2TIRA

Crystal structure analysis of a mutant escherichia coli thioredoxin in which lysine 36 is replaced by glutamic acid
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
108
structure length
108
Chain Sequence
b'SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCEMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THIOREDOXIN
publication title Crystal structure analysis of a mutant Escherichia coli thioredoxin in which lysine 36 is replaced by glutamic acid.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Electron transport
total genus 31
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 1993-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2tirA00
2VCXA 4CHSA 5ENUA 4DVCA 1TU7A 1FOVA 3QR6A 2GQMA 1T3BA 3MSZA 4NHWA 2H8LA 4PUFC 5ELAA 2H75A 1RK4A 4TR0A 1MTCA 3GX0A 4BWSA 3ERFA 5A4WA 2H71A 1SK1A 5D73A 4ZILA 3VWWA 2GS3A 3PH9A 2DLXA 2DC5A 4TXOB 4TW5A 3DWVA 1UN2A 5IO2A 3F3QA 2J23A 2VL2A 2DJKA 3ISOA 2GDRA 3L4NA 1EWXA 1TXXA 1G7EA 4AJ7A 2RUEA 1ON4A 1B9YC 3HJOA 2NDOA 3TKQA 2CA8A 1T00A 2LRNA 2WCIA 4IVFA 5ID2B 2JL4A 2RIIA 1Y6EA 5ECQB 3DVWA 4F82A 5G31A 2R5GA 2VIMA 2D2ZA 1GNEA 3NOFA 3SBCA 2H76A 2F8AA 2L4QA 2GVPA 1JZRA 4MZWA 4L8EA 3P90A 5J41A 1O8WA 2IJYA 4EF0A 2VOCA 2HFDA 3EMXA 3UARA 1WE0A 3FZ4A 5C04A 2H1GA 4POKA 1HQOA 3H79A 4KE3A 1ZCPA 2C0GA 3WT2A 4IQ1A 2L6CA 3KH7A 4I8BA 2HZFA 2PU9C 1USBA 2H6XA 2R4VA 4ECIA 1ILOA 1GULA 4RQRA 1VF3A 5F07A 1OC9A 1T4YA 1THOA 1GTIA 2V6OA 3KXOA 2GQLA 4POBA 3TOUA 1JHBA 1TOFA 2PPTA 2OBKA 4DSRA 5ECRB 3GH9A 1X5CA 4G9HA 2J9HA 2LEGA 4ECBA 3UL3A 1AQWA 2FUG2 2ES7A 1ERTA 4L5OA 2VLVA 1PRXA 2PBJA 2ALBA 3IK7A 1SL1B 1M9AA 3ZFLA 2HSYA 2FWHA 5ECPB 3J7Yk 3LSZA 5J4UA 2YV7A 1TRWA 1SKRB 3IAM2 3H93A 3TJFA 2MZCA 4HZ4A 4IHUA 4TR4A 1Z7PA 3F4RA 3FK8A 2FGXA 4XTSA 1M2AA 3TKSC 1BAYA 1A2LA 1MDIA 2DBCA 2BMXA 2HE3A 1G6WA 2YN1A 5J9BA 3ERWA 5DVBA 2V2GA 1TK0B 2PWJA 1S3DA 1R7HA 4IGJA 2I1UA 4HQSA 4ML1A 2P31A 1AXDA 3C8EA 3RHBA 1G7OA 4ID0A 3BCKA 5ELGA 4QL9A 6GSVA 3HVVA 2GSQA 1VF2A 4MPFA 1K0MA 1GLQA 2EC4A 1A2MA 3M9KA 3IE3A 3C1SA 2VL2C 4AGSA 5F06A 2VCVA 3HCZA 4YH2A 3GL5A 5IMAA 1GSQA 3M0FA 3LFLA 5F05A 2HSHA 3ZVJA 4Q5QA 1ACVA 2GLRA 2LRCA 4OFTA 4E8EA 5E4WA 1X9SB 1XW6A 5B6NA 2CX4A 5ECHB 4N30A 2B1KA 4XRDA 1Q98A 3KCMA 4BWQA 2DSAA 4JZQA 3UVTA 2CAQA 5G1KA 2L59A 4JBBA 4Q5RA 1SD8A 3EU4A 1HD2A 2RLIA 1DUGA 5HQPA 3GKKA 4LMVA 3GX8A 1JLWA 4N0VA 4EC0A 4KA0A 4JR4A 2HI7A 5FWGA 2YP6A 1SKSB 4FYBA 3UMAA 2B5XA 4IQAA 1WJKA 1GSUA 3VI5A 3DVXA 2IIYA 4PNFA 2C3QA 1OE7A 2CV4A 2QSIA 2KP1A 1OC8A 5JCUA 1MD4A 1EP8A 2GSSA 4K7OA 1XWCA 3ERGA 1J0FA 9GSSA 1WWJA 3UBLA 4V2NA 1EP7A 4XS4A 4OO4A 3ZTLA 3KP9A 1Y25A 3G7IA 3LEFA 3J7Yb 4NV2A 2MMZA 1GTUA 2CT6A 4TR1A 2RUFA 3APQA 8GSSA 2L6DA 2YCDA 3EWLA 2F3MA 4K0GA 3N5OA 3APOA 3PINA 1WP0A 5C00A 4KDYA 3IHQA 1A8LA 2AYTA 1EEMA 2N5FA 3KP8A 1YKCA 2FY6A 1A0FA 3RAZA 2VCTA 4N0ZA 1EV9A 4MZCA 4PNGA 3IA1A 5IMDA 6GSYA 3WYWA 5DALB 3UIWA 1TTZA 4HJMA 3GNJA 2X99A 2X8HA 2VUPA 19GSA 5JWRB 2DJ2A 4WBJA 1XWBA 2HNLA 4RUVA 3E3EA 4DSSB 4I97A 5J3RA 4I6XA 3TB2A 1Z5YE 3QMXA 20GSA 5L71A 4TXOA 2Z9SA 1TP9A 2P5QA 10GSA 3HKRA 4ZXGA 4HI7A 1K0BA 1WPIA 1TK5B 1THXA 4D73A 4JEDA 1MDJA 1T4ZA 1R4WA 5ECOB 3ZREA 1GP1A 1XPVA 1JZDA 4EL1A 2C3TA 2PVOC 4ZBDA 2I3YA 3M9JA 5ECLB 3EC3A 3QAGA 4JU5A 5HR0A 1T8EB 1AQXA 3GSTA 2YWIA 4LLRA 1EGOA 3I6AA 3EURA 1U3AA 4YAPA 1V40A 4MMMA 1SJ6A 1LJRA 5DQYA 3GHAA 1ZMAA 1K0OA 3A2WA 3VLNA 5G5EA 3U5RE 4K7NA 1F37A 2MYGA 2V41A 3PGTA 2OACA 4LA1A 2MMOA 2WB9A 3UBKA 3L9SA 5IMZA 2QGVA 3C7MA 4RQXA 3Q74A 2N5BA 1FHEA 4POLA 3MWHA 2G2QA 4GSNA 1IYHA 1EV4A 2C3NA 3L0HA 1SENA 4Q5NA 1PQNA 4ZBBA 2FWFA 3FZ9A 4I5QA 2I81A 4KAEA 3UAPA 5CP1A 1O7UA 4WXTA 2XBIA 4OFNA 4PGTA 2H0GA 2PN8A 1URMA 2P0GA 4GQFA 4YAVA 1PX7A 1PSQA 3FKFA 2PUKC 4KDXA 6GSTA 5JCWA 3SWLA 1Z9HA 4MPGA 2I9HA 3QAVA 5H5QA 5HFKA 1XXUA 3O6TA 4MJEA 1QK8A 5IMVA 2IWTA 3GKNA 5DAKB 4K6XA 3GTUB 3HXSA 2GT5A 2PERA 4KDUA 2IMDA 4YQMA 3L9UA 3Q6OA 5A4UA 5GSTA 1DE1A 2LNTA 4ML6A 2LSTA 5ABRA 3KMNA 1M2DA 3LYKA 5G2ZA 1SJZA 2VL9A 3GKXA 5CRDA 3IR4A 2A2RA 4ULXA 3D0ZA 2X8GA 1KEBA 3GH6A 2LV3A 4O92A 4OD7A 5KEJA 2B1LA 2QKEA 2YANA 2VD1A 2OADA 2C80A 3HJPA 3F9UA 2HXKA 1GTAA 1MEKA 1J9BA 3DXBA 1SK0A 2ON5A 2C0FA 3WGXA 4IN0A 2M72A 4CDOA 4KUNA 2WULA 3M3MA 5GSSA 3ED3A 2KUCA 1B8XA 4OCFA 2MBTA 4MDCA 4WEYA 3TGZA 1KTEA 3KZQA 1EGRA 4GQCA 3CMIA 2EIRA 2HLSA 1BJXA 1VRSD 3IAS2 1M2BA 3TKPA 2OE0A 3VWVA 4MF5A 4MH3A 1XCCA 1M0UA 3ZLPA 3DGQA 2AB6A 1DSBA 1I5GA 2VLUA 2MMAA 2A4VA 3HVXA 4PQIA 4V2MA 2B7KA 1O85A 5D9TA 1M7TA 4OCEA 3M1GA 2H66A 1O6JA 2N5AA 1A8YA 3DYRA 4MH2A 3VWXA 2C0EA 1NSWA 4L5LA 2TRCP 1MD3A 2B7JA 3EMPA 2JZTA 3IOSA 1G6YA 1XIYA 4NWYA 3I69A 3LXZA 4L0UA 1WRYA 2H0IA 1JZWA 4OO5A 3VFIA 2OE1A 2FHEA 4IBPA 2VL3A 1PKZA 3EYTA 1TW9A 1BG5A 3F6DA 2YZHA 4XS1A 1LU4A 4ZL8A 14GSA 3KTLA 4ZBAA 3FZ5A 3GKMA 4FH8A 4MABA 3TCOA 1GUHA 1OYJA 1EOGA 2H74A 2XC2A 3FR3A 2F51A 2VCQA 3LWAA 4H86A 3HVSA 1GSEA 5EL8A 2OJLA 3FW2A 1G0TA 2JSZA 3KJYA 2K8VA 3HDCA 3IRAA 3TJGA 4GSSA 2HYXA 2H30A 4MCUA 3VPTA 2LS5A 1VF1A 2NBSA 1V2AA 2OBIA 4J2FA 4MF7A 1Q4JA 3QAWA 1FW1A 3RPPA 2CVDA 4DSQA 3GN3A 1UC7A 3BJ5A 3ZITA 2IFQA 2B6MA 2FWGA 5G5FA 1YJ6A 1YKAA 3TKSE 5IOXA 4HZ2A 1ZL9A 2M46A 1GLPA 4K9ZA 6GSUA 2IMEA 2PVQA 2FD3A 4IJ3A 1K0AA 4KGIA 5D9XA 1QXHA 1ZGNA 1YZXA 5LCZA 5DALA 2B5YA 1B9XC 2LJAA 3HD5A 3IBHA 2EIOA 4ZL7A 1TJDA 5AN1A 2DIZA 5CRWA 3LXTA 5HFGA 3ZRDA 2VM2A 4V1Ag 2GZPA 5KN1A 2NTOA 2HZEA 3G7JA 4V1Ap 1PL2A 5CO3A 2LUSA 4MP4A 3D5JA 3EU3A 2CX3A 1OC9B 5COHA 1K3LA 3VPQA 2JU5A 1AC1A 1XWGA 2BTOT 4F9ZA 1SL0B 3D4TA 3C71A 1PN9A 2VCZA 6GSSA 2L5OA 1O73A 3U6VA 4AJ8A 4ISDA 1SL2B 3CBUA 2X8CA 5ECKB 4MJCA 1QFNA 2CVBA 3GMFA 1GSSA 1AUCA 4IJIA 1RW1A 1AIUA 3LGCA 1TI1A 3UEMA 5H5SA 5IMCA 1XFLA 3UJ1A 5CRHA 3GYKA 3I43A 2YOIA 5DCGA 1J08A 4EDZA 3ZMKA 5A4VA 2O85A 1U6TA 5KN3A 1TI3A 3P8WA 3D4MA 3LORA 1S3CA 2LJRA 1F3AA 2V6KA 2YWOA 12GSA 4ECJA 5CNWA 2DIYA 4QL7A 4G10A 1OVNA 3GL3A 1V9WA 3ME8A 1QGVA 1CQHA 3TJBA 4HDEA 4IELA 2L5LA 1FG4A 3TKRA 1Z6MA 4MZBA 1VF4A 5E59A 1A24A 3H1NA 1XVQA 2H19A 3D22A 4O32A 1GRXA 5FHIA 2LQQA 2O89A 3BBYA 3EE2A 2HT9A 6GSWA 3GURA 3G7YA 1N2AA 2LJKA 2O7KA 2H6ZA 1YEXA 1YF1A 3F4TA 5HR2A 5JWOB 4NAXA 5IPHA 3ME7A 2YWNA 4ILFA 1YF0A 2FLSA 3C73A 5INYA 3TRXA 2OE3A 3CRUA 2ZNMA 4XS6A 1SKWB 1AW9A 5AIXA 2AJQB 5ECMB 2NVLA 5IOWA 1ZOFA 2LQOA 3F4SA 2VO4A 3MDKA 2YV9A 3ZZXA 2IMIA 4PX1A 4TN8A 5HR1A 4F0BA 2F9SA 1RQMA 1BEDA 1YY7A 4V2LA 1I9DA 2K18A 4XCSA 5ECSA 1AQVA 4BVXA 2CAIA 6GSXA 4DEJA 3LQ7A 3GTUA 1W89A 3D6IA 4WETA 3E0UA 5ECIB 2LNSA 1V58A 2A2SA 1Z7RA 1FB0A 4NXIA 2E7PA 2ZUPA 5ID2A 2GSTA 5D8IA 3ZVJD 1WIKA 5CAXA 5IQYA 3ZIJA 1X5EA 1YDKA 3GIXA 2GSRA 3ZYWA 1K0NA 3L78A 1BQ7A 4YQVA 1DE2A 4TOPA 2JZRA 3VWUA 4JE1A 5D93A 1OKDA 1TRVA 4POMA 1BX9A 1GL8A 2VM1A 1X9WB 3FYGA 4XS4B 3KEBA 2GTUA 4KCEA 2OKAA 4I2UA 1XZOA 4PQ1A 4BL7A 4WBRD 2VLTA 4X1UA 4NHZA 3LYPA 4ZB6A 1OAZA 4CW9A 4GRFA 1N8JA 1H75A 2H1AA 4WR5A 5A5KA 3CRTA 4NPBA 3WGEA 1A23A 2R37A 4IS0A 4KB3A 4ECCA 5J5NA 1GSFA 2GT6A 2VAFA 2DJ1A 4K1FA 2JZSA 4GWRA 1V57A 4WF4A 1GWCA 3EINA 3IXRA 2DMLA 2IL3A 3A2VA 2H1DA 2AUVA 2FWEA 3PR8A 3M8NA 4L0WA 2H1BA 3KMOA 2WFCA 5LD0A 1CQGA 1AAZA 2XHFA 4KX4A 3P2AA 2HRNA 2DJ0A 3HZ8A 2H0HA 4XRAA 1M99A 2B5EA 5CREA 1B4PA 3C1RA 5B6MA 3WD6A 3IK9A 3TKSA 4ZB8A 2CZ2A 4Z7XA 1HNCA 3HZ4A 1KNGA 3CYNA 3DEXA 4GF0A 4BA7A 5B7CA 4MLYA 1YQ1A 1PL1A 1SYRA 3UVHA 2FA8A 1ML6A 1ST9A 5HR3A 4HU7A 4HJ2A 13GSA 1E2YA 4NV5A 4HUAA 4YQUA 2IMKA 2RM6A 11GSA 2WDUA 3IV4A 2YPMA 3TJJA 2EIQA 1TDIA 4D73B 3IC4A 2WZ9A 4RI6A 4IP6A 2JADA 3F8UA 5DQSA 3FR6A 4MK3A 1JLVA 2PMTA 2L4CA 2C1YA 3W6GA 5EVOA 1PA3A 3IPZA 3K8NA 1FVJA 3JCML 2WRTA 3MAKA 2WJUA 2TRXA 2KLXA 1S3AA 4I2TA 4PQHA 2CZ3A 2H01A 3GA4A 3LJRA 2DMMA 2NPBA 5DDLA 3CTGA 3TRPA 1E6BA 5D9VA 3F63A 5EPFA 2L57A 5IIZA 5IPGA 3KH9A 5AIVA 3CTFA 2FCHA 2JACA 4G19A 1FVKA 1XVWA 1R5AA 4X0XA 3AY8A 3IDVA 2AHEA 1XW5A 1F9MA 22GSA 4FO5A 1GTBA 1NW2A 3CXGA 1WMJA 3A3TA 2JSYA 3F6FA 4E8HA 4IW9A 2VCWA 4WR4A 4TRXA 1LBKA 1X0RA 4F0CA 3KIJA 3VK9A 3L9VA 4IKHA 2XPEA 1TU8A 4KW6A 4HS1A 1OKTA 2K6VA 4AJ6A 1T7PB 1PKWA 5LNKe 1QUWA 1TKDB 1GNWA 4K2DA 3R2QA 3GRXA 4FIWA 2C0DA 3GSSA 2MMNA 2RM5A 1XBSA 5J9CA 2GZZA 3EVIA 4GLTA 1X5DA 4GSTA 1TRUA 1M9BA 3O76A 1K0DA 3CSHA 4EXJA 4KH7A 4PURA 5H5RA 4N10A 2DJ3A 2IN3A 1O8XA 1K3YA 3HJMA 2GQKA 2LKUA 2MBSA 2KHPA 2F8FA 1Z6NA 2G0FA 4P3YB 7GSSA 3V1WA 1ZZYA 5AISA 3QOUA 3MNGA 3DRNA 4K7IA 1HNAA 3NZNA 4G2EA 2VD0A 4MA9A 3KM6A 1EZKA 3S9FA 1U3IA 2DJJA 3ZMLA 3W8SA 5DJMA 3O3TA 1TK8B 4PUAA 4GTUA 2REMA 1UVZA 4EE0A 1SU9A 4O7HA 3NIVA 3HY2A 4GXZA 1K3OA 2YJ7A 3TOTA 2IMFA 1B4QA 4JRRA 3WGDA 2PGTA 2YNXA 3BCIA 2LTKA 5AGYA 2AV4A 5HFIA 5EY6A 1FO5A 2H6YA 1SJIA 3QPMA 1JFUA 4RI7A 3FEUA 3QFBC 3G9BA 1XOBA 5F0GA 4XIHA 3OR5A 1H4OA 4DSSA 5B8AA 3GFKA 1UA5A 4X43A 3DD3A 1ERUA 5G30A 5D9WA 4IP1A 2C4JA 2CQ9A 3FR9A 3ZFBA 1PD21 3RBTA 4ZIJA 4F2IA 18GSA 1R5PA 2ZCTA 4TXVA 3CSJA 1T1VA 4KSOA 3DMLA 1C72A 4WF5A 1O81A 2OA7A 1FAAA 3FY7A 3D21A 1GSYA 1U88A 4HEA2 4PXOA 2TIRA 3E9JB 3F0IA 4BVYA 4BPYA 1W4VA 3QCPA 5IMFA 4J57E 1MDKA 4LL4B 1TRSA 1QQ2A 5FT3A 5DCHA 3RPNA 1GSDA 2HRFA 2B3SA 5B8BA 2O87A 1PGTA 4OFMA 2ON7A 3FZAA 3TUEA 5IO0A 1JZOA 1OC3A 4HU9A 4JR6A 4KSMA 2X64A 2E2MA 1R26A 3APSA 2E0QA 2K9FA 3KTBA 3Q18A 3Q19A 1PX6A 2FNOA 2KP2A 4AF2A 1HNBA 3WT1A 2BJXA 3US3A 1F3BA 3CSIA 3TJKA 5CRGA 4LL1B 1ABAA 1IYIA 3BD2A 4F03A 5GAND 2C8UA 2K8SA 5GZZB 4XHMA 1A2JA 2V1MA 2IFQB 4EDYA 4J56E 1X9MB 1PMTA 2O8VB 3GUSA 4Q5FA 3HHVA 3DIEA 5JWQB 1EOHA 1FB6A 3N9JA 4N11A 1ZYEA 2R6KA 1DBYA 4MJBA 4FYUA 3KD0A 3P7XA 16GSA 4KCAA 2WGRA 2YJHA 4HQZA 2R2JA 1XOAA 1WOUA 1KBNA 3W8JA 5ECNB 4LMWA 3QD9A 4GCIA 2HZEB 3HA9A 2YZUA 1ERVA 2WS2A 1EEJA 4KNDA 5DAKA 3H4KA 1NHOA 1XW9A 3UOMA 1NM3A 1B48A 1VGLA 2KOKA 4QQ7A 3ZL5A 5GAPD 3VI7A 3ZIVA 1GH2A 4EKZA 4TR3A 5D96A 1OE8A 4EO3A 2V32A 4NMUA 4MF6A 2H72A 3F3RA 4FYCA 3A5WA 3TDGA 2E2GA 1GUMA 4WKWA 5IM9A 4HOJA 1SD9A 3FHKA 4TKYA 3HYPA 2IPAA 2QC7A 1XWAA 5G1LA 1YEPA 1F2EA 5JCGA 3FRCA 3TRQA 3I9V2 2LRTA 1GUKA 3VURA 2M80A 1XWKA 4ZL9A 2GGTA 4TR1B 1SK2A 1ERWA 3KGKA 2R3XA 4OWYA 3QFAC 1QMVA 5KN2A 2FA4A 5CYYA 4TVEA 1HYUA 4ZB9A 17GSA 2I4AA 3BOAA 1Z3EA 3H8QA 4OMVA 2GZYA 3A2XA 1SYXA 1K0CA 4ACSA 2P5RA 1NHYA 1A0RP 3QDNA 5KN0A 4EUYA 4K0NA 2H70A 5DBQA 3LG6A 2AAWA 2XPDA 3RDWA 3DKSA 2H73A 4O5RA 2YWMA 3GV1A 1V98A 3RHCA 1U87A 2CVKA 1BYEA 1F6MC 4EVMA 4K8MA 1ZYQB 5DJLA 2XBQA 4MJAA 5F8BA
