3DXBA

Structure of the uhm domain of puf60 fused to thioredoxin
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
214
structure length
214
Chain Sequence
b'PMSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLAGSAMESTVMVLRNMVDPKDIDDDLEGEVTEECGKFGAVNRVIIYQEKQGEEEDAEIIVKIFVEFSIASETHKAIQALNGRWFAGRKVVAEVYDQERFDNSDLSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords thioredoxin N-terminally fused to Puf60(UHM)
publication title Dimerization and Protein Binding Specificity of the U2AF Homology Motif of the Splicing Factor Puf60.
pubmed doi rcsb
source organism Escherichia coli o157:h7
molecule tags Splicing, transcription
total genus 51
structure length 214
sequence length 214
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2008-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dxbA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3dxbA01
2AYMA 2VCXA 2OTLS 4CHSA 5ENUA 4DVCA 1TU7A 1FOVA 3QR6A 2GQMA 2CJKA 1T3BA 3MSZA 4NHWA 2H8LA 4PUFC 1D8ZA 5ELAA 2H75A 1RK4A 2ZJRQ 2XS2A 4TR0A 2KXHA 5LXYA 1MTCA 3GX0A 3ERFA 4BWSA 2H71A 5A4WA 4WCEQ 1JMTA 1SK1A 5D73A 2MZQA 4ZILA 3VWWA 2DO0A 1M5OC 2GS3A 5CA5A 3PH9A 2DLXA 2DC5A 3S7RA 4TXOB 4TW5A 3DWVA 3NMRA 1UN2A 5IO2A 3CCSS 3F3QA 2J23A 2VL2A 2DJKA 3ISOA 2PEHA 2GDRA 3L4NA 1EWXA 2YKAA 1TXXA 1G7EA 3CUNA 4AJ7A 2RUEA 1ON4A 1B9YC 1YHQS 3HJOA 2FHOB 2NDOA 3TKQA 2DNZA 2LXUA 3MOJB 2CA8A 1T00A 2LRNA 2WCIA 1HD1A 4IVFA 5ID2B 2JL4A 2RIIA 1Y6EA 5ECQB 3DVWA 4F82A 5G31A 2R5GA 2VIMA 2D2ZA 1GNEA 3NOFA 3SBCA 2H76A 2F8AA 4M5DB 2L4QA 1YI2S 2GVPA 1JZRA 1WHWA 4MZWA 4L8EA 3P90A 5J41A 2MJNA 2RRAA 1O8WA 2RQ4A 2IJYA 4EF0A 1K8AT 2VOCA 2HFDA 3EMXA 3UARA 1WE0A 3FZ4A 5C04A 2H1GA 4POKA 2SXLA 1HQOA 3H79A 4KE3A 1ZCPA 2C0GA 1Q86T 3WT2A 1OWXA 4IQ1A 2L6CA 3KH7A 4I8BA 5LJ3Y 2HZFA 2PU9C 4FXWA 1USBA 2H6XA 2R4VA 4ECIA 1ILOA 2MJUA 1GULA 4RQRA 1VF3A 2CQ1A 4YUDA 5F07A 1OC9A 4ED5A 3R1HA 2DHAA 1T4YA 4OZ0A 1AUDA 1DHMA 1THOA 1GTIA 2V6OA 3KXOA 2GQLA 4POBA 2KRBA 3TOUA 4PRFA 1JHBA 1TOFA 2JRSA 2PPTA 2OBKA 4DSRA 3MUMP 1SJRA 5ECRB 2DGOA 3GH9A 3CPWR 4QU6A 1X5CA 4G9HA 2J9HA 2LEGA 4ECBA 3UL3A 1AQWA 2FUG2 2ES7A 1ERTA 2MKKA 4L5OA 2MQOA 1X4EA 2CQHA 2KHCA 2VLVA 2CQGA 1H2TZ 1PRXA 2PBJA 2MZSA 2ALBA 3IK7A 2KH9A 2LA6A 1SL1B 1M9AA 1WTBA 1VQ5S 3ZFLA 2HSYA 5DM6Q 2FWHA 5ECPB 3J7Yk 2PE8A 3LSZA 5J4UA 2CPHA 1X4HA 2YV7A 1TRWA 1SKRB 3IAM2 3H93A 3TJFA 4W90B 2MZCA 2E5IA 3UCGA 4HZ4A 3UCUP 2YTCA 4IHUA 4TR4A 1Z7PA 2GO9A 3F4RA 4LMZA 3FK8A 2RQCA 2FGXA 2G1DA 4XTSA 1M2AA 3TKSC 1BAYA 2DK2A 3VAFA 1A2LA 1X4CA 1MDIA 2BMXA 2DBCA 2HE3A 2M0GB 1G6WA 3US5A 2YN1A 3VAHA 5J9BA 2MY8A 2HYIB 3ERWA 5DVBA 2V2GA 1TK0B 2PWJA 1S3DA 3CC2S 1R7HA 4IGJA 2KN4A 1SJ4P 2I1UA 4HQSA 4ML1A 2P31A 1AXDA 3C8EA 3RHBA 1YIJS 1G7OA 4ID0A 1VQNS 3BCKA 5ELGA 4QL9A 6GSVA 2YH0A 3HVVA 2KI2A 2GSQA 1VF2A 4MPFA 1K0MA 5GVQA 1GLQA 2EC4A 1A2MA 2MZ1A 3M9KA 3IE3A 3C1SA 2VL2C 1HA1A 4AGSA 3D2WA 5F06A 2VCVA 2F3JA 2DGXA 3HCZA 2MKJA 3I55S 4YH2A 3GL5A 5IMAA 1GSQA 3M0FA 2CQCA 3LFLA 1U1KA 2HSHA 5F05A 3ZVJA 4Q5QA 1ACVA 2GLRA 2LRCA 4OFTA 4E8EA 5E4WA 5GMKa 1X9SB 1XW6A 1M5KC 5B6NA 2CX4A 5ECHB 4N30A 2J0QD 3G9CA 2DNKA 2GHPA 2B1KA 4XRDA 1Q98A 3KCMA 2CQ4A 2MGZB 1VQLS 4BWQA 2DSAA 4JZQA 3UVTA 2CPXA 2CAQA 4FXVA 5G1KA 2L59A 4JBBA 2J76E 1OIAA 4Q5RA 1SD8A 3EU4A 1HD2A 3DLLQ 1QVFR 2RLIA 1DUGA 5HQPA 3CCUS 1U1MA 3GKKA 4LMVA 3GX8A 2KU7A 2LXIA 4F26A 1JLWA 4N0VA 4EC0A 4KA0A 4JR4A 2L9WA 2HI7A 1L3KA 5FWGA 1K9MT 2CQBA 2YP6A 1SKSB 4FYBA 1PGZA 2VODA 3TO8A 4WKRA 5LJ5Y 2CQIA 3UMAA 2B5XA 4IQAA 2MKHA 1WJKA 3RW7A 1GSUA 3VI5A 2XNRA 5BJRA 3DVXA 2IIYA 1VBYA 2Q79A 1VQOS 4PNFA 1R8HA 2C3QA 2VONA 1OE7A 5HL7Q 2CV4A 5CYJA 2QSIA 2KP1A 1OC8A 5JCUA 1MD4A 1EP8A 1OO0B 2CPYA 3J7ZT 1Q82T 2LEBA 2GSSA 4K7OA 1XWCA 3ERGA 3UD3P 1J0FA 9GSSA 1WWJA 2HGMA 2OIHA 3UBLA 4V2NA 1BY9A 1EP7A 4XS4A 4OO4A 3ZTLA 3KP9A 1KOHA 1X5OA 1Y25A 3G7IA 2RNEA 3LEFA 3J7Yb 2DGVA 4NV2A 1WF0A 5DDRC 2MMZA 4YB1P 1P27B 2FPHX 4BS2A 2KFYA 4WFNQ 1GTUA 2CT6A 4TR1A 2RUFA 3APQA 8GSSA 2L6DA 2YCDA 4F02A 3EWLA 5FJ4A 2F3MA 2DNOA 4K0GA 3N5OA 3APOA 3PINA 1WP0A 5C00A 2OSRA 4LJMA 4KDYA 5JVGQ 3IHQA 1A8LA 3VAIA 2LMIA 2AYTA 1EEMA 2XB2D 2N5FA 3KP8A 1YKCA 2FY6A 1A0FA 3RAZA 2CPIA 2VCTA 4N0ZA 1EV9A 4MZCA 4PNGA 3IA1A 5IMDA 6GSYA 1X5PA 3WYWA 5DALB 1HD0A 1F9FA 3UIWA 2ZJQQ 1JJ2R 1TTZA 1YJWS 4HJMA 3GNJA 2HGLA 3CULA 1WF1A 2X99A 2X8HA 2VUPA 2XS7A 4TLQA 19GSA 5JWRB 1X4BA 2DJ2A 1UFWA 4WBJA 1XWBA 2HNLA 4TU8A 4RUVA 3E3EA 4DSSB 4I97A 5J3RA 1VC6A 4I6XA 3TB2A 1Z5YE 3QMXA 20GSA 3G96A 5L71A 1VBXA 4IUFA 2OTJS 2B0GA 2QFJA 4TXOA 2Z9SA 2MMYA 1TP9A 1NO8A 2KRRA 1PO6A 2P5QA 10GSA 3HKRA 4ZXGA 4HI7A 1K0BA 4WIIA 1WPIA 1TK5B 1THXA 4D73A 4JEDA 1MDJA 1T4ZA 1WEYA 2DNRA 1R4WA 5ECOB 3ZREA 1GP1A 1XPVA 3UD4P 1JZDA 4EL1A 1YTYA 2C3TA 2DNNA 3MD1A 2PVOC 4ZBDA 2I3YA 3M9JA 5ECLB 3EC3A 3VALA 3QAGA 2HVZA 2M9KA 4JU5A 1U2FA 2JVOA 5HR0A 1T8EB 1AQXA 3GSTA 2YWIA 4LLRA 4CH0S 1ZH5A 2VOPA 1EGOA 2MQNA 3I6AA 3N9UC 3H2UB 3EURA 1QM9A 1U3AA 4YAPA 1V40A 1KC8T 4MMMA 1SJ6A 1LJRA 5DQYA 2MSTA 3GHAA 1ZMAA 1K0OA 2DNLA 5LSOA 3A2WA 3VLNA 5G5EA 3U5RE 3CCJS 4K7NA 1F37A 2MYGA 2V41A 3PGTA 2OACA 4LA1A 2MMOA 2WB9A 3UBKA 3L9SA 3L3CA 5IMZA 1H2UX 