1XFLA

Solution structure of thioredoxin h1 from arabidopsis thaliana
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
114
structure length
114
Chain Sequence
MASEEGQVIACHTVETWNEQLQKANESKTLVVVDFTASWCGPCRFIAPFFADLAKKLPNVLFLKVDTDELKSVASDWAIQAMPTFMFLKEGKILDKVVGAKKDELQSTIAKHLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Thioredoxin h1
publication title Solution structure of thioredoxin h1 from Arabidopsis thaliana.
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 36
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2004-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1xflA00
3IDVA 1QGVA 2JSZA 3H79A 4OD7A 3ZZXA 3QFBC 4MCUA 4BPYA 3LYPA 1KTEA 1A0RP 4N10A 2JADA 4MZWA 3OR5A 3M9JA 3HJOA 4L0UA 2H72A 3HHVA 2HRNA 4HQZA 5KN3A 3UBLA 3Q74A 2IWTA 5B6MA 2NDOA 1JFUA 4V2MA 3RPNA 5JWOB 4ZBBA 3ZVJD 5COHA 1TRWA 1R4WA 5KEJA 5ABRA 2HZEB 4FYUA 3VWXA 5A4VA 1UN2A 4ILFA 4KAEA 5ECRB 1FVKA 3WGEA 4ZL9A 9GSSA 3IA1A 1E6BA 1XVQA 2LRNA 2CX3A 4GTUA 19GSA 4K1FA 4PGTA 1K0AA 3L9UA 1E2YA 2DJ2A 1Z7RA 3QMXA 1J08A 1VF4A 2RLIA 2H1DA 1VGLA 3VK9A 2VAFA 2YP6A 4WXTA 2RUFA 3NZNA 4KX4A 4O92A 2RUEA 4JRRA 1O7UA 4IP1A 1FW1A 3FZ4A 1GLPA 1AXDA 4F0CA 2L4CA 1WMJA 4XHMA 1C72A 3FW2A 3L78A 3A2XA 16GSA 4J57E 3VWUA 2H6ZA 3HA9A 2DJ1A 1GULA 3HJPA 1ERTA 2C0FA 3VPTA 1WP0A 5GSTA 1QFNA 4MJCA 4BVYA 3PGTA 1KNGA 3UVHA 5DCGA 1XCCA 2HRFA 4O5RA 2VUPA 2R2JA 1S3DA 1SL0B 3IRAA 2HNLA 1S3CA 5EPFA 3C8EA 3GMFA 1O81A 4ECJA 2AV4A 5LNKe 3KJYA 2QKEA 3DRNA 3P8WA 3UEMA 1H4OA 5HFKA 4J56E 4NXIA 2B1KA 1YKAA 3QDNA 4WR4A 4MH2A 3H4KA 2K8SA 2EIQA 1HD2A 3IC4A 2GZPA 5DQSA 1YF1A 2ZNMA 5ECOB 3TDGA 2YZHA 4IVFA 3QD9A 4G10A 4DVCA 2RIIA 4L8EA 1G6WA 1S3AA 4IS0A 5B8AA 1RQMA 5ECPB 4FH8A 3GSTA 5G2ZA 1XW9A 4L5OA 4YQUA 3RAZA 2MMOA 2V2GA 2L5LA 2VD1A 1F3BA 4TR1A 2B6MA 3GNJA 1XZOA 3FHKA 1XOAA 1TDIA 3CYNA 1DSBA 1YKCA 1X0RA 4GXZA 5DBQA 5B8BA 3KIJA 1B4PA 2WRTA 1ST9A 1Q4JA 1GLQA 3LQ7A 3QAGA 2JZSA 3GH9A 3H93A 1MEKA 3GL5A 3LGCA 2QC7A 5IMVA 1SK2A 4H86A 1PKZA 3W8SA 1B9XC 5INYA 1ERVA 4XS4B 5ID2B 2PN8A 4JR6A 5G31A 2IJYA 1CQHA 3TJKA 4WETA 3J7Yb 2NBSA 2YWNA 3LEFA 1USBA 5HQPA 2DIYA 2V1MA 2LRCA 2YV7A 5H5QA 2FWGA 3HKRA 4YAVA 2F8AA 1M9BA 2FA8A 4DEJA 4I5QA 1AIUA 1SKSB 2YV9A 2LQQA 3DEXA 3KGKA 1EZKA 1T1VA 3GV1A 1PKWA 2O87A 4P3YB 1TW9A 5DALB 1AW9A 1OC9A 1B48A 2YPMA 1XW6A 2X8CA 1ON4A 3ZITA 4RI7A 5HFGA 2LS5A 1EV4A 2H19A 5F0GA 2CZ3A 3Q19A 1K0OA 4G19A 5DCHA 5H5RA 2BMXA 4MA9A 1FB6A 1OVNA 3TGZA 4IBPA 3NOFA 1DE2A 1V58A 1ZMAA 3GL3A 3U5RE 3LXTA 5IMDA 3A2VA 4F82A 2XBQA 2Z9SA 2GSTA 5KN0A 3EMXA 5C04A 3QCPA 3O3TA 5IO2A 1X5DA 18GSA 5E4WA 2MMNA 4ZIJA 3GURA 5IOXA 2OE0A 4IHUA 2DJ0A 2F51A 4OCEA 4GQFA 5F8BA 1WPIA 3TKSE 3UVTA 2C3TA 3ME8A 2GZZA 2H6YA 2LNTA 1F3AA 3CRTA 2H76A 4PNFA 2TRXA 4ECBA 1F9MA 1LJRA 1G7OA 1GNEA 3KP8A 3RHBA 2G2QA 4ECIA 4KNDA 1V57A 3BCIA 5J4UA 5IM9A 3FZ9A 2BJXA 3U6VA 4YH2A 4OO4A 4F9ZA 2OKAA 1ZL9A 2LJAA 4CDOA 1ZYQB 3KH9A 4GSNA 4KSMA 1WJKA 1A8LA 5DAKB 2CQ9A 5JCGA 3IAS2 1GSUA 5IPHA 1ERWA 2BTOT 1WRYA 4N0VA 2OJLA 6GSTA 1IYIA 2I1UA 4K8MA 4POLA 4BA7A 4FIWA 4IQAA 3GYKA 2KLXA 3L9SA 1OKTA 4KA0A 4NHZA 4HJ2A 2B5XA 2OA7A 4POKA 2YWMA 2FA4A 4YQVA 3H8QA 4OCFA 3VFIA 3HVXA 3RBTA 4X0XA 1PA3A 3KMNA 3TKRA 3GUSA 4G9HA 2P31A 1XWBA 2L6CA 2LSTA 3HCZA 4QQ7A 2ES7A 4IJIA 3C71A 1M2AA 1JZDA 2FY6A 3F0IA 2AUVA 3KP9A 4NV5A 3FZ5A 3ZREA 1AQXA 4ZB8A 1YZXA 4WBRD 2FWEA 1NHOA 4OO5A 1Y25A 1I5GA 2NPBA 1EWXA 1OE7A 1BEDA 3QFAC 1SKWB 4MF7A 3IAM2 2AYTA 3C1SA 3D6IA 5AIVA 4IQ1A 4IJ3A 3O6TA 2HLSA 2QSIA 2VCQA 3G7IA 2CAIA 4POMA 4ZBAA 1TKDB 4WBJA 3IK9A 4K6XA 4MF6A 3HDCA 3FK8A 3IK7A 2IL3A 3MAKA 1NHYA 1Z7PA 3ZYWA 2H6XA 5JWRB 3PINA 3ZIVA 1GUKA 1K0DA 5CRGA 5LD0A 5CRDA 4WKWA 5G5FA 4EDYA 1OC8A 1HYUA 1OYJA 4EUYA 3TRQA 4AJ6A 1TRSA 3MNGA 5IMAA 2GQLA 2XC2A 4BWSA 1Z5YE 1EEMA 2WZ9A 4KSOA 4N30A 1F2EA 5CRHA 4I2UA 1VF1A 5ECKB 3CSIA 5D73A 4OMVA 3BCKA 3ERGA 3M9KA 3HVSA 1VF3A 4I2TA 4XRDA 1NM3A 2VL2A 5H5SA 1TXXA 2VLUA 4MABA 3LYKA 2WFCA 1TRUA 3RPPA 1A0FA 3KTLA 5CP1A 7GSSA 3DVXA 2C4JA 2VCXA 2HYXA 4MJAA 5DQYA 4Q5NA 2OBIA 2IFQB 4KH7A 8GSSA 4XCSA 1U3AA 4EXJA 2HT9A 5ELAA 5FHIA 1EP7A 3QR6A 1VRSD 4PUFC 2YZUA 3WYWA 1AQWA 4KB3A 4RQXA 4POBA 2H73A 3HVVA 3GFKA 5HFIA 2YANA 3HJMA 5J9BA 1SYXA 2B3SA 5CAXA 3LFLA 1PSQA 1XWCA 3DGQA 4AGSA 3DIEA 2H8LA 2JU5A 4K7OA 5DVBA 4RI6A 3HD5A 4TN8A 3DKSA 3WGXA 3W6GA 2GS3A 4BVXA 2F3MA 3TOTA 2L57A 4XS1A 2N5FA 3DVWA 1K3LA 2HFDA 2CV4A 4AJ8A 1GWCA 4NPBA 2WULA 1JZWA 4PQ1A 1AAZA 4KDXA 4Q5QA 5ECSA 2RM6A 2B5EA 3IHQA 4JE1A 1B8XA 4FYBA 3WD6A 4DSRA 1T3BA 2GSRA 2VL9A 3S9FA 1AC1A 2WGRA 4Q5RA 2MYGA 5B6NA 2VL3A 2YOIA 3PR8A 1SK1A 2N5AA 2NTOA 3D4TA 5DAKA 3FR9A 5KN1A 3IBHA 4NV2A 2N5BA 1GL8A 5J9CA 4TXOB 2KOKA 3ISOA 10GSA 2GQMA 1A2MA 2YNXA 3ERFA 2HSYA 3WT1A 1HQOA 3CSJA 2PERA 3FR6A 5DJMA 3TRXA 4HZ4A 4HDEA 2DJKA 5B7CA 2R3XA 2CAQA 2J23A 3C1RA 2HI7A 1TK5B 3KCMA 5ECLB 2L5OA 1CQGA 1XWGA 4YAPA 3GKNA 1U3IA 13GSA 1ZGNA 6GSSA 3ED3A 2IIYA 1M7TA 2B7JA 1N2AA 2KHPA 4O32A 1BX9A 4MDCA 2E7PA 2VCZA 1XIYA 1ABAA 1GSEA 2OE1A 4E8HA 3O76A 1RK4A 3HY2A 3DD3A 3F6DA 3E0UA 2H74A 3DXBA 4HU9A 3ZMKA 2LUSA 2AB6A 2HZFA 2VCVA 3FY7A 3ZFBA 1X5CA 2WB9A 3APOA 1PD21 4DSQA 1U6TA 2B1LA 4D73B 1A24A 1X9WB 2K6VA 4HS1A 4I8BA 4IN0A 4TRXA 4PQHA 3I43A 1G7EA 2C8UA 4ISDA 3W8JA 2KP1A 1WIKA 2ZUPA 3RDWA 3F63A 1UVZA 5G1KA 3G7JA 3GKXA 3UAPA 3KEBA 4GSTA 4F2IA 6GSXA 1ZCPA 4MZBA 4F0BA 5CNWA 5JCWA 2IPAA 3LJRA 4ML1A 2LNSA 2GGTA 5IO0A 3CSHA 1EP8A 3G7YA 3I69A 3TOUA 2H1AA 1EV9A 4ZL7A 3CMIA 4K2DA 3NIVA 2YWIA 5F06A 2C1YA 5J5NA 1T4YA 1LBKA 1A8YA 1PN9A 4ULXA 1R5PA 1WOUA 2JACA 1GTBA 2I3YA 3QAWA 4QL7A 1X9MB 1ERUA 1U88A 2CT6A 2WDUA 1JZRA 4IP6A 1O73A 2IFQA 3IR4A 2H0GA 5CRWA 1EOGA 4CHSA 2PU9C 2GQKA 1DBYA 3ME7A 1OC9B 4TW5A 3ERWA 2CVBA 2HZEA 3IE3A 4OFMA 4HUAA 1XBSA 1PX6A 2H0HA 1GSSA 2MZCA 2LKUA 4MK3A 4HQSA 1B4QA 2OE3A 4QL9A 2MBTA 5G30A 12GSA 4BWQA 4EDZA 2GDRA 1TJDA 1TOFA 2LEGA 4V2LA 2DMLA 3PH9A 5ECIB 2C3QA 1O85A 5IQYA 2VIMA 5HR2A 3TKPA 4HI7A 1BAYA 1B9YC 2TRCP 1A2LA 2C3NA 3EE2A 1TI1A 4TXVA 5D9TA 1MDJA 1SENA 4TOPA 2V41A 1M2BA 5GZZB 6GSVA 2A2SA 3V1WA 6GSWA 2NVLA 4MMMA 2TIRA 5G1LA 1F6MC 3L4NA 1TP9A 4I6XA 1EEJA 4TR3A 3KMOA 1T8EB 3HZ8A 1QQ2A 4HU7A 2C0EA 2LQOA 4TVEA 3M1GA 2J9HA 4JR4A 4HEA2 2RM5A 4AF2A 2H0IA 5JCUA 2OBKA 5ENUA 1NSWA 2YJ7A 2PWJA 2V6OA 3A3TA 4TKYA 1TRVA 2H01A 1SL1B 1NW2A 1DUGA 1TK8B 3MDKA 3LORA 4K0NA 1Z6NA 1MD4A 2VCTA 4E8EA 3FR3A 2O7KA 3VI5A 3I6AA 1UC7A 2LTKA 1JZOA 3QOUA 4TXOA 1FG4A 2DSAA 4K0GA 5D9WA 5GAND 1PQNA 3KZQA 2PVOC 1SK0A 1XOBA 1J9BA 3CTFA 2D2ZA 2I81A 1QXHA 4V1Ag 2OADA 3MWHA 1V40A 2DBCA 1PRXA 2L4QA 2H1GA 3TKQA 1QUWA 4LL4B 2I9HA 1BG5A 2HSHA 3K8NA 4EVMA 1BJXA 4LMVA 2DMMA 5CO3A 5D93A 3GX8A 3TJGA 3UBKA 3BD2A 2H75A 2R6KA 4TR1B 2EIRA 5HR0A 3A2WA 4O7HA 1Z3EA 1GSYA 2X64A 4J2FA 3TUEA 5IPGA 2DLXA 3RHCA 3GA4A 3TJBA 2PBJA 1TK0B 2R37A 2GT6A 4KE3A 3FRCA 2ZCTA 4IGJA 2M72A 5AIXA 2IMEA 3D21A 3EINA 1KBNA 2VO4A 1MTCA 5AN1A 2GT5A 3CRUA 2HE3A 22GSA 2LJRA 3ZIJA 3UARA 2FD3A 2X99A 5IIZA 4EL1A 4GRFA 2C80A 3GRXA 4D73A 2LV3A 2YWOA 2LRTA 3GKKA 2M80A 3BBYA 3D0ZA 2FWFA 4JU5A 3UOMA 5G5EA 4ECCA 2E0QA 2XHFA 4XS4A 5ID2A 5EL8A 4Q5FA 3CTGA 3GTUB 1M0UA 1O8XA 3F9UA 4WF5A 2IN3A 3WT2A 4KDYA 4CW9A 2P5RA 5A4WA 3KD0A 2YCDA 3EVIA 1X9SB 1GSDA 2CZ2A 4MZCA 1WE0A 1AUCA 1XWAA 2KP2A 2HXKA 4MJEA 3FKFA 4ZBDA 5ELGA 3ZL5A 3D5JA 2L6DA 4ZB9A 3UIWA 2YN1A 1N8JA 1SJIA 5DALA 4MPGA 3APQA 4NWYA 1FAAA 4L0WA 1THXA 4GQCA 5AISA 1URMA 1PL1A 5IMZA 3AY8A 2FNOA 3HZ4A 1H75A 1YY7A 2I4AA 3L9VA 4X43A 1T00A 4K9ZA 4YQMA 1TTZA 2K18A 1ACVA 1A23A 2FUG2 4ACSA 1XFLA 2WS2A 2JZRA 3TKSC 3M0FA 3GKMA 4EE0A 1RW1A 2FCHA 1YDKA 1XXUA 3L0HA 3N9JA 4MH3A 3GIXA 2VCWA 2DJ3A 2P0GA 1M99A 2O8VB 5A4UA 4NAXA 4NHWA 3EU4A 3IPZA 5EY6A 1HNCA 3CBUA 3TRPA 3ZRDA 1KEBA 1VF2A 1THOA 2IMFA 3F4TA 2KUCA 5J3RA 3M8NA 4PXOA 2AAWA 1GSFA 2MMAA 1U87A 3LXZA 2ON5A 2ALBA 5IMCA 5CYYA 1Z6MA 4WR5A 2XBIA 3GX0A 3EC3A 2GSSA 2K8VA 2REMA 4OFTA 4TR0A 2JSYA 4WEYA 1XW5A 3VI7A 5DJLA 2OACA 1Y6EA 4FO5A 5D9VA 5D9XA 20GSA 1FB0A 4IW9A 1HNBA 4GF0A 1J0FA 3Q18A 4ML6A 3SBCA 3D22A 3UJ1A 4GSSA 1PMTA 1MD3A 2JL4A 1A2JA 5L71A 1OKDA 1GSQA 3FZAA 2MBSA 2C0DA 4ID0A 3P7XA 1G0TA 3GH6A 1SL2B 5F05A 2E2MA 4V2NA 1QMVA 1YF0A 4LA1A 3TKSA 3C7MA 2C0GA 3TB2A 1GTUA 2E2GA 2VOCA 1GRXA 1SU9A 1OAZA 1ML6A 5DDLA 6GSUA 3DYRA 5AGYA 2FGXA 2ON7A 4FYCA 1M2DA 3WGDA 4JEDA 1V9WA 1BYEA 3TJJA 5CREA 4EKZA 4MF5A 5D8IA 4DSSB 3LG6A 1T7PB 4PURA 2G0FA 4XRAA 1SD9A 1K0BA 1HNAA 3I9V2 2B7KA 3UL3A 3EURA 1V98A 1R7HA 4HZ2A 2VM1A 1SYRA 1TU7A 1MDKA 5D96A 1K3OA 4GWRA 1PX7A 4MLYA 4LMWA 4GCIA 4Z7XA 4LLRA 2IMDA 3F3QA 2XPDA 2H1BA 4KUNA 4LL1B 1JHBA 2DC5A 1BQ7A 2YJHA 4V1Ap 3H1NA 5FWGA 2F8FA 2CX4A 4WF4A 4ZL8A 3VLNA 3VPQA 3KM6A 2PMTA 4JZQA 2CVDA 4K7NA 5EVOA 4KW6A 3KH7A 2EIOA 4NMUA 5KN2A 1G6YA 5ECMB 3GHAA 3FEUA 1JLVA 4OFNA 5JWQB 2V32A 1MDIA 1FO5A 1IYHA 2K9FA 3ZMLA 3KXOA 4HOJA 4MP4A 3US3A 2DIZA 4GLTA 2IMKA 3GSSA 4I97A 1K0NA 6GSYA 4KCAA 3GTUA 3Q6OA 2XPEA 4EO3A 4EC0A 3A5WA 3KTBA 1FHEA 2R4VA 3E9JB 3UMAA 1K0MA 1LU4A 1SJZA 2AHEA 2IMIA 1SD8A 3F6FA 4F03A 2A4VA 5LCZA 3DMLA 1GNWA 5ECHB 4KGIA 17GSA 3F8UA 1O6JA 1JLWA 3TJFA 1DE1A 3BJ5A 1XPVA 4X1UA 5E59A 2VLVA 3APSA 1YQ1A 1GUHA 3DWVA 1M9AA 3EWLA 5A5KA 1K3YA 4IELA 4PQIA 3LSZA 2VM2A 2H30A 1AQVA 4BL7A 1GUMA 2GLRA 3D4MA 3FYGA 5F07A 2B5YA 4AJ7A 2WJUA 3GN3A 5FT3A 1GH2A 1TU8A 4PX1A 1I9DA 2GTUA 1GTAA 1OE8A 4KDUA 1WWJA 3G9BA 2MMZA 5GAPD 2O89A 5ECQB 1R5AA 3E3EA 2L59A 2A2RA 1ZYEA 4XS6A 3VWVA 2PUKC 2FHEA 1SJ6A 4OWYA 3HYPA 4HJMA 2X8HA 3J7Yk 2AJQB 3IXRA 2GSQA 4JBBA 2DJJA 1Z9HA 5IOWA 3IOSA 1YEXA 3JCML 2M46A 3LWAA 2EC4A 2P5QA 2PPTA 4G2EA 2X8GA 2PVQA 11GSA 2JZTA 5GSSA 3ZTLA 3TCOA 1ZOFA 4K7IA 1GTIA 1TI3A 2PGTA 2QGVA 1UA5A 5ECNB 2H66A 2CA8A 1FOVA 4IKHA 2VLTA 3QAVA 5J41A 2H70A 1EGOA 3BOAA 1OC3A 5HR3A 1YEPA 3VWWA 3CXGA 2VL2C 4N0ZA 4RUVA 3F3RA 1T4ZA 1W89A 4PNGA 3SWLA 1XWKA 2CVKA 4EF0A 2GVPA 4KCEA 3HXSA 2GZYA 1EGRA 4L5LA 3ZLPA 4ZB6A 1SKRB 2F9SA 3N5OA 1QK8A 3R2QA 4XTSA 2H71A 14GSA 2VD0A 3F4SA 4DSSA 2V6KA 1GP1A 3IV4A 3C73A 5C00A 1Q98A 1R26A 3P2AA 1V2AA 2FWHA 3F4RA 4ZILA 1YJ6A 5IMFA 3ZFLA 3MSZA 1PL2A 2LJKA 1K0CA 5HR1A 1XVWA 3P90A 1EOHA 1ZZYA 2WCIA 4TR4A 3QPMA 3ZVJA 4PUAA 4ZXGA 1W4VA 3VURA 4MJBA 4N11A 3EU3A 1ILOA 2FLSA 1O8WA 4RQRA 2R5GA 4MPFA 2O85A 4XIHA 3EYTA 1F37A 1X5EA 3M3MA 1FVJA 1PGTA 3EMPA