chains in the Genus database with same CATH superfamily
2VCXA 4CHSA 5ENUA 4DVCA 1TU7A 1FOVA 3QR6A 2GQMA 1T3BA 3MSZA 4NHWA 2H8LA 4PUFC 5ELAA 2H75A 1RK4A 3MYDA 4TR0A 1MTCA 3GX0A 4BWSA 3ERFA 5A4WA 2H71A 1SK1A 5D73A 4ZILA 3VWWA 4BVXB 2DKIA 2GS3A 3PH9A 2DLXA 2DC5A 4TXOB 4TW5A 3DWVA 1UN2A 5IO2A 3F3QA 2J23A 2VL2A 2DJKA 3ISOA 2GDRA 3L4NA 1EWXA 1TXXA 1G7EA 4AJ7A 2RUEA 1ON4A 1B9YC 3HJOA 2NDOA 3TKQA 4Z2TA 2CA8A 1T00A 2LRNA 2WCIA 4IVFA 5ID2B 2JL4A 2RIIA 1Y6EA 5ECQB 3DVWA 4F82A 5G31A 2R5GA 2VIMA 2D2ZA 1GNEA 3NOFA 3SBCA 2H76A 2F8AA 2L4QA 2GVPA 1JZRA 2X49A 4MZWA 4HSCX 4L8EA 3P90A 5J41A 1O8WA 2IJYA 4EF0A 4BIKA 2VOCA 2HFDA 3EMXA 3UARA 1WE0A 3FZ4A 5C04A 2H1GA 4POKA 1HQOA 3H79A 4KE3A 4EIPA 1ZCPA 2C0GA 3WT2A 4IQ1A 2L6CA 3KH7A 4I8BA 2HZFA 2PU9C 1USBA 2H6XA 2R4VA 4ECIA 1ILOA 1GULA 4RQRA 1VF3A 5F07A 1OC9A 1T4YA 1THOA 1GTIA 2V6OA 3KXOA 2GQLA 4POBA 3TOUA 1JHBA 1TOFA 2PPTA 2OBKA 3PPUA 4DSRA 5ECRB 3GH9A 1X5CA 4G9HA 2J9HA 2LEGA 4ECBA 3UL3A 1AQWA 2FUG2 2ES7A 1ERTA 4L5OA 2VLVA 1PRXA 2PBJA 2ALBA 3IK7A 1SL1B 1M9AA 3ZFLA 2HSYA 2FWHA 5ECPB 3J7Yk 3LSZA 5J4UA 2YV7A 1TRWA 4A5PA 1SKRB 3IAM2 3H93A 3TJFA 4MNNA 2MZCA 4HZ4A 4IHUA 4TR4A 1Z7PA 3F4RA 3FK8A 2FGXA 4XTSA 1M2AA 3TKSC 1BAYA 1A2LA 1MDIA 2DBCA 2BMXA 2HE3A 1G6WA 2YN1A 5J9BA 1M3IA 3ERWA 5DVBA 2V2GA 1TK0B 2PWJA 1S3DA 1R7HA 4IGJA 2I1UA 4HQSA 4ML1A 2P31A 1AXDA 3C8EA 3RHBA 1G7OA 4ID0A 3BCKA 5ELGA 4QL9A 6GSVA 3HVVA 2GSQA 1VF2A 4MPFA 1K0MA 1GLQA 2EC4A 1A2MA 3M9KA 3IE3A 3C1SA 2VL2C 4AGSA 5F06A 2VCVA 3HCZA 4YH2A 3GL5A 5IMAA 1GSQA 3M0FA 3LFLA 5F05A 2HSHA 3ZVJA 4Q5QA 1ACVA 2GLRA 2LRCA 4OFTA 4E8EA 5E4WA 1X9SB 1XW6A 5B6NA 2CX4A 5ECHB 4N30A 2B1KA 4XRDA 1Q98A 3KCMA 4BWQA 2DSAA 4JZQA 3UVTA 2CAQA 5G1KA 2L59A 4JBBA 3FMWA 4Q5RA 1SD8A 3EU4A 1HD2A 4G0LA 2RLIA 1M3JA 1DUGA 5HQPA 3GKKA 4LMVA 3GX8A 1JLWA 4N0VA 4EC0A 4KA0A 4JR4A 2HI7A 5FWGA 2YP6A 1SKSB 4FYBA 3UMAA 2B5XA 4IQAA 1WJKA 1GSUA 3VI5A 3DVXA 2IIYA 4PNFA 2C3QA 1OE7A 2CV4A 2QSIA 2KP1A 1OC8A 5JCUA 1MD4A 1EP8A 2GSSA 4K7OA 4CY6A 1XWCA 3ERGA 1J0FA 9GSSA 1WWJA 3UBLA 4V2NA 1EP7A 4XS4A 4OO4A 3ZTLA 3KP9A 1Y25A 3G7IA 3LEFA 3J7Yb 4NV2A 2MMZA 1GTUA 2CT6A 4TR1A 2RUFA 3APQA 8GSSA 2L6DA 2YCDA 3EWLA 2F3MA 4K0GA 3N5OA 3APOA 3PINA 1WP0A 2UZ8A 5C00A 4KDYA 3IHQA 1A8LA 2AYTA 1EEMA 2N5FA 3KP8A 1YKCA 2FY6A 1A0FA 3RAZA 2VCTA 4N0ZA 1EV9A 4MZCA 4PNGA 3IA1A 5IMDA 6GSYA 3WYWA 5DALB 3UIWA 1TTZA 4HJMA 3GNJA 2X99A 2X8HA 2VUPA 19GSA 5JWRB 2DJ2A 4WBJA 1XWBA 2HNLA 4RUVA 3E3EA 4DSSB 4I97A 5J3RA 4I6XA 3TB2A 1Z5YE 3QMXA 20GSA 5L71A 4TXOA 2Z9SA 1TP9A 2P5QA 10GSA 3HKRA 4ZXGA 4HI7A 1K0BA 1WPIA 1TK5B 1THXA 4D73A 4JEDA 1MDJA 1T4ZA 1R4WA 5ECOB 3ZREA 1GP1A 1XPVA 1JZDA 4EL1A 2C3TA 2PVOC 4ZBDA 2I3YA 3M9JA 5ECLB 3EC3A 3QAGA 4JU5A 5HR0A 1T8EB 1AQXA 3GSTA 2YWIA 4LLRA 1EGOA 3I6AA 4K5SA 3EURA 1U3AA 4YAPA 1V40A 4MMMA 1SJ6A 1LJRA 5DQYA 3GHAA 1ZMAA 1K0OA 3A2WA 3VLNA 5G5EA 3U5RE 4K7NA 1F37A 2MYGA 2V41A 3PGTA 2OACA 4LA1A 2MMOA 2WB9A 3UBKA 3L9SA 5IMZA 2QGVA 3C7MA 1ZYNA 4RQXA 3Q74A 4USSA 2N5BA 1FHEA 4POLA 1ZYPA 3MWHA 2G2QA 4GSNA 1IYHA 1EV4A 2C3NA 3L0HA 1SENA 4Q5NA 1PQNA 4ZBBA 2FWFA 3FZ9A 4I5QA 2I81A 4KAEA 3UAPA 5KOWA 1PFOA 5CP1A 1O7UA 4WXTA 2XBIA 4OFNA 4PGTA 2H0GA 2PN8A 1URMA 2P0GA 4GQFA 4YAVA 1PX7A 3R3EA 1PSQA 3FKFA 2PUKC 4KDXA 6GSTA 5JCWA 3SWLA 4CY8A 1Z9HA 4MPGA 2I9HA 3QAVA 5H5QA 5HFKA 1XXUA 3O6TA 4MJEA 1QK8A 5IMVA 2IWTA 3GKNA 5DAKB 4K6XA 3GTUB 2X4AA 3HXSA 2GT5A 2PERA 4KDUA 2IMDA 4YQMA 3L9UA 3Q6OA 5A4UA 5GSTA 1DE1A 2LNTA 4ML6A 2LSTA 5ABRA 3KMNA 1M2DA 3LYKA 5G2ZA 1SJZA 2VL9A 4YKGA 3GKXA 5CRDA 3IR4A 2A2RA 4ULXA 3D0ZA 4Z2RA 2X8GA 1KEBA 3GH6A 2LV3A 4O92A 4OD7A 5KEJA 2B1LA 2QKEA 2YANA 2VD1A 2OADA 2C80A 3IHGA 4KF9A 3HJPA 3F9UA 2HXKA 1GTAA 1MEKA 1J9BA 3DXBA 1SK0A 2ON5A 2C0FA 3WGXA 4IN0A 2M72A 4CDOA 4KUNA 2WULA 3M3MA 5GSSA 3ED3A 2KUCA 1B8XA 4OCFA 2MBTA 4MDCA 4WEYA 3TGZA 1KTEA 4Z2UA 3KZQA 1EGRA 4GQCA 3CMIA 2EIRA 2HLSA 4BL7B 1BJXA 1VRSD 3IAS2 1M2BA 3TKPA 2OE0A 3VWVA 4MF5A 4MH3A 1XCCA 1M0UA 3ZLPA 3DGQA 2AB6A 4G0IA 1DSBA 1I5GA 2VLUA 2MMAA 2A4VA 3HVXA 4PQIA 4V2MA 2B7KA 1O85A 5D9TA 1M7TA 2HRKA 4OCEA 3M1GA 2H66A 1O6JA 2N5AA 1A8YA 3DYRA 4MH2A 3VWXA 2C0EA 1NSWA 4L5LA 2TRCP 1MD3A 2B7JA 3EMPA 2JZTA 3IOSA 1G6YA 1XIYA 4NWYA 3I69A 3LXZA 4L0UA 1WRYA 2H0IA 1JZWA 4OO5A 3VFIA 2OE1A 2FHEA 4IBPA 2VL3A 1PKZA 3EYTA 1TW9A 1BG5A 3F6DA 2YZHA 4XS1A 1LU4A 4ZL8A 14GSA 3KTLA 4PTSA 4ZBAA 3FZ5A 3GKMA 4FH8A 4MABA 3TCOA 1GUHA 1OYJA 1EOGA 2H74A 2XC2A 3FR3A 2F51A 2VCQA 3LWAA 4H86A 3HVSA 1GSEA 5EL8A 2OJLA 3FW2A 1G0TA 2JSZA 3KJYA 2K8VA 2DKHA 3HDCA 3IRAA 3TJGA 4GSSA 2HYXA 2H30A 4MCUA 3VPTA 2LS5A 1VF1A 2NBSA 1V2AA 2OBIA 4J2FA 4MF7A 1Q4JA 3QAWA 1FW1A 3RPPA 2CVDA 4DSQA 3GN3A 1UC7A 4X4JA 3BJ5A 3ZITA 2IFQA 2B6MA 2FWGA 5G5FA 1YJ6A 1YKAA 3TKSE 5IOXA 4HZ2A 1ZL9A 2M46A 1GLPA 4K9ZA 6GSUA 2IMEA 3MIXA 2PVQA 2FD3A 4IJ3A 1K0AA 4KGIA 5D9XA 1QXHA 1ZGNA 1YZXA 5LCZA 5DALA 2B5YA 1B9XC 2LJAA 3HD5A 3IBHA 2EIOA 4ZL7A 1TJDA 5AN1A 2DIZA 5CRWA 3LXTA 5HFGA 3ZRDA 2VM2A 4V1Ag 2GZPA 5KN1A 2NTOA 2HZEA 3G7JA 4V1Ap 1PL2A 5CO3A 2LUSA 4FQUA 4MP4A 3D5JA 3EU3A 2CX3A 1OC9B 5COHA 1K3LA 3VPQA 2JU5A 1AC1A 1XWGA 2BTOT 4F9ZA 4G0KA 1SL0B 3D4TA 3C71A 1PN9A 2VCZA 6GSSA 2L5OA 1O73A 3U6VA 4AJ8A 4ISDA 1SL2B 3CBUA 2X8CA 5ECKB 4MJCA 1QFNA 2CVBA 3GMFA 1GSSA 1AUCA 2R0PA 4IJIA 1RW1A 1AIUA 3LGCA 3LW9A 1TI1A 3UEMA 5H5SA 5IMCA 1XFLA 3UJ1A 5CRHA 3GYKA 3I43A 2YOIA 5DCGA 1J08A 4EDZA 3ZMKA 5A4VA 2O85A 1U6TA 5KN3A 1TI3A 3D4MA 3LORA 1S3CA 2LJRA 1F3AA 2V6KA 2YWOA 12GSA 4ECJA 5CNWA 2DIYA 4QL7A 4G10A 1OVNA 3GL3A 1V9WA 3ME8A 1QGVA 1CQHA 3TJBA 4HDEA 4IELA 2L5LA 1FG4A 3TKRA 1Z6MA 4MZBA 4O5QA 1VF4A 5E59A 1A24A 3H1NA 1XVQA 2H19A 3D22A 1FOHA 4O32A 1GRXA 5FHIA 2LQQA 2O89A 3BBYA 4YKFA 3EE2A 2HT9A 6GSWA 3GURA 3G7YA 1N2AA 2LJKA 2O7KA 2H6ZA 1YEXA 1YF1A 3F4TA 5HR2A 3EPTA 5JWOB 4NAXA 5IPHA 3ME7A 2YWNA 4ILFA 1YF0A 2FLSA 3C73A 5INYA 3TRXA 2OE3A 3CRUA 2ZNMA 4XS6A 1SKWB 1AW9A 5AIXA 2AJQB 5ECMB 2NVLA 5IOWA 1ZOFA 2LQOA 3F4SA 2VO4A 3A5IA 3MDKA 2YV9A 3ZZXA 2IMIA 4PX1A 4TN8A 5HR1A 4F0BA 2F9SA 1RQMA 1BEDA 1YY7A 4V2LA 1I9DA 2K18A 4XCSA 5ECSA 1AQVA 4BVXA 2CAIA 6GSXA 4DEJA 3LQ7A 2HSMA 3GTUA 1W89A 3D6IA 4WETA 3E0UA 5ECIB 2LNSA 1V58A 2A2SA 1Z7RA 1FB0A 4NXIA 2E7PA 4BVYB 2ZUPA 5ID2A 2GSTA 5D8IA 3ZVJD 1WIKA 5CAXA 5IQYA 3ZIJA 1X5EA 1YDKA 3GIXA 2GSRA 3ZYWA 1K0NA 3L78A 1BQ7A 4YQVA 1DE2A 4TOPA 2JZRA 3VWUA 4JE1A 5D93A 1OKDA 1TRVA 4POMA 1BX9A 1GL8A 2VM1A 1X9WB 3FYGA 4XS4B 3KEBA 2GTUA 4KCEA 2OKAA 4I2UA 1XZOA 4PQ1A 4BL7A 4WBRD 2VLTA 4X1UA 4NHZA 3LYPA 4ZB6A 1OAZA 4CW9A 4GRFA 1N8JA 1H75A 2H1AA 4WR5A 5A5KA 3CRTA 4NPBA 3WGEA 1A23A 2R37A 4IS0A 4KB3A 4ECCA 5J5NA 1GSFA 2GT6A 2VAFA 2DJ1A 4K1FA 2JZSA 4GWRA 1V57A 4WF4A 1GWCA 3EINA 3IXRA 2DMLA 2IL3A 3A2VA 2H1DA 2AUVA 2FWEA 3PR8A 3M8NA 4L0WA 2H1BA 3KMOA 2WFCA 5LD0A 1CQGA 1AAZA 2XHFA 4KX4A 3P2AA 2HRNA 2DJ0A 3HZ8A 2H0HA 4XRAA 1M99A 2B5EA 5CREA 1B4PA 3C1RA 5B6MA 3WD6A 3IK9A 3TKSA 4ZB8A 2CZ2A 4Z7XA 1HNCA 3HZ4A 1KNGA 3CYNA 3DEXA 4GF0A 4BA7A 5B7CA 4MLYA 1YQ1A 1PL1A 1SYRA 3UVHA 2FA8A 1ML6A 5DJLA 1ST9A 1PN0A 5HR3A 4HU7A 4HJ2A 13GSA 4O5UA 1E2YA 4K5RA 4HUAA 4NV5A 4YQUA 2IMKA 2RM6A 11GSA 2WDUA 3IV4A 2YPMA 3TJJA 2EIQA 1TDIA 4D73B 3IC4A 2WZ9A 4RI6A 4IP6A 2JADA 3F8UA 5DQSA 3FR6A 4MK3A 1JLVA 2PMTA 2L4CA 2C1YA 3W6GA 5EVOA 1PA3A 3IPZA 3K8NA 1FVJA 3JCML 2WRTA 3MAKA 2WJUA 2TRXA 2KLXA 1S3AA 4I2TA 4PQHA 2CZ3A 2H01A 3GA4A 3LJRA 2DMMA 2NPBA 5DDLA 3CTGA 3TRPA 1E6BA 5D9VA 3F63A 5EPFA 2L57A 5IIZA 5IPGA 3KH9A 5AIVA 3CTFA 2FCHA 2JACA 4G19A 1FVKA 1XVWA 1R5AA 4X0XA 3AY8A 3IDVA 2AHEA 1XW5A 1F9MA 22GSA 4FO5A 1GTBA 1NW2A 3CXGA 1WMJA 3A3TA 2JSYA 3F6FA 4E8HA 4IW9A 2VCWA 4WR4A 4TRXA 4ICYA 1LBKA 2QA1A 1S3RA 1X0RA 4F0CA 2R0CA 3KIJA 3VK9A 3L9VA 4IKHA 2XPEA 1TU8A 4KW6A 4HS1A 1OKTA 2K6VA 4AJ6A 1T7PB 1PKWA 5LNKe 1QUWA 1TKDB 1GNWA 4K2DA 3R2QA 3GRXA 4FIWA 2C0DA 3GSSA 2MMNA 2RM5A 1XBSA 5J9CA 2GZZA 3EVIA 4GLTA 1X5DA 4GSTA 1TRUA 1M9BA 2A2PA 3O76A 1K0DA 3CSHA 4EXJA 4KH7A 4PURA 5H5RA 4N10A 2DJ3A 2IN3A 1O8XA 1K3YA 3HJMA 2GQKA 2LKUA 2MBSA 2KHPA 2F8FA 1Z6NA 2G0FA 4P3YB 7GSSA 3V1WA 1ZZYA 5AISA 3QOUA 3MNGA 3DRNA 4K7IA 1HNAA 3NZNA 4G2EA 2VD0A 4MA9A 3KM6A 1EZKA 3S9FA 1U3IA 2DJJA 3ZMLA 3W8SA 5DJMA 3O3TA 1TK8B 4PUAA 4GTUA 2REMA 5KOXA 1UVZA 4EE0A 1SU9A 4O7HA 3NIVA 3HY2A 4GXZA 1K3OA 2YJ7A 3TOTA 2IMFA 1B4QA 4JRRA 3WGDA 2PGTA 2YNXA 3BCIA 2LTKA 5AGYA 2AV4A 5HFIA 5EY6A 1FO5A 2H6YA 1SJIA 3QPMA 1JFUA 4RI7A 3FEUA 3QFBC 3G9BA 1XOBA 5F0GA 4XIHA 3OR5A 1H4OA 4DSSA 5B8AA 3GFKA 1UA5A 4X43A 3IC8A 3DD3A 1ERUA 5G30A 