3DXBA

Structure of the uhm domain of puf60 fused to thioredoxin
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
214
structure length
214
Chain Sequence
PMSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLAGSAMESTVMVLRNMVDPKDIDDDLEGEVTEECGKFGAVNRVIIYQEKQGEEEDAEIIVKIFVEFSIASETHKAIQALNGRWFAGRKVVAEVYDQERFDNSDLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords thioredoxin N-terminally fused to Puf60(UHM)
publication title Dimerization and Protein Binding Specificity of the U2AF Homology Motif of the Splicing Factor Puf60.
pubmed doi rcsb
source organism Escherichia coli o157:h7
molecule tags Splicing, transcription
total genus 51
structure length 214
sequence length 214
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2008-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dxbA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3dxbA01
3F4SA 5G1LA 2NLWA 2LKUA 3LPYA 5A4VA 2OSRA 2H1GA 2VL2C 4BWSA 2EVZA 3V1WA 4MJAA 3TGZA 4MJEA 2HLSA 1QMVA 1TP9A 5IM0A 5G31A 4J5OA 2DGQA 1FW1A 3GTUB 3TJKA 2RUEA 5DDQC 1E6BA 3U6VA 4CHSA 3Q74A 1FJEB 5HR0A 2VAFA 2JVRA 2H73A 2WCIA 5L71A 2MMZA 1K0OA 4F9ZA 5ENUA 4QQBA 4G19A 1AQXA 4V2NA 3MXHP 4Y0FA 3P5TL 3DIEA 3S01A 3QAGA 3VAFA 2MKKA 1GL8A 2MQMA 3DLLQ 5GAGU 3RPPA 1XXUA 1ERTA 1T4YA 3BCIA 2MMNA 3TKSE 3PH9A 4WBJA 2K8VA 4IQ1A 1X4EA 4FXVA 5J5NA 5G30A 1NU4A 3Q18A 1MTCA 5B7CA 2FA8A 4IS0A 2RT3A 2LRTA 2P0GA 4ZBDA 1U1RA 1Q7YT 3GRXA 1Z5YE 2DJKA 3DRNA 1TJDA 3EWLA 2N3LA 2KXHA 1O0PA 5CYYA 3TB2A 4TW5A 2XNRA 3EVIA 3NS6A 4WEYA 2LECA 4K0GA 5DQSA 5CREA 4N11A 2V2GA 2P5RA 2XC2A 13GSA 2KU7A 4WIIA 2PU9C 3TKPA 3GURA 3CYNA 4EDYA 1S3DA 5DAKA 5IM0B 4IN0A 4TXOA 4DSQA 2CVDA 5B8BA 2XNQA 2WDUA 4KX4A 5IO2A 3GUSA 3QDNA 3FY7A 2YH1A 1SD8A 1PO6A 2CPXA 3WD6A 1MD4A 4KA0A 3ULHA 1WTBA 2YJHA 5H5RA 3H2UB 1WG4A 2DLXA 4PUAA 3D22A 1TKDB 2MJUA 5H1SV 1YEPA 1WP0A 1GTIA 4K9ZA 1X4BA 4POLA 4I2TA 2KM8B 4V1Ap 1PA3A 3NOFA 2XS5A 3CCMS 1O81A 5B8AA 1M2DA 1K0AA 4ECIA 2CPFA 2DHGA 1Z6NA 2HFDA 1JZRA 5EPFA 1F9MA 1YF0A 1AAZA 2LV3A 3THPA 3LYKA 2RQ4A 4QL9A 2OACA 1DUGA 3E3EA 2IMFA 5D73A 5ECNB 2P5QA 1YITS 2LMIA 2V6OA 5ITHA 1A2MA 3MUTP 1X5EA 2GZYA 5DAKB 4BA7A 2N5FA 3TYTA 2H1AA 4TXOB 4GTUA 1Y6EA 1NW2A 1WHVA 2YKAA 3CULA 3TKSA 2M46A 4LMZA 3UL3A 3JCML 2DO0A 4K8MA 3S7RA 3PIOQ 3TOTA 2I2YA 5GAND 2J23A 3BEGB 3Q2TC 2RIIA 4IUFA 4AJ8A 5DBQA 2HGMA 2VIMA 3UMAA 2LQ5A 3W8JA 4EO3A 4MF5A 5IPHA 3A2VA 1BAYA 3UCGA 4MA9A 1FO5A 3HD5A 2B0GA 2RQCA 2GSQA 1P27B 2DNMA 1WF2A 4FIWA 4IJIA 5D78A 2KP1A 1H2UX 1KC8T 3ZVJD 1JZDA 2JZRA 3UVTA 4G10A 4G2EA 5IM9A 2DIUA 1JZWA 1ZGNA 2YWOA 2DNOA 4AJ7A 1X0RA 5EL8A 1OO0B 2M4MA 2X1GA 1KD1T 1EOGA 1Q98A 1TU7A 3UEMA 5DVBA 4NPBA 5LXYA 3Q2SC 1RKJA 3C1SA 2CPDA 3QFAC 2L6CA 5D93A 4HJMA 2AUVA 2HXKA 2KM8C 2MBSA 2HSHA 2MMYA 3IK7A 4ZB9A 1WRYA 4KDYA 3C71A 5CRDA 4M5DB 2GT6A 4HU7A 4KB3A 3G9CA 2GZPA 3W6GA 4PR6A 2O87A 3W8SA 2L41A 5GAEU 1VRSD 4FXWA 4EE0A 1BX9A 4TKYA 1WF0A 3M8NA 3F4TA 11GSA 3FR3A 14GSA 5LSLA 1F3BA 1VF1A 1U6FA 3HZ8A 2YTCA 1WG5A 5JVHQ 4TN8A 1F9FA 1T00A 2H75A 5F05A 1SJIA 2VL9A 2DHSA 2LA4A 3UOMA 4PQ1A 3BJ5A 4IOCQ 2DJ3A 1W89A 3J7YU 5AN1A 1Z9HA 4K7NA 4KGIA 2J9HA 2BZ2A 4FO5A 2OE3A 1R8HA 1TOFA 4TLQA 3SMZA 1BQ7A 2C8UA 2XHFA 1YDKA 5JWQB 3MURP 1X5SA 1M2AA 3K0JA 1T3BA 3G4SS 3CRUA 3GN3A 3KZQA 5F06A 5DALA 2H0HA 2MMOA 4EL1A 4C0OC 3KH7A 3VLNA 2DNHA 3MAKA 2JU5A 4C4WA 3K8NA 2DJ0A 1M99A 2FHOB 1PSQA 1QGVA 5HR2A 1VQ4S 1HD2A 1ILOA 2PBJA 4O32A 2AHEA 1RQMA 3UVHA 1WEXA 2B5EA 2TRCP 3UAPA 5A4WA 5GSTA 4MJBA 3M3MA 2VM1A 4YUDA 3M0FA 1SL2B 2KRBA 1K0NA 4RQRA 3D4MA 1X9MB 3G8TA 3RW6A 2H70A 3LFLA 1DBYA 4OO5A 3LQVA 1VF4A 2FPHX 17GSA 4L0WA 2MHNA 2YCDA 5JCWA 3LSZA 3FYGA 2BTOT 2DIVA 1X5TA 2LEAA 1U1MA 1FB6A 2J8AA 5DALB 4BWQA 2GO9A 3UBLA 3A2XA 3O3TA 4X43A 4BVYA 1GUMA 2N5AA 2DNYA 3GKNA 1SU9A 3QMXA 2XS7A 1SXLA 1M0UA 3UD3P 5FWGA 1SKSB 2K6VA 1WEYA 4FH8A 2H6ZA 1YJ9S 4V2LA 1ZMAA 2F9JA 3APSA 3N9UC 2LKZA 3G7JA 2ZUPA 2V41A 5KEJA 3SDEB 3I56S 4N0VA 1HL6A 2XPDA 3FHKA 1YHQS 4YAPA 1T8EB 1TU8A 1UN2A 3GSSA 2GS3A 1VF2A 5GAHU 2QFJA 2EC4A 2DNLA 4I97A 4MK3A 3F3QA 2DGSA 1VQ8S 2GDRA 3KCMA 5IO0A 2NTOA 2P31A 4ZL7A 2U2FA 2LJKA 3ED3A 2OA7A 3APOA 2H74A 1ZH5A 3CD6S 3KTLA 1T1VA 4Q5FA 1NO8A 2DGUA 5AIXA 1PQNA 1K0DA 4RI7A 2DHAA 1GUKA 1SJQA 1B48A 2CQIA 3D0ZA 3UWTA 2H1BA 5HFKA 2KVIA 2HYIB 5IMVA 3QCPA 3HJMA 2YANA 3VK9A 3F3RA 3VF0B 1U6TA 4LIRA 1YIJS 2DJ2A 4ULXA 5H5QA 2CQ3A 2BMXA 1GSFA 4GF0A 3HVVA 2AV4A 2H01A 1A0FA 2CVKA 1QXHA 4YH2A 4IO9Q 2EK1A 1OC8A 2I81A 2YNXA 1YY7A 4F02A 3I69A 1I5GA 2HT9A 3F9UA 3WT2A 1PX6A 1WELA 2R6KA 5D9TA 1DE1A 3HVSA 2X1AA 1XWGA 3QFBC 4BVXA 5JVGQ 4TRXA 3H93A 2RU3A 3BD2A 4PUFC 4K1FA 1TXXA 1M9AA 2C80A 2FC8A 4KCAA 2N82B 3R1HA 2DMLA 2WB9A 2M8HA 2EK6A 3KMOA 5ECSA 3RDWA 1GNWA 4P3YB 1GTUA 4TR3A 1GTBA 1ZCPA 3IV4A 4WF4A 4KDUA 1JJ4A 1JMTA 1SJ6A 1ERWA 1G6WA 1WE0A 1X5PA 1KBNA 1D8ZA 5IOWA 2O3DA 2CZ3A 1EEMA 4MF6A 1BG5A 1X5CA 4JE1A 2D2ZA 1ZYQB 1BEDA 1M5KC 1F6MC 3UCUP 3IDVA 3KTBA 4IP1A 2QKEA 1ZZYA 1B4PA 1V58A 2O89A 3QOUA 2MZCA 1QVGR 4GQFA 5IQYA 2E7PA 1KEBA 3TJGA 3TRPA 4DVCA 3FR6A 2GGTA 1GUHA 3F8UA 1YKCA 2DNKA 1OKDA 1XIYA 4MP4A 1SKWB 1A2JA 4RI6A 3KM6A 3H1NA 2M8DB 2NBSA 