI3 A;  5JWQ B;  1SKW B;  3M9K A;  2QA1 A;  4PUA A;  1EEM A;  4I97 A;  4X4J A;  3TRX A;  3F3R A;  2HSM A;  3M9J A;  3QR6 A;  2H76 A;  1ST9 A;  4NHZ A;  4NMU A;  4N10 A;  3C1S A;  1H4O A;  2JZR A;  3IA1 A;  3BCK A;  5A5K A;  3ME7 A;  4XRA A;  5DCG A;  3DKS A;  1TU8 A;  5ECS A;  3DIE A;  2B3S A;  1SD8 A;  4HJM A;  5ID2 B;  3W8S A;  1DE2 A;  4WR5 A;  5ECL B;  4NV2 A;  4LMW A;  1O81 A;  2B6M A;  2EIO A;  3EIN A;  1XW6 A;  3FZ4 A;  4MJA A;  2BTO T;  1TTZ A;  4G2E A;  4BVY B;  5DQY A;  3TKQ A;  1XOA A;  2B5E A;  4LLR A;  1JZD A;  2H1D A;  2XBI A;  2ON5 A;  5HR0 A;  1BX9 A;  4IJ3 A;  5IO2 A;  1FG4 A;  3GTU B;  3F8U A;  4YQU A;  1FVK A;  2PGT A;  4L8E A;  1HD2 A;  3IR4 A;  1PMT A;  2O89 A;  3FW2 A;  5G30 A;  3HHV A;  2KP2 A;  1BJX A;  3F4T A;  4JED A;  3Q6O A;  1TI1 A;  5J5N A;  1B9X C;  2L6C A;  3RHC A;  5HR1 A;  3GH6 A;  2R5G A;  3RPN A;  1SEN A;  4KSM A;  3DYR A;  6GST A;  3FR9 A;  5DDL A;  2M46 A;  2V41 A;  3KTB A;  1ZZY A;  4ZBB A;  3QFA C;  4EIQ A;  1SK2 A;  4H86 A;  2X8H A;  2IMD A;  5E59 A;  2NPB A;  1U88 A;  3DD3 A;  4D73 A;  4OD7 A;  4RUV A;  3H79 A;  1YJ6 A;  2GDR A;  2R2J A;  4K1F A;  1A24 A;  1U3I A;  4HS1 A;  2A4V A;  2GQM A;  3CRT A;  3EMP A;  1WIK A;  1ZYE A;  3L78 A;  3WGX A;  1B9Y C;  1SYR A;  4GSS A;  2RUE A;  1FW1 A;  2ES7 A;  2VUP A;  1GSS A;  3G7I A;  2CVK A;  4KB3 A;  1R5P A;  2VCQ A;  2V2G A;  3E3E A;  4O5Q A;  1M0U A;  3UBK A;  4HDE A;  4KAE A;  4K6X A;  4TW5 A;  3A5W A;  2LTK A;  3DGQ A;  4EXJ A;  3MWH A;  2TIR A;  1V57 A;  4TR1 A;  2VCX A;  2WB9 A;  5C00 A;  2G0F A;  1CQH A;  4ECB A;  2IFQ B;  1N8J A;  3TJJ A;  2RM5 A;  3KZQ A;  1QFN A;  3UMA A;  3RBT A;  4G0L A;  4WBR D;  3WGD A;  1OC9 B;  4GST A;  2REM A;  2VCW A;  1TRS A;  2V6O A;  2H75 A;  3CMI A;  4TXV A;  1XOB A;  5D73 A;  1J9B A;  3TKR A;  4NPB A;  3LFL A;  3NZN A;  2OAD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...