5D9WA 4IP1A 2C4JA 2CQ9A 3FR9A 3ZFBA 1PD21 3RBTA 4ZIJA 4F2IA 18GSA 1R5PA 2ZCTA 4TXVA 3CSJA 1T1VA 4KSOA 3DMLA 1C72A 4WF5A 1O81A 2OA7A 1FAAA 3FY7A 3D21A 1GSYA 1U88A 4HEA2 2QA2A 4PXOA 2TIRA 3E9JB 3F0IA 4BVYA 4BPYA 1W4VA 3QCPA 5IMFA 4J57E 1MDKA 4LL4B 1TRSA 1QQ2A 5FT3A 5DCHA 3RPNA 1GSDA 2HRFA 2B3SA 5B8BA 2O87A 1PGTA 4OFMA 2HRAA 2ON7A 3FZAA 3TUEA 5IO0A 1JZOA 1OC3A 4HU9A 4JR6A 4KSMA 2X64A 2E2MA 1R26A 3APSA 1XG8A 2E0QA 2K9FA 3KTBA 3Q18A 3Q19A 1PX6A 2FNOA 2KP2A 4AF2A 1HNBA 3WT1A 2BJXA 3CQFA 3US3A 1F3BA 3CSIA 3TJKA 5CRGA 4LL1B 1ABAA 1IYIA 3BD2A 4F03A 5GAND 2R0GA 2C8UA 2K8SA 5GZZB 4XHMA 1A2JA 2V1MA 2IFQB 4EDYA 4J56E 1X9MB 1PMTA 2O8VB 3GUSA 4Q5FA 3HHVA 3DIEA 5JWQB 1EOHA 1FB6A 3N9JA 4N11A 1ZYEA 2R6KA 1DBYA 4MJBA 4FYUA 5BMUA 3KD0A 3P7XA 16GSA 4KCAA 2WGRA 2YJHA 4HQZA 2R2JA 1XOAA 1WOUA 1KBNA 3W8JA 5ECNB 4LMWA 3QD9A 4GCIA 2HZEB 3HA9A 2YZUA 1ERVA 2WS2A 1EEJA 4KNDA 5DAKA 3H4KA 1NHOA 1XW9A 3UOMA 1NM3A 1B48A 1VGLA 2KOKA 4QQ7A 5BRTA 3ZL5A 5GAPD 3VI7A 3ZIVA 1GH2A 4EKZA 4TR3A 5D96A 1OE8A 4K2XA 4EO3A 2V32A 4NMUA 4MF6A 2H72A 3F3RA 4FYCA 3A5WA 3TDGA 2E2GA 1GUMA 4WKWA 3HVNA 4HOJA 1SD9A 5IM9A 3FHKA 4TKYA 3HYPA 2IPAA 4EIQA 2QC7A 1XWAA 5G1LA 1YEPA 1F2EA 5JCGA 3FRCA 3TRQA 3I9V2 2LRTA 1GUKA 3VURA 2M80A 1XWKA 4ZL9A 2GGTA 4TR1B 1SK2A 1ERWA 3KGKA 2R3XA 2A4HA 4OWYA 3QFAC 1QMVA 5KN2A 2FA4A 5CYYA 4TVEA 1HYUA 4ZB9A 17GSA 2I4AA 3BOAA 1Z3EA 3H8QA 4OMVA 2GZYA 3A2XA 1SYXA 1K0CA 4ACSA 2P5RA 1NHYA 1A0RP 3QDNA 5KN0A 4EUYA 4K0NA 2H70A 5DBQA 3LG6A 2AAWA 2XPDA 3RDWA 3DKSA 2H73A 4O5RA 2YWMA 3GV1A 1V98A 3RHCA 1U87A 2CVKA 1BYEA 1F6MC 4EVMA 4K8MA 1ZYQB 3P8WA 2XBQA 4MJAA 5F8BA
chains in the Genus database with same CATH topology
2VCXA 4CHSA 5ENUA 4DVCA 1TU7A 1FOVA 3QR6A 2GQMA 1T3BA 3MSZA 4NHWA 2H8LA 4PUFC 5ELAA 2H75A 1RK4A 3MYDA 4TR0A 1MTCA 3GX0A 4BWSA 3ERFA 5A4WA 2H71A 1SK1A 5D73A 4ZILA 3VWWA 4BVXB 2DKIA 2GS3A 3PH9A 2DLXA 2DC5A 4TXOB 4TW5A 3DWVA 1UN2A 5IO2A 3F3QA 2J23A 2VL2A 2DJKA 3ISOA 2GDRA 3L4NA 1EWXA 1TXXA 1G7EA 4AJ7A 2RUEA 1ON4A 1B9YC 3HJOA 2NDOA 3TKQA 4Z2TA 2CA8A 1T00A 2LRNA 2WCIA 4IVFA 5ID2B 2JL4A 2RIIA 1Y6EA 5ECQB 3DVWA 4F82A 5G31A 2R5GA 2VIMA 2D2ZA 1GNEA 3NOFA 3SBCA 2H76A 2F8AA 2L4QA 2GVPA 1JZRA 2X49A 4MZWA 4L8EA 3P90A 5J41A 1O8WA 2IJYA 4EF0A 2VOCA 2HFDA 3EMXA 3UARA 1WE0A 3FZ4A 5C04A 2H1GA 4POKA 1HQOA 3H79A 4KE3A 4EIPA 1ZCPA 2C0GA 3WT2A 4IQ1A 2L6CA 3KH7A 4I8BA 2HZFA 2PU9C 1USBA 2H6XA 2R4VA 4ECIA 1ILOA 1GULA 4RQRA 1VF3A 5F07A 1OC9A 1T4YA 1THOA 1GTIA 2V6OA 3KXOA 2GQLA 4POBA 3TOUA 1JHBA 1TOFA 2PPTA 2OBKA 3PPUA 4DSRA 5ECRB 3GH9A 1X5CA 4G9HA 2J9HA 2LEGA 4ECBA 3UL3A 1AQWA 2FUG2 2ES7A 1ERTA 4L5OA 2VLVA 1PRXA 2PBJA 2ALBA 3IK7A 1SL1B 1M9AA 3ZFLA 2HSYA 2FWHA 5ECPB 3J7Yk 3LSZA 5J4UA 2YV7A 1TRWA 4A5PA 1SKRB 3IAM2 3H93A 3TJFA 4MNNA 2MZCA 4HZ4A 4IHUA 4TR4A 1Z7PA 3F4RA 3FK8A 2FGXA 4XTSA 1M2AA 3TKSC 1BAYA 1A2LA 1MDIA 2DBCA 2BMXA 2HE3A 1G6WA 2YN1A 5J9BA 3ERWA 5DVBA 2V2GA 1TK0B 2PWJA 1S3DA 1R7HA 4IGJA 2I1UA 4HQSA 4ML1A 2P31A 1AXDA 3C8EA 3RHBA 1G7OA 4ID0A 3BCKA 5ELGA 4QL9A 6GSVA 3HVVA 2GSQA 1VF2A 4MPFA 1K0MA 1GLQA 2EC4A 1A2MA 3M9KA 3IE3A 3C1SA 2VL2C 4AGSA 5F06A 2VCVA 3HCZA 4YH2A 3GL5A 5IMAA 1GSQA 3M0FA 3LFLA 5F05A 2HSHA 3ZVJA 4Q5QA 1ACVA 2GLRA 2LRCA 4OFTA 4E8EA 5E4WA 1X9SB 1XW6A 5B6NA 2CX4A 5ECHB 4N30A 2B1KA 4XRDA 1Q98A 3KCMA 4BWQA 2DSAA 4JZQA 3UVTA 2CAQA 5G1KA 2L59A 4JBBA 3FMWA 4Q5RA 1SD8A 3EU4A 1HD2A 4G0LA 2RLIA 1DUGA 5HQPA 3GKKA 4LMVA 3GX8A 1JLWA 4N0VA 4EC0A 4KA0A 4JR4A 2HI7A 5FWGA 2YP6A 1SKSB 4FYBA 3UMAA 2B5XA 4IQAA 1WJKA 1GSUA 3VI5A 3DVXA 2IIYA 4PNFA 2C3QA 1OE7A 2CV4A 2QSIA 2KP1A 1OC8A 5JCUA 1MD4A 1EP8A 2GSSA 4K7OA 4CY6A 1XWCA 3ERGA 1J0FA 9GSSA 1WWJA 3UBLA 4V2NA 1EP7A 4XS4A 4OO4A 3ZTLA 3KP9A 1Y25A 3G7IA 3LEFA 3J7Yb 4NV2A 2MMZA 1GTUA 2CT6A 4TR1A 2RUFA 3APQA 8GSSA 2L6DA 2YCDA 3EWLA 2F3MA 4K0GA 3N5OA 3APOA 3PINA 1WP0A 2UZ8A 5C00A 4KDYA 3IHQA 1A8LA 2AYTA 1EEMA 2N5FA 3KP8A 1YKCA 2FY6A 1A0FA 3RAZA 2VCTA 4N0ZA 1EV9A 4MZCA 4PNGA 3IA1A 5IMDA 6GSYA 3WYWA 5DALB 3UIWA 1TTZA 4HJMA 3GNJA 2X99A 2X8HA 2VUPA 19GSA 5JWRB 2DJ2A 4WBJA 1XWBA 2HNLA 4RUVA 3E3EA 4DSSB 4I97A 5J3RA 4I6XA 3TB2A 1Z5YE 3QMXA 20GSA 5L71A 4TXOA 2Z9SA 1TP9A 2P5QA 10GSA 3HKRA 4ZXGA 4HI7A 1K0BA 1WPIA 1TK5B 1THXA 4D73A 4JEDA 1MDJA 1T4ZA 1R4WA 5ECOB 3ZREA 1GP1A 1XPVA 1JZDA 4EL1A 2C3TA 2PVOC 4ZBDA 2I3YA 3M9JA 5ECLB 3EC3A 3QAGA 4JU5A 5HR0A 1T8EB 1AQXA 3GSTA 2YWIA 4LLRA 1EGOA 3I6AA 4K5SA 3EURA 1U3AA 4YAPA 1V40A 4MMMA 1SJ6A 1LJRA 5DQYA 3GHAA 1ZMAA 1K0OA 3A2WA 3VLNA 5G5EA 3U5RE 4K7NA 1F37A 2MYGA 2V41A 3PGTA 2OACA 4LA1A 2MMOA 2WB9A 3UBKA 3L9SA 5IMZA 2QGVA 3C7MA 1ZYNA 4RQXA 3Q74A 4USSA 2N5BA 1FHEA 4POLA 1ZYPA 3MWHA 2G2QA 4GSNA 1IYHA 1EV4A 2C3NA 3L0HA 1SENA 4Q5NA 1PQNA 4ZBBA 2FWFA 3FZ9A 4I5QA 2I81A 4KAEA 3UAPA 5KOWA 5CP1A 1O7UA 4WXTA 2XBIA 4OFNA 4PGTA 2H0GA 2PN8A 1URMA 2P0GA 4GQFA 4YAVA 1PX7A 3R3EA 1PSQA 3FKFA 2PUKC 4KDXA 6GSTA 5JCWA 3SWLA 4CY8A 1Z9HA 4MPGA 2I9HA 3QAVA 5H5QA 5HFKA 1XXUA 3O6TA 4MJEA 1QK8A 5IMVA 2IWTA 3GKNA 5DAKB 4K6XA 3GTUB 2X4AA 3HXSA 2GT5A 2PERA 4KDUA 2IMDA 4YQMA 3L9UA 3Q6OA 5A4UA 5GSTA 1DE1A 2LNTA 4ML6A 2LSTA 5ABRA 3KMNA 1M2DA 3LYKA 5G2ZA 1SJZA 2VL9A 4YKGA 3GKXA 5CRDA 3IR4A 2A2RA 4ULXA 3D0ZA 4Z2RA 2X8GA 1KEBA 3GH6A 2LV3A 4O92A 4OD7A 5KEJA 2B1LA 2QKEA 2YANA 2VD1A 2OADA 2C80A 3IHGA 4KF9A 3HJPA 3F9UA 2HXKA 1GTAA 1MEKA 1J9BA 3DXBA 1SK0A 2ON5A 2C0FA 3WGXA 4IN0A 2M72A 4CDOA 4KUNA 2WULA 3M3MA 5GSSA 3ED3A 2KUCA 1B8XA 4OCFA 2MBTA 4MDCA 4WEYA 3TGZA 1KTEA 4Z2UA 3KZQA 1EGRA 4GQCA 3CMIA 2EIRA 2HLSA 4BL7B 1BJXA 1VRSD 3IAS2 1M2BA 3TKPA 2OE0A 3VWVA 4MF5A 4MH3A 1XCCA 1M0UA 3ZLPA 3DGQA 2AB6A 4G0IA 1DSBA 1I5GA 2VLUA 2MMAA 2A4VA 3HVXA 4PQIA 4V2MA 2B7KA 1O85A 5D9TA 1M7TA 2HRKA 4OCEA 3M1GA 2H66A 1O6JA 2N5AA 1A8YA 3DYRA 4MH2A 3VWXA 2C0EA 1NSWA 4L5LA 2TRCP 1MD3A 2B7JA 3EMPA 2JZTA 3IOSA 1G6YA 1XIYA 4NWYA 3I69A 3LXZA 4L0UA 1WRYA 2H0IA 1JZWA 4OO5A 3VFIA 2OE1A 2FHEA 4IBPA 2VL3A 1PKZA 3EYTA 1TW9A 1BG5A 3F6DA 2YZHA 4XS1A 1LU4A 4ZL8A 14GSA 3KTLA 4PTSA 4ZBAA 3FZ5A 3GKMA 4FH8A 4MABA 3TCOA 1GUHA 1OYJA 1EOGA 2H74A 2XC2A 3FR3A 2F51A 2VCQA 3LWAA 4H86A 3HVSA 1GSEA 5EL8A 2OJLA 3FW2A 1G0TA 2JSZA 3KJYA 2K8VA 2DKHA 3HDCA 3IRAA 3TJGA 4GSSA 2HYXA 2H30A 4MCUA 3VPTA 2LS5A 1VF1A 2NBSA 1V2AA 2OBIA 4J2FA 4MF7A 1Q4JA 3QAWA 1FW1A 3RPPA 2CVDA 4DSQA 3GN3A 1UC7A 4X4JA 3BJ5A 3ZITA 2IFQA 2B6MA 2FWGA 5G5FA 1YJ6A 1YKAA 3TKSE 5IOXA 4HZ2A 1ZL9A 2M46A 1GLPA 4K9ZA 6GSUA 2IMEA 3MIXA 2PVQA 2FD3A 4IJ3A 1K0AA 4KGIA 5D9XA 1QXHA 1ZGNA 1YZXA 5LCZA 5DALA 2B5YA 1B9XC 2LJAA 3HD5A 3IBHA 2EIOA 4ZL7A 1TJDA 5AN1A 2DIZA 5CRWA 3LXTA 5HFGA 3ZRDA 2VM2A 4V1Ag 2GZPA 5KN1A 2NTOA 2HZEA 3G7JA 4V1Ap 1PL2A 5CO3A 2LUSA 4FQUA 4MP4A 3D5JA 3EU3A 2CX3A 1OC9B 5COHA 1K3LA 3VPQA 2JU5A 1AC1A 1XWGA 2BTOT 4F9ZA 4G0KA 1SL0B 3D4TA 3C71A 1PN9A 2VCZA 6GSSA 2L5OA 1O73A 3U6VA 4AJ8A 4ISDA 1SL2B 3CBUA 2X8CA 5ECKB 4MJCA 1QFNA 2CVBA 3GMFA 1GSSA 1AUCA 2R0PA 4IJIA 1RW1A 1AIUA 3LGCA 3LW9A 1TI1A 3UEMA 5H5SA 5IMCA 1XFLA 3UJ1A 5CRHA 3GYKA 3I43A 2YOIA 5DCGA 1J08A 4EDZA 3ZMKA 5A4VA 2O85A 1U6TA 5KN3A 1TI3A 3D4MA 3LORA 1S3CA 2LJRA 1F3AA 2V6KA 2YWOA 12GSA 4ECJA 5CNWA 2DIYA 4QL7A 4G10A 1OVNA 3GL3A 1V9WA 3ME8A 1QGVA 1CQHA 3TJBA 4HDEA 4IELA 2L5LA 1FG4A 3TKRA 1Z6MA 4MZBA 4O5QA 1VF4A 5E59A 1A24A 3H1NA 1XVQA 2H19A 3D22A 1FOHA 4O32A 1GRXA 5FHIA 2LQQA 2O89A 3BBYA 4YKFA 3EE2A 2HT9A 6GSWA 3GURA 3G7YA 1N2AA 2LJKA 2O7KA 2H6ZA 1YEXA 1YF1A 3F4TA 5HR2A 3EPTA 5JWOB 4NAXA 5IPHA 3ME7A 2YWNA 4ILFA 1YF0A 2FLSA 3C73A 5INYA 3TRXA 2OE3A 3CRUA 2ZNMA 4XS6A 1SKWB 1AW9A 5AIXA 2AJQB 5ECMB 2NVLA 5IOWA 1ZOFA 2LQOA 3F4SA 2VO4A 3A5IA 3MDKA 2YV9A 3ZZXA 2IMIA 4PX1A 4TN8A 5HR1A 4F0BA 2F9SA 1RQMA 1BEDA 1YY7A 4V2LA 1I9DA 2K18A 4XCSA 5ECSA 1AQVA 4BVXA 2CAIA 6GSXA 4DEJA 3LQ7A 2HSMA 3GTUA 1W89A 3D6IA 4WETA 3E0UA 5ECIB 2LNSA 1V58A 2A2SA 1Z7RA 1FB0A 4NXIA 2E7PA 4BVYB 2ZUPA 5ID2A 2GSTA 5D8IA 3ZVJD 1WIKA 5CAXA 5IQYA 3ZIJA 1X5EA 1YDKA 3GIXA 2GSRA 3ZYWA 1K0NA 3L78A 1BQ7A 4YQVA 1DE2A 4TOPA 2JZRA 3VWUA 4JE1A 5D93A 1OKDA 1TRVA 4POMA 1BX9A 1GL8A 2VM1A 1X9WB 3FYGA 4XS4B 3KEBA 2GTUA 4KCEA 2OKAA 4I2UA 1XZOA 4PQ1A 4BL7A 4WBRD 2VLTA 4X1UA 4NHZA 3LYPA 4ZB6A 1OAZA 4CW9A 4GRFA 1N8JA 1H75A 2H1AA 4WR5A 5A5KA 3CRTA 4NPBA 3WGEA 1A23A 2R37A 4IS0A 4KB3A 4ECCA 5J5NA 1GSFA 2GT6A 2VAFA 2DJ1A 4K1FA 2JZSA 4GWRA 1V57A 4WF4A 1GWCA 3EINA 3IXRA 2DMLA 2IL3A 3A2VA 2H1DA 2AUVA 2FWEA 3PR8A 3M8NA 4L0WA 2H1BA 3KMOA 2WFCA 5LD0A 1CQGA 1AAZA 2XHFA 4KX4A 3P2AA 2HRNA 2DJ0A 3HZ8A 2H0HA 4XRAA 1M99A 2B5EA 5CREA 1B4PA 3C1RA 5B6MA 3WD6A 3IK9A 3TKSA 4ZB8A 2CZ2A 4Z7XA 1HNCA 3HZ4A 1KNGA 3CYNA 3DEXA 4GF0A 4BA7A 5B7CA 4MLYA 1YQ1A 1PL1A 1SYRA 3UVHA 2FA8A 1ML6A 5DJLA 1ST9A 1PN0A 5HR3A 4HU7A 4HJ2A 13GSA 4O5UA 1E2YA 4K5RA 4HUAA 4NV5A 4YQUA 2IMKA 2RM6A 11GSA 2WDUA 3IV4A 2YPMA 3TJJA 2EIQA 1TDIA 4D73B 3IC4A 2WZ9A 4RI6A 4IP6A 2JADA 3F8UA 5DQSA 3FR6A 4MK3A 1JLVA 2PMTA 2L4CA 2C1YA 3W6GA 5EVOA 1PA3A 3IPZA 3K8NA 1FVJA 3JCML 2WRTA 3MAKA 2WJUA 2TRXA 2KLXA 1S3AA 4I2TA 4PQHA 2CZ3A 2H01A 3GA4A 3LJRA 2DMMA 2NPBA 5DDLA 3CTGA 3TRPA 1E6BA 5D9VA 3F63A 5EPFA 2L57A 5IIZA 5IPGA 3KH9A 5AIVA 3CTFA 2FCHA 2JACA 4G19A 1FVKA 1XVWA 1R5AA 4X0XA 3AY8A 3IDVA 2AHEA 1XW5A 1F9MA 22GSA 4FO5A 1GTBA 1NW2A 3CXGA 1WMJA 3A3TA 2JSYA 3F6FA 4E8HA 4IW9A 2VCWA 4WR4A 4TRXA 4ICYA 1LBKA 2QA1A 1X0RA 4F0CA 2R0CA 3KIJA 3VK9A 3L9VA 4IKHA 2XPEA 1TU8A 4KW6A 4HS1A 1OKTA 2K6VA 4AJ6A 1T7PB 1PKWA 5LNKe 1QUWA 1TKDB 1GNWA 4K2DA 3R2QA 3GRXA 4FIWA 2C0DA 3GSSA 