1AUCA

Human thioredoxin (oxidized with diamide)
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
105
structure length
105
Chain Sequence
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords THIOREDOXIN
publication title Human thioredoxin homodimers: regulation by pH, role of aspartate 60, and crystal structure of the aspartate 60 --> asparagine mutant.
pubmed doi rcsb
total genus 36
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 1997-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1aucA00
1U6TA 2DJ0A 3VI5A 3Q6OA 3EE2A 3WT1A 5JWOB 3ZIJA 3RAZA 1AAZA 3HCZA 2HSYA 3UIWA 1FVJA 1PX6A 22GSA 2WGRA 3EC3A 3WGDA 2LJRA 3TOUA 2ZUPA 4GQFA 4MZBA 1TOFA 5IQYA 1Z7PA 4ZBDA 1N2AA 1M2AA 2FA4A 1TW9A 1YY7A 3GH6A 1S3AA 1TRUA 2V41A 2D2ZA 3H79A 3L9VA 1XWKA 3IBHA 1YEXA 5G5EA 1K0DA 5CRGA 3E3EA 3GURA 5HR2A 3MSZA 3F4SA 3ZVJD 2FWGA 1UC7A 1KNGA 3ISOA 4MMMA 2EIRA 3GIXA 2R5GA 4JR4A 2XHFA 3D6IA 3HZ4A 4OD7A 3TKSC 1PD21 2L6CA 2VD1A 5ECKB 2H01A 1BG5A 5DAKB 2EIOA 1FB6A 1TTZA 4HZ4A 1QMVA 1EOHA 5IPGA 4Z7XA 1PMTA 2IMIA 2R4VA 1O7UA 1ERVA 2VM1A 3HKRA 2O8VB 3GSSA 4FYCA 2FGXA 1V40A 2LQOA 4J57E 1PN9A 2ES7A 4NV5A 5H5RA 2DJJA 3GKXA 3GMFA 5ID2B 4HDEA 4ULXA 2L5OA 5J5NA 2KP1A 3P2AA 2FY6A 1PGTA 5B8AA 5IO0A 1ML6A 1GWCA 3HA9A 3KH7A 4QQ7A 2WDUA 3UVHA 5IO2A 1W89A 4AJ7A 2JZSA 2F3MA 4KH7A 2OA7A 2PBJA 4EDZA 2H1DA 1SYXA 5ELAA 1I5GA 3KTBA 2LNTA 2IL3A 4V1Ag 1ABAA 1OC9B 3CRUA 2RUFA 5AIXA 4OCFA 3IK7A 1EEMA 3F9UA 2AHEA 1MTCA 4YAVA 4NPBA 5D9TA 3LYPA 1SK0A 6GSVA 4V2MA 3GSTA 2K8VA 3J7Yb 2LRTA 5D9WA 2X8CA 4ML6A 1OKTA 3TGZA 1JLWA 4G10A 3F6FA 3KP9A 4KA0A 4IW9A 2O87A 4IJ3A 4WEYA 4PQ1A 4F03A 4V2NA 1YF1A 2KP2A 2CX4A 1XW5A 3VLNA 2PU9C 4POLA 1SK2A 2IPAA 5D73A 4F9ZA 2JSZA 4NV2A 5G1LA 3TKRA 3GN3A 2KHPA 5CRWA 5EPFA 2H74A 5AIVA 3L9SA 4BWQA 2M80A 3P8WA 3SWLA 5GSSA 3FR6A 4GQCA 3EU3A 4XS4B 1JZOA 1F6MC 3ME7A 5B6NA 3A2XA 1T4ZA 4MJCA 4AJ8A 4DSSA 3F3QA 1KEBA 1TXXA 4FIWA 2GSTA 2PERA 3QFBC 5ECHB 5IIZA 5DQSA 4ZBAA 2H6ZA 3IK9A 3I9V2 4EVMA 3FKFA 3GX0A 1LJRA 1TDIA 2LRNA 11GSA 3GHAA 2GS3A 2PMTA 3GH9A 4WF5A 2FWFA 4OWYA 2GLRA 2ZCTA 4MF5A 1DSBA 2DMLA 2GGTA 5DDLA 2CA8A 6GSWA 4RQRA 4TR3A 5D8IA 3QFAC 1TK5B 4GTUA 5A4VA 3GUSA 2WULA 3GL3A 4WF4A 3GV1A 3GX8A 1U3AA 2PGTA 2YV9A 2DC5A 3UMAA 1WOUA 5A4UA 4X0XA 4HZ2A 4ID0A 4Q5RA 1TU7A 2BJXA 5AN1A 1GUHA 4E8EA 3TJJA 3D21A 1VF4A 1GUMA 1T3BA 2YJHA 2YANA 1MD3A 4KDUA 5ECNB 5HFGA 2O7KA 4IVFA 2GZYA 1K3OA 4PNFA 3EURA 4XS6A 3QR6A 1QGVA 4JBBA 4POKA 4PURA 2HNLA 2WS2A 4GRFA 3TDGA 3GTUB 3M9KA 5LCZA 4L0UA 1GTUA 1I9DA 1FHEA 1CQHA 1K0AA 19GSA 4NAXA 4TR4A 2VL2A 1QUWA 1RQMA 2M72A 2P0GA 3D0ZA 1GUKA 2XBQA 4FO5A 5B6MA 2TRCP 1OC3A 9GSSA 4GCIA 4KB3A 2B7JA 3DGQA 1Y25A 3TB2A 1EV4A 4KCAA 5DAKA 4BWSA 1S3CA 1T7PB 1TI1A 4Q5QA 1OKDA 1Z5YE 4IN0A 5INYA 2MMZA 3DWVA 3LXZA 4JRRA 2C3NA 2YZUA 2C3TA 2L57A 3BJ5A 2XPDA 3C1SA 3F63A 2O89A 3P7XA 4ACSA 1HNAA 1WRYA 1HYUA 2RLIA 2X64A 5ID2A 1BQ7A 3DD3A 5IPHA 2VL9A 2WFCA 2J23A 3G7IA 1MDKA 5D96A 3LXTA 2HXKA 5KN3A 2JL4A 1B48A 3A2WA 3FYGA 3LYKA 3QAVA 1DBYA 4KGIA 2VD0A 3M1GA 4GSSA 4HJMA 4BA7A 1WIKA 4FYBA 3ZLPA 2VCXA 3GKMA 5EVOA 1AIUA 5ELGA 4Q5NA 4OMVA 3TRXA 1OC9A 4ILFA 5DJLA 2VAFA 4TXVA 4MPFA 3US3A 5AISA 2A4VA 2HLSA 5H5QA 2DIYA 1ZCPA 4K7IA 2B5YA 3DRNA 2YWOA 4V1Ap 2DJ1A 2H1BA 2VCTA 4ECBA 4F2IA 2V32A 3U6VA 4GXZA 2YP6A 1ACVA 5LNKe 3FZ9A 4ZL7A 4K0GA 3TKSA 5A4WA 4MK3A 2YNXA 3CSIA 2IMKA 4HUAA 4KUNA 5HQPA 4RUVA 1M0UA 1X5DA 3ZZXA 3D4TA 5J3RA 1PL2A 3NOFA 4K2DA 2N5BA 2VLTA 4KE3A 2OE1A 2FNOA 3L78A 2DIZA 1USBA 1T00A 1OYJA 4GSTA 4WETA 2CAIA 5KN0A 3WYWA 1B4PA 3FEUA 4MF7A 1M7TA 2PUKC 1H4OA 4KSOA 3UARA 1WMJA 5J9CA 2H1GA 1XW6A 2X8HA 3CRTA 4L0WA 2GT5A 1OE7A 2L5LA 3TKSE 1O81A 3R2QA 1SJIA 4XS4A 4FYUA 3KIJA 3VURA 2JU5A 3GKNA 1ZMAA 3RHBA 1KTEA 3W8JA 3M9JA 3FY7A 4ZB9A 3BD2A 4LMWA 1VF3A 3KGKA 1O85A 2YN1A 3U5RE 1DUGA 3DYRA 3VFIA 2DSAA 4ECJA 3FHKA 1W4VA 4K9ZA 1XVWA 3UL3A 2I81A 18GSA 2PVQA 3HVVA 2E0QA 3KJYA 4TKYA 4L5LA 3LFLA 4KDYA 4KCEA 4QL7A 3H93A 4TW5A 4J56E 1C72A 4TXOB 2OJLA 4TVEA 5GAPD 1URMA 4BVYA 2IMFA 4XTSA 3D5JA 1TU8A 3QMXA 10GSA 3HY2A 4TR1B 1TKDB 3P90A 3TCOA 5GAND 3OR5A 3IAM2 4LA1A 2HRNA 2IWTA 1YEPA 3IRAA 3C71A 3KMOA 3QD9A 4LL4B 4KDXA 5IMCA 4IJIA 3GTUA 3GL5A 1JZRA 4PQIA 4NWYA 4JU5A 1YKCA 2Z9SA 4K7NA 4N0VA 5L71A 1XBSA 3CSHA 3ZMKA 1OVNA 2WCIA 3LG6A 5JCUA 2H0HA 3BCKA 4ISDA 3FW2A 5KEJA 1T4YA 2EC4A 1AC1A 1AQWA 2DJ3A 2RM6A 1GTIA 3QAWA 1O8XA 2FWEA 2OKAA 3O3TA 1M2BA 2GSRA 4XHMA 6GSXA 1JFUA 1A2JA 2LTKA 5HR0A 4MH3A 1PX7A 1NHOA 6GSUA 1JHBA 1DE1A 3ZYWA 4DEJA 3IOSA 1V58A 1GLQA 2MMOA 4JZQA 3ZIVA 1XIYA 2EIQA 1JLVA 2JZTA 1GH2A 3IC4A 4I2UA 4P3YB 3LSZA 1RW1A 2B3SA 5J4UA 3APOA 1JZDA 2CAQA 1EEJA 3DIEA 1T1VA 1XPVA 3M0FA 2AB6A 4DSQA 3RDWA 4OFTA 2FUG2 4AGSA 1TJDA 2B7KA 2IMDA 1XW9A 3VPQA 4I5QA 1YJ6A 3F3RA 4MP4A 2LJKA 2H30A 3G7JA 1R4WA 5CREA 5ENUA 1ZYEA 4NXIA 5ECIB 2JSYA 4KW6A 3WT2A 2VL3A 1Z7RA 3HZ8A 3UBKA 4TN8A 2F9SA 1DE2A 2B1LA 2JZRA 1N8JA 4IELA 4GLTA 2HRFA 3MDKA 4EO3A 1EP8A 1G6YA 2P31A 3W6GA 3UBLA 1MEKA 5C00A 3EYTA 1YKAA 4XS1A 3VWXA 4ECIA 1MD4A 1O73A 1R26A 1H75A 2ZNMA 4JE1A 2I4AA 2LNSA 3QCPA 4IP1A 2AYTA 1VF1A 1XCCA 4MH2A 2R2JA 4IQ1A 4KAEA 1ILOA 2E2MA 4G19A 3GKKA 3DXBA 4IS0A 1GSQA 1BX9A 2IMEA 4ZL8A 1BEDA 1GSDA 3D22A 1MDIA 2WZ9A 1SL1B 1M9BA 2C0FA 2OE3A 4EC0A 5ECRB 5J9BA 4WBJA 1Z6NA 3MWHA 3TJGA 4YQUA 2L4QA 4IQAA 5IMAA 2K9FA 2JADA 5ECQB 5JWQB 2V1MA 2QSIA 4OO5A 3TJBA 3KCMA 2VM2A 2FCHA 3C8EA 1B4QA 5ECPB 2OBKA 1E6BA 4IGJA 4PUFC 5IOWA 1OE8A 3DVWA 1KBNA 2H0GA 3L4NA 2CX3A 5CO3A 5IMZA 4PUAA 4HI7A 2LRCA 2CT6A 2YOIA 2K6VA 1SD8A 4PNGA 3KMNA 2LSTA 3EWLA 2LV3A 1Y6EA 3IDVA 4ML1A 2IJYA 2H8LA 3ZTLA 3F0IA 2VCZA 1SKSB 2GZPA 5HFKA 4TXOA 2CVBA 2YCDA 3DKSA 5ECSA 1SJZA 3LQ7A 2VLUA 1ZYQB 2CZ2A 4TR1A 1X0RA 3KP8A 1F2EA 3M8NA 3ZRDA 5DALB 5IMVA 4F0CA 1MDJA 1ZOFA 3GFKA 3N9JA 3UVTA 3V1WA 3C7MA 4MJBA 4QL9A 4H86A 4RI6A 5COHA 1A8LA 3TKQA 5DBQA 1ERUA 1ZL9A 1XWGA 1K0CA 1SKRB 3FK8A 1X5EA 3IA1A 4ZBBA 2C3QA 2FLSA 3UJ1A 3FZ4A 3LWAA 2BMXA 4CW9A 2CZ3A 1FW1A 2MMNA 3VK9A 3M3MA 3FRCA 3IR4A 3L0HA 5KN1A 1WPIA 1S3DA 5F06A 1NSWA 1X9WB 3KEBA 1TI3A 2YWMA 4IBPA 3HD5A 1YQ1A 5G30A 3A2VA 2FHEA 4GF0A 4MABA 3TRPA 4MF6A 5G2ZA 4XRDA 1ZZYA 2X99A 1XWBA 3I69A 3DMLA 5ECMB 3APSA 3Q18A 3ZREA 3APQA 4FH8A 5EL8A 2LKUA 5DQYA 5B7CA 3TJFA 4HOJA 3PGTA 4HEA2 2C0GA 4I8BA 1U88A 2H6XA 1FO5A 1IYIA 1ON4A 2GQMA 2HFDA 3O76A 4XCSA 2LJAA 5E4WA 3ZITA 5C04A 1THXA 4HU7A 5ECOB 3A5WA 3JCML 3ZVJA 1SJ6A 4NHWA 4ZB6A 3H1NA 1XWAA 4F82A 4IP6A 2B6MA 1X9SB 1V98A 4JR6A 5DJMA 3CSJA 4CHSA 1FAAA 2MYGA 2R3XA 20GSA 3TOTA 4OFNA 5LD0A 1QXHA 1WE0A 1SENA 3HJMA 3FZ5A 2FD3A 1PL1A 3QAGA 4TOPA 3ED3A 1Q98A 4NHZA 2DJ2A 3A3TA 5ECLB 3EVIA 4HS1A 2MZCA 4LL1B 5G1KA 1NW2A 4KX4A 2H76A 2NPBA 2CVKA 5GSTA 3IAS2 2V6KA 3VI7A 2AUVA 3EMPA 5B8BA 1F3BA 1O6JA 2HSHA 5CAXA 1K0NA 2HI7A 1GSSA 2F8FA 4V2LA 1SD9A 3TKPA 3VWWA 2DJKA 1GNWA 2VOCA 1XOBA 3IE3A 2HT9A 2V6OA 1PA3A 2PVOC 1ST9A 1K3LA 4EDYA 3EINA 5FHIA 4KSMA 3UEMA 1VGLA 4L5OA 5F0GA 5H5SA 3H4KA 2XBIA 1Z3EA 1XZOA 1M2DA 2VLVA 2KOKA 3GA4A 2B1KA 2GT6A 2GZZA 2AJQB 3RBTA 3CTFA 1B9XC 5HR1A 2GQKA 2IFQB 3KM6A 4POMA 2GDRA 2OADA 2CQ9A 2YWIA 1U3IA 3IV4A 3O6TA 1TK0B 4D73B 2BTOT 2OE0A 1B8XA 4TRXA 1K0OA 2ON7A 4J2FA 4K6XA 1A0FA 2HZEB 3CTGA 4OO4A 4Q5FA 5JCWA 1GULA 2REMA 4CDOA 3RHCA 3BCIA 5FT3A 2WRTA 1U87A 1XWCA 2YV7A 4O32A 3HDCA 5JWRB 6GSTA 2AV4A 5CNWA 2E2GA 3K8NA 4LLRA 2VIMA 2I1UA 4N0ZA 5DVBA 4N11A 1SL0B 2I3YA 4EUYA 3ZL5A 5CRDA 4ECCA 3ZMLA 3KTLA 3TUEA 2GQLA 5DALA 1TP9A 13GSA 5CP1A 1SKWB 4K1FA 2QGVA 2PWJA 4EF0A 2LQQA 2K8SA 2VUPA 3F8UA 17GSA 2C4JA 3FR9A 2TIRA 2H73A 5CRHA 1SL2B 7GSSA 3HJOA 3PR8A 4KNDA 3QDNA 2C1YA 5D9VA 1THOA 1NHYA 3HHVA 1AUCA 3RPPA 1A8YA 4N30A 2RIIA 3BBYA 4E8HA 1A2LA 1X9MB 2ALBA 4HQSA 2B5XA 1BAYA 14GSA 4K8MA 5KN2A 5AGYA 2F51A 2L59A 4ZIJA 1JZWA 2H70A 4DSRA 1EWXA 3KD0A 3FR3A 5IMFA 3Q74A 2R37A 1GTBA 4X43A 1EP7A 5HR3A 3PINA 2LS5A 4IKHA 1NM3A 4ZB8A 2N5FA 1O8WA 4GWRA 4IHUA 1E2YA 4HQZA 5GZZB 2IN3A 3EMXA 3HJPA 4NMUA 1AXDA 2H75A 3IPZA 4YQMA 5IOXA 2L4CA 2NBSA 3ZFBA 1HNBA 5F05A 5EY6A 3WGEA 4WXTA 1M9AA 2DLXA 1Z9HA 2RM5A 2I9HA 1WWJA 2FA8A 1ERTA 2DBCA 1G7EA 2H19A 5E59A 4YH2A 1GL8A 1GSYA 2A2RA 1GRXA 5JCGA 1T8EB 2J9HA 4I2TA 5HFIA 2LEGA 4OCEA 1V9WA 3ME8A 4O7HA 1GTAA 2VCWA 4MZCA 5D93A 5F07A 4RI7A 5F8BA 3UAPA 2F8AA 2C0EA 1YZXA 3CBUA 2CVDA 3CXGA 1WP0A 3FZAA 2LUSA 1FG4A 1TK8B 3C73A 3HXSA 1R7HA 2K18A 1B9YC 1QQ2A 1XXUA 2AAWA 4MZWA 4EXJA 3F6DA 4WKWA 4MLYA 1X5CA 4JEDA 4WR4A 3NZNA 4O5RA 4MJAA 1PRXA 4K0NA 4G2EA 1BJXA 3F4TA 1K3YA 1HD2A 3GRXA 1Q4JA 1YF0A 1UVZA 2C0DA 1G0TA 1FVKA 3CYNA 2GSSA 1F37A 1AQVA 2OACA 4YQVA 2DMMA 4X1UA 5DCGA 1GSEA 2E7PA 1FB0A 4RQXA 3N5OA 3S9FA 2H0IA 1ERWA 2G2QA 4L8EA 3CMIA 4AJ6A 4TR0A 3ERGA 3E0UA 2HE3A 1EGOA 2H66A 1G6WA 1YDKA 1A23A 1GSUA 1SYRA 1UN2A 2IFQA 4BL7A 16GSA 1VF2A 3ZFLA 4OFMA 4MCUA 2G0FA 2QC7A 1PSQA 3VWVA 4PX1A 1TRSA 4GSNA 1A2MA 4D73A 3BOAA 3AY8A 2P5QA 5FWGA 1M99A 4F0BA 3UOMA 2WB9A 2HZEA 2MMAA 5A5KA 2IIYA 1TRWA 4I97A 3KZQA 3MAKA 4MPGA 3LEFA 1EGRA 4EL1A 3LJRA 2HZFA 4YAPA 2V2GA 1F9MA 1F3AA 3MNGA 1GSFA 1UA5A 2H1AA 1A24A 2WJUA 1XOAA 3IHQA 1LBKA 3G7YA 4N10A 3HVSA 1BYEA 1ZGNA 1WJKA 1XVQA 1HNCA 1QFNA 1J08A 4O92A 2H72A 3LORA 2ON5A 2L6DA 2NDOA 1AQXA 3E9JB 2GTUA 3EU4A 3QOUA 5D9XA 2C8UA 1J0FA 3NIVA 5IMDA 3QPMA 4PXOA 1Z6MA 1OC8A 2VCQA 2KLXA 1SU9A 2VO4A 2C80A 5CYYA 5DCHA 2N5AA 4BVXA 3GNJA 1EOGA 1GLPA 1AW9A 1V2AA 1OAZA 1R5PA 2JACA 3G9BA 1K0BA 3IXRA 1GP1A 2XC2A 3RPNA 4EE0A 2X8GA 2GVPA 1GNEA 1PKWA 2GSQA 4PGTA 3ERFA 3I43A 6GSSA 4MA9A 3VWUA 2H71A 4WR5A 1LU4A 4DVCA 5J41A 1TRVA 3DEXA 3TJKA 3Q19A 2YWNA 3TRQA 4I6XA 3ERWA 5G31A 2YJ7A 3W8SA 2QKEA 1SK1A 2TRXA 3VPTA 1CQGA 12GSA 1K0MA 1PKZA 2A2SA 3HVXA 3WD6A 1PQNA 2M46A 2MBSA 3LGCA 4HU9A 4WBRD 4LMVA 8GSSA 5ABRA 2PN8A 4MJEA 2PPTA 1EV9A 2CV4A 3I6AA 3KXOA 2HYXA 3PH9A 1EZKA 2MBTA 1A0RP 3GYKA 4ZL9A 1R5AA 2NTOA 3L9UA 2OBIA 4K7OA 4G9HA 5G5FA 2H6YA 4POBA 3WGXA 3J7Yk 5IM9A 2VL2C 4DSSB 2P5RA 4ZILA 3KH9A 1HQOA 3SBCA 3C1RA 2YZHA 1FOVA 4MDCA 3DVXA 1QK8A 1V57A 3H8QA 2O85A 3D4MA 2XPEA 2FWHA 4HJ2A 6GSYA 1RK4A 1VRSD 1IYHA 3F4RA 1G7OA 2YPMA 4XIHA 4ZXGA 2B5EA 1XFLA 4BPYA 2VCVA 1J9BA 2RUEA 2R6KA 2KUCA 2NVLA 4AF2A 4XRAA 4EKZA 3HYPA 4PQHA
