3TKPA

Crystal structure of full-length human peroxiredoxin 4 in the reduced form
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
197
structure length
197
Chain Sequence
HLSKAKISKPAPYWEGTAVIDGEFKELKLTDYRGKYLVFFFYPLDFTFVCPTEIIAFGDRLEEFRSINTEVVACSVDSQFTHLAWINTPRRQGGLGPIRIPLLSDLTHQISKDYGVYLEDSGHTLRGLFIIDDKGILRQITLNDLPVGRSVDETLRLVQAFQYTDKHGEVCPAGWKPGSETIIPDPAGKLKYFDKLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Peroxiredoxin-4
publication title Structural insights into the peroxidase activity and inactivation of human peroxiredoxin 4
pubmed doi rcsb
source organism Homo sapiens
total genus 67
structure length 197
sequence length 197
chains with identical sequence B, C, D, E
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2011-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00578 AhpC-TSA AhpC/TSA family
A PF10417 1-cysPrx_C C-terminal domain of 1-Cys peroxiredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3tkpA00
1BJXA 2AUVA 4EE0A 1Z9HA 2L59A 2QC7A 5IMDA 4XS6A 4J2FA 4KSOA 4MH2A 3WYWA 2VL3A 3L9VA 3M3MA 4GQCA 1OYJA 1WMJA 2RUEA 2LS5A 1QQ2A 5IO2A 1YJ6A 13GSA 4BA7A 2YJ7A 3VI5A 2YN1A 4OO5A 1GTIA 4X43A 2LRNA 4JEDA 4KH7A 17GSA 5B8AA 3LQ7A 4AJ6A 4L8EA 1YKCA 3LSZA 1JHBA 3BD2A 4X1UA 3J7Yb 5HR1A 4JRRA 1WWJA 5C00A 2H8LA 4OWYA 1GTUA 5D9WA 1SK0A 2IFQA 5CRGA 4GXZA 4V2LA 1HQOA 2H1BA 1GSEA 2EIQA 1X9SB 2LKUA 1BQ7A 2I1UA 1ML6A 3LFLA 5DVBA 1YY7A 3QFAC 1QMVA 1DUGA 1K3LA 1ON4A 4BVYA 2PN8A 2PWJA 4ZL9A 2V1MA 3ZVJA 3NIVA 1H75A 2X99A 3GFKA 3G7IA 5KN3A 2K6VA 1GLQA 5DDLA 2PGTA 2ZCTA 2DJ2A 1KBNA 1FO5A 1WE0A 5ABRA 4TR4A 2XPDA 1Y6EA 1K0BA 2PUKC 1K0CA 5JWQB 2H72A 2X64A 5ECQB 4HJMA 3TOUA 1WOUA 4Z7XA 4ULXA 1U87A 3RAZA 3ME7A 5E59A 3LYKA 1U88A 2K8VA 1SYRA 2JZSA 2IN3A 2WULA 4EKZA 4OCEA 2K8SA 1GL8A 4XRDA 4V2MA 5J9BA 3M1GA 5ECRB 2O8VB 1TRVA 5IO0A 2FD3A 4TXOA 2CZ2A 3TJBA 1M2DA 3CSIA 4WR5A 5ECSA 5IMZA 4ML1A 4NXIA 2CV4A 5F06A 5DBQA 2O89A 4P3YB 1TI1A 3UBKA 3CBUA 4I5QA 4IP6A 2GZZA 2DC5A 1ZGNA 1TRSA 4PUAA 2H74A 2WDUA 2HZEA 2WFCA 4AJ7A 3O3TA 1GUMA 3BCKA 3L9UA 5INYA 2E2GA 2NDOA 1DBYA 4F9ZA 4PQHA 1FB6A 2DLXA 4NV2A 4N10A 2WZ9A 3APSA 12GSA 3HKRA 2I81A 3QPMA 3R2QA 2CAQA 2VM2A 3E3EA 1GNWA 3LORA 4EXJA 2RLIA 1ZL9A 4MLYA 2HT9A 2KLXA 2PVOC 3D0ZA 2YV7A 4NHZA 5ECPB 4ZB8A 1J08A 1BEDA 2KOKA 1I5GA 1GTBA 1XBSA 5JCWA 4TR3A 4KDYA 4CW9A 4RQXA 2BMXA 1TKDB 3QCPA 4IQ1A 2P0GA 3IK9A 4BL7A 5CRDA 3SBCA 4DVCA 2QSIA 3DD3A 1OAZA 2ZNMA 8GSSA 3W8JA 4N30A 3Q18A 3H79A 2R5GA 2CX3A 4MMMA 1V40A 2ON7A 4WBRD 3QAGA 4LA1A 2L4CA 5ECIB 1SKSB 2NPBA 2C0DA 1T4YA 1PKZA 1T4ZA 1TP9A 4HQSA 4KUNA 4WEYA 4KGIA 4RUVA 3IPZA 2H0HA 1R4WA 2GT6A 3MAKA 1MTCA 1SL0B 2LUSA 3GA4A 2LTKA 1YF1A 4IP1A 1F3AA 3ZMKA 3VWUA 3C1SA 2CX4A 1B9YC 2F8FA 2LEGA 1S3AA 4NPBA 4ECIA 1AIUA 2B5EA 4KE3A 5FWGA 4GF0A 3TKRA 1QK8A 3UJ1A 3OR5A 2DJ0A 2VLVA 3GHAA 1ILOA 4G10A 1XPVA 2I9HA 3GKKA 4HU7A 1HD2A 3F6FA 2YWMA 1ABAA 2AJQB 4LLRA 1JZRA 4KB3A 5DAKA 3HDCA 5IM9A 1NHYA 1PX7A 5GAPD 3EU4A 1SJ6A 2O7KA 2F51A 2HRFA 2N5FA 3ZLPA 1U3AA 2DJ1A 1YZXA 5D73A 3KJYA 1Z7RA 4MF5A 4FYUA 3MWHA 3LXTA 3F0IA 2LNSA 4WBJA 2C8UA 4E8HA 1DE2A 5DALA 2VCWA 4IS0A 2R37A 4ZXGA 2B1LA 1V58A 2VCQA 3GURA 2EIOA 3UL3A 1MDJA 2A2RA 1AW9A 1MD3A 2YWOA 2GZPA 3D4MA 4GLTA 2YWIA 3TUEA 1TK5B 5AN1A 2GQMA 3C7MA 3WGEA 5GSTA 2TIRA 4AF2A 2C3TA 3KTLA 4LL4B 1GTAA 1NHOA 1SYXA 5G5FA 3ZIJA 2M46A 2DJ3A 3BCIA 3DIEA 5ECKB 5G1KA 1SKWB 4MZWA 3KXOA 4FYCA 4PGTA 1FAAA 3FR6A 4PXOA 3HVXA 4OO4A 2BJXA 3EMPA 4XHMA 3GYKA 4NHWA 2L57A 3IDVA 3A2VA 2TRCP 3EINA 4TR1B 3V1WA 1HNBA 1K0NA 4Q5RA 1EOHA 2OACA 4KSMA 4TVEA 2H6YA 4DSQA 3UBLA 3IE3A 1G7OA 3EMXA 5CO3A 3L9SA 2GDRA 4HQZA 4OCFA 3VLNA 1LBKA 2N5AA 1PQNA 3VWXA 1HYUA 3QAWA 2E7PA 2HNLA 4K7IA 3FHKA 3TKSC 1GUKA 2QGVA 3DXBA 5IOXA 1XIYA 3RBTA 2X8HA 1VRSD 3QAVA 3NOFA 1YEPA 5G5EA 3HA9A 3O6TA 1WRYA 5GZZB 3EWLA 4DSRA 1F6MC 2YCDA 1FVKA 4MH3A 5HQPA 3TDGA 4MJEA 4D73A 4KA0A 3KH9A 3CRUA 4XS4A 3W6GA 5F07A 5J9CA 1O81A 4PNGA 3D4TA 1GH2A 2RM6A 2GSSA 3A5WA 1ZOFA 2C4JA 3U5RE 4GWRA 3GL5A 2MYGA 5H5QA 3VK9A 2HXKA 3KIJA 1Y25A 4JBBA 4KX4A 5B6NA 2B3SA 2DIZA 1F37A 1N8JA 1ERVA 3I43A 2CZ3A 1XFLA 2DIYA 3TKQA 2NTOA 1BG5A 1JFUA 1LJRA 1HNAA 2JZRA 4MZCA 3IXRA 5IOWA 2WJUA 4POBA 1AXDA 1NM3A 4L0WA 4ZL7A 2HSHA 11GSA 3TKPA 4F2IA 3FZAA 2FHEA 3ZFLA 5GSSA 3LEFA 5CRWA 3FY7A 1A23A 2XBQA 5ID2A 1PA3A 5LD0A 2K18A 4XCSA 5FT3A 1PGTA 5B7CA 2MMOA 4MA9A 4IELA 3Q6OA 4HZ2A 1UA5A 3HVVA 3F9UA 3GV1A 3ZMLA 2H19A 2LRTA 1GLPA 3EURA 4Q5NA 5J4UA 2HFDA 2A2SA 2J9HA 3IR4A 3PR8A 3F6DA 4MJAA 3QD9A 1T8EB 1X5EA 1Z3EA 2H76A 1G0TA 3CXGA 1AQXA 5DCGA 1KNGA 4ZBDA 3TOTA 5IMCA 3S9FA 5FHIA 2VL2A 4LMVA 1V57A 3M9KA 1JZOA 1MD4A 5DJMA 1PRXA 6GSVA 3ERFA 1SD8A 3DYRA 3GX0A 3SWLA 4FO5A 2L6DA 3G9BA 1SENA 4FH8A 1OC8A 2L6CA 3I9V2 3VFIA 2YZHA 19GSA 1MEKA 1SU9A 2CT6A 4IW9A 2X8CA 2DSAA 4L5OA 2VOCA 4GCIA 4POKA 1DE1A 3WT1A 2VAFA 4NV5A 3I69A 1K0OA 2V6KA 3QR6A 2FA8A 1XCCA 3ZITA 1WPIA 4K9ZA 3VI7A 1E2YA 2CVKA 14GSA 1GSYA 3GNJA 5H5SA 2JSZA 3M9JA 4K1FA 1GSSA 5DJLA 4PURA 1V2AA 2Z9SA 4E8EA 4H86A 1YEXA 3L0HA 4DSSA 4HOJA 3CTGA 3HYPA 3NZNA 4ECCA 3TB2A 5IMFA 3H4KA 4IN0A 1CQHA 2ES7A 3FR3A 3M0FA 4I97A 1FB0A 1TRUA 5EY6A 2M80A 2F3MA 2B7JA 4CDOA 1EZKA 2IFQB 4YQMA 3ED3A 3TKSE 3UVTA 5A4VA 1SKRB 1UVZA 3HHVA 2KP1A 1ZYQB 1TK0B 5CP1A 2FLSA 5HR2A 2XHFA 2CQ9A 1UN2A 2PMTA 3GSSA 4OD7A 5B8BA 3F8UA 2VLUA 2GQLA 3TRPA 1IYHA 4ZB9A 5EVOA 2J23A 4MCUA 1TW9A 3IAM2 1VF4A 1CQGA 1FG4A 1OE8A 5ECLB 3EVIA 5D9XA 1XVWA 2C80A 2L4QA 3LWAA 3CYNA 1GULA 16GSA 2OADA 1EOGA 1TU7A 3RPNA 1EP7A 4F0BA 4I2TA 2HRNA 3GIXA 4ISDA 1RW1A 1ZYEA 2YWNA 3GL3A 2AV4A 3P8WA 1X9MB 2DBCA 2VCXA 5GAND 4QL9A 4GSNA 3F3RA 2C3NA 3N5OA 2EC4A 4QL7A 1N2AA 2MBSA 3WGDA 1OC9A 1VF2A 4ZL8A 1YKAA 5JCGA 4EO3A 3UVHA 2FY6A 4MF6A 4AGSA 1R7HA 2LJAA 4TXOB 2FUG2 5IIZA 4ECBA 2C1YA 3VURA 3HJMA 4GRFA 3ZREA 3RHCA 1C72A 3KTBA 4MK3A 2HE3A 3HZ8A 2AB6A 4OFTA 2CVBA 2V2GA 3TKSA 4EVMA 1Q98A 1M99A 3KD0A 2PBJA 1PKWA 2H01A 2ZUPA 1GSQA 1PX6A 2XC2A 1M7TA 4BPYA 1AUCA 2HZEB 2C0GA 3ZZXA 3MDKA 1A0FA 5HFKA 1XW5A 3KCMA 4MJCA 1RK4A 4O7HA 2AYTA 2NVLA 1AAZA 1OKTA 3RDWA 1GSFA 3GTUA 2IMEA 5CRHA 2B5XA 1A8YA 1T1VA 4K6XA 2YANA 1GRXA 1EEJA 2OE1A 2HYXA 3DRNA 4TW5A 5A4WA 5IMAA 2H66A 3DGQA 2HZFA 4I8BA 1ERUA 5KN1A 2DMMA 1AQWA 3QMXA 2R2JA 3CSHA 4YAVA 2B7KA 1TK8B 6GSTA 5KEJA 4WF5A 1OC3A 4WXTA 2H0IA 1K0DA 3A2XA 1OKDA 3ISOA 3KGKA 3FRCA 2LQOA 1U6TA 1BAYA 3WT2A 3ZIVA 4CHSA 3KEBA 1K0AA 1BYEA 4OMVA 2B1KA 2H30A 4Q5QA 4F0CA 2VO4A 2WS2A 3GKNA 3E9JB 3P7XA 4IQAA 2VIMA 2OKAA 3RPPA 2GTUA 3IBHA 2OBIA 1TOFA 2DJKA 1Z6NA 2IMFA 3GX8A 3RHBA 1EWXA 1G6YA 3FZ4A 4WKWA 4O5RA 1JLWA 1YDKA 4LMWA 5CYYA 4K7NA 3TJJA 2C0FA 5D9VA 1USBA 3H8QA 1M2BA 3US3A 3FEUA 4F03A 1A0RP 2IPAA 2YOIA 3C73A 1K3OA 3DVXA 2LSTA 5F8BA 4POMA 2ON5A 5HFGA 4XS1A 3ZRDA 2F8AA 2VCTA 3W8SA 3D5JA 2GZYA 2JSYA 4G9HA 1X5CA 3DMLA 4TN8A 3F4SA 5DAKB 2L5OA 2E2MA 5COHA 2ALBA 4K0GA 3HD5A 4NWYA 1A2MA 2AHEA 3IA1A 3ZYWA 4I2UA 3Q19A 5G1LA 1TJDA 5LCZA 3D6IA 5J3RA 4RI6A 3VPTA 2JZTA 2KUCA 3BJ5A 3FW2A 2YPMA 4GSTA 4K0NA 3QOUA 4JE1A 1BX9A 1VGLA 4WETA 2LRCA 4KDUA 5IQYA 5AISA 1KTEA 2K9FA 5EPFA 5DALB 1M9BA 2GSTA 4ZILA 4X0XA 3LGCA 2YZUA 4ZBAA 4NMUA 2IWTA 1FHEA 2OE3A 5LNKe 2M72A 4K2DA 2CVDA 2I3YA 2LQQA 2HLSA 1SJIA 1XW6A 1S3CA 2XBIA 4POLA 5D93A 3GKXA 1QGVA 3CSJA 2A4VA 1JLVA 3VWWA 2N5BA 5ENUA 1RQMA 1ZZYA 1ZCPA 3IOSA 4MZBA 2V6OA 5KN0A 3LG6A 4O92A 2H1DA 2GT5A 1AC1A 2VD1A 2NBSA 4Q5FA 4GTUA 1F3BA 3GMFA 2H71A 3ZL5A 4BWSA 3A3TA 2L5LA 3HVSA 1O8WA 1J0FA 3UAPA 3APQA 5E4WA 4GQFA 4KAEA 1THOA 4WF4A 2WRTA 4EF0A 2TRXA 3H1NA 1KEBA 2GLRA 3GRXA 4YAPA 4DEJA 3IHQA 1O7UA 4ID0A 4ZBBA 4KDXA 3EC3A 3O76A 1R5AA 5C04A 2QKEA 4OFNA 6GSYA 2P5RA 4BVXA 3IC4A 4L0UA 1GP1A 2DJJA 5HFIA 1FOVA 3HCZA 3DEXA 1WIKA 2YP6A 1A2LA 5L71A 1X0RA 3P90A 4JZQA 3I6AA 4RQRA 2H1AA 6GSSA 1B8XA 2MMNA 3HY2A 1X9WB 4HUAA 5JCUA 3LYPA 4J57E 4HDEA 4TOPA 4D73B 2D2ZA 22GSA 5H5RA 4XS4B 1XW9A 4I6XA 2OBKA 1PN9A 4IGJA 3U6VA 2R4VA 5F05A 1O73A 1Q4JA 2FCHA 4NAXA 3ZFBA 3ME8A 4F82A 1XWBA 2H0GA 3TRXA 4N0VA 3PH9A 4KW6A 1I9DA 6GSXA 4JR6A 1SL1B 3KP9A 4QQ7A 4MJBA 2MBTA 2H1GA 4V1Ap 3F3QA 5ECOB 1DSBA 3VWVA 1GSUA 2MZCA 1XOAA 2I4AA 4ILFA 4EDZA 1TXXA 5CNWA 5G30A 2B6MA 1T3BA 1ZMAA 3CTFA 2KP2A 2H73A 1O6JA 5ID2B 2FGXA 1TU8A 4GSSA 1NSWA 3DWVA 2V41A 3LJRA 3QDNA 2HI7A 1SK1A 4IHUA 5A5KA 3TRQA 2C3QA 3FZ5A 1ST9A 5ECHB 3L4NA 1XZOA 5IPHA 2FNOA 3GKMA 2P5QA 2LJRA 1W89A 2MMAA 3Q74A 2R3XA 4PUFC 1V98A 1VF1A 1G7EA 2H75A 1E6BA 1GSDA 2IMDA 2REMA 6GSUA 1XWKA 1NW2A 3ERGA 2VCZA 1FW1A 2VLTA 4HS1A 4JR4A 5HR0A 2G2QA 1M9AA 1AQVA 3G7JA 5AGYA 1B9XC 1SJZA 3PGTA 1X5DA 4XRAA 3D21A 4XTSA 4ACSA 3JCML 3KH7A 5D8IA 1Z6MA 5DQSA 3UOMA 2LV3A 4TRXA 2GS3A 2IL3A 3TGZA 1ACVA 3F4RA 1EV4A 4BWQA 4HU9A 4KCAA 2GQKA 4L5LA 3EU3A 2F9SA 3MNGA 5ELAA 3FR9A 5HR3A 2O85A 1G6WA 1UC7A 1QFNA 3HJPA 1U3IA 1Z7PA 1XVQA 2FWGA 1Z5YE 4EL1A 4EUYA 4HZ4A 4IBPA 2GGTA 1B48A 1WP0A 4YQUA 3TJKA 3APOA 4MDCA 2HSYA 2PVQA 2YNXA 5CAXA 3FK8A 4TR0A 4MPFA 2IIYA 3K8NA 1JZDA 4PQIA 3H93A 4ECJA 2VL2C 5J5NA 2B5YA 1M0UA 3FZ9A 2IMIA 3GH6A 4DSSB 5J41A 1YF0A 4PX1A 1O8XA 4HJ2A 1TI3A 2FA4A 1F2EA 1R26A 1VF3A 1IYIA 2JL4A 3D22A 3TCOA 3TJFA 5D9TA 2YV9A 4K7OA 4IVFA 2MMZA 2EIRA 5F0GA 2XPEA 5JWRB 3PINA 1TDIA 4G2EA 4KNDA 3G7YA 1GNEA 4J56E 4PNFA 4ZB6A 18GSA 2WGRA 5CREA 3UMAA 5JWOB 2V32A 1K0MA 3F4TA 1URMA 1V9WA 4MP4A 2H6ZA 4FIWA 3ZTLA 4TR1A 4MABA 3C71A 1JZWA 3HZ4A 3MSZA 4O32A 3BBYA 1PD21 5D96A 3J7Yk 5DQYA 4V2NA 1J9BA 4RI7A 10GSA 1THXA 1SD9A 1OE7A 2PPTA 1QUWA 2OA7A 4EDYA 2GVPA 3HXSA 2LNTA 1T7PB 4AJ8A 5B6MA 1SL2B 4XIHA 3EYTA 1MDIA 3C8EA 1QXHA 1M2AA 3IRAA 2VD0A 1F9MA 3IK7A 1R5PA 3UIWA 5IMVA 4MF7A 2P31A 4ML6A 1HNCA 4KCEA 1OC9B 3IAS2 1XOBA 2O87A 3A2WA 1EGRA 2YJHA 1FVJA 5G31A 1EEMA 5DCHA 2CAIA 4ZIJA 2RM5A 2VUPA 1SK2A 3M8NA 3N9JA 1ERTA 2C0EA 4G19A 1K3YA 2DMLA 1EGOA 3CRTA 1MDKA 4PQ1A 2GSRA 4TKYA 3KP8A 1PSQA 3VPQA 1LU4A 4MPGA 3GH9A 4HEA2 5G2ZA 2FWFA 2H6XA 2PU9C 5AIXA 4N11A 5IPGA 2JADA 3KMOA 3ZVJD 1GWCA 1XWGA 2IMKA 2IJYA 3BOAA 3TJGA 2GSQA 1XXUA 4EC0A 2KHPA 1PMTA 2VM1A 3GTUB 7GSSA 3L78A 3UEMA 1XWCA 2JACA 20GSA 1O85A 2VCVA 2G0FA 3E0UA 3EE2A 1A24A 5ECNB 4HI7A 2RIIA 1GUHA 1OVNA 3WD6A 5KN2A 3KZQA 1ERWA 1B4PA 2FWHA 2LJKA 4LL1B 2JU5A 3P2AA 5ECMB 2X8GA 1H4OA 4V1Ag 3GUSA 4YH2A 2RUFA 3IV4A 4TXVA 2WCIA 3CMIA 6GSWA 4JU5A 2WB9A 3KM6A 3DKSA 2OE0A 2R6KA 1TTZA 3QFBC 3DVWA 4K8MA 1W4VA 1TRWA 1A8LA 2E0QA 5A4UA 1EV9A 1T00A 3C1RA 4N0ZA 3FYGA 3UARA 4IKHA 3AY8A 3HJOA 1A2JA 2FWEA 4OFMA 3F63A 4YQVA 9GSSA 2H70A 2PERA 1YQ1A 3GSTA 1WJKA 1EP8A 2VL9A 3FKFA 4FYBA 3ERWA 5EL8A 1PL1A 4IJ3A 1S3DA 5ELGA 1PL2A 3GN3A 1B4QA 2AAWA 3LXZA 4WR4A 2OJLA 1XWAA 2CA8A 4IJIA 5AIVA 3KMNA 3WGXA 2BTOT