2MMNA 2RM5A 1XBSA 5J9CA 2GZZA 3EVIA 4GLTA 1X5DA 4GSTA 1TRUA 1M9BA 2A2PA 3O76A 1K0DA 3CSHA 4EXJA 4KH7A 4PURA 5H5RA 4N10A 2DJ3A 2IN3A 1O8XA 1K3YA 3HJMA 2GQKA 2LKUA 2MBSA 2KHPA 2F8FA 1Z6NA 2G0FA 4P3YB 7GSSA 3V1WA 1ZZYA 5AISA 3QOUA 3MNGA 3DRNA 4K7IA 1HNAA 3NZNA 4G2EA 2VD0A 4MA9A 3KM6A 1EZKA 3S9FA 1U3IA 2DJJA 3ZMLA 3W8SA 5DJMA 3O3TA 1TK8B 4PUAA 4GTUA 2REMA 5KOXA 1UVZA 4EE0A 1SU9A 4O7HA 3NIVA 3HY2A 4GXZA 1K3OA 2YJ7A 3TOTA 2IMFA 1B4QA 4JRRA 3WGDA 2PGTA 2YNXA 3BCIA 2LTKA 5AGYA 2AV4A 5HFIA 5EY6A 1FO5A 2H6YA 1SJIA 3QPMA 1JFUA 4RI7A 3FEUA 3QFBC 3G9BA 1XOBA 5F0GA 4XIHA 3OR5A 1H4OA 4DSSA 5B8AA 3GFKA 1UA5A 4X43A 3IC8A 3DD3A 1ERUA 5G30A 5D9WA 4IP1A 2C4JA 2CQ9A 3FR9A 3ZFBA 1PD21 3RBTA 4ZIJA 4F2IA 18GSA 1R5PA 2ZCTA 4TXVA 3CSJA 1T1VA 4KSOA 3DMLA 1C72A 4WF5A 1O81A 2OA7A 1FAAA 3FY7A 3D21A 1GSYA 1U88A 4HEA2 2QA2A 4PXOA 2TIRA 3E9JB 3F0IA 4BVYA 4BPYA 1W4VA 3QCPA 5IMFA 4J57E 1MDKA 4LL4B 1TRSA 1QQ2A 5FT3A 5DCHA 3RPNA 1GSDA 2HRFA 2B3SA 5B8BA 2O87A 1PGTA 4OFMA 2HRAA 2ON7A 3FZAA 3TUEA 5IO0A 1JZOA 1OC3A 4HU9A 4JR6A 4KSMA 2X64A 2E2MA 1R26A 3APSA 2E0QA 2K9FA 3KTBA 3Q18A 3Q19A 1PX6A 2FNOA 2KP2A 4AF2A 1HNBA 3WT1A 2BJXA 3US3A 1F3BA 3CSIA 3TJKA 5CRGA 4LL1B 1ABAA 1IYIA 3BD2A 4F03A 5GAND 2R0GA 2C8UA 2K8SA 5GZZB 4XHMA 1A2JA 2V1MA 2IFQB 4EDYA 4J56E 1X9MB 1PMTA 2O8VB 3GUSA 4Q5FA 3HHVA 3DIEA 5JWQB 1EOHA 1FB6A 3N9JA 4N11A 1ZYEA 2R6KA 1DBYA 4MJBA 4FYUA 5BMUA 3KD0A 3P7XA 16GSA 4KCAA 2WGRA 2YJHA 4HQZA 2R2JA 1XOAA 1WOUA 1KBNA 3W8JA 5ECNB 4LMWA 3QD9A 4GCIA 2HZEB 3HA9A 2YZUA 1ERVA 2WS2A 1EEJA 4KNDA 5DAKA 3H4KA 1NHOA 1XW9A 3UOMA 1NM3A 1B48A 1VGLA 2KOKA 4QQ7A 5BRTA 3ZL5A 5GAPD 3VI7A 3ZIVA 1GH2A 4EKZA 4TR3A 5D96A 1OE8A 4K2XA 4EO3A 2V32A 4NMUA 4MF6A 2H72A 3F3RA 4FYCA 3A5WA 3TDGA 2E2GA 1GUMA 4WKWA 5IM9A 4HOJA 1SD9A 3FHKA 4TKYA 3HYPA 2IPAA 4EIQA 2QC7A 1XWAA 5G1LA 1YEPA 1F2EA 5JCGA 3FRCA 3TRQA 3I9V2 2LRTA 1GUKA 3VURA 2M80A 1XWKA 4ZL9A 2GGTA 4TR1B 1SK2A 1ERWA 3KGKA 2R3XA 2A4HA 4OWYA 3QFAC 1QMVA 5KN2A 2FA4A 5CYYA 4TVEA 1HYUA 4ZB9A 17GSA 2I4AA 3BOAA 1Z3EA 3H8QA 4OMVA 2GZYA 3A2XA 1SYXA 1K0CA 4ACSA 2P5RA 1NHYA 1A0RP 3QDNA 5KN0A 4EUYA 4K0NA 2H70A 5DBQA 3LG6A 2AAWA 2XPDA 3RDWA 3DKSA 2H73A 4O5RA 2YWMA 3GV1A 1V98A 3RHCA 1U87A 2CVKA 1BYEA 1F6MC 4EVMA 4K8MA 1ZYQB 3P8WA 2XBQA 4MJAA 5F8BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VCX A;  4CHS A;  5ENU A;  4DVC A;  1TU7 A;  1FOV A;  3QR6 A;  2GQM A;  1T3B A;  3MSZ A;  4NHW A;  2H8L A;  4PUF C;  5ELA A;  2H75 A;  1RK4 A;  4TR0 A;  1MTC A;  3GX0 A;  4BWS A;  3ERF A;  5A4W A;  2H71 A;  1SK1 A;  5D73 A;  4ZIL A;  3VWW A;  2GS3 A;  3PH9 A;  2DLX A;  2DC5 A;  4TXO B;  4TW5 A;  3DWV A;  1UN2 A;  5IO2 A;  3F3Q A;  2J23 A;  2VL2 A;  2DJK A;  3ISO A;  2GDR A;  3L4N A;  1EWX A;  1TXX A;  1G7E A;  4AJ7 A;  2RUE A;  1ON4 A;  1B9Y C;  3HJO A;  2NDO A;  3TKQ A;  2CA8 A;  1T00 A;  2LRN A;  2WCI A;  4IVF A;  5ID2 B;  2JL4 A;  2RII A;  1Y6E A;  5ECQ B;  3DVW A;  4F82 A;  5G31 A;  2R5G A;  2VIM A;  2D2Z A;  1GNE A;  3NOF A;  3SBC A;  2H76 A;  2F8A A;  2L4Q A;  2GVP A;  1JZR A;  4MZW A;  4L8E A;  3P90 A;  5J41 A;  1O8W A;  2IJY A;  4EF0 A;  2VOC A;  2HFD A;  3EMX A;  3UAR A;  1WE0 A;  3FZ4 A;  5C04 A;  2H1G A;  4POK A;  1HQO A;  3H79 A;  4KE3 A;  1ZCP A;  2C0G A;  3WT2 A;  4IQ1 A;  2L6C A;  3KH7 A;  4I8B A;  2HZF A;  2PU9 C;  1USB A;  2H6X A;  2R4V A;  4ECI A;  1ILO A;  1GUL A;  4RQR A;  1VF3 A;  5F07 A;  1OC9 A;  1T4Y A;  1THO A;  1GTI A;  2V6O A;  3KXO A;  2GQL A;  4POB A;  3TOU A;  1JHB A;  1TOF A;  2PPT A;  2OBK A;  4DSR A;  5ECR B;  3GH9 A;  1X5C A;  4G9H A;  2J9H A;  2LEG A;  4ECB A;  3UL3 A;  1AQW A;  2FUG 2;  2ES7 A;  1ERT A;  4L5O A;  2VLV A;  1PRX A;  2PBJ A;  2ALB A;  3IK7 A;  1SL1 B;  1M9A A;  3ZFL A;  2HSY A;  2FWH A;  5ECP B;  3J7Y k;  3LSZ A;  5J4U A;  2YV7 A;  1TRW A;  1SKR B;  3IAM 2;  3H93 A;  3TJF A;  2MZC A;  4HZ4 A;  4IHU A;  4TR4 A;  1Z7P A;  3F4R A;  3FK8 A;  2FGX A;  4XTS A;  1M2A A;  3TKS C;  1BAY A;  1A2L A;  1MDI A;  2DBC A;  2BMX A;  2HE3 A;  1G6W A;  2YN1 A;  5J9B A;  3ERW A;  5DVB A;  2V2G A;  1TK0 B;  2PWJ A;  1S3D A;  1R7H A;  4IGJ A;  2I1U A;  4HQS A;  4ML1 A;  2P31 A;  1AXD A;  3C8E A;  3RHB A;  1G7O A;  4ID0 A;  3BCK A;  5ELG A;  4QL9 A;  6GSV A;  3HVV A;  2GSQ A;  1VF2 A;  4MPF A;  1K0M A;  1GLQ A;  2EC4 A;  1A2M A;  3M9K A;  3IE3 A;  3C1S A;  2VL2 C;  4AGS A;  5F06 A;  2VCV A;  3HCZ A;  4YH2 A;  3GL5 A;  5IMA A;  1GSQ A;  3M0F A;  3LFL A;  5F05 A;  2HSH A;  3ZVJ A;  4Q5Q A;  1ACV A;  2GLR A;  2LRC A;  4OFT A;  4E8E A;  5E4W A;  1X9S B;  1XW6 A;  5B6N A;  2CX4 A;  5ECH B;  4N30 A;  2B1K A;  4XRD A;  1Q98 A;  3KCM A;  4BWQ A;  2DSA A;  4JZQ A;  3UVT A;  2CAQ A;  5G1K A;  2L59 A;  4JBB A;  4Q5R A;  1SD8 A;  3EU4 A;  1HD2 A;  2RLI A;  1DUG A;  5HQP A;  3GKK A;  4LMV A;  3GX8 A;  1JLW A;  4N0V A;  4EC0 A;  4KA0 A;  4JR4 A;  2HI7 A;  5FWG A;  2YP6 A;  1SKS B;  4FYB A;  3UMA A;  2B5X A;  4IQA A;  1WJK A;  1GSU A;  3VI5 A;  3DVX A;  2IIY A;  4PNF A;  2C3Q A;  1OE7 A;  2CV4 A;  2QSI A;  2KP1 A;  1OC8 A;  5JCU A;  1MD4 A;  1EP8 A;  2GSS A;  4K7O A;  1XWC A;  3ERG A;  1J0F A;  9GSS A;  1WWJ A;  3UBL A;  4V2N A;  1EP7 A;  4XS4 A;  4OO4 A;  3ZTL A;  3KP9 A;  1Y25 A;  3G7I A;  3LEF A;  3J7Y b;  4NV2 A;  2MMZ A;  1GTU A;  2CT6 A;  4TR1 A;  2RUF A;  3APQ A;  8GSS A;  2L6D A;  2YCD A;  3EWL A;  2F3M A;  4K0G A;  3N5O A;  3APO A;  3PIN A;  1WP0 A;  5C00 A;  4KDY A;  3IHQ A;  1A8L A;  2AYT A;  1EEM A;  2N5F A;  3KP8 A;  1YKC A;  2FY6 A;  1A0F A;  3RAZ A;  2VCT A;  4N0Z A;  1EV9 A;  4MZC A;  4PNG A;  3IA1 A;  5IMD A;  6GSY A;  3WYW A;  5DAL B;  3UIW A;  1TTZ A;  4HJM A;  3GNJ A;  2X99 A;  2X8H A;  2VUP A;  19GS A;  5JWR B;  2DJ2 A;  4WBJ A;  1XWB A;  2HNL A;  4RUV A;  3E3E A;  4DSS B;  4I97 A;  5J3R A;  4I6X A;  3TB2 A;  1Z5Y E;  3QMX A;  20GS A;  5L71 A;  4TXO A;  2Z9S A;  1TP9 A;  2P5Q A;  10GS A;  3HKR A;  4ZXG A;  4HI7 A;  1K0B A;  1WPI A;  1TK5 B;  1THX A;  4D73 A;  4JED A;  1MDJ A;  1T4Z A;  1R4W A;  5ECO B;  3ZRE A;  1GP1 A;  1XPV A;  1JZD A;  4EL1 A;  2C3T A;  2PVO C;  4ZBD A;  2I3Y A;  3M9J A;  5ECL B;  3EC3 A;  3QAG A;  4JU5 A;  5HR0 A;  1T8E B;  1AQX A;  3GST A;  2YWI A;  4LLR A;  1EGO A;  3I6A A;  3EUR A;  1U3A A;  4YAP A;  1V40 A;  4MMM A;  1SJ6 A;  1LJR A;  5DQY A;  3GHA A;  1ZMA A;  1K0O A;  3A2W A;  3VLN A;  5G5E A;  3U5R E;  4K7N A;  1F37 A;  2MYG A;  2V41 A;  3PGT A;  2OAC A;  4LA1 A;  2MMO A;  2WB9 A;  3UBK A;  3L9S A;  5IMZ A;  2QGV A;  3C7M A;  4RQX A;  3Q74 A;  2N5B A;  1FHE A;  4POL A;  3MWH A;  2G2Q A;  4GSN A;  1IYH A;  1EV4 A;  2C3N A;  3L0H A;  1SEN A;  4Q5N A;  1PQN A;  4ZBB A;  2FWF A;  3FZ9 A;  4I5Q A;  2I81 A;  4KAE A;  3UAP A;  5CP1 A;  1O7U A;  4WXT A;  2XBI A;  4OFN A;  4PGT A;  2H0G A;  2PN8 A;  1URM A;  2P0G A;  4GQF A;  4YAV A;  1PX7 A;  1PSQ A;  3FKF A;  2PUK C;  4KDX A;  6GST A;  5JCW A;  3SWL A;  1Z9H A;  4MPG A;  2I9H A;  3QAV A;  5H5Q A;  5HFK A;  1XXU A;  3O6T A;  4MJE A;  1QK8 A;  5IMV A;  2IWT A;  3GKN A;  5DAK B;  4K6X A;  3GTU B;  3HXS A;  2GT5 A;  2PER A;  4KDU A;  2IMD A;  4YQM A;  3L9U A;  3Q6O A;  5A4U A;  5GST A;  1DE1 A;  2LNT A;  4ML6 A;  2LST A;  5ABR A;  3KMN A;  1M2D A;  3LYK A;  5G2Z A;  1SJZ A;  2VL9 A;  3GKX A;  5CRD A;  3IR4 A;  2A2R A;  4ULX A;  3D0Z A;  2X8G A;  1KEB A;  3GH6 A;  2LV3 A;  4O92 A;  4OD7 A;  5KEJ A;  2B1L A;  2QKE A;  2YAN A;  2VD1 A;  2OAD A;  2C80 A;  3HJP A;  3F9U A;  2HXK A;  1GTA A;  1MEK A;  1J9B A;  3DXB A;  1SK0 A;  2ON5 A;  2C0F A;  3WGX A;  4IN0 A;  2M72 A;  4CDO A;  4KUN A;  2WUL A;  3M3M A;  5GSS A;  3ED3 A;  2KUC A;  1B8X A;  4OCF A;  2MBT A;  4MDC A;  4WEY A;  3TGZ A;  1KTE A;  3KZQ A;  1EGR A;  4GQC A;  3CMI A;  2EIR A;  2HLS A;  1BJX A;  1VRS D;  3IAS 2;  1M2B A;  3TKP A;  2OE0 A;  3VWV A;  4MF5 A;  4MH3 A;  1XCC A;  1M0U A;  3ZLP A;  3DGQ A;  2AB6 A;  1DSB A;  1I5G A;  2VLU A;  2MMA A;  2A4V A;  3HVX A;  4PQI A;  4V2M A;  2B7K A;  1O85 A;  5D9T A;  1M7T A;  4OCE A;  3M1G A;  2H66 A;  1O6J A;  2N5A A;  1A8Y A;  3DYR A;  4MH2 A;  3VWX A;  2C0E A;  1NSW A;  4L5L A;  2TRC P;  1MD3 A;  2B7J A;  3EMP A;  2JZT A;  3IOS A;  1G6Y A;  1XIY A;  4NWY A;  3I69 A;  3LXZ A;  4L0U A;  1WRY A;  2H0I A;  1JZW A;  4OO5 A;  3VFI A;  2OE1 A;  2FHE A;  4IBP A;  2VL3 A;  1PKZ A;  3EYT A;  1TW9 A;  1BG5 A;  3F6D A;  2YZH A;  4XS1 A;  1LU4 A;  4ZL8 A;  14GS A;  3KTL A;  4ZBA A;  3FZ5 A;  3GKM A;  4FH8 A;  4MAB A;  3TCO A;  1GUH A;  1OYJ A;  1EOG A;  2H74 A;  2XC2 A;  3FR3 A;  2F51 A;  2VCQ A;  3LWA A;  4H86 A;  3HVS A;  1GSE A;  5EL8 A;  2OJL A;  3FW2 A;  1G0T A;  2JSZ A;  3KJY A;  2K8V A;  3HDC A;  3IRA A;  3TJG A;  4GSS A;  2HYX A;  2H30 A;  4MCU A;  3VPT A;  2LS5 A;  1VF1 A;  2NBS A;  1V2A A;  2OBI A;  4J2F A;  4MF7 A;  1Q4J A;  3QAW A;  1FW1 A;  3RPP A;  2CVD A;  4DSQ A;  3GN3 A;  1UC7 A;  3BJ5 A;  3ZIT A;  2IFQ A;  2B6M A;  2FWG A;  5G5F A;  1YJ6 A;  1YKA A;  3TKS E;  5IOX A;  4HZ2 A;  1ZL9 A;  2M46 A;  1GLP A;  4K9Z A;  6GSU A;  2IME A;  2PVQ A;  2FD3 A;  4IJ3 A;  1K0A A;  4KGI A;  5D9X A;  1QXH A;  1ZGN A;  1YZX A;  5LCZ A;  5DAL A;  2B5Y A;  1B9X C;  2LJA A;  3HD5 A;  3IBH A;  2EIO A;  4ZL7 A;  1TJD A;  5AN1 A;  2DIZ A;  5CRW A;  3LXT A;  5HFG A;  3ZRD A;  2VM2 A;  4V1A g;  2GZP A;  5KN1 A;  2NTO A;  2HZE A;  3G7J A;  