3DXBA

Structure of the uhm domain of puf60 fused to thioredoxin
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
214
structure length
214
Chain Sequence
PMSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLAGSAMESTVMVLRNMVDPKDIDDDLEGEVTEECGKFGAVNRVIIYQEKQGEEEDAEIIVKIFVEFSIASETHKAIQALNGRWFAGRKVVAEVYDQERFDNSDLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Splicing, transcription
molecule keywords thioredoxin N-terminally fused to Puf60(UHM)
publication title Dimerization and Protein Binding Specificity of the U2AF Homology Motif of the Splicing Factor Puf60.
pubmed doi rcsb
source organism Escherichia coli o157:h7
total genus 51
structure length 214
sequence length 214
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2008-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dxbA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3dxbA01
3H2VE 1G7EA 1SL2B 2GSSA 3W8JA 2L9WA 3BEGB 2PN8A 3PH9A 1OE7A 3KXOA 3UEMA 1FJCA 4HUAA 4XHMA 1WI6A 3VWUA 2LKZA 1BEDA 1PA3A 1PKZA 2H70A 1TI3A 2MBSA 4KSOA 3EVIA 4MA9A 5IMAA 5F0GA 2MZTA 4KDXA 2LEAA 4YAVA 1TRSA 2NLWA 4TXOB 3TUEA 3IV4A 1Q81T 3M8NA 3O3TA 2L59A 1VQ7S 1FJEB 4E8EA 4A8XA 1M2BA 2VCWA 1VQ4S 1EEJA 1U1LA 1OIAA 3Q74A 3QAGA 4TRXA 2C3QA 2VL3A 2DJKA 3CSJA 1THXA 4V19X 3F9UA 2DNGA 1RW1A 2MMOA 4U67Q 1M90T 3FHKA 2AB6A 4L8EA 1TK5B 5J41A 3UL3A 5G31A 2J8AA 4POKA 4TR4A 2L5LA 2G0FA 3DEXA 1Q86T 4YOEA 2A2RA 2GQMA 5IO0A 3HJMA 2GS3A 3Q19A 1OKDA 1U1QA 5GSTA 1ZMAA 5B6MA 22GSA 2DJJA 3S9FA 2CVBA 1EOHA 4NAXA 4XRAA 1SJZA 5DM7Q 2PVQA 4KCEA 1UAWA 1WF1A 3CMIA 1WEZA 5ECRB 1U87A 4BVXA 4DSSB 2FHOB 1GTUA 3GL5A 5HL7Q 3LGCA 5F07A 4GTUA 2KH9A 1VQ6S 1F2EA 7GSSA 5GSSA 1XZOA 2JX2A 2V41A 3F3RA 5KEJA 2LNSA 4XRDA 1Z9HA 1SU9A 4Y00A 1K3OA 2DIZA 1JJ4A 5HQPA 2I1UA 3CYNA 2AYMA 2DH9A 1O8XA 3GYKA 2VLTA 2A4VA 1GTAA 4I5QA 3WGDA 3UE2A 2RUEA 1VF1A 1H4OA 5ECIB 5LSLA 2M46A 2DIUA 2DHGA 3SBCA 4V2LA 1X5OA 4J5OA 5CRDA 4POLA 2L4QA 1WEYA 4P6QA 4FXWA 1RQMA 1VQMS 3GNJA 3QOUA 2M80A 2C4JA 4F9ZA 2LJRA 4TVEA 4EL1A 2L08A 1SK2A 2H1BA 2L41A 2HE3A 1N88A 2F9JA 2HRNA 1WG4A 1JLWA 2KXFA 3UJ1A 2M72A 3F4SA 4HZ2A 3N9UC 2CQDA 2AYBA 4JZQA 1RK4A 1U1PA 5IMZA 5JVGQ 1XOBA 1YY7A 4KCAA 5CAXA 3IWNC 4O32A 3RW6A 1X4BA 5GMKa 1TU7A 4UQTA 1URMA 5J4UA 2KRBA 2CPDA 5FJ4A 2PE8A 2MBTA 2N5AA 2X1AA 1WPIA 4Y0FA 5GAEU 2V1MA 1O81A 3GUSA 1M5PC 2G2QA 3MD1A 3E3EA 2WBRA 1R5AA 2AUVA 1G0TA 4GXZA 1QUWA 3VI5A 4NXIA 4KGIA 3BD2A 1T1VA 2F3MA 1XOAA 2DNLA 2OTLS 3DRNA 18GSA 4IGJA 1LBKA 3G96A 2BMXA 3G4SS 1XW5A 3GSTA 4YQUA 5HFKA 4N0ZA 3HZ4A 2GT6A 2OJLA 2LQQA 3M1GA 1K9MT 1YIJS 4IBPA 3KEBA 1OO0B 4F25A 2DJ1A 5D9TA 2E5IA 4EKZA 3F63A 2VOOA 3UBLA 5MLCV 2ADCA 2REMA 4KB3A 5CREA 3KH9A 4IQ1A 3J7YU 4EVMA 2MYGA 4GRFA 4G9HA 2R4VA 5IQQA 1T7PB 1B7FA 4TU9A 2LA4A 2YV9A 4CDOA 2X1FA 4DSRA 1JHBA 2MQNA 4IOCQ 1K0DA 1EV4A 1ZH5A 2LTKA 2E5GA 1AQXA 1MDIA 3HVSA 2VAFA 4PURA 4WFAQ 1F3AA 4WR4A 5DBQA 10GSA 2AAWA 1KEBA 2CVDA 4GWRA 3RAZA 5AGYA 3WGEA 1O6JA 1PL1A 1TW9A 4ML6A 1UC7A 3ZREA 2MGZA 1U1KA 3CXCR 1X4DA 3NOFA 1TRWA 2IFQB 2LJAA 1D9AA 2CPXA 4OZ0A 4LIRA 3EMPA 2R37A 1GUKA 4KX4A 2CQ3A 4FYCA 1X5CA 4MH3A 2LMIA 1S3AA 1M5KC 2TIRA 3HCZA 3QAVA 1V58A 2DGWA 1WIKA 1K73T 6GSWA 1PX7A 1YZXA 4L0UA 3VAFA 3MWHA 5DCGA 3CF5Q 1YEXA 3TYTA 1M7TA 1Z7RA 2OE3A 3NIVA 1YJNS 1KBNA 3TOUA 2B0GA 4GF0A 5CO3A 2CQ1A 2DGVA 2MQPA 2KUCA 2RRAA 2YV7A 4ILFA 3U1MA 4RU2A 5LCZA 1JJHA 1V57A 4QL9A 1QGVA 5IPGA 3L78A 5B8AA 3ERWA 2RM5A 1X4GA 1F9FA 3P8WA 2N5BA 2B7KA 2EIRA 4O5RA 2EC4A 1I9DA 2GT5A 2CZ3A 3MDFA 4LMWA 2LQ5A 3EX7B 2DIYA 4ZBAA 1GLPA 2MZRA 1WF2A 4DSQA 2ZJPQ 3FR3A 2FUG2 1X5DA 3G8TA 2HVZA 2H76A 1BJXA 4XTSA 1HNCA 1DBYA 3CMAS 4E8HA 1XVQA 1FT8A 3EE2A 3TKRA 1NSWA 1QMVA 3CCQS 4BWQA 2DGUA 1UVZA 1VC5A 1LU4A 3PR8A 1A8LA 2DH8A 3IK9A 1U3AA 1GNWA 5ITHA 1NO8A 1ERVA 1WWHA 2HFDA 4KAEA 3HHNB 2YKAA 2FHEA 5DALB 1FO5A 1EP8A 1M5VC 2CPHA 2B5EA 5KN3A 2L6CA 1K0BA 3VAMA 2KVIA 2PVOC 2HLSA 4X43A 3GH9A 4ZL7A 3QFAC 4ECJA 2YH1A 1QVGR 5IPHA 2GHPA 2MMZA 3LYPA 3WYWA 2D9PA 1N8JA 4K0NA 5D73A 3FR6A 3US3A 2LRTA 2VLUA 5D96A 1PMTA 5GAGU 1GRXA 1ON4A 3R1LA 2VCVA 2N3OA 1XWAA 1X4EA 4G2EA 2YTCA 1OPIA 2HZFA 1U3IA 2R5GA 3US5A 5G1LA 4RI6A 3QPMA 2K6VA 1MD4A 2FA4A 