chains in the Genus database with same CATH superfamily
1BJXA 2AUVA 4EE0A 2R0CA 1Z9HA 2L59A 2QC7A 5IMDA 4XS6A 4J2FA 4KSOA 4MH2A 3WYWA 2VL3A 3L9VA 3M3MA 4GQCA 1OYJA 1WMJA 2RUEA 2LS5A 1QQ2A 5IO2A 1YJ6A 13GSA 4BA7A 4K5RA 2YJ7A 3VI5A 2YN1A 4OO5A 1GTIA 4X43A 2LRNA 4JEDA 4KH7A 17GSA 5B8AA 3LQ7A 4AJ6A 4L8EA 1YKCA 3LSZA 2HRKA 1JHBA 3BD2A 4X1UA 3J7Yb 5HR1A 4JRRA 1WWJA 5C00A 2H8LA 4OWYA 1GTUA 5D9WA 1SK0A 2IFQA 5CRGA 4GXZA 4V2LA 1HQOA 2H1BA 1GSEA 2EIQA 1X9SB 2LKUA 1BQ7A 2I1UA 1ML6A 3LFLA 5DVBA 1YY7A 3QFAC 1QMVA 1DUGA 1K3LA 1ON4A 4BVYA 2PN8A 2PWJA 4ZL9A 2V1MA 3ZVJA 3NIVA 1H75A 2X99A 3GFKA 3G7IA 5KN3A 2R0PA 2UZ8A 2K6VA 1GLQA 5DDLA 2PGTA 2ZCTA 2DJ2A 1KBNA 1FO5A 1WE0A 5KOXA 5ABRA 4TR4A 4G0LA 2XPDA 1Y6EA 1K0BA 2PUKC 1K0CA 5JWQB 2H72A 2X64A 5ECQB 4HJMA 3TOUA 1WOUA 4Z7XA 4ULXA 1U87A 3RAZA 3ME7A 5E59A 3LYKA 1U88A 2K8VA 1SYRA 2JZSA 2IN3A 2WULA 4EKZA 4OCEA 2K8SA 1GL8A 4XRDA 4V2MA 5J9BA 3M1GA 5ECRB 2O8VB 1TRVA 5IO0A 2FD3A 4TXOA 2CZ2A 3TJBA 4BVXB 1M2DA 2R0GA 3CSIA 4WR5A 5ECSA 5IMZA 4ML1A 4NXIA 2CV4A 5F06A 5DBQA 2O89A 4P3YB 1TI1A 3UBKA 3CBUA 4I5QA 4IP6A 2GZZA 2DC5A 1ZGNA 1TRSA 4PUAA 2H74A 2WDUA 2HZEA 2WFCA 4AJ7A 3O3TA 1GUMA 3BCKA 3L9UA 5INYA 2E2GA 2NDOA 1DBYA 4F9ZA 4PQHA 1FB6A 2DLXA 4NV2A 4N10A 2WZ9A 3APSA 12GSA 3HKRA 2I81A 3QPMA 3R2QA 2CAQA 2VM2A 3E3EA 1GNWA 3LORA 4EXJA 2RLIA 1ZL9A 4MLYA 2HT9A 2KLXA 2PVOC 3D0ZA 2YV7A 4NHZA 5ECPB 4ZB8A 1J08A 1BEDA 2KOKA 1I5GA 1GTBA 1XBSA 5JCWA 4TR3A 4KDYA 4CW9A 4RQXA 2BMXA 1TKDB 3QCPA 4IQ1A 4Z2RA 2P0GA 3IK9A 1FOHA 4BL7A 5CRDA 3SBCA 4DVCA 2QSIA 3DD3A 1OAZA 2ZNMA 4K2XA 4O5UA 8GSSA 3W8JA 4N30A 3Q18A 3H79A 2R5GA 2CX3A 4MMMA 1V40A 2ON7A 4WBRD 3QAGA 4LA1A 2L4CA 5ECIB 1SKSB 2NPBA 2C0DA 1T4YA 1PKZA 1T4ZA 1TP9A 4HQSA 4KUNA 4WEYA 4KGIA 4RUVA 3IPZA 2H0HA 1S3RA 1R4WA 2GT6A 3MAKA 1MTCA 1SL0B 2LUSA 3GA4A 2LTKA 1YF1A 4IP1A 1F3AA 3ZMKA 3VWUA 3C1SA 2CX4A 1B9YC 2F8FA 2LEGA 1S3AA 4NPBA 4ECIA 1AIUA 2B5EA 4KE3A 5FWGA 4GF0A 3TKRA 1QK8A 3UJ1A 3OR5A 2DJ0A 2VLVA 3GHAA 1ILOA 4G10A 1XPVA 2I9HA 2X4AA 3GKKA 4HU7A 1HD2A 3F6FA 2YWMA 1ABAA 2AJQB 4LLRA 1JZRA 4KB3A 5DAKA 3HDCA 5IM9A 1NHYA 1PX7A 5GAPD 3EU4A 3MYDA 1SJ6A 2O7KA 2F51A 2HRFA 3EPTA 2N5FA 3ZLPA 1U3AA 2DJ1A 1YZXA 5D73A 3KJYA 2DKIA 2HSMA 1Z7RA 4MF5A 4FYUA 3MWHA 3LXTA 3F0IA 2LNSA 4WBJA 2C8UA 4E8HA 1DE2A 5DALA 2VCWA 4IS0A 2R37A 4ZXGA 2B1LA 1V58A 2VCQA 3GURA 2EIOA 3UL3A 1MDJA 2A2RA 1AW9A 1MD3A 2YWOA 2GZPA 3D4MA 4GLTA 2YWIA 3TUEA 1TK5B 5AN1A 2GQMA 4YKGA 3C7MA 3WGEA 5GSTA 2TIRA 4AF2A 2C3TA 3KTLA 4LL4B 1GTAA 1NHOA 1SYXA 5G5FA 2QA1A 3ZIJA 2M46A 2DJ3A 3BCIA 3DIEA 5ECKB 5G1KA 1SKWB 4MZWA 3KXOA 4FYCA 4PGTA 1FAAA 3FR6A 4PXOA 3HVXA 4OO4A 2BJXA 3EMPA 4XHMA 3GYKA 4NHWA 2L57A 3IDVA 3A2VA 2TRCP 3EINA 4TR1B 3V1WA 1HNBA 1K0NA 4Q5RA 1EOHA 2OACA 4KSMA 4TVEA 2H6YA 4DSQA 3UBLA 3IE3A 1G7OA 3EMXA 4EIQA 5CO3A 3L9SA 2GDRA 4HQZA 4OCFA 3VLNA 1LBKA 2N5AA 1PQNA 3VWXA 1HYUA 3QAWA 2E7PA 2HNLA 4K7IA 3FHKA 3TKSC 1GUKA 2QGVA 5BRTA 3DXBA 3PPUA 5IOXA 1ZYNA 1XIYA 3RBTA 2X8HA 1VRSD 3QAVA 3NOFA 1YEPA 5G5EA 3HA9A 3O6TA 1WRYA 5GZZB 3EWLA 4DSRA 1F6MC 2YCDA 1FVKA 4MH3A 5HQPA 3TDGA 4MJEA 4D73A 4KA0A 3KH9A 3CRUA 4XS4A 3W6GA 5F07A 5J9CA 1O81A 4PNGA 3D4TA 1GH2A 2RM6A 2GSSA 3A5WA 1ZOFA 2C4JA 3U5RE 4GWRA 3GL5A 2MYGA 5H5QA 3VK9A 2HXKA 3KIJA 2X49A 1Y25A 4JBBA 4KX4A 5B6NA 2B3SA 2DIZA 1F37A 1N8JA 1ERVA 3I43A 2CZ3A 1XFLA 2DIYA 3TKQA 2NTOA 1BG5A 1JFUA 1LJRA 1HNAA 2JZRA 4MZCA 3IXRA 5IOWA 2WJUA 4POBA 1AXDA 1NM3A 4L0WA 4ZL7A 2HSHA 11GSA 3TKPA 4F2IA 3FZAA 2FHEA 3ZFLA 5GSSA 3LEFA 5CRWA 3FY7A 1A23A 2XBQA 5ID2A 1PA3A 5LD0A 2K18A 4XCSA 5FT3A 1PGTA 5B7CA 2MMOA 4MA9A 4IELA 3Q6OA 4HZ2A 1UA5A 3HVVA 1XG8A 3F9UA 3GV1A 3ZMLA 2H19A 2LRTA 1GLPA 3EURA 4Q5NA 5J4UA 2HFDA 2A2SA 2J9HA 3IR4A 3PR8A 3F6DA 4MJAA 3QD9A 1T8EB 1X5EA 1Z3EA 2H76A 1G0TA 3CXGA 1AQXA 5DCGA 1KNGA 4ZBDA 3TOTA 5IMCA 3S9FA 5FHIA 2VL2A 4LMVA 1V57A 3M9KA 1JZOA 1MD4A 5DJMA 1PRXA 4K5SA 6GSVA 3ERFA 1SD8A 3DYRA 3GX0A 3SWLA 4FO5A 2L6DA 3G9BA 1SENA 4FH8A 1OC8A 2L6CA 3I9V2 3VFIA 2YZHA 19GSA 1MEKA 1SU9A 2CT6A 4IW9A 2X8CA 2DSAA 4L5OA 2VOCA 4GCIA 4POKA 1DE1A 3WT1A 2VAFA 4NV5A 3I69A 1K0OA 2V6KA 3QR6A 2FA8A 4Z2TA 1XCCA 3ZITA 3IC8A 1WPIA 4K9ZA 3VI7A 1E2YA 2CVKA 14GSA 1GSYA 3GNJA 5H5SA 2JSZA 3M9JA 4K1FA 1GSSA 5DJLA 4PURA 1V2AA 2Z9SA 4E8EA 4H86A 1YEXA 3L0HA 4DSSA 4HOJA 3CTGA 3HYPA 3NZNA 4ECCA 3TB2A 5IMFA 3H4KA 4IN0A 1CQHA 2ES7A 3FR3A 3M0FA 4I97A 1FB0A 1TRUA 5EY6A 2M80A 2F3MA 2B7JA 4CDOA 1EZKA 2IFQB 4YQMA 3ED3A 3TKSE 3UVTA 5A4VA 1SKRB 1UVZA 3HHVA 2KP1A 1ZYQB 1TK0B 5CP1A 2FLSA 5HR2A 2XHFA 2CQ9A 1UN2A 2PMTA 3GSSA 4OD7A 5B8BA 3F8UA 2VLUA 2GQLA 3TRPA 1IYHA 4ZB9A 5EVOA 4BVYB 2A2PA 2J23A 4MCUA 1TW9A 3IAM2 1VF4A 1CQGA 1FG4A 1OE8A 5ECLB 3EVIA 5D9XA 1XVWA 2A4HA 2C80A 2L4QA 3LWAA 3CYNA 1GULA 16GSA 2OADA 1EOGA 1TU7A 3RPNA 1EP7A 4F0BA 4I2TA 2HRNA 3GIXA 4CY8A 4ISDA 1RW1A 1ZYEA 2YWNA 2QA2A 3GL3A 2AV4A 3P8WA 1X9MB 2DBCA 2VCXA 5GAND 4QL9A 4GSNA 3F3RA 2C3NA 3N5OA 2EC4A 4QL7A 1N2AA 2MBSA 4CY6A 3WGDA 1OC9A 1VF2A 4ZL8A 1YKAA 5JCGA 4EO3A 3UVHA 2FY6A 4MF6A 4AGSA 1R7HA 2LJAA 4TXOB 2FUG2 5IIZA 4ECBA 2C1YA 3VURA 3HJMA 4GRFA 3ZREA 3RHCA 1C72A 4MNNA 4ICYA 3KTBA 4MK3A 2HE3A 3HZ8A 2AB6A 4OFTA 2CVBA 2V2GA 3TKSA 4EVMA 1Q98A 1M99A 3KD0A 2PBJA 1PKWA 2H01A 2ZUPA 1GSQA 1PX6A 2XC2A 1M7TA 4BPYA 1AUCA 2HZEB 2C0GA 3ZZXA 3MDKA 1A0FA 5HFKA 1XW5A 3KCMA 4MJCA 1RK4A 4O7HA 2AYTA 2NVLA 1AAZA 1PFOA 1OKTA 3RDWA 1GSFA 3GTUA 2IMEA 5CRHA 2B5XA 1A8YA 1T1VA 4K6XA 2YANA 1GRXA 1EEJA 2OE1A 2HYXA 3DRNA 4TW5A 4Z2UA 5A4WA 5IMAA 2H66A 3DGQA 2HZFA 4I8BA 1ERUA 5KN1A 2DMMA 1AQWA 3QMXA 2R2JA 3CSHA 4YAVA 2B7KA 1TK8B 6GSTA 5KEJA 4WF5A 4BL7B 1OC3A 4WXTA 2H0IA 1K0DA 3A2XA 1OKDA 3ISOA 3KGKA 3FRCA 2LQOA 1U6TA 4HSCX 1ZYPA 1BAYA 3WT2A 3ZIVA 4CHSA 3KEBA 1K0AA 1BYEA 4OMVA 2B1KA 2H30A 4Q5QA 4F0CA 2VO4A 2WS2A 3GKNA 3E9JB 3P7XA 4IQAA 2VIMA 2OKAA 3RPPA 2GTUA 3IBHA 2OBIA 1TOFA 2DJKA 1Z6NA 2IMFA 3GX8A 3RHBA 1EWXA 1G6YA 3FZ4A 4WKWA 4O5RA 1JLWA 1YDKA 4LMWA 5CYYA 4K7NA 3TJJA 2C0FA 5D9VA 1USBA 3H8QA 1M2BA 3US3A 3FEUA 4F03A 1A0RP 2IPAA 2YOIA 3R3EA 3C73A 1K3OA 3DVXA 2LSTA 5F8BA 4POMA 2ON5A 5HFGA 4XS1A 3ZRDA 2F8AA 2VCTA 3W8SA 3D5JA 2GZYA 2JSYA 4G9HA 1X5CA 3DMLA 4TN8A 3F4SA 5DAKB 2L5OA 2E2MA 5COHA 2ALBA 4K0GA 3HD5A 4NWYA 1A2MA 2AHEA 3IA1A 3ZYWA 4I2UA 3Q19A 4G0KA 1TJDA 5G1LA 3D6IA 5LCZA 5J3RA 5BMUA 4RI6A 3VPTA 2JZTA 2KUCA 3BJ5A 3FW2A 2YPMA 3CQFA 3MIXA 4GSTA 4K0NA 3QOUA 4JE1A 1BX9A 1VGLA 4WETA 2LRCA 4KDUA 5IQYA 4USSA 5AISA 1KTEA 2K9FA 5EPFA 5DALB 1M9BA 2GSTA 4ZILA 4X0XA 3LGCA 2YZUA 4ZBAA 4NMUA 2IWTA 1FHEA 2OE3A 5LNKe 2M72A 4K2DA 2CVDA 2I3YA 2LQQA 2HLSA 1SJIA 1XW6A 1S3CA 2XBIA 4POLA 5D93A 3GKXA 2DKHA 1QGVA 3CSJA 2A4VA 1JLVA 3VWWA 1M3JA 2N5BA 5ENUA 1RQMA 1ZZYA 3IHGA 4EIPA 1ZCPA 4FQUA 3IOSA 4MZBA 2V6OA 5KN0A 3LG6A 4O92A 2H1DA 2GT5A 1AC1A 2VD1A 4GTUA 4Q5FA 2NBSA 1F3BA 3GMFA 2H71A 3ZL5A 4BWSA 3A3TA 2L5LA 3HVSA 1O8WA 1J0FA 3UAPA 3APQA 5E4WA 4GQFA 4KAEA 1THOA 4WF4A 2WRTA 4EF0A 2TRXA 3H1NA 1KEBA 2GLRA 3GRXA 4YAPA 4DEJA 3IHQA 1O7UA 4ID0A 4ZBBA 4KDXA 3EC3A 3O76A 1R5AA 5C04A 2QKEA 4OFNA 6GSYA 2P5RA 4BVXA 3IC4A 4L0UA 1GP1A 2DJJA 5HFIA 1FOVA 3HCZA 3DEXA 1WIKA 2YP6A 1A2LA 5L71A 1X0RA 3P90A 4JZQA 3I6AA 4RQRA 2H1AA 6GSSA 1B8XA 2MMNA 3HY2A 1X9WB 4HUAA 5JCUA 3LYPA 4J57E 4HDEA 4TOPA 3LW9A 4D73B 4PTSA 2D2ZA 22GSA 5H5RA 4XS4B 1XW9A 4I6XA 2OBKA 1PN9A 4IGJA 3U6VA 2R4VA 5F05A 1O73A 1Q4JA 2FCHA 4NAXA 4G0IA 3ZFBA 3ME8A 4F82A 1XWBA 2H0GA 3TRXA 4N0VA 3PH9A 4KW6A 1I9DA 6GSXA 4JR6A 1SL1B 3KP9A 4QQ7A 4MJBA 2MBTA 2H1GA 4V1Ap 3F3QA 5ECOB 1DSBA 3VWVA 1GSUA 2MZCA 1XOAA 2I4AA 4ILFA 4EDZA 1TXXA 5CNWA 5G30A 2B6MA 1T3BA 1ZMAA 3CTFA 2KP2A 2H73A 1O6JA 4O5QA 5ID2B 2FGXA 1TU8A 4GSSA 1NSWA 5KOWA 3DWVA 2V41A 3LJRA 3QDNA 2HI7A 1SK1A 4IHUA 5A5KA 3TRQA 2C3QA 3FZ5A 1ST9A 5ECHB 3L4NA 1XZOA 5IPHA 2FNOA 3GKMA 2P5QA 2LJRA 1W89A 2MMAA 3Q74A 2R3XA 4PUFC 1V98A 1VF1A 1G7EA 2H75A 1E6BA 1GSDA 2IMDA 2REMA 6GSUA 1XWKA 1NW2A 3ERGA 2VCZA 1FW1A 2VLTA 4HS1A 4JR4A 5HR0A 2G2QA 1M9AA 1AQVA 3G7JA 5AGYA 1B9XC 1SJZA 3PGTA 1X5DA 4XRAA 3D21A 4XTSA 4X4JA 4ACSA 3JCML 3KH7A 5D8IA 1Z6MA 5DQSA 3UOMA 2LV3A 4TRXA 2GS3A 2IL3A 3TGZA 1ACVA 3F4RA 1EV4A 4BWQA 4HU9A 4KCAA 2GQKA 4L5LA 3EU3A 2F9SA 3MNGA 5ELAA 3FR9A 5HR3A 2O85A 1G6WA 1UC7A 1QFNA 3HJPA 1U3IA 4BIKA 1Z7PA 1XVQA 2FWGA 1Z5YE 4EL1A 