chains in the Genus database with same CATH superfamily
3IDVA 1QGVA 2JSZA 3H79A 4OD7A 3ZZXA 3QFBC 4MCUA 4BPYA 3LYPA 1KTEA 1A0RP 4N10A 2JADA 4MZWA 3OR5A 3M9JA 3HJOA 4L0UA 2H72A 3HHVA 2HRNA 4HQZA 5KN3A 3UBLA 3Q74A 2IWTA 5B6MA 2NDOA 1JFUA 2HSMA 4V2MA 3RPNA 5JWOB 4ZBBA 4ICYA 3ZVJD 5COHA 1TRWA 1R4WA 5KEJA 5ABRA 2HZEB 4FYUA 3VWXA 5A4VA 1UN2A 4ILFA 4KAEA 5ECRB 1FVKA 3WGEA 4ZL9A 9GSSA 3IA1A 1E6BA 1XVQA 2LRNA 2CX3A 4GTUA 19GSA 4K1FA 4PGTA 1K0AA 1PN0A 3L9UA 1E2YA 2DJ2A 2R0PA 1Z7RA 3QMXA 1J08A 1VF4A 2RLIA 2H1DA 1VGLA 3VK9A 2VAFA 2YP6A 4WXTA 2RUFA 3NZNA 4KX4A 4O92A 2RUEA 4JRRA 1O7UA 4IP1A 1FW1A 3FZ4A 1GLPA 1AXDA 4F0CA 2L4CA 1WMJA 4XHMA 1C72A 3FW2A 3L78A 3A2XA 16GSA 4J57E 3VWUA 2H6ZA 3HA9A 2DJ1A 1GULA 3HJPA 1ERTA 2C0FA 3VPTA 1WP0A 5GSTA 1QFNA 4MJCA 4BVYA 3PGTA 1KNGA 3UVHA 5DCGA 1XCCA 2HRFA 4O5RA 2VUPA 2R2JA 1S3DA 1SL0B 3IRAA 2HNLA 1S3CA 5EPFA 3C8EA 3GMFA 1O81A 4ECJA 2AV4A 5LNKe 3KJYA 2QKEA 3DRNA 3P8WA 3UEMA 1H4OA 5HFKA 4J56E 4NXIA 2B1KA 1YKAA 3QDNA 4WR4A 4MH2A 3H4KA 2K8SA 2EIQA 1HD2A 3IC4A 2GZPA 5DQSA 1YF1A 2ZNMA 3EPTA 5ECOB 3TDGA 2YZHA 4IVFA 3QD9A 4G10A 4DVCA 2RIIA 4L8EA 1G6WA 1S3AA 4IS0A 5B8AA 1RQMA 5ECPB 4FH8A 3GSTA 5G2ZA 1XW9A 4L5OA 4YQUA 3RAZA 2MMOA 2V2GA 4MNNA 2L5LA 2VD1A 1F3BA 4TR1A 2B6MA 3GNJA 4CY8A 1XZOA 3FHKA 1XOAA 1TDIA 3CYNA 1DSBA 1YKCA 1X0RA 4GXZA 5DBQA 5B8BA 3KIJA 1B4PA 2WRTA 1ST9A 1Q4JA 1GLQA 3LQ7A 3QAGA 2JZSA 3GH9A 3H93A 1MEKA 3GL5A 3LGCA 2QC7A 5IMVA 1SK2A 4H86A 1PKZA 3W8SA 1B9XC 5INYA 1ERVA 4XS4B 5ID2B 2PN8A 4Z2UA 4JR6A 5G31A 2IJYA 1CQHA 3TJKA 4WETA 3J7Yb 2NBSA 2YWNA 3LEFA 1USBA 5HQPA 2DIYA 2V1MA 2LRCA 2YV7A 5H5QA 2FWGA 3HKRA 4YAVA 2F8AA 1M9BA 2FA8A 4DEJA 4I5QA 1AIUA 1SKSB 2YV9A 2LQQA 3DEXA 3KGKA 1EZKA 1T1VA 3GV1A 1PKWA 2O87A 4P3YB 1TW9A 5DALB 1AW9A 1OC9A 1B48A 2YPMA 1XW6A 2X8CA 1ON4A 3ZITA 4RI7A 5HFGA 2HRKA 2LS5A 1EV4A 2H19A 5F0GA 2CZ3A 3Q19A 1K0OA 2DKIA 2QA1A 4G19A 5DCHA 5H5RA 2BMXA 4MA9A 1FB6A 1OVNA 3TGZA 4BIKA 4IBPA 3NOFA 1DE2A 1V58A 1ZMAA 4BVXB 3GL3A 2R0GA 3U5RE 3LXTA 4K5RA 3A2VA 5IMDA 4F82A 2XBQA 2Z9SA 2GSTA 5KN0A 3EMXA 5C04A 3QCPA 3O3TA 5IO2A 1X5DA 18GSA 5E4WA 2MMNA 4ZIJA 3GURA 5IOXA 2OE0A 4IHUA 2DJ0A 2F51A 4OCEA 4GQFA 4FQUA 5F8BA 1WPIA 3TKSE 3UVTA 2C3TA 3ME8A 2GZZA 2H6YA 2LNTA 1F3AA 3CRTA 2H76A 4PNFA 2TRXA 4ECBA 1F9MA 1LJRA 1G7OA 1GNEA 3KP8A 3RHBA 2G2QA 4ECIA 4KNDA 1V57A 3BCIA 5J4UA 5IM9A 3FZ9A 2BJXA 3U6VA 4YH2A 4OO4A 4F9ZA 2OKAA 1ZL9A 2LJAA 4CDOA 1ZYQB 3KH9A 4GSNA 4KSMA 1WJKA 1A8LA 5BMUA 5DAKB 2CQ9A 5JCGA 3IAS2 4KF9A 4K5SA 1GSUA 5IPHA 1ERWA 2BTOT 1WRYA 4N0VA 4CY6A 2OJLA 3CQFA 6GSTA 1IYIA 2I1UA 4K8MA 4POLA 4BA7A 4FIWA 4IQAA 3GYKA 2KLXA 3L9SA 1OKTA 4KA0A 4NHZA 3MIXA 4HJ2A 2B5XA 2OA7A 4POKA 2YWMA 2FA4A 4YQVA 4X4JA 3H8QA 4OCFA 1S3RA 3VFIA 3HVXA 3RBTA 4X0XA 1PA3A 3KMNA 3TKRA 3GUSA 4G9HA 2P31A 1XWBA 2L6CA 2LSTA 3HCZA 4QQ7A 2ES7A 4IJIA 3C71A 1M2AA 1JZDA 2FY6A 3F0IA 2AUVA 3KP9A 4NV5A 3FZ5A 3ZREA 1AQXA 4ZB8A 1YZXA 4WBRD 2FWEA 1NHOA 4OO5A 1Y25A 1I5GA 2NPBA 1EWXA 1OE7A 1BEDA 3QFAC 1SKWB 4MF7A 3IAM2 2AYTA 3C1SA 3D6IA 1FOHA 5AIVA 4IQ1A 4IJ3A 3O6TA 3IHGA 2HLSA 2QSIA 2VCQA 3G7IA 2CAIA 4POMA 4ZBAA 1TKDB 4WBJA 3IK9A 4K6XA 4MF6A 3HDCA 3FK8A 3IK7A 2IL3A 3MAKA 1NHYA 1Z7PA 3ZYWA 2H6XA 5JWRB 3PINA 3ZIVA 1GUKA 1K0DA 5CRGA 5LD0A 5CRDA 4WKWA 5G5FA 4EDYA 1OC8A 1HYUA 1OYJA 4EUYA 3TRQA 4AJ6A 1TRSA 3MNGA 5IMAA 2GQLA 2XC2A 4BWSA 1Z5YE 4USSA 1EEMA 2WZ9A 4KSOA 2A4HA 4N30A 1F2EA 5CRHA 4I2UA 1VF1A 5ECKB 3CSIA 5D73A 4OMVA 3BCKA 3ERGA 3M9KA 3HVSA 1VF3A 4I2TA 4XRDA 1NM3A 2VL2A 5H5SA 1TXXA 2VLUA 4MABA 3LYKA 2WFCA 1TRUA 3RPPA 1A0FA 3KTLA 5CP1A 7GSSA 3DVXA 2C4JA 2VCXA 2HYXA 4MJAA 5DQYA 4Q5NA 2OBIA 2IFQB 4KH7A 8GSSA 4XCSA 1U3AA 4EXJA 2HT9A 5ELAA 5FHIA 1EP7A 3QR6A 1VRSD 4PUFC 2YZUA 3WYWA 1AQWA 4KB3A 4RQXA 4POBA 2H73A 3HVVA 1ZYPA 3GFKA 5HFIA 2YANA 3HJMA 5J9BA 1SYXA 2B3SA 5CAXA 3LFLA 4HSCX 1PSQA 1XWCA 3DGQA 4BL7B 4AGSA 3DIEA 2H8LA 2JU5A 4K7OA 5DVBA 4RI6A 3HD5A 4TN8A 3DKSA 3WGXA 3W6GA 2GS3A 4BVXA 2F3MA 3TOTA 2L57A 4XS1A 2N5FA 3DVWA 1K3LA 2HFDA 2CV4A 4AJ8A 1GWCA 4NPBA 2WULA 1JZWA 4PQ1A 2UZ8A 1AAZA 4KDXA 4Q5QA 5ECSA 2RM6A 2B5EA 3IHQA 4JE1A 1B8XA 4FYBA 3WD6A 4DSRA 1T3BA 2GSRA 2VL9A 3S9FA 1AC1A 2WGRA 4Q5RA 2MYGA 5B6NA 2VL3A 2YOIA 3PR8A 1SK1A 2N5AA 2NTOA 3D4TA 5DAKA 3FR9A 5KN1A 3IBHA 4NV2A 2N5BA 1GL8A 5J9CA 4TXOB 2KOKA 3ISOA 10GSA 2GQMA 1A2MA 2YNXA 3ERFA 2HSYA 3WT1A 1HQOA 3CSJA 2PERA 3FR6A 5DJMA 3TRXA 4HZ4A 4HDEA 2DJKA 5B7CA 2R3XA 2CAQA 2J23A 3C1RA 2HI7A 1TK5B 3KCMA 5ECLB 2L5OA 1CQGA 1XWGA 4YAPA 3GKNA 1U3IA 13GSA 1ZGNA 6GSSA 3ED3A 3FMWA 2IIYA 1M7TA 2B7JA 1N2AA 2KHPA 4O32A 1BX9A 4MDCA 2E7PA 2VCZA 1XIYA 1ABAA 1GSEA 2OE1A 4E8HA 3O76A 1RK4A 3HY2A 3DD3A 3F6DA 3E0UA 2H74A 3DXBA 4HU9A 3ZMKA 2LUSA 2AB6A 2HZFA 2VCVA 3FY7A 3ZFBA 1X5CA 2WB9A 3APOA 1PD21 4DSQA 1U6TA 2B1LA 4D73B 1A24A 1X9WB 2K6VA 4HS1A 4I8BA 4IN0A 4TRXA 4PQHA 3HVNA 4G0LA 3I43A 1G7EA 2C8UA 4ISDA 3W8JA 2KP1A 1WIKA 2ZUPA 3RDWA 3F63A 1UVZA 5G1KA 3G7JA 3GKXA 3UAPA 3KEBA 4GSTA 3MYDA 4F2IA 1PFOA 6GSXA 1ZCPA 4MZBA 4F0BA 5CNWA 5JCWA 2IPAA 3LJRA 4ML1A 2LNSA 2GGTA 5IO0A 3CSHA 1EP8A 3G7YA 3I69A 3TOUA 2H1AA 1EV9A 4ZL7A 3CMIA 4K2DA 3NIVA 2YWIA 5F06A 2C1YA 5J5NA 1T4YA 1LBKA 1A8YA 1PN9A 4ULXA 1R5PA 1WOUA 2JACA 1GTBA 2I3YA 3QAWA 4QL7A 1X9MB 1ERUA 1U88A 2CT6A 2WDUA 1JZRA 4IP6A 5BRTA 1O73A 2IFQA 3IR4A 2H0GA 5CRWA 1EOGA 4CHSA 2PU9C 2GQKA 1DBYA 3ME7A 1OC9B 4TW5A 3ERWA 2CVBA 2HZEA 3IE3A 4OFMA 4HUAA 1XBSA 1PX6A 2H0HA 1GSSA 2MZCA 2LKUA 4MK3A 4HQSA 1B4QA 2OE3A 4QL9A 2MBTA 5G30A 12GSA 4BWQA 4EDZA 2GDRA 1TJDA 1TOFA 2LEGA 4V2LA 2DMLA 3PH9A 5ECIB 2C3QA 1O85A 5IQYA 2VIMA 5HR2A 3TKPA 4HI7A 1BAYA 1B9YC 2QA2A 2TRCP 1M3IA 1A2LA 2C3NA 3EE2A 1TI1A 4TXVA 5D9TA 1MDJA 1SENA 4TOPA 2V41A 1M2BA 2R0CA 5GZZB 6GSVA 2A2SA 3V1WA 6GSWA 2NVLA 4MMMA 2TIRA 5G1LA 1F6MC 3L4NA 1TP9A 4I6XA 1EEJA 4EIPA 4TR3A 3KMOA 1T8EB 3HZ8A 1QQ2A 4HU7A 2C0EA 2LQOA 2A2PA 5KOXA 4TVEA 3M1GA 2J9HA 4JR4A 4HEA2 2RM5A 4AF2A 2H0IA 5JCUA 2OBKA 5ENUA 1NSWA 2YJ7A 2PWJA 2V6OA 3A3TA 4TKYA 1TRVA 2H01A 1SL1B 1NW2A 1DUGA 1TK8B 3MDKA 3LORA 4K0NA 1Z6NA 1MD4A 2VCTA 4E8EA 3FR3A 2O7KA 3VI5A 3I6AA 1UC7A 2LTKA 1JZOA 3QOUA 4TXOA 1FG4A 2X4AA 2DSAA 4K0GA 5D9WA 5GAND 1PQNA 3KZQA 2PVOC 1SK0A 1XOBA 1J9BA 3CTFA 2D2ZA 2I81A 1QXHA 4V1Ag 1ZYNA 2OADA 3MWHA 1V40A 2DBCA 1PRXA 2L4QA 2H1GA 3TKQA 1QUWA 4LL4B 2I9HA 4A5PA 1BG5A 2HSHA 3K8NA 4EVMA 1BJXA 4LMVA 2DMMA 5CO3A 5D93A 3GX8A 3TJGA 3UBKA 3BD2A 2H75A 2R6KA 4TR1B 2EIRA 5HR0A 3A2WA 4O7HA 1Z3EA 1GSYA 2X64A 4J2FA 3TUEA 5IPGA 2DLXA 3RHCA 3GA4A 3TJBA 2PBJA 1TK0B 2R37A 2GT6A 4KE3A 3FRCA 2ZCTA 4IGJA 2M72A 5AIXA 2IMEA 3D21A 3EINA 1KBNA 2VO4A 1MTCA 5AN1A 2GT5A 3CRUA 2HE3A 22GSA 2LJRA 3ZIJA 3UARA 2FD3A 2X99A 5IIZA 4EL1A 4GRFA 2C80A 3GRXA 2DKHA 4D73A 2LV3A 2YWOA 2LRTA 3GKKA 2M80A 3BBYA 3D0ZA 2FWFA 4JU5A 3UOMA 5G5EA 3IC8A 4ECCA 2E0QA 2XHFA 4XS4A 5ID2A 5EL8A 4Q5FA 3CTGA 3GTUB 1M0UA 1O8XA 3F9UA 4WF5A 2IN3A 3WT2A 4KDYA 4CW9A 2P5RA 5A4WA 3KD0A 2YCDA 3EVIA 1X9SB 1GSDA 2CZ2A 4MZCA 1WE0A 1AUCA 1XWAA 2KP2A 2HXKA 4MJEA 3FKFA 4ZBDA 5ELGA 3ZL5A 3D5JA 2L6DA 4ZB9A 3UIWA 2YN1A 1N8JA 1SJIA 5DALA 4MPGA 3APQA 4NWYA 1FAAA 4L0WA 1THXA 4GQCA 5AISA 1URMA 1PL1A 5IMZA 3AY8A 2FNOA 3HZ4A 1H75A 1YY7A 2I4AA 3L9VA 4X43A 1T00A 4K9ZA 4YQMA 1TTZA 2K18A 1ACVA 1A23A 2FUG2 4ACSA 1XFLA 2WS2A 2JZRA 3TKSC 3M0FA 3GKMA 4EE0A 1RW1A 2FCHA 1YDKA 1XXUA 3L0HA 3N9JA 4MH3A 3GIXA 2VCWA 2DJ3A 2P0GA 1M99A 2O8VB 5A4UA 4NAXA 4NHWA 4G0IA 3EU4A 3IPZA 5EY6A 1HNCA 3CBUA 3TRPA 3ZRDA 1KEBA 1VF2A 1THOA 2IMFA 3F4TA 2KUCA 5J3RA 3M8NA 4PXOA 2AAWA 1GSFA 2MMAA 1U87A 3LXZA 2ON5A 2ALBA 5IMCA 5CYYA 1Z6MA 4WR5A 2XBIA 3GX0A 3EC3A 2GSSA 2K8VA 2REMA 4OFTA 4TR0A 2JSYA 4WEYA 1XW5A 3VI7A 5DJLA 2OACA 1Y6EA 4FO5A 5D9VA 5D9XA 20GSA 1FB0A 4IW9A 1HNBA 4GF0A 1J0FA 3Q18A 4ML6A 3SBCA 3D22A 3UJ1A 4GSSA 1XG8A 1PMTA 1MD3A 2HRAA 2JL4A 1A2JA 5L71A 1OKDA 1GSQA 3FZAA 2MBSA 2C0DA 5KOWA 4ID0A 3P7XA 1G0TA 3GH6A 1SL2B 5F05A 2E2MA 4V2NA 1QMVA 1YF0A 4LA1A 3TKSA 3C7MA 2C0GA 3TB2A 1GTUA 2E2GA 2VOCA 1GRXA 1SU9A 1OAZA 1ML6A 5DDLA 6GSUA 3DYRA 5AGYA 2FGXA 2ON7A 4FYCA 1M2DA 3WGDA 4JEDA 1V9WA 1BYEA 3TJJA 4K2XA 5CREA 4EKZA 4MF5A 4EIQA 3A5IA 5D8IA 4DSSB 3LG6A 1T7PB 4PURA 2G0FA 4XRAA 1SD9A 1K0BA 1HNAA 3I9V2 2B7KA 3UL3A 3EURA 1V98A 1R7HA 4HZ2A 2VM1A 1SYRA 1TU7A 1MDKA 5D96A 1K3OA 4GWRA 1PX7A 4MLYA 4LMWA 4GCIA 4Z7XA 4LLRA 2IMDA 3F3QA 2XPDA 2H1BA 4KUNA 4LL1B 1JHBA 2DC5A 1BQ7A 1M3JA 2YJHA 4V1Ap 3H1NA 5FWGA 2F8FA 2CX4A 4WF4A 4ZL8A 3VLNA 3VPQA 3KM6A 2PMTA 4JZQA 2CVDA 4K7NA 5EVOA 4KW6A 3KH7A 2EIOA 4NMUA 5KN2A 1G6YA 5ECMB 3GHAA 3FEUA 1JLVA 4OFNA 