2QGVA 3C7MA 4RQXA 1UW4A 3Q74A 3P5TL 3PIPQ 2N5BA 1FHEA 3CCVS 4POLA 3MWHA 2G2QA 4GSNA 1IYHA 1EV4A 2C3NA 3L0HA 1SENA 4Q5NA 3UCZP 1PQNA 4ZBBA 2FWFA 3FZ9A 4I5QA 5D78A 2I81A 4KAEA 3UAPA 5CP1A 1O7UA 2M7SA 3I56S 4WXTA 2XBIA 4OFNA 4PGTA 2H0GA 2PN8A 1URMA 2E5GA 2P0GA 4GQFA 4YAVA 1PX7A 2CQ2A 1PSQA 1IQTA 3FKFA 2PUKC 4KDXA 6GSTA 1FO1A 5JCWA 4PR6A 3SWLA 1Z9HA 4MPGA 2I9HA 3QAVA 1U1OA 5H5QA 5HFKA 1XXUA 3O6TA 4MJEA 2MB0B 1QK8A 4A8XA 5IMVA 2IWTA 3GKNA 5DAKB 3U1MA 2LECA 4K6XA 2DNMA 3GTUB 4V19X 3HXSA 2GT5A 2PERA 4KDUA 2IMDA 4YQMA 3L9UA 3Q6OA 3BO3A 5A4UA 2U1AA 5GSTA 2XNQA 1DE1A 2LNTA 4UQTA 4ML6A 2LSTA 5ABRA 3EGZA 3KMNA 1M2DA 3LYKA 5G2ZA 1WHYA 1SJZA 2E5JA 2VL9A 3GKXA 5CRDA 3IR4A 2A2RA 4ULXA 3D0ZA 2X8GA 1KEBA 3GH6A 3IWNC 2LV3A 4O92A 3CC4S 4OD7A 1G2EA 2B1LA 5KEJA 2QKEA 2YANA 2VD1A 2OADA 3R1LA 2DGWA 2C80A 3HJPA 2X1FA 3F9UA 2HXKA 1GTAA 1MEKA 3MD3A 1J9BA 3DXBA 5EN1A 1SK0A 2ON5A 2LEAA 2C0FA 3WGXA 3MUTP 4IN0A 2M72A 4CDOA 2WULA 4KUNA 3M3MA 5GSSA 3ED3A 2KUCA 1X5SA 1B8XA 2J8AA 4OCFA 2MBTA 2MSSA 4C4WA 4MDCA 1KTEA 4WEYA 3TGZA 3KZQA 1EGRA 2MQLA 4GQCA 3CMIA 2EIRA 2HLSA 1BJXA 2ERRA 1VRSD 3IAS2 1M2BA 3TKPA 2OE0A 3VWVA 4MF5A 4MH3A 1XCCA 1M0UA 3ZLPA 3DGQA 2AB6A 5D77A 1DSBA 1I5GA 2VLUA 2MMAA 3V4MA 1VQ7S 2A4VA 3HVXA 3S6EA 4PQIA 4V2MA 2B7KA 2KT5A 1FNXH 1O85A 5D9TA 1M7TA 2I2YA 3M1GA 4OCEA 2NLWA 2H66A 2OJ3A 1O6JA 2N5AA 1UP1A 1A8YA 1S79A 3DYRA 4MH2A 2C0EA 1NSWA 3VWXA 4L5LA 2TRCP 1MD3A 2B7JA 3EMPA 2JZTA 2X1BA 3IOSA 1K73T 2MY7A 1G6YA 2EK6A 1XIYA 4NWYA 3I69A 1KOOA 3LQVA 3LXZA 1JJ4A 4L0UA 5JVHQ 1WRYA 2H0IA 5DDOC 1JZWA 1HL6A 2D9PA 1WF2A 4OO5A 2I38A 3CCES 2AYGA 3VFIA 2OE1A 3U1LA 2RS2A 3ULHA 1M1KT 2FHEA 2VL3A 1PKZA 4IBPA 3EYTA 1TW9A 1BG5A 3F6DA 2YZHA 2O3DA 4XS1A 1LU4A 4ZL8A 3UWTA 4WFAQ 14GSA 3KTLA 4ZBAA 3FZ5A 3GKMA 4FH8A 4MABA 3TCOA 5IM0A 1GUHA 1OYJA 1EOGA 2H74A 2XC2A 3FR3A 2F51A 1FJ7A 2VCQA 3LWAA 4H86A 3HVSA 1GSEA 5EL8A 2OJLA 3FW2A 1G0TA 2JSZA 3KJYA 2K8VA 3HDCA 2ADBA 3R27A 3IRAA 3TJGA 4GSSA 2HYXA 2H30A 4MCUA 3VPTA 2LS5A 1VF1A 2NBSA 1V2AA 2OBIA 4J2FA 4MF7A 1Q4JA 3QAWA 1FW1A 3RPPA 2HZCA 2CVDA 4DSQA 3GN3A 1UC7A 1OPIA 3BJ5A 3ZITA 2IFQA 2B6MA 5IQQA 2FWGA 5G5FA 2MXYA 1VQMS 1YJ6A 1YJ9S 1YKAA 3TKSE 4HZ2A 5IOXA 2MZTA 1VC0A 1ZL9A 2M46A 1GLPA 5DM7Q 4K9ZA 2WBRA 6GSUA 3NNHA 2IMEA 3BEGB 2PVQA 2FD3A 4IJ3A 1K0AA 4KGIA 5D9XA 1QXHA 1ZGNA 1YZXA 5LCZA 5DALA 2B5YA 1B9XC 2LJAA 3HD5A 3IBHA 2EIOA 4ZL7A 1TJDA 5AN1A 2CPFA 2DIZA 4LIRA 5CRWA 3LXTA 5HFGA 3CCRS 3ZRDA 2VM2A 1WHXA 4V1Ag 2GZPA 5KN1A 2NTOA 2HZEA 5GAEU 2KXFA 3G7JA 1UAWA 4V1Ap 1PL2A 3BS9A 5CO3A 3MDFA 1WWHA 2LUSA 4MP4A 3D5JA 3EU3A 2CX3A 1OC9B 5COHA 1K3LA 3VPQA 2JU5A 1AC1A 1XWGA 2BTOT 1CVJA 4F9ZA 2MKSA 1SL0B 2DH7A 1VBZA 3D4TA 3C71A 1PN9A 2VCZA 6GSSA 4P6QA 2L5OA 1O73A 2VOOA 3U6VA 3FEYB 4AJ8A 2DGSA 4ISDA 1SL2B 4IOAQ 3CBUA 2X8CA 3FEXB 4MJCA 5ECKB 1QFNA 2CVBA 3GMFA 1GSSA 1AUCA 4IJIA 1RW1A 1AIUA 3LGCA 1SJQA 2DHXA 1TI1A 3UEMA 1S72S 5H5SA 5IMCA 3SDEA 1WEZA 1XFLA 1YJNS 3UJ1A 2MYFA 5CRHA 2XS5A 1U1LA 2G4BA 3GYKA 2DH8A 3I43A 2YOIA 5DCGA 1J08A 4EDZA 2E44A 3ZMKA 3UE2A 5A4VA 2O85A 1U6TA 5KN3A 1TI3A 1YWXA 3D4MA 3LORA 5DDQC 1S3CA 2LJRA 2RS8A 1F3AA 2V6KA 4IO9Q 2YWOA 5ITHA 12GSA 4ECJA 5CNWA 2DIYA 4QL7A 1X5TA 4G10A 1OVNA 3GL3A 2MPUA 1V9WA 3ME8A 2M8DB 2M2BA 1QGVA 1CQHA 3TJBA 3THPA 1WI8A 4HDEA 4IELA 3JB9k 2L5LA 1FG4A 3TKRA 1Z6MA 4MZBA 1VF4A 5E59A 1A24A 3H1NA 1XVQA 2H19A 3D22A 4O32A 1GRXA 5FHIA 3H2VE 2LQQA 2O89A 3BBYA 3EE2A 3S01A 1JJHA 2CPDA 2HT9A 6GSWA 3GURA 3G7YA 3CD6S 1N2AA 2LJKA 2O7KA 2H6ZA 1YEXA 1YF1A 3F4TA 2AYBA 5HR2A 2MKIA 1WI6A 5JWOB 4NAXA 5IPHA 3ME7A 2YWNA 4ILFA 1WEXA 1SJ3P 1YF0A 2FLSA 3C73A 5INYA 3TRXA 3NNAA 2OE3A 3CRUA 3OW2R 2ZNMA 4XS6A 1SKWB 1AW9A 5AIXA 2AJQB 5ECMB 2NVLA 5IOWA 4C0OC 1ZOFA 2LQOA 2LYVA 3F4SA 2VO4A 1FT8A 3MDKA 3G71S 2YV9A 3ZZXA 2IMIA 3ZZYA 1VQ8S 4PX1A 4TN8A 5HR1A 4F0BA 1H2VZ 2F9SA 3SXLA 1RQMA 1BEDA 1YY7A 4QU7A 4V2LA 1I9DA 2K18A 4XCSA 5ECSA 2M88A 1AQVA 4BVXA 2CAIA 6GSXA 3G8SA 4DEJA 3CF5Q 3LQ7A 3GTUA 1W89A 2CQ3A 3D6IA 4WETA 3S8SA 2DNQA 3E0UA 5ECIB 3CXCR 2LNSA 1V58A 2A2SA 2KVIA 1Z7RA 1FB0A 4NXIA 2E7PA 5GAHU 2ZUPA 5ID2A 2GSTA 5D8IA 3ZVJD 2CQ0A 1WIKA 5CAXA 5IQYA 3ZIJA 1X5EA 1YDKA 3GIXA 2DNPA 3RW6A 2GSRA 1YITS 3ZYWA 1K0NA 3L78A 1BQ7A 4YQVA 1DE2A 4TOPA 2JZRA 2FC9A 3PIOQ 1FHTA 3VWUA 4JE1A 5D93A 1OKDA 1TRVA 4POMA 1BX9A 1GL8A 2VM1A 3Q2TC 3VF0B 1X9WB 3FYGA 4XS4B 3THTA 3G6ES 3KEBA 2GTUA 4KCEA 2OKAA 4I2UA 2ADCA 1XZOA 4PQ1A 4BL7A 4WBRD 4ERDA 2VLTA 4NHZA 4X1UA 2AD9A 4PKDB 1VC5A 3LYPA 1KQSR 4ZB6A 1OAZA 4CW9A 4GRFA 5DETA 1N8JA 1H75A 2H1AA 2FY1A 2DGUA 4WR5A 5A5KA 3CRTA 4NPBA 3WGEA 1A23A 2R37A 4IS0A 1WG4A 2KYXA 4KB3A 4ECCA 5J5NA 3P6YC 1GSFA 2GT6A 1ZZFA 2VAFA 2DJ1A 4K1FA 2JZSA 4GWRA 1V57A 4QPTA 4WF4A 1M5PC 1GWCA 3EINA 3IXRA 2DMLA 2IL3A 4EGLA 3A2VA 2H1DA 2AUVA 2QEXS 2FWEA 3PR8A 3M8NA 4C7QA 4L0WA 2H1BA 3KMOA 2WFCA 5LD0A 1CQGA 1AAZA 5DDPC 1XN9A 2XHFA 4KX4A 3P2AA 1A7GE 1X4FA 2HRNA 4CIOA 2DJ0A 3HZ8A 4Z2XA 2H0HA 4XRAA 1M99A 2JX2A 2B5EA 5CREA 2M4MA 1B4PA 3MURP 3C1RA 5B6MA 3WD6A 3IK9A 2DGTA 1X4DA 2KXNB 3TKSA 1H6KX 4ZB8A 2KM8C 2CZ2A 3ZZZA 4Z7XA 1HNCA 1FJEB 3HZ4A 1KNGA 3CYNA 2LKZA 3DEXA 4GF0A 5GADU 4BA7A 5B7CA 4MLYA 1YQ1A 2YH1A 1ZZNA 1PL1A 1WHVA 1SYRA 3UVHA 2FA8A 1ML6A 5DJLA 1ST9A 5HR3A 4HU7A 4HJ2A 13GSA 2ZJPQ 1E2YA 4NV5A 4HUAA 3EGNA 4YQUA 2IMKA 4WF9Q 2RM6A 11GSA 2WDUA 3IV4A 2CPJA 2YPMA 3TJJA 2EIQA 1TDIA 2AYEA 3IC4A 4D73B 2WZ9A 4RI6A 2CQDA 4IP6A 2JADA 3F8UA 5DQSA 3FR6A 4MK3A 3J7YU 3G4SS 2D3OR 1JLVA 2PMTA 2F9DA 2RVJA 2MZJA 2L4CA 2C1YA 3W6GA 5EVOA 1PA3A 3IPZA 5GAGU 2M70A 3K8NA 1FVJA 3JCML 2WRTA 2X1GA 3MAKA 2WJUA 2JVRA 4W92B 2TRXA 2KLXA 1S3AA 2FC8A 4I2TA 4PQHA 2CZ3A 2H01A 3GA4A 3LJRA 3NS6A 2DMMA 2NPBA 5DDLA 3CTGA 3TRPA 1E6BA 5D9VA 3F63A 5EPFA 2L57A 5IIZA 5IPGA 3KH9A 2L08A 5AIVA 1N52B 3CTFA 2FCHA 3TP2A 3VAKA 2JACA 3MXHP 4G19A 4CQ1A 1FVKA 2K8GA 2MGZA 1XVWA 1R5AA 4X0XA 5LXRA 4YOEA 3AY8A 3IDVA 2MKCA 2AHEA 1XW5A 1F9MA 22GSA 4FO5A 1GTBA 3BO2A 1NW2A 3CXGA 1WMJA 3A3TA 2DNGA 2XSFA 2JSYA 3F6FA 4E8HA 4IW9A 2VCWA 4WR4A 4TRXA 1LBKA 1X0RA 4F0CA 3KIJA 3VK9A 3L9VA 4IKHA 2XPEA 1TU8A 1N54B 3P49B 4KW6A 4HS1A 2N3LA 1OKTA 4OZ1A 1U1RA 3SMZA 3VAMA 2K6VA 4AJ6A 1T7PB 2KG1A 1PKWA 5LNKe 1QUWA 2D9OA 1U1PA 3IRWP 1TKDB 1GNWA 4K2DA 3R2QA 3GRXA 4FIWA 1U6FA 2C0DA 3GSSA 1VQ9S 2MMNA 2RM5A 1XBSA 5J9CA 3B4MA 2GZZA 3EVIA 4GLTA 2E5HA 3CC7S 1X5DA 4GSTA 1TRUA 1M9BA 3O76A 1VQKS 2DB1A 1K0DA 3CSHA 4EXJA 4KH7A 4PURA 1W2BR 1VQPS 1X4GA 5H5RA 4N10A 2DJ3A 2IN3A 1O8XA 1K3YA 3HJMA 3K0JA 2GQKA 2LKUA 2MBSA 2KHPA 2F8FA 1Z6NA 2G0FA 3G8TA 4P3YB 7GSSA 3V1WA 1ZZYA 5AISA 3QOUA 3MNGA 3DRNA 4K7IA 1HNAA 3NZNA 1P1TA 1DBDA 2MQMA 4G2EA 2VD0A 1KD1T 4IOCQ 4MA9A 3KM6A 1EZKA 3S9FA 1U3IA 2BZ2A 2DJJA 3ZMLA 3W8SA 5DJMA 3O3TA 1TK8B 2LQ5A 4PUAA 4GTUA 2REMA 1UVZA 4EE0A 3BO4A 5H1SV 1SU9A 4O7HA 1U1NA 1URNA 3NIVA 1N8RT 3HY2A 4GXZA 5CXTA 1U1QA 1K3OA 2YJ7A 3TOTA 2G0CA 2IMFA 1B4QA 4JRRA 3WGDA 1U6BA 2RRBA 2PGTA 2YNXA 3BCIA 2LTKA 3MI7X 5HO4A 2AV4A 5AGYA 2NZ4A 5HFIA 5EY6A 1FO5A 1VQ4S 2H6YA 1SJIA 3QPMA 1FJCA 1JFUA 4RI7A 3FEUA 3QFBC 3G9BA 1XOBA 3CTRA 1NU4A 5F0GA 4XIHA 3Q2SC 3OR5A 1H4OA 1A9NB 2DISA 4DSSA 5B8AA 3GFKA 1WG5A 1UA5A 3CCMS 4X43A 3DD3A 1ERUA 1RKJA 5G30A 5D9WA 4IP1A 2C4JA 4Y0FA 2CQ9A 3FR9A 3HHNB 2UP1A 3LPYA 3ZFBA 1PD21 4TU9A 4U67Q 3RBTA 4ZIJA 4F2IA 18GSA 1R5PA 3NS5A 2CPZA 2ZCTA 4TXVA 3CSJA 1T1VA 4KSOA 3DMLA 1C72A 4WF5A 1X0FA 1O81A 2OA7A 2RUGA 1FAAA 2MQPA 3D21A 3FY7A 1GSYA 1U88A 4HEA2 4PXOA 2KG0A 2TIRA 3E9JB 3F0IA 4BVYA 2DIVA 4BPYA 2L41A 3VAJA 2DGQA 1W4VA 3QCPA 5IMFA 4J57E 1MDKA 4LL4B 1TRSA 1QQ2A 5FT3A 5DCHA 3RPNA 1GSDA 1DZ5A 2HRFA 3CCQS 2B3SA 5B8BA 2O87A 1WG1A 1PGTA 4OFMA 2ON7A 3FZAA 3TUEA 5IO0A 1JZOA 3EX7B 1OC3A 4HU9A 3B4DA 4JR6A 4KSMA 5IM0B 2X64A 4Y00A 2E2MA 1R26A 3APSA 2E0QA 2K9FA 3KTBA 3Q18A 3Q19A 2RU3A 1PX6A 2FNOA 2KP2A 4AF2A 1HNBA 2LCWA 3WT1A 2BJXA 2A3JA 3US3A 1F3BA 1DRZA 3CSIA 3TJKA 5CRGA 1ABAA 4LL1B 1IYIA 2CPEA 3BD2A 4F03A 1FXLA 5GAND 3CMES 2C8UA 2K8SA 5GZZB 4XHMA 2X1AA 1A2JA 2V1MA 2IFQB 2V94A 4EDYA 2DIUA 2N7CA 4J56E 1X9MB 4ZKAA 1PMTA 2O8VB 3GUSA 4Q5FA 3HHVA 2DNHA 3DIEA 5JWQB 1M90T 2RT3A 2DH9A 1EOHA 1FB6A 2N3OA 3N9JA 4N11A 1SXLA 2J0SD 1ZYEA 2R6KA 1DBYA 4MJBA 4FYUA 3KD0A 3P7XA 3MUVP 16GSA 3NNCA 4KCAA 2WGRA 2YJHA 4HQZA 2R2JA 1XOAA 1WOUA 1KBNA 4QQBA 3W8JA 5ECNB 4LMWA 3QD9A 4GCIA 2HZEB 2QA4S 3HA9A 2MHNA 2YZUA 1ERVA 2WS2A 1EEJA 4KNDA 5DAKA 2CQPA 2EK1A 3H4KA 1NHOA 1XW9A 3UOMA 1NM3A 1B48A 1VGLA 3VAGA 2KOKA 4QQ7A 1RK8A 3ZL5A 2LA4A 5GAPD 3VI7A 3ZIVA 2DO4A 1GH2A 4EKZA 4TR3A 5D96A 1OE8A 4EO3A 2V32A 4NMUA 4MF6A 1X4AA 4CH1A 3SDEB 3TYTA 2H72A 3F3RA 1M5VC 1D9AA 4FYCA 3A5WA 3TDGA 2E2GA 1GUMA 4WKWA 5IM9A 4HOJA 1SD9A 3P3DA 3FHKA 4TKYA 3HYPA 5IFMA 2IPAA 2QC7A 2DHGA 1XWAA 5G1LA 1YEPA 1N88A 1F2EA 5JCGA 3FRCA 4J5OA 3TRQA 3CMAS 2OSQA 1QVGR 3I9V2 2LRTA 2N82B 1GUKA 5MLCV 2EVZA 1Q7YT 2K3KA 3VURA 2MZRA 2M80A 1XWKA 2HGNA 4ZL9A 2GGTA 4RU2A 4F25A 4WFBQ 4TR1B 1SK2A 1ERWA 2DHSA 3KGKA 2R3XA 4OWYA 1SJFA 3QFAC 1QMVA 5KN2A 2FA4A 2M52A 5CYYA 4TVEA 1HYUA 4ZB9A 17GSA 2DITA 2I4AA 3BOAA 2M8HA 1Z3EA 3H8QA 4OMVA 2GZYA 1VQ6S 3A2XA 2U2FA 1SYXA 2MQQA 1K0CA 4ACSA 2KM8B 4UY8T 2P5RA 1NJIT 2BOPA 1A0RP 1NHYA 3QDNA 2F9JA 5KN0A 2JWNA 4EUYA 4K0NA 1WELA 2H70A 5DBQA 3LG6A 2AAWA 2XPDA 3RDWA 3DKSA 2H73A 4O5RA 1B7FA 2YWMA 3GV1A 4TU7A 5LSLA 1Q81T 1V98A 3RHCA 1U87A 2CVKA 1BYEA 2YWKA 1F6MC 4EVMA 3HI9A 4K8MA 3CCLS 1O0PA 1ZYQB 2DNYA 3P8WA 2XBQA 4MJAA 1R8PA 5F8BA
chains in the Genus database with same CATH superfamily
2AYMA 2OTLS 3KLIB 1K1SA 2NPFA 4F50A 1BQNB 3QR6A 2GQMA 3OTBA 2CNKB 2J7KA 2ALYB 4OHYA 1G6BA 2KXHA 5LXYA 1MTCA 3GX0A 2H71A 3RBXA 4WCEQ 4DR7J 1M5OC 4HI1A 4HVZA 2DLXA 2DC5A 3S7RA 3QWUA 3NMRA 1UN2A 3CCSS 1KQFB 3I87A 3V6DA 3ISOA 2XO6A 1Y5IB 5B0DA 2YKAA 3OPKA 1TXXA 4LQ3A 4J9UE 1G7EA 4JV1A 3MMBB 3CUNA 1GMUA 2FHOB 3Q8QB 5HANA 2DNZA 4Z2TA 1BXNA 2LRNA 3ADAC 1HD1A 2CFXA 4ZVQB 4PXEA 4YP3A 3KOAA 2RIIA 1Y6EA 1Y10A 1H0HB 3IM8A 2VFUA 2LQBA 4WXOA 4OX9F 4F82A 5G31A 4L72B 1GNEA 5IC6B 3NOFA 5HJXA 4NWBA 1YI2S 3JTNA 1IKWB 4O44A 4U8YA 5G4DA 2GVPA 1WHWA 3GLJA 3P90A 2IAJA 1XMQJ 1O8WA 3T5KA 1GNKA 3OLBA 2VOCA 3UARA 3V2UC 5C04A 1UEKA 3R9LA 2SXLA 1HQOA 4LSNB 1W25A 1ZCPA 2C0GA 2NPIA 3WT2A 3HLUA 1FXDA 2RAQA 4ZVUB 2ZM6F 5L1JA 3I4HX 2HZFA 2PU9C 1USBA 2H6XA 1ILOA 1LW0B 3NY0A 3T1AA 2A6OA 2CQ1A 4WFZA 2KFZA 3SV3A 1T4YA 2FHKA 1AUDA 3M8QB 3G6YA 2GMJA 4FYYB 