4EUYA 4IBPA 4HZ4A 2GGTA 1B48A 1WP0A 4YQUA 3TJKA 3APOA 4KF9A 4MDCA 2HSYA 2PVQA 2YNXA 5CAXA 3FK8A 4TR0A 4MPFA 2IIYA 3K8NA 1JZDA 4PQIA 3H93A 4ECJA 2VL2C 5J5NA 2B5YA 1M0UA 3FZ9A 2IMIA 3GH6A 4DSSB 5J41A 1YF0A 4PX1A 1O8XA 4HJ2A 1TI3A 2FA4A 1F2EA 1R26A 1VF3A 1IYIA 2JL4A 3D22A 3TCOA 3TJFA 5D9TA 2YV9A 4K7OA 4IVFA 2MMZA 2EIRA 5F0GA 2XPEA 5JWRB 3A5IA 3PINA 1TDIA 4G2EA 4KNDA 3G7YA 1GNEA 1M3IA 4J56E 4PNFA 4ZB6A 18GSA 2WGRA 5CREA 3UMAA 5JWOB 2V32A 1K0MA 3F4TA 1URMA 1V9WA 4MP4A 2H6ZA 3FMWA 4FIWA 3ZTLA 4TR1A 4MABA 3C71A 1JZWA 3HZ4A 3MSZA 4O32A 3BBYA 1PD21 5D96A 3J7Yk 5DQYA 4V2NA 1J9BA 4RI7A 10GSA 1THXA 1SD9A 1OE7A 2PPTA 1QUWA 2OA7A 4EDYA 2GVPA 4YKFA 3HXSA 2LNTA 1T7PB 4AJ8A 5B6MA 1SL2B 4XIHA 3EYTA 1MDIA 3C8EA 1QXHA 1M2AA 3IRAA 2VD0A 1F9MA 3IK7A 1R5PA 3UIWA 5IMVA 4MF7A 2P31A 4ML6A 3HVNA 1HNCA 4KCEA 1OC9B 3IAS2 1XOBA 2O87A 3A2WA 1EGRA 2YJHA 1FVJA 5G31A 1EEMA 5DCHA 2CAIA 4ZIJA 2RM5A 2VUPA 1SK2A 3M8NA 3N9JA 1ERTA 2C0EA 4G19A 1K3YA 2DMLA 1EGOA 3CRTA 1MDKA 4PQ1A 2GSRA 4TKYA 3KP8A 1PSQA 3VPQA 1LU4A 4MPGA 3GH9A 4HEA2 5G2ZA 2FWFA 2H6XA 2PU9C 5AIXA 4N11A 5IPGA 2JADA 3KMOA 3ZVJD 1GWCA 1XWGA 2IMKA 2IJYA 3BOAA 3TJGA 2GSQA 1XXUA 4EC0A 2HRAA 2KHPA 1PMTA 4A5PA 2VM1A 3GTUB 7GSSA 3L78A 3UEMA 1XWCA 2JACA 20GSA 1O85A 2VCVA 2G0FA 3E0UA 3EE2A 1A24A 5ECNB 4HI7A 2RIIA 1GUHA 1OVNA 3WD6A 5KN2A 1PN0A 3KZQA 1ERWA 1B4PA 2FWHA 2LJKA 4LL1B 2JU5A 3P2AA 5ECMB 2X8GA 1H4OA 4V1Ag 3GUSA 4YH2A 2RUFA 3IV4A 4TXVA 2WCIA 3CMIA 6GSWA 4JU5A 2WB9A 3KM6A 3DKSA 2OE0A 2R6KA 1TTZA 3QFBC 3DVWA 4K8MA 1W4VA 1TRWA 1A8LA 2E0QA 5A4UA 1EV9A 1T00A 3C1RA 4N0ZA 3FYGA 3UARA 4IKHA 3AY8A 3HJOA 1A2JA 2FWEA 4OFMA 3F63A 4YQVA 9GSSA 2H70A 2PERA 1YQ1A 3GSTA 1WJKA 1EP8A 2VL9A 3FKFA 4FYBA 3ERWA 5EL8A 1PL1A 4IJ3A 1S3DA 5ELGA 1PL2A 3GN3A 1B4QA 2AAWA 3LXZA 4WR4A 2OJLA 1XWAA 2CA8A 4IJIA 5AIVA 3KMNA 3WGXA 2BTOT
chains in the Genus database with same CATH topology
1BJXA 2AUVA 4EE0A 2R0CA 1Z9HA 2L59A 2QC7A 5IMDA 4XS6A 4J2FA 4KSOA 4MH2A 3WYWA 2VL3A 3L9VA 3M3MA 4GQCA 1OYJA 1WMJA 2RUEA 2LS5A 1QQ2A 5IO2A 1YJ6A 13GSA 4BA7A 4K5RA 2YJ7A 3VI5A 2YN1A 4OO5A 1GTIA 4X43A 2LRNA 4JEDA 4KH7A 17GSA 5B8AA 3LQ7A 4AJ6A 4L8EA 1YKCA 3LSZA 2HRKA 1JHBA 3BD2A 4X1UA 3J7Yb 5HR1A 4JRRA 1WWJA 5C00A 2H8LA 4OWYA 1GTUA 5D9WA 1SK0A 2IFQA 5CRGA 4GXZA 4V2LA 1HQOA 2H1BA 1GSEA 2EIQA 1X9SB 2LKUA 1BQ7A 2I1UA 1ML6A 3LFLA 5DVBA 1YY7A 3QFAC 1QMVA 1DUGA 1K3LA 1ON4A 4BVYA 2PN8A 2PWJA 4ZL9A 2V1MA 3ZVJA 3NIVA 1H75A 2X99A 3GFKA 3G7IA 5KN3A 2R0PA 2UZ8A 2K6VA 1GLQA 5DDLA 2PGTA 2ZCTA 2DJ2A 1KBNA 1FO5A 1WE0A 5KOXA 5ABRA 4TR4A 4G0LA 2XPDA 1Y6EA 1K0BA 2PUKC 1K0CA 5JWQB 2H72A 2X64A 5ECQB 4HJMA 3TOUA 1WOUA 4Z7XA 4ULXA 1U87A 3RAZA 3ME7A 5E59A 3LYKA 1U88A 2K8VA 1SYRA 2JZSA 2IN3A 2WULA 4EKZA 4OCEA 2K8SA 1GL8A 4XRDA 4V2MA 5J9BA 3M1GA 5ECRB 2O8VB 1TRVA 5IO0A 2FD3A 4TXOA 2CZ2A 3TJBA 4BVXB 1M2DA 2R0GA 3CSIA 4WR5A 5ECSA 5IMZA 4ML1A 4NXIA 2CV4A 5F06A 5DBQA 2O89A 4P3YB 1TI1A 3UBKA 3CBUA 4I5QA 4IP6A 2GZZA 2DC5A 1ZGNA 1TRSA 4PUAA 2H74A 2WDUA 2HZEA 2WFCA 4AJ7A 3O3TA 1GUMA 3BCKA 3L9UA 5INYA 2E2GA 2NDOA 1DBYA 4F9ZA 4PQHA 1FB6A 2DLXA 4NV2A 4N10A 2WZ9A 3APSA 12GSA 3HKRA 2I81A 3QPMA 3R2QA 2CAQA 2VM2A 3E3EA 1GNWA 3LORA 4EXJA 2RLIA 1ZL9A 4MLYA 2HT9A 2KLXA 2PVOC 3D0ZA 2YV7A 4NHZA 5ECPB 4ZB8A 1J08A 1BEDA 2KOKA 1I5GA 1GTBA 1XBSA 5JCWA 4TR3A 4KDYA 4CW9A 4RQXA 2BMXA 1TKDB 3QCPA 4IQ1A 4Z2RA 2P0GA 3IK9A 1FOHA 4BL7A 5CRDA 3SBCA 4DVCA 2QSIA 3DD3A 1OAZA 2ZNMA 4K2XA 4O5UA 8GSSA 3W8JA 4N30A 3Q18A 3H79A 2R5GA 2CX3A 4MMMA 1V40A 2ON7A 4WBRD 3QAGA 4LA1A 2L4CA 5ECIB 1SKSB 2NPBA 2C0DA 1T4YA 1PKZA 1T4ZA 1TP9A 4HQSA 4KUNA 4WEYA 4KGIA 4RUVA 3IPZA 2H0HA 1R4WA 2GT6A 3MAKA 1MTCA 1SL0B 2LUSA 3GA4A 2LTKA 1YF1A 4IP1A 1F3AA 3ZMKA 3VWUA 3C1SA 2CX4A 1B9YC 2F8FA 2LEGA 1S3AA 4NPBA 4ECIA 1AIUA 2B5EA 4KE3A 5FWGA 4GF0A 3TKRA 1QK8A 3UJ1A 3OR5A 2DJ0A 2VLVA 3GHAA 1ILOA 4G10A 1XPVA 2I9HA 2X4AA 3GKKA 4HU7A 1HD2A 3F6FA 2YWMA 1ABAA 2AJQB 4LLRA 1JZRA 4KB3A 5DAKA 3HDCA 5IM9A 1NHYA 1PX7A 5GAPD 3EU4A 3MYDA 1SJ6A 2O7KA 2F51A 2HRFA 3EPTA 2N5FA 3ZLPA 1U3AA 2DJ1A 1YZXA 5D73A 3KJYA 2DKIA 2HSMA 1Z7RA 4MF5A 4FYUA 3MWHA 3LXTA 3F0IA 2LNSA 4WBJA 2C8UA 4E8HA 1DE2A 5DALA 2VCWA 4IS0A 2R37A 4ZXGA 2B1LA 1V58A 2VCQA 3GURA 2EIOA 3UL3A 1MDJA 2A2RA 1AW9A 1MD3A 2YWOA 2GZPA 3D4MA 4GLTA 2YWIA 3TUEA 1TK5B 5AN1A 2GQMA 4YKGA 3C7MA 3WGEA 5GSTA 2TIRA 4AF2A 2C3TA 3KTLA 4LL4B 1GTAA 1NHOA 1SYXA 5G5FA 2QA1A 3ZIJA 2M46A 2DJ3A 3BCIA 3DIEA 5ECKB 5G1KA 1SKWB 4MZWA 3KXOA 4FYCA 4PGTA 1FAAA 3FR6A 4PXOA 3HVXA 4OO4A 2BJXA 3EMPA 4XHMA 3GYKA 4NHWA 2L57A 3IDVA 3A2VA 2TRCP 3EINA 4TR1B 3V1WA 1HNBA 1K0NA 4Q5RA 1EOHA 2OACA 4KSMA 4TVEA 2H6YA 4DSQA 3UBLA 3IE3A 1G7OA 3EMXA 4EIQA 5CO3A 3L9SA 2GDRA 4HQZA 4OCFA 3VLNA 1LBKA 2N5AA 1PQNA 3VWXA 1HYUA 3QAWA 2E7PA 2HNLA 4K7IA 3FHKA 3TKSC 1GUKA 2QGVA 5BRTA 3DXBA 3PPUA 5IOXA 1ZYNA 1XIYA 3RBTA 2X8HA 1VRSD 3QAVA 3NOFA 1YEPA 5G5EA 3HA9A 3O6TA 1WRYA 5GZZB 3EWLA 4DSRA 1F6MC 2YCDA 1FVKA 4MH3A 5HQPA 3TDGA 4MJEA 4D73A 4KA0A 3KH9A 3CRUA 4XS4A 3W6GA 5F07A 5J9CA 1O81A 4PNGA 3D4TA 1GH2A 2RM6A 2GSSA 3A5WA 1ZOFA 2C4JA 3U5RE 4GWRA 3GL5A 2MYGA 5H5QA 3VK9A 2HXKA 3KIJA 2X49A 1Y25A 4JBBA 4KX4A 5B6NA 2B3SA 2DIZA 1F37A 1N8JA 1ERVA 3I43A 2CZ3A 1XFLA 2DIYA 3TKQA 2NTOA 1BG5A 1JFUA 1LJRA 1HNAA 2JZRA 4MZCA 3IXRA 5IOWA 2WJUA 4POBA 1AXDA 1NM3A 4L0WA 4ZL7A 2HSHA 11GSA 3TKPA 4F2IA 3FZAA 2FHEA 3ZFLA 5GSSA 3LEFA 5CRWA 3FY7A 1A23A 2XBQA 5ID2A 1PA3A 5LD0A 2K18A 4XCSA 5FT3A 1PGTA 5B7CA 2MMOA 4MA9A 4IELA 3Q6OA 4HZ2A 1UA5A 3HVVA 3F9UA 3GV1A 3ZMLA 2H19A 2LRTA 1GLPA 3EURA 4Q5NA 5J4UA 2HFDA 2A2SA 2J9HA 3IR4A 3PR8A 3F6DA 4MJAA 3QD9A 1T8EB 1X5EA 1Z3EA 2H76A 1G0TA 3CXGA 1AQXA 5DCGA 1KNGA 4ZBDA 3TOTA 5IMCA 3S9FA 5FHIA 2VL2A 4LMVA 1V57A 3M9KA 1JZOA 1MD4A 5DJMA 1PRXA 4K5SA 6GSVA 3ERFA 1SD8A 3DYRA 3GX0A 3SWLA 4FO5A 2L6DA 3G9BA 1SENA 4FH8A 1OC8A 2L6CA 3I9V2 3VFIA 2YZHA 19GSA 1MEKA 1SU9A 2CT6A 4IW9A 2X8CA 2DSAA 4L5OA 2VOCA 4GCIA 4POKA 1DE1A 3WT1A 2VAFA 4NV5A 3I69A 1K0OA 2V6KA 3QR6A 2FA8A 4Z2TA 1XCCA 3ZITA 3IC8A 1WPIA 4K9ZA 3VI7A 1E2YA 2CVKA 14GSA 1GSYA 3GNJA 5H5SA 2JSZA 3M9JA 4K1FA 1GSSA 5DJLA 4PURA 1V2AA 2Z9SA 4E8EA 4H86A 1YEXA 3L0HA 4DSSA 4HOJA 3CTGA 3HYPA 3NZNA 4ECCA 3TB2A 5IMFA 3H4KA 4IN0A 1CQHA 2ES7A 3FR3A 3M0FA 4I97A 1FB0A 1TRUA 5EY6A 2M80A 2F3MA 2B7JA 4CDOA 1EZKA 2IFQB 4YQMA 3ED3A 3TKSE 3UVTA 5A4VA 1SKRB 1UVZA 3HHVA 2KP1A 1ZYQB 1TK0B 5CP1A 2FLSA 5HR2A 2XHFA 2CQ9A 1UN2A 2PMTA 3GSSA 4OD7A 5B8BA 3F8UA 2VLUA 2GQLA 3TRPA 1IYHA 4ZB9A 5EVOA 4BVYB 2A2PA 2J23A 4MCUA 1TW9A 3IAM2 1VF4A 1CQGA 1FG4A 1OE8A 5ECLB 3EVIA 5D9XA 1XVWA 2A4HA 2C80A 2L4QA 3LWAA 3CYNA 1GULA 16GSA 2OADA 1EOGA 1TU7A 3RPNA 1EP7A 4F0BA 4I2TA 2HRNA 3GIXA 4CY8A 4ISDA 1RW1A 1ZYEA 2YWNA 2QA2A 3GL3A 2AV4A 3P8WA 1X9MB 2DBCA 2VCXA 5GAND 4QL9A 4GSNA 3F3RA 2C3NA 3N5OA 2EC4A 4QL7A 1N2AA 2MBSA 4CY6A 3WGDA 1OC9A 1VF2A 4ZL8A 1YKAA 5JCGA 4EO3A 3UVHA 2FY6A 4MF6A 4AGSA 1R7HA 2LJAA 4TXOB 2FUG2 5IIZA 4ECBA 2C1YA 3VURA 3HJMA 4GRFA 3ZREA 3RHCA 1C72A 4MNNA 4ICYA 3KTBA 4MK3A 2HE3A 3HZ8A 2AB6A 4OFTA 2CVBA 2V2GA 3TKSA 4EVMA 1Q98A 1M99A 3KD0A 2PBJA 1PKWA 2H01A 2ZUPA 1GSQA 1PX6A 2XC2A 1M7TA 4BPYA 1AUCA 2HZEB 2C0GA 3ZZXA 3MDKA 1A0FA 5HFKA 1XW5A 3KCMA 4MJCA 1RK4A 4O7HA 2AYTA 2NVLA 1AAZA 1OKTA 3RDWA 1GSFA 3GTUA 2IMEA 5CRHA 2B5XA 1A8YA 1T1VA 4K6XA 2YANA 1GRXA 1EEJA 2OE1A 2HYXA 3DRNA 4TW5A 4Z2UA 5A4WA 5IMAA 2H66A 3DGQA 2HZFA 4I8BA 1ERUA 5KN1A 2DMMA 1AQWA 3QMXA 2R2JA 3CSHA 4YAVA 2B7KA 1TK8B 6GSTA 5KEJA 4WF5A 4BL7B 1OC3A 4WXTA 2H0IA 1K0DA 3A2XA 1OKDA 3ISOA 3KGKA 3FRCA 2LQOA 1U6TA 1ZYPA 1BAYA 3WT2A 3ZIVA 4CHSA 3KEBA 1K0AA 1BYEA 4OMVA 2B1KA 2H30A 4Q5QA 4F0CA 2VO4A 2WS2A 3GKNA 3E9JB 3P7XA 4IQAA 2VIMA 2OKAA 3RPPA 2GTUA 3IBHA 2OBIA 1TOFA 2DJKA 1Z6NA 2IMFA 3GX8A 3RHBA 1EWXA 1G6YA 3FZ4A 4WKWA 4O5RA 1JLWA 1YDKA 4LMWA 5CYYA 4K7NA 3TJJA 2C0FA 5D9VA 1USBA 3H8QA 1M2BA 3US3A 3FEUA 4F03A 1A0RP 2IPAA 2YOIA 3R3EA 3C73A 1K3OA 3DVXA 2LSTA 5F8BA 4POMA 2ON5A 5HFGA 4XS1A 3ZRDA 2F8AA 2VCTA 3W8SA 3D5JA 2GZYA 2JSYA 4G9HA 1X5CA 3DMLA 4TN8A 3F4SA 5DAKB 2L5OA 2E2MA 5COHA 2ALBA 4K0GA 3HD5A 4NWYA 1A2MA 2AHEA 3IA1A 3ZYWA 4I2UA 3Q19A 4G0KA 1TJDA 5G1LA 3D6IA 5LCZA 5J3RA 5BMUA 4RI6A 3VPTA 2JZTA 2KUCA 3BJ5A 3FW2A 2YPMA 3MIXA 4GSTA 4K0NA 3QOUA 4JE1A 1BX9A 1VGLA 4WETA 2LRCA 4KDUA 5IQYA 4USSA 5AISA 1KTEA 2K9FA 5EPFA 5DALB 1M9BA 2GSTA 4ZILA 4X0XA 3LGCA 2YZUA 4ZBAA 4NMUA 2IWTA 1FHEA 2OE3A 5LNKe 2M72A 4K2DA 2CVDA 2I3YA 2LQQA 2HLSA 1SJIA 1XW6A 1S3CA 2XBIA 4POLA 5D93A 3GKXA 2DKHA 1QGVA 3CSJA 2A4VA 1JLVA 3VWWA 2N5BA 5ENUA 1RQMA 1ZZYA 3IHGA 4EIPA 1ZCPA 4FQUA 3IOSA 4MZBA 2V6OA 5KN0A 3LG6A 4O92A 2H1DA 2GT5A 1AC1A 2VD1A 2NBSA 4Q5FA 4GTUA 1F3BA 3GMFA 2H71A 3ZL5A 4BWSA 3A3TA 2L5LA 3HVSA 1O8WA 1J0FA 3UAPA 3APQA 5E4WA 4GQFA 4KAEA 1THOA 4WF4A 2WRTA 4EF0A 2TRXA 3H1NA 1KEBA 2GLRA 3GRXA 4YAPA 4DEJA 3IHQA 1O7UA 4ID0A 4ZBBA 4KDXA 3EC3A 3O76A 1R5AA 5C04A 2QKEA 4OFNA 6GSYA 2P5RA 4BVXA 3IC4A 4L0UA 1GP1A 2DJJA 5HFIA 1FOVA 3HCZA 3DEXA 1WIKA 2YP6A 1A2LA 5L71A 1X0RA 3P90A 4JZQA 3I6AA 4RQRA 2H1AA 6GSSA 1B8XA 2MMNA 3HY2A 1X9WB 4HUAA 5JCUA 3LYPA 4J57E 4HDEA 4TOPA 3LW9A 4D73B 4PTSA 2D2ZA 22GSA 5H5RA 4XS4B 1XW9A 4I6XA 2OBKA 1PN9A 4IGJA 3U6VA 2R4VA 5F05A 1O73A 1Q4JA 2FCHA 4NAXA 4G0IA 3ZFBA 3ME8A 4F82A 1XWBA 2H0GA 3TRXA 4N0VA 3PH9A 4KW6A 1I9DA 6GSXA 4JR6A 1SL1B 3KP9A 4QQ7A 4MJBA 2MBTA 2H1GA 4V1Ap 3F3QA 5ECOB 1DSBA 3VWVA 1GSUA 2MZCA 1XOAA 2I4AA 4ILFA 4EDZA 1TXXA 5CNWA 5G30A 2B6MA 1T3BA 1ZMAA 3CTFA 2KP2A 2H73A 1O6JA 4O5QA 5ID2B 