chains in the Genus database with same CATH superfamily
1U6TA 2DJ0A 3VI5A 3CQFA 3Q6OA 3EE2A 3WT1A 5JWOB 3ZIJA 3RAZA 1AAZA 3HCZA 2HSYA 3UIWA 1FVJA 1PX6A 22GSA 5KOWA 2WGRA 3EC3A 3WGDA 2LJRA 3TOUA 2ZUPA 4GQFA 4MZBA 1TOFA 5IQYA 1Z7PA 4ZBDA 1N2AA 1M2AA 2FA4A 1TW9A 1YY7A 3GH6A 1S3AA 1TRUA 1M3JA 2V41A 2D2ZA 3H79A 3L9VA 1XWKA 3IBHA 1YEXA 5G5EA 1K0DA 5CRGA 3E3EA 3GURA 5HR2A 3MSZA 3F4SA 3ZVJD 2FWGA 1UC7A 1KNGA 3ISOA 4MMMA 2EIRA 3GIXA 2R5GA 4JR4A 2XHFA 3D6IA 3HZ4A 4OD7A 3TKSC 1PD21 2L6CA 2VD1A 5ECKB 2H01A 1BG5A 5DAKB 2EIOA 1FB6A 1TTZA 4HZ4A 1QMVA 1EOHA 5IPGA 4Z7XA 1PMTA 2IMIA 2R4VA 1O7UA 1ERVA 2VM1A 3HKRA 2O8VB 3GSSA 4FYCA 2FGXA 1V40A 2LQOA 4J57E 1PN9A 2ES7A 4NV5A 5H5RA 2DJJA 3GKXA 3GMFA 3MIXA 5ID2B 4HDEA 4ULXA 2L5OA 5J5NA 2KP1A 3P2AA 2FY6A 1PGTA 5B8AA 5IO0A 1ML6A 1GWCA 3HA9A 3KH7A 4QQ7A 2WDUA 3UVHA 5IO2A 1W89A 4AJ7A 2JZSA 2F3MA 4KH7A 2OA7A 2PBJA 4EDZA 2H1DA 1SYXA 5ELAA 1I5GA 3KTBA 2LNTA 2IL3A 4V1Ag 1ABAA 1OC9B 3CRUA 2RUFA 5AIXA 4OCFA 3IK7A 1EEMA 3F9UA 2AHEA 1MTCA 4YAVA 4NPBA 5D9TA 3LYPA 1SK0A 6GSVA 4V2MA 3GSTA 2K8VA 3J7Yb 2LRTA 5D9WA 2X8CA 4ML6A 1OKTA 3TGZA 1JLWA 4G10A 3F6FA 3KP9A 4KA0A 4IW9A 2O87A 4IJ3A 4WEYA 4PQ1A 4F03A 4V2NA 1YF1A 2KP2A 4G0LA 2CX4A 1XW5A 3VLNA 2PU9C 4POLA 1SK2A 2IPAA 5D73A 4F9ZA 2JSZA 4NV2A 5G1LA 3TKRA 3GN3A 2KHPA 5CRWA 5EPFA 2H74A 5AIVA 3L9SA 4BWQA 2M80A 3P8WA 3SWLA 5GSSA 3FR6A 4GQCA 3EU3A 4XS4B 1JZOA 1F6MC 3ME7A 5B6NA 3A2XA 1T4ZA 4MJCA 4AJ8A 4DSSA 3F3QA 1KEBA 1TXXA 4FIWA 2GSTA 2PERA 3QFBC 5ECHB 5IIZA 4K2XA 5DQSA 4ZBAA 2H6ZA 3IK9A 3I9V2 4EVMA 3FKFA 3GX0A 1LJRA 1TDIA 2LRNA 11GSA 3GHAA 2GS3A 2PMTA 3GH9A 4WF5A 2FWFA 4OWYA 2GLRA 2ZCTA 4MF5A 1DSBA 2DMLA 2GGTA 5DDLA 2CA8A 6GSWA 4RQRA 4TR3A 5D8IA 3QFAC 1TK5B 4GTUA 5A4VA 3GUSA 2WULA 3GL3A 4WF4A 3GV1A 3GX8A 1U3AA 2PGTA 2YV9A 2DC5A 3UMAA 1WOUA 4BVYB 5A4UA 4X0XA 4HZ2A 4ID0A 4Q5RA 1TU7A 2BJXA 5AN1A 1GUHA 4E8EA 3TJJA 3D21A 1VF4A 1GUMA 1T3BA 2DKHA 2YJHA 2YANA 1MD3A 4KDUA 5ECNB 5HFGA 2O7KA 4IVFA 2GZYA 1K3OA 4PNFA 3EURA 4XS6A 3QR6A 1QGVA 4JBBA 4POKA 4PURA 2HNLA 2WS2A 4GRFA 3TDGA 3GTUB 1PN0A 3M9KA 5LCZA 4L0UA 1GTUA 4HSCX 1I9DA 2HRAA 1FHEA 1CQHA 1K0AA 19GSA 4NAXA 4TR4A 2VL2A 1QUWA 1RQMA 2M72A 2P0GA 3D0ZA 1GUKA 2XBQA 4FO5A 5B6MA 2TRCP 1OC3A 9GSSA 4GCIA 4KB3A 2B7JA 3DGQA 4ICYA 1Y25A 3TB2A 1EV4A 4KCAA 5DAKA 4BWSA 1S3CA 1T7PB 1TI1A 4Q5QA 1OKDA 1Z5YE 4IN0A 5INYA 2MMZA 3DWVA 3LXZA 4JRRA 2C3NA 2YZUA 2C3TA 2L57A 3BJ5A 2XPDA 3C1SA 3F63A 2O89A 3P7XA 4ACSA 1HNAA 1WRYA 1HYUA 2RLIA 2X64A 5ID2A 2R0CA 1BQ7A 3DD3A 5IPHA 2VL9A 2WFCA 2J23A 3G7IA 1MDKA 5D96A 3LXTA 2HXKA 5KN3A 2JL4A 1B48A 3A2WA 3IC8A 3FYGA 3LYKA 3QAVA 1DBYA 4KGIA 2VD0A 3M1GA 4GSSA 4HJMA 4BA7A 1WIKA 4FYBA 3ZLPA 2VCXA 3GKMA 5EVOA 1AIUA 5ELGA 4Q5NA 4OMVA 3TRXA 1OC9A 4ILFA 5DJLA 2VAFA 4TXVA 4MPFA 3US3A 5AISA 2A4VA 2HLSA 5H5QA 2DIYA 1ZCPA 4K7IA 2B5YA 3DRNA 2YWOA 4V1Ap 2DJ1A 2H1BA 2VCTA 4ECBA 4F2IA 2V32A 3U6VA 4GXZA 2YP6A 1ACVA 5LNKe 3FZ9A 4ZL7A 4K0GA 3TKSA 4KF9A 5A4WA 4MK3A 2YNXA 3CSIA 2IMKA 4HUAA 4KUNA 5HQPA 4RUVA 1M0UA 1X5DA 3ZZXA 3D4TA 5J3RA 1PL2A 3NOFA 4K2DA 2N5BA 2VLTA 4KE3A 2OE1A 2FNOA 3L78A 2DIZA 4YKGA 1USBA 1T00A 1OYJA 4GSTA 4WETA 2CAIA 1M3IA 4YKFA 5KN0A 3WYWA 1B4PA 3FEUA 4MF7A 2X49A 1M7TA 2PUKC 1H4OA 4KSOA 3UARA 1WMJA 5J9CA 2H1GA 1XW6A 2X8HA 3CRTA 4L0WA 2GT5A 1OE7A 2L5LA 3TKSE 1O81A 3R2QA 1SJIA 4XS4A 4FYUA 3KIJA 3VURA 2JU5A 3GKNA 1ZMAA 3RHBA 1KTEA 3W8JA 3M9JA 3FY7A 4ZB9A 3BD2A 4LMWA 1VF3A 3KGKA 1O85A 2YN1A 3U5RE 1DUGA 3DYRA 3VFIA 2DSAA 4ECJA 3FHKA 1W4VA 4K9ZA 1XVWA 3UL3A 2HSMA 2I81A 18GSA 2PVQA 3HVVA 2E0QA 3KJYA 4TKYA 4L5LA 3LFLA 4KDYA 4KCEA 4QL7A 3H93A 4TW5A 4J56E 1C72A 4TXOB 2OJLA 4TVEA 5GAPD 1URMA 4BVYA 2IMFA 4XTSA 3D5JA 1TU8A 3QMXA 10GSA 3HY2A 4TR1B 1TKDB 3P90A 3TCOA 5GAND 3OR5A 3IAM2 5BMUA 4LA1A 2HRNA 2IWTA 4A5PA 1YEPA 3IRAA 3C71A 3KMOA 3QD9A 4LL4B 4Z2UA 4KDXA 5IMCA 4IJIA 3GTUA 3GL5A 1JZRA 4PQIA 4NWYA 4JU5A 1YKCA 2Z9SA 4K7NA 4N0VA 5L71A 1XBSA 3CSHA 3ZMKA 1OVNA 2WCIA 3LG6A 5JCUA 2H0HA 3BCKA 4ISDA 3FW2A 5KEJA 3A5IA 1T4YA 2EC4A 1AC1A 1AQWA 2DJ3A 2RM6A 1GTIA 3QAWA 1O8XA 2FWEA 2OKAA 3O3TA 1M2BA 2GSRA 4XHMA 6GSXA 1JFUA 1A2JA 2LTKA 5HR0A 4MH3A 1PX7A 1NHOA 6GSUA 1JHBA 1DE1A 3ZYWA 4DEJA 3IOSA 1V58A 1GLQA 2MMOA 4JZQA 4G0IA 1XIYA 3ZIVA 2EIQA 4G0KA 1JLVA 2JZTA 1GH2A 5KOXA 3IC4A 4I2UA 4P3YB 3LSZA 1RW1A 2B3SA 5J4UA 3APOA 1JZDA 2CAQA 1EEJA 4EIPA 3DIEA 1T1VA 4PTSA 1XPVA 3M0FA 2AB6A 4DSQA 3RDWA 4OFTA 2FUG2 4AGSA 1TJDA 2B7KA 2IMDA 1XW9A 3VPQA 4I5QA 1YJ6A 3F3RA 4MP4A 2LJKA 4O5QA 2H30A 3G7JA 3EPTA 1R4WA 4USSA 5CREA 1FOHA 1ZYEA 4NXIA 5ENUA 5ECIB 2JSYA 4KW6A 3WT2A 2VL3A 1Z7RA 3HZ8A 3UBKA 4TN8A 2F9SA 1DE2A 2B1LA 2JZRA 1N8JA 4IELA 4GLTA 2HRFA 3MDKA 4EO3A 1EP8A 1G6YA 2P31A 3W6GA 3UBLA 1MEKA 5C00A 3EYTA 1YKAA 4XS1A 3VWXA 4ECIA 1MD4A 1O73A 1R26A 1H75A 2ZNMA 4JE1A 2I4AA 2LNSA 3QCPA 4IP1A 2AYTA 1VF1A 1XCCA 4MH2A 2R2JA 4IQ1A 4KAEA 1ILOA 2E2MA 4G19A 3GKKA 3DXBA 4IS0A 1GSQA 1BX9A 2IMEA 4ZL8A 1BEDA 1GSDA 3D22A 1MDIA 2WZ9A 1SL1B 1M9BA 2C0FA 2OE3A 4EC0A 5ECRB 5J9BA 4WBJA 1Z6NA 3MWHA 3TJGA 4YQUA 2L4QA 4IQAA 5IMAA 2K9FA 2JADA 5ECQB 5JWQB 2V1MA 2QSIA 4OO5A 3TJBA 3KCMA 2VM2A 2FCHA 3C8EA 1B4QA 5ECPB 2OBKA 4X4JA 1E6BA 4IGJA 4PUFC 5IOWA 1OE8A 3DVWA 1KBNA 2H0GA 3L4NA 2CX3A 5CO3A 5IMZA 4PUAA 4HI7A 2LRCA 2CT6A 2YOIA 2K6VA 1SD8A 4K5RA 4PNGA 3KMNA 2LSTA 3EWLA 2LV3A 1Y6EA 3IDVA 4ML1A 2IJYA 1ZYNA 2H8LA 3ZTLA 3F0IA 2VCZA 1SKSB 2GZPA 1ZYPA 5HFKA 4TXOA 2CVBA 2YCDA 3DKSA 5ECSA 1SJZA 3LQ7A 2VLUA 1ZYQB 2CZ2A 4TR1A 1X0RA 3KP8A 1F2EA 3M8NA 3ZRDA 5DALB 5IMVA 4F0CA 1MDJA 1ZOFA 3GFKA 3N9JA 3UVTA 4MNNA 3V1WA 3C7MA 4MJBA 4QL9A 4H86A 4RI6A 5COHA 1A8LA 3TKQA 5DBQA 1ERUA 1ZL9A 1XWGA 1K0CA 1SKRB 3FK8A 1X5EA 3IA1A 4ZBBA 2C3QA 2FLSA 3UJ1A 3FZ4A 3LWAA 2BMXA 4CW9A 2HRKA 2CZ3A 1FW1A 2MMNA 3VK9A 3M3MA 3FRCA 3IR4A 3L0HA 5KN1A 1WPIA 1S3DA 5F06A 1NSWA 1X9WB 3KEBA 1XG8A 1TI3A 2YWMA 4IBPA 3HD5A 1YQ1A 5G30A 3A2VA 2FHEA 4GF0A 4MABA 3TRPA 4MF6A 5G2ZA 4XRDA 1ZZYA 2X99A 1XWBA 3I69A 3DMLA 5ECMB 3APSA 3Q18A 3ZREA 3APQA 4FH8A 5EL8A 2LKUA 5DQYA 5B7CA 3TJFA 4HOJA 3PGTA 4HEA2 2C0GA 4I8BA 1U88A 2H6XA 1FO5A 1IYIA 1ON4A 2GQMA 2HFDA 3O76A 4XCSA 2LJAA 5E4WA 3ZITA 5C04A 1THXA 4HU7A 5ECOB 3A5WA 3JCML 3ZVJA 1SJ6A 4NHWA 4ZB6A 3H1NA 1XWAA 4F82A 4IP6A 4CY6A 2B6MA 1X9SB 1V98A 4JR6A 5DJMA 3CSJA 4CHSA 1FAAA 2MYGA 2R3XA 20GSA 3TOTA 4OFNA 5LD0A 1QXHA 1WE0A 3R3EA 1SENA 3HJMA 3FZ5A 2FD3A 1PL1A 3QAGA 4TOPA 3ED3A 1Q98A 4NHZA 2DJ2A 3A3TA 5ECLB 3EVIA 3FMWA 4HS1A 2MZCA 4LL1B 5G1KA 1NW2A 4KX4A 2H76A 2NPBA 2CVKA 5GSTA 3IAS2 4Z2RA 2V6KA 3VI7A 2AUVA 3EMPA 5B8BA 1F3BA 1O6JA 2HSHA 5CAXA 1K0NA 2HI7A 1GSSA 2F8FA 4V2LA 1SD9A 3TKPA 3VWWA 2QA2A 2DJKA 1GNWA 2VOCA 1XOBA 3IE3A 2HT9A 2V6OA 1PA3A 3HVNA 2PVOC 1ST9A 1K3LA 4EDYA 3EINA 5FHIA 2DKIA 4KSMA 3UEMA 1VGLA 4L5OA 5F0GA 5H5SA 3H4KA 2XBIA 1Z3EA 1XZOA 1M2DA 2VLVA 2KOKA 3GA4A 2B1KA 2GT6A 2GZZA 4CY8A 2AJQB 3RBTA 3CTFA 1B9XC 5HR1A 2GQKA 2IFQB 3KM6A 4POMA 4BL7B 2GDRA 2OADA 2CQ9A 2YWIA 1U3IA 4K5SA 3IV4A 3O6TA 1TK0B 4D73B 2BTOT 2OE0A 1B8XA 4TRXA 1K0OA 2ON7A 4J2FA 4K6XA 1A0FA 2HZEB 3CTGA 4OO4A 4Q5FA 5JCWA 1GULA 2REMA 4CDOA 3RHCA 3BCIA 5FT3A 2WRTA 1U87A 1XWCA 2YV7A 4O32A 3HDCA 5JWRB 6GSTA 2AV4A 5CNWA 2E2GA 3K8NA 4LLRA 2VIMA 2I1UA 4N0ZA 5DVBA 4N11A 1SL0B 2I3YA 4EUYA 3ZL5A 5CRDA 4ECCA 3ZMLA 3KTLA 3TUEA 2GQLA 1S3RA 5DALA 1TP9A 13GSA 5CP1A 1SKWB 4K1FA 2QGVA 5BRTA 2QA1A 2PWJA 4EF0A 2LQQA 2K8SA 2VUPA 3F8UA 17GSA 2C4JA 3FR9A 2TIRA 2H73A 5CRHA 1SL2B 7GSSA 3HJOA 3PR8A 4KNDA 3QDNA 2C1YA 5D9VA 1THOA 1NHYA 3HHVA 1AUCA 3RPPA 1A8YA 4O5UA 4N30A 2RIIA 3BBYA 4E8HA 1A2LA 1X9MB 2ALBA 4HQSA 2B5XA 2R0PA 4BVXB 1BAYA 14GSA 4K8MA 5KN2A 5AGYA 2F51A 2L59A 4ZIJA 1JZWA 2H70A 4DSRA 1EWXA 3KD0A 3FR3A 5IMFA 3Q74A 2R37A 1GTBA 4X43A 1EP7A 5HR3A 4BIKA 3PINA 2LS5A 4IKHA 1NM3A 4ZB8A 2N5FA 1O8WA 4GWRA 4IHUA 1E2YA 4HQZA 5GZZB 2IN3A 3EMXA 3HJPA 4NMUA 1AXDA 2H75A 3IPZA 4YQMA 5IOXA 2L4CA 2NBSA 3ZFBA 1HNBA 5F05A 5EY6A 3WGEA 4WXTA 1PFOA 1M9AA 2DLXA 1Z9HA 2RM5A 2I9HA 1WWJA 2FA8A 1ERTA 3LW9A 2DBCA 1G7EA 2H19A 5E59A 4YH2A 1GL8A 1GSYA 2A2RA 2X4AA 1GRXA 5JCGA 1T8EB 2J9HA 4I2TA 5HFIA 2LEGA 4OCEA 1V9WA 3ME8A 4O7HA 1GTAA 2VCWA 4MZCA 5D93A 5F07A 4RI7A 5F8BA 3UAPA 2F8AA 2C0EA 1YZXA 3CBUA 2CVDA 3CXGA 1WP0A 3FZAA 2LUSA 1FG4A 1TK8B 3C73A 3HXSA 1R7HA 2K18A 1B9YC 1QQ2A 1XXUA 2AAWA 4MZWA 4EXJA 3F6DA 4WKWA 4MLYA 1X5CA 4JEDA 4WR4A 3NZNA 4O5RA 4MJAA 1PRXA 4K0NA 4G2EA 1BJXA 3F4TA 1K3YA 1HD2A 3GRXA 1Q4JA 1YF0A 1UVZA 2C0DA 1G0TA 1FVKA 3CYNA 2GSSA 1F37A 1AQVA 2OACA 4YQVA 2DMMA 4X1UA 5DCGA 1GSEA 2E7PA 1FB0A 4RQXA 3N5OA 3S9FA 2H0IA 1ERWA 2G2QA 4L8EA 3CMIA 4AJ6A 4TR0A 3ERGA 3E0UA 2HE3A 1EGOA 2H66A 