4HJ2A 5D78A 3K8NA 2HT9A 4OMVA 4NHZA 2HYXA 3CCLS 3EYTA 4HJMA 4IJ3A 4RQRA 1CQGA 4ECCA 3FR9A 2DITA 1X5PA 2CQGA 5JWRB 1FAAA 1SJIA 1B4PA 2N7CA 4XS4B 3HKRA 2MHNA 5CXTA 3BCIA 5KN0A 4YUDA 3ULHA 2HGMA 4QQBA 5IMFA 1SD9A 4KUNA 5HFGA 3RW7A 1L3KA 3NS6A 2M9KA 1M1KT 3WT2A 3FZ4A 5ECHB 4EF0A 2RRBA 4YB1P 1R26A 2MJNA 2HNLA 2D3OR 1EEMA 5DAKA 3TJFA 2BZ2A 3RBTA 2I2YA 4POMA 1NHYA 4V1Ap 4GQFA 3Q6OA 3HJPA 4F02A 1OKTA 5J5NA 2DJ2A 4C0OC 1WJKA 1R5PA 3A2VA 3M0FA 5AIVA 2RVJA 1A0FA 4L5OA 3CCSS 6GSUA 2DH7A 3C1RA 4MABA 2K18A 3ZVJA 4AJ6A 2CVKA 4TXVA 1GSDA 2DLXA 1VQ8S 5GAPD 4OFTA 3VALA 2WS2A 1WTBA 2LEBA 4PRFA 4WF9Q 1R4WA 2AYGA 3HVVA 5C04A 4WFNQ 2BOPA 4XS6A 4BS2A 2GSQA 2H0GA 3BOAA 4C4WA 2CV4A 1Y6EA 2M52A 1Q7YT 2IWTA 2TRXA 1WWJA 1KNGA 3ZRDA 1QFNA 5H5SA 3W8SA 3KP8A 1RKJA 1X0RA 3DD3A 3P5TL 5HO4A 1F6MC 3ERGA 4IQAA 1AW9A 2DGOA 2OKAA 3GH6A 3KTLA 3TJJA 2QC7A 3ZZYA 4ISDA 3TKPA 4LA1A 5DDRC 1BG5A 3FEUA 3NNHA 3E9JB 2XNQA 2PBJA 1TJDA 2ES7A 4HOJA 1GSYA 4LL1B 2K8SA 2CZ2A 1FB6A 2YWNA 4GQCA 1EP7A 1M0UA 4QQ7A 3BBYA 2AHEA 2DNHA 3QD9A 2I9HA 3APOA 5J3RA 3NZNA 4ML1A 1ERTA 4OFMA 2YOIA 1MD3A 1BQ7A 2C80A 2OBIA 1YJWS 4QL7A 4TR1A 3G9BA 2H73A 2XNRA 2YWIA 4HZ4A 3QDNA 2VD1A 3V1WA 1TI1A 2KU7A 3GA4A 3ZLPA 5JWQB 2OACA 3I9V2 4PUFC 4MP4A 1A24A 1EGRA 1A9NB 4ZL9A 2CQ9A 2DNRA 2AV4A 2XB2D 2BJXA 3HI9A 5IFMA 3CCMS 1TXXA 3MOJB 2DGSA 3KGKA 3LQ7A 2DMLA 3EU4A 4QU6A 4JBBA 3SMZA 2JZSA 2KM8B 3EGZA 1OAZA 3S01A 2KT5A 3ZMKA 4TKYA 4LL4B 5G2ZA 4L5LA 4OD7A 5GVQA 2CAQA 4D73A 4PGTA 5LNKe 3ZVJD 1XIYA 2WFCA 2IPAA 2FY1A 3VWWA 2H6YA 2AYTA 5C00A 1KQSR 2VD0A 1V98A 4PUAA 1A0RP 2U2FA 2FD3A 3KZQA 3MAKA 3ZTLA 2SXLA 3AY8A 3WD6A 1JLVA 5H5QA 1Z7PA 2LEGA 6GSXA 2V94A 4EGLA 3QCPA 3SDEB 5IO2A 3I6AA 2ZNMA 4AGSA 2NPBA 3F4RA 2DGXA 1SXLA 3F6FA 2CQBA 2A3JA 1O0PA 2MXYA 3D4TA 5IM0A 3FY7A 4NHWA 2V32A 1ZZNA 3BJ5A 19GSA 1ZCPA 3TKSE 2PPTA 2E2MA 2O85A 2F3JA 1GUHA 4HS1A 2L4CA 1HNBA 4FO5A 4NPBA 2YPMA 4K1FA 4ZXGA 1W4VA 5ECKB 4BWSA 3THTA 2LRNA 1OYJA 1WG1A 4CH1A 2C1YA 2J9HA 3D21A 3M9JA 4N11A 1TRVA 2HZEB 3DGQA 4PQ1A 1P27B 3CC7S 2P0GA 1WHWA 4WBRD 3QMXA 2E5HA 4RQXA 1WHYA 4K6XA 1D8ZA 5ENUA 2XS2A 1MDJA 5LD0A 3LFLA 5JCUA 1GTIA 3G71S 1PGTA 2DNMA 2X1GA 3D2WA 2X1BA 3ERFA 2XHFA 1OC8A 4W92B 3PINA 4I8BA 2H75A 2DC5A 4LMVA 4GSSA 4ULXA 1EZKA 5DDLA 3C71A 5ID2A 4JR6A 2E44A 5IMDA 3H1NA 1X4AA 3UIWA 2U1AA 2H1DA 2H1AA 3LWAA 1GULA 2MQOA 3IOSA 3CCVS 2KG1A 1TKDB 2IN3A 3APQA 1U1OA 3GKKA 2PU9C 3FRCA 4HU9A 3IDVA 3TDGA 2KHPA 3A2WA 3R2QA 5G30A 4KNDA 2GLRA 4M5DB 4ERDA 1MDKA 3UBKA 5ECOB 2YZHA 2RT3A 4F03A 2K9FA 3KCMA 3LJRA 5DQSA 2B5XA 2VCTA 2H6ZA 3LORA 3LXZA 5HR0A 4XIHA 4ECIA 3ZYWA 3ISOA 16GSA 3HHVA 3FZ9A 3RHBA 3U5RE 1XXUA 1XW6A 2CAIA 3UARA 1UA5A 1N8RT 4XS1A 3TRQA 1A7GE 3F0IA 3GSSA 5F06A 1YWXA 3CXGA 1QQ2A 3TJBA 4RI7A 1TK8B 1U1RA 2KLXA 1YF0A 2DHAA 1OC9B 5G5EA 3LXTA 5GADU 1SJFA 1VF3A 1NU4A 1GUMA 2OADA 1T4ZA 4X1UA 4PKDB 3KD0A 5JCGA 5J9CA 5IOWA 1GNEA 2XSFA 1ST9A 5IIZA 2WRTA 4I2UA 2C0DA 4XCSA 2DISA 1XPVA 1TK0B 1Q98A 3I55S 3JB9k 4OCFA 1Z5YE 4Z2XA 2ON7A 1GSUA 4Q5FA 2Z9SA 1SKWB 4DSSA 2MY7A 4GSTA 1K0AA 5G5FA 4K8MA 4MH2A 1DE1A 1PKWA 5GAND 3VAIA 3VPQA 1HD1A 3G9CA 3H79A 2K8GA 1B8XA 3ME8A 1OWXA 2JADA 4TR3A 2PMTA 3HY2A 1VQNS 3LYKA 3MUTP 2B3SA 3TKQA 1ERWA 1K3YA 2FWFA 3GKNA 1DRZA 2DHXA 3RPPA 2IIYA 4AF2A 5CRGA 1WELA 4NWYA 5AISA 5H1SV 3FEXB 3IBHA 4ZKAA 2X8CA 4EE0A 4WEYA 1YJ9S 3P3DA 1U6BA 2FWHA 2MKIA 2DGTA 2KRRA 1X5EA 3P6YC 3S7RA 4J2FA 2FY6A 2OE1A 3TOTA 3Q2SC 3KMNA 2RU3A 4OCEA 1TDIA 3DVWA 5EL8A 2RQ4A 3IAM2 4TOPA 4F82A 5CYYA 4HI7A 3GL3A 1DBDA 1UN2A 5ECPB 4CW9A 3CCRS 2JWNA 5L71A 2YZUA 3F6DA 3G6ES 3F4TA 2WZ9A 9GSSA 4FXVA 2N5FA 2LA6A 4F2IA 4PQHA 3DLLQ 2LRCA 3JCML 3CRUA 3B4MA 1YKCA 5J9BA 2O89A 5DJLA 1VRSD 2QSIA 1WHVA 2OBKA 2R3XA 2VOPA 2GVPA 1WEXA 2J23A 3N9JA 1GSSA 2H1GA 1VBXA 2OSQA 4ID0A 2CQ0A 2H0HA 1W2BR 1GLQA 4FIWA 3EGNA 2TRCP 4I2TA 5LXYA 1VQOS 4LMZA 4G19A 4IOAQ 4MCUA 2CA8A 3F3QA 5G1KA 2YCDA 2KFYA 6GSSA 2HSYA 1SKSB 1KOOA 2IMDA 1X4CA 3QR6A 3CCJS 1VF2A 2B7JA 3CRTA 3M9KA 4IP6A 5CYJA 4WBJA 2XS7A 3MUVP 3FK8A 3TRXA 4OFNA 3FW2A 3GKXA 1H2UX 2LXIA 1A2MA 2DK2A 1QM9A 1SK1A 3MDKA 4ZBBA 3O6TA 3IR4A 4JEDA 3IE3A 2OE0A 2MKCA 1J9BA 1M2AA 2X8HA 3R27A 3FKFA 1U2FA 2OIHA 1T00A 3HDCA 