5JWQB 2V32A 1MDIA 3PPUA 1FO5A 1IYHA 2K9FA 3ZMLA 3KXOA 4HOJA 4MP4A 3US3A 4Z2RA 2DIZA 4GLTA 2IMKA 3GSSA 4I97A 1K0NA 6GSYA 4KCAA 3GTUA 3Q6OA 2XPEA 4EO3A 4EC0A 3A5WA 3KTBA 1FHEA 2R4VA 3E9JB 3UMAA 1K0MA 1LU4A 1SJZA 2AHEA 2IMIA 1SD8A 3F6FA 4F03A 2A4VA 5LCZA 3DMLA 1GNWA 5ECHB 4KGIA 17GSA 3F8UA 1O6JA 1JLWA 3TJFA 1DE1A 3LW9A 2X49A 3BJ5A 1XPVA 4X1UA 5E59A 2VLVA 3APSA 1YQ1A 1GUHA 3DWVA 1M9AA 3EWLA 5A5KA 1K3YA 4IELA 4PQIA 3LSZA 2VM2A 2H30A 1AQVA 4BL7A 1GUMA 2GLRA 3D4MA 3FYGA 5F07A 2B5YA 4YKFA 4AJ7A 2WJUA 3GN3A 5FT3A 1GH2A 1TU8A 4O5UA 4PX1A 1I9DA 2GTUA 1GTAA 1OE8A 4KDUA 1WWJA 3G9BA 2MMZA 5GAPD 2O89A 5ECQB 1R5AA 3E3EA 2L59A 2A2RA 4BVYB 1ZYEA 4XS6A 3VWVA 2PUKC 2FHEA 1SJ6A 4OWYA 3HYPA 4HJMA 2X8HA 3J7Yk 2AJQB 3IXRA 2GSQA 4JBBA 2DJJA 1Z9HA 5IOWA 3IOSA 1YEXA 3JCML 2M46A 3LWAA 2EC4A 2P5QA 2PPTA 4G2EA 2X8GA 2PVQA 11GSA 2JZTA 5GSSA 3ZTLA 3TCOA 1ZOFA 4K7IA 1GTIA 1TI3A 2PGTA 2QGVA 1UA5A 5ECNB 2H66A 2CA8A 1FOVA 4IKHA 2VLTA 3QAVA 5J41A 2H70A 1EGOA 3BOAA 1OC3A 5HR3A 1YEPA 3VWWA 3CXGA 2VL2C 4N0ZA 4RUVA 3F3RA 1T4ZA 1W89A 4PNGA 3SWLA 1XWKA 2CVKA 4EF0A 2GVPA 4KCEA 3HXSA 4YKGA 2GZYA 1EGRA 4L5LA 3ZLPA 4ZB6A 1SKRB 3R3EA 2F9SA 3N5OA 1QK8A 3R2QA 4XTSA 2H71A 14GSA 2VD0A 3F4SA 4DSSA 2V6KA 1GP1A 3IV4A 3C73A 5C00A 1Q98A 1R26A 3P2AA 1V2AA 2FWHA 3F4RA 4Z2TA 4ZILA 1YJ6A 5IMFA 4PTSA 3ZFLA 3MSZA 1PL2A 2LJKA 1K0CA 5HR1A 1XVWA 3P90A 1EOHA 1ZZYA 2WCIA 4TR4A 3QPMA 3ZVJA 4PUAA 4ZXGA 4G0KA 1W4VA 3VURA 4MJBA 4N11A 3EU3A 1ILOA 2FLSA 1O8WA 4RQRA 2R5GA 4MPFA 2O85A 4XIHA 3EYTA 1F37A 1X5EA 3M3MA 1FVJA 1PGTA 4O5QA 3EMPA
chains in the Genus database with same CATH topology
3IDVA 1QGVA 2JSZA 3H79A 4OD7A 3ZZXA 3QFBC 4MCUA 4BPYA 3LYPA 1KTEA 1A0RP 4N10A 2JADA 4MZWA 3OR5A 3M9JA 3HJOA 4L0UA 2H72A 3HHVA 2HRNA 4HQZA 5KN3A 3UBLA 3Q74A 2IWTA 5B6MA 2NDOA 1JFUA 2HSMA 4V2MA 3RPNA 5JWOB 4ZBBA 4ICYA 3ZVJD 5COHA 1TRWA 1R4WA 5KEJA 5ABRA 2HZEB 4FYUA 3VWXA 5A4VA 1UN2A 4ILFA 4KAEA 5ECRB 1FVKA 3WGEA 4ZL9A 9GSSA 3IA1A 1E6BA 1XVQA 2LRNA 2CX3A 4GTUA 19GSA 4K1FA 4PGTA 1K0AA 1PN0A 3L9UA 1E2YA 2DJ2A 2R0PA 1Z7RA 3QMXA 1J08A 1VF4A 2RLIA 2H1DA 1VGLA 3VK9A 2VAFA 2YP6A 4WXTA 2RUFA 3NZNA 4KX4A 4O92A 2RUEA 4JRRA 1O7UA 4IP1A 1FW1A 3FZ4A 1GLPA 1AXDA 4F0CA 2L4CA 1WMJA 4XHMA 1C72A 3FW2A 3L78A 3A2XA 16GSA 4J57E 3VWUA 2H6ZA 3HA9A 2DJ1A 1GULA 3HJPA 1ERTA 2C0FA 3VPTA 1WP0A 5GSTA 1QFNA 4MJCA 4BVYA 3PGTA 1KNGA 3UVHA 5DCGA 1XCCA 2HRFA 4O5RA 2VUPA 2R2JA 1S3DA 1SL0B 3IRAA 2HNLA 1S3CA 5EPFA 3C8EA 3GMFA 1O81A 4ECJA 2AV4A 5LNKe 3KJYA 2QKEA 3DRNA 3P8WA 3UEMA 1H4OA 5HFKA 4J56E 4NXIA 2B1KA 1YKAA 3QDNA 4WR4A 4MH2A 3H4KA 2K8SA 2EIQA 1HD2A 3IC4A 2GZPA 5DQSA 1YF1A 2ZNMA 3EPTA 5ECOB 3TDGA 2YZHA 4IVFA 3QD9A 4G10A 4DVCA 2RIIA 4L8EA 1G6WA 1S3AA 4IS0A 5B8AA 1RQMA 5ECPB 4FH8A 3GSTA 5G2ZA 1XW9A 4L5OA 4YQUA 3RAZA 2MMOA 2V2GA 4MNNA 2L5LA 2VD1A 1F3BA 4TR1A 2B6MA 3GNJA 4CY8A 1XZOA 3FHKA 1XOAA 1TDIA 3CYNA 1DSBA 1YKCA 1X0RA 4GXZA 5DBQA 5B8BA 3KIJA 1B4PA 2WRTA 1ST9A 1Q4JA 1GLQA 3LQ7A 3QAGA 2JZSA 3GH9A 3H93A 1MEKA 3GL5A 3LGCA 2QC7A 5IMVA 1SK2A 4H86A 1PKZA 3W8SA 1B9XC 5INYA 1ERVA 4XS4B 5ID2B 2PN8A 4Z2UA 4JR6A 5G31A 2IJYA 1CQHA 3TJKA 4WETA 3J7Yb 2NBSA 2YWNA 3LEFA 1USBA 5HQPA 2DIYA 2V1MA 2LRCA 2YV7A 5H5QA 2FWGA 3HKRA 4YAVA 2F8AA 1M9BA 2FA8A 4DEJA 4I5QA 1AIUA 1SKSB 2YV9A 2LQQA 3DEXA 3KGKA 1EZKA 1T1VA 3GV1A 1PKWA 2O87A 4P3YB 1TW9A 5DALB 1AW9A 1OC9A 1B48A 2YPMA 1XW6A 2X8CA 1ON4A 3ZITA 4RI7A 5HFGA 2HRKA 2LS5A 1EV4A 2H19A 5F0GA 2CZ3A 3Q19A 1K0OA 2DKIA 2QA1A 4G19A 5DCHA 5H5RA 2BMXA 4MA9A 1FB6A 1OVNA 3TGZA 4IBPA 3NOFA 1DE2A 1V58A 1ZMAA 4BVXB 3GL3A 2R0GA 3U5RE 3LXTA 4K5RA 3A2VA 5IMDA 4F82A 2XBQA 2Z9SA 2GSTA 5KN0A 3EMXA 5C04A 3QCPA 3O3TA 5IO2A 1X5DA 18GSA 5E4WA 2MMNA 4ZIJA 3GURA 5IOXA 2OE0A 4IHUA 2DJ0A 2F51A 4OCEA 4GQFA 4FQUA 5F8BA 1WPIA 3TKSE 3UVTA 2C3TA 3ME8A 2GZZA 2H6YA 2LNTA 1F3AA 3CRTA 2H76A 4PNFA 2TRXA 4ECBA 1F9MA 1LJRA 1G7OA 1GNEA 3KP8A 3RHBA 2G2QA 4ECIA 4KNDA 1V57A 3BCIA 5J4UA 5IM9A 3FZ9A 2BJXA 3U6VA 4YH2A 4OO4A 4F9ZA 2OKAA 1ZL9A 2LJAA 4CDOA 1ZYQB 3KH9A 4GSNA 4KSMA 1WJKA 1A8LA 5BMUA 5DAKB 2CQ9A 5JCGA 3IAS2 4KF9A 4K5SA 1GSUA 5IPHA 1ERWA 2BTOT 1WRYA 4N0VA 4CY6A 2OJLA 6GSTA 1IYIA 2I1UA 4K8MA 4POLA 4BA7A 4FIWA 4IQAA 3GYKA 2KLXA 3L9SA 1OKTA 4KA0A 4NHZA 3MIXA 4HJ2A 2B5XA 2OA7A 4POKA 2YWMA 2FA4A 4YQVA 4X4JA 3H8QA 4OCFA 3VFIA 3HVXA 3RBTA 4X0XA 1PA3A 3KMNA 3TKRA 3GUSA 4G9HA 2P31A 1XWBA 2L6CA 2LSTA 3HCZA 4QQ7A 2ES7A 4IJIA 3C71A 1M2AA 1JZDA 2FY6A 3F0IA 2AUVA 3KP9A 4NV5A 3FZ5A 3ZREA 1AQXA 4ZB8A 1YZXA 4WBRD 2FWEA 1NHOA 4OO5A 1Y25A 1I5GA 2NPBA 1EWXA 1OE7A 1BEDA 3QFAC 1SKWB 4MF7A 3IAM2 2AYTA 3C1SA 3D6IA 1FOHA 5AIVA 4IQ1A 4IJ3A 3O6TA 3IHGA 2HLSA 2QSIA 2VCQA 3G7IA 2CAIA 4POMA 4ZBAA 1TKDB 4WBJA 3IK9A 4K6XA 4MF6A 3HDCA 3FK8A 3IK7A 2IL3A 3MAKA 1NHYA 1Z7PA 3ZYWA 2H6XA 5JWRB 3PINA 3ZIVA 1GUKA 1K0DA 5CRGA 5LD0A 5CRDA 4WKWA 5G5FA 4EDYA 1OC8A 1HYUA 1OYJA 4EUYA 3TRQA 4AJ6A 1TRSA 3MNGA 5IMAA 2GQLA 2XC2A 4BWSA 1Z5YE 4USSA 1EEMA 2WZ9A 4KSOA 2A4HA 4N30A 1F2EA 5CRHA 4I2UA 1VF1A 5ECKB 3CSIA 5D73A 4OMVA 3BCKA 3ERGA 3M9KA 3HVSA 1VF3A 4I2TA 4XRDA 1NM3A 2VL2A 5H5SA 1TXXA 2VLUA 4MABA 3LYKA 2WFCA 1TRUA 3RPPA 1A0FA 3KTLA 5CP1A 7GSSA 3DVXA 2C4JA 2VCXA 2HYXA 4MJAA 5DQYA 4Q5NA 2OBIA 2IFQB 4KH7A 8GSSA 4XCSA 1U3AA 4EXJA 2HT9A 5ELAA 5FHIA 1EP7A 3QR6A 1VRSD 4PUFC 2YZUA 3WYWA 1AQWA 4KB3A 4RQXA 4POBA 2H73A 3HVVA 1ZYPA 3GFKA 5HFIA 2YANA 3HJMA 5J9BA 1SYXA 2B3SA 5CAXA 3LFLA 1PSQA 1XWCA 3DGQA 4BL7B 4AGSA 3DIEA 2H8LA 2JU5A 4K7OA 5DVBA 4RI6A 3HD5A 4TN8A 3DKSA 3WGXA 3W6GA 2GS3A 4BVXA 2F3MA 3TOTA 2L57A 4XS1A 2N5FA 3DVWA 1K3LA 2HFDA 2CV4A 4AJ8A 1GWCA 4NPBA 2WULA 1JZWA 4PQ1A 2UZ8A 1AAZA 4KDXA 4Q5QA 5ECSA 2RM6A 2B5EA 3IHQA 4JE1A 1B8XA 4FYBA 3WD6A 4DSRA 1T3BA 2GSRA 2VL9A 3S9FA 1AC1A 2WGRA 4Q5RA 2MYGA 5B6NA 2VL3A 2YOIA 3PR8A 1SK1A 2N5AA 2NTOA 3D4TA 5DAKA 3FR9A 5KN1A 3IBHA 4NV2A 2N5BA 1GL8A 5J9CA 4TXOB 2KOKA 3ISOA 10GSA 2GQMA 1A2MA 2YNXA 3ERFA 2HSYA 3WT1A 1HQOA 3CSJA 2PERA 3FR6A 5DJMA 3TRXA 4HZ4A 4HDEA 2DJKA 5B7CA 2R3XA 2CAQA 2J23A 3C1RA 2HI7A 1TK5B 3KCMA 5ECLB 2L5OA 1CQGA 1XWGA 4YAPA 3GKNA 1U3IA 13GSA 1ZGNA 6GSSA 3ED3A 3FMWA 2IIYA 1M7TA 2B7JA 1N2AA 2KHPA 4O32A 1BX9A 4MDCA 2E7PA 2VCZA 1XIYA 1ABAA 1GSEA 2OE1A 4E8HA 3O76A 1RK4A 3HY2A 3DD3A 3F6DA 3E0UA 2H74A 3DXBA 4HU9A 3ZMKA 2LUSA 2AB6A 2HZFA 2VCVA 3FY7A 3ZFBA 1X5CA 2WB9A 3APOA 1PD21 4DSQA 1U6TA 2B1LA 4D73B 1A24A 1X9WB 2K6VA 4HS1A 4I8BA 4IN0A 4TRXA 4PQHA 4G0LA 3I43A 1G7EA 2C8UA 4ISDA 3W8JA 2KP1A 1WIKA 2ZUPA 3RDWA 3F63A 1UVZA 5G1KA 3G7JA 3GKXA 3UAPA 3KEBA 4GSTA 3MYDA 4F2IA 6GSXA 1ZCPA 4MZBA 4F0BA 5CNWA 5JCWA 2IPAA 3LJRA 4ML1A 2LNSA 2GGTA 5IO0A 3CSHA 1EP8A 3G7YA 3I69A 3TOUA 2H1AA 1EV9A 4ZL7A 3CMIA 4K2DA 3NIVA 2YWIA 5F06A 2C1YA 5J5NA 1T4YA 1LBKA 1A8YA 1PN9A 4ULXA 1R5PA 1WOUA 2JACA 1GTBA 2I3YA 3QAWA 4QL7A 1X9MB 1ERUA 1U88A 2CT6A 2WDUA 1JZRA 4IP6A 5BRTA 1O73A 2IFQA 3IR4A 2H0GA 5CRWA 1EOGA 4CHSA 2PU9C 2GQKA 1DBYA 3ME7A 1OC9B 4TW5A 3ERWA 2CVBA 2HZEA 3IE3A 4OFMA 4HUAA 1XBSA 1PX6A 2H0HA 1GSSA 2MZCA 2LKUA 4MK3A 4HQSA 1B4QA 2OE3A 4QL9A 2MBTA 5G30A 12GSA 4BWQA 4EDZA 2GDRA 1TJDA 1TOFA 2LEGA 4V2LA 2DMLA 3PH9A 5ECIB 2C3QA 1O85A 5IQYA 2VIMA 5HR2A 3TKPA 4HI7A 1BAYA 1B9YC 2QA2A 2TRCP 1A2LA 2C3NA 3EE2A 1TI1A 4TXVA 5D9TA 1MDJA 1SENA 4TOPA 2V41A 1M2BA 2R0CA 5GZZB 6GSVA 2A2SA 3V1WA 6GSWA 2NVLA 4MMMA 2TIRA 5G1LA 1F6MC 3L4NA 1TP9A 4I6XA 1EEJA 4EIPA 4TR3A 3KMOA 1T8EB 3HZ8A 1QQ2A 4HU7A 2C0EA 2LQOA 2A2PA 5KOXA 4TVEA 3M1GA 2J9HA 4JR4A 4HEA2 2RM5A 4AF2A 2H0IA 5JCUA 2OBKA 5ENUA 1NSWA 2YJ7A 2PWJA 2V6OA 3A3TA 4TKYA 1TRVA 2H01A 1SL1B 1NW2A 1DUGA 1TK8B 3MDKA 3LORA 4K0NA 1Z6NA 1MD4A 2VCTA 4E8EA 3FR3A 2O7KA 3VI5A 3I6AA 1UC7A 2LTKA 1JZOA 3QOUA 4TXOA 1FG4A 2X4AA 2DSAA 4K0GA 5D9WA 5GAND 1PQNA 3KZQA 2PVOC 1SK0A 1XOBA 1J9BA 3CTFA 2D2ZA 2I81A 1QXHA 4V1Ag 1ZYNA 2OADA 3MWHA 1V40A 2DBCA 1PRXA 2L4QA 2H1GA 3TKQA 1QUWA 4LL4B 2I9HA 4A5PA 1BG5A 2HSHA 3K8NA 4EVMA 1BJXA 4LMVA 2DMMA 5CO3A 5D93A 3GX8A 3TJGA 3UBKA 3BD2A 2H75A 2R6KA 4TR1B 2EIRA 5HR0A 3A2WA 4O7HA 1Z3EA 1GSYA 2X64A 4J2FA 3TUEA 5IPGA 2DLXA 3RHCA 3GA4A 3TJBA 2PBJA 1TK0B 2R37A 2GT6A 4KE3A 3FRCA 2ZCTA 4IGJA 2M72A 5AIXA 2IMEA 3D21A 3EINA 1KBNA 2VO4A 1MTCA 5AN1A 2GT5A 3CRUA 2HE3A 22GSA 2LJRA 3ZIJA 3UARA 2FD3A 2X99A 5IIZA 4EL1A 4GRFA 2C80A 3GRXA 2DKHA 4D73A 2LV3A 2YWOA 2LRTA 3GKKA 2M80A 3BBYA 3D0ZA 2FWFA 4JU5A 3UOMA 5G5EA 3IC8A 4ECCA 2E0QA 2XHFA 4XS4A 5ID2A 5EL8A 4Q5FA 3CTGA 3GTUB 1M0UA 1O8XA 3F9UA 4WF5A 2IN3A 3WT2A 4KDYA 4CW9A 2P5RA 5A4WA 3KD0A 2YCDA 3EVIA 1X9SB 1GSDA 2CZ2A 4MZCA 1WE0A 1AUCA 1XWAA 2KP2A 2HXKA 4MJEA 3FKFA 4ZBDA 5ELGA 3ZL5A 3D5JA 2L6DA 4ZB9A 3UIWA 2YN1A 1N8JA 1SJIA 5DALA 4MPGA 3APQA 4NWYA 1FAAA 4L0WA 1THXA 4GQCA 5AISA 1URMA 1PL1A 5IMZA 3AY8A 2FNOA 3HZ4A 1H75A 1YY7A 2I4AA 3L9VA 4X43A 1T00A 4K9ZA 4YQMA 1TTZA 2K18A 1ACVA 1A23A 2FUG2 4ACSA 1XFLA 2WS2A 2JZRA 3TKSC 3M0FA 3GKMA 4EE0A 1RW1A 2FCHA 1YDKA 1XXUA 3L0HA 3N9JA 4MH3A 3GIXA 2VCWA 2DJ3A 2P0GA 1M99A 2O8VB 5A4UA 4NAXA 4NHWA 4G0IA 3EU4A 3IPZA 5EY6A 1HNCA 3CBUA 3TRPA 3ZRDA 1KEBA 1VF2A 1THOA 2IMFA 3F4TA 2KUCA 5J3RA 3M8NA 4PXOA 2AAWA 1GSFA 2MMAA 1U87A 3LXZA 2ON5A 2ALBA 5IMCA 5CYYA 1Z6MA 4WR5A 2XBIA 3GX0A 3EC3A 2GSSA 2K8VA 2REMA 4OFTA 4TR0A 2JSYA 4WEYA 1XW5A 3VI7A 5DJLA 2OACA 1Y6EA 4FO5A 5D9VA 5D9XA 20GSA 1FB0A 4IW9A 1HNBA 4GF0A 1J0FA 3Q18A 4ML6A 3SBCA 3D22A 3UJ1A 4GSSA 1PMTA 1MD3A 2HRAA 2JL4A 1A2JA 5L71A 1OKDA 1GSQA 3FZAA 2MBSA 2C0DA 5KOWA 4ID0A 3P7XA 1G0TA 