4V1A p;  1PL2 A;  5CO3 A;  2LUS A;  4MP4 A;  3D5J A;  3EU3 A;  2CX3 A;  1OC9 B;  5COH A;  1K3L A;  3VPQ A;  2JU5 A;  1AC1 A;  1XWG A;  2BTO T;  4F9Z A;  1SL0 B;  3D4T A;  3C71 A;  1PN9 A;  2VCZ A;  6GSS A;  2L5O A;  1O73 A;  3U6V A;  4AJ8 A;  4ISD A;  1SL2 B;  3CBU A;  2X8C A;  5ECK B;  4MJC A;  1QFN A;  2CVB A;  3GMF A;  1GSS A;  1AUC A;  4IJI A;  1RW1 A;  1AIU A;  3LGC A;  1TI1 A;  3UEM A;  5H5S A;  5IMC A;  1XFL A;  3UJ1 A;  5CRH A;  3GYK A;  3I43 A;  2YOI A;  5DCG A;  1J08 A;  4EDZ A;  3ZMK A;  5A4V A;  2O85 A;  1U6T A;  5KN3 A;  1TI3 A;  3P8W A;  3D4M A;  3LOR A;  1S3C A;  2LJR A;  1F3A A;  2V6K A;  2YWO A;  12GS A;  4ECJ A;  5CNW A;  2DIY A;  4QL7 A;  4G10 A;  1OVN A;  3GL3 A;  1V9W A;  3ME8 A;  1QGV A;  1CQH A;  3TJB A;  4HDE A;  4IEL A;  2L5L A;  1FG4 A;  3TKR A;  1Z6M A;  4MZB A;  1VF4 A;  5E59 A;  1A24 A;  3H1N A;  1XVQ A;  2H19 A;  3D22 A;  4O32 A;  1GRX A;  5FHI A;  2LQQ A;  2O89 A;  3BBY A;  3EE2 A;  2HT9 A;  6GSW A;  3GUR A;  3G7Y A;  1N2A A;  2LJK A;  2O7K A;  2H6Z A;  1YEX A;  1YF1 A;  3F4T A;  5HR2 A;  5JWO B;  4NAX A;  5IPH A;  3ME7 A;  2YWN A;  4ILF A;  1YF0 A;  2FLS A;  3C73 A;  5INY A;  3TRX A;  2OE3 A;  3CRU A;  2ZNM A;  4XS6 A;  1SKW B;  1AW9 A;  5AIX A;  2AJQ B;  5ECM B;  2NVL A;  5IOW A;  1ZOF A;  2LQO A;  3F4S A;  2VO4 A;  3MDK A;  2YV9 A;  3ZZX A;  2IMI A;  4PX1 A;  4TN8 A;  5HR1 A;  4F0B A;  2F9S A;  1RQM A;  1BED A;  1YY7 A;  4V2L A;  1I9D A;  2K18 A;  4XCS A;  5ECS A;  1AQV A;  4BVX A;  2CAI A;  6GSX A;  4DEJ A;  3LQ7 A;  3GTU A;  1W89 A;  3D6I A;  4WET A;  3E0U A;  5ECI B;  2LNS A;  1V58 A;  2A2S A;  1Z7R A;  1FB0 A;  4NXI A;  2E7P A;  2ZUP A;  5ID2 A;  2GST A;  5D8I A;  3ZVJ D;  1WIK A;  5CAX A;  5IQY A;  3ZIJ A;  1X5E A;  1YDK A;  3GIX A;  2GSR A;  3ZYW A;  1K0N A;  3L78 A;  1BQ7 A;  4YQV A;  1DE2 A;  4TOP A;  2JZR A;  3VWU A;  4JE1 A;  5D93 A;  1OKD A;  1TRV A;  4POM A;  1BX9 A;  1GL8 A;  2VM1 A;  1X9W B;  3FYG A;  4XS4 B;  3KEB A;  2GTU A;  4KCE A;  2OKA A;  4I2U A;  1XZO A;  4PQ1 A;  4BL7 A;  4WBR D;  2VLT A;  4X1U A;  4NHZ A;  3LYP A;  4ZB6 A;  1OAZ A;  4CW9 A;  4GRF A;  1N8J A;  1H75 A;  2H1A A;  4WR5 A;  5A5K A;  3CRT A;  4NPB A;  3WGE A;  1A23 A;  2R37 A;  4IS0 A;  4KB3 A;  4ECC A;  5J5N A;  1GSF A;  2GT6 A;  2VAF A;  2DJ1 A;  4K1F A;  2JZS A;  4GWR A;  1V57 A;  4WF4 A;  1GWC A;  3EIN A;  3IXR A;  2DML A;  2IL3 A;  3A2V A;  2H1D A;  2AUV A;  2FWE A;  3PR8 A;  3M8N A;  4L0W A;  2H1B A;  3KMO A;  2WFC A;  5LD0 A;  1CQG A;  1AAZ A;  2XHF A;  4KX4 A;  3P2A A;  2HRN A;  2DJ0 A;  3HZ8 A;  2H0H A;  4XRA A;  1M99 A;  2B5E A;  5CRE A;  1B4P A;  3C1R A;  5B6M A;  3WD6 A;  3IK9 A;  3TKS A;  4ZB8 A;  2CZ2 A;  4Z7X A;  1HNC A;  3HZ4 A;  1KNG A;  3CYN A;  3DEX A;  4GF0 A;  4BA7 A;  5B7C A;  4MLY A;  1YQ1 A;  1PL1 A;  1SYR A;  3UVH A;  2FA8 A;  1ML6 A;  1ST9 A;  5HR3 A;  4HU7 A;  4HJ2 A;  13GS A;  1E2Y A;  4NV5 A;  4HUA A;  4YQU A;  2IMK A;  2RM6 A;  11GS A;  2WDU A;  3IV4 A;  2YPM A;  3TJJ A;  2EIQ A;  1TDI A;  4D73 B;  3IC4 A;  2WZ9 A;  4RI6 A;  4IP6 A;  2JAD A;  3F8U A;  5DQS A;  3FR6 A;  4MK3 A;  1JLV A;  2PMT A;  2L4C A;  2C1Y A;  3W6G A;  5EVO A;  1PA3 A;  3IPZ A;  3K8N A;  1FVJ A;  3JCM L;  2WRT A;  3MAK A;  2WJU A;  2TRX A;  2KLX A;  1S3A A;  4I2T A;  4PQH A;  2CZ3 A;  2H01 A;  3GA4 A;  3LJR A;  2DMM A;  2NPB A;  5DDL A;  3CTG A;  3TRP A;  1E6B A;  5D9V A;  3F63 A;  5EPF A;  2L57 A;  5IIZ A;  5IPG A;  3KH9 A;  5AIV A;  3CTF A;  2FCH A;  2JAC A;  4G19 A;  1FVK A;  1XVW A;  1R5A A;  4X0X A;  3AY8 A;  3IDV A;  2AHE A;  1XW5 A;  1F9M A;  22GS A;  4FO5 A;  1GTB A;  1NW2 A;  3CXG A;  1WMJ A;  3A3T A;  2JSY A;  3F6F A;  4E8H A;  4IW9 A;  2VCW A;  4WR4 A;  4TRX A;  1LBK A;  1X0R A;  4F0C A;  3KIJ A;  3VK9 A;  3L9V A;  4IKH A;  2XPE A;  1TU8 A;  4KW6 A;  4HS1 A;  1OKT A;  2K6V A;  4AJ6 A;  1T7P B;  1PKW A;  5LNK e;  1QUW A;  1TKD B;  1GNW A;  4K2D A;  3R2Q A;  3GRX A;  4FIW A;  2C0D A;  3GSS A;  2MMN A;  2RM5 A;  1XBS A;  5J9C A;  2GZZ A;  3EVI A;  4GLT A;  1X5D A;  4GST A;  1TRU A;  1M9B A;  3O76 A;  1K0D A;  3CSH A;  4EXJ A;  4KH7 A;  4PUR A;  5H5R A;  4N10 A;  2DJ3 A;  2IN3 A;  1O8X A;  1K3Y A;  3HJM A;  2GQK A;  2LKU A;  2MBS A;  2KHP A;  2F8F A;  1Z6N A;  2G0F A;  4P3Y B;  7GSS A;  3V1W A;  1ZZY A;  5AIS A;  3QOU A;  3MNG A;  3DRN A;  4K7I A;  1HNA A;  3NZN A;  4G2E A;  2VD0 A;  4MA9 A;  3KM6 A;  1EZK A;  3S9F A;  1U3I A;  2DJJ A;  3ZML A;  3W8S A;  5DJM A;  3O3T A;  1TK8 B;  4PUA A;  4GTU A;  2REM A;  1UVZ A;  4EE0 A;  1SU9 A;  4O7H A;  3NIV A;  3HY2 A;  4GXZ A;  1K3O A;  2YJ7 A;  3TOT A;  2IMF A;  1B4Q A;  4JRR A;  3WGD A;  2PGT A;  2YNX A;  3BCI A;  2LTK A;  5AGY A;  2AV4 A;  5HFI A;  5EY6 A;  1FO5 A;  2H6Y A;  1SJI A;  3QPM A;  1JFU A;  4RI7 A;  3FEU A;  3QFB C;  3G9B A;  1XOB A;  5F0G A;  4XIH A;  3OR5 A;  1H4O A;  4DSS A;  5B8A A;  3GFK A;  1UA5 A;  4X43 A;  3DD3 A;  1ERU A;  5G30 A;  5D9W A;  4IP1 A;  2C4J A;  2CQ9 A;  3FR9 A;  3ZFB A;  1PD2 1;  3RBT A;  4ZIJ A;  4F2I A;  18GS A;  1R5P A;  2ZCT A;  4TXV A;  3CSJ A;  1T1V A;  4KSO A;  3DML A;  1C72 A;  4WF5 A;  1O81 A;  2OA7 A;  1FAA A;  3FY7 A;  3D21 A;  1GSY A;  1U88 A;  4HEA 2;  4PXO A;  2TIR A;  3E9J B;  3F0I A;  4BVY A;  4BPY A;  1W4V A;  3QCP A;  5IMF A;  4J57 E;  1MDK A;  4LL4 B;  1TRS A;  1QQ2 A;  5FT3 A;  5DCH A;  3RPN A;  1GSD A;  2HRF A;  2B3S A;  5B8B A;  2O87 A;  1PGT A;  4OFM A;  2ON7 A;  3FZA A;  3TUE A;  5IO0 A;  1JZO A;  1OC3 A;  4HU9 A;  4JR6 A;  4KSM A;  2X64 A;  2E2M A;  1R26 A;  3APS A;  2E0Q A;  2K9F A;  3KTB A;  3Q18 A;  3Q19 A;  1PX6 A;  2FNO A;  2KP2 A;  4AF2 A;  1HNB A;  3WT1 A;  2BJX A;  3US3 A;  1F3B A;  3CSI A;  3TJK A;  5CRG A;  4LL1 B;  1ABA A;  1IYI A;  3BD2 A;  4F03 A;  5GAN D;  2C8U A;  2K8S A;  5GZZ B;  4XHM A;  1A2J A;  2V1M A;  2IFQ B;  4EDY A;  4J56 E;  1X9M B;  1PMT A;  2O8V B;  3GUS A;  4Q5F A;  3HHV A;  3DIE A;  5JWQ B;  1EOH A;  1FB6 A;  3N9J A;  4N11 A;  1ZYE A;  2R6K A;  1DBY A;  4MJB A;  4FYU A;  3KD0 A;  3P7X A;  16GS A;  4KCA A;  2WGR A;  2YJH A;  4HQZ A;  2R2J A;  1XOA A;  1WOU A;  1KBN A;  3W8J A;  5ECN B;  4LMW A;  3QD9 A;  4GCI A;  2HZE B;  3HA9 A;  2YZU A;  1ERV A;  2WS2 A;  1EEJ A;  4KND A;  5DAK A;  3H4K A;  1NHO A;  1XW9 A;  3UOM A;  1NM3 A;  1B48 A;  1VGL A;  2KOK A;  4QQ7 A;  3ZL5 A;  5GAP D;  3VI7 A;  3ZIV A;  1GH2 A;  4EKZ A;  4TR3 A;  5D96 A;  1OE8 A;  4EO3 A;  2V32 A;  4NMU A;  4MF6 A;  2H72 A;  3F3R A;  4FYC A;  3A5W A;  3TDG A;  2E2G A;  1GUM A;  4WKW A;  5IM9 A;  4HOJ A;  1SD9 A;  3FHK A;  4TKY A;  3HYP A;  2IPA A;  2QC7 A;  1XWA A;  5G1L A;  1YEP A;  1F2E A;  5JCG A;  3FRC A;  3TRQ A;  3I9V 2;  2LRT A;  1GUK A;  3VUR A;  2M80 A;  1XWK A;  4ZL9 A;  2GGT A;  4TR1 B;  1SK2 A;  1ERW A;  3KGK A;  2R3X A;  4OWY A;  3QFA C;  1QMV A;  5KN2 A;  2FA4 A;  5CYY A;  4TVE A;  1HYU A;  4ZB9 A;  17GS A;  2I4A A;  3BOA A;  1Z3E A;  3H8Q A;  4OMV A;  2GZY A;  3A2X A;  1SYX A;  1K0C A;  4ACS A;  2P5R A;  1NHY A;  1A0R P;  3QDN A;  5KN0 A;  4EUY A;  4K0N A;  2H70 A;  5DBQ A;  3LG6 A;  2AAW A;  2XPD A;  3RDW A;  3DKS A;  2H73 A;  4O5R A;  2YWM A;  3GV1 A;  1V98 A;  3RHC A;  1U87 A;  2CVK A;  1BYE A;  1F6M C;  4EVM A;  4K8M A;  1ZYQ B;  5DJL A;  2XBQ A;  4MJA A;  5F8B A; 
#chains in the Genus database with same CATH topology
 2VCX A;  4CHS A;  5ENU A;  4DVC A;  1TU7 A;  1FOV A;  3QR6 A;  2GQM A;  1T3B A;  3MSZ A;  4NHW A;  2H8L A;  4PUF C;  5ELA A;  2H75 A;  1RK4 A;  3MYD A;  4TR0 A;  1MTC A;  3GX0 A;  4BWS A;  3ERF A;  5A4W A;  2H71 A;  1SK1 A;  5D73 A;  4ZIL A;  3VWW A;  4BVX B;  2DKI A;  2GS3 A;  3PH9 A;  2DLX A;  2DC5 A;  4TXO B;  4TW5 A;  3DWV A;  1UN2 A;  5IO2 A;  3F3Q A;  2J23 A;  2VL2 A;  2DJK A;  3ISO A;  2GDR A;  3L4N A;  1EWX A;  1TXX A;  1G7E A;  4AJ7 A;  2RUE A;  1ON4 A;  1B9Y C;  3HJO A;  2NDO A;  3TKQ A;  4Z2T A;  2CA8 A;  1T00 A;  2LRN A;  2WCI A;  4IVF A;  5ID2 B;  2JL4 A;  2RII A;  1Y6E A;  5ECQ B;  3DVW A;  4F82 A;  5G31 A;  2R5G A;  2VIM A;  2D2Z A;  1GNE A;  3NOF A;  3SBC A;  2H76 A;  2F8A A;  2L4Q A;  2GVP A;  1JZR A;  2X49 A;  4MZW A;  4HSC X;  4L8E A;  3P90 A;  5J41 A;  1O8W A;  2IJY A;  4EF0 A;  4BIK A;  2VOC A;  2HFD A;  3EMX A;  3UAR A;  1WE0 A;  3FZ4 A;  5C04 A;  2H1G A;  4POK A;  1HQO A;  3H79 A;  4KE3 A;  4EIP A;  1ZCP A;  2C0G A;  3WT2 A;  4IQ1 A;  2L6C A;  3KH7 A;  4I8B A;  2HZF A;  2PU9 C;  1USB A;  2H6X A;  2R4V A;  4ECI A;  1ILO A;  1GUL A;  4RQR A;  1VF3 A;  5F07 A;  1OC9 A;  1T4Y A;  1THO A;  1GTI A;  2V6O A;  3KXO A;  2GQL A;  4POB A;  3TOU A;  1JHB A;  1TOF A;  2PPT A;  2OBK A;  3PPU A;  4DSR A;  5ECR B;  3GH9 A;  1X5C A;  4G9H A;  2J9H A;  2LEG A;  4ECB A;  3UL3 A;  1AQW A;  2FUG 2;  2ES7 A;  1ERT A;  4L5O A;  2VLV A;  1PRX A;  2PBJ A;  2ALB A;  3IK7 A;  1SL1 B;  1M9A A;  3ZFL A;  2HSY A;  2FWH A;  5ECP B;  3J7Y k;  3LSZ A;  5J4U A;  2YV7 A;  1TRW A;  4A5P A;  1SKR B;  3IAM 2;  3H93 A;  3TJF A;  4MNN A;  2MZC A;  4HZ4 A;  4IHU A;  4TR4 A;  1Z7P A;  3F4R A;  3FK8 A;  2FGX A;  4XTS A;  1M2A A;  3TKS C;  1BAY A;  1A2L A;  1MDI A;  2DBC A;  2BMX A;  2HE3 A;  1G6W A;  2YN1 A;  5J9B A;  1M3I A;  3ERW A;  5DVB A;  2V2G A;  1TK0 B;  2PWJ A;  1S3D A;  1R7H A;  4IGJ A;  2I1U A;  4HQS A;  4ML1 A;  2P31 A;  1AXD A;  3C8E A;  3RHB