3VWVA 3CTRA 1SJRA 1X4HA 1SJ3P 2CT6A 1AQVA 3IRAA 3VF0B 5CA5A 2FNOA 3VLNA 1SD8A 3C1SA 2WDUA 5JCWA 3J7Yb 2EIQA 2IMKA 3GIXA 3VAJA 4K9ZA 2N3LA 2DJ0A 2IFQA 2KXHA 2MQMA 5CRWA 5A4UA 2B5YA 5KN1A 1M5OC 1F37A 2VM2A 3H4KA 5LSOA 2MQLA 1ZGNA 4MJEA 5EVOA 4ZILA 1DZ5A 4ZB6A 2CPZA 5DETA 2ADBA 3S8SA 2XBIA 3QAWA 3VAKA 3D0ZA 2ZUPA 2QA4S 2FCHA 1K0MA 3P90A 4WCEQ 3MD3A 3GX0A 4KH7A 2F9DA 4YQMA 4MZWA 2C0GA 3NNCA 3UCZP 3QFBC 2CX3A 5HR3A 5IOXA 4WIIA 4MZBA 1EGOA 2CPJA 1B9XC 1HQOA 1PX6A 2MKHA 4EUYA 3CPWR 4CH0S 3VK9A 4LJMA 3W6GA 3DVXA 2ZCTA 6GSYA 1ML6A 2IMIA 5D9XA 1YKAA 3A2XA 3ZFLA 4O7HA 3GHAA 1NW2A 4N0VA 2V6KA 1BAYA 1SYRA 1XFLA 3ED3A 1XWGA 1AIUA 2QGVA 4IELA 3WGXA 2RS2A 2M8HA 5B6NA 1FVKA 2JL4A 3NMRA 2B6MA 1J08A 2YWOA 2H0IA 4CIOA 2RM6A 2X64A 2HSHA 2EK1A 3WT1A 2MKJA 1YDKA 1SJQA 2R2JA 2FC9A 2G4BA 1TTZA 3KM6A 2CPIA 1M9BA 2G0CA 1H75A 3IPZA 3C73A 1G6YA 4JE1A 1P1TA 3VAHA 2EVZA 4IO9Q 1B48A 1JFUA 1YI2S 3F8UA 2B1LA 1K0NA 2L6DA 2PEHA 1HA1A 1X9MB 4IW9A 3S6EA 2M0GB 2M4MA 5DALA 1FXLA 5B8BA 2JZRA 1R7HA 3P2AA 2C0EA 2NBSA 3H8QA 2M7SA 1GTBA 3CBUA 3A3TA 3J7Yk 5DQYA 2YNXA 3C8EA 1VBZA 2JVOA 2AYEA 1V40A 5ELGA 3FZ5A 5GAHU 2YJHA 5COHA 1N54B 1NM3A 2DMMA 2XC2A 5CNWA 2GO9A 1ERUA 1WMJA 4YAPA 3KH7A 1Q82T 3L4NA 1ZYQB 2LV3A 3TKSA 4K7OA 4MJBA 1A23A 2I81A 3GTUA 5CP1A 5DJMA 4CHSA 3V4MA 2XBQA 5IM0B 2E7PA 5D8IA 1K0OA 2OSRA 2C0FA 5ECLB 1R8PA 3VFIA 2I4AA 1ILOA 3DXBA 2IL3A 4XS4A 2JSYA 1GSQA 3TP2A 1Q4JA 2CQCA 2RQCA 3MNGA 2V6OA 1LJRA 3D22A 5D9VA 4ZIJA 4MMMA 1G7OA 5CRHA 2MMAA 2AD9A 3PIPQ 1VQLS 4KSMA 2H19A 1DHMA 3GN3A 1H2TZ 12GSA 4YQVA 5ELAA 4ED5A 4BL7A 2DNZA 4OZ1A 2JZTA 4EC0A 2E5JA 4MF6A 2H74A 4NMUA 1CQHA 1A2JA 1IYIA 2L57A 3C7MA 4KDYA 1TOFA 2NTOA 3GURA 2LYVA 2N82B 4I97A 1PGZA 4POBA 3GV1A 4V2MA 4MF5A 1EOGA 2VO4A 1GSFA 2MYFA 4UY8T 5ABRA 5ID2B 4K7IA 5HR2A 2MZSA 2D2ZA 4WKWA 4JRRA 1G6WA 2CQIA 1WHXA 5B7CA 3BO4A 1XW9A 1ABAA 1U88A 2MZJA 1C72A 4MF7A 1ZZFA 3MSZA 1M2DA 1XVWA 4GSNA 1FB0A 3TB2A 1EWXA 3ZL5A 4IUFA 3UCGA 5ECSA 1AUDA 2EK6A 2GQKA 2CQPA 4OWYA 2PGTA 1U6TA 4JR4A 4GLTA 14GSA 13GSA 2YP6A 5D77A 2VCXA 3GX8A 2NVLA 2DSAA 2B1KA 1A8YA 4KW6A 5JVHQ 1VQPS 3ZZXA 4IVFA 5H5RA 2JACA 1WP0A 1X9WB 1GP1A 1SENA 5DM6Q 1FG4A 2OTJS 1SL0B 1FJ7A 1X5TA 3TO8A 3TJGA 3UVHA 2GZPA 4BA7A 2MZQA 5IMCA 2JSZA 3HXSA 2LCWA 1S3DA 3DYRA 1YF1A 4PQIA 3UAPA 3B4DA 4MK3A 4DVCA 3CULA 1TU8A 1YQ1A 4IJIA 20GSA 2M2BA 4C7QA 1WI8A 4HU7A 3SWLA 2IJYA 1J0FA 2DB1A 1VQKS 4WF5A 4WFBQ 1S72S 2MY8A 2DIVA 3IK7A 5DVBA 2VLVA 3BCKA 3ZITA 2H01A 1OC3A 1ZOFA 2WB9A 2WCIA 1UFWA 3E0UA 2E2GA 3IA1A 3CSHA 1T3BA 2KYXA 4ZL8A 2X99A 2VL2C 3VAGA 4EDZA 4TR0A 3ZFBA 3LQVA 1WE0A 4K0GA 3BO3A 4W90B 2OJ3A 3I69A 2MGZB 4LLRA 2FLSA 3Q18A 4J57E 2FWGA 3LSZA 4Q5RA 3VURA 5LXRA 4WETA 2GTUA 3PGTA 4GCIA 2ZJRQ 4TW5A 2MPUA 2LKUA 1UW4A 2K3KA 2H8LA 2JVRA 2HYIB 4MZCA 1PSQA 3P7XA 3EINA 4TU8A 2LJKA 2JRSA 5AIXA 2MJUA 3KIJA 2HGNA 2VM1A 3M3MA 1JZRA 2JU5A 5LJ3Y 2KG0A 3U1LA 2WJUA 2WULA 3H2UB 4YH2A 4TXOA 1K3LA 2P5RA 5F8BA 3BO2A 4WF4A 5A4WA 4EDYA 1DSBA 1VF4A 2E0QA 4TU7A 4IN0A 5EY6A 3NS5A 5D9WA 1NHOA 3NNAA 1F9MA 4X0XA 1S79A 1X4FA 1RK8A 3LG6A 5ECMB 2DNQA 1ZYEA 3DWVA 3RDWA 5FHIA 3D4MA 1G2EA 3SDEA 2C3TA 3DIEA 3IC4A 2R6KA 2GSRA 3APSA 1HD0A 1VQ5S 1AUCA 2F51A 1R8HA 1SYXA 2DBCA 2M8DB 1XWKA 1VC0A 4AJ8A 2V2GA 2YN1A 2MMYA 1XWBA 1V9WA 2PUKC 4IS0A 3O76A 3TJKA 2CX4A 2VIMA 3THPA 1JZWA 3BS9A 5EPFA 3CTFA 3DKSA 3UD4P 2XPEA 1UP1A 2HZEA 3HA9A 5IM9A 3TRPA 2CPFA 1I5GA 2HXKA 1AQWA 2ERRA 1W89A 2RUFA 1JZDA 2XPDA 2LSTA 3EWLA 2P5QA 2CPEA 3UMAA 5HFIA 3CC2S 3DMLA 17GSA 4NV2A 1USBA 4OO4A 5ECQB 4TLQA 3SXLA 3UWTA 1ACVA 3ZMLA 1T8EB 2C3NA 1IYHA 2J76E 2H72A 1X5SA 4IKHA 2MQQA 1H6KX 3IAS2 3J7ZT 2J0SD 2X8GA 1FW1A 1TRUA 2DNPA 4DEJA 2H71A 2RIIA 1O73A 1WF0A 1E6BA 2DO0A 1F3BA 3K0JA 3HZ8A 1DE2A 3KP9A 2LS5A 3D5JA 4MDCA 1YHQS 3LEFA 2LXUA 1PD21 1JJ2R 1BY9A 1SJ4P 2DJ3A 5IMVA 1SL1B 2F8FA 1SK0A 1U1NA 2ZJQQ 1O8WA 2MSTA 2QFJA 1B9YC 3TCOA 3EMXA 5IQYA 2DO4A 4OO5A 1GL8A 1K8AT 1GH2A 3RPNA 1WRYA 5E59A 2F9SA 5EN1A 1KC8T 1WOUA 4Q5NA 2VCQA 1OVNA 2GZZA 2HI7A 2IMEA 3HJOA 2O3DA 2LECA 2HGLA 2VL9A 3VWXA 3TKSC 4H86A 4QU7A 3G7YA 3FYGA 4PX1A 5DAKB 5ECNB 1QXHA 1HYUA 3HYPA 2FC8A 2G1DA 4MLYA 3EU3A 2VL2A 3UOMA 1URNA 2NZ4A 2IMFA 4ZB9A 