1U1NA 3EU4A 1U3AA 1SJ3P 2K3KA 1N2AA 4N30A 3BS9A 1ERVA 3L0HA 4GCIA 2G2QA 3GL3A 1R5AA 1WHWA 1HYUA 1Z3EA 4PQIA 2CQDA 5B6MA 2B6MA 5IFMA 5A4UA 1Q81T 2OIHA 1PRXA 4OO4A 2MQPA 2KI2A 1M9BA 1PX7A 3ZYWA 2H71A 3APQA 4EF0A 3WYWA 1D9AA 3CUNA 1X0FA 4MDCA 1ZZFA 1MDIA 3U1LA 2VUPA 4ZL8A 2AYTA 3MSZA 1K3LA 2L08A 3F63A 3CCVS 2MYFA 3GH9A 5ECKB 2E2MA 2F3MA 2VLUA 5D9WA 5C00A 4NHZA 3I55S 1V2AA 2DNPA 3Q19A 4OZ0A 1AXDA 3C1RA 5IMDA 2C3TA 1M5OC 2YZHA 5G5EA 5LJ5Y 1URNA 5ECQB 2ERRA 2YWMA 6GSYA 1X5DA 1WG1A 2CPEA 3KH9A 2HZFA 3VFIA 2YH0A 5GMKa 1KNGA 1EOHA 2A2RA 5CNWA 1USBA 3WT1A 4K0NA 2O7KA 2NDOA 1GSUA 5CA5A 3TJBA 3ZL5A 5B6NA 1O85A 4DSSA 4V19X 5E59A 5J4UA 5GADU 2CPYA 1T4ZA 1SD9A 4HU9A 2VLVA 5FJ4A 4AJ6A 2YWNA 10GSA 2PVQA 2M0GB 3ERWA 1VQ9S 1MD3A 4N0ZA 3G8SA 2DNRA 1X4GA 1SJ4P 2K9FA 3CCQS 4F25A 2NPBA 2LNSA 2GT5A 2FCHA 2IN3A 4U67Q 3ZVJA 4QPTA 1OVNA 1ZYEA 4ZBAA 2RUGA 1TK8B 4WFNQ 4XS6A 2CPJA 2O85A 1AIUA 3LJRA 1JJHA 5F8BA 1N88A 5CXTA 1W2BR 3E0UA 1Q86T 4MH3A 1GTAA 4TVEA 3RAZA 2OSQA 3TJJA 1W4VA 2MGZA 1VBXA 3FR9A 2LUSA 1U1KA 1PMTA 5F0GA 2DJ1A 4TR1B 2CQ4A 2DSAA 4X0XA 4LMVA 4PNGA 1TRSA 4DSSB 4ML6A 4HI7A 4IW9A 3H2VE 5CRGA 4POMA 3U5RE 4PRFA 3TRQA 1WF1A 3KIJA 2ZJPQ 3TDGA 4L5OA 3DEXA 5DCGA 2WJUA 2A3JA 3CCLS 4ISDA 1B9YC 5LCZA 3N5OA 6GSUA 5FHIA 4WBRD 2RM6A 2L5OA 4I2UA 4QL7A 4WKWA 4KH7A 2CQ9A 1I9DA 4YQUA 1Q82T 2GSTA 1RK4A 4QU7A 2ZCTA 3EE2A 3HHVA 4NMUA 2FLSA 1JJ2R 5HQPA 4L8EA 1VC5A 1UAWA 1FVKA 3QAWA 2LRCA 2V94A 5MLCV 3LWAA 2DGXA 3OW2R 1ZL9A 4J57E 2EIRA 1G0TA 2H8LA 2OADA 3GX0A 1NHYA 1KOOA 2N3OA 1FXLA 3BO2A 1GSQA 1HQOA 2WRTA 3HKRA 1P1TA 3EMXA 3C73A 4JEDA 1WHYA 2VLTA 2A2SA 2AYEA 3MUVP 2MGZB 1OE8A 2I38A 3CSHA 3VAMA 4OCEA 3VAIA 1V40A 4ZB8A 3SWLA 1S72S 3Q6OA 3WGDA 2REMA 3G6ES 2LNTA 1EGRA 1ACVA 2H66A 1YQ1A 4RQXA 3PR8A 5DDRC 1EZKA 1WWJA 3PIPQ 2CAQA 5J41A 2QEXS 4WR5A 3ZTLA 2XPEA 1HD1A 4MZWA 1UFWA 1F37A 1GSDA 2AYGA 4OD7A 3DYRA 1XFLA 3CXCR 1QFNA 3IOSA 4YOEA 3D2WA 1J08A 2E5HA 1Q4JA 3L4NA 3IPZA 3L78A 4RU2A 5D9VA 3C7MA 3NNCA 5IPGA 4POKA 2YJ7A 2DIYA 1SJRA 2VCQA 2MKHA 1EP8A 3HZ4A 1JLWA 3NIVA 1NSWA 2M52A 2RS8A 4GSTA 2J0SD 1ML6A 2NVLA 3EGNA 2GQMA 5DDPC 1VQKS 2RLIA 3UBKA 2RNEA 2XBQA 2FD3A 3GKMA 2LJRA 4ML1A 1VQLS 3TRXA 5FT3A 1X4AA 2GLRA 4YB1P 4GXZA 1FHEA 3QD9A 1XWAA 5AIVA 1H2VZ 4IELA 2VM2A 4EGLA 4GQCA 5IMAA 3GHAA 2BOPA 3D6IA 5ECPB 1DHMA 3MWHA 2MXYA 4LL1B 1GLQA 2JZTA 3BCKA 2KHCA 1OYJA 1U3IA 2JSZA 4KDXA 3DXBA 1FOVA 4DEJA 5D96A 1HNBA 1YJNS 2H0IA 1VQ6S 2F51A 3S6EA 3MNGA 2WS2A 3CCES 2CX4A 1L3KA 4WF9Q 3EURA 3D4TA 2IFQA 1FAAA 2MZQA 3EINA 2DH9A 1Z6MA 2M2BA 2V32A 1V98A 5CYJA 1EV4A 4LLRA 2CPZA 1VQOS 3SDEA 4MJCA 3DD3A 2KUCA 5EVOA 1B4QA 3QPMA 2TRXA 4OCFA 2MZJA 1AW9A 7GSSA 2HSYA 3CF5Q 3NNHA 1M5VC 1SJZA 3ZITA 1XW9A 1RK8A 5AGYA 1V9WA 4Q5NA 2KH9A 3MOJB 2DC5A 1YJ6A 4HZ2A 3ME8A 4PURA 1WWHA 2YWIA 3C8EA 3FK8A 3VURA 1FNXH 3ERFA 5KN1A 2VL3A 2DGOA 5DJMA 5A5KA 3GFKA 5HR1A 3OR5A 1DZ5A 3ZZZA 1BYEA 2L4CA 3V4MA 1T7PB 2RS2A 1E2YA 4POBA 4L5LA 2HYXA 1R26A 4K6XA 3BO3A 2CVBA 3O6TA 1XVQA 5COHA 1DE2A 1XW6A 1F3AA 4FYCA 5J9BA 5BJRA 3IRWP 1PGTA 3E9JB 2IFQB 2OJLA 3BO4A 1B8XA 2E0QA 3MD1A 3NS5A 1VBZA 1H4OA 2MKCA 2CA8A 2GZZA 5ABRA 2M70A 2H6XA 2MMAA 1R7HA 4FYBA 2JRSA 9GSSA 3ZRDA 5G2ZA 2G1DA 2CT6A 3DVWA 4MZBA 3P8WA 1UW4A 5GSSA 2F9SA 5J9CA 1FG4A 2MQQA 3R1LA 1XN9A 1U1LA 3R2QA 1O8XA 3M9JA 2LS5A 4ZIJA 1X9SB 6GSWA 4GRFA 3VI7A 1U87A 1XPVA 3R27A 3TOUA 3LEFA 4TU8A 1PN9A 3VWUA 1O73A 1K8AT 4YAVA 2KT5A 2UP1A 3RPNA 2CQ1A 4NHWA 1EGOA 4CDOA 3VALA 2LQQA 4OMVA 2ADCA 3L9UA 1PGZA 1WJKA 4K7IA 1VF3A 4PQHA 4NAXA 3CMES 2D3OR 8GSSA 1XOBA 3CCUS 2XS2A 2CQ0A 3B4MA 1GSEA 4ID0A 3GX8A 4OFMA 2H19A 2RRAA 1TRVA 3H8QA 1GNEA 2K18A 5C04A 3LYPA 4IKHA 4WKRA 1A9NB 3FKFA 1PKWA 2YP6A 1SYRA 2HE3A 3F6FA 1A2LA 2H72A 2LTKA 1HD0A 5ECLB 1VBYA 1GLPA 5JCUA 1XCCA 3D5JA 3F6DA 1SENA 3BBYA 3VAGA 2GQKA 2XBIA 3CCRS 16GSA 4O7HA 4KCEA 4HEA2 2YZUA 1C72A 2LEBA 4QU6A 1X4CA 2HRNA 1QUWA 4OFNA 3IE3A 4O5RA 3HI9A 2DNQA 1XZOA 1NJIT 2L59A 4YQVA 4WF5A 2DO4A 6GSTA 2C4JA 3HJOA 1FVJA 2IJYA 3HCZA 4JU5A 2E5JA 2C0DA 4E8EA 2J0QD 2WGRA 3RHCA 3DKSA 2H76A 2MQOA 4J56E 2MZRA 2LJAA 3ZFBA 4ZXGA 2CZ2A 5CO3A 2JX2A 3P3DA 1GSYA 5JWRB 4IOAQ 1U1PA 4I5QA 2R3XA 4IP6A 3LGCA 2K8GA 2MZ1A 1O8WA 5ECIB 20GSA 4L0UA 3VPQA 2FUG2 5KN2A 3HA9A 1XOAA 2F9DA 1Z7PA 2PWJA 2ZJQQ 3CCSS 3UE2A 3ZZYA 2ON5A 3DWVA 4RUVA 1JHBA 4D73A 2F8AA 2YN1A 1A24A 4XS4B 1GRXA 3IWNC 3ISOA 1LU4A 2C0GA 19GSA 1THOA 5ECHB 3IR4A 2X8GA 2C3NA 2TIRA 3P7XA 4KW6A 4CIOA 3LXTA 2X8HA 2WZ9A 3M1GA 1UA5A 1BJXA 1N52B 1THXA 1YKAA 2R2JA 4KSOA 2K8SA 2IMIA 4ZKAA 4EVMA 2OE0A 3GL5A 2MY7A 5HFIA 2FWGA 4WXTA 3G7YA 4EXJA 5LD0A 5IIZA 1IYHA 1AC1A 2OBIA 2OTLS 2X8CA 4TOPA 3U1MA 4I8BA 5G1KA 1VQMS 4MZCA 3ZFLA 3ERGA 2H1DA 2YPMA 4JZQA 4MF7A 3CC7S 3ZMLA 2DGTA 4ED5A 2JADA 2IIYA 2CPHA 22GSA 1VQ5S 1PKZA 4WFAQ 2IPAA 2KP2A 1WOUA 2GVPA 3CC4S 2OBKA 2B5XA 4NV2A 4GWRA 2OJ3A 2PVOC 3GIXA 4J2FA 3TKQA 12GSA 2C3QA 4D73B 3US3A 3FRCA 1HNCA 3B4DA 5LSOA 1ZZNA 1OWXA 4XIHA 5J3RA 4BL7A 4UQTA 4AGSA 4FYUA 1U88A 4ECCA 4WFBQ 4TR1A 1AQVA 2AJQB 3HY2A 2MSSA 1AQWA 2LQOA 2MKJA 5LJ3Y 2VONA 1DRZA 1A8LA 4KSMA 2HGNA 5INYA 2CQCA 1ERUA 2ZJRQ 1VGLA 4HUAA 2CX3A 3AY8A 3EYTA 3HXSA 2KRRA 2MYGA 