A;  1G7O A;  4ID0 A;  3BCK A;  5ELG A;  4QL9 A;  6GSV A;  3HVV A;  2GSQ A;  1VF2 A;  4MPF A;  1K0M A;  1GLQ A;  2EC4 A;  1A2M A;  3M9K A;  3IE3 A;  3C1S A;  2VL2 C;  4AGS A;  5F06 A;  2VCV A;  3HCZ A;  4YH2 A;  3GL5 A;  5IMA A;  1GSQ A;  3M0F A;  3LFL A;  5F05 A;  2HSH A;  3ZVJ A;  4Q5Q A;  1ACV A;  2GLR A;  2LRC A;  4OFT A;  4E8E A;  5E4W A;  1X9S B;  1XW6 A;  5B6N A;  2CX4 A;  5ECH B;  4N30 A;  2B1K A;  4XRD A;  1Q98 A;  3KCM A;  4BWQ A;  2DSA A;  4JZQ A;  3UVT A;  2CAQ A;  5G1K A;  2L59 A;  4JBB A;  3FMW A;  4Q5R A;  1SD8 A;  3EU4 A;  1HD2 A;  4G0L A;  2RLI A;  1M3J A;  1DUG A;  5HQP A;  3GKK A;  4LMV A;  3GX8 A;  1JLW A;  4N0V A;  4EC0 A;  4KA0 A;  4JR4 A;  2HI7 A;  5FWG A;  2YP6 A;  1SKS B;  4FYB A;  3UMA A;  2B5X A;  4IQA A;  1WJK A;  1GSU A;  3VI5 A;  3DVX A;  2IIY A;  4PNF A;  2C3Q A;  1OE7 A;  2CV4 A;  2QSI A;  2KP1 A;  1OC8 A;  5JCU A;  1MD4 A;  1EP8 A;  2GSS A;  4K7O A;  4CY6 A;  1XWC A;  3ERG A;  1J0F A;  9GSS A;  1WWJ A;  3UBL A;  4V2N A;  1EP7 A;  4XS4 A;  4OO4 A;  3ZTL A;  3KP9 A;  1Y25 A;  3G7I A;  3LEF A;  3J7Y b;  4NV2 A;  2MMZ A;  1GTU A;  2CT6 A;  4TR1 A;  2RUF A;  3APQ A;  8GSS A;  2L6D A;  2YCD A;  3EWL A;  2F3M A;  4K0G A;  3N5O A;  3APO A;  3PIN A;  1WP0 A;  2UZ8 A;  5C00 A;  4KDY A;  3IHQ A;  1A8L A;  2AYT A;  1EEM A;  2N5F A;  3KP8 A;  1YKC A;  2FY6 A;  1A0F A;  3RAZ A;  2VCT A;  4N0Z A;  1EV9 A;  4MZC A;  4PNG A;  3IA1 A;  5IMD A;  6GSY A;  3WYW A;  5DAL B;  3UIW A;  1TTZ A;  4HJM A;  3GNJ A;  2X99 A;  2X8H A;  2VUP A;  19GS A;  5JWR B;  2DJ2 A;  4WBJ A;  1XWB A;  2HNL A;  4RUV A;  3E3E A;  4DSS B;  4I97 A;  5J3R A;  4I6X A;  3TB2 A;  1Z5Y E;  3QMX A;  20GS A;  5L71 A;  4TXO A;  2Z9S A;  1TP9 A;  2P5Q A;  10GS A;  3HKR A;  4ZXG A;  4HI7 A;  1K0B A;  1WPI A;  1TK5 B;  1THX A;  4D73 A;  4JED A;  1MDJ A;  1T4Z A;  1R4W A;  5ECO B;  3ZRE A;  1GP1 A;  1XPV A;  1JZD A;  4EL1 A;  2C3T A;  2PVO C;  4ZBD A;  2I3Y A;  3M9J A;  5ECL B;  3EC3 A;  3QAG A;  4JU5 A;  5HR0 A;  1T8E B;  1AQX A;  3GST A;  2YWI A;  4LLR A;  1EGO A;  3I6A A;  4K5S A;  3EUR A;  1U3A A;  4YAP A;  1V40 A;  4MMM A;  1SJ6 A;  1LJR A;  5DQY A;  3GHA A;  1ZMA A;  1K0O A;  3A2W A;  3VLN A;  5G5E A;  3U5R E;  4K7N A;  1F37 A;  2MYG A;  2V41 A;  3PGT A;  2OAC A;  4LA1 A;  2MMO A;  2WB9 A;  3UBK A;  3L9S A;  5IMZ A;  2QGV A;  3C7M A;  1ZYN A;  4RQX A;  3Q74 A;  4USS A;  2N5B A;  1FHE A;  4POL A;  1ZYP A;  3MWH A;  2G2Q A;  4GSN A;  1IYH A;  1EV4 A;  2C3N A;  3L0H A;  1SEN A;  4Q5N A;  1PQN A;  4ZBB A;  2FWF A;  3FZ9 A;  4I5Q A;  2I81 A;  4KAE A;  3UAP A;  5KOW A;  1PFO A;  5CP1 A;  1O7U A;  4WXT A;  2XBI A;  4OFN A;  4PGT A;  2H0G A;  2PN8 A;  1URM A;  2P0G A;  4GQF A;  4YAV A;  1PX7 A;  3R3E A;  1PSQ A;  3FKF A;  2PUK C;  4KDX A;  6GST A;  5JCW A;  3SWL A;  4CY8 A;  1Z9H A;  4MPG A;  2I9H A;  3QAV A;  5H5Q A;  5HFK A;  1XXU A;  3O6T A;  4MJE A;  1QK8 A;  5IMV A;  2IWT A;  3GKN A;  5DAK B;  4K6X A;  3GTU B;  2X4A A;  3HXS A;  2GT5 A;  2PER A;  4KDU A;  2IMD A;  4YQM A;  3L9U A;  3Q6O A;  5A4U A;  5GST A;  1DE1 A;  2LNT A;  4ML6 A;  2LST A;  5ABR A;  3KMN A;  1M2D A;  3LYK A;  5G2Z A;  1SJZ A;  2VL9 A;  4YKG A;  3GKX A;  5CRD A;  3IR4 A;  2A2R A;  4ULX A;  3D0Z A;  4Z2R A;  2X8G A;  1KEB A;  3GH6 A;  2LV3 A;  4O92 A;  4OD7 A;  5KEJ A;  2B1L A;  2QKE A;  2YAN A;  2VD1 A;  2OAD A;  2C80 A;  3IHG A;  4KF9 A;  3HJP A;  3F9U A;  2HXK A;  1GTA A;  1MEK A;  1J9B A;  3DXB A;  1SK0 A;  2ON5 A;  2C0F A;  3WGX A;  4IN0 A;  2M72 A;  4CDO A;  4KUN A;  2WUL A;  3M3M A;  5GSS A;  3ED3 A;  2KUC A;  1B8X A;  4OCF A;  2MBT A;  4MDC A;  4WEY A;  3TGZ A;  1KTE A;  4Z2U A;  3KZQ A;  1EGR A;  4GQC A;  3CMI A;  2EIR A;  2HLS A;  4BL7 B;  1BJX A;  1VRS D;  3IAS 2;  1M2B A;  3TKP A;  2OE0 A;  3VWV A;  4MF5 A;  4MH3 A;  1XCC A;  1M0U A;  3ZLP A;  3DGQ A;  2AB6 A;  4G0I A;  1DSB A;  1I5G A;  2VLU A;  2MMA A;  2A4V A;  3HVX A;  4PQI A;  4V2M A;  2B7K A;  1O85 A;  5D9T A;  1M7T A;  2HRK A;  4OCE A;  3M1G A;  2H66 A;  1O6J A;  2N5A A;  1A8Y A;  3DYR A;  4MH2 A;  3VWX A;  2C0E A;  1NSW A;  4L5L A;  2TRC P;  1MD3 A;  2B7J A;  3EMP A;  2JZT A;  3IOS A;  1G6Y A;  1XIY A;  4NWY A;  3I69 A;  3LXZ A;  4L0U A;  1WRY A;  2H0I A;  1JZW A;  4OO5 A;  3VFI A;  2OE1 A;  2FHE A;  4IBP A;  2VL3 A;  1PKZ A;  3EYT A;  1TW9 A;  1BG5 A;  3F6D A;  2YZH A;  4XS1 A;  1LU4 A;  4ZL8 A;  14GS A;  3KTL A;  4PTS A;  4ZBA A;  3FZ5 A;  3GKM A;  4FH8 A;  4MAB A;  3TCO A;  1GUH A;  1OYJ A;  1EOG A;  2H74 A;  2XC2 A;  3FR3 A;  2F51 A;  2VCQ A;  3LWA A;  4H86 A;  3HVS A;  1GSE A;  5EL8 A;  2OJL A;  3FW2 A;  1G0T A;  2JSZ A;  3KJY A;  2K8V A;  2DKH A;  3HDC A;  3IRA A;  3TJG A;  4GSS A;  2HYX A;  2H30 A;  4MCU A;  3VPT A;  2LS5 A;  1VF1 A;  2NBS A;  1V2A A;  2OBI A;  4J2F A;  4MF7 A;  1Q4J A;  3QAW A;  1FW1 A;  3RPP A;  2CVD A;  4DSQ A;  3GN3 A;  1UC7 A;  4X4J A;  3BJ5 A;  3ZIT A;  2IFQ A;  2B6M A;  2FWG A;  5G5F A;  1YJ6 A;  1YKA A;  3TKS E;  5IOX A;  4HZ2 A;  1ZL9 A;  2M46 A;  1GLP A;  4K9Z A;  6GSU A;  2IME A;  3MIX A;  2PVQ A;  2FD3 A;  4IJ3 A;  1K0A A;  4KGI A;  5D9X A;  1QXH A;  1ZGN A;  1YZX A;  5LCZ A;  5DAL A;  2B5Y A;  1B9X C;  2LJA A;  3HD5 A;  3IBH A;  2EIO A;  4ZL7 A;  1TJD A;  5AN1 A;  2DIZ A;  5CRW A;  3LXT A;  5HFG A;  3ZRD A;  2VM2 A;  4V1A g;  2GZP A;  5KN1 A;  2NTO A;  2HZE A;  3G7J A;  4V1A p;  1PL2 A;  5CO3 A;  2LUS A;  4FQU A;  4MP4 A;  3D5J A;  3EU3 A;  2CX3 A;  1OC9 B;  5COH A;  1K3L A;  3VPQ A;  2JU5 A;  1AC1 A;  1XWG A;  2BTO T;  4F9Z A;  4G0K A;  1SL0 B;  3D4T A;  3C71 A;  1PN9 A;  2VCZ A;  6GSS A;  2L5O A;  1O73 A;  3U6V A;  4AJ8 A;  4ISD A;  1SL2 B;  3CBU A;  2X8C A;  5ECK B;  4MJC A;  1QFN A;  2CVB A;  3GMF A;  1GSS A;  1AUC A;  2R0P A;  4IJI A;  1RW1 A;  1AIU A;  3LGC A;  3LW9 A;  1TI1 A;  3UEM A;  5H5S A;  5IMC A;  1XFL A;  3UJ1 A;  5CRH A;  3GYK A;  3I43 A;  2YOI A;  5DCG A;  1J08 A;  4EDZ A;  3ZMK A;  5A4V A;  2O85 A;  1U6T A;  5KN3 A;  1TI3 A;  3D4M A;  3LOR A;  1S3C A;  2LJR A;  1F3A A;  2V6K A;  2YWO A;  12GS A;  4ECJ A;  5CNW A;  2DIY A;  4QL7 A;  4G10 A;  1OVN A;  3GL3 A;  1V9W A;  3ME8 A;  1QGV A;  1CQH A;  3TJB A;  4HDE A;  4IEL A;  2L5L A;  1FG4 A;  3TKR A;  1Z6M A;  4MZB A;  4O5Q A;  1VF4 A;  5E59 A;  1A24 A;  3H1N A;  1XVQ A;  2H19 A;  3D22 A;  1FOH A;  4O32 A;  1GRX A;  5FHI A;  2LQQ A;  2O89 A;  3BBY A;  4YKF A;  3EE2 A;  2HT9 A;  6GSW A;  3GUR A;  3G7Y A;  1N2A A;  2LJK A;  2O7K A;  2H6Z A;  1YEX A;  1YF1 A;  3F4T A;  5HR2 A;  3EPT A;  5JWO B;  4NAX A;  5IPH A;  3ME7 A;  2YWN A;  4ILF A;  1YF0 A;  2FLS A;  3C73 A;  5INY A;  3TRX A;  2OE3 A;  3CRU A;  2ZNM A;  4XS6 A;  1SKW B;  1AW9 A;  5AIX A;  2AJQ B;  5ECM B;  2NVL A;  5IOW A;  1ZOF A;  2LQO A;  3F4S A;  2VO4 A;  3A5I A;  3MDK A;  2YV9 A;  3ZZX A;  2IMI A;  4PX1 A;  4TN8 A;  5HR1 A;  4F0B A;  2F9S A;  1RQM A;  1BED A;  1YY7 A;  4V2L A;  1I9D A;  2K18 A;  4XCS A;  5ECS A;  1AQV A;  4BVX A;  2CAI A;  6GSX A;  4DEJ A;  3LQ7 A;  2HSM A;  3GTU A;  1W89 A;  3D6I A;  4WET A;  3E0U A;  5ECI B;  2LNS A;  1V58 A;  2A2S A;  1Z7R A;  1FB0 A;  4NXI A;  2E7P A;  4BVY B;  2ZUP A;  5ID2 A;  2GST A;  5D8I A;  3ZVJ D;  1WIK A;  5CAX A;  5IQY A;  3ZIJ A;  1X5E A;  1YDK A;  3GIX A;  2GSR A;  3ZYW A;  1K0N A;  3L78 A;  1BQ7 A;  4YQV A;  1DE2 A;  4TOP A;  2JZR A;  3VWU A;  4JE1 A;  5D93 A;  1OKD A;  1TRV A;  4POM A;  1BX9 A;  1GL8 A;  2VM1 A;  1X9W B;  3FYG A;  4XS4 B;  3KEB A;  2GTU A;  4KCE A;  2OKA A;  4I2U A;  1XZO A;  4PQ1 A;  4BL7 A;  4WBR D;  2VLT A;  4X1U A;  4NHZ A;  3LYP A;  4ZB6 A;  1OAZ A;  4CW9 A;  4GRF A;  1N8J A;  1H75 A;  2H1A A;  4WR5 A;  5A5K A;  3CRT A;  4NPB A;  3WGE A;  1A23 A;  2R37 A;  4IS0 A;  4KB3 A;  4ECC A;  5J5N A;  1GSF A;  2GT6 A;  2VAF A;  2DJ1 A;  4K1F A;  2JZS A;  4GWR A;  1V57 A;  4WF4 A;  1GWC A;  3EIN A;  3IXR A;  2DML A;  2IL3 A;  3A2V A;  2H1D A;  2AUV A;  2FWE A;  3PR8 A;  3M8N A;  4L0W A;  2H1B A;  3KMO A;  2WFC A;  5LD0 A;  1CQG A;  1AAZ A;  2XHF A;  4KX4 A;  3P2A A;  2HRN A;  2DJ0 A;  3HZ8 A;  2H0H A;  4XRA A;  1M99 A;  2B5E A;  5CRE A;  1B4P A;  3C1R A;  5B6M A;  3WD6 A;  3IK9 A;  3TKS A;  4ZB8 A;  2CZ2 A;  4Z7X A;  1HNC A;  3HZ4 A;  1KNG A;  3CYN A;  3DEX A;  4GF0 A;  4BA7 A;  5B7C A;  4MLY A;  1YQ1 A;  1PL1 A;  1SYR A;  3UVH A;  2FA8 A;  1ML6 A;  5DJL A;  1ST9 A;  1PN0 A;  5HR3 A;  4HU7 A;  4HJ2 A;  13GS A;  4O5U A;  1E2Y A;  4K5R A;  4HUA A;  4NV5 A;  4YQU A;  2IMK A;  2RM6 A;  11GS A;  2WDU A;  3IV4 A;  2YPM A;  3TJJ A;  2EIQ A;  1TDI A;  4D73 B;  3IC4 A;  2WZ9 A;  4RI6 A;  4IP6 A;  2JAD A;  3F8U A;  5DQS A;  3FR6 A;  4MK3 A;  1JLV A;  2PMT A;  2L4C A;  2C1Y A;  3W6G A;  5EVO A;  1PA3 A;  3IPZ A;  3K8N A;  1FVJ A;  3JCM L;  2WRT A;  3MAK A;  2WJU A;  2TRX A;  2KLX A;  1S3A A;  4I2T A;  4PQH A;  2CZ3 A;  2H01 A;  3GA4 A;  3LJR A;  2DMM A;  2NPB A;  5DDL A;  3CTG A;  3TRP A;  1E6B A;  5D9V A;  3F63 A;  5EPF A;  2L57 A;  5IIZ A;  5IPG A;  3KH9 A;  5AIV A;  3CTF A;  2FCH A;  2JAC A;  4G19 A;  1FVK A;  1XVW A;  1R5A A;  4X0X A;  3AY8 A;  3IDV A;  2AHE A;  1XW5 A;  1F9M A;  22GS A;  4FO5 A;  1GTB A;  1NW2 A;  3CXG A;  1WMJ A;  3A3T A;  2JSY A;  3F6F A;  4E8H A;  4IW9 A;  2VCW A;  4WR4 A;  4TRX A;  4ICY A;  1LBK A;  2QA1 A;  1S3R A;  1X0R A;  4F0C A;  2R0C