3N5OA 2GQLA 5DCHA 2O8VB 1O7UA 2M88A 2DHSA 1KOHA 3L3CA 1OC9A 4BVYA 1HL6A 3CCUS 2I38A 2VODA 3GRXA 2YWKA 3L0HA 3VPTA 4WKRA 4EO3A 3OR5A 4N10A 3H93A 1X0FA 1BYEA 2RNEA 3EURA 1IQTA 3TGZA 4ACSA 5INYA 5E4WA 4AJ7A 2FA8A 2KOKA 3ME7A 2VCZA 2D9OA 3I56S 4PNGA 4KDUA 1Z6MA 2BTOT 2HRFA 4BPYA 4EXJA 2LUSA 3MXHP 3MI7X 1PQNA 3P49B 1FHTA 2GDRA 1YEPA 2O87A 4K2DA 3CCES 5DDPC 1YJ6A 1M9AA 4ZB8A 2OA7A 1XBSA 3ZIVA 3RHCA 4IHUA 2Q79A 1O85A 4G10A 2O7KA 4NV5A 4Q5QA 5D93A 4FYUA 3U6VA 3ZZZA 5BJRA 2KI2A 2ON5A 1VC6A 4HEA2 3GTUB 3L9SA 2GGTA 4KA0A 1JZOA 2DNKA 5KN2A 4J56E 2VUPA 1XWCA 5FWGA 1ZZYA 1N2AA 4ECBA 6GSVA 3FEYB 1AAZA 2DNOA 1N52B 1Z6NA 2PWJA 1DUGA 4TR1B 2L5OA 5GZZB 2P31A 2NDOA 1THOA 4K7NA 2ALBA 4PNFA 1ZL9A 2CPYA 3G7JA 1VGLA 3IHQA 4JU5A 5FT3A 4HDEA 4ZBDA 5HR1A 3LPYA 3CTGA 2MSSA 5LJ5Y 2C8UA 2I3YA 1WG5A 3A5WA 2LQOA 4MJCA 3GFKA 2RLIA 1CVJA 2DGQA 4HQSA 2QKEA 3D6IA 2CJKA 1FOVA 3CD6S 2MB0B 8GSSA 4QPTA 3MURP 2K8VA 3IXRA 1KTEA 1SJ6A 1Z3EA 2GSTA 1E2YA 1U1MA 3G7IA 2FWEA 2CQ4A 2DNNA 1MEKA 1GWCA 1QK8A 1VBYA 2RUGA 11GSA 2XS5A 4O92A 4RUVA 4WXTA 2FGXA 4WR5A 2QEXS 3PIOQ 5DDOC 1KD1T 3UVTA 4TN8A 1SKRB 1VQ9S 3VI7A 3KTBA 4D73B 1PL2A 2F8AA 3I43A 2KP1A 4MPFA 4I6XA 2VONA 3L9UA 3KMOA 5F05A 4F0BA 2FPHX 3FZAA 1GSEA 2LNTA 5A4VA 1BX9A 3R1HA 1T4YA 1XCCA 4FYBA 2M70A 1M99A 3L9VA 2CQHA 1YITS 2WGRA 1PN9A 1FO1A 2EIOA 3CMES 2H30A 1A2LA 2UP1A 2YH0A 2KM8C 2RS8A 6GSTA 1U6FA 3GKMA 1XN9A 2AJQB 2GZYA 3CSIA 1H2VZ 5A5KA 2PERA 2MKSA 1HD2A 3OW2R 2CQ2A 1V2AA 2HZCA 5JWOB 1X9SB 4F0CA 2KP2A 3Q2TC 1EV9A 2KHCA 1YTYA 5AN1A 1OE8A 1QVFR 3CC4S 1NJIT 4V2NA 1MTCA 4HQZA 1FHEA 3MUMP 2H6XA 4MJAA 2A2SA 2MKKA 4KE3A 3IRWP 4P3YB 1FVJA 2H66A 4V1Ag 2YJ7A 2MZ1A 1K0CA 3UCUP 1FNXH 3KJYA 3G8SA 2MMNA 1Y25A 1JMTA 4FH8A 4N30A 4PXOA 2KN4A 3HD5A 4Z7XA 3CUNA 4MPGA 2VOCA 1AC1A 1HNAA 1B4QA 2DNYA 4CQ1A 2KXNB 1S3CA 2J0QD 1PO6A 2MZCA 3HVXA 1PRXA 4PR6A 2YANA 1AXDA 1TP9A 3EC3A 3GMFA 4IP1A 3ZIJA 4F26A 3UD3P 4L0WA 5DDQC 2YWMA
chains in the Genus database with same CATH superfamily
2FIUA 4LF6F 1NZ8A 1VCTA 5HVFA 2FHJD 3K57A 1W7WA 3Q0AA 2IA6A 3BGRB 1I6JA 1FJCA 3VWUA 1PKZA 3EVIA 2MZTA 2LEAA 2NYIA 1TRSA 2NLWA 4HT5A 1Q81T 3M8SA 5ETSA 3O3TA 4NI2A 3EDQB 1F5BA 1FJEB 1VQ4S 1OIAA 5KFLA 2DJKA 3CSJA 1THXA 5D4PA 4NRTA 4JYAF 1F9EB 1M1GA 2FZGB 1RW1A 3KHLA 1UMJA 2KJVA 3CJKB 4U67Q 2JEFA 2GJFA 4L8EA 1S99A 2NUHA 4C8LA 3UL3A 4POKA 3DEXA 4YOEA 2A2RA 1HNVB 2Z30B 2GS3A 1JLFB 2UUTA 1U1QA 4DS5A 3PW2A 1Y4ZB 5GSTA 5B6MA 2DJJA 1EOHA 2ZFHA 3LF0A 1SJZA 5JJBA 4KCEA 2E9ZA 3DLKA 1FRLA 2YNIB 1AB8A 4DSSB 2FHOB 1GTUA 2IVMA 5F07A 1VQ6S 7GSSA 1BQXA 3F3RA 1YBUA 4OHYA 2UUBF 2HRUA 4X4TA 4J9UE 3C3LA 3HJVA 4C11B 2DIZA 4C9DA 5HQPA 3AT1B 1O8XA 3H90A 3WGDA 2WOMA 2XLKA 1J27A 3R5DA 1H4OA 2DIUA 2DHGA 3SBCA 5KG6A 4J5OA 5CRDA 3O6QA 4DUZJ 2L4QA 4KKOB 4P6QA 4LFBJ 4C0HA 3LALA 3M30A 2V8HA 1N5YA 1S1TB 1VQMS 5C24A 3QOUA 2C4JA 4F9ZA 2LJRA 1QUPA 2L41A 2HE3A 3ISNC 2F9JA 1CJTA 1WG4A 2KXFA 3UJ1A 3EJMA 2M72A 2XI2A 4CT9A 5JVGQ 1XOBA 1YY7A 2PSZA 3U02A 4UQTA 1URMA 4B3MJ 2H5JB 3IR6B 2HRYA 3OTBA 3T1YF 4N56A 2V1MA 1XR6A 2G2QA 1X7VA 2I9SA 4CTAA 2C2ZB 1IBLF 1G0TA 1QUWA 2QLJB 4NXIA 2BQ3A 3BD2A 4NYPA 4KF9A 1REVA 2IM1A 5IWAJ 2Q3PA 18GSA 5KFEA 2HVHA 4PQUA 1XW5A 4TNOA 2HIQA 5HFKA 1FWLA 4N0ZA 2J9EA 4IBPA 1N32J 4LF9J 2DJ1A 5D9TA 2E5IA 4EKZA 2JLGA 3UBLA 4KB3A 4YR2A 2WSCC 4DR1F 1T7PB 1B7FA 4KO0B 2FVCA 5C42A 1Y3JA 2X1FA 2IVFB 1JHBA 4USWA 2GIFA 4ICYA 2IA0A 3MM5A 2IBKA 5KFNA 4FF4A 1TKTA 4YB6A 1U09A 4WFAQ 4CNYA 3WGEA 1TW9A 3RAXA 2XI3A 3ZREA 5HMWA 4RW7B 3CXCR 2RDJA 2O1PA 1TRWA 3IHGA 1SUQA 4C8OA 1D9AA 2FYXA 1N5TA 1TELA 3MM8B 4KR0B 4LIRA 4CZCA 3EMPA 2IIHA 1NDKA 1GUKA 4KX4A 1LW0A 2CXEA 5I3UA 5E3RA 2LMIA 3HCZA 2DGWA 4OI3A 2AQ4A 4LUBA 6GSWA 4MKVA 4B3SF 3KNAA 1FVQA 3MWHA 3R7NB 3TYTA 2BQUA 2OE3A 5KFCA 1LFWA 3TVYA 2RRAA 2YV7A 3UR0A 3UW1A 3WZ0A 3JSRA 3NBPB 1JJHA 3A8JA 4QYZJ 4QL9A 4F04B 3GJSB 2B4OA 5B8AA 2H1YA 1F9FA 5BRTA 3HSJA 2COLA 2WSEC 4WWSA 2X3DA 2Q66A 2LQ5A 2DIYA 4ZBAA 2MZRA 5B0BA 5F41A 3SCKE 5KG1A 4JI3F 4PZVA 2H76A 2WVBA 5HATA 5KFXA 3M2UB 1FT8A 4G65A 4MKBA 3CCQS 1LU4A 1RHKB 4RR5A 1U3AA 2YNFB 2HK2A 5ITHA 2HFDA 2NS1B 4I1TA 3CJRA 2YKAA 1EP8A 1X31C 2B5EA 2ZHBA 2DXDA 3VAMA 2KVIA 1FEHA 2HLSA 4A8OA 