3S9FA 2DGVA 4Y00A 2FY6A 3UJ1A 1LBKA 2VODA 5GZZB 3CSJA 3IRAA 3GYKA 1G7OA 1DBDA 1J0FA 4OWYA 2M80A 1A23A 3G9BA 5G5FA 4XS1A 3VI5A 2RVJA 4LJMA 3PINA 1QQ2A 3UIWA 2X99A 1TI3A 1EP7A 2DH7A 4PKDB 2G4BA 2JL4A 3IA1A 1UVZA 3P2AA 4OZ1A 1SK1A 3D21A 4GLTA 3EMPA 3CTGA 2MQNA 1G6YA 2HZCA 2B1KA 1YZXA 1TK5B 2ES7A 2DBCA 5D9XA 1X4FA 4PNFA 3TKRA 1M2BA 2CPIA 4EUYA 5HL7Q 3MI7X 3WGXA 3FEUA 1DSBA 2DHXA 4EC0A 1SKRB 1M90T 1KQSR 1X4HA 5CAXA 1GH2A 1XVWA 2OE1A 2X1BA 4CQ1A 1URMA 3KP8A 4F03A 4HDEA 1H6KX 4KNDA 5ECMB 2LEGA 1OE7A 5IMCA 4QQ7A 3QR6A 1JZOA 3SXLA 4HQSA 5ELGA 3VWVA 2CQPA 2DNZA 1RW1A 4NWYA 3VAKA 1U1QA 1UP1A 3IC4A 5F07A 4KE3A 3DGQA 2XSFA 2MQLA 2PUKC 2GQLA 3MD3A 4EKZA 4HJ2A 3LG6A 4F0CA 1GULA 2VCVA 1BY9A 4CH0S 3VPTA 3TO8A 2C0EA 4MLYA 2OTJS 3GNJA 4Q5RA 1WHXA 2B5YA 2MBTA 2PMTA 3HYPA 2LXIA 2NZ4A 3CBUA 1ZOFA 4PX1A 1JLVA 3TCOA 4TU7A 3A5WA 3RW7A 2G0CA 3CMIA 1FT8A 2PEHA 1M5PC 1U1OA 2VD1A 1CQHA 3H79A 2KFYA 2FHEA 1U2FA 3HHNB 2I4AA 2FWEA 2VCTA 3F4RA 4WETA 1JFUA 4PGTA 2H6YA 3IAS2 4P6QA 2FWFA 1YWXA 2MKSA 4XCSA 1K0MA 2AD9A 2QA4S 2KYXA 1EEJA 4NV5A 1SJFA 4N10A 2VOOA 3NZNA 2AB6A 2DK2A 2I9HA 2KHPA 3I9V2 3FZ5A 1K3YA 4YQMA 3ZMKA 4MPGA 2DJJA 2LSTA 3CCJS 5HR3A 2HVZA 4ZL9A 5DETA 4HOJA 2OKAA 1M1KT 1Y25A 18GSA 2A4VA 2SXLA 2ALBA 4Z7XA 1H75A 3A2WA 3TUEA 1WIKA 4AF2A 3ZIVA 2IL3A 3EGZA 1OC9A 2FNOA 2WULA 5D77A 1SK0A 3WGEA 4HS1A 3US5A 2CJKA 3EC3A 5JCGA 4V2MA 2EIOA 3A3TA 1X5OA 2MSTA 4Q5QA 3J7Yb 3CPWR 2Z9SA 2H30A 5IOXA 2JVOA 1TRWA 1G7EA 2HGLA 5IQQA 4I6XA 3UARA 1FHTA 4LA1A 2YWKA 2X64A 1YTYA 5JWOB 2B7KA 2VD0A 1TTZA 4MPFA 2M72A 1V57A 5DM7Q 1VQ7S 1CVJA 4MMMA 1N8RT 4JBBA 4Z2XA 1B7FA 1PD21 4F26A 2LRNA 2O8VB 2YV9A 2DITA 1LJRA 5IMZA 5LXRA 3ME7A 4W90B 1H2TZ 3GKKA 3VWXA 1FB0A 2I1UA 3IAM2 3IHQA 2ADBA 4JR6A 3ZREA 5EN1A 1HNAA 6GSXA 3RBTA 2BJXA 3FEYB 3LQ7A 2XB2D 2PERA 4C7QA 1TI1A 1HA1A 2I3YA 3GV1A 4BS2A 3CTRA 2GTUA 3FEXB 2HZEA 4XHMA 1A8YA 5DDLA 4ECBA 4JRRA 5CRWA 2CQGA 2KG0A 1XBSA 2CV4A 3CSIA 3FW2A 4XTSA 4DSRA 3L9VA 3J7ZT 2DH8A 3O76A 1OC9B 2VOCA 3F0IA 3MDFA 3S8SA 3KD0A 2C1YA 5DJLA 3I43A 1SYXA 1NHOA 3GSTA 2GSSA 2MB0B 1B9XC 3FZ9A 5D8IA 1M7TA 2KG1A 1OC3A 4ERDA 4X1UA 2M88A 1SK2A 5HFGA 1S3AA 1IQTA 4ZB6A 2DGWA 2EIQA 2L4QA 5CRHA 2N7CA 1QM9A 5DCHA 4NXIA 1SL1B 4UY8T 2AYMA 2B3SA 4LMWA 5DM6Q 2FY1A 2PGTA 4EDZA 3IK9A 2GSRA 3TKSC 1ABAA 2E2GA 1FO1A 2ZNMA 4MH2A 3VAJA 2HI7A 4IHUA 3CRTA 4XRAA 1PL1A 3IXRA 1QVFR 3I6AA 4CW9A 1K9MT 2HZEB 5EY6A 3UCZP 1S3CA 2IMKA 2IWTA 2AYBA 2MY8A 3M9KA 2R5GA 4JR4A 1YEXA 1J9BA 3MUMP 5H5SA 2IMDA 4IJ3A 5KN3A 1NM3A 1ON4A 4PXOA 2KXNB 3KEBA 2PN8A 4ZBBA 2E44A 1K0BA 3QAVA 4GSSA 1VC0A 3VWWA 2JZSA 3DVXA 4W92B 2VCXA 3KP9A 1R5PA 4ZILA 5ID2A 1R8PA 1EV9A 4F0BA 2DMMA 3KXOA 6GSSA 4KAEA 2Q79A 1MEKA 2VL2A 2DNGA 2QSIA 4IVFA 2LXUA 2D9PA 2J76E 1GWCA 2GHPA 4H86A 5IMFA 2JSYA 2CQ2A 5ELAA 1UC7A 1XWKA 1AUDA 4TXVA 1ST9A 4TU9A 3P90A 2MJNA 3G71S 4WCEQ 1GP1A 1R4WA 3P49B 1OPIA 3PGTA 3BOAA 3DMLA 2R4VA 4TR4A 2L6DA 2FWHA 3N9JA 3GKXA 1CQGA 2FA4A 2V1MA 2QGVA 4HQZA 2QC7A 2WFCA 3TJFA 1K0CA 1X9WB 3GA4A 2KLXA 6GSVA 3ZLPA 1N8JA 3MDKA 4MCUA 3CXGA 1EWXA 3VAHA 2KOKA 4F2IA 2HRFA 1YI2S 3CTFA 2DIZA 3G7IA 2X1FA 4IBPA 2RRBA 3H4KA 5ECRB 2RUFA 2B7JA 2V6KA 1VQNS 4XS4A 2JWNA 4ILFA 1WI8A 2ON7A 4G9HA 1VC6A 4MABA 5ID2B 2H0GA 1KOHA 2L57A 3JB9k 2RM5A 2DNNA 1AUCA 3KMNA 1XW5A 2KXFA 2CQHA 5GVQA 3NNAA 4LL4B 3SBCA 2LA6A 2CAIA 1WPIA 2F3JA 2E5GA 3CMAS 1K73T 3THTA 4A8XA 2YV7A 3EX7B 2MPUA 1Z7RA 2G0FA 4IQAA 2LYVA 4CH1A 1MDKA 1TRUA 2B1LA 1TK0B 2IMEA 4IGJA 4XRDA 3CC2S 2DISA 1IYIA 3FZ4A 5ECOB 3L9SA 3LXZA 4K2DA 3KGKA 1U6BA 2PE8A 1VQPS 5HO4A 2DB1A 4ECJA 3ZZXA 2FGXA 2YOIA 2E5IA 1FJCA 3GMFA 1FJ7A 1MDJA 1QK8A 1OIAA 1K3OA 5E4WA 4E8HA 2M7SA 4TR0A 2WBRA 2PPTA 1SL0B 3GTUA 3HDCA 3EU3A 4KUNA 1XWBA 1XWCA 3HJPA 1A7GE 4WR4A 1TDIA 1G2EA 1WEZA 1WI6A 4GSNA 2HNLA 1S79A 3NMRA 1GSSA 1PL2A 2MZSA 1O7UA 5GAPD 2C0FA 2VOPA 4BPYA 2LCWA 2M9KA 5DQYA 2MZTA 2MKIA 2VCWA 4OFTA 2FC9A 3G96A 4K7OA 4ACSA 3LORA 5CP1A 1TW9A 1KTEA 3GH6A 4V1Ag 3KJYA 4F82A 1OAZA 2AAWA 2VCZA 5KN0A 2L9WA 1OKTA 1WMJA 1YJWS 2D9OA 3P6YC 3TP2A 3J7Yk 2R37A 2KN4A 1YF1A 5LNKe 1N54B 2F8FA 3UD4P 1A0RP 3ZIJA 3HVXA 3IBHA 2JACA 5DDOC 5AISA 3L3CA 1O6JA 4O92A 1X4DA 3RHBA 1F2EA 4HZ4A 2CQBA 2U1AA 3FZAA 2L5LA 2N5BA 2VO4A
chains in the Genus database with same CATH superfamily
1UFKA 2LKUA 1YRTA 1S48A 2OSRA 2H1GA 4NLYA 4XO0A 4MJEA 2VG6B 1TP9A 1FW1A 2DGQA 4Q8EA 5DDQC 3U6VA 2E66A 2HMIB 1FJEB 3MM9B 2JVRA 1YK9A 1YJRA 3HP6A 5ENUA 1AQXA 4V2NA 2VBYA 3MXHP 4Y0FA 1LWCA 2IBOA 4PXEA 1HNZJ 1U02A 3VAFA 2MQMA 3DLLQ 4J9QA 1XXUA 5BRTA 1ERTA 2V4QA 2NCKL 3TKSE 1IJEB 3DRRA 4DUZF 4IQ1A 4FXVA 5G30A 1U24A 3Q18A 1MTCA 4IS0A 4YB5A 2DPIA 1UVIA 1U1RA 1RLCL 1IKVA 4L74A 4KSEB 1FJGF 3W61A 1ZAWA 3T6BA 3KMSA 1S9FA 3NS6A 2LECA 5DQSA 2BE2B 1RT4B 2V2GA 3TKPA 1S3DA 2R8JA 5DAKA 4Y6IA 4YN3B 4DSQA 3FCVA 1RWXB 2XNQA 2XI2A 3CJTA 2YBVA 3ITHA 3OQ2A 4KX4A 1SV5B 5T14A 4NYOA 3D7SB 2UUCJ 1RISA 1PC5A 1ULRA 4UOCA 1VK3A 1LWCB 1MD4A 1JXVA 1WTBA 2YJHA 2RD5C 3IBWA 2F40A 2DLXA 4KR0B 4LFBJ 1LW2A 3MECA 3QBCA 1TKDB 2QC3A 1YEPA 1WP0A 3DRRB 4IG3A 4K9ZA 2DXEA 3EMTA 4POLA 2WHOA 3TVYA 4FF1A 2YX4A 1CC8A 5F3TA 3JXOA 2ZITA 1FRIA 4DCOB 1M2DA 2ROEA 1N36F 