4LFCJ 5KG0A 4CLTA 3KXOA 4POBA 1LXJA 5T7LB 2DGOA 4QU6A 4HT5A 2LEGA 3FCVA 1HW9A 3PKYA 4XK8C 4NZ7A 2ES7A 2MKKA 3CJRA 4WXWA 2MQOA 3AXMA 1PYTA 3DGVA 1PRXA 2MZSA 3QT5A 2KH9A 1BWVA 3NG8A 4PZVA 1J5OB 1NPRA 3ZFLA 2HSYA 2OGUA 4ANCA 2QLXA 2CPHA 1NK8A 2WW8A 2F1FA 2WONB 2F65A 3TJFA 2FLPA 2E5IA 5HMWA 4HZ4A 4IHUA 5J2NA 3FMBA 1Y5LB 1R27B 2OFGX 4MIWA 3NCQA 2RQCA 3A1YG 1R8CA 1R0BG 1T94A 3PX4A 2IBKA 1Q79A 2DK2A 1EP4B 2HHWA 2H54B 3AD7C 2M0GB 3K5LA 4QIEA 2YN1A 3VAHA 1M3IA 2NXJA 3I4PA 2F4FA 1A0OB 2V2GA 2D3ZA 2I1UA 2QO3A 4RW4A 1AXDA 1XR6A 5A76A 1G7OA 5HQ8A 2KI2A 4MPFA 3C1SA 1IWAA 1HA1A 4AGSA 4A48A 4TNOA 1BQMA 2IBOA 3PW7A 2J9DA 3JYTA 2LRCA 2GLRA 4OFTA 4HACA 4KGMA 2W7AA 5E4WA 1X9SB 1XW6A 1YX2A 2CUYA 4N30A 2J0QD 3G9CA 3W5XA 1U7LA 4B3TJ 2B1KA 4P52A 3KCMA 3C16A 1RCOB 3UVTA 1XBWA 2CPXA 4FXVA 4FVMA 3FMWA 2J76E 3GJRB 4RW9A 3W2VA 3JXOA 3IWXA 2RLIA 4PWWA 5F8LA 3OFGA 3UNYA 1RBOB 2QFIA 3GX8A 2KU7A 2LXIA 4F26A 2UUWA 4DG1B 4N0VA 3H5SA 4JR4A 4RJVA 1FNOA 3QWPA 2HBZB 5FWGA 4CTAA 1K9MT 3DI6A 4LBHA 1PGZA 5HBMA 1S5ZA 3PV8A 4IQAA 2MKHA 3GV7B 2K06A 3VI5A 5K8OA 6FDRA 2BJEA 1X8DA 1QTNB 3DMJB 3DVXA 4EFAC 1ZAWA 3POTB 2C3QA 1OE7A 2CV4A 3NBPA 3GU0A 5ETLA 3VGTA 4DLGA 1MD4A 1EP8A 3K5OA 2BYCA 5K14B 4CY6A 3UD3P 1HBOA 1WWJA 3GB0A 3PYEA 3UBLA 3MR3A 1X9WA 2VUGA 3MAAB 1EP7A 2VJUA 1X5OA 3GTYX 1Y25A 2RNEA 3MM8A 4GKJF 3M8RA 1S6PA 1WF0A 3PG9A 2R8GA 4QYRA 4WFNQ 1GTUA 3APQA 4R0JA 5FJ4A 4KE5A 2GW8A 1WC6A 3PINA 5F8JA 5CZXA 1IBMJ 4A8KA 2OSRA 1SUQA 5JVGQ 3T1HJ 2JJ4D 1A8LA 2LMIA 1SVDA 4ZP6A 3MM5A 2YXLA 3CJ2A 3VVUA 1YKCA 1VQSA 2VCTA 2FLNA 3KLFB 5IZHA 1EV9A 3OL8A 4PNGA 3IA1A 1FEHA 3G82A 5A8WA 5ETSA 2VFRA 2ZJQQ 1JJ2R 1YJWS 1IBLJ 4K50A 3GNJA 5DRKA 3TZYA 4U9RA 2X99A 3BPSP 5DGBA 2A2CA 4TLQA 19GSA 1X4BA 2DJ2A 1UFWA 4DQRA 1RKIA 2WVEA 4RUVA 5B08A 2XI2A 3FCWA 3CVKA 3PJ9A 1VC6A 1UFLA 1AZSA 3R5DA 3HFZB 3QMXA 5L71A 1ROFA 1Q8LA 1Y4ZB 2OTJS 4P74A 2BJ9A 4HLBA 1PO6A 2DVIA 5DQIA 4ZXGA 4J9RA 4JEDA 1MDJA 4G3IA 2LXFA 2NZCA 4ILRA 2W9CB 1R4WA 3D68A 2D3UA 1TKZA 2XYPB 5EWEA 4A8YA 2PVOC 3D7SB 4P71A 2GNKA 4F8RA 3LP0B 1FJGF 1QAJA 2M9KA 3M8WA 1U2FA 3M32B 5HR0A 4D3HA 1AQXA 3GSTA 2QMXA 4LLRA 3I6AA 5GMDA 5DQGA 2PI4A 1VLOA 4FS2A 4YFUA 1FA0A 1QM9A 3KK3B 3T1YJ 1F3VA 4DUYJ 1KC8T 4MMMA 2LQ8A 2PA8D 4AYBD 2MSTA 4EI2A 3GHAA 3BQ1A 4DPXA 2C2ZB 1ZMAA 1JJCB 2AKWB 4QR2A 1LW2A 3A2WA 1KVKA 3I32A 3K89A 5F8IA 1HMVA 3CCJS 1CC8A 4LF6F 5L39A 2MYGA 1HWKA 2OACA 2WB9A 3L9SA 1IJFB 1YRTA 3L3CA 4DEZA 1DTTA 1ZBTA 5CH7B 3C7MA 3NGTA 1UW4A 3Q74A 2N5BA 4KHRA 5ETKA 1FHEA 4POLA 1ZYPA 4I64A 1FXRA 5GADI 3LO3A 1MU2B 3L0HA 3UCZP 3C8YA 1PQNA 2W2OP 1YJUA 2V2KA 3FZ9A 4ECVA 4KAEA 3CE8A 2M7SA 3M2VB 1LFWA 8RUCA 4PGTA 3MWBA 2ASYA 3OT9A 4YAVA 3MEGA 1NDKA 2PUKC 1Q53A 4KDXA 2NXUA 4IG3A 4CY8A 3DC2A 4MPGA 1RT2A 1N34J 1N5SA 2MLYA 4LRBA 3GIIA 1XXUA 4ED1A 1QK8A 4DQSA 2IWTA 1SKRA 3IP0A 3GKNA 5DAKB 3U1MA 1CJUB 4LRCA 5KT4A 4Y3CA 2HVIA 1LWCA 3W64A 2IM0A 3U1NA 2U1AA 2XNQA 4UQGA 3C2PA 4UQTA 1DTQA 1XC9A 3EGZA 3FRZA 1M2DA 3LYKA 1K0TA 4IDKA 2UUCF 1HHQA 2VL9A 3DOLA 3GKXA 1TKTA 3RB6A 3IR4A 1OSDA 3SIPB 2X7IA 2A2RA 3W3SA 3GH6A 4O92A 4OD7A 3CC4S 3QGPA 2QKEA 1EQMA 2HFOA 4RL1A 1ZA1B 3OBIA 4KF9A 2HXKA 3B78A 2FZKB 1J9BA 4IRKA 1SK0A 2LEAA 4C8OA 3HHLD 4CLKA 4CDOA 2WULA 3ED3A 1Q8BA 4OCFA 2MSSA 4C4WA 4Z2UA 1EGRA 2XCAA 5F8MA 4GQCA 1K47A 4KGKA 2HLSA 3GE9A 1T03A 1BJXA 3IAS2 2XMKA 4LFAJ 2IM1A 3SQOP 4MH3A 4RBVA 2Y1IA 1CS4B 4CLSA 4G0IA 1I5GA 3WIUA 2MMAA 1HWIA 1VQ7S 1Q8IA 4K4WA 2A4VA 4O3QA 4PQIA 2V9WA 3UR3C 3TQEA 4B9NA 3CWJA 2KT5A 4WU2A 1N5TA 2B7CB 2PEBA 2I2YA 1F9HA 3D1QA 3QJLA 4DFPA 5JMNA 2VZ9A 1Y3JA 2X51A 1E6YA 4ZJLA 1S79A 1A8YA 2C0EA 4L5LA 4QIVA 2IY5B 4CT8A 4PAAA 4RO0A 4E98A 2JZTA 2X1BA 2ZHAA 4K4XA 2XY5A 5KFPA 4P2MA 3LQVA 1S1WA 5JVHQ 1WRYA 5DDOC 1D9FA 2D9PA 3AJ2A 3UI3A 3LF0A 4QCLA 1QDUB 2OE1A 1S99A 2VL3A 1PKZA 3EYTA 2VB6A 2WOMA 1TW9A 3F6DA 2CADA 5EHHA 1LU4A 4WFAQ 1N5YA 2FVRA 1RHJB 3KTLA 4LRAA 4PTSA 4ZVPB 4I7FA 3TCOA 1TUGB 4KH0B 3FR3A 4LF7J 1S0VA 3IMQJ 3LWAA 3DLKB 1G0TA 2JSZA 2WVDA 2ZH1A 2K8VA 3R27A 4O0IA 4MCUA 1SB6A 2W8KA 1G7CB 4I68A 2NBSA 1V2AA 3JAMU 5F0WA 3RPPA 3GN3A 4CYUB 5KFGA 1OPIA 2IFQA 4URGA 2GIFA 4K8RA 4X2BA 4YHHJ 1YJ6A 1X9MA 1ZL9A 4LIWA 4IOBA 2HMIB 5D4LA 2IMEA 4OFZA 1FKAF 1S1UB 3DRSB 1XNQF 4IJ3A 1FKOB 4RBTA 4J9NA 3CSKA 2V2QA 3KJFB 3AD8C 2IC3B 1FEEA 5DALA 2EIOA 3I0SB 5AN1A 4OX7A 2DIZA 5CRWA 3DOKA 1EZZB 3CCRS 2ZH7A 2FLLA 4KTQA 4V1Ag 3C6UB 1FRMA 5D15A 2GZPA 4U6PA 1VRUA 3MDFA 1WWHA 4R5PA 3FUYA 2LUSA 4FQUA 3EU3A 4MK9A 1OC9B 4ELTA 5COHA 2RF2A 2B9XA 1OY9A 1QE1B 3CDUA 2GQQA 3DGPA 1VBZA 2C2RA 3SFGA 2VCZA 3KK1B 2GQ2A 4P6QA 3U6VA 4YR0A 1KN6A 4ISDA 1SL2B 3GMGA 3H5XA 3P96A 2AF6A 3ZZTA 5J1EA 4NA3A 1GSSA 4X64F 1AUCA 2ILYA 1RW1A 1NK5A 1AIUA 2YNIA 3UEMA 5H5SA 4MK8A 1WEZA 3D3BJ 1IR1A 3HSDA 5FDLB 2MYFA 5CRHA 1RAJA 2XS5A 2G4BA 2LU2A 2DH8A 3I43A 4EDZA 3OHAA 5IXUA 1SV5A 3GPAA 4CLLA 1U6TA 1VGYA 4AL7A 3AY0A 3KUHA 3HKZD 1TAUA 4PG4A 3BR8A 5KFLA 4A8QA 4WP8A 2V6KA 12GSA 1K44A 4I67A 4QL7A 2VG5A 2OD6A 4C98A 2MPUA 3GWCA 1V9WA 3SSRA 3LW5C 1CQHA 3TJBA 1TMJA 1VR6A 4FYDA 2L5LA 1RWVB 1U2RA 3PNIA 4CO4A 4MZBA 1VF4A 5E59A 2H19A 4L73A 2LQQA 2HFUA 2ZVSA 4KGZB 4YKFA 2HKEA 1QUVA 2OKQA 