1ZYNA 4PWUA 1T8EA 3HM9A 5IV3A 3LYPA 1N8JA 4QR2A 1BMQB 3UD5A 1VDHA 4K0NA 4XPCA 3D54A 3AFGA 4B9LA 2XEXA 2QG9B 3R1LA 2VCVA 2N3OA 1SVDA 2RQKA 5MAOA 2EFPA 1RT2B 1X4EA 1JK9B 2NCKL 1OPIA 2HZFA 1S1WB 5KT6A 3DOKB 2A2PA 4RW9B 4USUA 2FA4A 3N4WA 4OHXA 3TI0A 2R7XA 1UCNA 4JI2F 4HJ2A 3K58A 4KJIA 4PTSA 4PQAA 5D78A 2E1MC 3K8NA 2HT9A 3PW5A 4ILRA 4N76A 1EQMA 3CCLS 5A0YB 1CQGA 5LOQA 1O6XA 1S0MA 2DITA 1VI7A 1X5PA 1EP4A 5JWRB 1SJIA 3HKRA 3BCIA 3ULHA 3KLEA 4QQBA 4NLGA 4LRBA 2M9KA 3QAUA 1Q53A 1VLOA 3FZ4A 5ECHB 4M5LA 3EVWA 4IFYB 3I96A 4YB1P 2VBWA 2HNLA 3HKWA 2W9CB 4V1Ap 2BJDA 1RHJB 1BWEA 4F02A 3TVKA 3V6DB 1OKTA 1WJKA 3CD0A 3VHQA 4IO1A 3M32B 3V6KA 1XMBA 1A0FA 4L5OA 4MABA 3F0NA 3ZVJA 1GSDA 2DLXA 1C0TA 2MTLA 3DCAA 1R4WA 2AYGA 5C04A 2R42A 2BOPA 3SYZA 4XS6A 4EBCA 3BOAA 3FRZA 2HQCA 4I2QB 1VJWA 3DRRA 1SJ1A 2TRXA 3KDNA 1IKVB 2E9RX 2V2VA 1KNGA 3GIJA 2OD6A 2OH2A 1HBNB 3KP8A 3P5TL 5HO4A 1F6MC 4DFJA 1TFWA 1AW9A 3H4BA 3TJJA 1CULA 4FP9A 3M7VA 3PPUA 3FEUA 1YK9A 2XNQA 2LQ8A 3N6LA 3WC0A 1MLAA 1OPZA 1WOSA 2BE7D 3T9NA 1U7LA 3TRGA 1EP7A 4QQ7A 3BBYA 2AHEA 2I9HA 3GSDA 2W2QP 1HNZJ 4LREA 2QSFA 3TZXA 4FBTA 2R7UA 1ERTA 4NEYA 3OHAA 1FI4A 1MD3A 1Y9OA 1BQ7A 1R7IA 2CDQA 1AZSB 2C3OA 1EETA 4CNZA 4G1QB 1CG2A 3I5BA 3QSIA 1XNQF 2GW8A 2VA3A 1FDDA 2QLXA 2JJ4D 1A24A 4L73A 2OELA 1YVFA 2XB2D 4ED6A 3HI9A 5IFMA 1RTJA 4EYIB 1SH2A 3MOJB 4NLVA 1TL7A 1KVIA 2DGSA 3KGKA 4IDKB 4U9RA 3EU4A 1ZAWA 3RBZA 4JBBA 2G13A 4FN5A 1OAZA 3ZFVA 2XC9A 1WDDA 2NZCA 5GVQA 3SCIE 5E2QA 7AT1B 4PGTA 2QYGA 5LNKe 5K8MA 3ZVJD 2WFCA 1KLMB 4OYPA 2AYTA 1YKWA 4WP9A 4LR9A 3M4XA 2U2FA 3KZQA 1FVSA 2XMWA 2DY9A 2JZ5A 3WQPA 3K17A 6GSXA 3QRPA 1E6YA 4Y6IA 1FFGB 1DTQA 4USTA 1YLXA 3HFZB 2NPBA 3F4RA 2V9WA 2JNJA 1MN9A 3FY7A 1ZZNA 1ZCPA 2J0WA 4HS1A 1LWXA 1FERA 3M8QB 4NPBA 2Q6CA 2YPMA 1W4VA 2VL1A 2QLBB 2BE2B 4BWSA 3THTA 2LRNA 3D28A 1WG1A 2GAGC 2J9HA 3M9JA 4N11A 5EX3A 1TRVA 3DGQA 3GIIA 1WHWA 2AV5A 2POKA 2QMWA 3DU6A 2LQBA 2XCPA 2ATLA 4HYKA 3SFUA 5LD0A 4NZ0A 3NCPA 2C3PA 1PGTA 2DNMA 3B6BA 4KHRA 4YB7A 2X1BA 2XHFA 4URSA 3PINA 2NPIA 1SC4B 1EZKA 3G82B 3OSPA 3M05A 3CDBA 5IMDA 3UIWA 1EKRA 2XMTA 1K0TA 1UEVA 1GULA 2GMHA 3K8VA 4FS2A 2IN3A 3APQA 1U1OA 2PU9C 1SIZA 1YX2A 3BQ2A 3IDVA 2YKQA 2KHPA 3CDUA 1ZYPA 3R2QA 4KNDA 2GLRA 4A8FA 3BGRA 2B4UA 3IAM9 2YZHA 2RT3A 2AEFA 3QFWA 4B9NA 1MSWD 3LJRA 4LF8J 2B5XA 4ZK7M 2H6ZA 4LF5J 4N8NA 5HR0A 1KN6A 1OQ6A 3AODA 3RHBA 3U5RE 3UARA 1W26A 1HQEB 3CXGA 5J2PB 5J1PA 3CJKA 4RI7A 5E5NA 1U1RA 2KLXA 2KFNA 2BOAA 1C4CA 2FUG9 4KT0C 1OC9B 1HNVA 3LXTA 2RF2B 1NU4A 1P6TA 1JLFA 1TL1B 1AFIA 1ZPVA 5I4MA 5J9CA 3KG1A 1TU0B 3JSYA 2WRTA 1WTFA 4XCSA 1XPVA 4I6WA 5HJXA 2DEIA 1S6UA 3LAMA 3I55S 2YNIA 4A8QA 3EXYA 2FZCB 1LKZA 2MY7A 4DSSA 3MEDB 3EGVA 2UUAJ 4OYXA 2RHSB 2LP4A 3G9CA 3Q8YA 3AH6A 4C11A 2JADA 4TR3A 3HHLA 3HY2A 3MUTP 3TKQA 2FWFA 5F9LA 4ES2A 2W4DA 2DHXA 3EPIA 1R43A 2IIYA 2Y1JA 5CRGA 5AISA 2RB7A 3IBHA 4FYYB 4EE0A 4YHHF 1HI0P 2DGTA 4KKOA 1S1TA 2OE1A 5IQ6A 4QWAA 5D4NA 3KMNA 1FX2A 3DVWA 2RQ4A 3IAM2 5CYYA 2O67A 1DBDA 3CCRS 1A6LA 2C2KB 2KT3A 3M6VA 3W65A 4DX8H 4EO6A 3F4TA 2WZ9A 3CJQA 3FKBA 2HNZA 1B99A 2WTFA 3SI8A 2LDYA 4ZCLA 4QPXA 1TL4A 5DJLA 2QSIA 4OZ5A 3HHEA 2VB6A 2V34A 1XC9A 1GSSA 1YJVA 1YJ7A 2H0HA 1W2BR 1GLQA 4DL5A 4LMZA 2J0XA 3U1NA 4IOAQ 2DBBA 4DS4A 2KFYA 4G0LA 2Z58B 3WC2A 4DV2F 2IMDA 3UN2A 2VJVA 1VF2A 4KGMA 3CRTA 4WU3A 2BVZA 4NLQA 4WBJA 3MUVP 3UR3C 2R9LA 1JQGA 5J2QB 1SH3A 3TRXA 1GNKA 3FW2A 1T3NA 4EBEA 2DK2A 1T7PA 1QM9A 1QDUB 4KO0A 4F4WA 4KBIA 1NSPA 3M2VA 1R0AB 2MKCA 1RLCL 1WORA 1T00A 3HDCA 3EDRB 1X4HA 2NXJA 1AA1B 1IR0A 1SJ3P 1AQVA 3VF0B 2HLTA 2YPYA 3RB3A 2RQMA 4A8KA 5IC6B 2FNOA 4UQGA 2OHDA 3J7Yb 4QWBA 4RBUA 4HR2A 4DBQA 4K4ZA 4PYDA 4K9ZA 3HHLD 2M3DA 1KVJA 2RKIA 1JKHB 2RIJA 5CRWA 5A4UA 4C3KA 2B5YA 2PEBA 3M6WA 7FDRA 3D1QA 1UZDA 3BGUA 3RU0A 2V2KA 1RACB 2CPZA 5KG7A 3N5FA 3QT5A 2ZUGA 4QIWD 2X49A 3W5YA 3VAKA 2VV5A 4WCEQ 4KH7A 1DQAA 4I7FB 4QIVA 3NNCA 5DQHA 1HBMA 4WIIA 3NBPA 3POTA 2HRAA 1EGOA 4X4RA 4CH0S 3W6GA 3TW0A 3CDAA 3HP6A 6GSYA 3KFWX 4DV4F 2QX0A 1ML6A 1YKAA 2GV1A 1NDCA 2V5HG 3GHAA 1NW2A 1YZ6A 2V6KA 4NL5A 1AIUA 1WC3A 2QGVA 5ETRA 1CJUB 2RS2A 3MCSA 4DPWA 4X65J 1FVKA 2IJFA 4DR4J 2RM6A 3DLEA 4TYAA 3WT1A 2MKJA 