3NRBA 1IKVB 3U27A 4OX6A 2HFDA 4K4SA 4AXJA 1LV5A 2V8PA 3OL7A 5AE2A 3ILIA 1DUGA 3E3EA 2R8KA 5ECNB 3CW2C 4IDKA 1TFWA 3OXFA 4ZJLA 3MUTP 5BMUA 3AHPA 1X5EA 5DAKB 2N5FA 4GTUA 1Y6EA 1NW2A 1GMWD 4M5DA 1XEZA 3K89A 1BXNA 3ITHB 1WJ9A 3UL3A 4K8MA 4G65A 3PIOQ 1U25A 3TOTA 4LFCJ 3Q2TC 4F36A 1FRHA 4CYUA 4IO1A 2HGMA 2LQ5A 2FJWA 5GADI 4MF5A 4Z2UA 1HR0J 5M2RA 4IG3B 2GVDA 2DNMA 1WF2A 2KP1A 4FKYA 2DIUA 1JZWA 4C11A 3N01A 1XNRJ 2X1GA 1KD1T 4NX9A 5E41A 4NPBA 5LXYA 4ZVPB 3C1SA 3N5FA 3HVTA 5I3PA 3QFAC 1QAJA 2FHJD 5DZ7A 4UQGA 4FS2A 4IDKB 2HSHA 1J27A 1WRYA 4M5DB 2CVIA 3M6WA 2GZPA 1H0HB 3CDAA 2L41A 5GAEU 2VV5A 1IBKF 4Q2MA 1BX9A 5HI7A 1WF0A 2L9DA 3FR3A 4CYUB 1F3BA 3HFVA 3A3PB 2UVWA 2AJFE 1WG5A 3RBZA 3FKBA 1ZAVA 2P2CB 3B6BA 3IR7B 1T00A 4ES1A 4ID8A 2GVDB 1SJIA 3OXGA 2PT0A 5IWAF 1XERA 2HHUA 4KGIA 1ZBTA 3QFWA 4C11B 2BZ2A 1HNIA 3QAUA 4JI1J 1R8HA 4FO5A 1S9EA 3HSDA 1YDKA 3T5JA 2GMHA 4LQ9A 2KVQE 3K0JA 3HVTB 1W2IA 3GQCA 3VLNA 1Q5VA 1RACB 4DSKA 3AOCA 1S6UA 5T41A 3K8NA 1TTHB 1FTCA 4USHA 3PHTA 1PSQA 1FK9B 4USSA 5U47A 2FVCA 1ILOA 2IY5B 1CJUA 2BJ9A 1WEXA 4F04B 2B5EA 1DAXA 4AXIA 3UAPA 3A1YG 4MJBA 3IAS9 3MM7A 3NP5A 2GQQA 2KRBA 1K0NA 1PFOA 4DX7A 1O5JA 3LFLA 2V68A 4N47A 2BUNA 3KJVA 2XO7A 3V5RA 3ZTPA 4YY3J 2XC9A 2FPHX 3EZ5A 3H98A 2BJ1A 4JI2J 2MHNA 4LRCA 3H4DA 2J8SA 1HNIB 1S9EB 1CS4A 2KZZA 2BTOT 4TY8A 3G82A 4JYAJ 4BWQA 4WXOA 1PIEA 2KT3A 1XMQF 3A2XA 1UJ5A 1SC1B 3HZEA 5J1NA 2N5AA 2DNYA 1SU9A 4DWIA 4ED7A 3CDUA 3W9IA 3R3TA 2H5EA 1I1GA 3UD3P 2IA6A 1CJUB 2K6VA 3MM6A 2H6ZA 4V2LA 1ICEB 1ZMAA 3APSA 2WVFA 2ZUPA 2V41A 2ZC3A 5KEJA 4EZ9A 1F2GA 1Y5IB 5DRKA 4RW4B 3K8WA 1I51B 2IAJB 2GS3A 4I97A 4MK3A 3F3QA 4KF9A 1VQ8S 1VGYA 3HULA 4WYWA 2FY8A 2VF3A 3H90A 4RUHA 3PYFA 2OA7A 3KNGA 3APOA 4AUKA 1CS4B 4ZCMA 4OI3A 4TY8B 3QLHA 3OHAA 4K0KF 3GIMA 4RI7A 4X65J 1KHWA 4QIVA 2DHAA 1RB0A 1GUKA 2CQIA 3D0ZA 4EU0A 4H4OA 3GV5B 3G86A 1KLNA 3TA2A 3VK9A 3VF0B 1N33J 2DJ2A 4AT1B 1GSFA 4FYWB 1RWVB 3OSNA 4GF0A 1S1TA 2H01A 1A0FA 2RAQA 4YH2A 4IO9Q 1U49A 2HAFA 3GONA 4F02A 3I69A 2YKMA 1JWWA 3F9UA 3WT2A 2OH2A 1PX6A 2R6KA 1U2CA 3HVSA 5JVGQ 2G9OA 3BD2A 4PUFC 3K5LA 4U7CA 3GYGA 2ROPA 1HQEA 2C80A 2LEPA 2FC8A 1NK4A 4HH0A 2M8HA 2EK6A 3C15A 1GNWA 2YNGA 1GTUA 4B9TA 3IV4A 1YVFA 4Y65A 1SJ6A 3QLHB 1NSAA 2XWXA 4MF6A 4H4OB 4JE1A 3SYZA 4X4UA 3RG6A 4Z37A 2NPFA 4RR5A 4DR4J 2QKEA 4KGMA 4C8MA 1V58A 1S1TB 2MZCA 1QVGR 3PJ9A 4PABA 4TLRA 2WAQD 3D4JA 2YKMB 4C8LA 3JS9A 1BC6A 2DNKA 3TAPA 4ZCLA 2J6UA 2LDIA 4RI6A 3MCNA 3KM6A 2EI5A 3MR2A 2IVFB 5CYQA 5KT4A 2ZBRA 1HQEB 2G2QA 5BR8F 2WOMB 3G2XA 4RLEA 1CG2A 1NAQA 3C15B 2B6MA 1Q81T 5FLXU 1M9BA 3N5BA 5LMNJ 3LP0A 1PX7A 5E3AA 4CO0A 1VRUA 2VQFF 1ZZFA 1Q8KA 4DV7J 2L08A 3C14A 3PDNA 2HNZA 4MIBA 2E2MA 4F3OA 4NHZA 3I55S 3HKWA 5DLGA 3Q19A 1TL7B 5D6GA 1AXDA 3VVTA 2XTJP 2C3TA 2HHQA 3PRBA 3QGPA 5G5EA 2XULA 1URNA 3DDKA 2YWMA 2EBGA 1WG1A 3VFIA 3P5BP 3KTQA 2YH0A 1EOHA 1RT6A 3GR1A 2IM0A 1P9YA 4LQ3A 5CYMA 5CYQB 3MHYA 4RBTA 4KGVB 1AZSA 3O8WA 2O01C 2HRYA 2QL7B 5L46A 2V4JB 5E59A 5J4UA 2POKA 1T4ZA 3HHEA 1SD9A 3OL9A 5FJ4A 3DU6A 4DDFA 2P9GA 5D0RA 2EXUA 1HNZF 2FJEB 2JSXA 4L73A 4LT6A 4LF6J 5KFIA 3JTPA 2YNFB 1FE4A 1RT5A 3DU5A 3PEHA 2HNZB 3EDRB 3ZVJA 2UUBJ 5A8KA 3HHKA 2B9WA 4ZVUB 4ZBAA 2RUGA 3KG1A 4WFNQ 3V4IA 2CPJA 1N88A 2BMBA 4A8SA 1W2BR 1QUVA 1AA1B 1GTAA 3RAZA 3HJFA 1W4VA 1M5HA 5CYMB 4TR1B 4PWUA 1XWLA 3LP1A 1AZSB 4KRWA 1BGXT 2JOQA 3N4WA 1J5OA 3IR6B 4ML6A 4LFAJ 2QMUB 2UUCF 3PPUA 3U5RE 3HX9A 1TV6B 3CCLS 3IC1A 3N5OA 4LFBF 3KK3A 4DV2J 2W7OA 3GB0A 2XMVA 4I2UA 1PSDA 3P4UB 2I5JA 4DQIA 4QU7A 4HLBA 2ZCTA 3EE2A 3AH6A 4DPXA 3CJ2A 5A8KB 1UAWA 2LRCA 1I94J 5MLCV 3MYDA 1ZL9A 2VBWA 2YKOA 2H8LA 1AFIA 3R97A 2N3OA 1FXLA 3HKRA 2NYIA 1OE8A 3TJAA 4UZBA 3VAMA 3IXQA 2WCXA 4OCEA 2VC0A 3SWLA 3Q6OA 1Y9OA 4G0KA 5KFWA 4DR1J 1JKHA 4RQXA 1J5OB 3IBCB 3PIPQ 4WR5A 3ZTLA 3GV8B 1RU1A 3VGSA 1F37A 2AYGA 4LFCF 4FYVB 4EIQA 4YOEA 1TKTA 4YB7A 4R8UA 3L78A 3KK3B 1VLYA 1KQKA 3C7MA 2DTJA 1HR0F 3D28A 4POKA 2I5JB 2YJ7A 1FD2A 2VCQA 2MKHA 1EP8A 1L5UA 1JLWA 1K44A 1S12A 5HQMA 1NUEA 2RS8A 1IBCB 2GCFA 3EGNA 1XNRF 1U4BA 1VQKS 2VG5A 2RLIA 2E9RX 3BBCA 1VQLS 3ZNJ1 2GLRA 1S10A 5J2PA 5DQIA 3QD9A 4KHMA 1H2VZ 3D3BJ 4XDDA 5IMAA 1KFDA 4M95A 2FZKB 4GVLA 4P72A 1JKHB 2ILZA 4PQAA 4ZVHA 7FDRA 4DEJA 5D96A 1HNBA 1RAEB 5KFUA 2KB2A 5F8MA 1VQ6S 2F51A 2WVDA 2GS8A 4HT7A 1U0HA 4WF9Q 1REGX 3EZOA 5HQ8A 3RB3A 1TKTB 2MZQA 4R8UB 3A3NB 3RBEA 3ELHA 1V98A 2CPZA 2QE5A 3SDEA 1G7CB 5LSRA 4NLGA 5EVOA 1B4QA 2ZNZA 4NMLA 1SPBP 4OCFA 2MZJA 1NZAA 4DL7A 2HSYA 3QIPB 4L76A 3SCKE 4JI1F 4CY6A 4P75A 4EBCA 1NKBA 2VG5B 3ZITA 4FZVA 3TVKA 1V9WA 1X9SA 4ICLB 1D0EA 3MOJB 2PGCA 3CD7A 1NZ8A 5J2PB 1IKYA 3ME8A 4F4XA 3BPSP 4O3QA 1VRTA 3VURA 4L3KA 4MYTA 3ERFA 2APOA 5JJBA 2Y1JA 2ASJA 2OEJA 5DQGA 1BYEA 3MEGA 5KFEA 3V4MA 1E2YA 2HYXA 4KTQA 2FDNA 1SCJB 2CVBA 1XVQA 3NGRA 3O6TA 1DE2A 3MMAB 1F3AA 4FYCA 1U0HB 5FLXY 4DZ6A 1VLOA 4DJBA 1EKRA 2W8LA 3BO4A 3OVAA 5IC4B 3PO4A 2E0QA 4FYDA 2CA8A 5ABRA 2H6XA 4XPEA 3WC0A 4CT9A 5KG6A 4JB8B 2JRSA 4YY3F 2OI2A 3ZRDA 5G2ZA 1U7LA 3P8WA 5M2PA 3EGWB 2EFNA 4JI2F 3R1LA 1S1XA 1XN9A 2Z0GA 1NDLA 2LS5A 2QMWA 1X9SB 3N28A 4JYAF 4IH7A 1XPVA 1IKYB 3R27A 1RAGB 3TOUA 4DR2J 4P9SA 3LEFA 