2DRBA 4PXCA 3GURA 2H6ZA 1YEXA 3F4TA 2J6SA 1BMQB 2HLUA 1PAUB 4QIWD 1O5JA 2R8JA 1BLUA 3IS9A 4ILFA 3KLVA 5INYA 1ZAXA 5L1KA 3T9ZA 3MR2A 4XS6A 4FVCA 4UW2A 3KLIA 4DX8H 4C0OC 5GAHI 1ZOFA 2LQOA 2LYVA 3F4SA 1BQNA 3LPEA 2UVRA 1FT8A 3MDKA 3G71S 1IM4A 1QAYA 4F0BA 1JLEB 4NZ6A 1RQMA 4P73A 1YY7A 4QU7A 1I9DA 3I9ZA 4XCSA 5ECSA 4RU9A 2QIFA 3HHLA 1DURA 1ACMB 3M8YA 3GTUA 1P6TA 1UETA 2E29A 2AJ4A 2J9CA 1BHNA 3MMBA 5ECIB 4ZCIA 4DV2J 3CXCR 2A2SA 2R7RA 4NXIA 4U96A 4BVYB 3OL6A 3W7BA 2BKOA 2CQ0A 1RLDA 4Y28C 1WIKA 4CO3A 4GC6A 4GKKF 5B0BA 2W2MP 2ZDPA 2YQ1A 1IKWA 3G8QA 1FD2A 1BQ7A 2FC9A 1FHTA 3VWUA 5D93A 5L38A 5FD1A 4POMA 5J2PB 5KFDA 4X4VA 3P4UB 4P2FA 3LGHA 2MLZA 2O1PA 3FYGA 4LSNA 1KVJA 5IT0A 1XZOA 2B9WA 3CDWA 1EX8A 2VLTA 4NHZA 4X1UA 1TVRB 3HFVA 3T6JA 3LYPA 1OAZA 1D9DA 4GRFA 1N8JA 2DGUA 4WR5A 5A5KA 1HBMB 2R37A 3C66A 2X3DA 3KK2B 1PG5B 2GT6A 3Q89A 1T9WA 4WBFA 4ED7A 3M8QA 2VAFA 4K1FA 4KT0C 1V57A 1TUVA 4J9OA 3OD2A 2DRDA 4ELUA 2IL3A 1I3OB 4EGLA 1RYRA 5T7LA 2FWEA 4C7QA 5LD0A 2UUTA 1XN9A 4KX4A 3RGIA 1A7GE 1X4FA 2A6MA 3CJKB 3Q8PB 3TVKA 1KLMA 3PYDA 2ZHBA 5DG7A 2R7SA 3QJPA 3LP1B 2J7UA 2R42A 1F2HA 5DG8A 4ZVTB 2B5JA 3WD6A 1JXLA 1KP6A 1X4DA 4IYQA 4DR6J 4Z7XA 4K4UA 3ILOA 1FFSB 3HZ4A 3SEOA 1KNGA 4PWUA 2WONA 4PXDA 4Y65A 1RWWB 4BA7A 5B7CA 3JQKA 4MLYA 1YQ1A 1PL1A 1WHVA 2R7UA 1RB0A 4X62F 3KLGB 1ST9A 1DY3A 13GSA 4O5UA 1YRUA 2GAHC 3H20A 4NCGB 4ZLPA 1M1GA 4LT6A 2LDIA 4D73B 2AYEA 4ZMMA 3L09A 4PPZA 3FR6A 1X7VA 2CVEA 1HR0F 4MK3A 3G4SS 4ECZA 2D3OR 1T05B 1JLVA 3Q8YA 3TRGA 2F9DA 2RVJA 2OPRB 3W6GA 3CJQA 4OV6A 4H4MA 4NXMJ 1S4FA 3OUYA 4W92B 1NSPA 3DHWC 3IA0A 2TRXA 3TAMB 4OYWA 2FC8A 2CZ3A 3GA4A 3A4TA 2NPBA 3TRPA 2BBEA 5D9VA 3F63A 2W9BA 2L57A 3HJFA 1J2VA 3KH9A 2L08A 1NK4A 2HK3A 2HQCA 2KVQE 4DPUA 3AY8A 3H98A 4XDCA 2MKCA 4N41A 2CG4A 2QC3A 2EFGA 3ONQA 4FO5A 4RNHA 4Q45A 2MHEA 1NW2A 3CB4A 2HHPA 1WMJA 1NAQA 4NCAA 2IYIA 3EVWA 1HNZF 4TRXA 4ICYA 2JOQA 2QA1A 2AGQA 1X0RA 3F56A 1AXQA 3KIJA 4ZPDA 4CWBA 5C24A 2H5EA 4KIAA 3BKFA 5D4OA 2GV1A 4UZBA 1OKTA 3SMZA 4I6AA 2CVIA 2H9ZA 3M1VB 1QUWA 3DLEA 1IKXB 2D9OA 4QWCA 3IRWP 2R9LA 2MTLA 1GNWA 4W4MA 3R2QA 1HNWF 3POTA 4FIWA 3QLHB 4JI5F 2V2VA 3PHEA 1FK9A 5J9CA 4HT7A 2GZZA 4ANEA 3HHEA 1J27A 4J9LA 2UVWA 2B7BB 4KHMA 3ZO7A 2A2PA 3O76A 1MWQA 3LH2S 3IRXB 4EBEA 5D3GB 1OPZA 3MAAA 5F8HA 4N10A 1JWWA 1K3YA 3MEDB 1NHVA 4PUOB 2MBSA 2G2YA 2W1BA 4WU3A 5IWAJ 1ZZYA 3QOUA 2VQFJ 3TI0A 1MSWD 3NZNA 1YG0A 3PZPA 1KD1T 1S49A 1NK7A 1SPBP 1EZKA 4TYAA 3VTIA 3ZMLA 4QIFA 2HFSA 3I82A 5DJMA 2REMA 2ZBCA 1PYOB 3HSZA 3BO4A 1SU9A 1IKYB 2V34A 1SH2A 5CXTA 1U1QA 4ZPBA 3LUYA 3A8JA 1NH7A 2G0CA 3O6QA 1WOPA 2V4JB 2H4WB 2YNXA 1SIWB 1RDRA 1CC7A 2LVWA 5HO4A 5EY6A 1VQ4S 3OVSA 4OX8A 1SJIA 3QPMA 2GS8A 4NRUA 5E3AA 2AJQA 4XIHA 4FKYA 3Q2SC 3JSRA 1JLQB 3BGLA 1WG5A 2BE2A 3NS7B 2JDJA 2C2MB 1UCNA 3UN2A 3G6XA 5D9WA 5G30A 3HHNB 2UP1A 2QMWA 3ZFBA 5E33A 4U67Q 3BBFA 2CWXA 4ED8A 3CSJA 1O81A 2W9CA 1TKXB 1C4CA 4PXOA 3MM7B 2KG0A 1GXTA 4BPYA 3LAKA 1MW7A 3VAJA 5A0YB 2EFOA 2DGQA 3LP0A 3QCPA 2GC8A 1TRSA 3M32A 1D09B 4ZS6A 1XQIA 5DCHA 2HZAA 3RPNA 1GSDA 2HRFA 4FBUA 1WG1A 1TTHB 3TUEA 5K8MA 3ZZRA 1OC3A 2PO4A 2IHR1 3KK3A 1D3WA 3BSAA 5KFXA 4RBUA 4C8KA 5KFNA 2UV8A 2E0QA 4FYVB 3ZTOA 3KTBA 1VCTA 3LP2B 2LCWA 1ZPWX 3R6GB 3WT1A 2OEMA 2BJXA 1HYSA 3TJKA 3KLHA 1KTQA 3E3XA 4LL1B 2KT2A 2R8KA 1RZMA 2HQDA 3IGNA 3T5LA 1FXLA 1NHUA 3NCRA 3CMES 3KHGA 4O4GB 1JQGA 1IN0A 1FWLA 4NYOA 2V94A 2JZ5A 1JLGB 4E0DA 1FFWB 4USWA 1UPPA 2Z2YB 1YSJA 1MU2A 2DNHA 2K1RA 3DIEA 4AD6A 4FNHA 4DR7F 3OVAA 1R7IA 3FKBA 3H59A 3M2VA 1ZYEA 3NOGA 5EWFA 3C15A 1KEKA 2R7XA 4MJBA 4I6YA 2H5IB 2HQFA 4KCAA 2WGRA 1WC4A 3G6VA 4X65J 2IA6A 1WOUA 3PCOB 1XOAA 4P9SA 3D67A 2BE9B 2Z57B 1QJHA 5KFBA 3QD9A 2VBXA 2P9CA 2WK4A 3GYXB 4ECYA 5B0FA 4CLFA 4GVBB 2WS2A 5DAKA 1VLYA 3U27A 5HATA 1NHOA 2IMWP 4F04B 4DS4A 3OR1B 2GX8A 5HK4A 3VAGA 5BRTA 1X0PA 1HW8A 2W9AA 2LA4A 2BXJA 5GAPD 3VI7A 2DO4A 3UVJA 1XMQF 3KJQB 1UEUA 3NGSA 2P6SA 3HP6A 4OHZA 4Q7AA 4OI4A 1RI7A 2R2UA 4EO3A 1RT4A 4F2RA 1RT1B 4MF6A 2DRAA 4CH1A 3GIMA 2H72A 3F3RA 1M5VC 1PKUA 2XMTA 5T41A 1D9AA 1ELOA 3A5WA 4YN3B 1VQYA 2E2GA 2G0JA 1SD9A 4M1KA 5KT2A 4CDIA 2R7WA 2J6UA 2Y8WA 2DXFA 3BGRA 2IPAA 4EIQA 2QC7A 1XWAA 1YEPA 5KFWA 3GONA 2ABYA 2LRTA 1I6JA 1AT1B 3DRYA 5AE3A 5MLCV 1ZM3A 2M80A 4LFCF 2AT1B 2HGNA 1H73A 1HHSA 3QATA 4F4YA 2PD1A 2R2RA 4DCOB 4RU2A 4WFBQ 4MFBB 2GVDB 4OWYA 4CM2A 3VQTA 1CS4A 4NLYA 2NSBA 3E01B 2GAGC 2IRXA 4KKOA 2U2FA 1K0CA 2KM8B 4LF5J 4Q43A 2DCUB 2HNYB 1S9GB 3AH6A 2BOPA 1NHYA 3QDNA 5KN0A 2VU5A 4EUYA 3DNCA 1FVSA 2VH7A 3FBCA 4IQMA 1U26A 1T3OA 1T3NA 4C8MA 2XPDA 5F8NA 1B7FA 3CO9A 4TU7A 4GKJJ 5GMEA 1ZM2A 1V98A 2YWKA 3ILIA 3UQSA 3QSYB 1ZYQB 4B02A 4BHQA 4NRTA 3P8WA 3UDVA 1T7PA 4I69A 2RDJA 3PRDA 3TNVA 1V6HA 3M05A 2F40A 4RKUC 1D8ZA 2V68A 4CO5A 2XS2A 4BWSA 5A4WA 3RAMA 1JMTA 4ZILA 3VWWA 2DO0A 3PH9A 1RT3B 4TW5A 3N5BA 1RWMB 2PEHA 4DSLA 2YQ3A 5IV3A 3PM9A 2RUEA 3OHBA 3Q83A 4B3MJ 1VIOA 5KFJA 3VCDA 1QUPA 3ENWA 4MKVA 2HURA 3IN5A 2DT9A 2ZVIA 4FYXB 4NLQA 1T00A 2WCIA 2JL4A 3HHLC 1B0TA 5ECQB 4LBIA 2VIMA 2C1EB 4B3TF 2H65B 3TUPA 4C3KA 3CJ4A 4YS2A 3J81j 1JZRA 1WDTA 3DDIA 1N6QB 4GMKA 1R43A 3BV8A 4UTGA 2XLIA 1K8AT 4BIKA 1MNEA 