2FGXA 1TU8A 4GSSA 1NSWA 5KOWA 3DWVA 2V41A 3LJRA 3QDNA 2HI7A 1SK1A 4IHUA 5A5KA 3TRQA 2C3QA 3FZ5A 1ST9A 5ECHB 3L4NA 1XZOA 5IPHA 2FNOA 3GKMA 2P5QA 2LJRA 1W89A 2MMAA 3Q74A 2R3XA 4PUFC 1V98A 1VF1A 1G7EA 2H75A 1E6BA 1GSDA 2IMDA 2REMA 6GSUA 1XWKA 1NW2A 3ERGA 2VCZA 1FW1A 2VLTA 4HS1A 4JR4A 5HR0A 2G2QA 1M9AA 1AQVA 3G7JA 5AGYA 1B9XC 1SJZA 3PGTA 1X5DA 4XRAA 3D21A 4XTSA 4X4JA 4ACSA 3JCML 3KH7A 5D8IA 1Z6MA 5DQSA 3UOMA 2LV3A 4TRXA 2GS3A 2IL3A 3TGZA 1ACVA 3F4RA 1EV4A 4BWQA 4HU9A 4KCAA 2GQKA 4L5LA 3EU3A 2F9SA 3MNGA 5ELAA 3FR9A 5HR3A 2O85A 1G6WA 1UC7A 1QFNA 3HJPA 1U3IA 1Z7PA 1XVQA 2FWGA 1Z5YE 4EL1A 4EUYA 4HZ4A 4IBPA 2GGTA 1B48A 1WP0A 4YQUA 3TJKA 3APOA 4KF9A 4MDCA 2HSYA 2PVQA 2YNXA 5CAXA 3FK8A 4TR0A 4MPFA 2IIYA 3K8NA 1JZDA 4PQIA 3H93A 4ECJA 2VL2C 5J5NA 2B5YA 1M0UA 3FZ9A 2IMIA 3GH6A 4DSSB 5J41A 1YF0A 4PX1A 1O8XA 4HJ2A 1TI3A 2FA4A 1F2EA 1R26A 1VF3A 1IYIA 2JL4A 3D22A 3TCOA 3TJFA 5D9TA 2YV9A 4K7OA 4IVFA 2MMZA 2EIRA 5F0GA 2XPEA 5JWRB 3A5IA 3PINA 1TDIA 4G2EA 4KNDA 3G7YA 1GNEA 4J56E 4PNFA 4ZB6A 18GSA 2WGRA 5CREA 3UMAA 5JWOB 2V32A 1K0MA 3F4TA 1URMA 1V9WA 4MP4A 2H6ZA 3FMWA 4FIWA 3ZTLA 4TR1A 4MABA 3C71A 1JZWA 3HZ4A 3MSZA 4O32A 3BBYA 1PD21 5D96A 3J7Yk 5DQYA 4V2NA 1J9BA 4RI7A 10GSA 1THXA 1SD9A 1OE7A 2PPTA 1QUWA 2OA7A 4EDYA 2GVPA 4YKFA 3HXSA 2LNTA 1T7PB 4AJ8A 5B6MA 1SL2B 4XIHA 3EYTA 1MDIA 3C8EA 1QXHA 1M2AA 3IRAA 2VD0A 1F9MA 3IK7A 1R5PA 3UIWA 5IMVA 4MF7A 2P31A 4ML6A 1HNCA 4KCEA 1OC9B 3IAS2 1XOBA 2O87A 3A2WA 1EGRA 2YJHA 1FVJA 5G31A 1EEMA 5DCHA 2CAIA 4ZIJA 2RM5A 2VUPA 1SK2A 3M8NA 3N9JA 1ERTA 2C0EA 4G19A 1K3YA 2DMLA 1EGOA 3CRTA 1MDKA 4PQ1A 2GSRA 4TKYA 3KP8A 1PSQA 3VPQA 1LU4A 4MPGA 3GH9A 4HEA2 5G2ZA 2FWFA 2H6XA 2PU9C 5AIXA 4N11A 5IPGA 2JADA 3KMOA 3ZVJD 1GWCA 1XWGA 2IMKA 2IJYA 3BOAA 3TJGA 2GSQA 1XXUA 4EC0A 2HRAA 2KHPA 1PMTA 4A5PA 2VM1A 3GTUB 7GSSA 3L78A 3UEMA 1XWCA 2JACA 20GSA 1O85A 2VCVA 2G0FA 3E0UA 3EE2A 1A24A 5ECNB 4HI7A 2RIIA 1GUHA 1OVNA 3WD6A 5KN2A 1PN0A 3KZQA 1ERWA 1B4PA 2FWHA 2LJKA 4LL1B 2JU5A 3P2AA 5ECMB 2X8GA 1H4OA 4V1Ag 3GUSA 4YH2A 2RUFA 3IV4A 4TXVA 2WCIA 3CMIA 6GSWA 4JU5A 2WB9A 3KM6A 3DKSA 2OE0A 2R6KA 1TTZA 3QFBC 3DVWA 4K8MA 1W4VA 1TRWA 1A8LA 2E0QA 5A4UA 1EV9A 1T00A 3C1RA 4N0ZA 3FYGA 3UARA 4IKHA 3AY8A 3HJOA 1A2JA 2FWEA 4OFMA 3F63A 4YQVA 9GSSA 2H70A 2PERA 1YQ1A 3GSTA 1WJKA 1EP8A 2VL9A 3FKFA 4FYBA 3ERWA 5EL8A 1PL1A 4IJ3A 1S3DA 5ELGA 1PL2A 3GN3A 1B4QA 2AAWA 3LXZA 4WR4A 2OJLA 1XWAA 2CA8A 4IJIA 5AIVA 3KMNA 3WGXA 2BTOT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BJX A;  2AUV A;  4EE0 A;  1Z9H A;  2L59 A;  2QC7 A;  5IMD A;  4XS6 A;  4J2F A;  4KSO A;  4MH2 A;  3WYW A;  2VL3 A;  3L9V A;  3M3M A;  4GQC A;  1OYJ A;  1WMJ A;  2RUE A;  2LS5 A;  1QQ2 A;  5IO2 A;  1YJ6 A;  13GS A;  4BA7 A;  2YJ7 A;  3VI5 A;  2YN1 A;  4OO5 A;  1GTI A;  4X43 A;  2LRN A;  4JED A;  4KH7 A;  17GS A;  5B8A A;  3LQ7 A;  4AJ6 A;  4L8E A;  1YKC A;  3LSZ A;  1JHB A;  3BD2 A;  4X1U A;  3J7Y b;  5HR1 A;  4JRR A;  1WWJ A;  5C00 A;  2H8L A;  4OWY A;  1GTU A;  5D9W A;  1SK0 A;  2IFQ A;  5CRG A;  4GXZ A;  4V2L A;  1HQO A;  2H1B A;  1GSE A;  2EIQ A;  1X9S B;  2LKU A;  1BQ7 A;  2I1U A;  1ML6 A;  3LFL A;  5DVB A;  1YY7 A;  3QFA C;  1QMV A;  1DUG A;  1K3L A;  1ON4 A;  4BVY A;  2PN8 A;  2PWJ A;  4ZL9 A;  2V1M A;  3ZVJ A;  3NIV A;  1H75 A;  2X99 A;  3GFK A;  3G7I A;  5KN3 A;  2K6V A;  1GLQ A;  5DDL A;  2PGT A;  2ZCT A;  2DJ2 A;  1KBN A;  1FO5 A;  1WE0 A;  5ABR A;  4TR4 A;  2XPD A;  1Y6E A;  1K0B A;  2PUK C;  1K0C A;  5JWQ B;  2H72 A;  2X64 A;  5ECQ B;  4HJM A;  3TOU A;  1WOU A;  4Z7X A;  4ULX A;  1U87 A;  3RAZ A;  3ME7 A;  5E59 A;  3LYK A;  1U88 A;  2K8V A;  1SYR A;  2JZS A;  2IN3 A;  2WUL A;  4EKZ A;  4OCE A;  2K8S A;  1GL8 A;  4XRD A;  4V2M A;  5J9B A;  3M1G A;  5ECR B;  2O8V B;  1TRV A;  5IO0 A;  2FD3 A;  4TXO A;  2CZ2 A;  3TJB A;  1M2D A;  3CSI A;  4WR5 A;  5ECS A;  5IMZ A;  4ML1 A;  4NXI A;  2CV4 A;  5F06 A;  5DBQ A;  2O89 A;  4P3Y B;  1TI1 A;  3UBK A;  3CBU A;  4I5Q A;  4IP6 A;  2GZZ A;  2DC5 A;  1ZGN A;  1TRS A;  4PUA A;  2H74 A;  2WDU A;  2HZE A;  2WFC A;  4AJ7 A;  3O3T A;  1GUM A;  3BCK A;  3L9U A;  5INY A;  2E2G A;  2NDO A;  1DBY A;  4F9Z A;  4PQH A;  1FB6 A;  2DLX A;  4NV2 A;  4N10 A;  2WZ9 A;  3APS A;  12GS A;  3HKR A;  2I81 A;  3QPM A;  3R2Q A;  2CAQ A;  2VM2 A;  3E3E A;  1GNW A;  3LOR A;  4EXJ A;  2RLI A;  1ZL9 A;  4MLY A;  2HT9 A;  2KLX A;  2PVO C;  3D0Z A;  2YV7 A;  4NHZ A;  5ECP B;  4ZB8 A;  1J08 A;  1BED A;  2KOK A;  1I5G A;  1GTB A;  1XBS A;  5JCW A;  4TR3 A;  4KDY A;  4CW9 A;  4RQX A;  2BMX A;  1TKD B;  3QCP A;  4IQ1 A;  2P0G A;  3IK9 A;  4BL7 A;  5CRD A;  3SBC A;  4DVC A;  2QSI A;  3DD3 A;  1OAZ A;  2ZNM A;  8GSS A;  3W8J A;  4N30 A;  3Q18 A;  3H79 A;  2R5G A;  2CX3 A;  4MMM A;  1V40 A;  2ON7 A;  4WBR D;  3QAG A;  4LA1 A;  2L4C A;  5ECI B;  1SKS B;  2NPB A;  2C0D A;  1T4Y A;  1PKZ A;  1T4Z A;  1TP9 A;  4HQS A;  4KUN A;  4WEY A;  4KGI A;  4RUV A;  3IPZ A;  2H0H A;  1R4W A;  2GT6 A;  3MAK A;  1MTC A;  1SL0 B;  2LUS A;  3GA4 A;  2LTK A;  1YF1 A;  4IP1 A;  1F3A A;  3ZMK A;  3VWU A;  3C1S A;  2CX4 A;  1B9Y C;  2F8F A;  2LEG A;  1S3A A;  4NPB A;  4ECI A;  1AIU A;  2B5E A;  4KE3 A;  5FWG A;  4GF0 A;  3TKR A;  1QK8 A;  3UJ1 A;  3OR5 A;  2DJ0 A;  2VLV A;  3GHA A;  1ILO A;  4G10 A;  1XPV A;  2I9H A;  3GKK A;  4HU7 A;  1HD2 A;  3F6F A;  2YWM A;  1ABA A;  2AJQ B;  4LLR A;  1JZR A;  4KB3 A;  5DAK A;  3HDC A;  5IM9 A;  1NHY A;  1PX7 A;  5GAP D;  3EU4 A;  1SJ6 A;  2O7K A;  2F51 A;  2HRF A;  2N5F A;  3ZLP A;  1U3A A;  2DJ1 A;  1YZX A;  5D73 A;  3KJY A;  1Z7R A;  4MF5 A;  4FYU A;  3MWH A;  3LXT A;  3F0I A;  2LNS A;  4WBJ A;  2C8U A;  4E8H A;  1DE2 A;  5DAL A;  2VCW A;  4IS0 A;  2R37 A;  4ZXG A;  2B1L A;  1V58 A;  2VCQ A;  3GUR A;  2EIO A;  3UL3 A;  1MDJ A;  2A2R A;  1AW9 A;  1MD3 A;  2YWO A;  2GZP A;  3D4M A;  4GLT A;  2YWI A;  3TUE A;  1TK5 B;  5AN1 A;  2GQM A;  3C7M A;  3WGE A;  5GST A;  2TIR A;  4AF2 A;  2C3T A;  3KTL A;  4LL4 B;  1GTA A;  1NHO A;  1SYX A;  5G5F A;  3ZIJ A;  2M46 A;  2DJ3 A;  3BCI A;  3DIE A;  5ECK B;  5G1K A;  1SKW B;  4MZW A;  3KXO A;  4FYC A;  4PGT A;  1FAA A;  3FR6 A;  4PXO A;  3HVX A;  4OO4 A;  2BJX A;  3EMP A;  4XHM A;  3GYK A;  4NHW A;  2L57 A;  3IDV A;  3A2V A;  2TRC P;  3EIN A;  4TR1 B;  3V1W A;  1HNB A;  1K0N A;  4Q5R A;  1EOH A;  2OAC A;  4KSM A;  4TVE A;  2H6Y A;  4DSQ A;  3UBL A;  3IE3 A;  1G7O A;  3EMX A;  5CO3 A;  3L9S A;  2GDR A;  4HQZ A;  4OCF A;  3VLN A;  1LBK A;  2N5A A;  1PQN A;  3VWX A;  1HYU A;  3QAW A;  2E7P A;  2HNL A;  4K7I A;  3FHK A;  3TKS C;  1GUK A;  2QGV A;  3DXB A;  5IOX A;  1XIY A;  3RBT A;  2X8H A;  1VRS D;  3QAV A;  3NOF A;  1YEP A;  5G5E A;  3HA9 A;  3O6T A;  1WRY A;  5GZZ B;  3EWL A;  4DSR A;  1F6M C;  2YCD A;  1FVK A;  4MH3 A;  5HQP A;  3TDG A;  4MJE A;  4D73 A;  4KA0 A;  3KH9 A;  3CRU A;  4XS4 A;  3W6G A;  5F07 A;  5J9C A;  1O81 A;  4PNG A;  3D4T A;  1GH2 A;  2RM6 A;  2GSS A;  3A5W A;  1ZOF A;  2C4J A;  3U5R E;  4GWR A;  3GL5 A;  2MYG A;  5H5Q A;  3VK9 A;  2HXK A;  3KIJ A;  1Y25 A;  4JBB A;  4KX4 A;  5B6N A;  2B3S A;  2DIZ A;  1F37 A;  1N8J A;  1ERV A;  3I43 A;  2CZ3 A;  1XFL A;  2DIY A;  3TKQ A;  2NTO A;  1BG5 A;  1JFU A;  1LJR A;  1HNA A;  2JZR A;  4MZC A;  3IXR A;  5IOW A;  2WJU A;  4POB A;  1AXD A;  1NM3 A;  4L0W A;  4ZL7 A;  2HSH A;  11GS A;  3TKP A;  4F2I A;  3FZA A;  2FHE A;  3ZFL A;  5GSS A;  3LEF A;  5CRW A;  3FY7 A;  1A23 A;  2XBQ A;  5ID2 A;  1PA3 A;  5LD0 A;  2K18 A;  4XCS A;  5FT3 A;  1PGT A;  5B7C A;  2MMO A;  4MA9 A;  4IEL A;  3Q6O A;  4HZ2 A;  1UA5 A;  3HVV A;  3F9U A;  3GV1 A;  3ZML A;  2H19 A;  2LRT A;  1GLP A;  3EUR A;  4Q5N A;  5J4U A;  2HFD A;  2A2S A;  2J9H A;  3IR4 A;  3PR8 A;  3F6D A;  4MJA A;  3QD9 A;  1T8E B;  1X5E A;  1Z3E A;  2H76 A;  1G0T A;  3CXG A;  1AQX A;  5DCG A;  1KNG A;  4ZBD A;  3TOT A;  5IMC A;  3S9F A;  5FHI A;  2VL2 A;  4LMV A;  1V57 A;  3M9K A;  1JZO A;  1MD4 A;  5DJM A;  1PRX A;  6GSV A;  3ERF A;  1SD8 A;  3DYR A;  3GX0 A;  3SWL A;  4FO5 A;  2L6D A;  3G9B A;  1SEN A;  4FH8 A;  1OC8 A;  2L6C A;  3I9V 2;  3VFI A;  2YZH A;  19GS A;  1MEK A;  1SU9 A;  2CT6 A;  4IW9 A;  2X8C A;  2DSA A;  4L5O A;  2VOC A;  4GCI A;  4POK A;  1DE1 A;  3WT1 A;  2VAF A;  4NV5 A;  3I69 A;  1K0O A;  2V6K A;  3QR6 A;  2FA8 A;  1XCC A;  3ZIT A;  1WPI A;  4K9Z A;  3VI7 A;  1E2Y A;  2CVK A;  14GS A;  1GSY A;  3GNJ A;  5H5S A;  2JSZ A;  3M9J A;  4K1F A;  1GSS A;  5DJL A;  4PUR A;  1V2A A;  2Z9S A;  4E8E A;  4H86 A;  1YEX A;  3L0H A;  4DSS A;  4HOJ A;  3CTG A;  3HYP A;  3NZN A;  4ECC A;  3TB2 A;  5IMF A;  3H4K A;  4IN0 A;  1CQH A;  2ES7 A;  3FR3 A;  3M0F A;  4I97 A;  1FB0 A;  1TRU A;  5EY6 A;  2M80 A;  2F3M A;  2B7J A;  4CDO A;  1EZK A;  2IFQ B;  4YQM A;  3ED3 A;  3TKS E;  3UVT A;  5A4V A;  1SKR B;  1UVZ A;  3HHV A;  2KP1 A;  1ZYQ B;  1TK0 B;  5CP1 A;  2FLS A;  5HR2 A;  2XHF A;  2CQ9 A;  1UN2 A;  2PMT A;  3GSS A;  4OD7 A;  5B8B A;  3F8U A;  2VLU A;  2GQL A;  3TRP A;  1IYH A;  4ZB9 A;  5EVO A;  2J23 A;  4MCU A;  1TW9 A;  3IAM 2;  1VF4 A;  1CQG A;  1FG4 A;  1OE8 A;  5ECL B;  3EVI A;  5D9X A;  1XVW A;  2C80 A;  2L4Q A;  3LWA A;  3CYN A;  1GUL A;  16GS A;  2OAD A;  1EOG A;  1TU7 A;  3RPN A;  1EP7 A;  4F0B A;  4I2T A;  2HRN A;  3GIX A;  4ISD A;  1RW1 A;  1ZYE A;  2YWN A;  3GL3 A;  2AV4 A;  3P8W A;  1X9M B;  2DBC A;  2VCX A;  