4UOFA 4P2MA 4DPUA 3IC8A 1VRTB 1PN9A 1K8AT 4YAVA 4PWDA 1R7IA 2FTRA 4OMVA 2F8HA 3TQEA 4O3SA 2WB4A 2QLFB 4OZ2A 4NAXA 3CMES 1P9QC 1YQHA 4WTOB 1W7WA 3GILA 2PN6A 1YBAA 5D3GB 1GNEA 2K18A 2GQCA 1PKWA 2YP6A 1SYRA 1MG7A 2H72A 2LTKA 1XMBA 1GLPA 3KUEA 4O4RA 3QT8A 4ED4A 3HF5A 3VAGA 2GQKA 1SQGA 3CCRS 3GIRA 1FESA 2XBPA 4HEA2 5ETLA 3D68A 1J5EJ 2HRNA 1S1XB 1QUWA 4NASA 1XZOA 2Q1LA 1HNXJ 1RHRB 1WUUA 4PG8A 2WW8A 4X65F 5FD1A 2H4WB 2WSFC 4CO1A 3HCZA 4E8EA 4LSZB 4PWDB 3DKSA 3HXMA 5AXLA 1N33F 2X7IA 4J56E 4E98A 1U0SA 5KG0A 8AT1B 3W63A 1OQ6A 2CZ2A 2JEGA 5CO3A 2JX2A 4ZHRB 4IOAQ 1IR1A 2VG7A 1O8WA 1ZM4A 2FUG2 1XOAA 3DGPA 2ZJQQ 4DX8H 3UE2A 4RBUA 3U1NA 4D73A 1A24A 3CO0P 3IWNC 4DX6A 19GSA 2YXLA 2C3NA 2HFOA 2TIRA 3AQPA 3M1GA 5DZ6A 1LKZA 3N0VA 2ABYA 3FDSA 2FWGA 3G7YA 4KKOA 3O6QA 1Y00A 2FB0A 5G1KA 2QYCA 4Q45A 4DCJB 2H1DA 4JZQA 4DR4F 2AWZA 4ED5A 1R8CA 2XG8A 3AD7C 2CPHA 3DRPA 3M2RA 4ECUA 4RO0A 2I9SA 2R7VA 3CC4S 3H20A 4OYOA 4ZPCA 2RB7A 1G1XA 3I0SB 2HHPA 3TKQA 12GSA 4D73B 4ZVTB 1HNCA 1V6HA 5CCLA 4J9PA 4XIHA 4ZVEA 3SEOA 4A8FA 3H59A 4ECCA 2RU9A 1FF2A 4HH1A 2E1PA 3MEEB 2MKJA 5LJ3Y 5LMNF 1DRZA 3HT3A 2HGNA 3AQOA 2ZKUA 1JLGA 4A47A 4FQUA 4KKOB 2Z2MA 4PUOA 3UJ1A 2VODA 4DV7F 1HBUA 3CSJA 2QX0A 3CDBA 1G7OA 1DBDA 4NZ7A 3VI5A 3I4PA 4Y28C 1Y10A 3FMWA 3KJQB 1EP7A 2G4BA 2JL4A 3DRPB 5EX3A 1UVZA 3P2AA 3M2RB 2I6WA 1U48A 1SK1A 4GLTA 3HT0A 2XMTA 3CTGA 1C0UA 2ATCB 4AL7A 4WE1A 2HZCA 4WKYA 3GMGA 2X4AA 1TK5B 2ES7A 2DBCA 4USIA 2RF2A 3KLFB 1X4FA 1M2BA 4K4VA 1N5QA 3MI7X 4ECQA 2BM1A 3D6TB 3KG4A 2DHXA 4KBIA 3W62A 2MLXA 3LGMA 2OPRB 3MAAB 3FZBA 1H6KX 2VA2A 1OE7A 5IMCA 3T3FA 1Z2LA 2GIRA 2BKPA 3VWVA 1JLGB 2HRTA 4LF6F 1UP1A 5C25A 4PUOB 2J0XA 2XSFA 2QO3A 4B9NA 4F0CA 5GAGI 5KOWA 2VPXB 3VPTA 2UUBF 3FSYA 3GNJA 3QGIA 2B5YA 2VFTA 4OYWA 2D69A 2LXIA 3IO1A 1CJVA 3ENWA 2FJBB 3RW7A 2G0CA 1FT8A 4K4YA 2IIHA 1C0UB 1CQHA 1HBNA 2FHEA 4J9LA 3F4RA 4WE1B 4RNFA 4M5KA 1IBLJ 4G6VB 2RF2B 4RW6A 5E5NA 3UFCX 1K0MA 3A13A 2QA4S 2WW4A 1NSKL 1EEJA 2HQIA 1SJFA 1UPPA 4N10A 3NZNA 1L3VA 4LFAF 3D1OA 2A6MA 4A8MP 2I9HA 5HK4A 3R9LA 1TELA 4G1QA 3KKFA 2DJJA 1FEEA 1NJXA 1EARA 2OKAA 4HOJA 4DV2F 3EPIA 1Y25A 1P1LA 2A4VA 5C25B 2SXLA 2HURA 3FNNA 1IUJA 4PXCA 3LANA 1M0SA 3EGZA 2IL3A 2N7YA 1BQNA 4HS1A 4AQYJ 3WGEA 2BXJA 2OEKA 1I94F 2VJUA 1NKCA 2JVOA 1CJVB 1DQ9A 5CABA 1DQAA 4ATNA 2BRKA 2B9YA 5JWOB 2NUUG 1YJVA 2B7KA 1HBNB 2YX7A 1D9DA 4ED0A 5DM7Q 2OD6A 2LU2A 4Z2XA 4RW6B 1U8WA 1B7FA 4I2PA 4GMKA 3GIIA 4DR1F 6FDRA 4LSLA 4JI7J 1C4AA 4KT0C 3ME7A 4BC9A 2MHEA 3KLEB 1XJWB 2W7PA 2A2CA 2IRUA 1WC5A 2I1UA 1HNAA 4X4VA 3PJWA 2AKWB 1D9FA 5CH7B 1JNZB 3QRRA 1EQMA 2I3YA 4BS2A 3VGTA 1W26A 1RSCA 4B3TJ 4JRRA 3I0RA 3GFXA 4DSRA 3VWSA 3PHEA 1BQNB 5L38A 1XBWA 2UZ8A 3GSTA 3QWUA 1UETA 4I0WA 3ILOA 2N4DA 1E6YB 3WQPA 4ERDA 3N79A 3DRYA 3OFFA 1RLDA 1TQLA 2FJVA 1SK2A 2FVPA 3W5ZA 1KN6A 2EFVA 1OSCA 1IQTA 1B4SA 2DT9A 2W2NP 2EIQA 5CRHA 3M6VA 1QM9A 4I2PB 3GJSB 1G4CA 2L9NA 1SL1B 2JH3A 4LSLB 1NHVA 5DM6Q 2FY1A 2PGTA 3I6PA 3I9V9 1IBMJ 3IK9A 2FGOA 2XCPA 1X9WA 1FO1A 4IHUA 3FCWA 3JQKA 1QVFR 2Z56B 4CW9A 1R43A 4O0IA 2PEBA 3I0RB 3CGIA 1YEXA 5H5SA 4MJKA 5KN3A 1XC9A 2KXNB 3KEBA 2PN8A 4ZBBA 1K0BA 4GSSA 3DVXA 2J9EA 4PEOA 4O0NA 3MR6A 4TYBA 1R8PA 2C3YA 4CWBA 4DR5J 2BQRA 1NB7A 2IVMA 1RWUA 2VL2A 5HVHA 5LL6d 3G8QA 2V8DA 2BANA 4DSJA 1V3RA 1F2HA 1QTMA 4YKFA 3MR3A 4C8OA 4EYIB 3G71S 2XYPB 2OP5A 1GP1A 3PGTA 4HL9A 3M2UA 3CO9A 1RU2A 3C6UA 1X9WB 2HIYA 1CBKA 3BDEA 1FKPA 3HHLB 1J2VA 4J9RA 4R25A 1N8JA 3WC2A 4Y34A 2DHHA 4MCUA 1QE1A 3AA9A 4U6PA 1YI2S 4WP9A 2DIZA 4I6WA 4JI4J 5KFFA 2CUYA 4IBPA 3GJTB 4NI2B 3JSYA 2RUFA 4Z7YA 5IV3A 2ZWPA 1VQNS 2JWNA 3T9ZA 3TA1A 1MROA 2C3MA 1WI8A 1VI7A 5L9XA 1VC6A 4MABA 3GR0A 2ZH5A 2H0GA 1TP7A 4NLVA 5H9EJ 1AUCA 1XW5A 4ZVSB 5J2NA 5GVQA 4XAKA 4DR2F 1JXLA 1MMNA 4LBPA 1WPIA 2F1FA 1WC6A 2DR5A 4I7FB 5KFKA 3FEZA 4DS4A 2GVZA 4H54A 4PCQA 4A8XA 2C2ZB 3EX7B 2R8IA 2AX1A 1OS5A 3T5KA 4IGJA 4XRDA 3MMCA 2EFGA 1RTDA 3KGKA 3PJXA 3MAHA 2DRDA 5HO4A 3OPKA 5HBMA 3ZZXA 3KWMA 1K3OA 1GXTA 3CJ4A 2YQ1A 4TR0A 2WBRA 2PPTA 2ZUGA 4KUNA 1XWCA 2W24A 2HAIA 4WR4A 4QR2A 4FP9A 2M5YA 1RT1A 4M5NA 4QWBA 1GSSA 1PL2A 4NOHA 4BPYA 3OLAA 1J5EF 2AV5A 5ETOA 4K7OA 3MCMA 5CP1A 1MROB 1HNXF 3HHLC 3GIJA 3KJYA 2Y3YA 4JI5J 2VCZA 5KN0A 2L9WA 1WDTA 4DV0J 1NPKA 1XIQA 2D9OA 5J2NB 3P6YC 3TP2A 3M6UA 1ZYNA 1YF1A 5LNKe 1N54B 2R7SA 2G2YA 2GVZB 3IBHA 1O6JA 1N0VC 1Q8LA 4ECXA 4QWEA 3P45B 1RTDB 1ZPWX 4CM2A 2U1AA 4DFPA 1UL3A 2VO4A 2CZ4A 3F4SA 3TOQA 3BGOP 5HBMB 3LPYA 2VL2C 4BWSA 2EVZA 2CNNB 5AE3A 3V1WA 4IRDA 4MFBB 2HLSA 5IM0A 4DQQA 3PNIA 2W9AA 5HR0A 1RT1B 1T9VA 2ZKTA 1WSVA 3PKMA 2LLZA 1T3NA 2YKPA 3S01A 3QAGA 3PW4A 1GL8A 1FWKA 2XQCA 3J7Z5 3RPPA 1V9OA 1CQMA 2DCLA 1IWGA 2QLJB 3PH9A 4WBJA 5J5NA 4H4KC 2W7AA 5DS7A 2LRTA 2P0GA 2V67A 2QL9B 3GRXA 5B0DA 1Z5YE 2UUWA 3ZZ0A 1RDRA 2E7VA 1Y11A 5CYYA 5B0BA 2J9DA 2XNRA 3UDLA 4K0GA 4N11A 13GSA 2KU7A 1TUGB 4X4SA 3CD0A 4WIIA 3GURA 4UY85 3CYNA 4ED6A 4RU9A 2J6SA 5IM0B 4IN0A 4TXOA 4PPDA 2Z2ZA 2FUG9 2WDUA 5IO2A 3GUSA 3QDNA 3FY7A 2QMXA 1SD8A 4DU8A 1PO6A 2CPXA 3ULHA 5H5RA 1B99A 5HSPA 4ILMA 4ZPAA 2UU9J 4PUAA 4DN0A 3D22A 3M4XA 5J1EB 1D1UA 4V1Ap 2OD4A 3NOFA 2XS5A 3IG1A 3DGVA 2DHGA 4PG5A 