1G6WA 1YDKA 1A23A 1GSUA 1SYRA 1UN2A 2IFQA 4BL7A 16GSA 1VF2A 3ZFLA 4OFMA 4MCUA 2G0FA 2QC7A 4Z2TA 1PSQA 3VWVA 4PX1A 1TRSA 4GSNA 1A2MA 4D73A 3BOAA 3AY8A 2P5QA 5FWGA 1M99A 4F0BA 3UOMA 2WB9A 2HZEA 2MMAA 5A5KA 2IIYA 1TRWA 4I97A 3KZQA 3MAKA 4MPGA 3LEFA 1EGRA 4EL1A 3LJRA 2HZFA 4YAPA 2V2GA 1F9MA 2R0GA 1F3AA 3MNGA 1GSFA 1UA5A 2H1AA 1A24A 2WJUA 2UZ8A 4EIQA 1XOAA 3IHQA 1LBKA 3G7YA 4N10A 3HVSA 1BYEA 1ZGNA 3MYDA 1WJKA 1XVQA 1HNCA 1QFNA 1J08A 4O92A 2H72A 3LORA 2ON5A 2L6DA 2NDOA 1AQXA 3E9JB 2A2PA 2GTUA 3EU4A 3QOUA 5D9XA 2C8UA 1J0FA 3NIVA 5IMDA 3QPMA 4PXOA 1Z6MA 1OC8A 2VCQA 2KLXA 1SU9A 2VO4A 2C80A 5CYYA 5DCHA 2N5AA 4BVXA 3GNJA 1EOGA 1GLPA 1AW9A 1V2AA 1OAZA 1R5PA 2JACA 3G9BA 1K0BA 3IXRA 1GP1A 2XC2A 3RPNA 4EE0A 2X8GA 2GVPA 1GNEA 1PKWA 2GSQA 4PGTA 3ERFA 3I43A 6GSSA 4MA9A 3VWUA 2H71A 4WR5A 1LU4A 4DVCA 5J41A 1TRVA 3DEXA 3TJKA 3Q19A 2YWNA 3TRQA 4I6XA 3ERWA 5G31A 2YJ7A 3W8SA 2QKEA 1SK1A 2TRXA 3VPTA 1CQGA 12GSA 1K0MA 1PKZA 2A2SA 3HVXA 3WD6A 1PQNA 2M46A 2MBSA 3LGCA 4HU9A 4WBRD 3PPUA 4LMVA 8GSSA 5ABRA 2PN8A 4MJEA 2PPTA 1EV9A 2CV4A 3I6AA 3KXOA 2HYXA 3PH9A 1EZKA 2MBTA 1A0RP 3GYKA 4ZL9A 1R5AA 2NTOA 3L9UA 2OBIA 4K7OA 4G9HA 5G5FA 2H6YA 4POBA 3WGXA 3J7Yk 5IM9A 2VL2C 4DSSB 2P5RA 4ZILA 3KH9A 1HQOA 3SBCA 3C1RA 3IHGA 2YZHA 1FOVA 4MDCA 3DVXA 1QK8A 1V57A 3H8QA 2O85A 3D4MA 2XPEA 2FWHA 4FQUA 4HJ2A 6GSYA 1RK4A 1VRSD 2A4HA 1IYHA 3F4RA 1G7OA 2YPMA 4XIHA 4ZXGA 2B5EA 1XFLA 4BPYA 2VCVA 1J9BA 2RUEA 2R6KA 2KUCA 2NVLA 4AF2A 4XRAA 4EKZA 3HYPA 4PQHA
chains in the Genus database with same CATH topology
1U6TA 2DJ0A 3VI5A 3Q6OA 3EE2A 3WT1A 5JWOB 3ZIJA 3RAZA 1AAZA 3HCZA 2HSYA 3UIWA 1FVJA 1PX6A 22GSA 5KOWA 2WGRA 3EC3A 3WGDA 2LJRA 3TOUA 2ZUPA 4GQFA 4MZBA 1TOFA 5IQYA 1Z7PA 4ZBDA 1N2AA 1M2AA 2FA4A 1TW9A 1YY7A 3GH6A 1S3AA 1TRUA 2V41A 2D2ZA 3H79A 3L9VA 1XWKA 3IBHA 1YEXA 5G5EA 1K0DA 5CRGA 3E3EA 3GURA 5HR2A 3MSZA 3F4SA 3ZVJD 2FWGA 1UC7A 1KNGA 3ISOA 4MMMA 2EIRA 3GIXA 2R5GA 4JR4A 2XHFA 3D6IA 3HZ4A 4OD7A 3TKSC 1PD21 2L6CA 2VD1A 5ECKB 2H01A 1BG5A 5DAKB 2EIOA 1FB6A 1TTZA 4HZ4A 1QMVA 1EOHA 5IPGA 4Z7XA 1PMTA 2IMIA 2R4VA 1O7UA 1ERVA 2VM1A 3HKRA 2O8VB 3GSSA 4FYCA 2FGXA 1V40A 2LQOA 4J57E 1PN9A 2ES7A 4NV5A 5H5RA 2DJJA 3GKXA 3GMFA 3MIXA 5ID2B 4HDEA 4ULXA 2L5OA 5J5NA 2KP1A 3P2AA 2FY6A 1PGTA 5B8AA 5IO0A 1ML6A 1GWCA 3HA9A 3KH7A 4QQ7A 2WDUA 3UVHA 5IO2A 1W89A 4AJ7A 2JZSA 2F3MA 4KH7A 2OA7A 2PBJA 4EDZA 2H1DA 1SYXA 5ELAA 1I5GA 3KTBA 2LNTA 2IL3A 4V1Ag 1ABAA 1OC9B 3CRUA 2RUFA 5AIXA 4OCFA 3IK7A 1EEMA 3F9UA 2AHEA 1MTCA 4YAVA 4NPBA 5D9TA 3LYPA 1SK0A 6GSVA 4V2MA 3GSTA 2K8VA 3J7Yb 2LRTA 5D9WA 2X8CA 4ML6A 1OKTA 3TGZA 1JLWA 4G10A 3F6FA 3KP9A 4KA0A 4IW9A 2O87A 4IJ3A 4WEYA 4PQ1A 4F03A 4V2NA 1YF1A 2KP2A 4G0LA 2CX4A 1XW5A 3VLNA 2PU9C 4POLA 1SK2A 2IPAA 5D73A 4F9ZA 2JSZA 4NV2A 5G1LA 3TKRA 3GN3A 2KHPA 5CRWA 5EPFA 2H74A 5AIVA 3L9SA 4BWQA 2M80A 3P8WA 3SWLA 5GSSA 3FR6A 4GQCA 3EU3A 4XS4B 1JZOA 1F6MC 3ME7A 5B6NA 3A2XA 1T4ZA 4MJCA 4AJ8A 4DSSA 3F3QA 1KEBA 1TXXA 4FIWA 2GSTA 2PERA 3QFBC 5ECHB 5IIZA 4K2XA 5DQSA 4ZBAA 2H6ZA 3IK9A 3I9V2 4EVMA 3FKFA 3GX0A 1LJRA 1TDIA 2LRNA 11GSA 3GHAA 2GS3A 2PMTA 3GH9A 4WF5A 2FWFA 4OWYA 2GLRA 2ZCTA 4MF5A 1DSBA 2DMLA 2GGTA 5DDLA 2CA8A 6GSWA 4RQRA 4TR3A 5D8IA 3QFAC 1TK5B 4GTUA 5A4VA 3GUSA 2WULA 3GL3A 4WF4A 3GV1A 3GX8A 1U3AA 2PGTA 2YV9A 2DC5A 3UMAA 1WOUA 4BVYB 5A4UA 4X0XA 4HZ2A 4ID0A 4Q5RA 1TU7A 2BJXA 5AN1A 1GUHA 4E8EA 3TJJA 3D21A 1VF4A 1GUMA 1T3BA 2DKHA 2YJHA 2YANA 1MD3A 4KDUA 5ECNB 5HFGA 2O7KA 4IVFA 2GZYA 1K3OA 4PNFA 3EURA 4XS6A 3QR6A 1QGVA 4JBBA 4POKA 4PURA 2HNLA 2WS2A 4GRFA 3TDGA 3GTUB 1PN0A 3M9KA 5LCZA 4L0UA 1GTUA 1I9DA 2HRAA 1FHEA 1CQHA 1K0AA 19GSA 4NAXA 4TR4A 2VL2A 1QUWA 1RQMA 2M72A 2P0GA 3D0ZA 1GUKA 2XBQA 4FO5A 5B6MA 2TRCP 1OC3A 9GSSA 4GCIA 4KB3A 2B7JA 3DGQA 4ICYA 1Y25A 3TB2A 1EV4A 4KCAA 5DAKA 4BWSA 1S3CA 1T7PB 1TI1A 4Q5QA 1OKDA 1Z5YE 4IN0A 5INYA 2MMZA 3DWVA 3LXZA 4JRRA 2C3NA 2YZUA 2C3TA 2L57A 3BJ5A 2XPDA 3C1SA 3F63A 2O89A 3P7XA 4ACSA 1HNAA 1WRYA 1HYUA 2RLIA 2X64A 5ID2A 2R0CA 1BQ7A 3DD3A 5IPHA 2VL9A 2WFCA 2J23A 3G7IA 1MDKA 5D96A 3LXTA 2HXKA 5KN3A 2JL4A 1B48A 3A2WA 3IC8A 3FYGA 3LYKA 3QAVA 1DBYA 4KGIA 2VD0A 3M1GA 4GSSA 4HJMA 4BA7A 1WIKA 4FYBA 3ZLPA 2VCXA 3GKMA 5EVOA 1AIUA 5ELGA 4Q5NA 4OMVA 3TRXA 1OC9A 4ILFA 5DJLA 2VAFA 4TXVA 4MPFA 3US3A 5AISA 2A4VA 2HLSA 5H5QA 2DIYA 1ZCPA 4K7IA 2B5YA 3DRNA 2YWOA 4V1Ap 2DJ1A 2H1BA 2VCTA 4ECBA 4F2IA 2V32A 3U6VA 4GXZA 2YP6A 1ACVA 5LNKe 3FZ9A 4ZL7A 4K0GA 3TKSA 4KF9A 5A4WA 4MK3A 2YNXA 3CSIA 2IMKA 4HUAA 4KUNA 5HQPA 4RUVA 1M0UA 1X5DA 3ZZXA 3D4TA 5J3RA 1PL2A 3NOFA 4K2DA 2N5BA 2VLTA 4KE3A 2OE1A 2FNOA 3L78A 2DIZA 4YKGA 1USBA 1T00A 1OYJA 4GSTA 4WETA 2CAIA 4YKFA 5KN0A 3WYWA 1B4PA 3FEUA 4MF7A 2X49A 1M7TA 2PUKC 1H4OA 4KSOA 3UARA 1WMJA 5J9CA 2H1GA 1XW6A 2X8HA 3CRTA 4L0WA 2GT5A 1OE7A 2L5LA 3TKSE 1O81A 3R2QA 1SJIA 4XS4A 4FYUA 3KIJA 3VURA 2JU5A 3GKNA 1ZMAA 3RHBA 1KTEA 3W8JA 3M9JA 3FY7A 4ZB9A 3BD2A 4LMWA 1VF3A 3KGKA 1O85A 2YN1A 3U5RE 1DUGA 3DYRA 3VFIA 2DSAA 4ECJA 3FHKA 1W4VA 4K9ZA 1XVWA 3UL3A 2HSMA 2I81A 18GSA 2PVQA 3HVVA 2E0QA 3KJYA 4TKYA 4L5LA 3LFLA 4KDYA 4KCEA 4QL7A 3H93A 4TW5A 4J56E 1C72A 4TXOB 2OJLA 4TVEA 5GAPD 1URMA 4BVYA 2IMFA 4XTSA 3D5JA 1TU8A 3QMXA 10GSA 3HY2A 4TR1B 1TKDB 3P90A 3TCOA 5GAND 3OR5A 3IAM2 5BMUA 4LA1A 2HRNA 2IWTA 4A5PA 1YEPA 3IRAA 3C71A 3KMOA 3QD9A 4LL4B 4Z2UA 4KDXA 5IMCA 4IJIA 3GTUA 3GL5A 1JZRA 4PQIA 4NWYA 4JU5A 1YKCA 2Z9SA 4K7NA 4N0VA 5L71A 1XBSA 3CSHA 3ZMKA 1OVNA 2WCIA 3LG6A 5JCUA 2H0HA 3BCKA 4ISDA 3FW2A 5KEJA 3A5IA 1T4YA 2EC4A 1AC1A 1AQWA 2DJ3A 2RM6A 1GTIA 3QAWA 1O8XA 2FWEA 2OKAA 3O3TA 1M2BA 2GSRA 4XHMA 6GSXA 1JFUA 1A2JA 2LTKA 5HR0A 4MH3A 1PX7A 1NHOA 6GSUA 1JHBA 1DE1A 3ZYWA 4DEJA 3IOSA 1V58A 1GLQA 2MMOA 4JZQA 4G0IA 1XIYA 3ZIVA 2EIQA 4G0KA 1JLVA 2JZTA 1GH2A 5KOXA 3IC4A 4I2UA 4P3YB 3LSZA 1RW1A 2B3SA 5J4UA 3APOA 1JZDA 2CAQA 1EEJA 4EIPA 3DIEA 1T1VA 4PTSA 1XPVA 3M0FA 2AB6A 4DSQA 3RDWA 4OFTA 2FUG2 4AGSA 1TJDA 2B7KA 2IMDA 1XW9A 3VPQA 4I5QA 1YJ6A 3F3RA 4MP4A 2LJKA 4O5QA 2H30A 3G7JA 3EPTA 1R4WA 4USSA 5CREA 1FOHA 1ZYEA 4NXIA 5ENUA 5ECIB 2JSYA 4KW6A 3WT2A 2VL3A 1Z7RA 3HZ8A 3UBKA 4TN8A 2F9SA 1DE2A 2B1LA 2JZRA 1N8JA 4IELA 4GLTA 2HRFA 3MDKA 4EO3A 1EP8A 1G6YA 2P31A 3W6GA 3UBLA 1MEKA 5C00A 3EYTA 1YKAA 4XS1A 3VWXA 4ECIA 1MD4A 1O73A 1R26A 1H75A 2ZNMA 4JE1A 2I4AA 2LNSA 3QCPA 4IP1A 2AYTA 1VF1A 1XCCA 4MH2A 2R2JA 4IQ1A 4KAEA 1ILOA 2E2MA 4G19A 3GKKA 3DXBA 4IS0A 1GSQA 1BX9A 2IMEA 4ZL8A 1BEDA 1GSDA 3D22A 1MDIA 2WZ9A 1SL1B 1M9BA 2C0FA 2OE3A 4EC0A 5ECRB 5J9BA 4WBJA 1Z6NA 3MWHA 3TJGA 4YQUA 2L4QA 4IQAA 5IMAA 2K9FA 2JADA 5ECQB 5JWQB 2V1MA 2QSIA 4OO5A 3TJBA 3KCMA 2VM2A 2FCHA 3C8EA 1B4QA 5ECPB 2OBKA 4X4JA 1E6BA 4IGJA 4PUFC 5IOWA 1OE8A 3DVWA 1KBNA 2H0GA 3L4NA 2CX3A 5CO3A 5IMZA 4PUAA 4HI7A 2LRCA 2CT6A 2YOIA 2K6VA 1SD8A 4K5RA 4PNGA 3KMNA 2LSTA 3EWLA 2LV3A 1Y6EA 3IDVA 4ML1A 2IJYA 1ZYNA 2H8LA 3ZTLA 3F0IA 2VCZA 1SKSB 2GZPA 1ZYPA 5HFKA 4TXOA 2CVBA 2YCDA 3DKSA 5ECSA 1SJZA 3LQ7A 2VLUA 1ZYQB 2CZ2A 4TR1A 1X0RA 3KP8A 1F2EA 3M8NA 3ZRDA 5DALB 5IMVA 4F0CA 1MDJA 1ZOFA 3GFKA 3N9JA 3UVTA 4MNNA 3V1WA 3C7MA 4MJBA 4QL9A 4H86A 4RI6A 5COHA 1A8LA 3TKQA 5DBQA 1ERUA 1ZL9A 1XWGA 1K0CA 1SKRB 3FK8A 1X5EA 3IA1A 4ZBBA 2C3QA 2FLSA 3UJ1A 3FZ4A 3LWAA 2BMXA 4CW9A 2HRKA 2CZ3A 1FW1A 2MMNA 3VK9A 3M3MA 3FRCA 3IR4A 3L0HA 5KN1A 1WPIA 1S3DA 5F06A 1NSWA 1X9WB 3KEBA 1TI3A 2YWMA 4IBPA 3HD5A 1YQ1A 5G30A 3A2VA 2FHEA 4GF0A 4MABA 3TRPA 4MF6A 5G2ZA 4XRDA 1ZZYA 2X99A 1XWBA 3I69A 3DMLA 5ECMB 3APSA 3Q18A 3ZREA 3APQA 4FH8A 5EL8A 2LKUA 5DQYA 5B7CA 3TJFA 4HOJA 3PGTA 4HEA2 2C0GA 4I8BA 1U88A 2H6XA 1FO5A 1IYIA 1ON4A 2GQMA 2HFDA 3O76A 4XCSA 2LJAA 5E4WA 3ZITA 5C04A 1THXA 4HU7A 5ECOB 3A5WA 3JCML 3ZVJA 1SJ6A 4NHWA 4ZB6A 3H1NA 1XWAA 4F82A 4IP6A 4CY6A 2B6MA 1X9SB 1V98A 4JR6A 5DJMA 3CSJA 4CHSA 1FAAA 2MYGA 2R3XA 20GSA 3TOTA 4OFNA 5LD0A 1QXHA 1WE0A 3R3EA 1SENA 3HJMA 3FZ5A 2FD3A 1PL1A 3QAGA 4TOPA 3ED3A 1Q98A 4NHZA 2DJ2A 3A3TA 5ECLB 3EVIA 3FMWA 4HS1A 2MZCA 4LL1B 5G1KA 1NW2A 4KX4A 2H76A 2NPBA 2CVKA 5GSTA 3IAS2 4Z2RA 2V6KA 3VI7A 2AUVA 3EMPA 5B8BA 1F3BA 1O6JA 2HSHA 5CAXA 1K0NA 2HI7A 1GSSA 2F8FA 4V2LA 1SD9A 3TKPA 3VWWA 2QA2A 2DJKA 1GNWA 2VOCA 1XOBA 3IE3A 2HT9A 2V6OA 1PA3A 2PVOC 1ST9A 1K3LA 4EDYA 3EINA 5FHIA 2DKIA 4KSMA 3UEMA 1VGLA 4L5OA 5F0GA 5H5SA 3H4KA 2XBIA 1Z3EA 1XZOA 1M2DA 2VLVA 2KOKA 3GA4A 2B1KA 2GT6A 2GZZA 4CY8A 2AJQB 3RBTA 3CTFA 1B9XC 5HR1A 2GQKA 2IFQB 3KM6A 4POMA 4BL7B 2GDRA 2OADA 2CQ9A 2YWIA 1U3IA 4K5SA 3IV4A 3O6TA 1TK0B 4D73B 2BTOT 2OE0A 1B8XA 4TRXA 1K0OA 2ON7A 4J2FA 4K6XA 1A0FA 2HZEB 3CTGA 4OO4A 4Q5FA 5JCWA 1GULA 2REMA 4CDOA 3RHCA 3BCIA 5FT3A 2WRTA 1U87A 1XWCA 2YV7A 4O32A 3HDCA 5JWRB 6GSTA 2AV4A 5CNWA 2E2GA 3K8NA 4LLRA 2VIMA 2I1UA 4N0ZA 5DVBA 4N11A 1SL0B 2I3YA 4EUYA 3ZL5A 5CRDA 4ECCA 3ZMLA 3KTLA 3TUEA 2GQLA 5DALA 1TP9A 13GSA 5CP1A 1SKWB 4K1FA 2QGVA 5BRTA 2QA1A 2PWJA 4EF0A 2LQQA 2K8SA 2VUPA 3F8UA 17GSA 2C4JA 3FR9A 2TIRA 2H73A 5CRHA 1SL2B 7GSSA 3HJOA 3PR8A 4KNDA 3QDNA 2C1YA 5D9VA 1THOA 1NHYA 3HHVA 1AUCA 3RPPA 1A8YA 4O5UA 4N30A 2RIIA 3BBYA 4E8HA 1A2LA 1X9MB 2ALBA 4HQSA 2B5XA 2R0PA 4BVXB 1BAYA 14GSA 4K8MA 5KN2A 5AGYA 2F51A 2L59A 4ZIJA 1JZWA 2H70A 4DSRA 1EWXA 3KD0A 3FR3A 5IMFA 3Q74A 2R37A 1GTBA 4X43A 1EP7A 5HR3A 3PINA 2LS5A 4IKHA 1NM3A 4ZB8A 2N5FA 1O8WA 4GWRA 4IHUA 1E2YA 4HQZA 5GZZB 2IN3A 3EMXA 3HJPA 4NMUA 1AXDA 2H75A 3IPZA 4YQMA 5IOXA 2L4CA 2NBSA 3ZFBA 1HNBA 5F05A 5EY6A 3WGEA 4WXTA 1M9AA 2DLXA 