3GH6A 1SL2B 5F05A 2E2MA 4V2NA 1QMVA 1YF0A 4LA1A 3TKSA 3C7MA 2C0GA 3TB2A 1GTUA 2E2GA 2VOCA 1GRXA 1SU9A 1OAZA 1ML6A 5DDLA 6GSUA 3DYRA 5AGYA 2FGXA 2ON7A 4FYCA 1M2DA 3WGDA 4JEDA 1V9WA 1BYEA 3TJJA 4K2XA 5CREA 4EKZA 4MF5A 4EIQA 3A5IA 5D8IA 4DSSB 3LG6A 1T7PB 4PURA 2G0FA 4XRAA 1SD9A 1K0BA 1HNAA 3I9V2 2B7KA 3UL3A 3EURA 1V98A 1R7HA 4HZ2A 2VM1A 1SYRA 1TU7A 1MDKA 5D96A 1K3OA 4GWRA 1PX7A 4MLYA 4LMWA 4GCIA 4Z7XA 4LLRA 2IMDA 3F3QA 2XPDA 2H1BA 4KUNA 4LL1B 1JHBA 2DC5A 1BQ7A 2YJHA 4V1Ap 3H1NA 5FWGA 2F8FA 2CX4A 4WF4A 4ZL8A 3VLNA 3VPQA 3KM6A 2PMTA 4JZQA 2CVDA 4K7NA 5EVOA 4KW6A 3KH7A 2EIOA 4NMUA 5KN2A 1G6YA 5ECMB 3GHAA 3FEUA 1JLVA 4OFNA 5JWQB 2V32A 1MDIA 3PPUA 1FO5A 1IYHA 2K9FA 3ZMLA 3KXOA 4HOJA 4MP4A 3US3A 4Z2RA 2DIZA 4GLTA 2IMKA 3GSSA 4I97A 1K0NA 6GSYA 4KCAA 3GTUA 3Q6OA 2XPEA 4EO3A 4EC0A 3A5WA 3KTBA 1FHEA 2R4VA 3E9JB 3UMAA 1K0MA 1LU4A 1SJZA 2AHEA 2IMIA 1SD8A 3F6FA 4F03A 2A4VA 5LCZA 3DMLA 1GNWA 5ECHB 4KGIA 17GSA 3F8UA 1O6JA 1JLWA 3TJFA 1DE1A 3LW9A 2X49A 3BJ5A 1XPVA 4X1UA 5E59A 2VLVA 3APSA 1YQ1A 1GUHA 3DWVA 1M9AA 3EWLA 5A5KA 1K3YA 4IELA 4PQIA 3LSZA 2VM2A 2H30A 1AQVA 4BL7A 1GUMA 2GLRA 3D4MA 3FYGA 5F07A 2B5YA 4YKFA 4AJ7A 2WJUA 3GN3A 5FT3A 1GH2A 1TU8A 4O5UA 4PX1A 1I9DA 2GTUA 1GTAA 1OE8A 4KDUA 1WWJA 3G9BA 2MMZA 5GAPD 2O89A 5ECQB 1R5AA 3E3EA 2L59A 2A2RA 4BVYB 1ZYEA 4XS6A 3VWVA 2PUKC 2FHEA 1SJ6A 4OWYA 3HYPA 4HJMA 2X8HA 3J7Yk 2AJQB 3IXRA 2GSQA 4JBBA 2DJJA 1Z9HA 5IOWA 3IOSA 1YEXA 3JCML 2M46A 3LWAA 2EC4A 2P5QA 2PPTA 4G2EA 2X8GA 2PVQA 11GSA 2JZTA 5GSSA 3ZTLA 3TCOA 1ZOFA 4K7IA 1GTIA 1TI3A 2PGTA 2QGVA 1UA5A 5ECNB 2H66A 2CA8A 1FOVA 4IKHA 2VLTA 3QAVA 5J41A 2H70A 1EGOA 3BOAA 1OC3A 5HR3A 1YEPA 3VWWA 3CXGA 2VL2C 4N0ZA 4RUVA 3F3RA 1T4ZA 1W89A 4PNGA 3SWLA 1XWKA 2CVKA 4EF0A 2GVPA 4KCEA 3HXSA 4YKGA 2GZYA 1EGRA 4L5LA 3ZLPA 4ZB6A 1SKRB 3R3EA 2F9SA 3N5OA 1QK8A 3R2QA 4XTSA 2H71A 14GSA 2VD0A 3F4SA 4DSSA 2V6KA 1GP1A 3IV4A 3C73A 5C00A 1Q98A 1R26A 3P2AA 1V2AA 2FWHA 3F4RA 4Z2TA 4ZILA 1YJ6A 5IMFA 4PTSA 3ZFLA 3MSZA 1PL2A 2LJKA 1K0CA 5HR1A 1XVWA 3P90A 1EOHA 1ZZYA 2WCIA 4TR4A 3QPMA 3ZVJA 4PUAA 4ZXGA 4G0KA 1W4VA 3VURA 4MJBA 4N11A 3EU3A 1ILOA 2FLSA 1O8WA 4RQRA 2R5GA 4MPFA 2O85A 4XIHA 3EYTA 1F37A 1X5EA 3M3MA 1FVJA 1PGTA 4O5QA 3EMPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IDV A;  1QGV A;  2JSZ A;  3H79 A;  4OD7 A;  3ZZX A;  3QFB C;  4MCU A;  4BPY A;  3LYP A;  1KTE A;  1A0R P;  4N10 A;  2JAD A;  4MZW A;  3OR5 A;  3M9J A;  3HJO A;  4L0U A;  2H72 A;  3HHV A;  2HRN A;  4HQZ A;  5KN3 A;  3UBL A;  3Q74 A;  2IWT A;  5B6M A;  2NDO A;  1JFU A;  4V2M A;  3RPN A;  5JWO B;  4ZBB A;  3ZVJ D;  5COH A;  1TRW A;  1R4W A;  5KEJ A;  5ABR A;  2HZE B;  4FYU A;  3VWX A;  5A4V A;  1UN2 A;  4ILF A;  4KAE A;  5ECR B;  1FVK A;  3WGE A;  4ZL9 A;  9GSS A;  3IA1 A;  1E6B A;  1XVQ A;  2LRN A;  2CX3 A;  4GTU A;  19GS A;  4K1F A;  4PGT A;  1K0A A;  3L9U A;  1E2Y A;  2DJ2 A;  1Z7R A;  3QMX A;  1J08 A;  1VF4 A;  2RLI A;  2H1D A;  1VGL A;  3VK9 A;  2VAF A;  2YP6 A;  4WXT A;  2RUF A;  3NZN A;  4KX4 A;  4O92 A;  2RUE A;  4JRR A;  1O7U A;  4IP1 A;  1FW1 A;  3FZ4 A;  1GLP A;  1AXD A;  4F0C A;  2L4C A;  1WMJ A;  4XHM A;  1C72 A;  3FW2 A;  3L78 A;  3A2X A;  16GS A;  4J57 E;  3VWU A;  2H6Z A;  3HA9 A;  2DJ1 A;  1GUL A;  3HJP A;  1ERT A;  2C0F A;  3VPT A;  1WP0 A;  5GST A;  1QFN A;  4MJC A;  4BVY A;  3PGT A;  1KNG A;  3UVH A;  5DCG A;  1XCC A;  2HRF A;  4O5R A;  2VUP A;  2R2J A;  1S3D A;  1SL0 B;  3IRA A;  2HNL A;  1S3C A;  5EPF A;  3C8E A;  3GMF A;  1O81 A;  4ECJ A;  2AV4 A;  5LNK e;  3KJY A;  2QKE A;  3DRN A;  3P8W A;  3UEM A;  1H4O A;  5HFK A;  4J56 E;  4NXI A;  2B1K A;  1YKA A;  3QDN A;  4WR4 A;  4MH2 A;  3H4K A;  2K8S A;  2EIQ A;  1HD2 A;  3IC4 A;  2GZP A;  5DQS A;  1YF1 A;  2ZNM A;  5ECO B;  3TDG A;  2YZH A;  4IVF A;  3QD9 A;  4G10 A;  4DVC A;  2RII A;  4L8E A;  1G6W A;  1S3A A;  4IS0 A;  5B8A A;  1RQM A;  5ECP B;  4FH8 A;  3GST A;  5G2Z A;  1XW9 A;  4L5O A;  4YQU A;  3RAZ A;  2MMO A;  2V2G A;  2L5L A;  2VD1 A;  1F3B A;  4TR1 A;  2B6M A;  3GNJ A;  1XZO A;  3FHK A;  1XOA A;  1TDI A;  3CYN A;  1DSB A;  1YKC A;  1X0R A;  4GXZ A;  5DBQ A;  5B8B A;  3KIJ A;  1B4P A;  2WRT A;  1ST9 A;  1Q4J A;  1GLQ A;  3LQ7 A;  3QAG A;  2JZS A;  3GH9 A;  3H93 A;  1MEK A;  3GL5 A;  3LGC A;  2QC7 A;  5IMV A;  1SK2 A;  4H86 A;  1PKZ A;  3W8S A;  1B9X C;  5INY A;  1ERV A;  4XS4 B;  5ID2 B;  2PN8 A;  4JR6 A;  5G31 A;  2IJY A;  1CQH A;  3TJK A;  4WET A;  3J7Y b;  2NBS A;  2YWN A;  3LEF A;  1USB A;  5HQP A;  2DIY A;  2V1M A;  2LRC A;  2YV7 A;  5H5Q A;  2FWG A;  3HKR A;  4YAV A;  2F8A A;  1M9B A;  2FA8 A;  4DEJ A;  4I5Q A;  1AIU A;  1SKS B;  2YV9 A;  2LQQ A;  3DEX A;  3KGK A;  1EZK A;  1T1V A;  3GV1 A;  1PKW A;  2O87 A;  4P3Y B;  1TW9 A;  5DAL B;  1AW9 A;  1OC9 A;  1B48 A;  2YPM A;  1XW6 A;  2X8C A;  1ON4 A;  3ZIT A;  4RI7 A;  5HFG A;  2LS5 A;  1EV4 A;  2H19 A;  5F0G A;  2CZ3 A;  3Q19 A;  1K0O A;  4G19 A;  5DCH A;  5H5R A;  2BMX A;  4MA9 A;  1FB6 A;  1OVN A;  3TGZ A;  4IBP A;  3NOF A;  1DE2 A;  1V58 A;  1ZMA A;  3GL3 A;  3U5R E;  3LXT A;  5IMD A;  3A2V A;  4F82 A;  2XBQ A;  2Z9S A;  2GST A;  5KN0 A;  3EMX A;  5C04 A;  3QCP A;  3O3T A;  5IO2 A;  1X5D A;  18GS A;  5E4W A;  2MMN A;  4ZIJ A;  3GUR A;  5IOX A;  2OE0 A;  4IHU A;  2DJ0 A;  2F51 A;  4OCE A;  4GQF A;  5F8B A;  1WPI A;  3TKS E;  3UVT A;  2C3T A;  3ME8 A;  2GZZ A;  2H6Y A;  2LNT A;  1F3A A;  3CRT A;  2H76 A;  4PNF A;  2TRX A;  4ECB A;  1F9M A;  1LJR A;  1G7O A;  1GNE A;  3KP8 A;  3RHB A;  2G2Q A;  4ECI A;  4KND A;  1V57 A;  3BCI A;  5J4U A;  5IM9 A;  3FZ9 A;  2BJX A;  3U6V A;  4YH2 A;  4OO4 A;  4F9Z A;  2OKA A;  1ZL9 A;  2LJA A;  4CDO A;  1ZYQ B;  3KH9 A;  4GSN A;  4KSM A;  1WJK A;  1A8L A;  5DAK B;  2CQ9 A;  5JCG A;  3IAS 2;  1GSU A;  5IPH A;  1ERW A;  2BTO T;  1WRY A;  4N0V A;  2OJL A;  6GST A;  1IYI A;  2I1U A;  4K8M A;  4POL A;  4BA7 A;  4FIW A;  4IQA A;  3GYK A;  2KLX A;  3L9S A;  1OKT A;  4KA0 A;  4NHZ A;  4HJ2 A;  2B5X A;  2OA7 A;  4POK A;  2YWM A;  2FA4 A;  4YQV A;  3H8Q A;  4OCF A;  3VFI A;  3HVX A;  3RBT A;  4X0X A;  1PA3 A;  3KMN A;  3TKR A;  3GUS A;  4G9H A;  2P31 A;  1XWB A;  2L6C A;  2LST A;  3HCZ A;  4QQ7 A;  2ES7 A;  4IJI A;  3C71 A;  1M2A A;  1JZD A;  2FY6 A;  3F0I A;  2AUV A;  3KP9 A;  4NV5 A;  3FZ5 A;  3ZRE A;  1AQX A;  4ZB8 A;  1YZX A;  4WBR D;  2FWE A;  1NHO A;  4OO5 A;  1Y25 A;  1I5G A;  2NPB A;  1EWX A;  1OE7 A;  1BED A;  3QFA C;  1SKW B;  4MF7 A;  3IAM 2;  2AYT A;  3C1S A;  3D6I A;  5AIV A;  4IQ1 A;  4IJ3 A;  3O6T A;  2HLS A;  2QSI A;  2VCQ A;  3G7I A;  2CAI A;  4POM A;  4ZBA A;  1TKD B;  4WBJ A;  3IK9 A;  4K6X A;  4MF6 A;  3HDC A;  3FK8 A;  3IK7 A;  2IL3 A;  3MAK A;  1NHY A;  1Z7P A;  3ZYW A;  2H6X A;  5JWR B;  3PIN A;  3ZIV A;  1GUK A;  1K0D A;  5CRG A;  5LD0 A;  5CRD A;  4WKW A;  5G5F A;  4EDY A;  1OC8 A;  1HYU A;  1OYJ A;  4EUY A;  3TRQ A;  4AJ6 A;  1TRS A;  3MNG A;  5IMA A;  2GQL A;  2XC2 A;  4BWS A;  1Z5Y E;  1EEM A;  2WZ9 A;  4KSO A;  4N30 A;  1F2E A;  5CRH A;  4I2U A;  1VF1 A;  5ECK B;  3CSI A;  5D73 A;  4OMV A;  3BCK A;  3ERG A;  3M9K A;  3HVS A;  1VF3 A;  4I2T A;  4XRD A;  1NM3 A;  2VL2 A;  5H5S A;  1TXX A;  2VLU A;  4MAB A;  3LYK A;  2WFC A;  1TRU A;  3RPP A;  1A0F A;  3KTL A;  5CP1 A;  7GSS A;  3DVX A;  2C4J A;  2VCX A;  2HYX A;  4MJA A;  5DQY A;  4Q5N A;  2OBI A;  2IFQ B;  4KH7 A;  8GSS A;  4XCS A;  1U3A A;  4EXJ A;  2HT9 A;  5ELA A;  5FHI A;  1EP7 A;  3QR6 A;  1VRS D;  4PUF C;  2YZU A;  3WYW A;  1AQW A;  4KB3 A;  4RQX A;  4POB A;  2H73 A;  3HVV A;  3GFK A;  5HFI A;  2YAN A;  3HJM A;  5J9B A;  1SYX A;  2B3S A;  5CAX A;  3LFL A;  1PSQ A;  1XWC A;  3DGQ A;  4AGS A;  3DIE A;  2H8L A;  2JU5 A;  4K7O A;  5DVB A;  4RI6 A;  3HD5 A;  4TN8 A;  3DKS A;  3WGX A;  3W6G A;  2GS3 A;  4BVX A;  2F3M A;  3TOT A;  2L57 A;  4XS1 A;  2N5F A;  3DVW A;  1K3L A;  2HFD A;  2CV4 A;  4AJ8 A;  1GWC A;  4NPB A;  2WUL A;  1JZW A;  4PQ1 A;  1AAZ A;  4KDX A;  4Q5Q A;  5ECS A;  2RM6 A;  2B5E A;  3IHQ A;  4JE1 A;  1B8X A;  4FYB A;  3WD6 A;  4DSR A;  1T3B A;  2GSR A;  2VL9 A;  3S9F A;  1AC1 A;  2WGR A;  4Q5R A;  2MYG A;  5B6N A;  2VL3 A;  2YOI A;  3PR8 A;  1SK1 A;  2N5A A;  2NTO A;  3D4T A;  5DAK A;  3FR9 A;  5KN1 A;  3IBH A;  4NV2 A;  2N5B A;  1GL8 A;  5J9C A;  4TXO B;  2KOK A;  3ISO A;  10GS A;  2GQM A;  1A2M A;  2YNX A;  3ERF A;  2HSY A;  3WT1 A;  1HQO A;  3CSJ A;  2PER A;  3FR6 A;  5DJM A;  3TRX A;  4HZ4 A;  4HDE A;  2DJK A;  5B7C A;  2R3X A;  2CAQ A;  2J23 A;  3C1R A;  2HI7 A;  1TK5 B;  3KCM A;  5ECL B;  2L5O A;  1CQG A;  1XWG A;  4YAP A;  3GKN A;  1U3I A;  13GS A;  1ZGN A;  6GSS A;  3ED3 A;  2IIY A;  1M7T A;  2B7J A;  1N2A A;  2KHP A;  4O32 A;  1BX9 A;  4MDC A;  2E7P A;  2VCZ A;  1XIY A;  1ABA A;  1GSE A;  2OE1 A;  4E8H A;  3O76 A;  1RK4 A;  3HY2 A;  3DD3 A;  3F6D A;  3E0U A;  2H74 A;  3DXB A;  4HU9 A;  3ZMK A;  2LUS A;  2AB6 A;  2HZF A;  2VCV A;  3FY7 A;  3ZFB A;  1X5C A;  2WB9 A;  3APO A;  1PD2 1;  4DSQ A;  1U6T A;  2B1L A;  4D73 B;  1A24 A;  1X9W B;  2K6V A;  4HS1 A;  4I8B A;  4IN0 A;  4TRX A;  4PQH A;  3I43 A;  1G7E A;  2C8U A;  4ISD A;  3W8J A;  2KP1 A;  1WIK A;  2ZUP A;  3RDW A;  3F63 A;  1UVZ A;  5G1K A;  3G7J A;  3GKX A;  3UAP A;  3KEB A;  4GST A;  4F2I A;  6GSX A;  1ZCP A;  4MZB A;  4F0B A;  5CNW A;  5JCW A;  2IPA