2K7JA 1JZRA 5EPFA 1LOUA 1AAZA 2B4UA 3HKZD 3LYKA 4F0HA 2OACA 4Z2TA 2WVBA 3T9NA 1S1UA 1TVRA 2XEXA 5F8HA 1N48A 3I31A 4DPOA 2IMFA 3MEKA 1K1QA 4Y2CA 2FLPA 1FEHA 2NR0A 1E6VA 4GC6A 2GZYA 4TXOB 3MGJA 3GJQB 1H74A 4ELUA 3TKSA 2M46A 1OQ3A 4X4PA 4LMZA 3GU0A 1S76D 5GAND 4EBEA 2J23A 4B3OA 2RIIA 5DBQA 2MLZA 3UMAA 4ZPVR 5IPHA 3LTOA 3NWRA 3LP2A 1BAYA 5HMWA 4MA9A 3H42A 4V1Ak 2RQCA 4OIXA 2XGPA 1AUSL 5D78A 4M5GA 2JZRA 2C1EB 3UVTA 4G2EA 3W65A 4AJ7A 2Y0BB 3UEMA 5GMEA 3QPIA 4KAIA 3Q2SC 4UZCA 1PJ7A 1RKJA 4EO6A 3ET6A 2L6CA 1S1UB 1TVRB 2HS3A 2P8IA 2AUVA 3VHQA 2RDDA 5EUHA 1VHIA 3IK7A 1IBLF 3A4TA 2GT6A 4KB3A 2P6TA 3W6GA 2B7CB 4PR6A 1T9WA 4NRTA 1AW0A 4EE0A 1CJTA 5CCMA 4HDHA 2J7WA 4DFKA 5C24A 2JFDA 3CJ0A 4B3OB 14GSA 5LSLA 2EC2A 3UR3C 4ZLNA 1SL2A 3R2DJ 4DL6A 4JUZA 3QT5A 4YKGA 3HZ8A 3BKFA 1NLKL 2YTCA 3LP2B 5JVHQ 1DTQB 4PG4A 1F9FA 3E3XA 3TQ1A 2ZBIA 3UOMA 4PQ1A 4IOCQ 2RHSB 1BWEA 1W89A 2W9BA 5AN1A 5ETQA 2VFVA 4K7NA 3IM9A 4AQYF 1XK8A 2J9HA 1NK0A 3SMZA 5BYRA 1RXOB 3PW2A 2HHHF 3G4SS 3GN3A 3KZQA 5F06A 2PI5A 3ET6B 4C0BA 3KLIA 4C0OC 2VPWB 3K5MA 3BYPA 2DNHA 4C4WA 2FJAB 4USWA 4D3HA 4MK7A 2GO8A 4E8UA 1VQ4S 2PBJA 3UVHA 1TL1B 4JI7F 5GSTA 2OPQB 2QG9B 5C24B 4ECTA 2HQFA 1SL2B 4RQRA 2WSCC 3IP0A 2RE1A 1R6VA 3UR0A 1FNMA 1DBYA 3H5UA 2WVCA 4M63A 4B3TF 2J0WA 4ZMMA 3D6MB 1VF4A 2NYHA 3PYGA 1R31A 4HHUA 1Y5LB 4ES2A 3CJKA 2YCDA 4DV5J 3T41A 3DLBA 1ELOA 4FYXB 2R4FA 4I68A 2PMZD 5JCWA 2LQ9A 2YKQA 2LEAA 2FJDB 2WVEA 2OHDA 3UBLA 2F7VA 3KLIB 1TMJA 4X43A 1RP5A 4CLSA 3HLUA 4MK9A 2FGCA 2VFSA 3J7A1 1SXLA 2QIFA 1PBAA 4DSEA 5H9FJ 2HBRB 4CM0A 1YJ9S 1HHSA 2CNOB 1IBMF 1M3IA 3E8OA 1HL6A 5HROB 1YHQS 4ZP8A 1S9GA 4FVMA 1PBUA 1NJYA 3GSSA 5GAHU 2EC4A 2DGSA 2KDOA 3HFKA 2GDRA 3ETMA 4HDGA 3KCMA 5IO0A 2P31A 4ENOA 4DMZA 3CJKB 3ED3A 4ER8A 1ZM3A 3AD9C 3L95X 4EFAC 2H65B 2HFVA 1NO8A 2DGUA 5AIXA 1K0DA 1SJQA 4DR5F 3QCPA 2CXEA 1WC1A 2Z2LA 4LIRA 2CQ3A 2BMXA 4KGKA 3PRVA 3W2VA 2AV4A 1T94A 3IHGA 2CVKA 1H7XA 3RRKA 2I81A 1YZ6A 2V8HA 1N5TA 5KFPA 2C2DA 1WELA 1Z1ZA 1DE1A 3QFBC 4BVXA 4WFXA 2RU3A 1LW0B 1S9GB 5AE1A 4V19J 1MWQA 1TXXA 1M9AA 4MIWA 3EGVA 2N82B 3HMJG 2DMLA 4LF8J 1EX8A 5MAOA 4JI4F 4OHYA 3W60A 3KMOA 3BZQA 2LVWA 3HO1A 5L1KA 2D7SA 4WU3A 1KWMA 3U7JA 4TR3A 1GTBA 1RHMB 1ZCPA 1QD1A 1JJ4A 5DG8A 2WONA 1JMTA 1ERWA 1G6WA 4NCBA 5E33A 1FRXA 5IOWA 5I4MA 4KYZA 2O3DA 4BLGA 1V3SA 4URSA 1ZYQB 3O2IA 2XMWA 4Q43A 2G1HA 1FKOA 1M5KC 4BC7A 2HRKA 3KTBA 2UZAA 2O89A 4IRKA 5F8IA 5JMNA 3M1VA 2W2OP 1KEBA 5HQLA 4DVCA 3ZZTA 1ZM2A 1S57A 4YS2A 5BYSA 4KJIA 1OKDA 4MP4A 4E0DA 4BVXB 2M8DB 4EZ6A 2ZFHA 2ZNYA 2ZBPA 4JI8F 2K3KA 4FYYB 1N2AA 4N30A 1VISA 3NWGA 4BBYA 4ANEA 1LK5A 3L0HA 1S99A 2QT7A 1R5AA 1GAOA 1S1WA 2A0FB 1TR0A 1HYUA 5B6MA 4PQUB 5IFMA 4G1IA 2OIHA 1PRXA 1DY3A 4OO4A 2ATLA 3HCXA 2KI2A 3ZYWA 3DM2A 3FGVA 2E1AA 4MDCA 3M2VB 4JI5F 5B0CA 2ZBQA 3CCVS 4DV0F 2RJZA 2HBZB 1H72C 1FKOB 2LXFA 2L3MA 2DNPA 1WSRA 5HN0A 3M1VB 4I6YA 2YZHA 6GSYA 1RYRA 3SV3A 3KG0A 2NQPA 1KNGA 3R7NB 2W2QP 4A4JA 2AP6A 5CNWA 3WT1A 4K0NA 1FERA 2R2TA 3M9OB 4XTTA 1GSUA 5CA5A 3F73A 3TJBA 1RE1B 1O85A 1KBRA 4DSSA 5HJYA 1GMWA 2W4DA 1NEEA 5F8GA 5GADU 2CPYA 1PILA 3SCJE 1S1WB 4AJ6A 3D0GE 1HBOA 2IM1A 4UUWA 4YR3A 3K57A 1Y0HA 3DM2B 2DNRA 3G8SA 1YG0A 1N36J 2HQCA 4DPYA 1BD6A 3K8VA 4F25A 2AEJA 2LNSA 2QLXA 2FCHA 3DOMB 1UA1A 5A8WA 1HKAA 3WHIA 1AROP 1RWWB 3EE3A 3PCOB 3RYLA 2EWHA 1AIUA 1NM2A 1FDBA 2MGZA 2IDLA 1PMTA 3IGNA 5F0GA 3CWJA 1TL5A 3E01A 1TL4A 2QGFB 4PNGA 1TRSA 4DSSB 3H2VE 1PYTA 4POMA 3TRQA 2DYAA 1W25A 3CIMA 1FWLA 1HBOB 3TDGA 4L5OA 3DEXA 3IR5B 2AIRB 4OZLA 3BN4A 1RT3A 2VKRA 2RRNA 1M1GA 2UU9F 6GSUA 3KK1B 1ZOTA 2L5OA 4WKWA 2CQ9A 3L4BC 1Q82T 4QIEA 2GSTA 2GMJA 2FHMA 4ZPTR 5A8WB 3OTCA 1RADB 4Z2RA 4MKYA 3FSIA 2FLSA 1VC5A 2HS0A 2V94A 3CJQA 3PYDA 3KK2B 3SV4A 4ZK7M 2EIRA 4DL4A 3GX0A 2OADA 3FBEA 3L9ZA 2WRTA 3C73A 1PCAA 2IMOA 2MGZB 3T19A 3CSHA 4ZVOB 1X8DA 4ZB8A 3E01B 2REMA 2X51A 1EGRA 2H66A 5DDRC 3HD1A 3CJRA 2QEXS 4HVZA 1T11A 4MZWA 1GSDA 2F65A 4OD7A 2ACMA 4GKKF 3NOCA 2E5HA 3MTKA 2E9ZA 4WWSA 1Q5YA 4NCAA 4RU2A 1U09A 4DZDA 4DS5A 3BKTA 3IA0A 1NSWA 4HI1A 3FJ2A 5D15A 2M52A 3HK2A 2YQ0A 2J0SD 1Y4ZB 1ZM9A 4OZ5A 2YWHA 2DJWA 3M32A 4JV1A 3UBKA 2RNEA 3R8YA 3QQCD 3GKMA 2LJRA 3T6JA 4YB1P 1BUXA 3GZ7A 3A5IA 4EGLA 2FVRA 5LMUJ 1Y3KA 1QAXA 3VCDA 1DHMA 3MWHA 2MXYA 2JZTA 4KDXA 3BN7A 4LBIA 2CADA 2PD1A 4K4TA 5KG2A 3S6EA 4PXDA 2W9CA 1GT8A 3DLGA 2F4VJ 2UUAJ 1FAAA 3EINA 4J9KA 3EVMA 1Z6MA 2M2BA 5D4PA 5CYJA 2OLWA 4LLRA 4GO7X 2R8HA 1VQOS 1O6XA 2IYGA 4YR2A 3FBFA 3TNVA 1WKLA 1M5SA 3NNHA 3UI3A 3OUYA 3M32B 3LH2S 1N4LA 5AGYA 4M8LA 3GCXP 4HZ2A 2YWIA 6FD1A 3FK8A 2R9LA 3NAHA 1FNXH 5KN1A 4U7UD 2DGOA 2V34A 2ALZA 3GFKA 3H25A 1PKUA 2RH3A 2Q6CA 3ZZOA 3OR5A 1R0CB 1DZ5A 4Y3CA 2L4CA 1T7PB 2RS2A 3KUGA 2HK2A 1XW6A 1PGTA 3E9JB 3DLGB 2BOAA 3BPDA 2ZVSA 1B8XA 5B0GA 3MD1A 3M8PB 2GZZA 1YGYA 2M70A 2P9CA 5F9LA 2CT6A 2FVSA 1UW4A 4RW9B 1RBLA 3SSQA 2F9SA 3GE9A 3BB5A 4MKBA 4DV5F 1RI7A 4X4QA 4ECSA 4OHZA 1RA6A 5KT6A 3OUYB 1QUPA 3R2QA 1PYOB 4ZIJA 4QWCA 1U87A 4U8VA 4NLUA 4C97A 4F0KA 5F3ZA 1O73A 2KT5A 2UP1A 1HHQA 4MNNA 4TN2A 1R0BG 2H1YA 1Q16B 3HM9A 3VALA 3FUYA 2LQQA 5C5JA 1PGZA 1VF3A 4JI6F 4PQHA 4USTA 1XOBA 3CCUS 2XS2A 2CQ0A 3GX8A 