1Z9HA 2RM5A 2I9HA 1WWJA 2FA8A 1ERTA 3LW9A 2DBCA 1G7EA 2H19A 5E59A 4YH2A 1GL8A 1GSYA 2A2RA 2X4AA 1GRXA 5JCGA 1T8EB 2J9HA 4I2TA 5HFIA 2LEGA 4OCEA 1V9WA 3ME8A 4O7HA 1GTAA 2VCWA 4MZCA 5D93A 5F07A 4RI7A 5F8BA 3UAPA 2F8AA 2C0EA 1YZXA 3CBUA 2CVDA 3CXGA 1WP0A 3FZAA 2LUSA 1FG4A 1TK8B 3C73A 3HXSA 1R7HA 2K18A 1B9YC 1QQ2A 1XXUA 2AAWA 4MZWA 4EXJA 3F6DA 4WKWA 4MLYA 1X5CA 4JEDA 4WR4A 3NZNA 4O5RA 4MJAA 1PRXA 4K0NA 4G2EA 1BJXA 3F4TA 1K3YA 1HD2A 3GRXA 1Q4JA 1YF0A 1UVZA 2C0DA 1G0TA 1FVKA 3CYNA 2GSSA 1F37A 1AQVA 2OACA 4YQVA 2DMMA 4X1UA 5DCGA 1GSEA 2E7PA 1FB0A 4RQXA 3N5OA 3S9FA 2H0IA 1ERWA 2G2QA 4L8EA 3CMIA 4AJ6A 4TR0A 3ERGA 3E0UA 2HE3A 1EGOA 2H66A 1G6WA 1YDKA 1A23A 1GSUA 1SYRA 1UN2A 2IFQA 4BL7A 16GSA 1VF2A 3ZFLA 4OFMA 4MCUA 2G0FA 2QC7A 4Z2TA 1PSQA 3VWVA 4PX1A 1TRSA 4GSNA 1A2MA 4D73A 3BOAA 3AY8A 2P5QA 5FWGA 1M99A 4F0BA 3UOMA 2WB9A 2HZEA 2MMAA 5A5KA 2IIYA 1TRWA 4I97A 3KZQA 3MAKA 4MPGA 3LEFA 1EGRA 4EL1A 3LJRA 2HZFA 4YAPA 2V2GA 1F9MA 2R0GA 1F3AA 3MNGA 1GSFA 1UA5A 2H1AA 1A24A 2WJUA 2UZ8A 4EIQA 1XOAA 3IHQA 1LBKA 3G7YA 4N10A 3HVSA 1BYEA 1ZGNA 3MYDA 1WJKA 1XVQA 1HNCA 1QFNA 1J08A 4O92A 2H72A 3LORA 2ON5A 2L6DA 2NDOA 1AQXA 3E9JB 2A2PA 2GTUA 3EU4A 3QOUA 5D9XA 2C8UA 1J0FA 3NIVA 5IMDA 3QPMA 4PXOA 1Z6MA 1OC8A 2VCQA 2KLXA 1SU9A 2VO4A 2C80A 5CYYA 5DCHA 2N5AA 4BVXA 3GNJA 1EOGA 1GLPA 1AW9A 1V2AA 1OAZA 1R5PA 2JACA 3G9BA 1K0BA 3IXRA 1GP1A 2XC2A 3RPNA 4EE0A 2X8GA 2GVPA 1GNEA 1PKWA 2GSQA 4PGTA 3ERFA 3I43A 6GSSA 4MA9A 3VWUA 2H71A 4WR5A 1LU4A 4DVCA 5J41A 1TRVA 3DEXA 3TJKA 3Q19A 2YWNA 3TRQA 4I6XA 3ERWA 5G31A 2YJ7A 3W8SA 2QKEA 1SK1A 2TRXA 3VPTA 1CQGA 12GSA 1K0MA 1PKZA 2A2SA 3HVXA 3WD6A 1PQNA 2M46A 2MBSA 3LGCA 4HU9A 4WBRD 3PPUA 4LMVA 8GSSA 5ABRA 2PN8A 4MJEA 2PPTA 1EV9A 2CV4A 3I6AA 3KXOA 2HYXA 3PH9A 1EZKA 2MBTA 1A0RP 3GYKA 4ZL9A 1R5AA 2NTOA 3L9UA 2OBIA 4K7OA 4G9HA 5G5FA 2H6YA 4POBA 3WGXA 3J7Yk 5IM9A 2VL2C 4DSSB 2P5RA 4ZILA 3KH9A 1HQOA 3SBCA 3C1RA 3IHGA 2YZHA 1FOVA 4MDCA 3DVXA 1QK8A 1V57A 3H8QA 2O85A 3D4MA 2XPEA 2FWHA 4FQUA 4HJ2A 6GSYA 1RK4A 1VRSD 2A4HA 1IYHA 3F4RA 1G7OA 2YPMA 4XIHA 4ZXGA 2B5EA 1XFLA 4BPYA 2VCVA 1J9BA 2RUEA 2R6KA 2KUCA 2NVLA 4AF2A 4XRAA 4EKZA 3HYPA 4PQHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U6T A;  2DJ0 A;  3VI5 A;  3Q6O A;  3EE2 A;  3WT1 A;  5JWO B;  3ZIJ A;  3RAZ A;  1AAZ A;  3HCZ A;  2HSY A;  3UIW A;  1FVJ A;  1PX6 A;  22GS A;  2WGR A;  3EC3 A;  3WGD A;  2LJR A;  3TOU A;  2ZUP A;  4GQF A;  4MZB A;  1TOF A;  5IQY A;  1Z7P A;  4ZBD A;  1N2A A;  1M2A A;  2FA4 A;  1TW9 A;  1YY7 A;  3GH6 A;  1S3A A;  1TRU A;  2V41 A;  2D2Z A;  3H79 A;  3L9V A;  1XWK A;  3IBH A;  1YEX A;  5G5E A;  1K0D A;  5CRG A;  3E3E A;  3GUR A;  5HR2 A;  3MSZ A;  3F4S A;  3ZVJ D;  2FWG A;  1UC7 A;  1KNG A;  3ISO A;  4MMM A;  2EIR A;  3GIX A;  2R5G A;  4JR4 A;  2XHF A;  3D6I A;  3HZ4 A;  4OD7 A;  3TKS C;  1PD2 1;  2L6C A;  2VD1 A;  5ECK B;  2H01 A;  1BG5 A;  5DAK B;  2EIO A;  1FB6 A;  1TTZ A;  4HZ4 A;  1QMV A;  1EOH A;  5IPG A;  4Z7X A;  1PMT A;  2IMI A;  2R4V A;  1O7U A;  1ERV A;  2VM1 A;  3HKR A;  2O8V B;  3GSS A;  4FYC A;  2FGX A;  1V40 A;  2LQO A;  4J57 E;  1PN9 A;  2ES7 A;  4NV5 A;  5H5R A;  2DJJ A;  3GKX A;  3GMF A;  5ID2 B;  4HDE A;  4ULX A;  2L5O A;  5J5N A;  2KP1 A;  3P2A A;  2FY6 A;  1PGT A;  5B8A A;  5IO0 A;  1ML6 A;  1GWC A;  3HA9 A;  3KH7 A;  4QQ7 A;  2WDU A;  3UVH A;  5IO2 A;  1W89 A;  4AJ7 A;  2JZS A;  2F3M A;  4KH7 A;  2OA7 A;  2PBJ A;  4EDZ A;  2H1D A;  1SYX A;  5ELA A;  1I5G A;  3KTB A;  2LNT A;  2IL3 A;  4V1A g;  1ABA A;  1OC9 B;  3CRU A;  2RUF A;  5AIX A;  4OCF A;  3IK7 A;  1EEM A;  3F9U A;  2AHE A;  1MTC A;  4YAV A;  4NPB A;  5D9T A;  3LYP A;  1SK0 A;  6GSV A;  4V2M A;  3GST A;  2K8V A;  3J7Y b;  2LRT A;  5D9W A;  2X8C A;  4ML6 A;  1OKT A;  3TGZ A;  1JLW A;  4G10 A;  3F6F A;  3KP9 A;  4KA0 A;  4IW9 A;  2O87 A;  4IJ3 A;  4WEY A;  4PQ1 A;  4F03 A;  4V2N A;  1YF1 A;  2KP2 A;  2CX4 A;  1XW5 A;  3VLN A;  2PU9 C;  4POL A;  1SK2 A;  2IPA A;  5D73 A;  4F9Z A;  2JSZ A;  4NV2 A;  5G1L A;  3TKR A;  3GN3 A;  2KHP A;  5CRW A;  5EPF A;  2H74 A;  5AIV A;  3L9S A;  4BWQ A;  2M80 A;  3P8W A;  3SWL A;  5GSS A;  3FR6 A;  4GQC A;  3EU3 A;  4XS4 B;  1JZO A;  1F6M C;  3ME7 A;  5B6N A;  3A2X A;  1T4Z A;  4MJC A;  4AJ8 A;  4DSS A;  3F3Q A;  1KEB A;  1TXX A;  4FIW A;  2GST A;  2PER A;  3QFB C;  5ECH B;  5IIZ A;  5DQS A;  4ZBA A;  2H6Z A;  3IK9 A;  3I9V 2;  4EVM A;  3FKF A;  3GX0 A;  1LJR A;  1TDI A;  2LRN A;  11GS A;  3GHA A;  2GS3 A;  2PMT A;  3GH9 A;  4WF5 A;  2FWF A;  4OWY A;  2GLR A;  2ZCT A;  4MF5 A;  1DSB A;  2DML A;  2GGT A;  5DDL A;  2CA8 A;  6GSW A;  4RQR A;  4TR3 A;  5D8I A;  3QFA C;  1TK5 B;  4GTU A;  5A4V A;  3GUS A;  2WUL A;  3GL3 A;  4WF4 A;  3GV1 A;  3GX8 A;  1U3A A;  2PGT A;  2YV9 A;  2DC5 A;  3UMA A;  1WOU A;  5A4U A;  4X0X A;  4HZ2 A;  4ID0 A;  4Q5R A;  1TU7 A;  2BJX A;  5AN1 A;  1GUH A;  4E8E A;  3TJJ A;  3D21 A;  1VF4 A;  1GUM A;  1T3B A;  2YJH A;  2YAN A;  1MD3 A;  4KDU A;  5ECN B;  5HFG A;  2O7K A;  4IVF A;  2GZY A;  1K3O A;  4PNF A;  3EUR A;  4XS6 A;  3QR6 A;  1QGV A;  4JBB A;  4POK A;  4PUR A;  2HNL A;  2WS2 A;  4GRF A;  3TDG A;  3GTU B;  3M9K A;  5LCZ A;  4L0U A;  1GTU A;  1I9D A;  1FHE A;  1CQH A;  1K0A A;  19GS A;  4NAX A;  4TR4 A;  2VL2 A;  1QUW A;  1RQM A;  2M72 A;  2P0G A;  3D0Z A;  1GUK A;  2XBQ A;  4FO5 A;  5B6M A;  2TRC P;  1OC3 A;  9GSS A;  4GCI A;  4KB3 A;  2B7J A;  3DGQ A;  1Y25 A;  3TB2 A;  1EV4 A;  4KCA A;  5DAK A;  4BWS A;  1S3C A;  1T7P B;  1TI1 A;  4Q5Q A;  1OKD A;  1Z5Y E;  4IN0 A;  5INY A;  2MMZ A;  3DWV A;  3LXZ A;  4JRR A;  2C3N A;  2YZU A;  2C3T A;  2L57 A;  3BJ5 A;  2XPD A;  3C1S A;  3F63 A;  2O89 A;  3P7X A;  4ACS A;  1HNA A;  1WRY A;  1HYU A;  2RLI A;  2X64 A;  5ID2 A;  1BQ7 A;  3DD3 A;  5IPH A;  2VL9 A;  2WFC A;  2J23 A;  3G7I A;  1MDK A;  5D96 A;  3LXT A;  2HXK A;  5KN3 A;  2JL4 A;  1B48 A;  3A2W A;  3FYG A;  3LYK A;  3QAV A;  1DBY A;  4KGI A;  2VD0 A;  3M1G A;  4GSS A;  4HJM A;  4BA7 A;  1WIK A;  4FYB A;  3ZLP A;  2VCX A;  3GKM A;  5EVO A;  1AIU A;  5ELG A;  4Q5N A;  4OMV A;  3TRX A;  1OC9 A;  4ILF A;  5DJL A;  2VAF A;  4TXV A;  4MPF A;  3US3 A;  5AIS A;  2A4V A;  2HLS A;  5H5Q A;  2DIY A;  1ZCP A;  4K7I A;  2B5Y A;  3DRN A;  2YWO A;  4V1A p;  2DJ1 A;  2H1B A;  2VCT A;  4ECB A;  4F2I A;  2V32 A;  3U6V A;  4GXZ A;  2YP6 A;  1ACV A;  5LNK e;  3FZ9 A;  4ZL7 A;  4K0G A;  3TKS A;  5A4W A;  4MK3 A;  2YNX A;  3CSI A;  2IMK A;  4HUA A;  4KUN A;  5HQP A;  4RUV A;  1M0U A;  1X5D A;  3ZZX A;  3D4T A;  5J3R A;  1PL2 A;  3NOF A;  4K2D A;  2N5B A;  2VLT A;  4KE3 A;  2OE1 A;  2FNO A;  3L78 A;  2DIZ A;  1USB A;  1T00 A;  1OYJ A;  4GST A;  4WET A;  2CAI A;  5KN0 A;  3WYW A;  1B4P A;  3FEU A;  4MF7 A;  1M7T A;  2PUK C;  1H4O A;  4KSO A;  3UAR A;  1WMJ A;  5J9C A;  2H1G A;  1XW6 A;  2X8H A;  3CRT A;  4L0W A;  2GT5 A;  1OE7 A;  2L5L A;  3TKS E;  1O81 A;  3R2Q A;  1SJI A;  4XS4 A;  4FYU A;  3KIJ A;  3VUR A;  2JU5 A;  3GKN A;  1ZMA A;  3RHB A;  1KTE A;  3W8J A;  3M9J A;  3FY7 A;  4ZB9 A;  3BD2 A;  4LMW A;  1VF3 A;  3KGK A;  1O85 A;  2YN1 A;  3U5R E;  1DUG A;  3DYR A;  3VFI A;  2DSA A;  4ECJ A;  3FHK A;  1W4V A;  4K9Z A;  1XVW A;  3UL3 A;  2I81 A;  18GS A;  2PVQ A;  3HVV A;  2E0Q A;  3KJY A;  4TKY A;  4L5L A;  3LFL A;  4KDY A;  4KCE A;  4QL7 A;  3H93 A;  4TW5 A;  4J56 E;  1C72 A;  4TXO B;  2OJL A;  4TVE A;  5GAP D;  1URM A;  4BVY A;  2IMF A;  4XTS A;  3D5J A;  1TU8 A;  3QMX A;  10GS A;  3HY2 A;  4TR1 B;  1TKD B;  3P90 A;  3TCO A;  5GAN D;  3OR5 A;  3IAM 2;  4LA1 A;  2HRN A;  2IWT A;  1YEP A;  3IRA A;  3C71 A;  3KMO A;  3QD9 A;  4LL4 B;  4KDX A;  5IMC A;  4IJI A;  3GTU A;  3GL5 A;  1JZR A;  4PQI A;  4NWY A;  4JU5 A;  1YKC A;  2Z9S A;  4K7N A;  4N0V A;  5L71 A;  1XBS A;  3CSH A;  3ZMK A;  1OVN A;  2WCI A;  3LG6 A;  5JCU A;  2H0H A;  3BCK A;  4ISD A;  3FW2 A;  5KEJ A;  1T4Y A;  2EC4 A;  1AC1 A;  1AQW A;  2DJ3 A;  2RM6 A;  1GTI A;  3QAW A;  1O8X A;  2FWE A;  2OKA A;  3O3T A;  1M2B A;  2GSR A;  4XHM A;  6GSX A;  1JFU A;  1A2J A;  2LTK A;  5HR0 A;  4MH3 A;  1PX7 A;  1NHO A;  6GSU A;  1JHB A;  1DE1 A;  3ZYW A;  4DEJ A;  3IOS A;  1V58 A;  1GLQ A;  2MMO A;  4JZQ A;  3ZIV A;  1XIY A;  2EIQ A;  1JLV A;  2JZT A;  1GH2 A;  3IC4 A;  4I2U A;  4P3Y B;  3LSZ A;  1RW1 A;  2B3S A;  5J4U A;  3APO A;  1JZD A;  2CAQ A;  1EEJ A;  3DIE A;  1T1V A;  1XPV A;  3M0F A;  2AB6 A;  4DSQ A;  3RDW A;  4OFT A;  2FUG 2;  4AGS A;  1TJD A;  2B7K A;  2IMD A;  1XW9 A;  3VPQ A;  4I5Q A;  1YJ6 A;  3F3R A;  4MP4 A;  2LJK A;  2H30 A;  3G7J A;  1R4W A;  5CRE A;  5ENU A;  1ZYE A;  4NXI A;  5ECI B;  2JSY A;  4KW6 A;  3WT2 A;  2VL3 A;  1Z7R A;  3HZ8 A;  3UBK A;  4TN8 A;  2F9S A;  1DE2 A;  2B1L A;  2JZR A;  1N8J A;  4IEL A;  4GLT A;  2HRF A;  3MDK A;  4EO3 A;  1EP8 A;  1G6Y A;  2P31 A;  3W6G A;  3UBL A;  1MEK A;  5C00 A;  3EYT A;  1YKA A;  4XS1 A;  3VWX A;  4ECI A;  1MD4 A;  1O73 A;  1R26 A;  1H75 A;  2ZNM A;  4JE1 A;  2I4A A;  2LNS A;  3QCP A;  4IP1 A;  2AYT A;  1VF1 A;  1XCC A;  4MH2 A;  2R2J A;  4IQ1 A;  4KAE A;  1ILO A;  2E2M A;  4G19 A;  3GKK A;  3DXB A;  4IS0 A;  1GSQ A;  1BX9 A;  2IME A;  4ZL8 A;  1BED A;  1GSD A;  3D22 A;  1MDI A;  2WZ9 A;  1SL1 B;  1M9B A;  2C0F A;  2OE3 A;  4EC0 A;  5ECR B;  5J9B A;  4WBJ A;  1Z6N A;  3MWH A;  