A;  3LJR A;  4ML1 A;  2LNS A;  2GGT A;  5IO0 A;  3CSH A;  1EP8 A;  3G7Y A;  3I69 A;  3TOU A;  2H1A A;  1EV9 A;  4ZL7 A;  3CMI A;  4K2D A;  3NIV A;  2YWI A;  5F06 A;  2C1Y A;  5J5N A;  1T4Y A;  1LBK A;  1A8Y A;  1PN9 A;  4ULX A;  1R5P A;  1WOU A;  2JAC A;  1GTB A;  2I3Y A;  3QAW A;  4QL7 A;  1X9M B;  1ERU A;  1U88 A;  2CT6 A;  2WDU A;  1JZR A;  4IP6 A;  1O73 A;  2IFQ A;  3IR4 A;  2H0G A;  5CRW A;  1EOG A;  4CHS A;  2PU9 C;  2GQK A;  1DBY A;  3ME7 A;  1OC9 B;  4TW5 A;  3ERW A;  2CVB A;  2HZE A;  3IE3 A;  4OFM A;  4HUA A;  1XBS A;  1PX6 A;  2H0H A;  1GSS A;  2MZC A;  2LKU A;  4MK3 A;  4HQS A;  1B4Q A;  2OE3 A;  4QL9 A;  2MBT A;  5G30 A;  12GS A;  4BWQ A;  4EDZ A;  2GDR A;  1TJD A;  1TOF A;  2LEG A;  4V2L A;  2DML A;  3PH9 A;  5ECI B;  2C3Q A;  1O85 A;  5IQY A;  2VIM A;  5HR2 A;  3TKP A;  4HI7 A;  1BAY A;  1B9Y C;  2TRC P;  1A2L A;  2C3N A;  3EE2 A;  1TI1 A;  4TXV A;  5D9T A;  1MDJ A;  1SEN A;  4TOP A;  2V41 A;  1M2B A;  5GZZ B;  6GSV A;  2A2S A;  3V1W A;  6GSW A;  2NVL A;  4MMM A;  2TIR A;  5G1L A;  1F6M C;  3L4N A;  1TP9 A;  4I6X A;  1EEJ A;  4TR3 A;  3KMO A;  1T8E B;  3HZ8 A;  1QQ2 A;  4HU7 A;  2C0E A;  2LQO A;  4TVE A;  3M1G A;  2J9H A;  4JR4 A;  4HEA 2;  2RM5 A;  4AF2 A;  2H0I A;  5JCU A;  2OBK A;  5ENU A;  1NSW A;  2YJ7 A;  2PWJ A;  2V6O A;  3A3T A;  4TKY A;  1TRV A;  2H01 A;  1SL1 B;  1NW2 A;  1DUG A;  1TK8 B;  3MDK A;  3LOR A;  4K0N A;  1Z6N A;  1MD4 A;  2VCT A;  4E8E A;  3FR3 A;  2O7K A;  3VI5 A;  3I6A A;  1UC7 A;  2LTK A;  1JZO A;  3QOU A;  4TXO A;  1FG4 A;  2DSA A;  4K0G A;  5D9W A;  5GAN D;  1PQN A;  3KZQ A;  2PVO C;  1SK0 A;  1XOB A;  1J9B A;  3CTF A;  2D2Z A;  2I81 A;  1QXH A;  4V1A g;  2OAD A;  3MWH A;  1V40 A;  2DBC A;  1PRX A;  2L4Q A;  2H1G A;  3TKQ A;  1QUW A;  4LL4 B;  2I9H A;  1BG5 A;  2HSH A;  3K8N A;  4EVM A;  1BJX A;  4LMV A;  2DMM A;  5CO3 A;  5D93 A;  3GX8 A;  3TJG A;  3UBK A;  3BD2 A;  2H75 A;  2R6K A;  4TR1 B;  2EIR A;  5HR0 A;  3A2W A;  4O7H A;  1Z3E A;  1GSY A;  2X64 A;  4J2F A;  3TUE A;  5IPG A;  2DLX A;  3RHC A;  3GA4 A;  3TJB A;  2PBJ A;  1TK0 B;  2R37 A;  2GT6 A;  4KE3 A;  3FRC A;  2ZCT A;  4IGJ A;  2M72 A;  5AIX A;  2IME A;  3D21 A;  3EIN A;  1KBN A;  2VO4 A;  1MTC A;  5AN1 A;  2GT5 A;  3CRU A;  2HE3 A;  22GS A;  2LJR A;  3ZIJ A;  3UAR A;  2FD3 A;  2X99 A;  5IIZ A;  4EL1 A;  4GRF A;  2C80 A;  3GRX A;  4D73 A;  2LV3 A;  2YWO A;  2LRT A;  3GKK A;  2M80 A;  3BBY A;  3D0Z A;  2FWF A;  4JU5 A;  3UOM A;  5G5E A;  4ECC A;  2E0Q A;  2XHF A;  4XS4 A;  5ID2 A;  5EL8 A;  4Q5F A;  3CTG A;  3GTU B;  1M0U A;  1O8X A;  3F9U A;  4WF5 A;  2IN3 A;  3WT2 A;  4KDY A;  4CW9 A;  2P5R A;  5A4W A;  3KD0 A;  2YCD A;  3EVI A;  1X9S B;  1GSD A;  2CZ2 A;  4MZC A;  1WE0 A;  1AUC A;  1XWA A;  2KP2 A;  2HXK A;  4MJE A;  3FKF A;  4ZBD A;  5ELG A;  3ZL5 A;  3D5J A;  2L6D A;  4ZB9 A;  3UIW A;  2YN1 A;  1N8J A;  1SJI A;  5DAL A;  4MPG A;  3APQ A;  4NWY A;  1FAA A;  4L0W A;  1THX A;  4GQC A;  5AIS A;  1URM A;  1PL1 A;  5IMZ A;  3AY8 A;  2FNO A;  3HZ4 A;  1H75 A;  1YY7 A;  2I4A A;  3L9V A;  4X43 A;  1T00 A;  4K9Z A;  4YQM A;  1TTZ A;  2K18 A;  1ACV A;  1A23 A;  2FUG 2;  4ACS A;  1XFL A;  2WS2 A;  2JZR A;  3TKS C;  3M0F A;  3GKM A;  4EE0 A;  1RW1 A;  2FCH A;  1YDK A;  1XXU A;  3L0H A;  3N9J A;  4MH3 A;  3GIX A;  2VCW A;  2DJ3 A;  2P0G A;  1M99 A;  2O8V B;  5A4U A;  4NAX A;  4NHW A;  3EU4 A;  3IPZ A;  5EY6 A;  1HNC A;  3CBU A;  3TRP A;  3ZRD A;  1KEB A;  1VF2 A;  1THO A;  2IMF A;  3F4T A;  2KUC A;  5J3R A;  3M8N A;  4PXO A;  2AAW A;  1GSF A;  2MMA A;  1U87 A;  3LXZ A;  2ON5 A;  2ALB A;  5IMC A;  5CYY A;  1Z6M A;  4WR5 A;  2XBI A;  3GX0 A;  3EC3 A;  2GSS A;  2K8V A;  2REM A;  4OFT A;  4TR0 A;  2JSY A;  4WEY A;  1XW5 A;  3VI7 A;  5DJL A;  2OAC A;  1Y6E A;  4FO5 A;  5D9V A;  5D9X A;  20GS A;  1FB0 A;  4IW9 A;  1HNB A;  4GF0 A;  1J0F A;  3Q18 A;  4ML6 A;  3SBC A;  3D22 A;  3UJ1 A;  4GSS A;  1PMT A;  1MD3 A;  2JL4 A;  1A2J A;  5L71 A;  1OKD A;  1GSQ A;  3FZA A;  2MBS A;  2C0D A;  4ID0 A;  3P7X A;  1G0T A;  3GH6 A;  1SL2 B;  5F05 A;  2E2M A;  4V2N A;  1QMV A;  1YF0 A;  4LA1 A;  3TKS A;  3C7M A;  2C0G A;  3TB2 A;  1GTU A;  2E2G A;  2VOC A;  1GRX A;  1SU9 A;  1OAZ A;  1ML6 A;  5DDL A;  6GSU A;  3DYR A;  5AGY A;  2FGX A;  2ON7 A;  4FYC A;  1M2D A;  3WGD A;  4JED A;  1V9W A;  1BYE A;  3TJJ A;  5CRE A;  4EKZ A;  4MF5 A;  5D8I A;  4DSS B;  3LG6 A;  1T7P B;  4PUR A;  2G0F A;  4XRA A;  1SD9 A;  1K0B A;  1HNA A;  3I9V 2;  2B7K A;  3UL3 A;  3EUR A;  1V98 A;  1R7H A;  4HZ2 A;  2VM1 A;  1SYR A;  1TU7 A;  1MDK A;  5D96 A;  1K3O A;  4GWR A;  1PX7 A;  4MLY A;  4LMW A;  4GCI A;  4Z7X A;  4LLR A;  2IMD A;  3F3Q A;  2XPD A;  2H1B A;  4KUN A;  4LL1 B;  1JHB A;  2DC5 A;  1BQ7 A;  2YJH A;  4V1A p;  3H1N A;  5FWG A;  2F8F A;  2CX4 A;  4WF4 A;  4ZL8 A;  3VLN A;  3VPQ A;  3KM6 A;  2PMT A;  4JZQ A;  2CVD A;  4K7N A;  5EVO A;  4KW6 A;  3KH7 A;  2EIO A;  4NMU A;  5KN2 A;  1G6Y A;  5ECM B;  3GHA A;  3FEU A;  1JLV A;  4OFN A;  5JWQ B;  2V32 A;  1MDI A;  1FO5 A;  1IYH A;  2K9F A;  3ZML A;  3KXO A;  4HOJ A;  4MP4 A;  3US3 A;  2DIZ A;  4GLT A;  2IMK A;  3GSS A;  4I97 A;  1K0N A;  6GSY A;  4KCA A;  3GTU A;  3Q6O A;  2XPE A;  4EO3 A;  4EC0 A;  3A5W A;  3KTB A;  1FHE A;  2R4V A;  3E9J B;  3UMA A;  1K0M A;  1LU4 A;  1SJZ A;  2AHE A;  2IMI A;  1SD8 A;  3F6F A;  4F03 A;  2A4V A;  5LCZ A;  3DML A;  1GNW A;  5ECH B;  4KGI A;  17GS A;  3F8U A;  1O6J A;  1JLW A;  3TJF A;  1DE1 A;  3BJ5 A;  1XPV A;  4X1U A;  5E59 A;  2VLV A;  3APS A;  1YQ1 A;  1GUH A;  3DWV A;  1M9A A;  3EWL A;  5A5K A;  1K3Y A;  4IEL A;  4PQI A;  3LSZ A;  2VM2 A;  2H30 A;  1AQV A;  4BL7 A;  1GUM A;  2GLR A;  3D4M A;  3FYG A;  5F07 A;  2B5Y A;  4AJ7 A;  2WJU A;  3GN3 A;  5FT3 A;  1GH2 A;  1TU8 A;  4PX1 A;  1I9D A;  2GTU A;  1GTA A;  1OE8 A;  4KDU A;  1WWJ A;  3G9B A;  2MMZ A;  5GAP D;  2O89 A;  5ECQ B;  1R5A A;  3E3E A;  2L59 A;  2A2R A;  1ZYE A;  4XS6 A;  3VWV A;  2PUK C;  2FHE A;  1SJ6 A;  4OWY A;  3HYP A;  4HJM A;  2X8H A;  3J7Y k;  2AJQ B;  3IXR A;  2GSQ A;  4JBB A;  2DJJ A;  1Z9H A;  5IOW A;  3IOS A;  1YEX A;  3JCM L;  2M46 A;  3LWA A;  2EC4 A;  2P5Q A;  2PPT A;  4G2E A;  2X8G A;  2PVQ A;  11GS A;  2JZT A;  5GSS A;  3ZTL A;  3TCO A;  1ZOF A;  4K7I A;  1GTI A;  1TI3 A;  2PGT A;  2QGV A;  1UA5 A;  5ECN B;  2H66 A;  2CA8 A;  1FOV A;  4IKH A;  2VLT A;  3QAV A;  5J41 A;  2H70 A;  1EGO A;  3BOA A;  1OC3 A;  5HR3 A;  1YEP A;  3VWW A;  3CXG A;  2VL2 C;  4N0Z A;  4RUV A;  3F3R A;  1T4Z A;  1W89 A;  4PNG A;  3SWL A;  1XWK A;  2CVK A;  4EF0 A;  2GVP A;  4KCE A;  3HXS A;  2GZY A;  1EGR A;  4L5L A;  3ZLP A;  4ZB6 A;  1SKR B;  2F9S A;  3N5O A;  1QK8 A;  3R2Q A;  4XTS A;  2H71 A;  14GS A;  2VD0 A;  3F4S A;  4DSS A;  2V6K A;  1GP1 A;  3IV4 A;  3C73 A;  5C00 A;  1Q98 A;  1R26 A;  3P2A A;  1V2A A;  2FWH A;  3F4R A;  4ZIL A;  1YJ6 A;  5IMF A;  3ZFL A;  3MSZ A;  1PL2 A;  2LJK A;  1K0C A;  5HR1 A;  1XVW A;  3P90 A;  1EOH A;  1ZZY A;  2WCI A;  4TR4 A;  3QPM A;  3ZVJ A;  4PUA A;  4ZXG A;  1W4V A;  3VUR A;  4MJB A;  4N11 A;  3EU3 A;  1ILO A;  2FLS A;  1O8W A;  4RQR A;  2R5G A;  4MPF A;  2O85 A;  4XIH A;  3EYT A;  1F37 A;  1X5E A;  3M3M A;  1FVJ A;  1PGT A;  3EMP A; 
#chains in the Genus database with same CATH topology
 3IDV A;  1QGV A;  2JSZ A;  3H79 A;  4OD7 A;  3ZZX A;  3QFB C;  4MCU A;  4BPY A;  3LYP A;  1KTE A;  1A0R P;  4N10 A;  2JAD A;  4MZW A;  3OR5 A;  3M9J A;  3HJO A;  4L0U A;  2H72 A;  3HHV A;  2HRN A;  4HQZ A;  5KN3 A;  3UBL A;  3Q74 A;  2IWT A;  5B6M A;  2NDO A;  1JFU A;  2HSM A;  4V2M A;  3RPN A;  5JWO B;  4ZBB A;  4ICY A;  3ZVJ D;  5COH A;  1TRW A;  1R4W A;  5KEJ A;  5ABR A;  2HZE B;  4FYU A;  3VWX A;  5A4V A;  1UN2 A;  4ILF A;  4KAE A;  5ECR B;  1FVK A;  3WGE A;  4ZL9 A;  9GSS A;  3IA1 A;  1E6B A;  1XVQ A;  2LRN A;  2CX3 A;  4GTU A;  19GS A;  4K1F A;  4PGT A;  1K0A A;  1PN0 A;  3L9U A;  1E2Y A;  2DJ2 A;  2R0P A;  1Z7R A;  3QMX A;  1J08 A;  1VF4 A;  2RLI A;  2H1D A;  1VGL A;  3VK9 A;  2VAF A;  2YP6 A;  4WXT A;  2RUF A;  3NZN A;  4KX4 A;  4O92 A;  2RUE A;  4JRR A;  1O7U A;  4IP1 A;  1FW1 A;  3FZ4 A;  1GLP A;  1AXD A;  4F0C A;  2L4C A;  1WMJ A;  4XHM A;  1C72 A;  3FW2 A;  3L78 A;  3A2X A;  16GS A;  4J57 E;  3VWU A;  2H6Z A;  3HA9 A;  2DJ1 A;  1GUL A;  3HJP A;  1ERT A;  2C0F A;  3VPT A;  1WP0 A;  5GST A;  1QFN A;  4MJC A;  4BVY A;  3PGT A;  1KNG A;  3UVH A;  5DCG A;  1XCC A;  2HRF A;  4O5R A;  2VUP A;  2R2J A;  1S3D A;  1SL0 B;  3IRA A;  2HNL A;  1S3C A;  5EPF A;  3C8E A;  3GMF A;  1O81 A;  4ECJ A;  2AV4 A;  5LNK e;  3KJY A;  2QKE A;  3DRN A;  3P8W A;  3UEM A;  1H4O A;  5HFK A;  4J56 E;  4NXI A;  2B1K A;  1YKA A;  3QDN A;  4WR4 A;  4MH2 A;  3H4K A;  2K8S A;  2EIQ A;  1HD2 A;  3IC4 A;  2GZP A;  5DQS A;  1YF1 A;  2ZNM A;  3EPT A;  5ECO B;  3TDG A;  2YZH A;  4IVF A;  3QD9 A;  4G10 A;  4DVC A;  2RII A;  4L8E A;  1G6W A;  1S3A A;  4IS0 A;  5B8A A;  1RQM A;  5ECP B;  4FH8 A;  3GST A;  5G2Z A;  1XW9 A;  4L5O A;  4YQU A;  3RAZ A;  2MMO A;  2V2G A;  4MNN A;  2L5L A;  2VD1 A;  1F3B A;  4TR1 A;  2B6M A;  3GNJ A;  4CY8 A;  1XZO A;  3FHK A;  1XOA A;  1TDI A;  3CYN A;  1DSB A;  1YKC A;  1X0R A;  4GXZ A;  5DBQ A;  5B8B A;  3KIJ A;  1B4P A;  2WRT A;  1ST9 A;  1Q4J A;  1GLQ A;  3LQ7 A;  