4P74A 3K2YA 5E3PA 2H19A 3TAMB 1D09B 2RRAA 1TRVA 2MTLA 2ZUAA 3H8QA 3UQSA 5C04A 3LYPA 4IKHA 4WKRA 5ADZA 3FKFA 3BSOA 1FVSA 2HE3A 3F6FA 1HNVB 4J9OA 3IS9A 3DRSA 4OI0A 5JCUA 4PG7A 1XCCA 3D5JA 3F6DA 1Q8IA 2XBIA 4L3NA 3KHRA 16GSA 1DLOA 3KLVA 4KCEA 2LEBA 4QU6A 1X4CA 3K58A 4OFNA 4O5RA 4LF4J 2IM2A 1RCXB 2ZH7A 1NJIT 2L59A 4YQVA 4UT4A 3DLKB 4DFMA 1WC4A 3GYXB 4KQZA 4I67A 1RWNB 1T9TA 1RYSA 4YDXA 2J0QD 1YZ7A 1YKWA 2IM3A 2B8PA 2MQOA 2QL5B 8ATCB 2LJAA 4GVBA 1ZAXA 3OL8A 4RNHA 2ZD1A 2CJYB 4C3KA 5K5MA 3SI8A 2R3XA 5ECIB 20GSA 2F9DA 2PWJA 1OPZA 2DPJA 4OYIA 1RQ0A 3ZZYA 1NK6A 5ETKA 3IMQJ 3FQKA 3IS9B 5GAHI 4XS4B 1GRXA 3TEGA 2DR6A 4RNMA 3ISOA 2C0GA 4U95A 4LF8F 1EAYC 3IR4A 3PW7A 3NBPA 3R7SB 3P7XA 3K17A 4CIOA 3DLHA 4LVOP 4LF7J 4KW6A 2WZ9A 4WK1A 1QLNA 2O67A 4ILRA 1THXA 2R2JA 3M9MB 4KSOA 3V81A 2MY7A 2NUHA 4L72B 5C42B 4NXMJ 4WXTA 3JSBA 1FI4A 3QWPA 2QJ3A 2HFUA 2X8CA 4J9UE 4EYHB 3U1MA 4MZCA 2ZDPA 3ZFLA 1UVNA 1TMMA 4MF7A 3CC7S 3FBBA 2DCUB 4GVBB 2IIYA 2ZD1B 1LK7A 4X62J 1WOUA 3BR8A 1FD8A 2W4CA 1IM6A 4GWRA 2UVRA 3GIXA 4EO8A 5J2QB 2C3QA 3T1YJ 1ZZNA 4GKJJ 2CJ9A 4AGSA 4FYUA 2EBEA 3NBPB 1U88A 4K4WA 3PX6A 4OX9J 2ASYA 4YB6A 2MSSA 1AQWA 3ZZRA 3RZAA 3ISND 4XIUA 2VONA 4NLOA 1A8LA 1LFPA 5INYA 5HANA 2CX3A 3AY8A 3EYTA 2WRMA 2KRRA 2MYGA 3S9FA 2DGVA 4Y00A 1MSWD 5GZZB 1NJZA 3IRAA 1PJ5A 3GYKA 4B9LA 3G9BA 1A23A 4OJ3A 3PINA 2H3EB 1Q0NA 2X99A 2ZOFA 2DH7A 2HKEA 3TI0A 3D21A 4ZVGA 5IC6B 4RW7A 2GC8A 4OYAA 2GJIA 1OMSA 5D9XA 3TKRA 3AFGA 2AGOA 4EC0A 1EQ0A 1M90T 1KQSR 4OYXA 3PX4A 2JL9A 1URMA 4HDEA 5ECMB 4NEYA 2FHKA 3QR6A 1JZOA 3SXLA 5ELGA 4NWYA 2B4VA 3DGQA 4AYBD 5K14A 2PUKC 2EKYA 3RAMA 2GQLA 4UOGA 4EKZA 4CLKA 5B0AA 4DU7A 2VCVA 1BY9A 4CH0S 3TO8A 2C0EA 4MLYA 2OTJS 1WHXA 2MBTA 3IM8A 3KXDA 2NZ4A 3CBUA 3HFZB 5CD4H 2B51A 3CMIA 3PRDA 2J9CA 3E2EA 3SSSA 2H48B 2PEHA 2XMUA 1U1OA 3O3LA 1U2FA 2JLGA 2VCTA 4PGTA 1RAIB 4QYZJ 3NKYA 5HATA 2H6YA 3F56A 3A8JA 4LRFA 3PR5B 2CFXA 1YWXA 2AD9A 2KYXA 2ZZTA 3OTOJ 2NXCA 4NV5A 4URQU 1LW2B 3GYNA 3MECB 1KDNA 2OFGX 1PYSB 2AB6A 3X3UA 2A2PA 3CJ3A 3A12A 5A0YA 2EFOA 1NDPA 3K7RA 2JLFA 5T7LA 1XQIA 4X66F 4RPFA 4ZJQA 3FZ5A 1K3YA 2C22A 2HVZA 5DETA 1SI9A 2DBBA 4O3PA 4ELVA 3BJYA 2ALBA 4Z7XA 2PDAA 4CT8A 2JLEA 2WULA 5D77A 2OO4A 3DOLA 5D4OA 3A3TA 1T9XA 5A8RA 3MR5A 3J7Yb 3BKUA 3EXYA 2Z9SA 4F2SA 1TRWA 1G7EA 2HGLA 3ZZUA 5IQQA 4I6XA 1FHTA 2EW9A 4IFYA 1YTYA 2X64A 4A46A 1TTZA 4MPFA 3K5PA 1KS2A 1VQ7S 1S97A 1B3TA 1PD21 2LRNA 4RJVA 2F5GA 2YV9A 2DITA 2XZDB 2ZWOA 1H2TZ 1KQFB 1FB0A 4LRDA 4DL0C 3IAM2 3MIXA 3EM1A 2LFVA 4CZCA 6GSXA 4DOZA 4CO5A 2XB2D 2CJXB 4C7QA 1UPMB 3PR4A 2C3PA 4QYRA 2GTUA 3VZIA 3VR1A 1A8YA 5DDLA 1B0PA 2V2QA 3DMJA 5H9EK 1UTAA 1XBSA 4XTSA 2DH8A 3C2PA 3O76A 1SQEA 3F0IA 3AD8C 3OL6A 1NKEA 3DOLB 3I43A 2KZMA 3AOAA 3FZ9A 3H7HB 1KTVA 2KG1A 2CIMA 3R5DA 4ETZA 4P2SA 1HI0P 1ITPA 2DR7A 4JOUA 3VZHA 4IFYB 2C42A 4Q44A 2CZ9A 1RTIA 4NLPA 5LMUF 2HZAA 2QLWA 4NXIA 2CG8A 4P52A 1EETA 2GJFA 2AYMA 2B3SA 4LMWA 2M3DA 5CQGA 3MEDA 1RT2A 2ZNMA 2ZOMA 4HYKA 4MH2A 1PL1A 2F4VF 3MM8A 3IXRA 2UUAF 4QR0A 5EY6A 1WD6A 1S3CA 3MTJA 4CP5A 3DMJB 5B08A 4HT5A 3WX4A 2AYBA 2MY8A 1KFSA 2CDRB 2R5GA 1J9BA 4IJ3A 2WTFA 2AW0A 4PXOA 4OLOA 4ELTA 1AYEA 4F4WA 3ENVA 2JZSA 4WZQA 1R5PA 4ZILA 3J7YI 4KGZB 4IQMA 1MEKA 1AXQA 3KFWX 1RTIB 4LF2A 2LXUA 2J76E 3MM7B 4H86A 1NCLA 1ZYPA 3T1AA 3CJ5A 2CQ2A 2CJBA 5C2CA 1XWKA 4TU9A 3IRXA 3P90A 1O51A 3G6XA 2GAHC 1EETB 1TK0A 1TKZA 2MJNA 4CO4A 1ZS6A 3BOAA 5F8JA 3MEDB 3KJVB 3GKXA 4HQZA 5DGBA 2WFCA 5I3QA 4F3MA 4ZJOA 1XR6A 4GO5X 3MDKA 4WTYA 1EWXA 1U6ZA 9RUBA 1FX2A 4OV6A 2N4CA 3VAHA 2HRFA 3CTFA 3G7IA 3G82B 3JSMA 4DSIA 3HHLD 3H4KA 1H38A 5ECRB 4PWWA 1MWZA 1BQMA 2B7JA 5FDLA 1KVKA 4K8RA 5F8NA 2HIQA 4G9HA 4A8QA 4J9SA 3RUBL 5DJBA 1T95A 1FCAA 4MT1A 2L57A 2DR8A 1WKKA 3KMNA 2KXFA 3QIDA 1R3NA 3MM6B 3NNAA 4LL4B 2IMWP 3SBCA 2Z30B 2CAIA 1UVKA 1U2RA 4PYDA 1K73T 2RILA 2WB1D 3THTA 4YEAA 2YV7A 3IRXB 4OX7A 4IQAA 2LYVA 4CRJA 2B7BB 1TK0B 1TKZB 2A2DA 1QAYA 3CC2S 3FZ4A 4AD6A 1VQPS 4ECJA 2WBMA 3GMFA 1FJ7A 1MDJA 1OIAA 2CRLA 3KHLA 1NSQA 4E8HA 3MAQA 3HDCA 4ZLPA 3EU3A 1XWBA 3FFIA 4LRAA 4NMXA 1A7GE 2C3UA 3OTEA 4KFBA 2YX1A 1HBMA 3QT6A 1UCNA 3D5MA 1S79A 4FNIA 2MZSA 2C0FA 2ASLA 4C8KA 1HWJA 2LCWA 4HTJA 4OFTA 2VCWA 3EICA 2FC9A 1VR6A 3LORA 2HG4A 4LF4F 3GH6A 4KV8A 2AAWA 3DKDA 2DRAA 2GFFA 3DRXA 1WMJA 1K0TA 3HVWA 3GFHA 3V6DA 2HHSA 2KO1A 3M8WA 1EIYB 1A0RP 3QFHA 2VUGA 1FKAF 1RTZA 2JACA 3QATA 1Z4UA 2A1BA 3L3CA 4O92A 2IC3A 4HZ4A 2CQBA 4B9VA 3R6GB 3SQOP 5A4VA 1SIWB 4CH7A 3MM5A 1RWOB 4NYZA 1PN0A 4MJAA 1HHTP 1QMVA 3FRYA 3TAQA 2YNGB 2FLOA 3TJKA 3FFIB 4NZ0A 3UPFA 3Q74A 4CHSA 2R7OA 3W3SA 2VAFA 2H73A 5L71A 1HBMB 2MMZA 4F9ZA 1LWXA 4G19A 3NLCA 4LSNA 4LF7F 3D9BA 1FRJA 3I5CA 4DSFA 1XNQJ 3HSZA 1GXUA 2RMLA 4ES3A 3BREA 4C9DA 3QAEA 5GAGU 1KP6A 4F50A 4NXMF 1T4YA 4N41A 2BJEA 2YKNA 1R89A 1X4EA 2E1CA 1ROFA 1NU4A 1Q78A 2RT3A 4ZBDA 2E1MC 1Q7YT 4NYPA 1R6YA 2DJKA 2IC3B 2YY3A 2N3LA 2KXHA 1O0PA 4TW5A 3WBZA 4X62F 1D8YA 1TUWA 5CREA 4NLTA 1Y7PA 4DXLA 3MM5B 2DVIA 3JTNA 5IOLA 2CVDA 2HSEB 4C8NA 5B8BA 2B9XA 3LP0B 4OMFG 3M8RA 3T1YF 3CJ8A 2PIIA 2YH1A 4GKJF 1VRUB 5HP1A 4P2FA 3OR1A 3SCLE 3BGFA 4WP8A 2EKNA 4KA0A 4RUCA 2B3TB 3C14B 4OX9F 1TL3A 