3N01A 2WVEA 3M2UA 4QR0A 1HQUB 3RBDA 1U0HB 1QTNB 4ZS6A 4J9VA 1P1TA 3VAHA 2EVZA 4JE1A 1R31A 1JFUA 3F8UA 2YNFA 4P73A 4ZHRB 1N56A 3FNNA 3D6HB 5GMEA 1X9MB 3S6EA 2M4MA 3H2LA 1FXLA 2V2ZA 2JZRA 1C0UB 4O0NA 2KT2A 2NBSA 2IRUA 3CBUA 3IP0A 1UVNA 1SCJB 1V40A 5ELGA 4ZVFA 4ENOA 5GAHU 1Y0HA 3PTWA 4IOBA 5CNWA 1WMJA 1RT2A 1RU2A 3RYLA 3NGUA 1Q82T 1ZYQB 1S1WA 4MJBA 3DOKA 3GTUA 5DJMA 4DXLA 4RW9A 1K47A 1P8GA 5J2MB 5D8IA 4Z7YA 3AJ2A 2HHPA 2C2EA 1ZA2B 5A0YA 2KDOA 1NEEA 4DPUA 1RTIB 4UUWA 2RQCA 1WC4A 3MNGA 2V6OA 1LJRA 4IRCA 2UVVA 3D22A 4BVXB 4NLPA 1V3RA 1FNOA 1XJWB 3PIPQ 2R7WA 1DHMA 3GN3A 2H4WB 1S76D 4IFYA 3CO9A 4ZP9A 4F7VA 4YQVA 2JZTA 4EC0A 2W9CA 4DV3J 4OIXA 4ECSA 3R3EA 1EQ0A 4LFAJ 2F5GA 1IYIA 3V6DA 3GURA 4POBA 3T6JA 4MF5A 1EOGA 1RHQB 5ABRA 4ZVHA 4RUBA 5HAOA 4K7IA 2D2ZA 3EICA 1DAXA 1RT6B 2CQIA 2IVYA 3K5PA 1XW9A 1ABAA 1QAIA 1GQEA 1C72A 1XVWA 1FDAA 3TB2A 3ZL5A 3HHDA 3UCGA 1NPPA 1RAGB 3MAHA 5ECSA 2EK6A 2GQKA 1NK6A 1U6TA 4JR4A 4I2QA 3VQSA 5D77A 1IKVA 2C2DA 4G3IA 1HBNA 2IDEA 1R0CB 2NVLA 2QFIA 2DSAA 4KW6A 5JVHQ 3LA0A 4IVFA 2JACA 1TUVA 1WP0A 1Y00A 5DM6Q 3GONA 4QBUA 4EU0A 1SL0B 5DG7A 3ICLA 4LF6J 3TJGA 3UVHA 1IUJA 3MPWA 2GZPA 4BA7A 2Q6BA 2XGPA 3W62A 3QLHA 2LU2A 2VG6B 2KZMA 4DVCA 2YQ1A 3DHXA 4LF4F 4U6PA 4NLOA 3HT0A 4GC6A 4FNHA 4YP3A 3I0SB 1AZSA 4HI1A 3SWLA 1VQKS 4ES3A 3TX0A 2MY8A 2DIVA 3PFEA 4EMDA 1ZS6A 4JYAJ 4G1QA 3PHEA 3ZITA 2QLWA 1OC3A 2WB9A 2RMLA 1UFWA 4YR0A 3W60A 2ZH7A 2VL2C 5K8PA 1WE0A 4ED4A 4W90B 1RHMB 1NPRA 2FLSA 4IDKA 4J57E 2VFVA 1VLYA 2DR5A 1WC5A 4K2JA 2MPUA 1UW4A 2K3KA 3EGWB 2HYIB 3EINA 3OT9A 4FF2A 3FZBA 2UUBJ 2MJUA 4N5SA 3KIJA 1PJ7A 2VM1A 3M3MA 3OTOF 2JU5A 1KLMA 5LJ3Y 4YH2A 5HMYA 1K3LA 5F8BA 1RABB 2YNHB 4NLSA 3BO2A 4QIFA 4I0WA 2ATCB 1T03B 1FFWB 2E0QA 4TU7A 4IN0A 2GZOA 3VVUA 1TP7A 4ZLJA 4RNMA 1RYRA 3RDWA 2F8MA 1G2EA 1O51A 2BRKA 3MCNA 1YRUA 4MK7A 3DIEA 3DRPB 3IC4A 1RI7A 3RG6A 3APSA 1BQMB 2AF6A 2BRLA 3V81B 4I6YA 1SYXA 4X4VA 2GHWA 1XWKA 2DT9A 3UVJB 1V9WA 1SIWB 3M8QA 4YY3J 2VIMA 2BE2A 2JL9A 3UD4P 1GMUA 3MPYA 4JI7F 3HA9A 4PPZA 3T1YJ 2NREA 3HZEA 1AQWA 3MM9A 1W89A 2RUFA 2NXCA 3RZAA 1JZDA 3TARA 2IDLA 1UKUA 1IBLJ 5BYSA 3CC2S 1HWIA 1ZM4A 2EBGA 2CZVC 4NV2A 17GSA 3DOMB 3L95X 3VCDA 2CWKA 3QJJA 5ECQB 4TLQA 3SXLA 3UWTA 2ZD1B 3A13A 1KTVA 1H6KX 5KFQA 3ENQA 3RTVA 1TRUA 2DNPA 1Q78A 4OX7A 2H5IB 1O73A 5CYMB 1R8BA 3BR9A 2YPZA 4HDHA 3KP9A 4DR1J 5DO2A 1BWVA 2LXUA 5B09A 1BY9A 5RUBA 2BW7A 2F8FA 1F60B 2MSTA 2QFJA 2N7YA 3HHKA 4OO5A 1GL8A 3PYEA 5HQ8A 1NPKA 1IXKA 2GHVC 4U7CA 2O3DA 4NEZA 3HMJG 4H86A 4PX1A 5DAKB 3PXGa 4ETXA 2K3IA 4DUYF 1PG5B 4OYIA 1HQEA 2LFVA 3QGIA 5J2PA 3UOMA 2GQQA 1URNA 1YJRA 3GIKA 1FWKA 2IMFA 1D9DA 2GQLA 1O7UA 4DCJB 2DHSA 1OC9A 3CCUS 2RF2A 2VODA 4OZJA 1IWAA 2YWKA 1TL1A 4F2RA 4K8RA 2ZHAA 1C1BA 1U26A 4C98A 3BYPA 4XIUA 2V8PA 3EURA 2ZEJA 1FESA 3TGZA 4JUZA 5K14B 1O8BA 2V63A 3MEDA 2AJFE 1RGVA 2W25A 1GXUA 1XIQA 2VCZA 3ELHA 2BTOT 4QCLA 1FNMA 1PQNA 4WK1A 1FHTA 4JI3J 1FE4A 1YEPA 5DDPC 4ZB8A 4OMFG 3EM1A 2C3YA 1XBSA 3H5UA 4IHUA 5D0RA 4NV5A 1YRTA 5D93A 3U6VA 5IC4B 2IMOA 1TL3B 5F8IA 1T0TV 4MT1A 1WKJA 2BR0A 5M2RA 1JZOA 2WVDA 3CJ3A 4DSIA 5F8LA 1R0BG 1U49A 1RAIB 2VC1A 1N2AA 3D6MB 1HWUA 1JLCB 1AAZA 1Y5LB 1NSQA 4TR1B 1DUGA 3A8KA 2NDOA 3AA8A 2DTJA 4LVOP 1VGLA 2C2MB 1IKXB 4ZPWR 5HVGA 2RRNA 4ZBDA 4FYXB 3H20A 3LWLA 3HVRA 3PX4A 3OVAA 2LQOA 4OYAA 2RLIA 4JI2J 2HHXA 3PV8A 4C3LA 3D6IA 3M8WA 2X3GA 3G6VA 4QPTA 4O44B 1E2YA 2Y1IA 2CQ4A 2DNNA 4YDXA 1MEKA 1QK8A 11GSA 2XS5A 4DR6F 2IAJB 3AB4B 4RUVA 1F9HA 1YQHA 2WW4A 5D4LA 2FGXA 5L8RC 3NGRA 3HD2A 3VI7A 5J2QA 3I87A 1UJ6A 2VONA 2HIYA 3QIPB 5F05A 4F0BA 2FPHX 5KOWA 1BX9A 3R1HA 1XMOF 1RT1B 3GFHA 1M3JA 3KUHA 1R0AA 1S77D 3L9VA 1CS4B 5L1KA 1NK9A 3CMES 1A2LA 3A12A 2XZDB 1APSA 1R27B 2G2OA 2RS8A 1HKAA 5KFOA 4EK2A 1NB2A 2GS8A 1NKCA 2XWXA 5A5KA 2PERA 3JXOA 1JKHA 1V2AA 3QRRA 3IXQA 2KP2A 4OYMA 4USIA 2HBQB 3BN7A 2GO8A 1YTYA 1IM6A 4V2NA 5DG9A 1Q1KA 5IT9Y 4CLZA 3MUMP 4LRFA 2A2SA 4X64F 4KE3A 3NGDA 1HBUB 4I7FA 3KK1B 3ILJA 4PUOA 2WBMA 2MZ1A 4B3RJ 2HSEB 3R9LA 3VZHA 4FS1A 1FNXH 2ZH8A 4O3QA 5H9EK 4CO1A 5KG5A 3PJWA 3BSAA 3HD5A 3DLBA 2ASYA 1RAAB 4Z7XA 3H5XA 3NWRA 1VIXA 3TZWA 2E9TA 3RRHA 1B4QA 1CJUA 5LMUF 5HP1B 3HVXA 2YANA 3LP2B 3OUYB 