3TJG A;  4YQU A;  2L4Q A;  4IQA A;  5IMA A;  2K9F A;  2JAD A;  5ECQ B;  5JWQ B;  2V1M A;  2QSI A;  4OO5 A;  3TJB A;  3KCM A;  2VM2 A;  2FCH A;  3C8E A;  1B4Q A;  5ECP B;  2OBK A;  1E6B A;  4IGJ A;  4PUF C;  5IOW A;  1OE8 A;  3DVW A;  1KBN A;  2H0G A;  3L4N A;  2CX3 A;  5CO3 A;  5IMZ A;  4PUA A;  4HI7 A;  2LRC A;  2CT6 A;  2YOI A;  2K6V A;  1SD8 A;  4PNG A;  3KMN A;  2LST A;  3EWL A;  2LV3 A;  1Y6E A;  3IDV A;  4ML1 A;  2IJY A;  2H8L A;  3ZTL A;  3F0I A;  2VCZ A;  1SKS B;  2GZP A;  5HFK A;  4TXO A;  2CVB A;  2YCD A;  3DKS A;  5ECS A;  1SJZ A;  3LQ7 A;  2VLU A;  1ZYQ B;  2CZ2 A;  4TR1 A;  1X0R A;  3KP8 A;  1F2E A;  3M8N A;  3ZRD A;  5DAL B;  5IMV A;  4F0C A;  1MDJ A;  1ZOF A;  3GFK A;  3N9J A;  3UVT A;  3V1W A;  3C7M A;  4MJB A;  4QL9 A;  4H86 A;  4RI6 A;  5COH A;  1A8L A;  3TKQ A;  5DBQ A;  1ERU A;  1ZL9 A;  1XWG A;  1K0C A;  1SKR B;  3FK8 A;  1X5E A;  3IA1 A;  4ZBB A;  2C3Q A;  2FLS A;  3UJ1 A;  3FZ4 A;  3LWA A;  2BMX A;  4CW9 A;  2CZ3 A;  1FW1 A;  2MMN A;  3VK9 A;  3M3M A;  3FRC A;  3IR4 A;  3L0H A;  5KN1 A;  1WPI A;  1S3D A;  5F06 A;  1NSW A;  1X9W B;  3KEB A;  1TI3 A;  2YWM A;  4IBP A;  3HD5 A;  1YQ1 A;  5G30 A;  3A2V A;  2FHE A;  4GF0 A;  4MAB A;  3TRP A;  4MF6 A;  5G2Z A;  4XRD A;  1ZZY A;  2X99 A;  1XWB A;  3I69 A;  3DML A;  5ECM B;  3APS A;  3Q18 A;  3ZRE A;  3APQ A;  4FH8 A;  5EL8 A;  2LKU A;  5DQY A;  5B7C A;  3TJF A;  4HOJ A;  3PGT A;  4HEA 2;  2C0G A;  4I8B A;  1U88 A;  2H6X A;  1FO5 A;  1IYI A;  1ON4 A;  2GQM A;  2HFD A;  3O76 A;  4XCS A;  2LJA A;  5E4W A;  3ZIT A;  5C04 A;  1THX A;  4HU7 A;  5ECO B;  3A5W A;  3JCM L;  3ZVJ A;  1SJ6 A;  4NHW A;  4ZB6 A;  3H1N A;  1XWA A;  4F82 A;  4IP6 A;  2B6M A;  1X9S B;  1V98 A;  4JR6 A;  5DJM A;  3CSJ A;  4CHS A;  1FAA A;  2MYG A;  2R3X A;  20GS A;  3TOT A;  4OFN A;  5LD0 A;  1QXH A;  1WE0 A;  1SEN A;  3HJM A;  3FZ5 A;  2FD3 A;  1PL1 A;  3QAG A;  4TOP A;  3ED3 A;  1Q98 A;  4NHZ A;  2DJ2 A;  3A3T A;  5ECL B;  3EVI A;  4HS1 A;  2MZC A;  4LL1 B;  5G1K A;  1NW2 A;  4KX4 A;  2H76 A;  2NPB A;  2CVK A;  5GST A;  3IAS 2;  2V6K A;  3VI7 A;  2AUV A;  3EMP A;  5B8B A;  1F3B A;  1O6J A;  2HSH A;  5CAX A;  1K0N A;  2HI7 A;  1GSS A;  2F8F A;  4V2L A;  1SD9 A;  3TKP A;  3VWW A;  2DJK A;  1GNW A;  2VOC A;  1XOB A;  3IE3 A;  2HT9 A;  2V6O A;  1PA3 A;  2PVO C;  1ST9 A;  1K3L A;  4EDY A;  3EIN A;  5FHI A;  4KSM A;  3UEM A;  1VGL A;  4L5O A;  5F0G A;  5H5S A;  3H4K A;  2XBI A;  1Z3E A;  1XZO A;  1M2D A;  2VLV A;  2KOK A;  3GA4 A;  2B1K A;  2GT6 A;  2GZZ A;  2AJQ B;  3RBT A;  3CTF A;  1B9X C;  5HR1 A;  2GQK A;  2IFQ B;  3KM6 A;  4POM A;  2GDR A;  2OAD A;  2CQ9 A;  2YWI A;  1U3I A;  3IV4 A;  3O6T A;  1TK0 B;  4D73 B;  2BTO T;  2OE0 A;  1B8X A;  4TRX A;  1K0O A;  2ON7 A;  4J2F A;  4K6X A;  1A0F A;  2HZE B;  3CTG A;  4OO4 A;  4Q5F A;  5JCW A;  1GUL A;  2REM A;  4CDO A;  3RHC A;  3BCI A;  5FT3 A;  2WRT A;  1U87 A;  1XWC A;  2YV7 A;  4O32 A;  3HDC A;  5JWR B;  6GST A;  2AV4 A;  5CNW A;  2E2G A;  3K8N A;  4LLR A;  2VIM A;  2I1U A;  4N0Z A;  5DVB A;  4N11 A;  1SL0 B;  2I3Y A;  4EUY A;  3ZL5 A;  5CRD A;  4ECC A;  3ZML A;  3KTL A;  3TUE A;  2GQL A;  5DAL A;  1TP9 A;  13GS A;  5CP1 A;  1SKW B;  4K1F A;  2QGV A;  2PWJ A;  4EF0 A;  2LQQ A;  2K8S A;  2VUP A;  3F8U A;  17GS A;  2C4J A;  3FR9 A;  2TIR A;  2H73 A;  5CRH A;  1SL2 B;  7GSS A;  3HJO A;  3PR8 A;  4KND A;  3QDN A;  2C1Y A;  5D9V A;  1THO A;  1NHY A;  3HHV A;  1AUC A;  3RPP A;  1A8Y A;  4N30 A;  2RII A;  3BBY A;  4E8H A;  1A2L A;  1X9M B;  2ALB A;  4HQS A;  2B5X A;  1BAY A;  14GS A;  4K8M A;  5KN2 A;  5AGY A;  2F51 A;  2L59 A;  4ZIJ A;  1JZW A;  2H70 A;  4DSR A;  1EWX A;  3KD0 A;  3FR3 A;  5IMF A;  3Q74 A;  2R37 A;  1GTB A;  4X43 A;  1EP7 A;  5HR3 A;  3PIN A;  2LS5 A;  4IKH A;  1NM3 A;  4ZB8 A;  2N5F A;  1O8W A;  4GWR A;  4IHU A;  1E2Y A;  4HQZ A;  5GZZ B;  2IN3 A;  3EMX A;  3HJP A;  4NMU A;  1AXD A;  2H75 A;  3IPZ A;  4YQM A;  5IOX A;  2L4C A;  2NBS A;  3ZFB A;  1HNB A;  5F05 A;  5EY6 A;  3WGE A;  4WXT A;  1M9A A;  2DLX A;  1Z9H A;  2RM5 A;  2I9H A;  1WWJ A;  2FA8 A;  1ERT A;  2DBC A;  1G7E A;  2H19 A;  5E59 A;  4YH2 A;  1GL8 A;  1GSY A;  2A2R A;  1GRX A;  5JCG A;  1T8E B;  2J9H A;  4I2T A;  5HFI A;  2LEG A;  4OCE A;  1V9W A;  3ME8 A;  4O7H A;  1GTA A;  2VCW A;  4MZC A;  5D93 A;  5F07 A;  4RI7 A;  5F8B A;  3UAP A;  2F8A A;  2C0E A;  1YZX A;  3CBU A;  2CVD A;  3CXG A;  1WP0 A;  3FZA A;  2LUS A;  1FG4 A;  1TK8 B;  3C73 A;  3HXS A;  1R7H A;  2K18 A;  1B9Y C;  1QQ2 A;  1XXU A;  2AAW A;  4MZW A;  4EXJ A;  3F6D A;  4WKW A;  4MLY A;  1X5C A;  4JED A;  4WR4 A;  3NZN A;  4O5R A;  4MJA A;  1PRX A;  4K0N A;  4G2E A;  1BJX A;  3F4T A;  1K3Y A;  1HD2 A;  3GRX A;  1Q4J A;  1YF0 A;  1UVZ A;  2C0D A;  1G0T A;  1FVK A;  3CYN A;  2GSS A;  1F37 A;  1AQV A;  2OAC A;  4YQV A;  2DMM A;  4X1U A;  5DCG A;  1GSE A;  2E7P A;  1FB0 A;  4RQX A;  3N5O A;  3S9F A;  2H0I A;  1ERW A;  2G2Q A;  4L8E A;  3CMI A;  4AJ6 A;  4TR0 A;  3ERG A;  3E0U A;  2HE3 A;  1EGO A;  2H66 A;  1G6W A;  1YDK A;  1A23 A;  1GSU A;  1SYR A;  1UN2 A;  2IFQ A;  4BL7 A;  16GS A;  1VF2 A;  3ZFL A;  4OFM A;  4MCU A;  2G0F A;  2QC7 A;  1PSQ A;  3VWV A;  4PX1 A;  1TRS A;  4GSN A;  1A2M A;  4D73 A;  3BOA A;  3AY8 A;  2P5Q A;  5FWG A;  1M99 A;  4F0B A;  3UOM A;  2WB9 A;  2HZE A;  2MMA A;  5A5K A;  2IIY A;  1TRW A;  4I97 A;  3KZQ A;  3MAK A;  4MPG A;  3LEF A;  1EGR A;  4EL1 A;  3LJR A;  2HZF A;  4YAP A;  2V2G A;  1F9M A;  1F3A A;  3MNG A;  1GSF A;  1UA5 A;  2H1A A;  1A24 A;  2WJU A;  1XOA A;  3IHQ A;  1LBK A;  3G7Y A;  4N10 A;  3HVS A;  1BYE A;  1ZGN A;  1WJK A;  1XVQ A;  1HNC A;  1QFN A;  1J08 A;  4O92 A;  2H72 A;  3LOR A;  2ON5 A;  2L6D A;  2NDO A;  1AQX A;  3E9J B;  2GTU A;  3EU4 A;  3QOU A;  5D9X A;  2C8U A;  1J0F A;  3NIV A;  5IMD A;  3QPM A;  4PXO A;  1Z6M A;  1OC8 A;  2VCQ A;  2KLX A;  1SU9 A;  2VO4 A;  2C80 A;  5CYY A;  5DCH A;  2N5A A;  4BVX A;  3GNJ A;  1EOG A;  1GLP A;  1AW9 A;  1V2A A;  1OAZ A;  1R5P A;  2JAC A;  3G9B A;  1K0B A;  3IXR A;  1GP1 A;  2XC2 A;  3RPN A;  4EE0 A;  2X8G A;  2GVP A;  1GNE A;  1PKW A;  2GSQ A;  4PGT A;  3ERF A;  3I43 A;  6GSS A;  4MA9 A;  3VWU A;  2H71 A;  4WR5 A;  1LU4 A;  4DVC A;  5J41 A;  1TRV A;  3DEX A;  3TJK A;  3Q19 A;  2YWN A;  3TRQ A;  4I6X A;  3ERW A;  5G31 A;  2YJ7 A;  3W8S A;  2QKE A;  1SK1 A;  2TRX A;  3VPT A;  1CQG A;  12GS A;  1K0M A;  1PKZ A;  2A2S A;  3HVX A;  3WD6 A;  1PQN A;  2M46 A;  2MBS A;  3LGC A;  4HU9 A;  4WBR D;  4LMV A;  8GSS A;  5ABR A;  2PN8 A;  4MJE A;  2PPT A;  1EV9 A;  2CV4 A;  3I6A A;  3KXO A;  2HYX A;  3PH9 A;  1EZK A;  2MBT A;  1A0R P;  3GYK A;  4ZL9 A;  1R5A A;  2NTO A;  3L9U A;  2OBI A;  4K7O A;  4G9H A;  5G5F A;  2H6Y A;  4POB A;  3WGX A;  3J7Y k;  5IM9 A;  2VL2 C;  4DSS B;  2P5R A;  4ZIL A;  3KH9 A;  1HQO A;  3SBC A;  3C1R A;  2YZH A;  1FOV A;  4MDC A;  3DVX A;  1QK8 A;  1V57 A;  3H8Q A;  2O85 A;  3D4M A;  2XPE A;  2FWH A;  4HJ2 A;  6GSY A;  1RK4 A;  1VRS D;  1IYH A;  3F4R A;  1G7O A;  2YPM A;  4XIH A;  4ZXG A;  2B5E A;  1XFL A;  4BPY A;  2VCV A;  1J9B A;  2RUE A;  2R6K A;  2KUC A;  2NVL A;  4AF2 A;  4XRA A;  4EKZ A;  3HYP A;  4PQH A; 
#chains in the Genus database with same CATH topology
 1U6T A;  2DJ0 A;  3VI5 A;  3CQF A;  3Q6O A;  3EE2 A;  3WT1 A;  5JWO B;  3ZIJ A;  3RAZ A;  1AAZ A;  3HCZ A;  2HSY A;  3UIW A;  1FVJ A;  1PX6 A;  22GS A;  5KOW A;  2WGR A;  3EC3 A;  3WGD A;  2LJR A;  3TOU A;  2ZUP A;  4GQF A;  4MZB A;  1TOF A;  5IQY A;  1Z7P A;  4ZBD A;  1N2A A;  1M2A A;  2FA4 A;  1TW9 A;  1YY7 A;  3GH6 A;  1S3A A;  1TRU A;  1M3J A;  2V41 A;  2D2Z A;  3H79 A;  3L9V A;  1XWK A;  3IBH A;  1YEX A;  5G5E A;  1K0D A;  5CRG A;  3E3E A;  3GUR A;  5HR2 A;  3MSZ A;  3F4S A;  3ZVJ D;  2FWG A;  1UC7 A;  1KNG A;  3ISO A;  4MMM A;  2EIR A;  3GIX A;  2R5G A;  4JR4 A;  2XHF A;  3D6I A;  3HZ4 A;  4OD7 A;  3TKS C;  1PD2 1;  2L6C A;  2VD1 A;  5ECK B;  2H01 A;  1BG5 A;  5DAK B;  2EIO A;  1FB6 A;  1TTZ A;  4HZ4 A;  1QMV A;  1EOH A;  5IPG A;  4Z7X A;  1PMT A;  2IMI A;  2R4V A;  1O7U A;  1ERV A;  2VM1 A;  3HKR A;  2O8V B;  3GSS A;  4FYC A;  2FGX A;  1V40 A;  2LQO A;  4J57 E;  1PN9 A;  2ES7 A;  4NV5 A;  5H5R A;  2DJJ A;  3GKX A;  3GMF A;  3MIX A;  5ID2 B;  4HDE A;  4ULX A;  2L5O A;  5J5N A;  2KP1 A;  3P2A A;  2FY6 A;  1PGT A;  5B8A A;  5IO0 A;  1ML6 A;  1GWC A;  3HA9 A;  3KH7 A;  4QQ7 A;  2WDU A;  3UVH A;  5IO2 A;  1W89 A;  4AJ7 A;  2JZS A;  2F3M A;  4KH7 A;  2OA7 A;  2PBJ A;  4EDZ A;  2H1D A;  1SYX A;  5ELA A;  1I5G A;  3KTB A;  2LNT A;  2IL3 A;  4V1A g;  1ABA A;  1OC9 B;  3CRU A;  2RUF A;  5AIX A;  4OCF A;  3IK7 A;  1EEM A;  3F9U A;  2AHE A;  1MTC A;  4YAV A;  4NPB A;  5D9T A;  3LYP A;  1SK0 A;  6GSV A;  4V2M A;  3GST A;  2K8V A;  3J7Y b;  2LRT A;  5D9W A;  2X8C A;  4ML6 A;  1OKT A;  3TGZ A;  1JLW A;  4G10 A;  3F6F A;  3KP9 A;  4KA0 A;  4IW9 A;  2O87 A;  4IJ3 A;  4WEY A;  4PQ1 A;  4F03 A;  4V2N A;  1YF1 A;  2KP2 A;  4G0L A;  2CX4 A;  1XW5 A;  3VLN A;  2PU9 C;  4POL A;  1SK2 A;  2IPA A;  5D73 A;  4F9Z A;  2JSZ A;  4NV2 A;  5G1L A;  3TKR A;  3GN3 A;  2KHP A;  5CRW A;  5EPF A;  2H74 A;  5AIV A;  3L9S A;  4BWQ A;  2M80 A;  3P8W A;  3SWL A;  5GSS A;  3FR6 A;  4GQC A;  3EU3 A;  4XS4 B;  1JZO A;  1F6M C;  3ME7 