5GAN D;  4QL9 A;  4GSN A;  3F3R A;  2C3N A;  3N5O A;  2EC4 A;  4QL7 A;  1N2A A;  2MBS A;  3WGD A;  1OC9 A;  1VF2 A;  4ZL8 A;  1YKA A;  5JCG A;  4EO3 A;  3UVH A;  2FY6 A;  4MF6 A;  4AGS A;  1R7H A;  2LJA A;  4TXO B;  2FUG 2;  5IIZ A;  4ECB A;  2C1Y A;  3VUR A;  3HJM A;  4GRF A;  3ZRE A;  3RHC A;  1C72 A;  3KTB A;  4MK3 A;  2HE3 A;  3HZ8 A;  2AB6 A;  4OFT A;  2CVB A;  2V2G A;  3TKS A;  4EVM A;  1Q98 A;  1M99 A;  3KD0 A;  2PBJ A;  1PKW A;  2H01 A;  2ZUP A;  1GSQ A;  1PX6 A;  2XC2 A;  1M7T A;  4BPY A;  1AUC A;  2HZE B;  2C0G A;  3ZZX A;  3MDK A;  1A0F A;  5HFK A;  1XW5 A;  3KCM A;  4MJC A;  1RK4 A;  4O7H A;  2AYT A;  2NVL A;  1AAZ A;  1OKT A;  3RDW A;  1GSF A;  3GTU A;  2IME A;  5CRH A;  2B5X A;  1A8Y A;  1T1V A;  4K6X A;  2YAN A;  1GRX A;  1EEJ A;  2OE1 A;  2HYX A;  3DRN A;  4TW5 A;  5A4W A;  5IMA A;  2H66 A;  3DGQ A;  2HZF A;  4I8B A;  1ERU A;  5KN1 A;  2DMM A;  1AQW A;  3QMX A;  2R2J A;  3CSH A;  4YAV A;  2B7K A;  1TK8 B;  6GST A;  5KEJ A;  4WF5 A;  1OC3 A;  4WXT A;  2H0I A;  1K0D A;  3A2X A;  1OKD A;  3ISO A;  3KGK A;  3FRC A;  2LQO A;  1U6T A;  1BAY A;  3WT2 A;  3ZIV A;  4CHS A;  3KEB A;  1K0A A;  1BYE A;  4OMV A;  2B1K A;  2H30 A;  4Q5Q A;  4F0C A;  2VO4 A;  2WS2 A;  3GKN A;  3E9J B;  3P7X A;  4IQA A;  2VIM A;  2OKA A;  3RPP A;  2GTU A;  3IBH A;  2OBI A;  1TOF A;  2DJK A;  1Z6N A;  2IMF A;  3GX8 A;  3RHB A;  1EWX A;  1G6Y A;  3FZ4 A;  4WKW A;  4O5R A;  1JLW A;  1YDK A;  4LMW A;  5CYY A;  4K7N A;  3TJJ A;  2C0F A;  5D9V A;  1USB A;  3H8Q A;  1M2B A;  3US3 A;  3FEU A;  4F03 A;  1A0R P;  2IPA A;  2YOI A;  3C73 A;  1K3O A;  3DVX A;  2LST A;  5F8B A;  4POM A;  2ON5 A;  5HFG A;  4XS1 A;  3ZRD A;  2F8A A;  2VCT A;  3W8S A;  3D5J A;  2GZY A;  2JSY A;  4G9H A;  1X5C A;  3DML A;  4TN8 A;  3F4S A;  5DAK B;  2L5O A;  2E2M A;  5COH A;  2ALB A;  4K0G A;  3HD5 A;  4NWY A;  1A2M A;  2AHE A;  3IA1 A;  3ZYW A;  4I2U A;  3Q19 A;  5G1L A;  1TJD A;  5LCZ A;  3D6I A;  5J3R A;  4RI6 A;  3VPT A;  2JZT A;  2KUC A;  3BJ5 A;  3FW2 A;  2YPM A;  4GST A;  4K0N A;  3QOU A;  4JE1 A;  1BX9 A;  1VGL A;  4WET A;  2LRC A;  4KDU A;  5IQY A;  5AIS A;  1KTE A;  2K9F A;  5EPF A;  5DAL B;  1M9B A;  2GST A;  4ZIL A;  4X0X A;  3LGC A;  2YZU A;  4ZBA A;  4NMU A;  2IWT A;  1FHE A;  2OE3 A;  5LNK e;  2M72 A;  4K2D A;  2CVD A;  2I3Y A;  2LQQ A;  2HLS A;  1SJI A;  1XW6 A;  1S3C A;  2XBI A;  4POL A;  5D93 A;  3GKX A;  1QGV A;  3CSJ A;  2A4V A;  1JLV A;  3VWW A;  2N5B A;  5ENU A;  1RQM A;  1ZZY A;  1ZCP A;  3IOS A;  4MZB A;  2V6O A;  5KN0 A;  3LG6 A;  4O92 A;  2H1D A;  2GT5 A;  1AC1 A;  2VD1 A;  2NBS A;  4Q5F A;  4GTU A;  1F3B A;  3GMF A;  2H71 A;  3ZL5 A;  4BWS A;  3A3T A;  2L5L A;  3HVS A;  1O8W A;  1J0F A;  3UAP A;  3APQ A;  5E4W A;  4GQF A;  4KAE A;  1THO A;  4WF4 A;  2WRT A;  4EF0 A;  2TRX A;  3H1N A;  1KEB A;  2GLR A;  3GRX A;  4YAP A;  4DEJ A;  3IHQ A;  1O7U A;  4ID0 A;  4ZBB A;  4KDX A;  3EC3 A;  3O76 A;  1R5A A;  5C04 A;  2QKE A;  4OFN A;  6GSY A;  2P5R A;  4BVX A;  3IC4 A;  4L0U A;  1GP1 A;  2DJJ A;  5HFI A;  1FOV A;  3HCZ A;  3DEX A;  1WIK A;  2YP6 A;  1A2L A;  5L71 A;  1X0R A;  3P90 A;  4JZQ A;  3I6A A;  4RQR A;  2H1A A;  6GSS A;  1B8X A;  2MMN A;  3HY2 A;  1X9W B;  4HUA A;  5JCU A;  3LYP A;  4J57 E;  4HDE A;  4TOP A;  4D73 B;  2D2Z A;  22GS A;  5H5R A;  4XS4 B;  1XW9 A;  4I6X A;  2OBK A;  1PN9 A;  4IGJ A;  3U6V A;  2R4V A;  5F05 A;  1O73 A;  1Q4J A;  2FCH A;  4NAX A;  3ZFB A;  3ME8 A;  4F82 A;  1XWB A;  2H0G A;  3TRX A;  4N0V A;  3PH9 A;  4KW6 A;  1I9D A;  6GSX A;  4JR6 A;  1SL1 B;  3KP9 A;  4QQ7 A;  4MJB A;  2MBT A;  2H1G A;  4V1A p;  3F3Q A;  5ECO B;  1DSB A;  3VWV A;  1GSU A;  2MZC A;  1XOA A;  2I4A A;  4ILF A;  4EDZ A;  1TXX A;  5CNW A;  5G30 A;  2B6M A;  1T3B A;  1ZMA A;  3CTF A;  2KP2 A;  2H73 A;  1O6J A;  5ID2 B;  2FGX A;  1TU8 A;  4GSS A;  1NSW A;  3DWV A;  2V41 A;  3LJR A;  3QDN A;  2HI7 A;  1SK1 A;  4IHU A;  5A5K A;  3TRQ A;  2C3Q A;  3FZ5 A;  1ST9 A;  5ECH B;  3L4N A;  1XZO A;  5IPH A;  2FNO A;  3GKM A;  2P5Q A;  2LJR A;  1W89 A;  2MMA A;  3Q74 A;  2R3X A;  4PUF C;  1V98 A;  1VF1 A;  1G7E A;  2H75 A;  1E6B A;  1GSD A;  2IMD A;  2REM A;  6GSU A;  1XWK A;  1NW2 A;  3ERG A;  2VCZ A;  1FW1 A;  2VLT A;  4HS1 A;  4JR4 A;  5HR0 A;  2G2Q A;  1M9A A;  1AQV A;  3G7J A;  5AGY A;  1B9X C;  1SJZ A;  3PGT A;  1X5D A;  4XRA A;  3D21 A;  4XTS A;  4ACS A;  3JCM L;  3KH7 A;  5D8I A;  1Z6M A;  5DQS A;  3UOM A;  2LV3 A;  4TRX A;  2GS3 A;  2IL3 A;  3TGZ A;  1ACV A;  3F4R A;  1EV4 A;  4BWQ A;  4HU9 A;  4KCA A;  2GQK A;  4L5L A;  3EU3 A;  2F9S A;  3MNG A;  5ELA A;  3FR9 A;  5HR3 A;  2O85 A;  1G6W A;  1UC7 A;  1QFN A;  3HJP A;  1U3I A;  1Z7P A;  1XVQ A;  2FWG A;  1Z5Y E;  4EL1 A;  4EUY A;  4HZ4 A;  4IBP A;  2GGT A;  1B48 A;  1WP0 A;  4YQU A;  3TJK A;  3APO A;  4MDC A;  2HSY A;  2PVQ A;  2YNX A;  5CAX A;  3FK8 A;  4TR0 A;  4MPF A;  2IIY A;  3K8N A;  1JZD A;  4PQI A;  3H93 A;  4ECJ A;  2VL2 C;  5J5N A;  2B5Y A;  1M0U A;  3FZ9 A;  2IMI A;  3GH6 A;  4DSS B;  5J41 A;  1YF0 A;  4PX1 A;  1O8X A;  4HJ2 A;  1TI3 A;  2FA4 A;  1F2E A;  1R26 A;  1VF3 A;  1IYI A;  2JL4 A;  3D22 A;  3TCO A;  3TJF A;  5D9T A;  2YV9 A;  4K7O A;  4IVF A;  2MMZ A;  2EIR A;  5F0G A;  2XPE A;  5JWR B;  3PIN A;  1TDI A;  4G2E A;  4KND A;  3G7Y A;  1GNE A;  4J56 E;  4PNF A;  4ZB6 A;  18GS A;  2WGR A;  5CRE A;  3UMA A;  5JWO B;  2V32 A;  1K0M A;  3F4T A;  1URM A;  1V9W A;  4MP4 A;  2H6Z A;  4FIW A;  3ZTL A;  4TR1 A;  4MAB A;  3C71 A;  1JZW A;  3HZ4 A;  3MSZ A;  4O32 A;  3BBY A;  1PD2 1;  5D96 A;  3J7Y k;  5DQY A;  4V2N A;  1J9B A;  4RI7 A;  10GS A;  1THX A;  1SD9 A;  1OE7 A;  2PPT A;  1QUW A;  2OA7 A;  4EDY A;  2GVP A;  3HXS A;  2LNT A;  1T7P B;  4AJ8 A;  5B6M A;  1SL2 B;  4XIH A;  3EYT A;  1MDI A;  3C8E A;  1QXH A;  1M2A A;  3IRA A;  2VD0 A;  1F9M A;  3IK7 A;  1R5P A;  3UIW A;  5IMV A;  4MF7 A;  2P31 A;  4ML6 A;  1HNC A;  4KCE A;  1OC9 B;  3IAS 2;  1XOB A;  2O87 A;  3A2W A;  1EGR A;  2YJH A;  1FVJ A;  5G31 A;  1EEM A;  5DCH A;  2CAI A;  4ZIJ A;  2RM5 A;  2VUP A;  1SK2 A;  3M8N A;  3N9J A;  1ERT A;  2C0E A;  4G19 A;  1K3Y A;  2DML A;  1EGO A;  3CRT A;  1MDK A;  4PQ1 A;  2GSR A;  4TKY A;  3KP8 A;  1PSQ A;  3VPQ A;  1LU4 A;  4MPG A;  3GH9 A;  4HEA 2;  5G2Z A;  2FWF A;  2H6X A;  2PU9 C;  5AIX A;  4N11 A;  5IPG A;  2JAD A;  3KMO A;  3ZVJ D;  1GWC A;  1XWG A;  2IMK A;  2IJY A;  3BOA A;  3TJG A;  2GSQ A;  1XXU A;  4EC0 A;  2KHP A;  1PMT A;  2VM1 A;  3GTU B;  7GSS A;  3L78 A;  3UEM A;  1XWC A;  2JAC A;  20GS A;  1O85 A;  2VCV A;  2G0F A;  3E0U A;  3EE2 A;  1A24 A;  5ECN B;  4HI7 A;  2RII A;  1GUH A;  1OVN A;  3WD6 A;  5KN2 A;  3KZQ A;  1ERW A;  1B4P A;  2FWH A;  2LJK A;  4LL1 B;  2JU5 A;  3P2A A;  5ECM B;  2X8G A;  1H4O A;  4V1A g;  3GUS A;  4YH2 A;  2RUF A;  3IV4 A;  4TXV A;  2WCI A;  3CMI A;  6GSW A;  4JU5 A;  2WB9 A;  3KM6 A;  3DKS A;  2OE0 A;  2R6K A;  1TTZ A;  3QFB C;  3DVW A;  4K8M A;  1W4V A;  1TRW A;  1A8L A;  2E0Q A;  5A4U A;  1EV9 A;  1T00 A;  3C1R A;  4N0Z A;  3FYG A;  3UAR A;  4IKH A;  3AY8 A;  3HJO A;  1A2J A;  2FWE A;  4OFM A;  3F63 A;  4YQV A;  9GSS A;  2H70 A;  2PER A;  1YQ1 A;  3GST A;  1WJK A;  1EP8 A;  2VL9 A;  3FKF A;  4FYB A;  3ERW A;  5EL8 A;  1PL1 A;  4IJ3 A;  1S3D A;  5ELG A;  1PL2 A;  3GN3 A;  1B4Q A;  2AAW A;  3LXZ A;  4WR4 A;  2OJL A;  1XWA A;  2CA8 A;  4IJI A;  5AIV A;  3KMN A;  3WGX A;  2BTO T; 
#chains in the Genus database with same CATH topology
 1BJX A;  2AUV A;  4EE0 A;  2R0C A;  1Z9H A;  2L59 A;  2QC7 A;  5IMD A;  4XS6 A;  4J2F A;  4KSO A;  4MH2 A;  3WYW A;  2VL3 A;  3L9V A;  3M3M A;  4GQC A;  1OYJ A;  1WMJ A;  2RUE A;  2LS5 A;  1QQ2 A;  5IO2 A;  1YJ6 A;  13GS A;  4BA7 A;  4K5R A;  2YJ7 A;  3VI5 A;  2YN1 A;  4OO5 A;  1GTI A;  4X43 A;  2LRN A;  4JED A;  4KH7 A;  17GS A;  5B8A A;  3LQ7 A;  4AJ6 A;  4L8E A;  1YKC A;  3LSZ A;  2HRK A;  1JHB A;  3BD2 A;  4X1U A;  3J7Y b;  5HR1 A;  4JRR A;  1WWJ A;  5C00 A;  2H8L A;  4OWY A;  1GTU A;  5D9W A;  1SK0 A;  2IFQ A;  5CRG A;  4GXZ A;  4V2L A;  1HQO A;  2H1B A;  1GSE A;  2EIQ A;  1X9S B;  2LKU A;  1BQ7 A;  2I1U A;  1ML6 A;  3LFL A;  5DVB A;  1YY7 A;  3QFA C;  1QMV A;  1DUG A;  1K3L A;  1ON4 A;  4BVY A;  2PN8 A;  2PWJ A;  4ZL9 A;  2V1M A;  3ZVJ A;  3NIV A;  1H75 A;  2X99 A;  3GFK A;  3G7I A;  5KN3 A;  2R0P A;  2UZ8 A;  2K6V A;  1GLQ A;  5DDL A;  2PGT A;  2ZCT A;  2DJ2 A;  1KBN A;  1FO5 A;  1WE0 A;  5KOX A;  5ABR A;  4TR4 A;  4G0L A;  2XPD A;  1Y6E A;  1K0B A;  2PUK C;  1K0C A;  5JWQ B;  2H72 A;  2X64 A;  5ECQ B;  4HJM A;  3TOU A;  1WOU A;  4Z7X A;  4ULX A;  1U87 A;  3RAZ A;  3ME7 A;  5E59 A;  3LYK A;  1U88 A;  2K8V A;  1SYR A;  2JZS A;  2IN3 A;  2WUL A;  4EKZ A;  4OCE A;  2K8S A;  1GL8 A;  4XRD A;  4V2M A;  5J9B A;  3M1G A;  5ECR B;  2O8V B;  1TRV A;  5IO0 A;  2FD3 A;  4TXO A;  2CZ2 A;  3TJB A;  4BVX B;  1M2D A;  2R0G A;  3CSI A;  4WR5 A;  5ECS A;  5IMZ A;  4ML1 A;  4NXI A;  2CV4 A;  5F06 A;  5DBQ A;  2O89 A;  4P3Y B;  1TI1 A;  3UBK A;  3CBU A;  4I5Q A;  4IP6 A;  2GZZ A;  2DC5 A;  1ZGN A;  1TRS A;  4PUA A;  2H74 A;  2WDU A;  2HZE A;  2WFC A;  4AJ7 A;  3O3T A;  1GUM A;  3BCK A;  3L9U A;  5INY A;  2E2G A;  2NDO A;  1DBY A;  4F9Z A;  4PQH A;  1FB6 A;  2DLX A;  4NV2 A;  4N10 A;  2WZ9 A;  3APS A;  12GS A;  3HKR A;  2I81 A;  3QPM A;  3R2Q A;  2CAQ A;  2VM2 A;  3E3E A;  1GNW A;  3LOR A;  4EXJ A;  2RLI A;  1ZL9 A;  4MLY A;  2HT9 A;  2KLX A;  2PVO C;  3D0Z A;  2YV7 A;  4NHZ A;  5ECP B;  4ZB8 A;  1J08 A;  1BED A;  2KOK A;  1I5G A;  1GTB A;  1XBS A;  5JCW A;  4TR3 A;  4KDY A;  4CW9 A;  4RQX A;  2BMX A;  1TKD B;  3QCP A;  4IQ1 A;  4Z2R A;  2P0G A;  3IK9 A;  1FOH A;  4BL7 A;  5CRD A;  3SBC A;  4DVC A;  2QSI A;  3DD3 A;  1OAZ A;  2ZNM A;  4K2X A;  4O5U A;  8GSS A;  3W8J A;  4N30 A;  3Q18 A;  3H79 A;  2R5G A;  2CX3 A;  4MMM A;  1V40 A;  2ON7 A;  4WBR D;  3QAG A;  4LA1 A;  2L4C A;  5ECI B;  1SKS B;  2NPB A;  2C0D A;  1T4Y A;  1PKZ A;  1T4Z A;  1TP9 A;  4HQS A;  4KUN A;  4WEY A;  4KGI A;  4RUV A;  3IPZ A;  2H0H A;  1S3R A;  1R4W A;  2GT6 A;  3MAK A;  1MTC A;  1SL0 B;  2LUS A;  3GA4 A;  2LTK A;  1YF1 A;  4IP1 A;  1F3A A;  3ZMK A;  3VWU A;  3C1S A;  2CX4 A;  1B9Y C;  2F8F A;  2LEG A;  1S3A A;  4NPB A;  4ECI A;  1AIU A;  2B5E A;  4KE3 A;  5FWG A;  4GF0 A;  3TKR A;  1QK8 A;  3UJ1 A;  3OR5 A;  2DJ0 A;  2VLV A;  3GHA A;  1ILO A;  4G10 A;  1XPV A;  2I9H A;  2X4A A;  3GKK A;  4HU7 A;  1HD2 A;  3F6F A;  2YWM A;  1ABA A;  2AJQ B;  4LLR A;  1JZR A;  4KB3 A;  5DAK A;  3HDC A;  5IM9 A;  1NHY A;  1PX7 A;  5GAP D;  3EU4 A;  3MYD A;  1SJ6 A;  2O7K A;  2F51 A;  2HRF A;  3EPT A;  2N5F A;  3ZLP A;  1U3A A;  2DJ1 A;  1YZX A;  5D73 A;  3KJY A;  2DKI A;  2HSM A;  1Z7R A;  4MF5 A;  4FYU A;  3MWH A;  3LXT A;  3F0I A;  2LNS A;  4WBJ A;  2C8U A;  4E8H A;  1DE2 A;  5DAL A;  2VCW A;  4IS0 A;  2R37 A;  4ZXG A;  2B1L A;  1V58 A;  2VCQ A;  3GUR A;  2EIO A;  3UL3 A;  1MDJ A;  2A2R A;  1AW9 A;  1MD3 A;  2YWO A;  2GZP A;  3D4M A;  4GLT A;  2YWI A;  3TUE A;  1TK5 B;  5AN1 A;  2GQM A;  4YKG A;  3C7M A;  3WGE A;  5GST A;  2TIR A;  4AF2 A;  2C3T A;  3KTL A;  4LL4 B;  1GTA A;  1NHO A;  1SYX A;  5G5F A;  2QA1 A;  3ZIJ A;  2M46 A;  2DJ3 A;  3BCI A;  3DIE A;  5ECK B;  5G1K A;  1SKW B;  4MZW A;  3KXO A;  4FYC A;  4PGT A;  1FAA A;  3FR6 A;  4PXO A;  3HVX A;  4OO4 A;  2BJX A;  3EMP A;  4XHM A;  3GYK A;  4NHW A;  2L57 A;  3IDV A;  3A2V A;  2TRC P;  3EIN A;  4TR1 B;  3V1W A;  1HNB A;  1K0N A;  4Q5R A;  1EOH A;  2OAC A;  4KSM A;  4TVE A;  2H6Y A;  4DSQ A;  3UBL A;  3IE3 A;  1G7O A;  3EMX A;  4EIQ A;  5CO3 A;  3L9S A;  2GDR A;  4HQZ A;  4OCF A;  3VLN A;  1LBK A;  2N5A A;  1PQN A;  3VWX A;  1HYU A;  3QAW A;  2E7P A;  2HNL A;  4K7I A;  3FHK A;  3TKS C;  1GUK A;  2QGV A;  5BRT A;  3DXB A;  3PPU A;  5IOX A;  1ZYN A;  1XIY A;  3RBT A;  2X8H A;  1VRS D;  3QAV A;  3NOF A;  1YEP A;  5G5E A;  3HA9 A;  3O6T A;  1WRY A;  5GZZ B;  3EWL A;  4DSR A;  1F6M C;  2YCD A;  1FVK A;  4MH3 A;  5HQP A;  3TDG A;  4MJE A;  4D73 A;  4KA0 A;  3KH9 A;  3CRU A;  4XS4 A;  3W6G A;  5F07 A;  5J9C A;  1O81 A;  4PNG A;  3D4T A;  1GH2 A;  2RM6 A;  2GSS A;  3A5W A;  1ZOF A;  2C4J A;  3U5R E;  4GWR A;  3GL5 A;  2MYG A;  5H5Q A;  3VK9 A;  2HXK A;  3KIJ A;  2X49 A;  1Y25 A;  4JBB A;  4KX4 A;  5B6N A;  2B3S A;  2DIZ A;  1F37 A;  1N8J A;  1ERV A;  3I43 A;  2CZ3 A;  1XFL A;  2DIY A;  3TKQ A;  2NTO A;  1BG5 A;  1JFU A;  1LJR A;  1HNA A;  2JZR A;  4MZC A;  3IXR A;  5IOW A;  2WJU A;  4POB A;  1AXD A;  1NM3 A;  4L0W A;  4ZL7 A;  2HSH A;  11GS A;  3TKP A;  4F2I A;  3FZA A;  2FHE A;  3ZFL A;  5GSS A;  3LEF A;  5CRW A;  3FY7 A;  1A23 A;  2XBQ A;  5ID2 A;  1PA3 A;  5LD0 A;  2K18 A;  4XCS A;  5FT3 A;  1PGT A;  5B7C A;  2MMO A;  4MA9 A;  4IEL A;  3Q6O A;  4HZ2 A;  1UA5 A;  3HVV A;  1XG8 A;  3F9U A;  3GV1 A;  3ZML A;  2H19 A;  2LRT A;  1GLP A;  3EUR A;  4Q5N A;  5J4U A;  2HFD A;  2A2S A;  2J9H A;  3IR4 A;  3PR8 A;  3F6D A;  4MJA A;  3QD9 A;  1T8E B;  1X5E A;  1Z3E A;  2H76 A;  1G0T A;  3CXG A;  1AQX A;  5DCG A;  1KNG A;  4ZBD A;  3TOT A;  5IMC A;  3S9F A;  5FHI A;  2VL2 A;  4LMV A;  1V57 A;  3M9K A;  1JZO A;  1MD4 A;  5DJM A;  1PRX A;  4K5S A;  6GSV A;  3ERF A;  1SD8 A;  3DYR A;  3GX0 A;  3SWL A;  4FO5 A;  2L6D A;  3G9B A;  1SEN A;  4FH8 A;  1OC8 A;  2L6C A;  3I9V 2;  3VFI A;  2YZH A;  19GS A;  1MEK A;  1SU9 A;  2CT6 A;  4IW9 A;  2X8C A;  2DSA A;  4L5O A;  2VOC A;  4GCI A;  4POK A;  1DE1 A;  3WT1 A;  2VAF A;  4NV5 A;  3I69 A;  1K0O A;  2V6K A;  3QR6 A;  2FA8 A;  4Z2T A;  1XCC A;  3ZIT A;  3IC8 A;  1WPI A;  4K9Z A;  3VI7 A;  1E2Y A;  2CVK A;  14GS A;  1GSY A;  3GNJ A;  5H5S A;  2JSZ A;  3M9J A;  4K1F A;  1GSS A;  5DJL A;  4PUR A;  1V2A A;  2Z9S A;  4E8E A;  4H86 A;  1YEX A;  3L0H A;  4DSS A;  4HOJ A;  3CTG A;  3HYP A;  3NZN A;  4ECC A;  3TB2 A;  5IMF A;  3H4K A;  4IN0 A;  1CQH A;  2ES7 A;  3FR3 A;  3M0F A;  4I97 A;  1FB0 A;  1TRU A;  5EY6 A;  2M80 A;  2F3M A;  2B7J A;  4CDO A;  1EZK A;  2IFQ B;  4YQM A;  3ED3 A;  3TKS E;  3UVT A;  5A4V A;  1SKR B;  1UVZ A;  3HHV A;  2KP1 A;  1ZYQ B;  1TK0 B;  5CP1 A;  2FLS A;  5HR2 A;  2XHF A;  2CQ9 A;  1UN2 A;  2PMT A;  3GSS A;  4OD7 A;  5B8B A;  3F8U A;  2VLU A;  2GQL A;  3TRP A;  1IYH A;  4ZB9 A;  5EVO A;  4BVY B;  2A2P A;  2J23 A;  4MCU A;  1TW9 A;  3IAM 2;  1VF4 A;  1CQG A;  1FG4 A;  1OE8 A;  5ECL B;  3EVI A;  5D9X A;  1XVW A;  2A4H A;  2C80 A;  2L4Q A;  3LWA A;  3CYN A;  1GUL A;  16GS A;  2OAD A;  1EOG A;  1TU7 A;  3RPN A;  1EP7 A;  4F0B A;  4I2T A;  2HRN A;  3GIX A;  4CY8 A;  4ISD A;  1RW1 A;  1ZYE A;  2YWN A;  2QA2 A;  3GL3 A;  2AV4 A;  3P8W A;  1X9M B;  2DBC A;  2VCX A;  5GAN D;  4QL9 A;  4GSN A;  3F3R A;  2C3N A;  3N5O A;  2EC4 A;  4QL7 A;  1N2A A;  2MBS A;  4CY6 A;  3WGD A;  1OC9 A;  1VF2 A;  4ZL8 A;  1YKA A;  5JCG A;  4EO3 A;  3UVH A;  2FY6 A;  4MF6 A;  4AGS A;  1R7H A;  2LJA A;  4TXO B;  2FUG 2;  5IIZ A;  4ECB A;  2C1Y A;  3VUR A;  3HJM A;  4GRF A;  3ZRE A;  3RHC A;  1C72 A;  4MNN A;  4ICY A;  3KTB A;  4MK3 A;  2HE3 A;  3HZ8 A;  2AB6 A;  4OFT A;  2CVB A;  2V2G A;  3TKS A;  4EVM A;  1Q98 A;  1M99 A;  3KD0 A;  2PBJ A;  1PKW A;  2H01 A;  2ZUP A;  1GSQ A;  1PX6 A;  2XC2 A;  1M7T A;  4BPY A;  1AUC A;  2HZE B;  2C0G A;  3ZZX A;  3MDK A;  1A0F A;  5HFK A;  1XW5 A;  3KCM A;  4MJC A;  1RK4 A;  4O7H A;  2AYT A;  2NVL A;  1AAZ A;  1PFO A;  1OKT A;  3RDW A;  1GSF A;  3GTU A;  2IME A;  5CRH A;  2B5X A;  1A8Y A;  1T1V A;  4K6X A;  2YAN A;  1GRX A;  1EEJ A;  2OE1 A;  2HYX A;  3DRN A;  4TW5 A;  4Z2U A;  5A4W A;  5IMA A;  2H66 A;  3DGQ A;  2HZF A;  4I8B A;  1ERU A;  5KN1 A;  2DMM A;  1AQW A;  3QMX A;  2R2J A;  3CSH A;  4YAV A;  2B7K A;  1TK8 B;  6GST A;  5KEJ A;  4WF5 A;  4BL7 B;  1OC3 A;  4WXT A;  2H0I A;  1K0D A;  3A2X A;  1OKD A;  3ISO A;  3KGK A;  3FRC A;  2LQO A;  1U6T A;  4HSC X;  1ZYP A;  1BAY A;  3WT2 A;  3ZIV A;  4CHS A;  3KEB A;  1K0A A;  1BYE A;  4OMV A;  2B1K A;  2H30 A;  4Q5Q A;  4F0C A;  2VO4 A;  2WS2 A;  3GKN A;  3E9J B;  3P7X A;  4IQA A;  2VIM A;  2OKA A;  3RPP A;  2GTU A;  3IBH A;  2OBI A;  1TOF A;  2DJK A;  1Z6N A;  2IMF A;  3GX8 A;  3RHB A;  1EWX A;  1G6Y A;  3FZ4 A;  4WKW A;  4O5R A;  1JLW A;  1YDK A;  4LMW A;  5CYY A;  4K7N A;  3TJJ A;  2C0F A;  5D9V A;  1USB A;  3H8Q A;  1M2B A;  3US3 A;  3FEU A;  4F03 A;  1A0R P;  2IPA A;  2YOI A;  3R3E A;  3C73 A;  1K3O A;  3DVX A;  2LST A;  5F8B A;  4POM A;  2ON5 A;  5HFG A;  4XS1 A;  3ZRD A;  2F8A A;  2VCT A;  3W8S A;  3D5J A;  2GZY A;  2JSY A;  4G9H A;  1X5C A;  3DML A;  4TN8 A;  3F4S A;  5DAK B;  2L5O A;  2E2M A;  5COH A;  2ALB A;  4K0G A;  3HD5 A;  4NWY A;  1A2M A;  2AHE A;  3IA1 A;  3ZYW A;  4I2U A;  3Q19 A;  4G0K A;  1TJD A;  5G1L A;  3D6I A;  5LCZ A;  5J3R A;  5BMU A;  4RI6 A;  3VPT A;  2JZT A;  2KUC A;  3BJ5 A;  3FW2 A;  2YPM A;  3CQF A;  3MIX A;  4GST A;  4K0N A;  3QOU A;  4JE1 A;  1BX9 A;  1VGL A;  4WET A;  2LRC A;  4KDU A;  5IQY A;  4USS A;  5AIS A;  1KTE A;  2K9F A;  5EPF A;  5DAL B;  1M9B A;  2GST A;  4ZIL A;  4X0X A;  3LGC A;  2YZU A;  4ZBA A;  4NMU A;  2IWT A;  1FHE A;  2OE3 A;  5LNK e;  2M72 A;  4K2D A;  2CVD A;  2I3Y A;  2LQQ A;  2HLS A;  1SJI A;  1XW6 A;  1S3C A;  2XBI A;  4POL A;  5D93 A;  3GKX A;  2DKH A;  1QGV A;  3CSJ A;  2A4V A;  1JLV A;  3VWW A;  1M3J A;  2N5B A;  5ENU A;  1RQM A;  1ZZY A;  3IHG A;  4EIP A;  1ZCP A;  4FQU A;  3IOS A;  4MZB A;  2V6O A;  5KN0 A;  3LG6 A;  4O92 A;  2H1D A;  2GT5 A;  1AC1 A;  2VD1 A;  4GTU A;  4Q5F A;  2NBS A;  1F3B A;  3GMF A;  2H71 A;  3ZL5 A;  4BWS A;  3A3T A;  2L5L A;  3HVS A;  1O8W A;  1J0F A;  3UAP A;  3APQ A;  5E4W A;  4GQF A;  4KAE A;  1THO A;  4WF4 A;  2WRT A;  4EF0 A;  2TRX A;  3H1N A;  1KEB A;  2GLR A;  3GRX A;  4YAP A;  4DEJ A;  3IHQ A;  1O7U A;  4ID0 A;  4ZBB A;  4KDX A;  3EC3 A;  3O76 A;  1R5A A;  5C04 A;  2QKE A;  4OFN A;  6GSY A;  2P5R A;  4BVX A;  3IC4 A;  4L0U A;  1GP1 A;  2DJJ A;  5HFI A;  1FOV A;  3HCZ A;  3DEX A;  1WIK A;  2YP6 A;  1A2L A;  5L71 A;  1X0R A;  3P90 A;  4JZQ A;  3I6A A;  4RQR A;  2H1A A;  6GSS A;  1B8X A;  2MMN A;  3HY2 A;  1X9W B;  4HUA A;  5JCU A;  3LYP A;  4J57 E;  4HDE A;  4TOP A;  3LW9 A;  4D73 B;  4PTS A;  2D2Z A;  22GS A;  5H5R A;  4XS4 B;  1XW9 A;  4I6X A;  2OBK A;  1PN9 A;  4IGJ A;  3U6V A;  2R4V A;  5F05 A;  1O73 A;  1Q4J A;  2FCH A;  4NAX A;  4G0I A;  3ZFB A;  3ME8 A;  4F82 A;  1XWB A;  2H0G A;  3TRX A;  4N0V A;  3PH9 A;  4KW6 A;  1I9D A;  6GSX A;  4JR6 A;  1SL1 B;  3KP9 A;  4QQ7 A;  4MJB A;  2MBT A;  2H1G A;  4V1A p;  3F3Q A;  5ECO B;  1DSB A;  3VWV A;  1GSU A;  2MZC A;  1XOA A;  2I4A A;  4ILF A;  4EDZ A;  1TXX A;  5CNW A;  5G30 A;  2B6M A;  1T3B A;  1ZMA A;  3CTF A;  2KP2 A;  2H73 A;  