2FLPA 1AXDA 1Z2ZA 4IP1A 1GAOA 2QMXA 4F26A 4PG6A 2HMIB 2YWMA 5AXKA 2P5VA 3H2VE 1G7EA 3W8JA 1U0HA 3I5AA 1X8DA 3PH9A 3W66A 1LXJA 1XNQJ 4N7TA 4ZHRA 3UEMA 2B7BB 2LKZA 2H70A 2P9EA 1PA3A 2MBSA 2CNOB 2QLFB 4DPXA 1FWPA 1C0UA 5IMAA 5F0GA 4KDXA 4ANDA 3OTCA 4WZMA 3M8NA 1F3VA 1HWJA 2DD8S 2XHWA 1CEZA 4EIPA 4F0MA 1VQ7S 2EFQA 4A8XA 2AJ4A 1U1LA 5KOXA 3VQTA 4X4QA 4A8SA 4PWDB 2PFDA 4BHQA 3F9UA 1XERA 2HSMA 2MMOA 1M90T 1ZYQA 2AB6A 1TK5B 2L5LA 1CPZA 1T3OA 4Q44A 5J2MA 5L9NA 5CZXA 4DQIA 2Y1RI 5B0FA 1PAEX 1OKDA 4AT1B 2DCUB 1D0EA 22GSA 1RTIA 1S1VB 5KG2A 3GMGA 2PVQA 3Q8VA 1R6VA 4L72B 2ZH6A 5F8NA 1U87A 4BVXA 4GVLA 2KH9A 1F2EA 1XZOA 4XRDA 3UN5A 1Z9HA 1K3OA 1JJCB 1N6QA 1H7WA 2HHUA 3CYNA 3HDSA 3GYKA 5A2QY 4I5QA 3HT3A 1C1CB 3HK2A 3R7BB 2FHKA 3OD2A 2WSFC 4V2LA 1X5OA 4DSJA 2EWHA 1RQMA 4NLWA 5KFRA 3GNJA 3CGIA 3H0PA 3I9ZA 1SK2A 2H1BA 2HRNA 3F4SA 2B9XA 3OSNA 3N9UC 2CQDA 2AYBA 4JZQA 3D6TB 5CD4A 5CAXA 1P9QC 3T5JA 3FVYA 1UVIA 5J4UA 2KRBA 5FJ4A 4ANEA 2N5AA 2AT1B 1ZOTA 3E3EA 4C0BA 4GXZA 2QT7A 1SL0A 4KGIA 4PXDA 4B3OB 3JYTA 2DNLA 2DXEA 3EVOA 3DRNA 2BDPA 4IGJA 3F56A 3G96A 3FCVA 1HPZB 4F4AA 4NMXA 3GQCA 2GT6A 5GAEI 2OJLA 3BQ0A 2VG6A 1L5UA 3KEBA 2IMWP 3KLIA 1OO0B 2XO6A 3G8QA 2VOOA 5MLCV 5A8WA 4ER8A 4ECRA 2V4JB 3I0SA 3KH9A 1QTMA 4G9HA 4K50A 1TQLA 2UUCF 4DSRA 2MQNA 3A1YG 4IOCQ 4ZJLA 2IYIA 3SSRA 2E5GA 2VAFA 2FVRA 2KL8A 1F3AA 3L09A 4HI2A 5DBQA 1S6OA 2AAWA 3RAZA 2C2OB 3TUJC 3J7YI 1PL1A 1S0VA 1V5VA 4K5SA 3CEDA 1EJ7L 2ZZMA 1UWBA 1X4DA 4ZLLA 2CNKB 4JI5J 3Q89A 3AXMA 5KFPA 4M63A 2R37A 1YJUA 4K2XA 4MH3A 1M5KC 3MEGB 2TIRA 1WC6A 2AZ1A 3AD9C 4DLEA 3CF5Q 1YEXA 3V6HA 1Z7RA 1YJNS 4GF0A 2YNHA 2MQPA 4ILFA 3U1MA 2HNYA 1T03A 4KPCA 5IPGA 2DPIA 2VDIA 1X4GA 3P8WA 1HNIB 4KTQA 3QO9A 1I9DA 4TQSA 3RAMA 2CZ3A 4LMWA 3DRPA 1BQMA 4USKA 5CABA 4DSQA 3CCWA 2GMJA 1X5DA 4MKAA 1OY6A 4AFFA 3UVJA 2HVZA 2IJNA 4XTSA 2ZDPA 2RD5C 2ZWOA 1HNCA 4E8HA 5ETOA 4NA1A 4X62F 1XVQA 3EE2A 4V1Ak 4UOGA 3CIZA 3PR8A 2DH8A 2KZZA 3IK9A 4DSEA 2D74B 2ACYA 1Z2LA 3HHNB 2FHEA 1FO5A 3KLHB 2FLOA 2L6CA 3EZ5A 3W7BA 3DOMA 2WVFA 5AE1A 2ZD1A 2YH1A 5IPHA 3WYWA 2D9PA 4OX9F 2LRTA 2VLUA 1PMTA 3QJPA 3A8IA 4F3QA 4RBVA 1ZM9A 3FFIB 4C3MA 4M5NA 5CYMA 4RI6A 3QPMA 3NGSA 3MR3A 2J7WA 3KKFA 3RB0A 4OMVA 4NHZA 3R5JB 3EYTA 1RAFB 4RQRA 4ECCA 3G87A 2BJEA 3H4DA 1U8SA 5KT5A 1B4PA 2HVEA 1IBMF 5KN0A 1GT8A 2GA7A 4YUDA 1KFDA 1OQ3A 1L3KA 3NS6A 1L3TA 1OSDA 4HHHA 3H5SA 3PX6A 3MFHA 1HI1A 4WIQA 1EEMA 5DAKA 2CIMA 5EWGA 2R4FA 4POMA 1NHYA 3Q6OA 2G2YA 1IR2A 3I9V9 5J5NA 4C0OC 4UW2A 2AGOA 2XO7A 6GSUA 2DH7A 2I0XA 3IM9A 4AJ6A 3PJXA 5GAPD 3TAMB 1UJ5A 1UPPA 4PRFA 2DCLA 3QGHA 4WF9Q 3W2WB 2R0CA 4WFNQ 1VRUB 2A0FB 3HVNA 2H0GA 2GSQA 2IM3A 4DV4J 1Y6EA 2QGFB 4E8UA 3H25A 2JSXA 4LBPA 3ZRDA 3TZZA 1X0RA 3IC1A 4ICLA 2HVIA 5KFGA 4EZ9A 1GX5A 2VH7A 3Q23A 2XMAA 3ZZYA 4ISDA 3TKPA 3P96A 3TJ8A 2HAIA 4X4UA 4Y28C 2HHHF 4HOJA 4OZLA 2HQFA 1IJFB 1LW2B 3WIVA 4GQCA 1TL3A 2AJ1A 5AJ3F 4YN3B 3N6MA 4ZN1A 2HFNA 1ACMB 3TQ1A 3APOA 5J3RA 3SBMA 2IRYA 2YOIA 5LMNF 1B0PA 3DDNA 3IS9B 3KWMA 2K7JA 3PACA 4TR1A 2HBZB 3G9BA 2YXLA 2H73A 3D67A 3DLKB 3G2XA 4HZ4A 2VD1A 4K59A 1D8YA 3GA4A 2KHDA 4H4KA 1VIOA 3I9V2 1A9NB 4ZL9A 4XDDA 2DNRA 4O3PA 3O44A 4K7QA 1R3NA 1D09B 1AT1B 1GH8A 1B64A 4QU6A 4O44A 3V4IB 3OXFA 2KM8B 3EGZA 2AJ0A 1S4EA 2OPRA 3PYGA 3K5OA 2IAJA 4U96A 3M30B 2AHOB 4LL4B 4OD7A 2CAQA 5HBMB 4CO3A 1XIYA 1PKUA 3R7SB 2I6WA 3VWWA 3SIPB 3CD7A 2KVQE 1V98A 4MYUA 4PUAA 3IMQJ 3ZTLA 1TMJA 4HVZA 3WD6A 1U4BA 1CC8A 3QCPA 2H5EA 3I6AA 3M9OB 2CYYA 4CTAB 3HX9A 2A3JA 4KAIA 3D4TA 4NHWA 2ZH4A 2V32A 19GSA 4R5PB 5DZ6A 3TKSE 4YB5A 2E2MA 4DF4A 1OYEA 1HNBA 1TAUA 4FO5A 3OTEA 4K1FA 4ZXGA 2XCAA 1MG7A 3RRKA 2ALZA 2C28A 3AA9A 1SQGA 1OYJA 6AT1B 3DKDA 2HZEB 4JI4F 4PQ1A 2Y8YA 4KSEB 1HBUA 4NCGB 4RQXA 1WHYA 3KK1A 5ENUA 4DU8A 3V6JA 2W7OA 5JCUA 1GTIA 3AJDA 3JAMU 3DN9A 1BHNA 3D2WA 4LF7F 1OC8A 4W92B 2H75A 2W1BA 3R5GA 3N5BA 4M95A 1TKTB 2J9CA 2XMKA 2B8PA 3H1NA 2JFKA 2U1AA 1EKSA 2YKMB 5HP1A 1RP5A 4LF4J 3LWAA 4ELTA 3LP2A 3OUYA 3TNVA 3VZIA 2KG1A 1TKDB 2CNNB 9ATCB 1SUQB 3MF5A 2QTWA 4ECWA 2HMIA 2YQ3A 1JLGB 2UXCF 1TKZB 3DYAB 4DV5F 2V9KA 4RLEA 4ZJQA 5IV4A 2D7SA 1ZAVA 4KHMA 5ECOB 3T19A 4F03A 1B70B 1H72C 4OYBA 2RILA 3HPOA 3LXZA 2P6TA 1N0VC 