3QAG A;  2JZS A;  3GH9 A;  3H93 A;  1MEK A;  3GL5 A;  3LGC A;  2QC7 A;  5IMV A;  1SK2 A;  4H86 A;  1PKZ A;  3W8S A;  1B9X C;  5INY A;  1ERV A;  4XS4 B;  5ID2 B;  2PN8 A;  4Z2U A;  4JR6 A;  5G31 A;  2IJY A;  1CQH A;  3TJK A;  4WET A;  3J7Y b;  2NBS A;  2YWN A;  3LEF A;  1USB A;  5HQP A;  2DIY A;  2V1M A;  2LRC A;  2YV7 A;  5H5Q A;  2FWG A;  3HKR A;  4YAV A;  2F8A A;  1M9B A;  2FA8 A;  4DEJ A;  4I5Q A;  1AIU A;  1SKS B;  2YV9 A;  2LQQ A;  3DEX A;  3KGK A;  1EZK A;  1T1V A;  3GV1 A;  1PKW A;  2O87 A;  4P3Y B;  1TW9 A;  5DAL B;  1AW9 A;  1OC9 A;  1B48 A;  2YPM A;  1XW6 A;  2X8C A;  1ON4 A;  3ZIT A;  4RI7 A;  5HFG A;  2HRK A;  2LS5 A;  1EV4 A;  2H19 A;  5F0G A;  2CZ3 A;  3Q19 A;  1K0O A;  2DKI A;  2QA1 A;  4G19 A;  5DCH A;  5H5R A;  2BMX A;  4MA9 A;  1FB6 A;  1OVN A;  3TGZ A;  4BIK A;  4IBP A;  3NOF A;  1DE2 A;  1V58 A;  1ZMA A;  4BVX B;  3GL3 A;  2R0G A;  3U5R E;  3LXT A;  4K5R A;  3A2V A;  5IMD A;  4F82 A;  2XBQ A;  2Z9S A;  2GST A;  5KN0 A;  3EMX A;  5C04 A;  3QCP A;  3O3T A;  5IO2 A;  1X5D A;  18GS A;  5E4W A;  2MMN A;  4ZIJ A;  3GUR A;  5IOX A;  2OE0 A;  4IHU A;  2DJ0 A;  2F51 A;  4OCE A;  4GQF A;  4FQU A;  5F8B A;  1WPI A;  3TKS E;  3UVT A;  2C3T A;  3ME8 A;  2GZZ A;  2H6Y A;  2LNT A;  1F3A A;  3CRT A;  2H76 A;  4PNF A;  2TRX A;  4ECB A;  1F9M A;  1LJR A;  1G7O A;  1GNE A;  3KP8 A;  3RHB A;  2G2Q A;  4ECI A;  4KND A;  1V57 A;  3BCI A;  5J4U A;  5IM9 A;  3FZ9 A;  2BJX A;  3U6V A;  4YH2 A;  4OO4 A;  4F9Z A;  2OKA A;  1ZL9 A;  2LJA A;  4CDO A;  1ZYQ B;  3KH9 A;  4GSN A;  4KSM A;  1WJK A;  1A8L A;  5BMU A;  5DAK B;  2CQ9 A;  5JCG A;  3IAS 2;  4KF9 A;  4K5S A;  1GSU A;  5IPH A;  1ERW A;  2BTO T;  1WRY A;  4N0V A;  4CY6 A;  2OJL A;  3CQF A;  6GST A;  1IYI A;  2I1U A;  4K8M A;  4POL A;  4BA7 A;  4FIW A;  4IQA A;  3GYK A;  2KLX A;  3L9S A;  1OKT A;  4KA0 A;  4NHZ A;  3MIX A;  4HJ2 A;  2B5X A;  2OA7 A;  4POK A;  2YWM A;  2FA4 A;  4YQV A;  4X4J A;  3H8Q A;  4OCF A;  1S3R A;  3VFI A;  3HVX A;  3RBT A;  4X0X A;  1PA3 A;  3KMN A;  3TKR A;  3GUS A;  4G9H A;  2P31 A;  1XWB A;  2L6C A;  2LST A;  3HCZ A;  4QQ7 A;  2ES7 A;  4IJI A;  3C71 A;  1M2A A;  1JZD A;  2FY6 A;  3F0I A;  2AUV A;  3KP9 A;  4NV5 A;  3FZ5 A;  3ZRE A;  1AQX A;  4ZB8 A;  1YZX A;  4WBR D;  2FWE A;  1NHO A;  4OO5 A;  1Y25 A;  1I5G A;  2NPB A;  1EWX A;  1OE7 A;  1BED A;  3QFA C;  1SKW B;  4MF7 A;  3IAM 2;  2AYT A;  3C1S A;  3D6I A;  1FOH A;  5AIV A;  4IQ1 A;  4IJ3 A;  3O6T A;  3IHG A;  2HLS A;  2QSI A;  2VCQ A;  3G7I A;  2CAI A;  4POM A;  4ZBA A;  1TKD B;  4WBJ A;  3IK9 A;  4K6X A;  4MF6 A;  3HDC A;  3FK8 A;  3IK7 A;  2IL3 A;  3MAK A;  1NHY A;  1Z7P A;  3ZYW A;  2H6X A;  5JWR B;  3PIN A;  3ZIV A;  1GUK A;  1K0D A;  5CRG A;  5LD0 A;  5CRD A;  4WKW A;  5G5F A;  4EDY A;  1OC8 A;  1HYU A;  1OYJ A;  4EUY A;  3TRQ A;  4AJ6 A;  1TRS A;  3MNG A;  5IMA A;  2GQL A;  2XC2 A;  4BWS A;  1Z5Y E;  4USS A;  1EEM A;  2WZ9 A;  4KSO A;  2A4H A;  4N30 A;  1F2E A;  5CRH A;  4I2U A;  1VF1 A;  5ECK B;  3CSI A;  5D73 A;  4OMV A;  3BCK A;  3ERG A;  3M9K A;  3HVS A;  1VF3 A;  4I2T A;  4XRD A;  1NM3 A;  2VL2 A;  5H5S A;  1TXX A;  2VLU A;  4MAB A;  3LYK A;  2WFC A;  1TRU A;  3RPP A;  1A0F A;  3KTL A;  5CP1 A;  7GSS A;  3DVX A;  2C4J A;  2VCX A;  2HYX A;  4MJA A;  5DQY A;  4Q5N A;  2OBI A;  2IFQ B;  4KH7 A;  8GSS A;  4XCS A;  1U3A A;  4EXJ A;  2HT9 A;  5ELA A;  5FHI A;  1EP7 A;  3QR6 A;  1VRS D;  4PUF C;  2YZU A;  3WYW A;  1AQW A;  4KB3 A;  4RQX A;  4POB A;  2H73 A;  3HVV A;  1ZYP A;  3GFK A;  5HFI A;  2YAN A;  3HJM A;  5J9B A;  1SYX A;  2B3S A;  5CAX A;  3LFL A;  4HSC X;  1PSQ A;  1XWC A;  3DGQ A;  4BL7 B;  4AGS A;  3DIE A;  2H8L A;  2JU5 A;  4K7O A;  5DVB A;  4RI6 A;  3HD5 A;  4TN8 A;  3DKS A;  3WGX A;  3W6G A;  2GS3 A;  4BVX A;  2F3M A;  3TOT A;  2L57 A;  4XS1 A;  2N5F A;  3DVW A;  1K3L A;  2HFD A;  2CV4 A;  4AJ8 A;  1GWC A;  4NPB A;  2WUL A;  1JZW A;  4PQ1 A;  2UZ8 A;  1AAZ A;  4KDX A;  4Q5Q A;  5ECS A;  2RM6 A;  2B5E A;  3IHQ A;  4JE1 A;  1B8X A;  4FYB A;  3WD6 A;  4DSR A;  1T3B A;  2GSR A;  2VL9 A;  3S9F A;  1AC1 A;  2WGR A;  4Q5R A;  2MYG A;  5B6N A;  2VL3 A;  2YOI A;  3PR8 A;  1SK1 A;  2N5A A;  2NTO A;  3D4T A;  5DAK A;  3FR9 A;  5KN1 A;  3IBH A;  4NV2 A;  2N5B A;  1GL8 A;  5J9C A;  4TXO B;  2KOK A;  3ISO A;  10GS A;  2GQM A;  1A2M A;  2YNX A;  3ERF A;  2HSY A;  3WT1 A;  1HQO A;  3CSJ A;  2PER A;  3FR6 A;  5DJM A;  3TRX A;  4HZ4 A;  4HDE A;  2DJK A;  5B7C A;  2R3X A;  2CAQ A;  2J23 A;  3C1R A;  2HI7 A;  1TK5 B;  3KCM A;  5ECL B;  2L5O A;  1CQG A;  1XWG A;  4YAP A;  3GKN A;  1U3I A;  13GS A;  1ZGN A;  6GSS A;  3ED3 A;  3FMW A;  2IIY A;  1M7T A;  2B7J A;  1N2A A;  2KHP A;  4O32 A;  1BX9 A;  4MDC A;  2E7P A;  2VCZ A;  1XIY A;  1ABA A;  1GSE A;  2OE1 A;  4E8H A;  3O76 A;  1RK4 A;  3HY2 A;  3DD3 A;  3F6D A;  3E0U A;  2H74 A;  3DXB A;  4HU9 A;  3ZMK A;  2LUS A;  2AB6 A;  2HZF A;  2VCV A;  3FY7 A;  3ZFB A;  1X5C A;  2WB9 A;  3APO A;  1PD2 1;  4DSQ A;  1U6T A;  2B1L A;  4D73 B;  1A24 A;  1X9W B;  2K6V A;  4HS1 A;  4I8B A;  4IN0 A;  4TRX A;  4PQH A;  3HVN A;  4G0L A;  3I43 A;  1G7E A;  2C8U A;  4ISD A;  3W8J A;  2KP1 A;  1WIK A;  2ZUP A;  3RDW A;  3F63 A;  1UVZ A;  5G1K A;  3G7J A;  3GKX A;  3UAP A;  3KEB A;  4GST A;  3MYD A;  4F2I A;  1PFO A;  6GSX A;  1ZCP A;  4MZB A;  4F0B A;  5CNW A;  5JCW A;  2IPA A;  3LJR A;  4ML1 A;  2LNS A;  2GGT A;  5IO0 A;  3CSH A;  1EP8 A;  3G7Y A;  3I69 A;  3TOU A;  2H1A A;  1EV9 A;  4ZL7 A;  3CMI A;  4K2D A;  3NIV A;  2YWI A;  5F06 A;  2C1Y A;  5J5N A;  1T4Y A;  1LBK A;  1A8Y A;  1PN9 A;  4ULX A;  1R5P A;  1WOU A;  2JAC A;  1GTB A;  2I3Y A;  3QAW A;  4QL7 A;  1X9M B;  1ERU A;  1U88 A;  2CT6 A;  2WDU A;  1JZR A;  4IP6 A;  5BRT A;  1O73 A;  2IFQ A;  3IR4 A;  2H0G A;  5CRW A;  1EOG A;  4CHS A;  2PU9 C;  2GQK A;  1DBY A;  3ME7 A;  1OC9 B;  4TW5 A;  3ERW A;  2CVB A;  2HZE A;  3IE3 A;  4OFM A;  4HUA A;  1XBS A;  1PX6 A;  2H0H A;  1GSS A;  2MZC A;  2LKU A;  4MK3 A;  4HQS A;  1B4Q A;  2OE3 A;  4QL9 A;  2MBT A;  5G30 A;  12GS A;  4BWQ A;  4EDZ A;  2GDR A;  1TJD A;  1TOF A;  2LEG A;  4V2L A;  2DML A;  3PH9 A;  5ECI B;  2C3Q A;  1O85 A;  5IQY A;  2VIM A;  5HR2 A;  3TKP A;  4HI7 A;  1BAY A;  1B9Y C;  2QA2 A;  2TRC P;  1M3I A;  1A2L A;  2C3N A;  3EE2 A;  1TI1 A;  4TXV A;  5D9T A;  1MDJ A;  1SEN A;  4TOP A;  2V41 A;  1M2B A;  2R0C A;  5GZZ B;  6GSV A;  2A2S A;  3V1W A;  6GSW A;  2NVL A;  4MMM A;  2TIR A;  5G1L A;  1F6M C;  3L4N A;  1TP9 A;  4I6X A;  1EEJ A;  4EIP A;  4TR3 A;  3KMO A;  1T8E B;  3HZ8 A;  1QQ2 A;  4HU7 A;  2C0E A;  2LQO A;  2A2P A;  5KOX A;  4TVE A;  3M1G A;  2J9H A;  4JR4 A;  4HEA 2;  2RM5 A;  4AF2 A;  2H0I A;  5JCU A;  2OBK A;  5ENU A;  1NSW A;  2YJ7 A;  2PWJ A;  2V6O A;  3A3T A;  4TKY A;  1TRV A;  2H01 A;  1SL1 B;  1NW2 A;  1DUG A;  1TK8 B;  3MDK A;  3LOR A;  4K0N A;  1Z6N A;  1MD4 A;  2VCT A;  4E8E A;  3FR3 A;  2O7K A;  3VI5 A;  3I6A A;  1UC7 A;  2LTK A;  1JZO A;  3QOU A;  4TXO A;  1FG4 A;  2X4A A;  2DSA A;  4K0G A;  5D9W A;  5GAN D;  1PQN A;  3KZQ A;  2PVO C;  1SK0 A;  1XOB A;  1J9B A;  3CTF A;  2D2Z A;  2I81 A;  1QXH A;  4V1A g;  1ZYN A;  2OAD A;  3MWH A;  1V40 A;  2DBC A;  1PRX A;  2L4Q A;  2H1G A;  3TKQ A;  1QUW A;  4LL4 B;  2I9H A;  4A5P A;  1BG5 A;  2HSH A;  3K8N A;  4EVM A;  1BJX A;  4LMV A;  2DMM A;  5CO3 A;  5D93 A;  3GX8 A;  3TJG A;  3UBK A;  3BD2 A;  2H75 A;  2R6K A;  4TR1 B;  2EIR A;  5HR0 A;  3A2W A;  4O7H A;  1Z3E A;  1GSY A;  2X64 A;  4J2F A;  3TUE A;  5IPG A;  2DLX A;  3RHC A;  3GA4 A;  3TJB A;  2PBJ A;  1TK0 B;  2R37 A;  2GT6 A;  4KE3 A;  3FRC A;  2ZCT A;  4IGJ A;  2M72 A;  5AIX A;  2IME A;  3D21 A;  3EIN A;  1KBN A;  2VO4 A;  1MTC A;  5AN1 A;  2GT5 A;  3CRU A;  2HE3 A;  22GS A;  2LJR A;  3ZIJ A;  3UAR A;  2FD3 A;  2X99 A;  5IIZ A;  4EL1 A;  4GRF A;  2C80 A;  3GRX A;  2DKH A;  4D73 A;  2LV3 A;  2YWO A;  2LRT A;  3GKK A;  2M80 A;  3BBY A;  3D0Z A;  2FWF A;  4JU5 A;  3UOM A;  5G5E A;  3IC8 A;  4ECC A;  2E0Q A;  2XHF A;  4XS4 A;  5ID2 A;  5EL8 A;  4Q5F A;  3CTG A;  3GTU B;  1M0U A;  1O8X A;  3F9U A;  4WF5 A;  2IN3 A;  3WT2 A;  4KDY A;  4CW9 A;  2P5R A;  5A4W A;  3KD0 A;  2YCD A;  3EVI A;  1X9S B;  1GSD A;  2CZ2 A;  4MZC A;  1WE0 A;  1AUC A;  1XWA A;  2KP2 A;  2HXK A;  4MJE A;  3FKF A;  4ZBD A;  5ELG A;  3ZL5 A;  3D5J A;  2L6D A;  4ZB9 A;  3UIW A;  2YN1 A;  1N8J A;  1SJI A;  5DAL A;  4MPG A;  3APQ A;  4NWY A;  1FAA A;  4L0W A;  1THX A;  4GQC A;  5AIS A;  1URM A;  1PL1 A;  5IMZ A;  3AY8 A;  2FNO A;  3HZ4 A;  1H75 A;  1YY7 A;  2I4A A;  3L9V A;  4X43 A;  1T00 A;  4K9Z A;  4YQM A;  1TTZ A;  2K18 A;  1ACV A;  1A23 A;  2FUG 2;  4ACS A;  1XFL A;  2WS2 A;  2JZR A;  3TKS C;  3M0F A;  3GKM A;  4EE0 A;  1RW1 A;  2FCH A;  1YDK A;  1XXU A;  3L0H A;  3N9J A;  4MH3 A;  3GIX A;  2VCW A;  2DJ3 A;  2P0G A;  1M99 A;  2O8V B;  5A4U A;  4NAX A;  4NHW A;  4G0I A;  3EU4 A;  3IPZ A;  5EY6 A;  1HNC A;  3CBU A;  3TRP A;  3ZRD A;  1KEB A;  1VF2 A;  1THO A;  2IMF A;  3F4T A;  2KUC A;  5J3R A;  3M8N A;  4PXO A;  2AAW A;  1GSF A;  2MMA A;  1U87 A;  3LXZ A;  2ON5 A;  2ALB A;  5IMC A;  5CYY A;  1Z6M A;  4WR5 A;  2XBI A;  3GX0 A;  3EC3 A;  2GSS A;  2K8V A;  2REM A;  4OFT A;  4TR0 A;  2JSY A;  4WEY A;  1XW5 A;  3VI7 A;  5DJL A;  2OAC A;  1Y6E