A;  5B6N A;  3A2X A;  1T4Z A;  4MJC A;  4AJ8 A;  4DSS A;  3F3Q A;  1KEB A;  1TXX A;  4FIW A;  2GST A;  2PER A;  3QFB C;  5ECH B;  5IIZ A;  4K2X A;  5DQS A;  4ZBA A;  2H6Z A;  3IK9 A;  3I9V 2;  4EVM A;  3FKF A;  3GX0 A;  1LJR A;  1TDI A;  2LRN A;  11GS A;  3GHA A;  2GS3 A;  2PMT A;  3GH9 A;  4WF5 A;  2FWF A;  4OWY A;  2GLR A;  2ZCT A;  4MF5 A;  1DSB A;  2DML A;  2GGT A;  5DDL A;  2CA8 A;  6GSW A;  4RQR A;  4TR3 A;  5D8I A;  3QFA C;  1TK5 B;  4GTU A;  5A4V A;  3GUS A;  2WUL A;  3GL3 A;  4WF4 A;  3GV1 A;  3GX8 A;  1U3A A;  2PGT A;  2YV9 A;  2DC5 A;  3UMA A;  1WOU A;  4BVY B;  5A4U A;  4X0X A;  4HZ2 A;  4ID0 A;  4Q5R A;  1TU7 A;  2BJX A;  5AN1 A;  1GUH A;  4E8E A;  3TJJ A;  3D21 A;  1VF4 A;  1GUM A;  1T3B A;  2DKH A;  2YJH A;  2YAN A;  1MD3 A;  4KDU A;  5ECN B;  5HFG A;  2O7K A;  4IVF A;  2GZY A;  1K3O A;  4PNF A;  3EUR A;  4XS6 A;  3QR6 A;  1QGV A;  4JBB A;  4POK A;  4PUR A;  2HNL A;  2WS2 A;  4GRF A;  3TDG A;  3GTU B;  1PN0 A;  3M9K A;  5LCZ A;  4L0U A;  1GTU A;  4HSC X;  1I9D A;  2HRA A;  1FHE A;  1CQH A;  1K0A A;  19GS A;  4NAX A;  4TR4 A;  2VL2 A;  1QUW A;  1RQM A;  2M72 A;  2P0G A;  3D0Z A;  1GUK A;  2XBQ A;  4FO5 A;  5B6M A;  2TRC P;  1OC3 A;  9GSS A;  4GCI A;  4KB3 A;  2B7J A;  3DGQ A;  4ICY A;  1Y25 A;  3TB2 A;  1EV4 A;  4KCA A;  5DAK A;  4BWS A;  1S3C A;  1T7P B;  1TI1 A;  4Q5Q A;  1OKD A;  1Z5Y E;  4IN0 A;  5INY A;  2MMZ A;  3DWV A;  3LXZ A;  4JRR A;  2C3N A;  2YZU A;  2C3T A;  2L57 A;  3BJ5 A;  2XPD A;  3C1S A;  3F63 A;  2O89 A;  3P7X A;  4ACS A;  1HNA A;  1WRY A;  1HYU A;  2RLI A;  2X64 A;  5ID2 A;  2R0C A;  1BQ7 A;  3DD3 A;  5IPH A;  2VL9 A;  2WFC A;  2J23 A;  3G7I A;  1MDK A;  5D96 A;  3LXT A;  2HXK A;  5KN3 A;  2JL4 A;  1B48 A;  3A2W A;  3IC8 A;  3FYG A;  3LYK A;  3QAV A;  1DBY A;  4KGI A;  2VD0 A;  3M1G A;  4GSS A;  4HJM A;  4BA7 A;  1WIK A;  4FYB A;  3ZLP A;  2VCX A;  3GKM A;  5EVO A;  1AIU A;  5ELG A;  4Q5N A;  4OMV A;  3TRX A;  1OC9 A;  4ILF A;  5DJL A;  2VAF A;  4TXV A;  4MPF A;  3US3 A;  5AIS A;  2A4V A;  2HLS A;  5H5Q A;  2DIY A;  1ZCP A;  4K7I A;  2B5Y A;  3DRN A;  2YWO A;  4V1A p;  2DJ1 A;  2H1B A;  2VCT A;  4ECB A;  4F2I A;  2V32 A;  3U6V A;  4GXZ A;  2YP6 A;  1ACV A;  5LNK e;  3FZ9 A;  4ZL7 A;  4K0G A;  3TKS A;  4KF9 A;  5A4W A;  4MK3 A;  2YNX A;  3CSI A;  2IMK A;  4HUA A;  4KUN A;  5HQP A;  4RUV A;  1M0U A;  1X5D A;  3ZZX A;  3D4T A;  5J3R A;  1PL2 A;  3NOF A;  4K2D A;  2N5B A;  2VLT A;  4KE3 A;  2OE1 A;  2FNO A;  3L78 A;  2DIZ A;  4YKG A;  1USB A;  1T00 A;  1OYJ A;  4GST A;  4WET A;  2CAI A;  1M3I A;  4YKF A;  5KN0 A;  3WYW A;  1B4P A;  3FEU A;  4MF7 A;  2X49 A;  1M7T A;  2PUK C;  1H4O A;  4KSO A;  3UAR A;  1WMJ A;  5J9C A;  2H1G A;  1XW6 A;  2X8H A;  3CRT A;  4L0W A;  2GT5 A;  1OE7 A;  2L5L A;  3TKS E;  1O81 A;  3R2Q A;  1SJI A;  4XS4 A;  4FYU A;  3KIJ A;  3VUR A;  2JU5 A;  3GKN A;  1ZMA A;  3RHB A;  1KTE A;  3W8J A;  3M9J A;  3FY7 A;  4ZB9 A;  3BD2 A;  4LMW A;  1VF3 A;  3KGK A;  1O85 A;  2YN1 A;  3U5R E;  1DUG A;  3DYR A;  3VFI A;  2DSA A;  4ECJ A;  3FHK A;  1W4V A;  4K9Z A;  1XVW A;  3UL3 A;  2HSM A;  2I81 A;  18GS A;  2PVQ A;  3HVV A;  2E0Q A;  3KJY A;  4TKY A;  4L5L A;  3LFL A;  4KDY A;  4KCE A;  4QL7 A;  3H93 A;  4TW5 A;  4J56 E;  1C72 A;  4TXO B;  2OJL A;  4TVE A;  5GAP D;  1URM A;  4BVY A;  2IMF A;  4XTS A;  3D5J A;  1TU8 A;  3QMX A;  10GS A;  3HY2 A;  4TR1 B;  1TKD B;  3P90 A;  3TCO A;  5GAN D;  3OR5 A;  3IAM 2;  5BMU A;  4LA1 A;  2HRN A;  2IWT A;  4A5P A;  1YEP A;  3IRA A;  3C71 A;  3KMO A;  3QD9 A;  4LL4 B;  4Z2U A;  4KDX A;  5IMC A;  4IJI A;  3GTU A;  3GL5 A;  1JZR A;  4PQI A;  4NWY A;  4JU5 A;  1YKC A;  2Z9S A;  4K7N A;  4N0V A;  5L71 A;  1XBS A;  3CSH A;  3ZMK A;  1OVN A;  2WCI A;  3LG6 A;  5JCU A;  2H0H A;  3BCK A;  4ISD A;  3FW2 A;  5KEJ A;  3A5I A;  1T4Y A;  2EC4 A;  1AC1 A;  1AQW A;  2DJ3 A;  2RM6 A;  1GTI A;  3QAW A;  1O8X A;  2FWE A;  2OKA A;  3O3T A;  1M2B A;  2GSR A;  4XHM A;  6GSX A;  1JFU A;  1A2J A;  2LTK A;  5HR0 A;  4MH3 A;  1PX7 A;  1NHO A;  6GSU A;  1JHB A;  1DE1 A;  3ZYW A;  4DEJ A;  3IOS A;  1V58 A;  1GLQ A;  2MMO A;  4JZQ A;  4G0I A;  1XIY A;  3ZIV A;  2EIQ A;  4G0K A;  1JLV A;  2JZT A;  1GH2 A;  5KOX A;  3IC4 A;  4I2U A;  4P3Y B;  3LSZ A;  1RW1 A;  2B3S A;  5J4U A;  3APO A;  1JZD A;  2CAQ A;  1EEJ A;  4EIP A;  3DIE A;  1T1V A;  4PTS A;  1XPV A;  3M0F A;  2AB6 A;  4DSQ A;  3RDW A;  4OFT A;  2FUG 2;  4AGS A;  1TJD A;  2B7K A;  2IMD A;  1XW9 A;  3VPQ A;  4I5Q A;  1YJ6 A;  3F3R A;  4MP4 A;  2LJK A;  4O5Q A;  2H30 A;  3G7J A;  3EPT A;  1R4W A;  4USS A;  5CRE A;  1FOH A;  1ZYE A;  4NXI A;  5ENU A;  5ECI B;  2JSY A;  4KW6 A;  3WT2 A;  2VL3 A;  1Z7R A;  3HZ8 A;  3UBK A;  4TN8 A;  2F9S A;  1DE2 A;  2B1L A;  2JZR A;  1N8J A;  4IEL A;  4GLT A;  2HRF A;  3MDK A;  4EO3 A;  1EP8 A;  1G6Y A;  2P31 A;  3W6G A;  3UBL A;  1MEK A;  5C00 A;  3EYT A;  1YKA A;  4XS1 A;  3VWX A;  4ECI A;  1MD4 A;  1O73 A;  1R26 A;  1H75 A;  2ZNM A;  4JE1 A;  2I4A A;  2LNS A;  3QCP A;  4IP1 A;  2AYT A;  1VF1 A;  1XCC A;  4MH2 A;  2R2J A;  4IQ1 A;  4KAE A;  1ILO A;  2E2M A;  4G19 A;  3GKK A;  3DXB A;  4IS0 A;  1GSQ A;  1BX9 A;  2IME A;  4ZL8 A;  1BED A;  1GSD A;  3D22 A;  1MDI A;  2WZ9 A;  1SL1 B;  1M9B A;  2C0F A;  2OE3 A;  4EC0 A;  5ECR B;  5J9B A;  4WBJ A;  1Z6N A;  3MWH A;  3TJG A;  4YQU A;  2L4Q A;  4IQA A;  5IMA A;  2K9F A;  2JAD A;  5ECQ B;  5JWQ B;  2V1M A;  2QSI A;  4OO5 A;  3TJB A;  3KCM A;  2VM2 A;  2FCH A;  3C8E A;  1B4Q A;  5ECP B;  2OBK A;  4X4J A;  1E6B A;  4IGJ A;  4PUF C;  5IOW A;  1OE8 A;  3DVW A;  1KBN A;  2H0G A;  3L4N A;  2CX3 A;  5CO3 A;  5IMZ A;  4PUA A;  4HI7 A;  2LRC A;  2CT6 A;  2YOI A;  2K6V A;  1SD8 A;  4K5R A;  4PNG A;  3KMN A;  2LST A;  3EWL A;  2LV3 A;  1Y6E A;  3IDV A;  4ML1 A;  2IJY A;  1ZYN A;  2H8L A;  3ZTL A;  3F0I A;  2VCZ A;  1SKS B;  2GZP A;  1ZYP A;  5HFK A;  4TXO A;  2CVB A;  2YCD A;  3DKS A;  5ECS A;  1SJZ A;  3LQ7 A;  2VLU A;  1ZYQ B;  2CZ2 A;  4TR1 A;  1X0R A;  3KP8 A;  1F2E A;  3M8N A;  3ZRD A;  5DAL B;  5IMV A;  4F0C A;  1MDJ A;  1ZOF A;  3GFK A;  3N9J A;  3UVT A;  4MNN A;  3V1W A;  3C7M A;  4MJB A;  4QL9 A;  4H86 A;  4RI6 A;  5COH A;  1A8L A;  3TKQ A;  5DBQ A;  1ERU A;  1ZL9 A;  1XWG A;  1K0C A;  1SKR B;  3FK8 A;  1X5E A;  3IA1 A;  4ZBB A;  2C3Q A;  2FLS A;  3UJ1 A;  3FZ4 A;  3LWA A;  2BMX A;  4CW9 A;  2HRK A;  2CZ3 A;  1FW1 A;  2MMN A;  3VK9 A;  3M3M A;  3FRC A;  3IR4 A;  3L0H A;  5KN1 A;  1WPI A;  1S3D A;  5F06 A;  1NSW A;  1X9W B;  3KEB A;  1XG8 A;  1TI3 A;  2YWM A;  4IBP A;  3HD5 A;  1YQ1 A;  5G30 A;  3A2V A;  2FHE A;  4GF0 A;  4MAB A;  3TRP A;  4MF6 A;  5G2Z A;  4XRD A;  1ZZY A;  2X99 A;  1XWB A;  3I69 A;  3DML A;  5ECM B;  3APS A;  3Q18 A;  3ZRE A;  3APQ A;  4FH8 A;  5EL8 A;  2LKU A;  5DQY A;  5B7C A;  3TJF A;  4HOJ A;  3PGT A;  4HEA 2;  2C0G A;  4I8B A;  1U88 A;  2H6X A;  1FO5 A;  1IYI A;  1ON4 A;  2GQM A;  2HFD A;  3O76 A;  4XCS A;  2LJA A;  5E4W A;  3ZIT A;  5C04 A;  1THX A;  4HU7 A;  5ECO B;  3A5W A;  3JCM L;  3ZVJ A;  1SJ6 A;  4NHW A;  4ZB6 A;  3H1N A;  1XWA A;  4F82 A;  4IP6 A;  4CY6 A;  2B6M A;  1X9S B;  1V98 A;  4JR6 A;  5DJM A;  3CSJ A;  4CHS A;  1FAA A;  2MYG A;  2R3X A;  20GS A;  3TOT A;  4OFN A;  5LD0 A;  1QXH A;  1WE0 A;  3R3E A;  1SEN A;  3HJM A;  3FZ5 A;  2FD3 A;  1PL1 A;  3QAG A;  4TOP A;  3ED3 A;  1Q98 A;  4NHZ A;  2DJ2 A;  3A3T A;  5ECL B;  3EVI A;  3FMW A;  4HS1 A;  2MZC A;  4LL1 B;  5G1K A;  1NW2 A;  4KX4 A;  2H76 A;  2NPB A;  2CVK A;  5GST A;  3IAS 2;  4Z2R A;  2V6K A;  3VI7 A;  2AUV A;  3EMP A;  5B8B A;  1F3B A;  1O6J A;  2HSH A;  5CAX A;  1K0N A;  2HI7 A;  1GSS A;  2F8F A;  4V2L A;  1SD9 A;  3TKP A;  3VWW A;  2QA2 A;  2DJK A;  1GNW A;  2VOC A;  1XOB A;  3IE3 A;  2HT9 A;  2V6O A;  1PA3 A;  3HVN A;  2PVO C;  1ST9 A;  1K3L A;  4EDY A;  3EIN A;  5FHI A;  2DKI A;  4KSM A;  3UEM A;  1VGL A;  4L5O A;  5F0G A;  5H5S A;  3H4K A;  2XBI A;  1Z3E A;  1XZO A;  1M2D A;  2VLV A;  2KOK A;  3GA4 A;  2B1K A;  2GT6 A;  2GZZ A;  4CY8 A;  2AJQ B;  3RBT A;  3CTF A;  1B9X C;  5HR1 A;  2GQK A;  2IFQ B;  3KM6 A;  4POM A;  4BL7 B;  2GDR A;  2OAD A;  2CQ9 A;  2YWI A;  1U3I A;  4K5S A;  3IV4 A;  3O6T A;  1TK0 B;  4D73 B;  2BTO T;  2OE0 A;  1B8X A;  4TRX A;  1K0O A;  2ON7 A;  4J2F A;  4K6X A;  1A0F A;  2HZE B;  3CTG A;  4OO4 A;  4Q5F A;  5JCW A;  1GUL A;  2REM A;  4CDO A;  3RHC A;  3BCI A;  5FT3 A;  2WRT A;  1U87 A;  1XWC A;  2YV7 A;  4O32 A;  3HDC A;  5JWR B;  6GST A;  2AV4 A;  5CNW A;  2E2G A;  3K8N A;  4LLR A;  2VIM A;  2I1U A;  4N0Z A;  5DVB A;  4N11 A;  1SL0 B;  2I3Y A;  4EUY A;  3ZL5 A;  5CRD A;  4ECC A;  3ZML A;  3KTL A;  3TUE A;  2GQL A;  1S3R A;  5DAL A;  1TP9 A;  13GS A;  5CP1 A;  1SKW B;  4K1F A;  2QGV A;  5BRT A;  2QA1 A;  2PWJ A;  4EF0 A;  2LQQ A;  2K8S A;  2VUP A;  3F8U A;  17GS A;  2C4J A;  3FR9 A;  2TIR A;  2H73 A;  5CRH A;  1SL2 B;  7GSS A;  3HJO A;  3PR8 A;  4KND A;  3QDN A;  2C1Y A;  5D9V A;  1THO A;  1NHY A;  3HHV A;  1AUC A;  3RPP A;  1A8Y A;  4O5U A;  4N30 A;  2RII A;  3BBY A;  4E8H A;  1A2L A;  1X9M B;  2ALB A;  4HQS A;  2B5X A;  2R0P A;  4BVX B;  1BAY A;  14GS A;  4K8M A;  5KN2 A;  5AGY A;  2F51 A;  2L59 A;  4ZIJ A;  1JZW A;  2H70 A;  4DSR A;  1EWX A;  3KD0 A;  3FR3 A;  5IMF A;  