3RUBL 2IC3A 2H1GA 4DU7A 3H79A 2JLFA 3I0SA 4EIPA 1Q86T 1VJQA 4ZPAA 1OWXA 2ZC4A 4GO7X 5A8RB 1F2GA 3C14A 4ECIA 3HVRA 4C8YA 4DZDA 1OC9A 4ED5A 4F0KA 2DHAA 1QE1A 3QBCA 1RHRB 1C0TB 1IUJA 1WC3A 4IQXA 4J7CA 4CNZA 5K9FA 3KK1A 2XZDB 1TOFA 3RG6A 2AJFE 4KPCA 2W7OA 2JRSA 4WP3A 2OBKA 2PPTA 2NYHA 5ECRB 5KFSA 2BR0A 1X5CA 1REGX 3UL3A 4O3OA 1ERTA 1X4EA 2KHCA 3M4XA 4LR8A 2VLVA 2V67A 1NJXA 2PBJA 3IK7A 1F0XA 2LA6A 1SL1B 3OR2B 2XI3A 1WTBA 1M9AA 3OQ2A 1FWKA 3J7Yk 4PYDA 3JQMA 5J4UA 2YV7A 1VHFA 1W26A 4A5PA 4W90B 2UUAJ 1TL1B 1IBMF 3T1HF 1U2CA 1S0MA 2G1DA 4XTSA 5JUMA 4AFFA 3VAFA 4HH0A 1X4CA 4YB7A 2DBCA 2WZ1A 2HE3A 1YBUA 5J9BA 2F8MA 4WE1B 3RRKA 3ERWA 1IBLF 1S3DA 1R7HA 2KN4A 3M2RB 3F0NA 4DV0J 1SJ4P 4ML1A 2LEPA 2RB7A 3HFKA 4ID0A 2UXBJ 2QL9B 6GSVA 2YH0A 5IC4B 3HVVA 4NX9A 2GSQA 3D54A 2AIRB 4WK3A 4EUVA 3IE3A 1VK3A 2VL2C 2BRLA 2VCVA 2FGOA 3H7HB 2MKJA 3HCZA 3M0FA 1JLAB 5F05A 2HSHA 4E8EA 1TL7B 2XQCA 5K8PA 5B6NA 2CG8A 2RHSB 1Q98A 1VQLS 2DSAA 5E41A 3SFUA 1PC5A 4OJ1A 5G1KA 1JLEA 3I5CA 1OIAA 4Q5RA 1SD8A 2EFVA 1F5BA 1GMWD 5KFOA 4DXLA 2B6AA 4GC7A 4G0LA 1QVFR 5HQPA 4CM0A 1F5CA 3FC9A 1YJRA 2DD8S 1U25A 2XHWA 2ZOGA 3EE3A 3ELHA 1MROA 2L9WA 2UVUA 2E5LJ 1R6YA 2XY6A 1SKSB 4FPIA 4Y2KA 4WKRA 2CQIA 4DUYF 4YDXA 1WJKA 3CIMA 3RW7A 2GQCA 1NK0A 1PJ6A 3K57A 2DPJA 5BJRA 1JNZB 2HNZB 4NLSA 2CDRB 4MH8A 3W8GA 1VQOS 3H2LA 1F1BB 2VONA 1WKLA 5HL7Q 2F8HA 3MCOA 2QSIA 3TZXA 1OC8A 1JK9B 3DLHA 2IRUA 2LLZA 2CPYA 2AJ0A 1J0FA 4PCQA 4J9QA 2GJ2A 2QX0A 2PIIA 3T3FA 1KOHA 2XM3A 1KQGB 2FJEB 3LEFA 4Z37A 2LQ9A 4NV2A 4YB1P 1P27B 5LL6d 1TL5A 2CT6A 3GIJA 2HS4A 2C2EA 2XMWA 2YCDA 4Q0BB 1HBMA 2KB2A 3K5PA 4OI2A 4K0GA 3N5OA 3ET6A 4EEYA 3KK2A 1QAIA 4JI0J 1WP0A 2UZ8A 4JI8J 3IHQA 3VAIA 3EVMA 1S6QB 1RHUB 1HBUB 1L3TA 4ETZA 2BX6A 5IMDA 1X5PA 4ZVFA 3IR7B 3BH7B 4USMA 1RWOB 1TTZA 3LP1A 3KUGA 4C8LA 3FFIB 3A12A 1RAFB 1NMEB 2IDLA 4KO0B 1FKPB 1WOSA 3B82A 2J6TA 4YR3A 4WBJA 3W63A 3QGHA 1XWBA 2RQKA 2YNGB 3E3EA 4QPXA 4I97A 4DQPA 2IJNA 3TZWA 5J3RA 5FLXU 5M2UA 4I6XA 4ZVRB 4USVA 5KG1A 2XMUA 2Q6BA 1L3UA 2BQRA 1KBRA 1VBXA 1L3VA 3KLGA 4N7TA 3C6TB 1CJTB 4HDHA 4TXOA 2AGOA 1B64A 1TP9A 2P5QA 1TZ0A 2XHCA 3PYGA 3HKRA 4HI7A 1K0BA 4WIIA 3W8PA 4D73A 3JQJA 1RHKB 1LWFA 5ECOB 1R3NA 3HT3A 5KG4A 3TWZA 2B3TB 5J2MA 3PRVA 1T05A 2ZHOA 4P72A 4YB6A 5K5MA 3UD4P 1JZDA 2OPRA 4LFAF 4C11A 5ETVA 4ZPVR 3TUIC 2I3YA 3VALA 2HVZA 4JU5A 5F0UA 3JSBA 2E7WA 3S1TA 2IVFB 1ZH5A 1EGOA 5E7OB 5U47A 1FTRA 5KFHA 4K5SA 3ZNJ1 1FDAA 4OI1A 1U3AA 1V40A 1GXLA 2OPSB 4CO1A 4QYZJ 3PVXA 3M2UA 3DRXA 2FJXA 2YPYA 2VPWB 3H42A 4ED6A 5A8KB 1RAAB 5G5EA 2CIMA 3UPFA 2F8EX 3U5RE 2XYHB 4K7NA 5CQGA 4ZHRB 1FX2A 3CD7A 3PGTA 5KG3A 4MYUA 4LA1A 3UBKA 1A6LA 1C1CA 4WK1A 4ZN3A 4PPDA 2Z2ZA 2V4QA 3MPDA 3LWLA 1ZYNA 1MN9A 3W62A 4USSA 3P5TL 2D41A 3DOMB 2GMLA 3MWHA 2G2QA 4IFVB 1NHKL 1EV4A 3F44A 3HCXA 3PEJA 2HHSA 1SENA 4Q5NA 4GVLA 3TA2A 4ZBBA 1SC3B 1P9QC 2DBBA 5D78A 5H9FK 4M5KA 4J9VA 2XBIA 4OFNA 2H0GA 2JEJA 4HEA9 2P0GA 4LF7F 4GQFA 1IQTA 1JLBB 3SCIE 3QLHA 4EK2A 2Y0SD 1YK9A 2I9HA 1NK6A 5H5QA 4HTIA 3O6TA 4AL6A 4K6XA 5C25A 4V19X 2DR8A 5C42B 2GT5A 5D3GA 1VOMA 4NL5A 3T41A 1ZAVA 4YHHF 5A4UA 3EDRB 4ECWA 3PJWA 5GSTA 4PUOA 1U02A 2ZH8A 5HAOA 1VMBA 5ABRA 3HVTB 4B3SF 1WKKA 3H4DA 1WHYA 1TV6A 4WTOB 1OYDA 3MCSA 3D0ZA 1NM2A 4Z2RA 2UXCJ 3CIZA 1G2EA 4RWWA 2PN6A 2YANA 3R1LA 1PIEA 1UJ4A 4ED0A 1IKYA 3V4IA 3HJPA 2YWWA 3N5FA 4N8OA 3DXBA 4IN0A 4F2SA 4KUNA 5GSSA 2J7WA 1B8XA 2V4JA 4MDCA 4WEYA 1KTEA 2MQLA 4Y2IA 5I3UB 5KG5A 2ERRA 3I0RB 4ZPWR 4NXNJ 1Y3KA 5G0RB 2RSQA 1SQEA 3TKPA 2OLWA 2OE0A 1XCCA 2EC2A 1M0UA 3DGQA 4C8ZA 4GKKJ 2BE7D 4ZLLA 2WW4A 2Y3YA 2C3PA 4D3GA 1DSBA 3V4MA 3HVXA 3S6EA 2QYCA 5THWA 2A18A 4V2MA 2B7KA 2RRNA 4MK7A 4WFYA 1O85A 1RYSA 2MLXA 5DQHA 1M7TA 2HRKA 1U0HA 3M1GA 2H66A 2OJ3A 2N5AA 1UP1A 2IFXA 3TANA 1SQGA 2QE5A 3MMAB 1T9UA 1OS5A 1AB8A 2BANA 2TRCP 2NCKL 3AQOA 2E9TA 1NLKL 3NAHA 1RT7B 2DY9A 2B7JA 1Q95G 4LSLB 4F0HA 3UW1A 3ZZ0A 4NWYA 1C2PA 3LXZA 1JJ4A 2H0IA 1H72C 4F36A 4K4TA 4AT1B 5BR8J 3D0GE 4WWSA 3U1LA 1TFWA 3ULHA 4IBPA 2OHDA 3J80Y 2E1MC 3HMJG 1BG5A 3CJ0A 5CCMA 4XS1A 4KFBB 14GSA 4BC7A 4G1IA 4A8SA 4QW8A 5HN0A 3GKMA 1IR0A 3PTWA 4B9SA 2V4RA 1FJ7A 2VCQA 3I9V9 2W8LA 4H86A 1RXOB 2ZBPA 3TJGA 4JP8A 2HYXA 3TUJC 4DHVA 1VF1A 4MF7A 1Q4JA 1FW1A 4DBQA 2HZCA 3OSPA 2CVDA 4J90A 1UC7A 4O4GA 2HVHA 2FLOA 3ZITA 1JLGA 2FWGA 1YKAA 2M46A 1SH0A 1GLPA 5DM7Q 4K9ZA 2GIQA 1RAGB 4JBCA 2FD3A 2D69A 3EZUA 3DRPA 2BQUA 5LCZA 3ISND 2B5YA 5KFFA 4QWEA 4DL3A 4R8UB 2LJAA 3IBHA 4ZL7A 1L5UA 3M8SA 1S76D 4LIRA 1V5IB 3LXTA 5HFGA 2CWKA 3ZRDA 2RKIB 4S0MA 1WHXA 3E8OA 3V6KA 4ECXA 1PL2A 2RDIA 5D0RA 2CX3A 3KYLA 5CHCB 2PDAA 2JU5A 1AC1A 4WP9A 4F9ZA 2ZKUA 4G0KA 1SL0B 4H4OA 1I51B 2F7VA 1PN9A 1LEOA 2HBQB 6GSSA 4ZOSA 3V5RA 2L5OA 4AJ8A 1JLCB 3CBUA 3FEXB 5ECKB 3MM9B 3QIPB 4B9UA 1RT1A 3LW9A 1S72S 2WSEC 5IMCA 1Q7LB 4OLOA 2RMLA 1YJNS 5L1IA 4DV5J 1U1LA 3MMJA 3GR1A 3GYKA 2FJBB 3N6LA 2IJFA 3F41A 2XSJB 5A4VA 3K8VA 2W2QP 2HEKA 4LRFA 3GV8B 3T6BA 5DZ6A 1VYAA 1NCLA 2P2CB 3LORA 4X4PA 4F4XA 4DSFA 2ZE2A 1S0OA 1S3CA 1F3AA 4IO9Q 2YWOA 3V6JA 1YRXA 2IPOB 5C2CA 1M1HA 1OVNA 2FJAB 4XIUA 4MFBA 1GT8A 5BYRA 1RT6A 1RTIB 2BJ1A 4YY3J 4IELA 3JB9k 5B0EA 4KY3A 1FG4A 4L3NA 