A;  4FO5 A;  5D9V A;  5D9X A;  20GS A;  1FB0 A;  4IW9 A;  1HNB A;  4GF0 A;  1J0F A;  3Q18 A;  4ML6 A;  3SBC A;  3D22 A;  3UJ1 A;  4GSS A;  1XG8 A;  1PMT A;  1MD3 A;  2HRA A;  2JL4 A;  1A2J A;  5L71 A;  1OKD A;  1GSQ A;  3FZA A;  2MBS A;  2C0D A;  5KOW A;  4ID0 A;  3P7X A;  1G0T A;  3GH6 A;  1SL2 B;  5F05 A;  2E2M A;  4V2N A;  1QMV A;  1YF0 A;  4LA1 A;  3TKS A;  3C7M A;  2C0G A;  3TB2 A;  1GTU A;  2E2G A;  2VOC A;  1GRX A;  1SU9 A;  1OAZ A;  1ML6 A;  5DDL A;  6GSU A;  3DYR A;  5AGY A;  2FGX A;  2ON7 A;  4FYC A;  1M2D A;  3WGD A;  4JED A;  1V9W A;  1BYE A;  3TJJ A;  4K2X A;  5CRE A;  4EKZ A;  4MF5 A;  4EIQ A;  3A5I A;  5D8I A;  4DSS B;  3LG6 A;  1T7P B;  4PUR A;  2G0F A;  4XRA A;  1SD9 A;  1K0B A;  1HNA A;  3I9V 2;  2B7K A;  3UL3 A;  3EUR A;  1V98 A;  1R7H A;  4HZ2 A;  2VM1 A;  1SYR A;  1TU7 A;  1MDK A;  5D96 A;  1K3O A;  4GWR A;  1PX7 A;  4MLY A;  4LMW A;  4GCI A;  4Z7X A;  4LLR A;  2IMD A;  3F3Q A;  2XPD A;  2H1B A;  4KUN A;  4LL1 B;  1JHB A;  2DC5 A;  1BQ7 A;  1M3J A;  2YJH A;  4V1A p;  3H1N A;  5FWG A;  2F8F A;  2CX4 A;  4WF4 A;  4ZL8 A;  3VLN A;  3VPQ A;  3KM6 A;  2PMT A;  4JZQ A;  2CVD A;  4K7N A;  5EVO A;  4KW6 A;  3KH7 A;  2EIO A;  4NMU A;  5KN2 A;  1G6Y A;  5ECM B;  3GHA A;  3FEU A;  1JLV A;  4OFN A;  5JWQ B;  2V32 A;  1MDI A;  3PPU A;  1FO5 A;  1IYH A;  2K9F A;  3ZML A;  3KXO A;  4HOJ A;  4MP4 A;  3US3 A;  4Z2R A;  2DIZ A;  4GLT A;  2IMK A;  3GSS A;  4I97 A;  1K0N A;  6GSY A;  4KCA A;  3GTU A;  3Q6O A;  2XPE A;  4EO3 A;  4EC0 A;  3A5W A;  3KTB A;  1FHE A;  2R4V A;  3E9J B;  3UMA A;  1K0M A;  1LU4 A;  1SJZ A;  2AHE A;  2IMI A;  1SD8 A;  3F6F A;  4F03 A;  2A4V A;  5LCZ A;  3DML A;  1GNW A;  5ECH B;  4KGI A;  17GS A;  3F8U A;  1O6J A;  1JLW A;  3TJF A;  1DE1 A;  3LW9 A;  2X49 A;  3BJ5 A;  1XPV A;  4X1U A;  5E59 A;  2VLV A;  3APS A;  1YQ1 A;  1GUH A;  3DWV A;  1M9A A;  3EWL A;  5A5K A;  1K3Y A;  4IEL A;  4PQI A;  3LSZ A;  2VM2 A;  2H30 A;  1AQV A;  4BL7 A;  1GUM A;  2GLR A;  3D4M A;  3FYG A;  5F07 A;  2B5Y A;  4YKF A;  4AJ7 A;  2WJU A;  3GN3 A;  5FT3 A;  1GH2 A;  1TU8 A;  4O5U A;  4PX1 A;  1I9D A;  2GTU A;  1GTA A;  1OE8 A;  4KDU A;  1WWJ A;  3G9B A;  2MMZ A;  5GAP D;  2O89 A;  5ECQ B;  1R5A A;  3E3E A;  2L59 A;  2A2R A;  4BVY B;  1ZYE A;  4XS6 A;  3VWV A;  2PUK C;  2FHE A;  1SJ6 A;  4OWY A;  3HYP A;  4HJM A;  2X8H A;  3J7Y k;  2AJQ B;  3IXR A;  2GSQ A;  4JBB A;  2DJJ A;  1Z9H A;  5IOW A;  3IOS A;  1YEX A;  3JCM L;  2M46 A;  3LWA A;  2EC4 A;  2P5Q A;  2PPT A;  4G2E A;  2X8G A;  2PVQ A;  11GS A;  2JZT A;  5GSS A;  3ZTL A;  3TCO A;  1ZOF A;  4K7I A;  1GTI A;  1TI3 A;  2PGT A;  2QGV A;  1UA5 A;  5ECN B;  2H66 A;  2CA8 A;  1FOV A;  4IKH A;  2VLT A;  3QAV A;  5J41 A;  2H70 A;  1EGO A;  3BOA A;  1OC3 A;  5HR3 A;  1YEP A;  3VWW A;  3CXG A;  2VL2 C;  4N0Z A;  4RUV A;  3F3R A;  1T4Z A;  1W89 A;  4PNG A;  3SWL A;  1XWK A;  2CVK A;  4EF0 A;  2GVP A;  4KCE A;  3HXS A;  4YKG A;  2GZY A;  1EGR A;  4L5L A;  3ZLP A;  4ZB6 A;  1SKR B;  3R3E A;  2F9S A;  3N5O A;  1QK8 A;  3R2Q A;  4XTS A;  2H71 A;  14GS A;  2VD0 A;  3F4S A;  4DSS A;  2V6K A;  1GP1 A;  3IV4 A;  3C73 A;  5C00 A;  1Q98 A;  1R26 A;  3P2A A;  1V2A A;  2FWH A;  3F4R A;  4Z2T A;  4ZIL A;  1YJ6 A;  5IMF A;  4PTS A;  3ZFL A;  3MSZ A;  1PL2 A;  2LJK A;  1K0C A;  5HR1 A;  1XVW A;  3P90 A;  1EOH A;  1ZZY A;  2WCI A;  4TR4 A;  3QPM A;  3ZVJ A;  4PUA A;  4ZXG A;  4G0K A;  1W4V A;  3VUR A;  4MJB A;  4N11 A;  3EU3 A;  1ILO A;  2FLS A;  1O8W A;  4RQR A;  2R5G A;  4MPF A;  2O85 A;  4XIH A;  3EYT A;  1F37 A;  1X5E A;  3M3M A;  1FVJ A;  1PGT A;  4O5Q A;  3EMP A; 
#chains in the Genus database with same CATH homology
 3IDV A;  1QGV A;  2JSZ A;  3H79 A;  4OD7 A;  3ZZX A;  3QFB C;  4MCU A;  4BPY A;  3LYP A;  1KTE A;  1A0R P;  4N10 A;  2JAD A;  4MZW A;  3OR5 A;  3M9J A;  3HJO A;  4L0U A;  2H72 A;  3HHV A;  2HRN A;  4HQZ A;  5KN3 A;  3UBL A;  3Q74 A;  2IWT A;  5B6M A;  2NDO A;  1JFU A;  2HSM A;  4V2M A;  3RPN A;  5JWO B;  4ZBB A;  4ICY A;  3ZVJ D;  5COH A;  1TRW A;  1R4W A;  5KEJ A;  5ABR A;  2HZE B;  4FYU A;  3VWX A;  5A4V A;  1UN2 A;  4ILF A;  4KAE A;  5ECR B;  1FVK A;  3WGE A;  4ZL9 A;  9GSS A;  3IA1 A;  1E6B A;  1XVQ A;  2LRN A;  2CX3 A;  4GTU A;  19GS A;  4K1F A;  4PGT A;  1K0A A;  1PN0 A;  3L9U A;  1E2Y A;  2DJ2 A;  2R0P A;  1Z7R A;  3QMX A;  1J08 A;  1VF4 A;  2RLI A;  2H1D A;  1VGL A;  3VK9 A;  2VAF A;  2YP6 A;  4WXT A;  2RUF A;  3NZN A;  4KX4 A;  4O92 A;  2RUE A;  4JRR A;  1O7U A;  4IP1 A;  1FW1 A;  3FZ4 A;  1GLP A;  1AXD A;  4F0C A;  2L4C A;  1WMJ A;  4XHM A;  1C72 A;  3FW2 A;  3L78 A;  3A2X A;  16GS A;  4J57 E;  3VWU A;  2H6Z A;  3HA9 A;  2DJ1 A;  1GUL A;  3HJP A;  1ERT A;  2C0F A;  3VPT A;  1WP0 A;  5GST A;  1QFN A;  4MJC A;  4BVY A;  3PGT A;  1KNG A;  3UVH A;  5DCG A;  1XCC A;  2HRF A;  4O5R A;  2VUP A;  2R2J A;  1S3D A;  1SL0 B;  3IRA A;  2HNL A;  1S3C A;  5EPF A;  3C8E A;  3GMF A;  1O81 A;  4ECJ A;  2AV4 A;  5LNK e;  3KJY A;  2QKE A;  3DRN A;  3P8W A;  3UEM A;  1H4O A;  5HFK A;  4J56 E;  4NXI A;  2B1K A;  1YKA A;  3QDN A;  4WR4 A;  4MH2 A;  3H4K A;  2K8S A;  2EIQ A;  1HD2 A;  3IC4 A;  2GZP A;  5DQS A;  1YF1 A;  2ZNM A;  3EPT A;  5ECO B;  3TDG A;  2YZH A;  4IVF A;  3QD9 A;  4G10 A;  4DVC A;  2RII A;  4L8E A;  1G6W A;  1S3A A;  4IS0 A;  5B8A A;  1RQM A;  5ECP B;  4FH8 A;  3GST A;  5G2Z A;  1XW9 A;  4L5O A;  4YQU A;  3RAZ A;  2MMO A;  2V2G A;  4MNN A;  2L5L A;  2VD1 A;  1F3B A;  4TR1 A;  2B6M A;  3GNJ A;  4CY8 A;  1XZO A;  3FHK A;  1XOA A;  1TDI A;  3CYN A;  1DSB A;  1YKC A;  1X0R A;  4GXZ A;  5DBQ A;  5B8B A;  3KIJ A;  1B4P A;  2WRT A;  1ST9 A;  1Q4J A;  1GLQ A;  3LQ7 A;  3QAG A;  2JZS A;  3GH9 A;  3H93 A;  1MEK A;  3GL5 A;  3LGC A;  2QC7 A;  5IMV A;  1SK2 A;  4H86 A;  1PKZ A;  3W8S A;  1B9X C;  5INY A;  1ERV A;  4XS4 B;  5ID2 B;  2PN8 A;  4Z2U A;  4JR6 A;  5G31 A;  2IJY A;  1CQH A;  3TJK A;  4WET A;  3J7Y b;  2NBS A;  2YWN A;  3LEF A;  1USB A;  5HQP A;  2DIY A;  2V1M A;  2LRC A;  2YV7 A;  5H5Q A;  2FWG A;  3HKR A;  4YAV A;  2F8A A;  1M9B A;  2FA8 A;  4DEJ A;  4I5Q A;  1AIU A;  1SKS B;  2YV9 A;  2LQQ A;  3DEX A;  3KGK A;  1EZK A;  1T1V A;  3GV1 A;  1PKW A;  2O87 A;  4P3Y B;  1TW9 A;  5DAL B;  1AW9 A;  1OC9 A;  1B48 A;  2YPM A;  1XW6 A;  2X8C A;  1ON4 A;  3ZIT A;  4RI7 A;  5HFG A;  2HRK A;  2LS5 A;  1EV4 A;  2H19 A;  5F0G A;  2CZ3 A;  3Q19 A;  1K0O A;  2DKI A;  2QA1 A;  4G19 A;  5DCH A;  5H5R A;  2BMX A;  4MA9 A;  1FB6 A;  1OVN A;  3TGZ A;  4IBP A;  3NOF A;  1DE2 A;  1V58 A;  1ZMA A;  4BVX B;  3GL3 A;  2R0G A;  3U5R E;  3LXT A;  4K5R A;  3A2V A;  5IMD A;  4F82 A;  2XBQ A;  2Z9S A;  2GST A;  5KN0 A;  3EMX A;  5C04 A;  3QCP A;  3O3T A;  5IO2 A;  1X5D A;  18GS A;  5E4W A;  2MMN A;  4ZIJ A;  3GUR A;  5IOX A;  2OE0 A;  4IHU A;  2DJ0 A;  2F51 A;  4OCE A;  4GQF A;  4FQU A;  5F8B A;  1WPI A;  3TKS E;  3UVT A;  2C3T A;  3ME8 A;  2GZZ A;  2H6Y A;  2LNT A;  1F3A A;  3CRT A;  2H76 A;  4PNF A;  2TRX A;  4ECB A;  1F9M A;  1LJR A;  1G7O A;  1GNE A;  3KP8 A;  3RHB A;  2G2Q A;  4ECI A;  4KND A;  1V57 A;  3BCI A;  5J4U A;  5IM9 A;  3FZ9 A;  2BJX A;  3U6V A;  4YH2 A;  4OO4 A;  4F9Z A;  2OKA A;  1ZL9 A;  2LJA A;  4CDO A;  1ZYQ B;  3KH9 A;  4GSN A;  4KSM A;  1WJK A;  1A8L A;  5BMU A;  5DAK B;  2CQ9 A;  5JCG A;  3IAS 2;  4KF9 A;  4K5S A;  1GSU A;  5IPH A;  1ERW A;  2BTO T;  1WRY A;  4N0V A;  4CY6 A;  2OJL A;  6GST A;  1IYI A;  2I1U A;  4K8M A;  4POL A;  4BA7 A;  4FIW A;  4IQA A;  3GYK A;  2KLX A;  3L9S A;  1OKT A;  4KA0 A;  4NHZ A;  3MIX A;  4HJ2 A;  2B5X A;  2OA7 A;  4POK A;  2YWM A;  2FA4 A;  4YQV A;  4X4J A;  3H8Q A;  4OCF A;  3VFI A;  3HVX A;  3RBT A;  4X0X A;  1PA3 A;  3KMN A;  3TKR A;  3GUS A;  4G9H A;  2P31 A;  1XWB A;  2L6C A;  2LST A;  3HCZ A;  4QQ7 A;  2ES7 A;  4IJI A;  3C71 A;  1M2A A;  1JZD A;  2FY6 A;  3F0I A;  2AUV A;  3KP9 A;  4NV5 A;  3FZ5 A;  3ZRE A;  1AQX A;  4ZB8 A;  1YZX A;  4WBR D;  2FWE A;  1NHO A;  4OO5 A;  1Y25 A;  1I5G A;  2NPB A;  1EWX A;  1OE7 A;  1BED A;  3QFA C;  1SKW B;  4MF7 A;  3IAM 2;  2AYT A;  3C1S A;  3D6I A;  1FOH A;  5AIV A;  4IQ1 A;  4IJ3 A;  3O6T A;  3IHG A;  2HLS A;  2QSI A;  2VCQ A;  3G7I A;  2CAI A;  4POM A;  4ZBA A;  1TKD B;  4WBJ A;  3IK9 A;  4K6X A;  4MF6 A;  3HDC A;  3FK8 A;  3IK7 A;  2IL3 A;  3MAK A;  1NHY A;  1Z7P A;  3ZYW A;  2H6X A;  5JWR B;  3PIN A;  3ZIV A;  1GUK A;  1K0D A;  5CRG A;  5LD0 A;  5CRD A;  4WKW A;  5G5F A;  4EDY A;  1OC8 A;  1HYU A;  1OYJ A;  4EUY A;  3TRQ A;  4AJ6 A;  1TRS A;  3MNG A;  5IMA A;  2GQL A;  2XC2 A;  4BWS A;  1Z5Y E;  4USS A;  1EEM A;  2WZ9 A;  4KSO A;  2A4H A;  4N30 A;  1F2E A;  5CRH A;  4I2U A;  1VF1 A;  5ECK B;  3CSI A;  5D73 A;  4OMV A;  3BCK A;  3ERG A;  3M9K A;  3HVS A;  1VF3 A;  4I2T A;  4XRD A;  1NM3 A;  2VL2 A;  5H5S A;  1TXX A;  2VLU A;  4MAB A;  3LYK A;  2WFC A;  1TRU A;  3RPP A;  1A0F A;  3KTL A;  5CP1 A;  7GSS A;  3DVX A;  2C4J A;  2VCX A;  2HYX A;  4MJA A;  5DQY A;  4Q5N A;  2OBI A;  2IFQ B;  4KH7 A;  8GSS A;  4XCS A;  1U3A A;  4EXJ A;  2HT9 A;  5ELA A;  5FHI A;  1EP7 A;  3QR6 A;  1VRS D;  4PUF C;  2YZU A;  3WYW A;  1AQW A;  4KB3 A;  4RQX A;  4POB A;  2H73 A;  3HVV A;  1ZYP A;  3GFK A;  5HFI A;  2YAN A;  3HJM A;  5J9B A;  1SYX A;  2B3S A;  5CAX A;  3LFL A;  1PSQ A;  