1O6J A;  4O5Q A;  5ID2 B;  2FGX A;  1TU8 A;  4GSS A;  1NSW A;  5KOW A;  3DWV A;  2V41 A;  3LJR A;  3QDN A;  2HI7 A;  1SK1 A;  4IHU A;  5A5K A;  3TRQ A;  2C3Q A;  3FZ5 A;  1ST9 A;  5ECH B;  3L4N A;  1XZO A;  5IPH A;  2FNO A;  3GKM A;  2P5Q A;  2LJR A;  1W89 A;  2MMA A;  3Q74 A;  2R3X A;  4PUF C;  1V98 A;  1VF1 A;  1G7E A;  2H75 A;  1E6B A;  1GSD A;  2IMD A;  2REM A;  6GSU A;  1XWK A;  1NW2 A;  3ERG A;  2VCZ A;  1FW1 A;  2VLT A;  4HS1 A;  4JR4 A;  5HR0 A;  2G2Q A;  1M9A A;  1AQV A;  3G7J A;  5AGY A;  1B9X C;  1SJZ A;  3PGT A;  1X5D A;  4XRA A;  3D21 A;  4XTS A;  4X4J A;  4ACS A;  3JCM L;  3KH7 A;  5D8I A;  1Z6M A;  5DQS A;  3UOM A;  2LV3 A;  4TRX A;  2GS3 A;  2IL3 A;  3TGZ A;  1ACV A;  3F4R A;  1EV4 A;  4BWQ A;  4HU9 A;  4KCA A;  2GQK A;  4L5L A;  3EU3 A;  2F9S A;  3MNG A;  5ELA A;  3FR9 A;  5HR3 A;  2O85 A;  1G6W A;  1UC7 A;  1QFN A;  3HJP A;  1U3I A;  4BIK A;  1Z7P A;  1XVQ A;  2FWG A;  1Z5Y E;  4EL1 A;  4EUY A;  4IBP A;  4HZ4 A;  2GGT A;  1B48 A;  1WP0 A;  4YQU A;  3TJK A;  3APO A;  4KF9 A;  4MDC A;  2HSY A;  2PVQ A;  2YNX A;  5CAX A;  3FK8 A;  4TR0 A;  4MPF A;  2IIY A;  3K8N A;  1JZD A;  4PQI A;  3H93 A;  4ECJ A;  2VL2 C;  5J5N A;  2B5Y A;  1M0U A;  3FZ9 A;  2IMI A;  3GH6 A;  4DSS B;  5J41 A;  1YF0 A;  4PX1 A;  1O8X A;  4HJ2 A;  1TI3 A;  2FA4 A;  1F2E A;  1R26 A;  1VF3 A;  1IYI A;  2JL4 A;  3D22 A;  3TCO A;  3TJF A;  5D9T A;  2YV9 A;  4K7O A;  4IVF A;  2MMZ A;  2EIR A;  5F0G A;  2XPE A;  5JWR B;  3A5I A;  3PIN A;  1TDI A;  4G2E A;  4KND A;  3G7Y A;  1GNE A;  1M3I A;  4J56 E;  4PNF A;  4ZB6 A;  18GS A;  2WGR A;  5CRE A;  3UMA A;  5JWO B;  2V32 A;  1K0M A;  3F4T A;  1URM A;  1V9W A;  4MP4 A;  2H6Z A;  3FMW A;  4FIW A;  3ZTL A;  4TR1 A;  4MAB A;  3C71 A;  1JZW A;  3HZ4 A;  3MSZ A;  4O32 A;  3BBY A;  1PD2 1;  5D96 A;  3J7Y k;  5DQY A;  4V2N A;  1J9B A;  4RI7 A;  10GS A;  1THX A;  1SD9 A;  1OE7 A;  2PPT A;  1QUW A;  2OA7 A;  4EDY A;  2GVP A;  4YKF A;  3HXS A;  2LNT A;  1T7P B;  4AJ8 A;  5B6M A;  1SL2 B;  4XIH A;  3EYT A;  1MDI A;  3C8E A;  1QXH A;  1M2A A;  3IRA A;  2VD0 A;  1F9M A;  3IK7 A;  1R5P A;  3UIW A;  5IMV A;  4MF7 A;  2P31 A;  4ML6 A;  3HVN A;  1HNC A;  4KCE A;  1OC9 B;  3IAS 2;  1XOB A;  2O87 A;  3A2W A;  1EGR A;  2YJH A;  1FVJ A;  5G31 A;  1EEM A;  5DCH A;  2CAI A;  4ZIJ A;  2RM5 A;  2VUP A;  1SK2 A;  3M8N A;  3N9J A;  1ERT A;  2C0E A;  4G19 A;  1K3Y A;  2DML A;  1EGO A;  3CRT A;  1MDK A;  4PQ1 A;  2GSR A;  4TKY A;  3KP8 A;  1PSQ A;  3VPQ A;  1LU4 A;  4MPG A;  3GH9 A;  4HEA 2;  5G2Z A;  2FWF A;  2H6X A;  2PU9 C;  5AIX A;  4N11 A;  5IPG A;  2JAD A;  3KMO A;  3ZVJ D;  1GWC A;  1XWG A;  2IMK A;  2IJY A;  3BOA A;  3TJG A;  2GSQ A;  1XXU A;  4EC0 A;  2HRA A;  2KHP A;  1PMT A;  4A5P A;  2VM1 A;  3GTU B;  7GSS A;  3L78 A;  3UEM A;  1XWC A;  2JAC A;  20GS A;  1O85 A;  2VCV A;  2G0F A;  3E0U A;  3EE2 A;  1A24 A;  5ECN B;  4HI7 A;  2RII A;  1GUH A;  1OVN A;  3WD6 A;  5KN2 A;  1PN0 A;  3KZQ A;  1ERW A;  1B4P A;  2FWH A;  2LJK A;  4LL1 B;  2JU5 A;  3P2A A;  5ECM B;  2X8G A;  1H4O A;  4V1A g;  3GUS A;  4YH2 A;  2RUF A;  3IV4 A;  4TXV A;  2WCI A;  3CMI A;  6GSW A;  4JU5 A;  2WB9 A;  3KM6 A;  3DKS A;  2OE0 A;  2R6K A;  1TTZ A;  3QFB C;  3DVW A;  4K8M A;  1W4V A;  1TRW A;  1A8L A;  2E0Q A;  5A4U A;  1EV9 A;  1T00 A;  3C1R A;  4N0Z A;  3FYG A;  3UAR A;  4IKH A;  3AY8 A;  3HJO A;  1A2J A;  2FWE A;  4OFM A;  3F63 A;  4YQV A;  9GSS A;  2H70 A;  2PER A;  1YQ1 A;  3GST A;  1WJK A;  1EP8 A;  2VL9 A;  3FKF A;  4FYB A;  3ERW A;  5EL8 A;  1PL1 A;  4IJ3 A;  1S3D A;  5ELG A;  1PL2 A;  3GN3 A;  1B4Q A;  2AAW A;  3LXZ A;  4WR4 A;  2OJL A;  1XWA A;  2CA8 A;  4IJI A;  5AIV A;  3KMN A;  3WGX A;  2BTO T; 
#chains in the Genus database with same CATH homology
 1BJX A;  2AUV A;  4EE0 A;  2R0C A;  1Z9H A;  2L59 A;  2QC7 A;  5IMD A;  4XS6 A;  4J2F A;  4KSO A;  4MH2 A;  3WYW A;  2VL3 A;  3L9V A;  3M3M A;  4GQC A;  1OYJ A;  1WMJ A;  2RUE A;  2LS5 A;  1QQ2 A;  5IO2 A;  1YJ6 A;  13GS A;  4BA7 A;  4K5R A;  2YJ7 A;  3VI5 A;  2YN1 A;  4OO5 A;  1GTI A;  4X43 A;  2LRN A;  4JED A;  4KH7 A;  17GS A;  5B8A A;  3LQ7 A;  4AJ6 A;  4L8E A;  1YKC A;  3LSZ A;  2HRK A;  1JHB A;  3BD2 A;  4X1U A;  3J7Y b;  5HR1 A;  4JRR A;  1WWJ A;  5C00 A;  2H8L A;  4OWY A;  1GTU A;  5D9W A;  1SK0 A;  2IFQ A;  5CRG A;  4GXZ A;  4V2L A;  1HQO A;  2H1B A;  1GSE A;  2EIQ A;  1X9S B;  2LKU A;  1BQ7 A;  2I1U A;  1ML6 A;  3LFL A;  5DVB A;  1YY7 A;  3QFA C;  1QMV A;  1DUG A;  1K3L A;  1ON4 A;  4BVY A;  2PN8 A;  2PWJ A;  4ZL9 A;  2V1M A;  3ZVJ A;  3NIV A;  1H75 A;  2X99 A;  3GFK A;  3G7I A;  5KN3 A;  2R0P A;  2UZ8 A;  2K6V A;  1GLQ A;  5DDL A;  2PGT A;  2ZCT A;  2DJ2 A;  1KBN A;  1FO5 A;  1WE0 A;  5KOX A;  5ABR A;  4TR4 A;  4G0L A;  2XPD A;  1Y6E A;  1K0B A;  2PUK C;  1K0C A;  5JWQ B;  2H72 A;  2X64 A;  5ECQ B;  4HJM A;  3TOU A;  1WOU A;  4Z7X A;  4ULX A;  1U87 A;  3RAZ A;  3ME7 A;  5E59 A;  3LYK A;  1U88 A;  2K8V A;  1SYR A;  2JZS A;  2IN3 A;  2WUL A;  4EKZ A;  4OCE A;  2K8S A;  1GL8 A;  4XRD A;  4V2M A;  5J9B A;  3M1G A;  5ECR B;  2O8V B;  1TRV A;  5IO0 A;  2FD3 A;  4TXO A;  2CZ2 A;  3TJB A;  4BVX B;  1M2D A;  2R0G A;  3CSI A;  4WR5 A;  5ECS A;  5IMZ A;  4ML1 A;  4NXI A;  2CV4 A;  5F06 A;  5DBQ A;  2O89 A;  4P3Y B;  1TI1 A;  3UBK A;  3CBU A;  4I5Q A;  4IP6 A;  2GZZ A;  2DC5 A;  1ZGN A;  1TRS A;  4PUA A;  2H74 A;  2WDU A;  2HZE A;  2WFC A;  4AJ7 A;  3O3T A;  1GUM A;  3BCK A;  3L9U A;  5INY A;  2E2G A;  2NDO A;  1DBY A;  4F9Z A;  4PQH A;  1FB6 A;  2DLX A;  4NV2 A;  4N10 A;  2WZ9 A;  3APS A;  12GS A;  3HKR A;  2I81 A;  3QPM A;  3R2Q A;  2CAQ A;  2VM2 A;  3E3E A;  1GNW A;  3LOR A;  4EXJ A;  2RLI A;  1ZL9 A;  4MLY A;  2HT9 A;  2KLX A;  2PVO C;  3D0Z A;  2YV7 A;  4NHZ A;  5ECP B;  4ZB8 A;  1J08 A;  1BED A;  2KOK A;  1I5G A;  1GTB A;  1XBS A;  5JCW A;  4TR3 A;  4KDY A;  4CW9 A;  4RQX A;  2BMX A;  1TKD B;  3QCP A;  4IQ1 A;  4Z2R A;  2P0G A;  3IK9 A;  1FOH A;  4BL7 A;  5CRD A;  3SBC A;  4DVC A;  2QSI A;  3DD3 A;  1OAZ A;  2ZNM A;  4K2X A;  4O5U A;  8GSS A;  3W8J A;  4N30 A;  3Q18 A;  3H79 A;  2R5G A;  2CX3 A;  4MMM A;  1V40 A;  2ON7 A;  4WBR D;  3QAG A;  4LA1 A;  2L4C A;  5ECI B;  1SKS B;  2NPB A;  2C0D A;  1T4Y A;  1PKZ A;  1T4Z A;  1TP9 A;  4HQS A;  4KUN A;  4WEY A;  4KGI A;  4RUV A;  3IPZ A;  2H0H A;  1R4W A;  2GT6 A;  3MAK A;  1MTC A;  1SL0 B;  2LUS A;  3GA4 A;  2LTK A;  1YF1 A;  4IP1 A;  1F3A A;  3ZMK A;  3VWU A;  3C1S A;  2CX4 A;  1B9Y C;  2F8F A;  2LEG A;  1S3A A;  4NPB A;  4ECI A;  1AIU A;  2B5E A;  4KE3 A;  5FWG A;  4GF0 A;  3TKR A;  1QK8 A;  3UJ1 A;  3OR5 A;  2DJ0 A;  2VLV A;  3GHA A;  1ILO A;  4G10 A;  1XPV A;  2I9H A;  2X4A A;  3GKK A;  4HU7 A;  1HD2 A;  3F6F A;  2YWM A;  1ABA A;  2AJQ B;  4LLR A;  1JZR A;  4KB3 A;  5DAK A;  3HDC A;  5IM9 A;  1NHY A;  1PX7 A;  5GAP D;  3EU4 A;  3MYD A;  1SJ6 A;  2O7K A;  2F51 A;  2HRF A;  3EPT A;  2N5F A;  3ZLP A;  1U3A A;  2DJ1 A;  1YZX A;  5D73 A;  3KJY A;  2DKI A;  2HSM A;  1Z7R A;  4MF5 A;  4FYU A;  3MWH A;  3LXT A;  3F0I A;  2LNS A;  4WBJ A;  2C8U A;  4E8H A;  1DE2 A;  5DAL A;  2VCW A;  4IS0 A;  2R37 A;  4ZXG A;  2B1L A;  1V58 A;  2VCQ A;  3GUR A;  2EIO A;  3UL3 A;  1MDJ A;  2A2R A;  1AW9 A;  1MD3 A;  2YWO A;  2GZP A;  3D4M A;  4GLT A;  2YWI A;  3TUE A;  1TK5 B;  5AN1 A;  2GQM A;  4YKG A;  3C7M A;  3WGE A;  5GST A;  2TIR A;  4AF2 A;  2C3T A;  3KTL A;  4LL4 B;  1GTA A;  1NHO A;  1SYX A;  5G5F A;  2QA1 A;  3ZIJ A;  2M46 A;  2DJ3 A;  3BCI A;  3DIE A;  5ECK B;  5G1K A;  1SKW B;  4MZW A;  3KXO A;  4FYC A;  4PGT A;  1FAA A;  3FR6 A;  4PXO A;  3HVX A;  4OO4 A;  2BJX A;  3EMP A;  4XHM A;  3GYK A;  4NHW A;  2L57 A;  3IDV A;  3A2V A;  2TRC P;  3EIN A;  4TR1 B;  3V1W A;  1HNB A;  1K0N A;  4Q5R A;  1EOH A;  2OAC A;  4KSM A;  4TVE A;  2H6Y A;  4DSQ A;  3UBL A;  3IE3 A;  1G7O A;  3EMX A;  4EIQ A;  5CO3 A;  3L9S A;  2GDR A;  4HQZ A;  4OCF A;  3VLN A;  1LBK A;  2N5A A;  1PQN A;  3VWX A;  1HYU A;  3QAW A;  2E7P A;  2HNL A;  4K7I A;  3FHK A;  3TKS C;  1GUK A;  2QGV A;  5BRT A;  3DXB A;  3PPU A;  5IOX A;  1ZYN A;  1XIY A;  3RBT A;  2X8H A;  1VRS D;  3QAV A;  3NOF A;  1YEP A;  5G5E A;  3HA9 A;  3O6T A;  1WRY A;  5GZZ B;  3EWL A;  4DSR A;  1F6M C;  2YCD A;  1FVK A;  4MH3 A;  5HQP A;  3TDG A;  4MJE A;  4D73 A;  4KA0 A;  3KH9 A;  3CRU A;  4XS4 A;  3W6G A;  5F07 A;  5J9C A;  1O81 A;  4PNG A;  3D4T A;  1GH2 A;  2RM6 A;  2GSS A;  3A5W A;  1ZOF A;  2C4J A;  3U5R E;  4GWR A;  3GL5 A;  2MYG A;  5H5Q A;  3VK9 A;  2HXK A;  3KIJ A;  2X49 A;  1Y25 A;  4JBB A;  4KX4 A;  5B6N A;  2B3S A;  2DIZ A;  1F37 A;  1N8J A;  1ERV A;  3I43 A;  2CZ3 A;  1XFL A;  2DIY A;  3TKQ A;  2NTO A;  1BG5 A;  1JFU A;  1LJR A;  1HNA A;  2JZR A;  4MZC A;  3IXR A;  5IOW A;  2WJU A;  4POB A;  1AXD A;  1NM3 A;  4L0W A;  4ZL7 A;  2HSH A;  11GS A;  3TKP A;  4F2I A;  3FZA A;  2FHE A;  3ZFL A;  5GSS A;  3LEF A;  5CRW A;  3FY7 A;  1A23 A;  2XBQ A;  5ID2 A;  1PA3 A;  5LD0 A;  2K18 A;  4XCS A;  5FT3 A;  1PGT A;  5B7C A;  2MMO A;  4MA9 A;  4IEL A;  3Q6O A;  4HZ2 A;  1UA5 A;  3HVV A;  3F9U A;  3GV1 A;  3ZML A;  2H19 A;  2LRT A;  1GLP A;  3EUR A;  4Q5N A;  5J4U A;  2HFD A;  2A2S A;  2J9H A;  3IR4 A;  3PR8 A;  3F6D A;  4MJA A;  3QD9 A;  1T8E B;  1X5E A;  1Z3E A;  2H76 A;  1G0T A;  3CXG A;  1AQX A;  5DCG A;  1KNG A;  4ZBD