3TKRA 1Z6MA 2GGPA 3E01A 4O5QA 2VICA 3H1NA 1XVQA 3D22A 1GRXA 1HBNB 1KFSA 3OXGA 4DR6F 1V9OA 3EXYA 2UU9J 3S01A 4ID5A 4N56A 2CPDA 2HT9A 4M5GA 6GSWA 2KL8A 3QT8A 5ADZA 1YF1A 5HR2A 1WD6A 2B4PA 2RJZA 3ME7A 3MEEA 4DF4A 2W7PA 3L4BC 2FYXA 1SJ3P 5B7WA 3TAQA 3C73A 1ZYQA 2Z58B 3KMSA 3V6HA 2ZNMA 1SKWB 1AW9A 4OHWA 5ECMB 2NVLA 3TZZA 2L3MA 3A5IA 3SQGB 4B9VA 3ZZXA 3ZZYA 4TN8A 1U48A 3KDOA 4V2LA 2ROGA 3HSJA 2J9EA 1RTJB 2YX7A 3BN7A 1FDBA 2CAIA 3K59A 3UN3A 5CYMA 1SBRA 3G8SA 3KNGA 2HSMA 4NXMF 1HI0P 1RU1A 1W89A 2CQ3A 2ACMA 4WETA 4C97A 3K5MA 1YBTA 2DNQA 2XG8A 3OFHA 3E0UA 2LNSA 1BGXT 1FB0A 4WTYA 4PABA 5GAHU 2LDYA 2YNHB 2GSTA 1WC5A 5KAKA 5M2RA 2DR9A 1PBUA 5IQYA 4DSIA 3GIXA 2DNPA 3IG1B 3RW6A 1GXUA 1U6ZA 3QRRA 2XWXA 3L78A 4YQVA 2E66A 4TOPA 2Y8YA 1N6QA 2JZRA 1XMOJ 2B8QA 1NH8A 4JE1A 1U09A 1TRVA 4ILLA 3Q2TC 2OEJA 3LGNA 2YKMB 3HO1A 2V69A 3G6ES 4IO1A 3KEBA 4N8NA 2GTUA 2VQEJ 4KCEA 3KG4A 4DV1J 4BL7A 2AJ1A 4ERDA 2AD9A 5A8RA 1KQSR 4ZB6A 4MKBA 1RHQB 5DETA 3EM1A 3MPUB 2PA3A 3BM7A 4KV8B 4IS0A 2QV6A 3DYAA 1C0TA 2Z30B 1GSFA 1ZZFA 1WSRA 1M5PC 3EINA 1DQ9A 2B9YA 2JNJA 4ZCLA 3R5CA 5A6WA 1S7IA 3B6BA 4ETXA 6FD1A 3P2AA 1T95A 4P7VA 2RQMA 2H0HA 4M95A 4XRAA 1JB0C 3UO0A 1OJ4A 4OLPA 2JX2A 1N4LA 1AFJA 3BF4A 5CREA 3IXQA 2M4MA 4CT9A 4DL4A 3MURP 1N56A 3KHHA 1B4PA 3C1RA 5B6MA 1SL1A 1UVMA 2DGTA 2AX0A 1K1QA 3ZZZA 2A2DA 3BQ2A 1HNCA 5IWAF 1FJEB 4QYZK 2VQFF 2AGPA 4JV2A 3DEXA 4HYKA 4GF0A 1ZPVA 3R7BB 2AQ4A 4RW7B 1TL1A 1B4SA 3MAQA 1SYRA 1RWKB 4DV3J 5L9NA 4ECSA 4OJHA 5B09A 2EC0A 1E2YA 1DAXA 5CAAA 2IMKA 3IV4A 2CPJA 3GJSB 3IC4A 3NWGA 3ITHB 3GG0A 4IP6A 2WHOA 4NLDA 4F0MA 4ZVSB 2AW0A 3DFEA 4OX6A 3TVYA 4I2PB 4G1QB 2HHVA 5HLFA 2C1YA 2EKYA 4CZCA 1SC6A 5GAGU 3K8NA 3OTOJ 2X1GA 3MAKA 2WJUA 4NMXA 1FDDA 3MCMA 2EFNA 3AB2B 2PFFB 2KLXA 3A3PB 2HHUA 4PQHA 3D0IE 2R2TA 3CTGA 1JLAA 1S7HA 5FIIA 5IPGA 3SV4A 1N52B 1TL7A 3CTFA 3TP2A 4G19A 2RDDA 1HQ2A 4TY8B 4FKXA 1XVWA 1R89A 5LXRA 3NGDA 3FJ2A 3EJMA 3NWRA 3BSOA 2AHEA 3IDVA 1F9MA 1CLFA 2WTFA 1HPZB 3SI8A 3BO2A 1LQ9A 2FDNA 3IO1A 2DXEA 3EPIA 2VCWA 1XEZA 3FEZA 4FZVA 1LFPA 2W01A 1Z2LA 3VK9A 2ZH9A 3L9VA 4IKHA 3AODA 4DV4F 4ZP9A 4ECQA 1N54B 1I1GA 2C3OA 4OZ1A 3VAMA 2K6VA 2KG1A 2EXUA 4MYTA 2YNFA 1LK7A 4OL8A 3SBMA 3RU0A 3KNAA 1VS3A 4H4KC 5CD4A 1APSA 3GSSA 4IFYB 2KFNA 4ITSA 5C7PA 4GLTA 2EI5A 2VF3A 1X5DA 1M9BA 1VQKS 5ETTA 3TUZC 2DB1A 3V6DB 4KH7A 2CNLB 4K0KJ 2VIHA 1VQPS 5H5RA 2DJ3A 1NKEA 2PGCA 3K0JA 3FNNA 2GQKA 3OXLA 4DX7A 7GSSA 3MNGA 1HNAA 4Q0BA 2JHEA 1P1TA 2OEKA 4IOCQ 3HF5A 3KM6A 1HARA 3S9FA 1U3IA 3R2CJ 4ZLJA 3W8SA 4X65F 3N6MA 1TK8B 1RTHA 4GTUA 4EE0A 1HBUA 2IAJB 1HNIB 2JH3A 4ID8A 4Q2MA 4KYZA 2PT0A 3O1LA 4DUZJ 2IMFA 4JRRA 3WGDA 3D5MA 1N33F 1RJJA 3BCIA 1C0UA 2LTKA 2VKRA 4YDDB 3MI7X 5HFIA 2FHJA 3FFIA 3FEUA 3D1OA 3G9BA 1G3OA 4DJBA 3IR6B 3K17A 5F0GA 3AAWB 2EBEA 5HVHA 2CJQA 5EX3A 2GHWA 3CEDA 2YNGA 2G2ZA 3GFKA 5B8AA 1TL4A 4NLGA 4X43A 1XTZA 5DZ7A 1BE4A 4IP1A 4F67A 5KFKA 2C4JA 2G0IA 4ALZA 2CKWA 4Y0FA 3H5YA 3CDEA 3LPYA 3C6TA 1PD21 3W61A 1CJTA 4UOFA 3RBTA 4F2IA 2AZ3A 1R5PA 3NS5A 2IA0A 4KSOA 2V50A 1IQZA 1C72A 3DMLA 4WF5A 1S57A 2OA7A 2RUGA 1GSYA 3EICA 4HEA2 2QA2A 2CXEA 3ZZPA 4DPTA 2TIRA 3E9JB 3EGWB 2L41A 3L7UA 1BC6A 2FVQA 1XK8A 5IMFA 1GFWB 2HNDA 2QMUB 2CJXB 1QQ2A 5KFTA 5FT3A 4PQUB 5IT9Y 4ZVHA 2YX1A 2ON7A 5IO0A 5J2NB 1LWEB 1FWPA 1RU2A 3AOAA 2HRYA 3B4DA 4LF5F 2ZZNA 4JR6A 2VPXB 3OLAA 2W2PP 1XG8A 2K9FA 4BLGA 1NDPA 1KNZA 1GH8A 2RU3A 4ZLNA 2FNOA 1UVLA 3PO5A 4HR2A 3ZFVA 4AF2A 2QZ8A 2FJDB 1PILA 1F3BA 2OPQA 4X84A 4RW4B 1ABAA 4RW6A 2H5JB 3X1LB 3RR7A 4M5NA 3BD2A 4F03A 4OIXA 2DEIA 3D6HB 3R5JB 4Q5VA 2X1AA 1A2JA 3DOMA 3PW4A 1YVFA 4ZKAA 1UA0A 4IFVA 1KHVA 1BQMB 3BB5A 2CA9A 1NB7A 4IG0B 4JB8B 1M90T 2EBGA 2DH9A 1EOHA 2N3OA 3N9JA 2J0SD 4NCBA 3DRRB 2QLFB 2R6KA 4A8WA 4MKAA 1RAEB 3P7XA 3MUVP 16GSA 2YJHA 3H40A 4KQZA 3MR5A 4B3MF 4QQBA 3W8JA 1Y11A 4RW9B 3OL9A 1UA1A 2HZEB 4TVAB 1J5EJ 3HA9A 3CD0A 2MHNA 1ERVA 3BJYA 4KNDA 2EK1A 1HFEL 5C42A 3UD5A 4KAIA 3BDPA 4CTAB 1B70B 1RK8A 1S1XB 1NSQA 3HVTA 1CJKB 1GH2A 5C5JA 4WYLA 1NUEA 4K2XA 2AU0A 3TYTA 2WB1D 2OUGA 4WKWA 3HVNA 4ER8A 3P3DA 1KR4A 2AP6A 2ROPA 2WVFA 3RTVA 4X66J 5AT1B 3RAQA 5A6PA 2DHGA 5JCGA 4I4BA 1HBOB 3O5TB 2D7SA 3CMAS 1RADB 1U24A 3I9V2 2N82B 2QLBB 2B4OA 5I3UA 5SUHA 2EVZA 1XWKA 4ZL9A 1S6PB 2AHOB 2GGTA 5G0RA 5L8RC 4Z7YA 4UUXA 4RR5A 3KGKA 2R3XA 1SJFA 2FA4A 1I94F 3GCXP 4LQ9A 3ZZOA 5B0CA 2GZYA 1EJ7L 3A2XA 5IT4A 3MM5B 2Q1LA 3QFWA 1SYXA 2MQQA 4FF4A 4EBDA 3Q8RB 1NJIT 2V8VA 1B0VA 2F9JA 1GX5A 2JWNA 4K0NA 4NMLA 3AQPA 1AUSL 3GIKA 1NKCA 2FGCA 4P7TA 3MMAA 4JV5J 2AAWA 4Y6IA 5A8WB 5ETOA 3DKSA 2BOAA 1T9TA 3WIVA 3GV1A 3CCWA 1RT7A 3N28A 2UUAF 1T9VA 1Q81T 2XTJP 2YKNB 1FF2A 1BYEA 2OELA 3I6PA 4X4OA 4EVMA 4B3RJ 2ZITA 3HI9A 3L7PA 3CCLS 4HL9A 5CABA 4K8MA 1O0PA 5HQLA 3TR5A 5DJLA 4MJAA 3M9NB 1EKRA 3R8YA 5F8BA 2VCXA 4CHSA 4ELVA 5ENUA 2DY1A 2G13A 1TU7A 2W25A 1FOVA 2CJKA 1TKDA 3MSZA 2O01C 2IVMA 4NHWA 4PUFC 4NA1A 2H75A 3GJQB 4NEYA 2ZJRQ 4TR0A 4NI2A 2Z4PA 1AZSB 1PCAA 4DV0F 4A47A 5D73A 1SQFA 1H74A 3RB4A 2B8PA 5CA5A 2GS3A 2UXBF 3WBZA 2WB4A 4ED3A 3F3QA 3B54A 3NP5A 1XR7A 2J23A 2DJKA 4ES1A 1EWXA 2WAQD 4AJ7A 1JXVA 2CNNB 4WJBA 3TJAA 1TKZB 1CULA 2NDOA 3TKQA 2LXUA 