1XWC A;  3DGQ A;  4BL7 B;  4AGS A;  3DIE A;  2H8L A;  2JU5 A;  4K7O A;  5DVB A;  4RI6 A;  3HD5 A;  4TN8 A;  3DKS A;  3WGX A;  3W6G A;  2GS3 A;  4BVX A;  2F3M A;  3TOT A;  2L57 A;  4XS1 A;  2N5F A;  3DVW A;  1K3L A;  2HFD A;  2CV4 A;  4AJ8 A;  1GWC A;  4NPB A;  2WUL A;  1JZW A;  4PQ1 A;  2UZ8 A;  1AAZ A;  4KDX A;  4Q5Q A;  5ECS A;  2RM6 A;  2B5E A;  3IHQ A;  4JE1 A;  1B8X A;  4FYB A;  3WD6 A;  4DSR A;  1T3B A;  2GSR A;  2VL9 A;  3S9F A;  1AC1 A;  2WGR A;  4Q5R A;  2MYG A;  5B6N A;  2VL3 A;  2YOI A;  3PR8 A;  1SK1 A;  2N5A A;  2NTO A;  3D4T A;  5DAK A;  3FR9 A;  5KN1 A;  3IBH A;  4NV2 A;  2N5B A;  1GL8 A;  5J9C A;  4TXO B;  2KOK A;  3ISO A;  10GS A;  2GQM A;  1A2M A;  2YNX A;  3ERF A;  2HSY A;  3WT1 A;  1HQO A;  3CSJ A;  2PER A;  3FR6 A;  5DJM A;  3TRX A;  4HZ4 A;  4HDE A;  2DJK A;  5B7C A;  2R3X A;  2CAQ A;  2J23 A;  3C1R A;  2HI7 A;  1TK5 B;  3KCM A;  5ECL B;  2L5O A;  1CQG A;  1XWG A;  4YAP A;  3GKN A;  1U3I A;  13GS A;  1ZGN A;  6GSS A;  3ED3 A;  3FMW A;  2IIY A;  1M7T A;  2B7J A;  1N2A A;  2KHP A;  4O32 A;  1BX9 A;  4MDC A;  2E7P A;  2VCZ A;  1XIY A;  1ABA A;  1GSE A;  2OE1 A;  4E8H A;  3O76 A;  1RK4 A;  3HY2 A;  3DD3 A;  3F6D A;  3E0U A;  2H74 A;  3DXB A;  4HU9 A;  3ZMK A;  2LUS A;  2AB6 A;  2HZF A;  2VCV A;  3FY7 A;  3ZFB A;  1X5C A;  2WB9 A;  3APO A;  1PD2 1;  4DSQ A;  1U6T A;  2B1L A;  4D73 B;  1A24 A;  1X9W B;  2K6V A;  4HS1 A;  4I8B A;  4IN0 A;  4TRX A;  4PQH A;  4G0L A;  3I43 A;  1G7E A;  2C8U A;  4ISD A;  3W8J A;  2KP1 A;  1WIK A;  2ZUP A;  3RDW A;  3F63 A;  1UVZ A;  5G1K A;  3G7J A;  3GKX A;  3UAP A;  3KEB A;  4GST A;  3MYD A;  4F2I A;  6GSX A;  1ZCP A;  4MZB A;  4F0B A;  5CNW A;  5JCW A;  2IPA A;  3LJR A;  4ML1 A;  2LNS A;  2GGT A;  5IO0 A;  3CSH A;  1EP8 A;  3G7Y A;  3I69 A;  3TOU A;  2H1A A;  1EV9 A;  4ZL7 A;  3CMI A;  4K2D A;  3NIV A;  2YWI A;  5F06 A;  2C1Y A;  5J5N A;  1T4Y A;  1LBK A;  1A8Y A;  1PN9 A;  4ULX A;  1R5P A;  1WOU A;  2JAC A;  1GTB A;  2I3Y A;  3QAW A;  4QL7 A;  1X9M B;  1ERU A;  1U88 A;  2CT6 A;  2WDU A;  1JZR A;  4IP6 A;  5BRT A;  1O73 A;  2IFQ A;  3IR4 A;  2H0G A;  5CRW A;  1EOG A;  4CHS A;  2PU9 C;  2GQK A;  1DBY A;  3ME7 A;  1OC9 B;  4TW5 A;  3ERW A;  2CVB A;  2HZE A;  3IE3 A;  4OFM A;  4HUA A;  1XBS A;  1PX6 A;  2H0H A;  1GSS A;  2MZC A;  2LKU A;  4MK3 A;  4HQS A;  1B4Q A;  2OE3 A;  4QL9 A;  2MBT A;  5G30 A;  12GS A;  4BWQ A;  4EDZ A;  2GDR A;  1TJD A;  1TOF A;  2LEG A;  4V2L A;  2DML A;  3PH9 A;  5ECI B;  2C3Q A;  1O85 A;  5IQY A;  2VIM A;  5HR2 A;  3TKP A;  4HI7 A;  1BAY A;  1B9Y C;  2QA2 A;  2TRC P;  1A2L A;  2C3N A;  3EE2 A;  1TI1 A;  4TXV A;  5D9T A;  1MDJ A;  1SEN A;  4TOP A;  2V41 A;  1M2B A;  2R0C A;  5GZZ B;  6GSV A;  2A2S A;  3V1W A;  6GSW A;  2NVL A;  4MMM A;  2TIR A;  5G1L A;  1F6M C;  3L4N A;  1TP9 A;  4I6X A;  1EEJ A;  4EIP A;  4TR3 A;  3KMO A;  1T8E B;  3HZ8 A;  1QQ2 A;  4HU7 A;  2C0E A;  2LQO A;  2A2P A;  5KOX A;  4TVE A;  3M1G A;  2J9H A;  4JR4 A;  4HEA 2;  2RM5 A;  4AF2 A;  2H0I A;  5JCU A;  2OBK A;  5ENU A;  1NSW A;  2YJ7 A;  2PWJ A;  2V6O A;  3A3T A;  4TKY A;  1TRV A;  2H01 A;  1SL1 B;  1NW2 A;  1DUG A;  1TK8 B;  3MDK A;  3LOR A;  4K0N A;  1Z6N A;  1MD4 A;  2VCT A;  4E8E A;  3FR3 A;  2O7K A;  3VI5 A;  3I6A A;  1UC7 A;  2LTK A;  1JZO A;  3QOU A;  4TXO A;  1FG4 A;  2X4A A;  2DSA A;  4K0G A;  5D9W A;  5GAN D;  1PQN A;  3KZQ A;  2PVO C;  1SK0 A;  1XOB A;  1J9B A;  3CTF A;  2D2Z A;  2I81 A;  1QXH A;  4V1A g;  1ZYN A;  2OAD A;  3MWH A;  1V40 A;  2DBC A;  1PRX A;  2L4Q A;  2H1G A;  3TKQ A;  1QUW A;  4LL4 B;  2I9H A;  4A5P A;  1BG5 A;  2HSH A;  3K8N A;  4EVM A;  1BJX A;  4LMV A;  2DMM A;  5CO3 A;  5D93 A;  3GX8 A;  3TJG A;  3UBK A;  3BD2 A;  2H75 A;  2R6K A;  4TR1 B;  2EIR A;  5HR0 A;  3A2W A;  4O7H A;  1Z3E A;  1GSY A;  2X64 A;  4J2F A;  3TUE A;  5IPG A;  2DLX A;  3RHC A;  3GA4 A;  3TJB A;  2PBJ A;  1TK0 B;  2R37 A;  2GT6 A;  4KE3 A;  3FRC A;  2ZCT A;  4IGJ A;  2M72 A;  5AIX A;  2IME A;  3D21 A;  3EIN A;  1KBN A;  2VO4 A;  1MTC A;  5AN1 A;  2GT5 A;  3CRU A;  2HE3 A;  22GS A;  2LJR A;  3ZIJ A;  3UAR A;  2FD3 A;  2X99 A;  5IIZ A;  4EL1 A;  4GRF A;  2C80 A;  3GRX A;  2DKH A;  4D73 A;  2LV3 A;  2YWO A;  2LRT A;  3GKK A;  2M80 A;  3BBY A;  3D0Z A;  2FWF A;  4JU5 A;  3UOM A;  5G5E A;  3IC8 A;  4ECC A;  2E0Q A;  2XHF A;  4XS4 A;  5ID2 A;  5EL8 A;  4Q5F A;  3CTG A;  3GTU B;  1M0U A;  1O8X A;  3F9U A;  4WF5 A;  2IN3 A;  3WT2 A;  4KDY A;  4CW9 A;  2P5R A;  5A4W A;  3KD0 A;  2YCD A;  3EVI A;  1X9S B;  1GSD A;  2CZ2 A;  4MZC A;  1WE0 A;  1AUC A;  1XWA A;  2KP2 A;  2HXK A;  4MJE A;  3FKF A;  4ZBD A;  5ELG A;  3ZL5 A;  3D5J A;  2L6D A;  4ZB9 A;  3UIW A;  2YN1 A;  1N8J A;  1SJI A;  5DAL A;  4MPG A;  3APQ A;  4NWY A;  1FAA A;  4L0W A;  1THX A;  4GQC A;  5AIS A;  1URM A;  1PL1 A;  5IMZ A;  3AY8 A;  2FNO A;  3HZ4 A;  1H75 A;  1YY7 A;  2I4A A;  3L9V A;  4X43 A;  1T00 A;  4K9Z A;  4YQM A;  1TTZ A;  2K18 A;  1ACV A;  1A23 A;  2FUG 2;  4ACS A;  1XFL A;  2WS2 A;  2JZR A;  3TKS C;  3M0F A;  3GKM A;  4EE0 A;  1RW1 A;  2FCH A;  1YDK A;  1XXU A;  3L0H A;  3N9J A;  4MH3 A;  3GIX A;  2VCW A;  2DJ3 A;  2P0G A;  1M99 A;  2O8V B;  5A4U A;  4NAX A;  4NHW A;  4G0I A;  3EU4 A;  3IPZ A;  5EY6 A;  1HNC A;  3CBU A;  3TRP A;  3ZRD A;  1KEB A;  1VF2 A;  1THO A;  2IMF A;  3F4T A;  2KUC A;  5J3R A;  3M8N A;  4PXO A;  2AAW A;  1GSF A;  2MMA A;  1U87 A;  3LXZ A;  2ON5 A;  2ALB A;  5IMC A;  5CYY A;  1Z6M A;  4WR5 A;  2XBI A;  3GX0 A;  3EC3 A;  2GSS A;  2K8V A;  2REM A;  4OFT A;  4TR0 A;  2JSY A;  4WEY A;  1XW5 A;  3VI7 A;  5DJL A;  2OAC A;  1Y6E A;  4FO5 A;  5D9V A;  5D9X A;  20GS A;  1FB0 A;  4IW9 A;  1HNB A;  4GF0 A;  1J0F A;  3Q18 A;  4ML6 A;  3SBC A;  3D22 A;  3UJ1 A;  4GSS A;  1PMT A;  1MD3 A;  2HRA A;  2JL4 A;  1A2J A;  5L71 A;  1OKD A;  1GSQ A;  3FZA A;  2MBS A;  2C0D A;  5KOW A;  4ID0 A;  3P7X A;  1G0T A;  3GH6 A;  1SL2 B;  5F05 A;  2E2M A;  4V2N A;  1QMV A;  1YF0 A;  4LA1 A;  3TKS A;  3C7M A;  2C0G A;  3TB2 A;  1GTU A;  2E2G A;  2VOC A;  1GRX A;  1SU9 A;  1OAZ A;  1ML6 A;  5DDL A;  6GSU A;  3DYR A;  5AGY A;  2FGX A;  2ON7 A;  4FYC A;  1M2D A;  3WGD A;  4JED A;  1V9W A;  1BYE A;  3TJJ A;  4K2X A;  5CRE A;  4EKZ A;  4MF5 A;  4EIQ A;  3A5I A;  5D8I A;  4DSS B;  3LG6 A;  1T7P B;  4PUR A;  2G0F A;  4XRA A;  1SD9 A;  1K0B A;  1HNA A;  3I9V 2;  2B7K A;  3UL3 A;  3EUR A;  1V98 A;  1R7H A;  4HZ2 A;  2VM1 A;  1SYR A;  1TU7 A;  1MDK A;  5D96 A;  1K3O A;  4GWR A;  1PX7 A;  4MLY A;  4LMW A;  4GCI A;  4Z7X A;  4LLR A;  2IMD A;  3F3Q A;  2XPD A;  2H1B A;  4KUN A;  4LL1 B;  1JHB A;  2DC5 A;  1BQ7 A;  2YJH A;  4V1A p;  3H1N A;  5FWG A;  2F8F A;  2CX4 A;  4WF4 A;  4ZL8 A;  3VLN A;  3VPQ A;  3KM6 A;  2PMT A;  4JZQ A;  2CVD A;  4K7N A;  5EVO A;  4KW6 A;  3KH7 A;  2EIO A;  4NMU A;  5KN2 A;  1G6Y A;  5ECM B;  3GHA A;  3FEU A;  1JLV A;  4OFN A;  5JWQ B;  2V32 A;  1MDI A;  3PPU A;  1FO5 A;  1IYH A;  2K9F A;  3ZML A;  3KXO A;  4HOJ A;  4MP4 A;  3US3 A;  4Z2R A;  2DIZ A;  4GLT A;  2IMK A;  3GSS A;  4I97 A;  1K0N A;  6GSY A;  4KCA A;  3GTU A;  3Q6O A;  2XPE A;  4EO3 A;  4EC0 A;  3A5W A;  3KTB A;  1FHE A;  2R4V A;  3E9J B;  3UMA A;  1K0M A;  1LU4 A;  1SJZ A;  2AHE A;  2IMI A;  1SD8 A;  3F6F A;  4F03 A;  2A4V A;  5LCZ A;  3DML A;  1GNW A;  5ECH B;  4KGI A;  17GS A;  3F8U A;  1O6J A;  1JLW A;  3TJF A;  1DE1 A;  3LW9 A;  2X49 A;  3BJ5 A;  1XPV A;  4X1U A;  5E59 A;  2VLV A;  3APS A;  1YQ1 A;  1GUH A;  3DWV A;  1M9A A;  3EWL A;  5A5K A;  1K3Y A;  4IEL A;  4PQI A;  3LSZ A;  2VM2 A;  2H30 A;  1AQV A;  4BL7 A;  1GUM A;  2GLR A;  3D4M A;  3FYG A;  5F07 A;  2B5Y A;  4YKF A;  4AJ7 A;  2WJU A;  3GN3 A;  5FT3 A;  1GH2 A;  1TU8 A;  4O5U A;  4PX1 A;  1I9D A;  2GTU A;  1GTA A;  1OE8 A;  4KDU A;  1WWJ A;  3G9B A;  2MMZ A;  5GAP D;  2O89 A;  5ECQ B;  1R5A A;  3E3E A;  2L59 A;  2A2R A;  4BVY B;  1ZYE A;  4XS6 A;  3VWV A;  2PUK C;  2FHE A;  1SJ6 A;  4OWY A;  3HYP A;  4HJM A;  2X8H A;  3J7Y k;  2AJQ B;  3IXR A;  2GSQ A;  4JBB A;  2DJJ A;  1Z9H A;  5IOW A;  3IOS A;  1YEX A;  3JCM L;  2M46 A;  3LWA A;  2EC4 A;  2P5Q A;  2PPT A;  4G2E A;  2X8G A;  2PVQ A;  11GS A;  2JZT A;  5GSS A;  3ZTL A;  3TCO A;  1ZOF A;  4K7I A;  1GTI A;  1TI3 A;  2PGT A;  2QGV A;  1UA5 A;  5ECN B;  2H66 A;  2CA8 A;  1FOV A;  4IKH A;  2VLT A;  3QAV A;  5J41 A;  2H70 A;  1EGO A;  3BOA A;  1OC3 A;  5HR3 A;  1YEP A;  3VWW A;  3CXG A;  2VL2 C;  4N0Z A;  4RUV A;  3F3R A;  1T4Z A;  1W89 A;  4PNG A;  3SWL A;  1XWK A;  2CVK A;  4EF0 A;  2GVP A;  4KCE A;  3HXS A;  4YKG A;  2GZY A;  1EGR A;  4L5L A;  3ZLP A;  4ZB6 A;  1SKR B;  3R3E A;  2F9S A;  3N5O A;  1QK8 A;  3R2Q A;  4XTS A;  2H71 A;  14GS A;  2VD0 A;  3F4S A;  4DSS A;  2V6K A;  1GP1 A;  3IV4 A;  3C73 A;  5C00 A;  1Q98 A;  1R26 A;  3P2A A;  1V2A A;  2FWH A;  3F4R A;  4Z2T A;  4ZIL A;  1YJ6 A;  5IMF A;  4PTS A;  3ZFL A;  3MSZ A;  1PL2 A;  2LJK A;  1K0C A;  5HR1 A;  1XVW A;  3P90 A;  1EOH A;  1ZZY A;  2WCI A;  4TR4 A;  3QPM A;  3ZVJ A;  4PUA A;  4ZXG A;  4G0K A;  1W4V A;  3VUR A;  4MJB A;  4N11 A;  3EU3 A;  1ILO A;  2FLS A;  1O8W A;  4RQR A;  2R5G A;  4MPF A;  2O85 A;  4XIH A;  3EYT A;  1F37 A;  1X5E A;  3M3M A;  1FVJ A;  1PGT A;  4O5Q A;  3EMP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...