A;  3TOT A;  5IMC A;  3S9F A;  5FHI A;  2VL2 A;  4LMV A;  1V57 A;  3M9K A;  1JZO A;  1MD4 A;  5DJM A;  1PRX A;  4K5S A;  6GSV A;  3ERF A;  1SD8 A;  3DYR A;  3GX0 A;  3SWL A;  4FO5 A;  2L6D A;  3G9B A;  1SEN A;  4FH8 A;  1OC8 A;  2L6C A;  3I9V 2;  3VFI A;  2YZH A;  19GS A;  1MEK A;  1SU9 A;  2CT6 A;  4IW9 A;  2X8C A;  2DSA A;  4L5O A;  2VOC A;  4GCI A;  4POK A;  1DE1 A;  3WT1 A;  2VAF A;  4NV5 A;  3I69 A;  1K0O A;  2V6K A;  3QR6 A;  2FA8 A;  4Z2T A;  1XCC A;  3ZIT A;  3IC8 A;  1WPI A;  4K9Z A;  3VI7 A;  1E2Y A;  2CVK A;  14GS A;  1GSY A;  3GNJ A;  5H5S A;  2JSZ A;  3M9J A;  4K1F A;  1GSS A;  5DJL A;  4PUR A;  1V2A A;  2Z9S A;  4E8E A;  4H86 A;  1YEX A;  3L0H A;  4DSS A;  4HOJ A;  3CTG A;  3HYP A;  3NZN A;  4ECC A;  3TB2 A;  5IMF A;  3H4K A;  4IN0 A;  1CQH A;  2ES7 A;  3FR3 A;  3M0F A;  4I97 A;  1FB0 A;  1TRU A;  5EY6 A;  2M80 A;  2F3M A;  2B7J A;  4CDO A;  1EZK A;  2IFQ B;  4YQM A;  3ED3 A;  3TKS E;  3UVT A;  5A4V A;  1SKR B;  1UVZ A;  3HHV A;  2KP1 A;  1ZYQ B;  1TK0 B;  5CP1 A;  2FLS A;  5HR2 A;  2XHF A;  2CQ9 A;  1UN2 A;  2PMT A;  3GSS A;  4OD7 A;  5B8B A;  3F8U A;  2VLU A;  2GQL A;  3TRP A;  1IYH A;  4ZB9 A;  5EVO A;  4BVY B;  2A2P A;  2J23 A;  4MCU A;  1TW9 A;  3IAM 2;  1VF4 A;  1CQG A;  1FG4 A;  1OE8 A;  5ECL B;  3EVI A;  5D9X A;  1XVW A;  2A4H A;  2C80 A;  2L4Q A;  3LWA A;  3CYN A;  1GUL A;  16GS A;  2OAD A;  1EOG A;  1TU7 A;  3RPN A;  1EP7 A;  4F0B A;  4I2T A;  2HRN A;  3GIX A;  4CY8 A;  4ISD A;  1RW1 A;  1ZYE A;  2YWN A;  2QA2 A;  3GL3 A;  2AV4 A;  3P8W A;  1X9M B;  2DBC A;  2VCX A;  5GAN D;  4QL9 A;  4GSN A;  3F3R A;  2C3N A;  3N5O A;  2EC4 A;  4QL7 A;  1N2A A;  2MBS A;  4CY6 A;  3WGD A;  1OC9 A;  1VF2 A;  4ZL8 A;  1YKA A;  5JCG A;  4EO3 A;  3UVH A;  2FY6 A;  4MF6 A;  4AGS A;  1R7H A;  2LJA A;  4TXO B;  2FUG 2;  5IIZ A;  4ECB A;  2C1Y A;  3VUR A;  3HJM A;  4GRF A;  3ZRE A;  3RHC A;  1C72 A;  4MNN A;  4ICY A;  3KTB A;  4MK3 A;  2HE3 A;  3HZ8 A;  2AB6 A;  4OFT A;  2CVB A;  2V2G A;  3TKS A;  4EVM A;  1Q98 A;  1M99 A;  3KD0 A;  2PBJ A;  1PKW A;  2H01 A;  2ZUP A;  1GSQ A;  1PX6 A;  2XC2 A;  1M7T A;  4BPY A;  1AUC A;  2HZE B;  2C0G A;  3ZZX A;  3MDK A;  1A0F A;  5HFK A;  1XW5 A;  3KCM A;  4MJC A;  1RK4 A;  4O7H A;  2AYT A;  2NVL A;  1AAZ A;  1OKT A;  3RDW A;  1GSF A;  3GTU A;  2IME A;  5CRH A;  2B5X A;  1A8Y A;  1T1V A;  4K6X A;  2YAN A;  1GRX A;  1EEJ A;  2OE1 A;  2HYX A;  3DRN A;  4TW5 A;  4Z2U A;  5A4W A;  5IMA A;  2H66 A;  3DGQ A;  2HZF A;  4I8B A;  1ERU A;  5KN1 A;  2DMM A;  1AQW A;  3QMX A;  2R2J A;  3CSH A;  4YAV A;  2B7K A;  1TK8 B;  6GST A;  5KEJ A;  4WF5 A;  4BL7 B;  1OC3 A;  4WXT A;  2H0I A;  1K0D A;  3A2X A;  1OKD A;  3ISO A;  3KGK A;  3FRC A;  2LQO A;  1U6T A;  1ZYP A;  1BAY A;  3WT2 A;  3ZIV A;  4CHS A;  3KEB A;  1K0A A;  1BYE A;  4OMV A;  2B1K A;  2H30 A;  4Q5Q A;  4F0C A;  2VO4 A;  2WS2 A;  3GKN A;  3E9J B;  3P7X A;  4IQA A;  2VIM A;  2OKA A;  3RPP A;  2GTU A;  3IBH A;  2OBI A;  1TOF A;  2DJK A;  1Z6N A;  2IMF A;  3GX8 A;  3RHB A;  1EWX A;  1G6Y A;  3FZ4 A;  4WKW A;  4O5R A;  1JLW A;  1YDK A;  4LMW A;  5CYY A;  4K7N A;  3TJJ A;  2C0F A;  5D9V A;  1USB A;  3H8Q A;  1M2B A;  3US3 A;  3FEU A;  4F03 A;  1A0R P;  2IPA A;  2YOI A;  3R3E A;  3C73 A;  1K3O A;  3DVX A;  2LST A;  5F8B A;  4POM A;  2ON5 A;  5HFG A;  4XS1 A;  3ZRD A;  2F8A A;  2VCT A;  3W8S A;  3D5J A;  2GZY A;  2JSY A;  4G9H A;  1X5C A;  3DML A;  4TN8 A;  3F4S A;  5DAK B;  2L5O A;  2E2M A;  5COH A;  2ALB A;  4K0G A;  3HD5 A;  4NWY A;  1A2M A;  2AHE A;  3IA1 A;  3ZYW A;  4I2U A;  3Q19 A;  4G0K A;  1TJD A;  5G1L A;  3D6I A;  5LCZ A;  5J3R A;  5BMU A;  4RI6 A;  3VPT A;  2JZT A;  2KUC A;  3BJ5 A;  3FW2 A;  2YPM A;  3MIX A;  4GST A;  4K0N A;  3QOU A;  4JE1 A;  1BX9 A;  1VGL A;  4WET A;  2LRC A;  4KDU A;  5IQY A;  4USS A;  5AIS A;  1KTE A;  2K9F A;  5EPF A;  5DAL B;  1M9B A;  2GST A;  4ZIL A;  4X0X A;  3LGC A;  2YZU A;  4ZBA A;  4NMU A;  2IWT A;  1FHE A;  2OE3 A;  5LNK e;  2M72 A;  4K2D A;  2CVD A;  2I3Y A;  2LQQ A;  2HLS A;  1SJI A;  1XW6 A;  1S3C A;  2XBI A;  4POL A;  5D93 A;  3GKX A;  2DKH A;  1QGV A;  3CSJ A;  2A4V A;  1JLV A;  3VWW A;  2N5B A;  5ENU A;  1RQM A;  1ZZY A;  3IHG A;  4EIP A;  1ZCP A;  4FQU A;  3IOS A;  4MZB A;  2V6O A;  5KN0 A;  3LG6 A;  4O92 A;  2H1D A;  2GT5 A;  1AC1 A;  2VD1 A;  2NBS A;  4Q5F A;  4GTU A;  1F3B A;  3GMF A;  2H71 A;  3ZL5 A;  4BWS A;  3A3T A;  2L5L A;  3HVS A;  1O8W A;  1J0F A;  3UAP A;  3APQ A;  5E4W A;  4GQF A;  4KAE A;  1THO A;  4WF4 A;  2WRT A;  4EF0 A;  2TRX A;  3H1N A;  1KEB A;  2GLR A;  3GRX A;  4YAP A;  4DEJ A;  3IHQ A;  1O7U A;  4ID0 A;  4ZBB A;  4KDX A;  3EC3 A;  3O76 A;  1R5A A;  5C04 A;  2QKE A;  4OFN A;  6GSY A;  2P5R A;  4BVX A;  3IC4 A;  4L0U A;  1GP1 A;  2DJJ A;  5HFI A;  1FOV A;  3HCZ A;  3DEX A;  1WIK A;  2YP6 A;  1A2L A;  5L71 A;  1X0R A;  3P90 A;  4JZQ A;  3I6A A;  4RQR A;  2H1A A;  6GSS A;  1B8X A;  2MMN A;  3HY2 A;  1X9W B;  4HUA A;  5JCU A;  3LYP A;  4J57 E;  4HDE A;  4TOP A;  3LW9 A;  4D73 B;  4PTS A;  2D2Z A;  22GS A;  5H5R A;  4XS4 B;  1XW9 A;  4I6X A;  2OBK A;  1PN9 A;  4IGJ A;  3U6V A;  2R4V A;  5F05 A;  1O73 A;  1Q4J A;  2FCH A;  4NAX A;  4G0I A;  3ZFB A;  3ME8 A;  4F82 A;  1XWB A;  2H0G A;  3TRX A;  4N0V A;  3PH9 A;  4KW6 A;  1I9D A;  6GSX A;  4JR6 A;  1SL1 B;  3KP9 A;  4QQ7 A;  4MJB A;  2MBT A;  2H1G A;  4V1A p;  3F3Q A;  5ECO B;  1DSB A;  3VWV A;  1GSU A;  2MZC A;  1XOA A;  2I4A A;  4ILF A;  4EDZ A;  1TXX A;  5CNW A;  5G30 A;  2B6M A;  1T3B A;  1ZMA A;  3CTF A;  2KP2 A;  2H73 A;  1O6J A;  4O5Q A;  5ID2 B;  2FGX A;  1TU8 A;  4GSS A;  1NSW A;  5KOW A;  3DWV A;  2V41 A;  3LJR A;  3QDN A;  2HI7 A;  1SK1 A;  4IHU A;  5A5K A;  3TRQ A;  2C3Q A;  3FZ5 A;  1ST9 A;  5ECH B;  3L4N A;  1XZO A;  5IPH A;  2FNO A;  3GKM A;  2P5Q A;  2LJR A;  1W89 A;  2MMA A;  3Q74 A;  2R3X A;  4PUF C;  1V98 A;  1VF1 A;  1G7E A;  2H75 A;  1E6B A;  1GSD A;  2IMD A;  2REM A;  6GSU A;  1XWK A;  1NW2 A;  3ERG A;  2VCZ A;  1FW1 A;  2VLT A;  4HS1 A;  4JR4 A;  5HR0 A;  2G2Q A;  1M9A A;  1AQV A;  3G7J A;  5AGY A;  1B9X C;  1SJZ A;  3PGT A;  1X5D A;  4XRA A;  3D21 A;  4XTS A;  4X4J A;  4ACS A;  3JCM L;  3KH7 A;  5D8I A;  1Z6M A;  5DQS A;  3UOM A;  2LV3 A;  4TRX A;  2GS3 A;  2IL3 A;  3TGZ A;  1ACV A;  3F4R A;  1EV4 A;  4BWQ A;  4HU9 A;  4KCA A;  2GQK A;  4L5L A;  3EU3 A;  2F9S A;  3MNG A;  5ELA A;  3FR9 A;  5HR3 A;  2O85 A;  1G6W A;  1UC7 A;  1QFN A;  3HJP A;  1U3I A;  1Z7P A;  1XVQ A;  2FWG A;  1Z5Y E;  4EL1 A;  4EUY A;  4HZ4 A;  4IBP A;  2GGT A;  1B48 A;  1WP0 A;  4YQU A;  3TJK A;  3APO A;  4KF9 A;  4MDC A;  2HSY A;  2PVQ A;  2YNX A;  5CAX A;  3FK8 A;  4TR0 A;  4MPF A;  2IIY A;  3K8N A;  1JZD A;  4PQI A;  3H93 A;  4ECJ A;  2VL2 C;  5J5N A;  2B5Y A;  1M0U A;  3FZ9 A;  2IMI A;  3GH6 A;  4DSS B;  5J41 A;  1YF0 A;  4PX1 A;  1O8X A;  4HJ2 A;  1TI3 A;  2FA4 A;  1F2E A;  1R26 A;  1VF3 A;  1IYI A;  2JL4 A;  3D22 A;  3TCO A;  3TJF A;  5D9T A;  2YV9 A;  4K7O A;  4IVF A;  2MMZ A;  2EIR A;  5F0G A;  2XPE A;  5JWR B;  3A5I A;  3PIN A;  1TDI A;  4G2E A;  4KND A;  3G7Y A;  1GNE A;  4J56 E;  4PNF A;  4ZB6 A;  18GS A;  2WGR A;  5CRE A;  3UMA A;  5JWO B;  2V32 A;  1K0M A;  3F4T A;  1URM A;  1V9W A;  4MP4 A;  2H6Z A;  3FMW A;  4FIW A;  3ZTL A;  4TR1 A;  4MAB A;  3C71 A;  1JZW A;  3HZ4 A;  3MSZ A;  4O32 A;  3BBY A;  1PD2 1;  5D96 A;  3J7Y k;  5DQY A;  4V2N A;  1J9B A;  4RI7 A;  10GS A;  1THX A;  1SD9 A;  1OE7 A;  2PPT A;  1QUW A;  2OA7 A;  4EDY A;  2GVP A;  4YKF A;  3HXS A;  2LNT A;  1T7P B;  4AJ8 A;  5B6M A;  1SL2 B;  4XIH A;  3EYT A;  1MDI A;  3C8E A;  1QXH A;  1M2A A;  3IRA A;  2VD0 A;  1F9M A;  3IK7 A;  1R5P A;  3UIW A;  5IMV A;  4MF7 A;  2P31 A;  4ML6 A;  1HNC A;  4KCE A;  1OC9 B;  3IAS 2;  1XOB A;  2O87 A;  3A2W A;  1EGR A;  2YJH A;  1FVJ A;  5G31 A;  1EEM A;  5DCH A;  2CAI A;  4ZIJ A;  2RM5 A;  2VUP A;  1SK2 A;  3M8N A;  3N9J A;  1ERT A;  2C0E A;  4G19 A;  1K3Y A;  2DML A;  1EGO A;  3CRT A;  1MDK A;  4PQ1 A;  2GSR A;  4TKY A;  3KP8 A;  1PSQ A;  3VPQ A;  1LU4 A;  4MPG A;  3GH9 A;  4HEA 2;  5G2Z A;  2FWF A;  2H6X A;  2PU9 C;  5AIX A;  4N11 A;  5IPG A;  2JAD A;  3KMO A;  3ZVJ D;  1GWC A;  1XWG A;  2IMK A;  2IJY A;  3BOA A;  3TJG A;  2GSQ A;  1XXU A;  4EC0 A;  2HRA A;  2KHP A;  1PMT A;  4A5P A;  2VM1 A;  3GTU B;  7GSS A;  3L78 A;  3UEM A;  1XWC A;  2JAC A;  20GS A;  1O85 A;  2VCV A;  2G0F A;  3E0U A;  3EE2 A;  1A24 A;  5ECN B;  4HI7 A;  2RII A;  1GUH A;  1OVN A;  3WD6 A;  5KN2 A;  1PN0 A;  3KZQ A;  1ERW A;  1B4P A;  2FWH A;  2LJK A;  4LL1 B;  2JU5 A;  3P2A A;  5ECM B;  2X8G A;  1H4O A;  4V1A g;  3GUS A;  4YH2 A;  2RUF A;  3IV4 A;  4TXV A;  2WCI A;  3CMI A;  6GSW A;  4JU5 A;  2WB9 A;  3KM6 A;  3DKS A;  2OE0 A;  2R6K A;  1TTZ A;  3QFB C;  3DVW A;  4K8M A;  1W4V A;  1TRW A;  1A8L A;  2E0Q A;  5A4U A;  1EV9 A;  1T00 A;  3C1R A;  4N0Z A;  3FYG A;  3UAR A;  4IKH A;  3AY8 A;  3HJO A;  1A2J A;  2FWE A;  4OFM A;  3F63 A;  4YQV A;  9GSS A;  2H70 A;  2PER A;  1YQ1 A;  3GST A;  1WJK A;  1EP8 A;  2VL9 A;  3FKF A;  4FYB A;  3ERW A;  5EL8 A;  1PL1 A;  4IJ3 A;  1S3D A;  5ELG A;  1PL2 A;  3GN3 A;  1B4Q A;  2AAW A;  3LXZ A;  4WR4 A;  2OJL A;  1XWA A;  2CA8 A;  4IJI A;  5AIV A;  3KMN A;  3WGX A;  2BTO T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...