A;  3KIJ A;  3VK9 A;  3L9V A;  4IKH A;  2XPE A;  1TU8 A;  4KW6 A;  4HS1 A;  1OKT A;  2K6V A;  4AJ6 A;  1T7P B;  1PKW A;  5LNK e;  1QUW A;  1TKD B;  1GNW A;  4K2D A;  3R2Q A;  3GRX A;  4FIW A;  2C0D A;  3GSS A;  2MMN A;  2RM5 A;  1XBS A;  5J9C A;  2GZZ A;  3EVI A;  4GLT A;  1X5D A;  4GST A;  1TRU A;  1M9B A;  2A2P A;  3O76 A;  1K0D A;  3CSH A;  4EXJ A;  4KH7 A;  4PUR A;  5H5R A;  4N10 A;  2DJ3 A;  2IN3 A;  1O8X A;  1K3Y A;  3HJM A;  2GQK A;  2LKU A;  2MBS A;  2KHP A;  2F8F A;  1Z6N A;  2G0F A;  4P3Y B;  7GSS A;  3V1W A;  1ZZY A;  5AIS A;  3QOU A;  3MNG A;  3DRN A;  4K7I A;  1HNA A;  3NZN A;  4G2E A;  2VD0 A;  4MA9 A;  3KM6 A;  1EZK A;  3S9F A;  1U3I A;  2DJJ A;  3ZML A;  3W8S A;  5DJM A;  3O3T A;  1TK8 B;  4PUA A;  4GTU A;  2REM A;  5KOX A;  1UVZ A;  4EE0 A;  1SU9 A;  4O7H A;  3NIV A;  3HY2 A;  4GXZ A;  1K3O A;  2YJ7 A;  3TOT A;  2IMF A;  1B4Q A;  4JRR A;  3WGD A;  2PGT A;  2YNX A;  3BCI A;  2LTK A;  5AGY A;  2AV4 A;  5HFI A;  5EY6 A;  1FO5 A;  2H6Y A;  1SJI A;  3QPM A;  1JFU A;  4RI7 A;  3FEU A;  3QFB C;  3G9B A;  1XOB A;  5F0G A;  4XIH A;  3OR5 A;  1H4O A;  4DSS A;  5B8A A;  3GFK A;  1UA5 A;  4X43 A;  3IC8 A;  3DD3 A;  1ERU A;  5G30 A;  5D9W A;  4IP1 A;  2C4J A;  2CQ9 A;  3FR9 A;  3ZFB A;  1PD2 1;  3RBT A;  4ZIJ A;  4F2I A;  18GS A;  1R5P A;  2ZCT A;  4TXV A;  3CSJ A;  1T1V A;  4KSO A;  3DML A;  1C72 A;  4WF5 A;  1O81 A;  2OA7 A;  1FAA A;  3FY7 A;  3D21 A;  1GSY A;  1U88 A;  4HEA 2;  2QA2 A;  4PXO A;  2TIR A;  3E9J B;  3F0I A;  4BVY A;  4BPY A;  1W4V A;  3QCP A;  5IMF A;  4J57 E;  1MDK A;  4LL4 B;  1TRS A;  1QQ2 A;  5FT3 A;  5DCH A;  3RPN A;  1GSD A;  2HRF A;  2B3S A;  5B8B A;  2O87 A;  1PGT A;  4OFM A;  2HRA A;  2ON7 A;  3FZA A;  3TUE A;  5IO0 A;  1JZO A;  1OC3 A;  4HU9 A;  4JR6 A;  4KSM A;  2X64 A;  2E2M A;  1R26 A;  3APS A;  1XG8 A;  2E0Q A;  2K9F A;  3KTB A;  3Q18 A;  3Q19 A;  1PX6 A;  2FNO A;  2KP2 A;  4AF2 A;  1HNB A;  3WT1 A;  2BJX A;  3CQF A;  3US3 A;  1F3B A;  3CSI A;  3TJK A;  5CRG A;  4LL1 B;  1ABA A;  1IYI A;  3BD2 A;  4F03 A;  5GAN D;  2R0G A;  2C8U A;  2K8S A;  5GZZ B;  4XHM A;  1A2J A;  2V1M A;  2IFQ B;  4EDY A;  4J56 E;  1X9M B;  1PMT A;  2O8V B;  3GUS A;  4Q5F A;  3HHV A;  3DIE A;  5JWQ B;  1EOH A;  1FB6 A;  3N9J A;  4N11 A;  1ZYE A;  2R6K A;  1DBY A;  4MJB A;  4FYU A;  5BMU A;  3KD0 A;  3P7X A;  16GS A;  4KCA A;  2WGR A;  2YJH A;  4HQZ A;  2R2J A;  1XOA A;  1WOU A;  1KBN A;  3W8J A;  5ECN B;  4LMW A;  3QD9 A;  4GCI A;  2HZE B;  3HA9 A;  2YZU A;  1ERV A;  2WS2 A;  1EEJ A;  4KND A;  5DAK A;  3H4K A;  1NHO A;  1XW9 A;  3UOM A;  1NM3 A;  1B48 A;  1VGL A;  2KOK A;  4QQ7 A;  5BRT A;  3ZL5 A;  5GAP D;  3VI7 A;  3ZIV A;  1GH2 A;  4EKZ A;  4TR3 A;  5D96 A;  1OE8 A;  4K2X A;  4EO3 A;  2V32 A;  4NMU A;  4MF6 A;  2H72 A;  3F3R A;  4FYC A;  3A5W A;  3TDG A;  2E2G A;  1GUM A;  4WKW A;  3HVN A;  4HOJ A;  1SD9 A;  5IM9 A;  3FHK A;  4TKY A;  3HYP A;  2IPA A;  4EIQ A;  2QC7 A;  1XWA A;  5G1L A;  1YEP A;  1F2E A;  5JCG A;  3FRC A;  3TRQ A;  3I9V 2;  2LRT A;  1GUK A;  3VUR A;  2M80 A;  1XWK A;  4ZL9 A;  2GGT A;  4TR1 B;  1SK2 A;  1ERW A;  3KGK A;  2R3X A;  2A4H A;  4OWY A;  3QFA C;  1QMV A;  5KN2 A;  2FA4 A;  5CYY A;  4TVE A;  1HYU A;  4ZB9 A;  17GS A;  2I4A A;  3BOA A;  1Z3E A;  3H8Q A;  4OMV A;  2GZY A;  3A2X A;  1SYX A;  1K0C A;  4ACS A;  2P5R A;  1NHY A;  1A0R P;  3QDN A;  5KN0 A;  4EUY A;  4K0N A;  2H70 A;  5DBQ A;  3LG6 A;  2AAW A;  2XPD A;  3RDW A;  3DKS A;  2H73 A;  4O5R A;  2YWM A;  3GV1 A;  1V98 A;  3RHC A;  1U87 A;  2CVK A;  1BYE A;  1F6M C;  4EVM A;  4K8M A;  1ZYQ B;  3P8W A;  2XBQ A;  4MJA A;  5F8B A; 
#chains in the Genus database with same CATH homology
 2VCX A;  4CHS A;  5ENU A;  4DVC A;  1TU7 A;  1FOV A;  3QR6 A;  2GQM A;  1T3B A;  3MSZ A;  4NHW A;  2H8L A;  4PUF C;  5ELA A;  2H75 A;  1RK4 A;  3MYD A;  4TR0 A;  1MTC A;  3GX0 A;  4BWS A;  3ERF A;  5A4W A;  2H71 A;  1SK1 A;  5D73 A;  4ZIL A;  3VWW A;  4BVX B;  2DKI A;  2GS3 A;  3PH9 A;  2DLX A;  2DC5 A;  4TXO B;  4TW5 A;  3DWV A;  1UN2 A;  5IO2 A;  3F3Q A;  2J23 A;  2VL2 A;  2DJK A;  3ISO A;  2GDR A;  3L4N A;  1EWX A;  1TXX A;  1G7E A;  4AJ7 A;  2RUE A;  1ON4 A;  1B9Y C;  3HJO A;  2NDO A;  3TKQ A;  4Z2T A;  2CA8 A;  1T00 A;  2LRN A;  2WCI A;  4IVF A;  5ID2 B;  2JL4 A;  2RII A;  1Y6E A;  5ECQ B;  3DVW A;  4F82 A;  5G31 A;  2R5G A;  2VIM A;  2D2Z A;  1GNE A;  3NOF A;  3SBC A;  2H76 A;  2F8A A;  2L4Q A;  2GVP A;  1JZR A;  2X49 A;  4MZW A;  4L8E A;  3P90 A;  5J41 A;  1O8W A;  2IJY A;  4EF0 A;  2VOC A;  2HFD A;  3EMX A;  3UAR A;  1WE0 A;  3FZ4 A;  5C04 A;  2H1G A;  4POK A;  1HQO A;  3H79 A;  4KE3 A;  4EIP A;  1ZCP A;  2C0G A;  3WT2 A;  4IQ1 A;  2L6C A;  3KH7 A;  4I8B A;  2HZF A;  2PU9 C;  1USB A;  2H6X A;  2R4V A;  4ECI A;  1ILO A;  1GUL A;  4RQR A;  1VF3 A;  5F07 A;  1OC9 A;  1T4Y A;  1THO A;  1GTI A;  2V6O A;  3KXO A;  2GQL A;  4POB A;  3TOU A;  1JHB A;  1TOF A;  2PPT A;  2OBK A;  3PPU A;  4DSR A;  5ECR B;  3GH9 A;  1X5C A;  4G9H A;  2J9H A;  2LEG A;  4ECB A;  3UL3 A;  1AQW A;  2FUG 2;  2ES7 A;  1ERT A;  4L5O A;  2VLV A;  1PRX A;  2PBJ A;  2ALB A;  3IK7 A;  1SL1 B;  1M9A A;  3ZFL A;  2HSY A;  2FWH A;  5ECP B;  3J7Y k;  3LSZ A;  5J4U A;  2YV7 A;  1TRW A;  4A5P A;  1SKR B;  3IAM 2;  3H93 A;  3TJF A;  4MNN A;  2MZC A;  4HZ4 A;  4IHU A;  4TR4 A;  1Z7P A;  3F4R A;  3FK8 A;  2FGX A;  4XTS A;  1M2A A;  3TKS C;  1BAY A;  1A2L A;  1MDI A;  2DBC A;  2BMX A;  2HE3 A;  1G6W A;  2YN1 A;  5J9B A;  3ERW A;  5DVB A;  2V2G A;  1TK0 B;  2PWJ A;  1S3D A;  1R7H A;  4IGJ A;  2I1U A;  4HQS A;  4ML1 A;  2P31 A;  1AXD A;  3C8E A;  3RHB A;  1G7O A;  4ID0 A;  3BCK A;  5ELG A;  4QL9 A;  6GSV A;  3HVV A;  2GSQ A;  1VF2 A;  4MPF A;  1K0M A;  1GLQ A;  2EC4 A;  1A2M A;  3M9K A;  3IE3 A;  3C1S A;  2VL2 C;  4AGS A;  5F06 A;  2VCV A;  3HCZ A;  4YH2 A;  3GL5 A;  5IMA A;  1GSQ A;  3M0F A;  3LFL A;  5F05 A;  2HSH A;  3ZVJ A;  4Q5Q A;  1ACV A;  2GLR A;  2LRC A;  4OFT A;  4E8E A;  5E4W A;  1X9S B;  1XW6 A;  5B6N A;  2CX4 A;  5ECH B;  4N30 A;  2B1K A;  4XRD A;  1Q98 A;  3KCM A;  4BWQ A;  2DSA A;  4JZQ A;  3UVT A;  2CAQ A;  5G1K A;  2L59 A;  4JBB A;  3FMW A;  4Q5R A;  1SD8 A;  3EU4 A;  1HD2 A;  4G0L A;  2RLI A;  1DUG A;  5HQP A;  3GKK A;  4LMV A;  3GX8 A;  1JLW A;  4N0V A;  4EC0 A;  4KA0 A;  4JR4 A;  2HI7 A;  5FWG A;  2YP6 A;  1SKS B;  4FYB A;  3UMA A;  2B5X A;  4IQA A;  1WJK A;  1GSU A;  3VI5 A;  3DVX A;  2IIY A;  4PNF A;  2C3Q A;  1OE7 A;  2CV4 A;  2QSI A;  2KP1 A;  1OC8 A;  5JCU A;  1MD4 A;  1EP8 A;  2GSS A;  4K7O A;  4CY6 A;  1XWC A;  3ERG A;  1J0F A;  9GSS A;  1WWJ A;  3UBL A;  4V2N A;  1EP7 A;  4XS4 A;  4OO4 A;  3ZTL A;  3KP9 A;  1Y25 A;  3G7I A;  3LEF A;  3J7Y b;  4NV2 A;  2MMZ A;  1GTU A;  2CT6 A;  4TR1 A;  2RUF A;  3APQ A;  8GSS A;  2L6D A;  2YCD A;  3EWL A;  2F3M A;  4K0G A;  3N5O A;  3APO A;  3PIN A;  1WP0 A;  2UZ8 A;  5C00 A;  4KDY A;  3IHQ A;  1A8L A;  2AYT A;  1EEM A;  2N5F A;  3KP8 A;  1YKC A;  2FY6 A;  1A0F A;  3RAZ A;  2VCT A;  4N0Z A;  1EV9 A;  4MZC A;  4PNG A;  3IA1 A;  5IMD A;  6GSY A;  3WYW A;  5DAL B;  3UIW A;  1TTZ A;  4HJM A;  3GNJ A;  2X99 A;  2X8H A;  2VUP A;  19GS A;  5JWR B;  2DJ2 A;  4WBJ A;  1XWB A;  2HNL A;  4RUV A;  3E3E A;  4DSS B;  4I97 A;  5J3R A;  4I6X A;  3TB2 A;  1Z5Y E;  3QMX A;  20GS A;  5L71 A;  4TXO A;  2Z9S A;  1TP9 A;  2P5Q A;  10GS A;  3HKR A;  4ZXG A;  4HI7 A;  1K0B A;  1WPI A;  1TK5 B;  1THX A;  4D73 A;  4JED A;  1MDJ A;  1T4Z A;  1R4W A;  5ECO B;  3ZRE A;  1GP1 A;  1XPV A;  1JZD A;  4EL1 A;  2C3T A;  2PVO C;  4ZBD A;  2I3Y A;  3M9J A;  5ECL B;  3EC3 A;  3QAG A;  4JU5 A;  5HR0 A;  1T8E B;  1AQX A;  3GST A;  2YWI A;  4LLR A;  1EGO A;  3I6A A;  4K5S A;  3EUR A;  1U3A A;  4YAP A;  1V40 A;  4MMM A;  1SJ6 A;  1LJR A;  5DQY A;  3GHA A;  1ZMA A;  1K0O A;  3A2W A;  3VLN A;  5G5E A;  3U5R E;  4K7N A;  1F37 A;  2MYG A;  2V41 A;  3PGT A;  2OAC A;  4LA1 A;  2MMO A;  2WB9 A;  3UBK A;  3L9S A;  5IMZ A;  2QGV A;  3C7M A;  1ZYN A;  4RQX A;  3Q74 A;  4USS A;  2N5B A;  1FHE A;  4POL A;  1ZYP A;  3MWH A;  2G2Q A;  4GSN A;  1IYH A;  1EV4 A;  2C3N A;  3L0H A;  1SEN A;  4Q5N A;  1PQN A;  4ZBB A;  2FWF A;  3FZ9 A;  4I5Q A;  2I81 A;  4KAE A;  3UAP A;  5KOW A;  5CP1 A;  1O7U A;  4WXT A;  2XBI A;  4OFN A;  4PGT A;  2H0G A;  2PN8 A;  1URM A;  2P0G A;  4GQF A;  4YAV A;  1PX7 A;  3R3E A;  1PSQ A;  3FKF A;  2PUK C;  4KDX A;  6GST A;  5JCW A;  3SWL A;  4CY8 A;  1Z9H A;  4MPG A;  2I9H A;  3QAV A;  5H5Q A;  5HFK A;  1XXU A;  3O6T A;  4MJE A;  1QK8 A;  5IMV A;  2IWT A;  3GKN A;  5DAK B;  4K6X A;  3GTU B;  2X4A A;  3HXS A;  2GT5 A;  2PER A;  4KDU A;  2IMD A;  4YQM A;  3L9U A;  3Q6O A;  5A4U A;  5GST A;  1DE1 A;  2LNT A;  4ML6 A;  2LST A;  5ABR A;  3KMN A;  1M2D A;  3LYK A;  5G2Z A;  1SJZ A;  2VL9 A;  4YKG A;  3GKX A;  5CRD A;  3IR4 A;  2A2R A;  4ULX A;  3D0Z A;  4Z2R A;  2X8G A;  1KEB A;  3GH6 A;  2LV3 A;  4O92 A;  4OD7 A;  5KEJ A;  2B1L A;  2QKE A;  2YAN A;  2VD1 A;  2OAD A;  2C80 A;  3IHG A;  4KF9 A;  3HJP A;  3F9U A;  2HXK A;  1GTA A;  1MEK A;  1J9B A;  3DXB A;  1SK0 A;  2ON5 A;  2C0F A;  3WGX A;  4IN0 A;  2M72 A;  4CDO A;  4KUN A;  2WUL A;  3M3M A;  5GSS A;  3ED3 A;  2KUC A;  1B8X A;  4OCF A;  2MBT A;  4MDC A;  4WEY A;  3TGZ A;  1KTE A;  4Z2U A;  