1K47A 1WG4A 2OEMA 4CO3A 1WTFA 2ROGA 1VHFA 4OHVA 2C28A 2BBEA 2R7QA 5KFXA 2MJUA 4FBTA 2YKNB 4R0JA 1X4BA 1AFJA 3M8YA 4I2TA 2R0GA 3CCTA 1NDCA 2AU0A 2KM8B 1YRUA 1PA3A 5D4NA 2K3IA 3QJPA 3CCMS 5B8AA 3OJUA 2CPFA 1Z6NA 1RT6B 1F9MA 2LV3A 4OI6A 2QLBB 2RQ4A 4K4XA 4QL9A 5B0FA 4RWWA 2X3DA 3M8SA 4N8NA 2CJQA 5D73A 2P5QA 1JLFA 2FLNA 5IS2A 2V6OA 2CA9A 4DPWA 1A2MA 3ILLA 3TYTA 2H1AA 2V6AA 1B0TA 2HVHA 2YKAA 4RUBA 3QSYB 3JCML 1Y5NB 5JXSA 3S7RA 5HP1B 3BV8A 2ZM6J 2I2YA 2F4FA 1RT5B 3BEGB 4AJ8A 1UZDA 1TL3B 2VIMA 4EO3A 4QIGA 2BDPA 3A2VA 2UXDJ 4WJBA 3UCGA 2B0GA 2LU1A 3V4IB 4FIWA 1H2UX 4NA1A 5HVFA 4ZA1A 5IM9A 2YWOA 2DNOA 1GTHA 1EOGA 1TU7A 5DVBA 3LP1B 2XY6A 1L3TA 3VTIA 4LR8A 5D93A 4KY3A 1EP4A 1UWBA 1TFYA 2HXKA 2KM8C 1JLFB 3Q8YA 3PW5A 4X4RA 4ZB9A 3RJMB 4QBUA 1PC4A 4KDYA 5CRDA 4DFJA 3OTOF 1S0MA 2O87A 3DC2A 2R2SA 3SIPB 3Q8PB 1IKXA 3M8NA 2UXCJ 3F4TA 4C6AA 1L3SA 3W1YC 4OZNA 1BLUA 4N7TA 1X9MA 4OV1A 2XMJA 5IT9U 2H5IB 4ZVRB 4TN8A 4B08A 4A8WA 3TUJC 4N5SA 4FF3A 1OY6A 1OYEA 2H75A 2VL9A 3MPUB 2LA4A 4BIKA 1S7IA 3TWZA 3RB6A 4IG0A 5D8HB 2V9KA 1BQ7A 1IVZA 5JWQB 3MURP 2BRLA 1M2AA 3CRUA 5DALA 3W8PA 3PM9A 3D1HA 2NZCA 3NMAA 1UWBB 3KH7A 1JLBA 3AJ1A 1GXLA 2DJ0A 4ZITA 2BYCA 1QGVA 2IVYA 4O32A 2AHEA 3ZTSA 3T5LA 2TRCP 3QO9A 1GX5A 2PA8D 3M3MA 1IKXB 4B9UA 1MLAA 4OYPA 2DKOB 3PX0A 4XK8C 3D4MA 4ZN1A 1X9MB 1T8EA 2H70A 2XYGB 4JV0A 2YWEA 4DV1J 1L3UA 1VQSA 4DQPA 1NH8A 2CJAA 17GSA 4ZP6A 3DFEA 4IG0B 4JI3J 2Y8YA 1SKUB 3PFOA 4K5RA 3LSZA 3FYGA 2QN6B 4WZMA 2V50A 5J2MA 1X5TA 2BJ8A 2BABA 3FK4A 1U1MA 5DALB 1PAEX 2L48A 1P8GA 2GO9A 3O3TA 4BVYA 5D0HA 1JLBB 3TJ9A 1U45A 3GKNA 1S3RA 3QMXA 1DARA 2XS7A 3ADAC 1M0UA 5FWGA 3KDOA 3QO9B 2F9JA 2LKZA 5EGYA 3EYZA 3JQMA 2HS4A 3SDEB 4N0VA 3RR7A 2XPDA 2EG1A 4YAPA 4CTAA 1T8EB 2MDAA 1VBKA 4KB7A 1UN2A 3IAM9 4ZDNA 2QFJA 3R5GA 1N6QA 2OFHX 1KLMA 3ICLA 3BYRA 3UDEA 2LJKA 3Q8SB 2H74A 4NLQA 4RNNA 1ZH5A 3QT7A 3CD6S 2VDHA 4YHHJ 3KTLA 1NB2A 2V9WA 5J2MB 4Q5FA 4LR9A 1KQGB 3UWTA 2H1BA 3MEGB 5HFKA 3D0HE 2HYIB 3J7AN 3HJMA 5G0RA 5KFLA 1U6TA 4OJHA 2HRAA 3N6MA 1BHNA 2NSCA 1JK9B 3OD2A 3Q24A 1QXHA 4DUTA 2JJ4D 1OC8A 1JLAA 3MF5A 1HQ2A 1RTJA 1RHJB 1S6OA 1REVA 1SKWA 5D9TA 4QCLA 2CZVC 2UV8G 1XWGA 3EXCX 3UD5A 1UEUA 1M3JA 4TRXA 3H93A 4CTAB 2FYXA 2XYHB 4K1FA 4KCAA 2V2VA 3R1HA 4RW8A 2WB9A 5M2UA 3AAWB 1N6QB 1T9YA 4QIFA 2R7RA 5ECSA 3RDWA 2GJ2A 3MCOA 4R0EA 4NZ6A 1S77D 4URGA 2HMIA 1CPZA 1X0PA 3MM9A 4WF4A 3Q8QB 3QMQA 1HI1A 2J9DE 1Q4RA 2VASA 1X5PA 1WE0A 1KBNA 1D8ZA 1X5CA 1BEDA 3IN5A 4EI2A 3UCUP 3IDVA 3TRGA 3O1LA 1ZZYA 4GQFA 2E7PA 5K9FA 3TRPA 1JLAB 4UOHA 1RTJB 2GGTA 4OLPA 1FDDA 1MNEA 1GUHA 4RBVA 4I6AA 3F8UA 2OAUA 1YKCA 1REVB 5LT5A 1XIYA 1SKWB 2R7XA 4S0MA 1WNEA 4WXWA 1A2JA 3M30A 1KNZA 3J80Y 2FZCB 2NBSA 1U1NA 3NCRA 1SJ3P 1QAIA 4F3QA 2BE2A 3H8YA 1RT4A 4RW8B 1ERVA 4CLLA 1WHWA 3SFGA 5A4UA 1HWUA 4J7CA 3R5AA 3FBCA 3I87A 1SV5A 3APQA 3WYWA 3CUNA 1MDIA 4USVA 2VUPA 4ZL8A 2AYTA 1FA0A 1XR7A 3D54A 3S1TA 1K3LA 1HW8A 2MYFA 3GH9A 2F3MA 2HNDA 5D9WA 1H73A 4F4AA 3SZ2A 2VG7B 1TKDA 1V2AA 3RRHA 4OZ0A 3DGPB 2ACYA 1TK8A 5IMDA 1FNOA 1FDAA 5LJ5Y 5ECQB 1X5DA 4CLZA 1NK5A 1ZPVA 5GMKa 3B82A 4CDIA 2A2RA 1USBA 3M30B 4DL5A 2UXBJ 2O7KA 2NDOA 4DL2A 5IT9Y 3AJ2A 2H9ZA 2XSJA 3ZL5A 1C1CA 3UDCA 4OFZA 4CLUA 5KAKA 4QWAA 2O66A 4HU9A 2LDYA 10GSA 2PVQA 3ERWA 1XNQF 4N0ZA 1WKJA 1SJ4P 1OY8A 2K9FA 3CCQS 4J9VA 3VQTA 4U9RA 3TX0A 2IN3A 4U67Q 2DRBA 2HNDB 4NA3A 2HBQB 3UN3A 1OVNA 1ZYEA 1TK8B 4XS6A 3TANA 2IHR1 4TVAB 2O85A 5CXTA 3SCIE 2BA9A 4M5LA 3E0UA 3ZZPA 1KVIA 4MH3A 4TVEA 2OSQA 3BSAA 3W2WA 5HLFA 2ZOGA 1VBXA 1T02A 1U1KA 2LUSA 2G0IA 2YPZA 2DJ1A 2CQ4A 3G6YA 2XSJB 2DSAA 2G2ZA 4X0XA 1C1CB 2V5HG 4XPCA 1BQXA 4IYQA 3PW0A 4PRFA 4G1PA 4UF4A 1WF1A 2GHWA 4DF4A 1HBUB 2A3JA 3AXMA 2CKWA 5FHIA 3OFHA 4WBFA 5HVGA 2R2RA 4WBRD 4QR1A 3NGKA 4KH7A 4B3SJ 1QDUB 2ZHBA 4YQUA 3RTVA 4CLYA 1RK4A 5F8LA 4IH6A 4K2XA 4WPAA 4I2QA 2XO6A 1G6BA 4C48A 1JJ2R 3ZTRA 4L8EA 3LWAA 3W8GA 2E7WA 2DGXA 5DQHA 3OW2R 2AX0A 1G0TA 2ZH8A 1MWYA 3BQ1A 1NHYA 1GSQA 3BO2A 1HQOA 1WHYA 3W2WB 1F9EB 2VLTA 5HLFB 3MUVP 2GHVC 3DOKA 1NMEB 3KHHA 3VAIA 3R3EA 1S72S 5KT5A 1FRMA 1FFGB 3G6ES 2LNTA 2QA1A 1YQ1A 3PR8A 1EZKA 2E29A 1WWJA 3PEJA 2IJFA 2E7XA 2V2KA 2K1RA 5IT4A 2ZM6F 1FK9A 3HVNA 2W8KA 2F8EX 2PI4A 1QFNA 3D2WA 1J08A 2FD2A 5FIIA 2HZVA 4ZOSA 3IPZA 2NSBA 2ZH6A 2UXDF 5D9VA 3AA8A 1SJRA 3HZ4A 2HHHJ 3NIVA 4DI6A 4I2QB 3GFZA 4P2XA 2Y1LB 4GSTA 3CIZA 2D74B 4ECWA 2Q66A 2GQMA 1UVJA 3CB4A 2XBQA 3OV7A 4ML1A 2H4YB 2V0NA 3ENAA 5FT3A 3TRXA 3AY0A 2OGUA 1S5ZA 4P7VA 3DHWC 1FHEA 4O3RA 1URRA 4UUXA 4DUYF 5L39A 5AIVA 2OMLA 2VM2A 3DOKB 3GV7B 3GHAA 3RB4A 3I32A 2AZ1A 5ECPB 4EBDA 4G1QB 4JV2A 3JQJA 3FZ2A 2KHCA 3C8YA 1FOVA 5L9NA 2K1RB 4PAAA 3MNGA 2UXCF 2IPOB 3CCES 1JXEA 4NL5A 3K59A 1L3KA 3EURA 4PYAA 1VIXA 3QZ8A 2IFQA 2EEYA 2KYZA 4NXNJ 1JNRB 2XY5A 4JBCA 1IR2A 3DYAA 4I64A 1SIZA 3DCAA 3NGTA 3QNWB 4RW4A 3DD3A 3WDOA 1F6TA 2H54B 1IN0A 5AT1B 1N32F 4CNYA 1AW9A 7GSSA 2IAJA 5GMDA 4BWMA 1KR4A 3MWBA 3MOZA 2IJRA 3EPGA 1HNWJ 4Q5NA 2KH9A 3NXZA 2HPUA 1SVDA 1X7VA 1GMUA 1RAFB 4DR3F 4PURA 1WWHA 3C8EA 2AGQA 2ZZNA 3M6XA 4NE9C 3QJLA 3JTOA 5F9NA 3QSIA 5A5KA 1X60A 1SUQA 3EWGA 1B0VA 3CNQP 4X64J 4POBA 5F41A 1RKIA 4K6XA 3BO3A 1NBEB