3MOJB 2CA8A 2D1CA 4NEZA 4ZP7A 3SBCA 2H76A 4M5DB 3RZAA 5F3TA 3AB4B 2X49A 1YZ7A 4HSCX 1HQEB 4L8EA 3ZTPA 2MJNA 2RRAA 2IJYA 4EF0A 1S9FA 5CCLA 5L9XA 2HFDA 3EMXA 1MN7A 1WE0A 4ZVOB 4RZRA 1PSDA 3JS9A 4R8UA 4KE3A 1TR0A 1R0AA 4UZCA 3KUEA 3AFGA 2ZDOA 1O8BA 3QRQA 2E5LF 2RKIA 2L6CA 3KH7A 4I8BA 5LJ3Y 4L76A 4TYBA 4YEAA 2BQ3A 2E1CA 2MJUA 1GULA 2RD5C 5AXLA 1BUXA 2ZKTA 5F07A 3R1HA 1RWXB 3PW5A 1N0UA 2ZZMA 5KT7A 4AXJA 1DHMA 2GQLA 1CJVA 2KRBA 2NUUG 3DU6A 1JHBA 1JLCA 3BSCA 3THVA 1SJRA 3P5BP 1DFDA 5I42B 3CPWR 3HKWA 4G9HA 4NZ0A 2J9HA 2HHQA 1AQWA 3HDSA 2HSEB 4L5OA 2CQHA 3D0HE 1H2TZ 2L9DA 2AEMA 3BGFA 3NGUA 3MEGB 3NLCA 4C48A 1VQ5S 1HI1A 1WKJA 2XY7A 2N7YA 3CDAA 5DM6Q 3BSNA 5ECPB 1RT2B 4AQYJ 2PE8A 3LSZA 2V63A 2V8DA 2WRMA 3Q8SB 1SKRB 4UUWA 3H93A 3I96A 2V0NA 4JI0F 2HW3A 3UCUP 1VRTB 4TR4A 4JI8F 3K58A 3F4RA 1T02A 5HROA 3N4WA 3CCZA 1C1BA 1M2AA 4OZJA 4ILMA 1BAYA 1A2LA 4NA2A 2BMXA 2IMOA 4IDKB 2BKNA 2JC0A 4LRDA 1TKTB 2MY8A 5SZTA 2HYIB 5DVBA 1TK0B 4NLRA 4JI3J 4IGJA 2EFQA 4HQSA 3FSYA 4CLWA 3LAMA 2P31A 2VG7B 3C8EA 3RHBA 4KHPJ 4HKQA 3FZ2A 3BCKA 5ELGA 1HBNA 2X3GA 4L6V3 1VF2A 4L74A 1K0MA 3ISNC 4C9DA 1GLQA 4DSKA 1A2MA 3M9KA 2DXDA 1O51A 3D2WA 4I2QA 3Q0AA 3I55S 4YH2A 3GL5A 1GSQA 2HFZA 3LFLA 1U1KA 3HPOA 3ZVJA 4B3SJ 4Q5QA 1ACVA 4JYAF 4RWXA 2CX4A 1TL3B 2DNKA 4XRDA 2NYIA 3N79A 3SQGA 2J5AA 4JZQA 7AT1B 1JXEA 2L59A 4JBBA 4F3MA 3NRBA 3EU4A 2I0XA 4RX6A 1RTJA 1DUGA 3M6UA 3GKKA 4NOHA 4LMVA 4J9PA 3QAEA 2Z56B 1JLWA 2OPPB 1LWXA 4KA0A 2BJ8A 4O3SA 4ZIWA 2YP6A 4FDFA 3T9NA 4U7UK 3CDBA 1G4CA 2P6TA 2HRUA 4TLRA 5LJ5Y 1S1WB 2YNHA 3UMAA 2ZBQA 1GSUA 2XNRA 3KWMA 3IG1A 2ZZTA 2WOMB 1T9XA 1NRKA 4XPCA 4PNFA 3LGMA 1N5YB 2KP1A 1F60B 1RTDB 2C2OB 3QO9A 1S1TA 4I7FB 1OO0B 3J7ZT 2LEBA 3WQPA 2GSSA 2XGQA 2YKMA 1XWCA 3ERGA 2OIHA 2N4CA 1BY9A 4JI2J 1ZTWA 3DDNA 4OO4A 3KP9A 2ATLA 2Q3PA 4AL5A 1RT5A 3PR5B 2VPYB 2DGVA 4DCPB 1OY6A 2ZH6A 4JI1J 2MMZA 2FPHX 2RE1A 3LALA 4TR1A 1N32J 2L6DA 3EWLA 5H9EJ 4KV8A 2AX1A 1S9EA 2F3MA 4I0WA 4Y34A 5C00A 2E1RA 4KDYA 3IC1A 2AYTA 1RP5A 1EEMA 1QSLA 2XB2D 2N5FA 3KP8A 3RAZA 1IM6A 4RUBA 1MWYA 1RAIB 4N0ZA 4MZCA 3EGVA 3GFZA 3MR7A 3NXZA 5D0HA 4N47A 2BJ7A 3WYWA 4IKAA 1P9YA 5DALB 1HD0A 2QSWA 3TJ9A 2JEFA 3UIWA 3GR0A 3QYYA 3MFIA 2VG6B 1MMNA 2HGLA 3DOKB 3PW0A 1AYEA 2VFTA 1RBAA 2VUPA 3SYZA 2XS7A 3ZTRA 5JWRB 3NEKA 4DL5A 4TU8A 2RF2B 4FPRA 1JIHA 4DSSB 4RW7A 3M8PB 3HD1A 3TB2A 3TVZA 2UXCF 2OP5A 3FVYA 2QRRA 2CJBA 5B0GA 3TX0A 2XMAA 2CYYA 4C8NA 5KFUA 2KRRA 2AEFA 2ZH5A 3PW2A 1TK5B 1THXA 2A1BA 3FCHA 1T4ZA 1WEYA 2DNRA 1YKWA 2N4DA 1GP1A 4EO6A 4KJIA 1XPVA 3EZOA 4HHJA 3ETOA 4G1QA 4OMFG 3DLBA 4O4RA 1YTYA 1NZAA 4NXNF 2C3TA 1RWUA 2DNNA 3MD1A 1LV5A 4ZBDA 2FTRA 2VASA 1HIYA 3M9JA 3EC3A 3D66A 3DKDA 3OVBA 5K8NA 1T8EB 2YWIA 4CH0S 2VOPA 2JSXA 3EURA 3FSXA 1UEVA 5AXMA 1EARA 1B3TA 2VG5B 1SJ6A 1LJRA 1RQ0A 2JFKA 2FIUA 3SCJE 4RNOA 2V8PA 3ZTSA 5CYQB 4J9MA 3VLNA 1Z4UA 2KJVA 4RPFA 4JUZA 1R8BA 1UKUA 4ZCKA 1F37A 1HPZA 3FK4A 1LW0A 5AE2A 3KXDA 2MMOA 4OJGA 2F4VJ 2K7KA 4LVOP 5IMZA 3F73A 5BR8F 4RQXA 4NE9C 4GSNA 1TP7A 1CQMA 5D6GA 2FWFA 4I5QA 1HQUB 1PFOA 5CP1A 4DUTA 3IBFB 2LP4A 3I56S 2VHGA 4WXTA 5J1PA 1KTVA 2PN8A 2E5GA 1U45A 4MKYA 2ZOFA 1PX7A 4H54A 3FKFA 2VBYA 5F9NA 1FO1A 4OQJA 3U7JA 5JCWA 1J5OA 4IFYA 1T0TV 3NGKA 4FF2A 4ZDNA 3HHLB 5KT6A 3GFHA 3DXSX 1T11A 3PEHA 3P8BB 2LECA 3GTUB 1EETB 3HXSA 5GAGI 4KDUA 4YQMA 4ML6A 4KGVB 2LSTA 2PMZD 4UOCA 3JAMY 3KMNA 4ICLB 1EP4A 1NPPA 1RABB 2YQ0A 4IH7A 1GTHA 1IBKJ 2P8IA 4B08A 2XC9A 4ULXA 1XERA 2XYGB 5KEJA 3IWNC 2LV3A 2B1LA 4QJVA 1ZM9A 1UTAA 1TK8A 2OADA 2YKPA 2DGWA 1DLOB 2BKPA 3F9UA 1HNIA 5EN1A 2PFDA 2C0FA 3WGXA 3MUTP 2M72A 3M3MA 4FNIA 2J8AA 2XLKA 3C3LA 1VI7A 3KZQA 2VC0A 2DR7A 3CMIA 3DCAA 2JFDA 1VHIA 2CRLA 4NPOA 4DR1J 2K7JA 3M7VA 3OJSA 1UW9A 5HQMA 3RB0A 4U7CA 1X9SA 3RBEA 4MF5A 4LSZB 3PKMA 1L3SA 1IR2A 5IOLA 2AB6A 3FBEA 5D77A 1ULRA 4F4WA 4XAKA 2I1RA 3MECB 5C2GA 3GG1A 1R8AA 4DV5F 3EUNA 4HTJA 4OCEA 3EXCX 3ZXWA 2NLWA 3LTOA 4NLTA 5MAOA 3DYRA 4MH2A 1NSWA 4DG1A 1KLMB 3BKTA 4F4AA 2VBWA 2B4VA 3BN4A 1Y9OA 2MY7A 2B5JB 4TQRA 3OFEA 2VA3A 1WORA 3WX4A 1XIYA 2HQGA 1KOOA 4L0UA 4RNFA 1WJ9A 4P2XA 1JZWA 1HL6A 3PFEA 5E2QA 2I38A 3CCES 3VFIA 1Z1ZA 3K8WA 3W5YA 2RS2A 3DMJA 2FHEA 4YY3F 4ZJOA 1VIXA 2E7XA 4PQUA 2QL5B 4ZL8A 3TW0A 3K7RA 1LWEA 2F63A 4Q8EA 4Q44A 4ZBAA 3FZ5A 4FH8A 4MABA 5K14A 1GUHA 1U8SA 1OYJA 1EOGA 3UDCA 2HWHA 2UU9F 2XC2A 2F51A 1NKBA 4MAKA 3MPVA 4W98A 3LA0A 3HVSA 1GSEA 1UVKA 5EL8A 2OJLA 3KJYA 2DKHA 2ADBA 1LOUA 4GSSA 2H30A 2LS5A 2OBIA 4ENOA 4DSQA 4H4MB 3D6MB 3OUYB 4MTPA 4TXSA 3BJ5A 4FXDA 2B6MA 2QT7A 1JLFB 3W2WB 2MXYA 2XBPA 3TKSE 5IOXA 4HZ2A 2MZTA 3MGJA 1VC0A 3CJTA 4IG0A 4OZLA 2WBRA 3NNHA 1E6VB 2W9BB 2VFSA 1XWLA 3MIXA 3CMQA 3BEGB 3KLFA 3QZ7A 3DRRA 3KHRA 5D9XA 1QXHA 2CPFA 3AJDA 4QOTA 3FZBA 5JJBA 3QFHA 4O0NA 4U7UD 5KN1A 2HZEA 5GAEU 1Y0HA 2KXFA 3G7JA 1UAWA 3HXMA 3BS9A 2HS0A 2GIRA 5JXSA 3D5JA 2VL1A 4DN9A 1GEHA 3VPQA 1XWGA 1EHWA 3CO0P 2DH7A 4M5IA 3C71A 1YJVA 1CBKA 2VOOA 5C24B 1S1XA 3M6VA 3LANA 1XMOF 2VPZB 1CJKA 3OJUA 2CVBA 1YZ6A 3AOBA 3LGCA 1SJQA 2DHXA 3KG1A 1HWLA 1TI1A 3DLEB 3LWMA 1H3DA 1XFLA 2AMCB 2VQEF 1Q8KA 4DV1F 1WDDA 3H8YA 1J08A 1S48A 3ZMKA 2RILA 3UE2A 2DHHA 2ZBRA 1FK9B 2O85A