3KZQ A;  1EGR A;  4GQC A;  3CMI A;  2EIR A;  2HLS A;  4BL7 B;  1BJX A;  1VRS D;  3IAS 2;  1M2B A;  3TKP A;  2OE0 A;  3VWV A;  4MF5 A;  4MH3 A;  1XCC A;  1M0U A;  3ZLP A;  3DGQ A;  2AB6 A;  4G0I A;  1DSB A;  1I5G A;  2VLU A;  2MMA A;  2A4V A;  3HVX A;  4PQI A;  4V2M A;  2B7K A;  1O85 A;  5D9T A;  1M7T A;  2HRK A;  4OCE A;  3M1G A;  2H66 A;  1O6J A;  2N5A A;  1A8Y A;  3DYR A;  4MH2 A;  3VWX A;  2C0E A;  1NSW A;  4L5L A;  2TRC P;  1MD3 A;  2B7J A;  3EMP A;  2JZT A;  3IOS A;  1G6Y A;  1XIY A;  4NWY A;  3I69 A;  3LXZ A;  4L0U A;  1WRY A;  2H0I A;  1JZW A;  4OO5 A;  3VFI A;  2OE1 A;  2FHE A;  4IBP A;  2VL3 A;  1PKZ A;  3EYT A;  1TW9 A;  1BG5 A;  3F6D A;  2YZH A;  4XS1 A;  1LU4 A;  4ZL8 A;  14GS A;  3KTL A;  4PTS A;  4ZBA A;  3FZ5 A;  3GKM A;  4FH8 A;  4MAB A;  3TCO A;  1GUH A;  1OYJ A;  1EOG A;  2H74 A;  2XC2 A;  3FR3 A;  2F51 A;  2VCQ A;  3LWA A;  4H86 A;  3HVS A;  1GSE A;  5EL8 A;  2OJL A;  3FW2 A;  1G0T A;  2JSZ A;  3KJY A;  2K8V A;  2DKH A;  3HDC A;  3IRA A;  3TJG A;  4GSS A;  2HYX A;  2H30 A;  4MCU A;  3VPT A;  2LS5 A;  1VF1 A;  2NBS A;  1V2A A;  2OBI A;  4J2F A;  4MF7 A;  1Q4J A;  3QAW A;  1FW1 A;  3RPP A;  2CVD A;  4DSQ A;  3GN3 A;  1UC7 A;  4X4J A;  3BJ5 A;  3ZIT A;  2IFQ A;  2B6M A;  2FWG A;  5G5F A;  1YJ6 A;  1YKA A;  3TKS E;  5IOX A;  4HZ2 A;  1ZL9 A;  2M46 A;  1GLP A;  4K9Z A;  6GSU A;  2IME A;  3MIX A;  2PVQ A;  2FD3 A;  4IJ3 A;  1K0A A;  4KGI A;  5D9X A;  1QXH A;  1ZGN A;  1YZX A;  5LCZ A;  5DAL A;  2B5Y A;  1B9X C;  2LJA A;  3HD5 A;  3IBH A;  2EIO A;  4ZL7 A;  1TJD A;  5AN1 A;  2DIZ A;  5CRW A;  3LXT A;  5HFG A;  3ZRD A;  2VM2 A;  4V1A g;  2GZP A;  5KN1 A;  2NTO A;  2HZE A;  3G7J A;  4V1A p;  1PL2 A;  5CO3 A;  2LUS A;  4FQU A;  4MP4 A;  3D5J A;  3EU3 A;  2CX3 A;  1OC9 B;  5COH A;  1K3L A;  3VPQ A;  2JU5 A;  1AC1 A;  1XWG A;  2BTO T;  4F9Z A;  4G0K A;  1SL0 B;  3D4T A;  3C71 A;  1PN9 A;  2VCZ A;  6GSS A;  2L5O A;  1O73 A;  3U6V A;  4AJ8 A;  4ISD A;  1SL2 B;  3CBU A;  2X8C A;  5ECK B;  4MJC A;  1QFN A;  2CVB A;  3GMF A;  1GSS A;  1AUC A;  2R0P A;  4IJI A;  1RW1 A;  1AIU A;  3LGC A;  3LW9 A;  1TI1 A;  3UEM A;  5H5S A;  5IMC A;  1XFL A;  3UJ1 A;  5CRH A;  3GYK A;  3I43 A;  2YOI A;  5DCG A;  1J08 A;  4EDZ A;  3ZMK A;  5A4V A;  2O85 A;  1U6T A;  5KN3 A;  1TI3 A;  3D4M A;  3LOR A;  1S3C A;  2LJR A;  1F3A A;  2V6K A;  2YWO A;  12GS A;  4ECJ A;  5CNW A;  2DIY A;  4QL7 A;  4G10 A;  1OVN A;  3GL3 A;  1V9W A;  3ME8 A;  1QGV A;  1CQH A;  3TJB A;  4HDE A;  4IEL A;  2L5L A;  1FG4 A;  3TKR A;  1Z6M A;  4MZB A;  4O5Q A;  1VF4 A;  5E59 A;  1A24 A;  3H1N A;  1XVQ A;  2H19 A;  3D22 A;  1FOH A;  4O32 A;  1GRX A;  5FHI A;  2LQQ A;  2O89 A;  3BBY A;  4YKF A;  3EE2 A;  2HT9 A;  6GSW A;  3GUR A;  3G7Y A;  1N2A A;  2LJK A;  2O7K A;  2H6Z A;  1YEX A;  1YF1 A;  3F4T A;  5HR2 A;  3EPT A;  5JWO B;  4NAX A;  5IPH A;  3ME7 A;  2YWN A;  4ILF A;  1YF0 A;  2FLS A;  3C73 A;  5INY A;  3TRX A;  2OE3 A;  3CRU A;  2ZNM A;  4XS6 A;  1SKW B;  1AW9 A;  5AIX A;  2AJQ B;  5ECM B;  2NVL A;  5IOW A;  1ZOF A;  2LQO A;  3F4S A;  2VO4 A;  3A5I A;  3MDK A;  2YV9 A;  3ZZX A;  2IMI A;  4PX1 A;  4TN8 A;  5HR1 A;  4F0B A;  2F9S A;  1RQM A;  1BED A;  1YY7 A;  4V2L A;  1I9D A;  2K18 A;  4XCS A;  5ECS A;  1AQV A;  4BVX A;  2CAI A;  6GSX A;  4DEJ A;  3LQ7 A;  2HSM A;  3GTU A;  1W89 A;  3D6I A;  4WET A;  3E0U A;  5ECI B;  2LNS A;  1V58 A;  2A2S A;  1Z7R A;  1FB0 A;  4NXI A;  2E7P A;  4BVY B;  2ZUP A;  5ID2 A;  2GST A;  5D8I A;  3ZVJ D;  1WIK A;  5CAX A;  5IQY A;  3ZIJ A;  1X5E A;  1YDK A;  3GIX A;  2GSR A;  3ZYW A;  1K0N A;  3L78 A;  1BQ7 A;  4YQV A;  1DE2 A;  4TOP A;  2JZR A;  3VWU A;  4JE1 A;  5D93 A;  1OKD A;  1TRV A;  4POM A;  1BX9 A;  1GL8 A;  2VM1 A;  1X9W B;  3FYG A;  4XS4 B;  3KEB A;  2GTU A;  4KCE A;  2OKA A;  4I2U A;  1XZO A;  4PQ1 A;  4BL7 A;  4WBR D;  2VLT A;  4X1U A;  4NHZ A;  3LYP A;  4ZB6 A;  1OAZ A;  4CW9 A;  4GRF A;  1N8J A;  1H75 A;  2H1A A;  4WR5 A;  5A5K A;  3CRT A;  4NPB A;  3WGE A;  1A23 A;  2R37 A;  4IS0 A;  4KB3 A;  4ECC A;  5J5N A;  1GSF A;  2GT6 A;  2VAF A;  2DJ1 A;  4K1F A;  2JZS A;  4GWR A;  1V57 A;  4WF4 A;  1GWC A;  3EIN A;  3IXR A;  2DML A;  2IL3 A;  3A2V A;  2H1D A;  2AUV A;  2FWE A;  3PR8 A;  3M8N A;  4L0W A;  2H1B A;  3KMO A;  2WFC A;  5LD0 A;  1CQG A;  1AAZ A;  2XHF A;  4KX4 A;  3P2A A;  2HRN A;  2DJ0 A;  3HZ8 A;  2H0H A;  4XRA A;  1M99 A;  2B5E A;  5CRE A;  1B4P A;  3C1R A;  5B6M A;  3WD6 A;  3IK9 A;  3TKS A;  4ZB8 A;  2CZ2 A;  4Z7X A;  1HNC A;  3HZ4 A;  1KNG A;  3CYN A;  3DEX A;  4GF0 A;  4BA7 A;  5B7C A;  4MLY A;  1YQ1 A;  1PL1 A;  1SYR A;  3UVH A;  2FA8 A;  1ML6 A;  5DJL A;  1ST9 A;  1PN0 A;  5HR3 A;  4HU7 A;  4HJ2 A;  13GS A;  4O5U A;  1E2Y A;  4K5R A;  4HUA A;  4NV5 A;  4YQU A;  2IMK A;  2RM6 A;  11GS A;  2WDU A;  3IV4 A;  2YPM A;  3TJJ A;  2EIQ A;  1TDI A;  4D73 B;  3IC4 A;  2WZ9 A;  4RI6 A;  4IP6 A;  2JAD A;  3F8U A;  5DQS A;  3FR6 A;  4MK3 A;  1JLV A;  2PMT A;  2L4C A;  2C1Y A;  3W6G A;  5EVO A;  1PA3 A;  3IPZ A;  3K8N A;  1FVJ A;  3JCM L;  2WRT A;  3MAK A;  2WJU A;  2TRX A;  2KLX A;  1S3A A;  4I2T A;  4PQH A;  2CZ3 A;  2H01 A;  3GA4 A;  3LJR A;  2DMM A;  2NPB A;  5DDL A;  3CTG A;  3TRP A;  1E6B A;  5D9V A;  3F63 A;  5EPF A;  2L57 A;  5IIZ A;  5IPG A;  3KH9 A;  5AIV A;  3CTF A;  2FCH A;  2JAC A;  4G19 A;  1FVK A;  1XVW A;  1R5A A;  4X0X A;  3AY8 A;  3IDV A;  2AHE A;  1XW5 A;  1F9M A;  22GS A;  4FO5 A;  1GTB A;  1NW2 A;  3CXG A;  1WMJ A;  3A3T A;  2JSY A;  3F6F A;  4E8H A;  4IW9 A;  2VCW A;  4WR4 A;  4TRX A;  4ICY A;  1LBK A;  2QA1 A;  1X0R A;  4F0C A;  2R0C A;  3KIJ A;  3VK9 A;  3L9V A;  4IKH A;  2XPE A;  1TU8 A;  4KW6 A;  4HS1 A;  1OKT A;  2K6V A;  4AJ6 A;  1T7P B;  1PKW A;  5LNK e;  1QUW A;  1TKD B;  1GNW A;  4K2D A;  3R2Q A;  3GRX A;  4FIW A;  2C0D A;  3GSS A;  2MMN A;  2RM5 A;  1XBS A;  5J9C A;  2GZZ A;  3EVI A;  4GLT A;  1X5D A;  4GST A;  1TRU A;  1M9B A;  2A2P A;  3O76 A;  1K0D A;  3CSH A;  4EXJ A;  4KH7 A;  4PUR A;  5H5R A;  4N10 A;  2DJ3 A;  2IN3 A;  1O8X A;  1K3Y A;  3HJM A;  2GQK A;  2LKU A;  2MBS A;  2KHP A;  2F8F A;  1Z6N A;  2G0F A;  4P3Y B;  7GSS A;  3V1W A;  1ZZY A;  5AIS A;  3QOU A;  3MNG A;  3DRN A;  4K7I A;  1HNA A;  3NZN A;  4G2E A;  2VD0 A;  4MA9 A;  3KM6 A;  1EZK A;  3S9F A;  1U3I A;  2DJJ A;  3ZML A;  3W8S A;  5DJM A;  3O3T A;  1TK8 B;  4PUA A;  4GTU A;  2REM A;  5KOX A;  1UVZ A;  4EE0 A;  1SU9 A;  4O7H A;  3NIV A;  3HY2 A;  4GXZ A;  1K3O A;  2YJ7 A;  3TOT A;  2IMF A;  1B4Q A;  4JRR A;  3WGD A;  2PGT A;  2YNX A;  3BCI A;  2LTK A;  5AGY A;  2AV4 A;  5HFI A;  5EY6 A;  1FO5 A;  2H6Y A;  1SJI A;  3QPM A;  1JFU A;  4RI7 A;  3FEU A;  3QFB C;  3G9B A;  1XOB A;  5F0G A;  4XIH A;  3OR5 A;  1H4O A;  4DSS A;  5B8A A;  3GFK A;  1UA5 A;  4X43 A;  3IC8 A;  3DD3 A;  1ERU A;  5G30 A;  5D9W A;  4IP1 A;  2C4J A;  2CQ9 A;  3FR9 A;  3ZFB A;  1PD2 1;  3RBT A;  4ZIJ A;  4F2I A;  18GS A;  1R5P A;  2ZCT A;  4TXV A;  3CSJ A;  1T1V A;  4KSO A;  3DML A;  1C72 A;  4WF5 A;  1O81 A;  2OA7 A;  1FAA A;  3FY7 A;  3D21 A;  1GSY A;  1U88 A;  4HEA 2;  2QA2 A;  4PXO A;  2TIR A;  3E9J B;  3F0I A;  4BVY A;  4BPY A;  1W4V A;  3QCP A;  5IMF A;  4J57 E;  1MDK A;  4LL4 B;  1TRS A;  1QQ2 A;  5FT3 A;  5DCH A;  3RPN A;  1GSD A;  2HRF A;  2B3S A;  5B8B A;  2O87 A;  1PGT A;  4OFM A;  2HRA A;  2ON7 A;  3FZA A;  3TUE A;  5IO0 A;  1JZO A;  1OC3 A;  4HU9 A;  4JR6 A;  4KSM A;  2X64 A;  2E2M A;  1R26 A;  3APS A;  2E0Q A;  2K9F A;  3KTB A;  3Q18 A;  3Q19 A;  1PX6 A;  2FNO A;  2KP2 A;  4AF2 A;  1HNB A;  3WT1 A;  2BJX A;  3US3 A;  1F3B A;  3CSI A;  3TJK A;  5CRG A;  4LL1 B;  1ABA A;  1IYI A;  3BD2 A;  4F03 A;  5GAN D;  2R0G A;  2C8U A;  2K8S A;  5GZZ B;  4XHM A;  1A2J A;  2V1M A;  2IFQ B;  4EDY A;  4J56 E;  1X9M B;  1PMT A;  2O8V B;  3GUS A;  4Q5F A;  3HHV A;  3DIE A;  5JWQ B;  1EOH A;  1FB6 A;  3N9J A;  4N11 A;  1ZYE A;  2R6K A;  1DBY A;  4MJB A;  4FYU A;  5BMU A;  3KD0 A;  3P7X A;  16GS A;  4KCA A;  2WGR A;  2YJH A;  4HQZ A;  2R2J A;  1XOA A;  1WOU A;  1KBN A;  3W8J A;  5ECN B;  4LMW A;  3QD9 A;  4GCI A;  2HZE B;  3HA9 A;  2YZU A;  1ERV A;  2WS2 A;  1EEJ A;  4KND A;  5DAK A;  3H4K A;  1NHO A;  1XW9 A;  3UOM A;  1NM3 A;  1B48 A;  1VGL A;  2KOK A;  4QQ7 A;  5BRT A;  3ZL5 A;  5GAP D;  3VI7 A;  3ZIV A;  1GH2 A;  4EKZ A;  4TR3 A;  5D96 A;  1OE8 A;  4K2X A;  4EO3 A;  2V32 A;  4NMU A;  4MF6 A;  2H72 A;  3F3R A;  4FYC A;  3A5W A;  3TDG A;  2E2G A;  1GUM A;  4WKW A;  5IM9 A;  4HOJ A;  1SD9 A;  3FHK A;  4TKY A;  3HYP A;  2IPA A;  4EIQ A;  2QC7 A;  1XWA A;  5G1L A;  1YEP A;  1F2E A;  5JCG A;  3FRC A;  3TRQ A;  3I9V 2;  2LRT A;  1GUK A;  3VUR A;  2M80 A;  1XWK A;  4ZL9 A;  2GGT A;  4TR1 B;  1SK2 A;  1ERW A;  3KGK A;  2R3X A;  2A4H A;  4OWY A;  3QFA C;  1QMV A;  5KN2 A;  2FA4 A;  5CYY A;  4TVE A;  1HYU A;  4ZB9 A;  17GS A;  2I4A A;  3BOA A;  1Z3E A;  3H8Q A;  4OMV A;  2GZY A;  3A2X A;  1SYX A;  1K0C A;  4ACS A;  2P5R A;  1NHY A;  1A0R P;  3QDN A;  5KN0 A;  4EUY A;  4K0N A;  2H70 A;  5DBQ A;  3LG6 A;  2AAW A;  2XPD A;  3RDW A;  3DKS A;  2H73 A;  4O5R A;  2YWM A;  3GV1 A;  1V98 A;  3RHC A;  1U87 A;  2CVK A;  1BYE A;  1F6M C;  4EVM A;  4K8M A;  1ZYQ B;  3P8W A;  2XBQ A;  4MJA A;  5F8B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...