3Q74 A;  2R37 A;  1GTB A;  4X43 A;  1EP7 A;  5HR3 A;  4BIK A;  3PIN A;  2LS5 A;  4IKH A;  1NM3 A;  4ZB8 A;  2N5F A;  1O8W A;  4GWR A;  4IHU A;  1E2Y A;  4HQZ A;  5GZZ B;  2IN3 A;  3EMX A;  3HJP A;  4NMU A;  1AXD A;  2H75 A;  3IPZ A;  4YQM A;  5IOX A;  2L4C A;  2NBS A;  3ZFB A;  1HNB A;  5F05 A;  5EY6 A;  3WGE A;  4WXT A;  1PFO A;  1M9A A;  2DLX A;  1Z9H A;  2RM5 A;  2I9H A;  1WWJ A;  2FA8 A;  1ERT A;  3LW9 A;  2DBC A;  1G7E A;  2H19 A;  5E59 A;  4YH2 A;  1GL8 A;  1GSY A;  2A2R A;  2X4A A;  1GRX A;  5JCG A;  1T8E B;  2J9H A;  4I2T A;  5HFI A;  2LEG A;  4OCE A;  1V9W A;  3ME8 A;  4O7H A;  1GTA A;  2VCW A;  4MZC A;  5D93 A;  5F07 A;  4RI7 A;  5F8B A;  3UAP A;  2F8A A;  2C0E A;  1YZX A;  3CBU A;  2CVD A;  3CXG A;  1WP0 A;  3FZA A;  2LUS A;  1FG4 A;  1TK8 B;  3C73 A;  3HXS A;  1R7H A;  2K18 A;  1B9Y C;  1QQ2 A;  1XXU A;  2AAW A;  4MZW A;  4EXJ A;  3F6D A;  4WKW A;  4MLY A;  1X5C A;  4JED A;  4WR4 A;  3NZN A;  4O5R A;  4MJA A;  1PRX A;  4K0N A;  4G2E A;  1BJX A;  3F4T A;  1K3Y A;  1HD2 A;  3GRX A;  1Q4J A;  1YF0 A;  1UVZ A;  2C0D A;  1G0T A;  1FVK A;  3CYN A;  2GSS A;  1F37 A;  1AQV A;  2OAC A;  4YQV A;  2DMM A;  4X1U A;  5DCG A;  1GSE A;  2E7P A;  1FB0 A;  4RQX A;  3N5O A;  3S9F A;  2H0I A;  1ERW A;  2G2Q A;  4L8E A;  3CMI A;  4AJ6 A;  4TR0 A;  3ERG A;  3E0U A;  2HE3 A;  1EGO A;  2H66 A;  1G6W A;  1YDK A;  1A23 A;  1GSU A;  1SYR A;  1UN2 A;  2IFQ A;  4BL7 A;  16GS A;  1VF2 A;  3ZFL A;  4OFM A;  4MCU A;  2G0F A;  2QC7 A;  4Z2T A;  1PSQ A;  3VWV A;  4PX1 A;  1TRS A;  4GSN A;  1A2M A;  4D73 A;  3BOA A;  3AY8 A;  2P5Q A;  5FWG A;  1M99 A;  4F0B A;  3UOM A;  2WB9 A;  2HZE A;  2MMA A;  5A5K A;  2IIY A;  1TRW A;  4I97 A;  3KZQ A;  3MAK A;  4MPG A;  3LEF A;  1EGR A;  4EL1 A;  3LJR A;  2HZF A;  4YAP A;  2V2G A;  1F9M A;  2R0G A;  1F3A A;  3MNG A;  1GSF A;  1UA5 A;  2H1A A;  1A24 A;  2WJU A;  2UZ8 A;  4EIQ A;  1XOA A;  3IHQ A;  1LBK A;  3G7Y A;  4N10 A;  3HVS A;  1BYE A;  1ZGN A;  3MYD A;  1WJK A;  1XVQ A;  1HNC A;  1QFN A;  1J08 A;  4O92 A;  2H72 A;  3LOR A;  2ON5 A;  2L6D A;  2NDO A;  1AQX A;  3E9J B;  2A2P A;  2GTU A;  3EU4 A;  3QOU A;  5D9X A;  2C8U A;  1J0F A;  3NIV A;  5IMD A;  3QPM A;  4PXO A;  1Z6M A;  1OC8 A;  2VCQ A;  2KLX A;  1SU9 A;  2VO4 A;  2C80 A;  5CYY A;  5DCH A;  2N5A A;  4BVX A;  3GNJ A;  1EOG A;  1GLP A;  1AW9 A;  1V2A A;  1OAZ A;  1R5P A;  2JAC A;  3G9B A;  1K0B A;  3IXR A;  1GP1 A;  2XC2 A;  3RPN A;  4EE0 A;  2X8G A;  2GVP A;  1GNE A;  1PKW A;  2GSQ A;  4PGT A;  3ERF A;  3I43 A;  6GSS A;  4MA9 A;  3VWU A;  2H71 A;  4WR5 A;  1LU4 A;  4DVC A;  5J41 A;  1TRV A;  3DEX A;  3TJK A;  3Q19 A;  2YWN A;  3TRQ A;  4I6X A;  3ERW A;  5G31 A;  2YJ7 A;  3W8S A;  2QKE A;  1SK1 A;  2TRX A;  3VPT A;  1CQG A;  12GS A;  1K0M A;  1PKZ A;  2A2S A;  3HVX A;  3WD6 A;  1PQN A;  2M46 A;  2MBS A;  3LGC A;  4HU9 A;  4WBR D;  3PPU A;  4LMV A;  8GSS A;  5ABR A;  2PN8 A;  4MJE A;  2PPT A;  1EV9 A;  2CV4 A;  3I6A A;  3KXO A;  2HYX A;  3PH9 A;  1EZK A;  2MBT A;  1A0R P;  3GYK A;  4ZL9 A;  1R5A A;  2NTO A;  3L9U A;  2OBI A;  4K7O A;  4G9H A;  5G5F A;  2H6Y A;  4POB A;  3WGX A;  3J7Y k;  5IM9 A;  2VL2 C;  4DSS B;  2P5R A;  4ZIL A;  3KH9 A;  1HQO A;  3SBC A;  3C1R A;  3IHG A;  2YZH A;  1FOV A;  4MDC A;  3DVX A;  1QK8 A;  1V57 A;  3H8Q A;  2O85 A;  3D4M A;  2XPE A;  2FWH A;  4FQU A;  4HJ2 A;  6GSY A;  1RK4 A;  1VRS D;  2A4H A;  1IYH A;  3F4R A;  1G7O A;  2YPM A;  4XIH A;  4ZXG A;  2B5E A;  1XFL A;  4BPY A;  2VCV A;  1J9B A;  2RUE A;  2R6K A;  2KUC A;  2NVL A;  4AF2 A;  4XRA A;  4EKZ A;  3HYP A;  4PQH A; 
#chains in the Genus database with same CATH homology
 1U6T A;  2DJ0 A;  3VI5 A;  3Q6O A;  3EE2 A;  3WT1 A;  5JWO B;  3ZIJ A;  3RAZ A;  1AAZ A;  3HCZ A;  2HSY A;  3UIW A;  1FVJ A;  1PX6 A;  22GS A;  5KOW A;  2WGR A;  3EC3 A;  3WGD A;  2LJR A;  3TOU A;  2ZUP A;  4GQF A;  4MZB A;  1TOF A;  5IQY A;  1Z7P A;  4ZBD A;  1N2A A;  1M2A A;  2FA4 A;  1TW9 A;  1YY7 A;  3GH6 A;  1S3A A;  1TRU A;  2V41 A;  2D2Z A;  3H79 A;  3L9V A;  1XWK A;  3IBH A;  1YEX A;  5G5E A;  1K0D A;  5CRG A;  3E3E A;  3GUR A;  5HR2 A;  3MSZ A;  3F4S A;  3ZVJ D;  2FWG A;  1UC7 A;  1KNG A;  3ISO A;  4MMM A;  2EIR A;  3GIX A;  2R5G A;  4JR4 A;  2XHF A;  3D6I A;  3HZ4 A;  4OD7 A;  3TKS C;  1PD2 1;  2L6C A;  2VD1 A;  5ECK B;  2H01 A;  1BG5 A;  5DAK B;  2EIO A;  1FB6 A;  1TTZ A;  4HZ4 A;  1QMV A;  1EOH A;  5IPG A;  4Z7X A;  1PMT A;  2IMI A;  2R4V A;  1O7U A;  1ERV A;  2VM1 A;  3HKR A;  2O8V B;  3GSS A;  4FYC A;  2FGX A;  1V40 A;  2LQO A;  4J57 E;  1PN9 A;  2ES7 A;  4NV5 A;  5H5R A;  2DJJ A;  3GKX A;  3GMF A;  3MIX A;  5ID2 B;  4HDE A;  4ULX A;  2L5O A;  5J5N A;  2KP1 A;  3P2A A;  2FY6 A;  1PGT A;  5B8A A;  5IO0 A;  1ML6 A;  1GWC A;  3HA9 A;  3KH7 A;  4QQ7 A;  2WDU A;  3UVH A;  5IO2 A;  1W89 A;  4AJ7 A;  2JZS A;  2F3M A;  4KH7 A;  2OA7 A;  2PBJ A;  4EDZ A;  2H1D A;  1SYX A;  5ELA A;  1I5G A;  3KTB A;  2LNT A;  2IL3 A;  4V1A g;  1ABA A;  1OC9 B;  3CRU A;  2RUF A;  5AIX A;  4OCF A;  3IK7 A;  1EEM A;  3F9U A;  2AHE A;  1MTC A;  4YAV A;  4NPB A;  5D9T A;  3LYP A;  1SK0 A;  6GSV A;  4V2M A;  3GST A;  2K8V A;  3J7Y b;  2LRT A;  5D9W A;  2X8C A;  4ML6 A;  1OKT A;  3TGZ A;  1JLW A;  4G10 A;  3F6F A;  3KP9 A;  4KA0 A;  4IW9 A;  2O87 A;  4IJ3 A;  4WEY A;  4PQ1 A;  4F03 A;  4V2N A;  1YF1 A;  2KP2 A;  4G0L A;  2CX4 A;  1XW5 A;  3VLN A;  2PU9 C;  4POL A;  1SK2 A;  2IPA A;  5D73 A;  4F9Z A;  2JSZ A;  4NV2 A;  5G1L A;  3TKR A;  3GN3 A;  2KHP A;  5CRW A;  5EPF A;  2H74 A;  5AIV A;  3L9S A;  4BWQ A;  2M80 A;  3P8W A;  3SWL A;  5GSS A;  3FR6 A;  4GQC A;  3EU3 A;  4XS4 B;  1JZO A;  1F6M C;  3ME7 A;  5B6N A;  3A2X A;  1T4Z A;  4MJC A;  4AJ8 A;  4DSS A;  3F3Q A;  1KEB A;  1TXX A;  4FIW A;  2GST A;  2PER A;  3QFB C;  5ECH B;  5IIZ A;  4K2X A;  5DQS A;  4ZBA A;  2H6Z A;  3IK9 A;  3I9V 2;  4EVM A;  3FKF A;  3GX0 A;  1LJR A;  1TDI A;  2LRN A;  11GS A;  3GHA A;  2GS3 A;  2PMT A;  3GH9 A;  4WF5 A;  2FWF A;  4OWY A;  2GLR A;  2ZCT A;  4MF5 A;  1DSB A;  2DML A;  2GGT A;  5DDL A;  2CA8 A;  6GSW A;  4RQR A;  4TR3 A;  5D8I A;  3QFA C;  1TK5 B;  4GTU A;  5A4V A;  3GUS A;  2WUL A;  3GL3 A;  4WF4 A;  3GV1 A;  3GX8 A;  1U3A A;  2PGT A;  2YV9 A;  2DC5 A;  3UMA A;  1WOU A;  4BVY B;  5A4U A;  4X0X A;  4HZ2 A;  4ID0 A;  4Q5R A;  1TU7 A;  2BJX A;  5AN1 A;  1GUH A;  4E8E A;  3TJJ A;  3D21 A;  1VF4 A;  1GUM A;  1T3B A;  2DKH A;  2YJH A;  2YAN A;  1MD3 A;  4KDU A;  5ECN B;  5HFG A;  2O7K A;  4IVF A;  2GZY A;  1K3O A;  4PNF A;  3EUR A;  4XS6 A;  3QR6 A;  1QGV A;  4JBB A;  4POK A;  4PUR A;  2HNL A;  2WS2 A;  4GRF A;  3TDG A;  3GTU B;  1PN0 A;  3M9K A;  5LCZ A;  4L0U A;  1GTU A;  1I9D A;  2HRA A;  1FHE A;  1CQH A;  1K0A A;  19GS A;  4NAX A;  4TR4 A;  2VL2 A;  1QUW A;  1RQM A;  2M72 A;  2P0G A;  3D0Z A;  1GUK A;  2XBQ A;  4FO5 A;  5B6M A;  2TRC P;  1OC3 A;  9GSS A;  4GCI A;  4KB3 A;  2B7J A;  3DGQ A;  4ICY A;  1Y25 A;  3TB2 A;  1EV4 A;  4KCA A;  5DAK A;  4BWS A;  1S3C A;  1T7P B;  1TI1 A;  4Q5Q A;  1OKD A;  1Z5Y E;  4IN0 A;  5INY A;  2MMZ A;  3DWV A;  3LXZ A;  4JRR A;  2C3N A;  2YZU A;  2C3T A;  2L57 A;  3BJ5 A;  2XPD A;  3C1S A;  3F63 A;  2O89 A;  3P7X A;  4ACS A;  1HNA A;  1WRY A;  1HYU A;  2RLI A;  2X64 A;  5ID2 A;  2R0C A;  1BQ7 A;  3DD3 A;  5IPH A;  2VL9 A;  2WFC A;  2J23 A;  3G7I A;  1MDK A;  5D96 A;  3LXT A;  2HXK A;  5KN3 A;  2JL4 A;  1B48 A;  3A2W A;  3IC8 A;  3FYG A;  3LYK A;  3QAV A;  1DBY A;  4KGI A;  2VD0 A;  3M1G A;  4GSS A;  4HJM A;  4BA7 A;  1WIK A;  4FYB A;  3ZLP A;  2VCX A;  3GKM A;  5EVO A;  1AIU A;  5ELG A;  4Q5N A;  4OMV A;  3TRX A;  1OC9 A;  4ILF A;  5DJL A;  2VAF A;  4TXV A;  4MPF A;  3US3 A;  5AIS A;  2A4V A;  2HLS A;  5H5Q A;  2DIY A;  1ZCP A;  4K7I A;  2B5Y A;  3DRN A;  2YWO A;  4V1A p;  2DJ1 A;  2H1B A;  2VCT A;  4ECB A;  4F2I A;  2V32 A;  3U6V A;  4GXZ A;  2YP6 A;  1ACV A;  5LNK e;  3FZ9 A;  4ZL7 A;  4K0G A;  3TKS A;  4KF9 A;  5A4W A;  4MK3 A;  2YNX A;  3CSI A;  2IMK A;  4HUA A;  4KUN A;  5HQP A;  4RUV A;  1M0U A;  1X5D A;  3ZZX A;  3D4T A;  5J3R A;  1PL2 A;  3NOF A;  4K2D A;  2N5B A;  2VLT A;  4KE3 A;  2OE1 A;  2FNO A;  3L78 A;  2DIZ A;  4YKG A;  1USB A;  1T00 A;  1OYJ A;  4GST A;  4WET A;  2CAI A;  4YKF A;  5KN0 A;  3WYW A;  1B4P A;  3FEU A;  4MF7 A;  2X49 A;  1M7T A;  2PUK C;  1H4O A;  4KSO A;  3UAR A;  1WMJ A;  5J9C A;  2H1G A;  1XW6 A;  2X8H A;  3CRT A;  4L0W A;  2GT5 A;  1OE7 A;  2L5L A;  3TKS E;  1O81 A;  3R2Q A;  1SJI A;  4XS4 A;  4FYU A;  3KIJ A;  3VUR A;  2JU5 A;  3GKN A;  1ZMA A;  3RHB A;  1KTE A;  3W8J A;  3M9J A;  3FY7 A;  4ZB9 A;  3BD2 A;  4LMW A;  1VF3 A;  3KGK A;  1O85 A;  2YN1 A;  3U5R E;  1DUG A;  3DYR A;  3VFI A;  2DSA A;  4ECJ A;  3FHK A;  1W4V A;  4K9Z A;  1XVW A;  3UL3 A;  2HSM A;  2I81 A;  18GS A;  2PVQ A;  3HVV A;  2E0Q A;  3KJY A;  4TKY A;  4L5L A;  3LFL A;  4KDY A;  4KCE A;  4QL7 A;  3H93 A;  4TW5 A;  4J56 E;  1C72 A;  4TXO B;  2OJL A;  4TVE A;  5GAP D;  1URM A;  4BVY A;  2IMF A;  4XTS A;  3D5J A;  1TU8 A;  3QMX A;  10GS A;  3HY2 A;  4TR1 B;  1TKD B;  3P90 A;  3TCO A;  5GAN D;  3OR5 A;  3IAM 2;  5BMU A;  4LA1 A;  2HRN A;  2IWT A;  4A5P A;  1YEP A;  3IRA A;  3C71 A;  3KMO A;  3QD9 A;  4LL4 B;  4Z2U A;  4KDX A;  5IMC A;  4IJI A;  3GTU A;  3GL5 A;  1JZR A;  4PQI A;  4NWY A;  4JU5 A;  1YKC A;  2Z9S A;  4K7N A;  4N0V A;  5L71 A;  1XBS A;  3CSH A;  3ZMK A;  1OVN A;  2WCI A;  3LG6 A;  5JCU A;  2H0H A;  3BCK A;  4ISD A;  3FW2 A;  5KEJ A;  3A5I A;  1T4Y A;  2EC4 A;  1AC1 A;  1AQW A;  2DJ3 A;  2RM6 A;  1GTI A;  3QAW A;  1O8X A;  2FWE A;  2OKA A;  3O3T A;  1M2B A;  2GSR A;  4XHM A;  6GSX A;  1JFU A;  1A2J A;  2LTK A;  5HR0 A;  4MH3 A;  1PX7 A;  1NHO A;  6GSU A;  1JHB A;  1DE1 A;  3ZYW A;  4DEJ A;  3IOS A;  1V58 A;  1GLQ A;  2MMO A;  4JZQ A;  4G0I A;  1XIY A;  3ZIV A;  2EIQ A;  4G0K A;  1JLV A;  2JZT A;  1GH2 A;  5KOX A;  3IC4 A;  4I2U A;  4P3Y B;  3LSZ A;  1RW1 A;  2B3S A;  5J4U A;  3APO A;  1JZD A;  2CAQ A;  1EEJ A;  4EIP A;  3DIE A;  1T1V A;  4PTS A;  1XPV A;  3M0F A;  2AB6 A;  4DSQ A;  3RDW A;  4OFT A;  2FUG 2;  4AGS A;  1TJD A;  2B7K A;  2IMD A;  1XW9 A;  3VPQ A;  4I5Q A;  1YJ6 A;  3F3R A;  4MP4 A;  2LJK A;  4O5Q A;  2H30 A;  3G7J A;  3EPT A;  1R4W A;  4USS A;  5CRE A;  1FOH A;  1ZYE A;  4NXI A;  5ENU A;  5ECI B;  2JSY A;  4KW6 A;  3WT2 A;  2VL3 A;  1Z7R A;  3HZ8 A;  3UBK A;  4TN8 A;  2F9S A;  1DE2 A;  2B1L A;  2JZR A;  1N8J A;  4IEL A;  4GLT A;  2HRF A;  3MDK A;  4EO3 A;  1EP8 A;  1G6Y A;  2P31 A;  3W6G A;  3UBL A;  1MEK A;  5C00 A;  3EYT A;  1YKA A;  4XS1 A;  3VWX A;  4ECI A;  1MD4 A;  1O73 A;  1R26 A;  1H75 A;  2ZNM A;  4JE1 A;  2I4A A;  2LNS A;  3QCP A;  4IP1 A;  2AYT A;  1VF1 A;  1XCC A;  4MH2 A;  2R2J A;  4IQ1 A;  4KAE A;  1ILO A;  2E2M A;  4G19 A;  3GKK A;  3DXB A;  4IS0 A;  1GSQ A;  1BX9 A;  2IME A;  4ZL8 A;  1BED A;  1GSD A;  3D22 A;  1MDI A;  2WZ9 A;  1SL1 B;  1M9B A;  2C0F A;  2OE3 A;  4EC0 A;  5ECR B;  5J9B A;  4WBJ A;  1Z6N A;  3MWH A;  3TJG A;  4YQU A;  2L4Q A;  4IQA A;  5IMA A;  2K9F A;  2JAD A;  5ECQ B;  5JWQ B;  2V1M A;  2QSI A;  4OO5 A;  3TJB A;  3KCM A;  2VM2 A;  2FCH A;  3C8E A;  1B4Q A;  5ECP B;  2OBK A;  4X4J A;  1E6B A;  4IGJ A;  4PUF C;  5IOW A;  1OE8 A;  3DVW A;  1KBN A;  2H0G A;  3L4N A;  2CX3 A;  5CO3 A;  5IMZ A;  4PUA A;  4HI7 A;  2LRC A;  2CT6 A;  2YOI A;  2K6V A;  1SD8 A;  4K5R A;  4PNG A;  3KMN A;  2LST A;  3EWL A;  2LV3 A;  1Y6E A;  3IDV A;  4ML1 A;  2IJY A;  1ZYN A;  2H8L A;  3ZTL A;  3F0I A;  2VCZ A;  1SKS B;  2GZP A;  1ZYP A;  5HFK A;  4TXO A;  2CVB A;  2YCD A;  3DKS A;  5ECS A;  1SJZ A;  3LQ7 A;  2VLU A;  1ZYQ B;  2CZ2 A;  4TR1 A;  1X0R A;  3KP8 A;  1F2E A;  3M8N A;  3ZRD A;  5DAL B;  5IMV A;  4F0C A;  1MDJ A;  1ZOF A;  3GFK A;  3N9J A;  3UVT A;  4MNN A;  3V1W A;  3C7M A;  4MJB A;  4QL9 A;  4H86 A;  4RI6 A;  5COH A;  1A8L A;  3TKQ A;  5DBQ A;  1ERU A;  1ZL9 A;  1XWG A;  1K0C A;  1SKR B;  3FK8 A;  1X5E A;  3IA1 A;  4ZBB A;  2C3Q A;  2FLS A;  3UJ1 A;  3FZ4 A;  3LWA A;  2BMX A;  4CW9 A;  2HRK A;  2CZ3 A;  1FW1 A;  2MMN A;  3VK9 A;  3M3M A;  3FRC A;  3IR4 A;  3L0H A;  5KN1 A;  1WPI A;  1S3D A;  5F06 A;  1NSW A;  1X9W B;  3KEB A;  1TI3 A;  2YWM A;  4IBP A;  3HD5 A;  1YQ1 A;  5G30 A;  3A2V A;  2FHE A;  4GF0 A;  4MAB A;  3TRP A;  4MF6 A;  5G2Z A;  4XRD A;  1ZZY A;  2X99 A;  1XWB A;  3I69 A;  3DML A;  5ECM B;  3APS A;  3Q18 A;  3ZRE A;  3APQ A;  4FH8 A;  5EL8 A;  2LKU A;  5DQY A;  5B7C A;  3TJF A;  4HOJ A;  3PGT A;  4HEA 2;  2C0G A;  4I8B A;  1U88 A;  2H6X A;  1FO5 A;  1IYI A;  1ON4 A;  2GQM A;  2HFD A;  3O76 A;  4XCS A;  2LJA A;  5E4W A;  3ZIT A;  5C04 A;  1THX A;  4HU7 A;  5ECO B;  3A5W A;  3JCM L;  3ZVJ A;  1SJ6 A;  4NHW A;  4ZB6 A;  3H1N A;  1XWA A;  4F82 A;  4IP6 A;  4CY6 A;  2B6M A;  1X9S B;  1V98 A;  4JR6 A;  5DJM A;  3CSJ A;  4CHS A;  1FAA A;  2MYG A;  2R3X A;  20GS A;  3TOT A;  4OFN A;  5LD0 A;  1QXH A;  1WE0 A;  3R3E A;  1SEN A;  3HJM A;  3FZ5 A;  2FD3 A;  1PL1 A;  3QAG A;  4TOP A;  3ED3 A;  1Q98 A;  4NHZ A;  2DJ2 A;  3A3T A;  5ECL B;  3EVI A;  3FMW A;  4HS1 A;  2MZC A;  4LL1 B;  5G1K A;  1NW2 A;  4KX4 A;  2H76 A;  2NPB A;  2CVK A;  5GST A;  3IAS 2;  4Z2R A;  2V6K A;  3VI7 A;  2AUV A;  3EMP A;  5B8B A;  1F3B A;  1O6J A;  2HSH A;  5CAX A;  1K0N A;  2HI7 A;  1GSS A;  2F8F A;  4V2L A;  1SD9 A;  3TKP A;  3VWW A;  2QA2 A;  2DJK A;  1GNW A;  2VOC A;  1XOB A;  3IE3 A;  2HT9 A;  2V6O A;  1PA3 A;  2PVO C;  1ST9 A;  1K3L A;  4EDY A;  3EIN A;  5FHI A;  2DKI A;  4KSM A;  3UEM A;  1VGL A;  4L5O A;  5F0G A;  5H5S A;  3H4K A;  2XBI A;  1Z3E A;  1XZO A;  1M2D A;  2VLV A;  2KOK A;  3GA4 A;  2B1K A;  2GT6 A;  2GZZ A;  4CY8 A;  2AJQ B;  3RBT A;  3CTF A;  1B9X C;  5HR1 A;  2GQK A;  2IFQ B;  3KM6 A;  4POM A;  4BL7 B;  2GDR A;  2OAD A;  2CQ9 A;  2YWI A;  1U3I A;  4K5S A;  3IV4 A;  3O6T A;  1TK0 B;  4D73 B;  2BTO T;  2OE0 A;  1B8X A;  4TRX A;  1K0O A;  2ON7 A;  4J2F A;  4K6X A;  1A0F A;  2HZE B;  3CTG A;  4OO4 A;  4Q5F A;  5JCW A;  1GUL A;  2REM A;  4CDO A;  3RHC A;  3BCI A;  5FT3 A;  2WRT A;  1U87 A;  1XWC A;  2YV7 A;  4O32 A;  3HDC A;  5JWR B;  6GST A;  2AV4 A;  5CNW A;  2E2G A;  3K8N A;  4LLR A;  2VIM A;  2I1U A;  4N0Z A;  5DVB A;  4N11 A;  1SL0 B;  2I3Y A;  4EUY A;  3ZL5 A;  5CRD A;  4ECC A;  3ZML A;  3KTL A;  3TUE A;  2GQL A;  5DAL A;  1TP9 A;  13GS A;  5CP1 A;  1SKW B;  4K1F A;  2QGV A;  5BRT A;  2QA1 A;  2PWJ A;  4EF0 A;  2LQQ A;  2K8S A;  2VUP A;  3F8U A;  17GS A;  2C4J A;  3FR9 A;  2TIR A;  2H73 A;  5CRH A;  1SL2 B;  7GSS A;  3HJO A;  3PR8 A;  4KND A;  3QDN A;  2C1Y A;  5D9V A;  1THO A;  1NHY A;  3HHV A;  1AUC A;  3RPP A;  1A8Y A;  4O5U A;  4N30 A;  2RII A;  3BBY A;  4E8H A;  1A2L A;  1X9M B;  2ALB A;  4HQS A;  2B5X A;  2R0P A;  4BVX B;  1BAY A;  14GS A;  4K8M A;  5KN2 A;  5AGY A;  2F51 A;  2L59 A;  4ZIJ A;  1JZW A;  2H70 A;  4DSR A;  1EWX A;  3KD0 A;  3FR3 A;  5IMF A;  3Q74 A;  2R37 A;  1GTB A;  4X43 A;  1EP7 A;  5HR3 A;  3PIN A;  2LS5 A;  4IKH A;  1NM3 A;  4ZB8 A;  2N5F A;  1O8W A;  4GWR A;  4IHU A;  1E2Y A;  4HQZ A;  5GZZ B;  2IN3 A;  3EMX A;  3HJP A;  4NMU A;  1AXD A;  2H75 A;  3IPZ A;  4YQM A;  5IOX A;  2L4C A;  2NBS A;  3ZFB A;  1HNB A;  5F05 A;  5EY6 A;  3WGE A;  4WXT A;  1M9A A;  2DLX A;  1Z9H A;  2RM5 A;  2I9H A;  1WWJ A;  2FA8 A;  1ERT A;  3LW9 A;  2DBC A;  1G7E A;  2H19 A;  5E59 A;  4YH2 A;  1GL8 A;  1GSY A;  2A2R A;  2X4A A;  1GRX A;  5JCG A;  1T8E B;  2J9H A;  4I2T A;  5HFI A;  2LEG A;  4OCE A;  1V9W A;  3ME8 A;  4O7H A;  1GTA A;  2VCW A;  4MZC A;  5D93 A;  5F07 A;  4RI7 A;  5F8B A;  3UAP A;  2F8A A;  2C0E A;  1YZX A;  3CBU A;  2CVD A;  3CXG A;  1WP0 A;  3FZA A;  2LUS A;  1FG4 A;  1TK8 B;  3C73 A;  3HXS A;  1R7H A;  2K18 A;  1B9Y C;  1QQ2 A;  1XXU A;  2AAW A;  4MZW A;  4EXJ A;  3F6D A;  4WKW A;  4MLY A;  1X5C A;  4JED A;  4WR4 A;  3NZN A;  4O5R A;  4MJA A;  1PRX A;  4K0N A;  4G2E A;  1BJX A;  3F4T A;  1K3Y A;  1HD2 A;  3GRX A;  1Q4J A;  1YF0 A;  1UVZ A;  2C0D A;  1G0T A;  1FVK A;  3CYN A;  2GSS A;  1F37 A;  1AQV A;  2OAC A;  4YQV A;  2DMM A;  4X1U A;  5DCG A;  1GSE A;  2E7P A;  1FB0 A;  4RQX A;  3N5O A;  3S9F A;  2H0I A;  1ERW A;  2G2Q A;  4L8E A;  3CMI A;  4AJ6 A;  4TR0 A;  3ERG A;  3E0U A;  2HE3 A;  1EGO A;  2H66 A;  1G6W A;  1YDK A;  1A23 A;  1GSU A;  1SYR A;  1UN2 A;  2IFQ A;  4BL7 A;  16GS A;  1VF2 A;  3ZFL A;  4OFM A;  4MCU A;  2G0F A;  2QC7 A;  4Z2T A;  1PSQ A;  3VWV A;  4PX1 A;  1TRS A;  4GSN A;  1A2M A;  4D73 A;  3BOA A;  3AY8 A;  2P5Q A;  5FWG A;  1M99 A;  4F0B A;  3UOM A;  2WB9 A;  2HZE A;  2MMA A;  5A5K A;  2IIY A;  1TRW A;  4I97 A;  3KZQ A;  3MAK A;  4MPG A;  3LEF A;  1EGR A;  4EL1 A;  3LJR A;  2HZF A;  4YAP A;  2V2G A;  1F9M A;  2R0G A;  1F3A A;  3MNG A;  1GSF A;  1UA5 A;  2H1A A;  1A24 A;  2WJU A;  2UZ8 A;  4EIQ A;  1XOA A;  3IHQ A;  1LBK A;  3G7Y A;  4N10 A;  3HVS A;  1BYE A;  1ZGN A;  3MYD A;  1WJK A;  1XVQ A;  1HNC A;  1QFN A;  1J08 A;  4O92 A;  2H72 A;  3LOR A;  2ON5 A;  2L6D A;  2NDO A;  1AQX A;  3E9J B;  2A2P A;  2GTU A;  3EU4 A;  3QOU A;  5D9X A;  2C8U A;  1J0F A;  3NIV A;  5IMD A;  3QPM A;  4PXO A;  1Z6M A;  1OC8 A;  2VCQ A;  2KLX A;  1SU9 A;  2VO4 A;  2C80 A;  5CYY A;  5DCH A;  2N5A A;  4BVX A;  3GNJ A;  1EOG A;  1GLP A;  1AW9 A;  1V2A A;  1OAZ A;  1R5P A;  2JAC A;  3G9B A;  1K0B A;  3IXR A;  1GP1 A;  2XC2 A;  3RPN A;  4EE0 A;  2X8G A;  2GVP A;  1GNE A;  1PKW A;  2GSQ A;  4PGT A;  3ERF A;  3I43 A;  6GSS A;  4MA9 A;  3VWU A;  2H71 A;  4WR5 A;  1LU4 A;  4DVC A;  5J41 A;  1TRV A;  3DEX A;  3TJK A;  3Q19 A;  2YWN A;  3TRQ A;  4I6X A;  3ERW A;  5G31 A;  2YJ7 A;  3W8S A;  2QKE A;  1SK1 A;  2TRX A;  3VPT A;  1CQG A;  12GS A;  1K0M A;  1PKZ A;  2A2S A;  3HVX A;  3WD6 A;  1PQN A;  2M46 A;  2MBS A;  3LGC A;  4HU9 A;  4WBR D;  3PPU A;  4LMV A;  8GSS A;  5ABR A;  2PN8 A;  4MJE A;  2PPT A;  1EV9 A;  2CV4 A;  3I6A A;  3KXO A;  2HYX A;  3PH9 A;  1EZK A;  2MBT A;  1A0R P;  3GYK A;  4ZL9 A;  1R5A A;  2NTO A;  3L9U A;  2OBI A;  4K7O A;  4G9H A;  5G5F A;  2H6Y A;  4POB A;  3WGX A;  3J7Y k;  5IM9 A;  2VL2 C;  4DSS B;  2P5R A;  4ZIL A;  3KH9 A;  1HQO A;  3SBC A;  3C1R A;  3IHG A;  2YZH A;  1FOV A;  4MDC A;  3DVX A;  1QK8 A;  1V57 A;  3H8Q A;  2O85 A;  3D4M A;  2XPE A;  2FWH A;  4FQU A;  4HJ2 A;  6GSY A;  1RK4 A;  1VRS D;  2A4H A;  1IYH A;  3F4R A;  1G7O A;  2YPM A;  4XIH A;  4ZXG A;  2B5E A;  1XFL A;  4BPY A;  2VCV A;  1J9B A;  2RUE A;  2R6K A;  2KUC A;  2NVL A;  4AF2 A;  4XRA A;  4EKZ A;  3HYP A;  4PQH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...