4DLGA 3AQOA 3SV3A 4ECIA 3CE8A 2E7XA 4WKYA 5HVHA 1RU1A 3HHVA 3FZ9A 2ROEA 3MHYA 3TAPA 4X84A 1XW6A 1UEKA 1A7GE 4PWDA 5F06A 1QAXA 3TJBA 2DHAA 5G5EA 3OTOJ 3NL0A 1VF3A 4IG3B 1GUMA 1T4ZA 4X1UA 4PKDB 3FQKA 5JCGA 3PYFA 2OO4A 3I0RB 1GNEA 1S1VA 2DISA 1VMBA 3BSNA 2ZITA 3QYYA 5B7WA 8AT1B 4O23A 1GSUA 1SKWB 5G5FA 4K8MA 4MH2A 2XZTB 2Y0BB 2NXEA 3H79A 2K8GA 4R25A 3I32A 3NXZA 2PMTA 4HACB 5EDWA 1VQNS 1P1LA 3GFZA 3GKNA 3HULA 4RX6A 1VK8A 3Q8UA 1DRZA 1JB0C 4GKJF 3RPPA 1C1CA 5H1SV 4ZKAA 4WEYA 4AXIA 1YJ9S 2W01A 4P52A 2MKIA 4JI7J 4HH0A 3MWBA 4J2FA 2XSJB 3GP9A 2FY6A 2EPIA 4DFKA 3TOTA 2Z2ZA 2RU3A 2AKWB 5CCMA 2CVEA 1TDIA 4TOPA 2XMMA 4HI7A 4CW9A 4CLLA 3G6ES 2BUNA 2DKHA 2N5FA 4QWCA 1MNEA 3B4MA 5GMDA 1YKCA 2O89A 2ZM6F 4Y2CA 3JQJA 2B43A 4ZVTB 2OBKA 1K44A 1DFDA 2R3XA 4DG1B 1OS5A 1WEXA 1PYOB 3N9JA 4B3OA 2H1GA 1TUGB 1U2RA 4WTOB 4DPOA 5IT4A 3BSOA 4IRKA 4PG5A 4U8VA 5T14A 4G19A 2CA8A 3F3QA 6GSSA 2HSYA 5K5MA 4CT8A 1CBKA 3BZQA 3QR6A 2V4QA 3MPDA 1H0HB 1S0NA 3RB6A 1Y5NB 3CT9A 5CYJA 2XY7A 4C48A 2D1CA 2V4JA 2YNGB 3FK8A 2HFOA 4OFNA 1Q8IA 4CM2A 1H2UX 1A2MA 4ZP8A 3GJTB 4DUYJ 2YKOA 4ID5B 5H9FK 4JEDA 1J9BA 1M2AA 3R27A 3RUBL 1U2FA 4BLGA 2C22A 3G6XA 3IBWA 3NY0A 5J1NA 3R5BA 1H7XA 2WDUA 2EIQA 3GIXA 3VAJA 1H3DA 1WNEA 2DJ0A 3EYZA 4MYTA 2KXHA 2XWYA 4ZJOA 4DN0A 1DLOB 4IR1A 1M5OC 5LSOA 4WYWA 4RW6B 5EVOA 4A8MP 4C6AA 4XTTA 3S8SA 4ZMMA 3QAWA 4QOTA 2ZUPA 3Q22A 3OXGA 2FCHA 2G0JA 2CAJA 3W2VB 1S97A 2P8IA 3MD3A 3GX0A 3GV7B 2OAUA 3BREA 5HR3A 4Q43A 2A18A 2CPJA 4ANCA 4ZVPB 3DVXA 3UDVA 3A2XA 4O7HA 4N0VA 1SYRA 1XWGA 4MIBA 4IELA 1RTJB 2M8HA 5B6NA 2JL4A 4DQRA 2B6MA 1J08A 2H0IA 4CIOA 1S10A 2HSHA 2FC9A 2G4BA 1TTZA 3KM6A 2CPIA 4EFAC 1ROFA 3CJ5A 1HHQA 3IPZA 3ZTRA 1G6YA 3R5CA 2KJWA 1Q95G 4IO9Q 5A6WA 4KGKA 1K0NA 3EMTA 2PEHA 4I69A 1HA1A 4IW9A 3UFCX 3KLHA 2BBEA 2C0EA 3F44A 3CJ2A 3BV8A 1TV6B 1ZETA 2W2OP 3SV4A 3A3TA 3D1HA 2K1RB 3M8YA 2YKPA 1FRIA 3TEGA 2YJHA 2VFTA 2ILZA 2ZH2A 5COHA 2BXJA 2XC2A 2VPZB 1URRA 4DR6J 4HHUA 2GX8A 1B0TA 5KT2A 2R7TA 3FFIA 2LV3A 1MW7A 4ZVQB 3BDPA 2I81A 4RJVA 4WBFA 1SH0A 3LANA 1K0OA 5ECLB 2AEJA 3VFIA 1UJ4A 2I4AA 1ILOA 3DXBA 1XMOJ 1SB6A 1HYSB 3CNQP 4L74A 1NRKA 3OV7A 1RAHB 4ZIJA 4MMMA 1G7OA 2ZNZA 5CRHA 2AD9A 1VQLS 2H19A 5CCLA 4ED5A 5FDLB 4PPDA 2DNZA 4OZ1A 4ECTA 2HRKA 2CJYB 2AGQA 3D5MA 4HL9A 2H74A 1A2JA 2QSWA 2L57A 2NR0A 2K7KA 2UV8A 1TOFA 2BA9A 4I97A 1PGZA 4FVCA 3GV1A 1KEKA 1MN7A 1REGX 3PX0A 2ROGA 3GR1A 2QYCA 2BANB 4E0DA 4IYQA 3AOCA 4DX5A 3J81Y 1KBRA 1LK5A 3BO4A 4X64J 1Y11A 2J9DA 3TVZA 2R7SA 3A8EA 2ZKUA 1EWXA 3L7PA 4N77A 1VRUA 1AUDA 2CQPA 4OWYA 1FKPB 2CA9A 3ZTOA 3VGVA 4WK3A 7FD1A 1KQFB 3LTOA 4ECQA 1P9YA 2JDJA 2VCXA 4PXCA 1ELOA 1SC1B 1A8YA 2B1KA 1S49A 3TUPA 5LMUJ 3ZZXA 4JI8F 5H5RA 1GP1A 1NDPA 4LSLB 1SENA 4UOCA 2R7RA 2OTJS 3BBFA 2AIRB 1V6HA 4MMOA 1ULRA 1LW2A 4FZVA 5IMCA 1J5OB 5A8KB 2D3O1 1S3DA 4PQIA 4IH6A 5CHCB 1AROP 3B78A 3B4DA 4XPEA 3OLAA 3IS9A 1YQ1A 3HZGA 2BJ9A 4ZPCA 4XO0A 1J0FA 4TLRA 1S72S 4YEAA 2ASLA 5DVBA 3BCKA 2WCIA 3IA1A 1VBKA 3CJSA 1HBOA 2KYXA 4MIAA 3B8HA 3D66A 1RAJA 1FCAA 3HHLB 3LQVA 3BO3A 2OJ3A 2MGZB 4OZ3A 3Q18A 3PR5B 5LXRA 3KXDA 3KHHA 3V4IA 2GTUA 1S48A 4TW5A 4FYDA 3TUZC 2H8LA 2CJBA 2XMJA 1PSQA 2R8GA 2AU0A 4TU8A 5AIXA 5HBMA 1W25A 1ICEB 1S3RA 2HHTA 4TXOA 4Z2RA 1NK7A 3PR4A 2W7PA 5A4WA 4EDYA 5D3GB 4KFBA 1DSBA 1I94F 3M6UA 1K1QA 3WBZA 5D9WA 4DCPB 1NHOA 3NNAA 3ZZUA 4X0XA 1FTRA 2CADA 3LG6A 2HNZB 1FTCA 1GEHA 1VGYA 2Z2LA 3B82A 3D4MA 5FHIA 4J9QA 3JQMA 4O0IA 4QIEA 2PC6A 5E3AA 2VKRA 2GSRA 1VQ5S 2F51A 2DBCA 1IJEB 2M8DB 3J80U 4R5PA 2FJWA 5C2GA 4AJ8A 2YN1A 1XWBA 2PUKC 4IS0A 1NJXA 4DI6A 3THPA 1JZWA 2Z4PA 3BS9A 5C2CA 3DDKA 3R97A 1RWNB 2HZEA 2W8LA 5SZTA 2HXKA 3C46A 4NCGA 2O66A 2ACMA 3EWLA 2ASDA 2CPEA 1RWUA 4Q0BA 1LQ9A 4OO4A 1QY7A 2Z57B 1S4FA 1AXQA 4NZ6A 1RWPB 3M2VB 3CCZA 2F8EX 2LLZA 1JLQA 1F5CA 2Y9HA 2MQQA 3HSGA 4YQWA 4Z37A 4MNNA 4DEJA 2H71A 3HSZA 3MOZA 4UTGA 2VQFF 2YKMA 1Y3KA 2DO0A 2QN6B 2M5YA 2HQGA 4ECZA 1U24A 2EC2A 1TKDA 4RNFA 2LS5A 2V50A 2RKIB 1JLGA 1HNXJ 1JWWA 1TKZA 3DYAA 1SL1B 2UUCJ 2ZJQQ 2GC8A 3EMXA 5IQYA 1F3FA 5B0CA 1NKBA 1L3UA 3LUYA 3H8YA 1K8AT 1GH2A 2IYGA 1NK0A 2F9SA 1RA7A 4Q5NA 2VCQA 1ZBTA 2HI7A 3HJOA 2LECA 3LP0A 2HGLA 1FE0A 2ZBRA 1UWAA 1HBMB 3DOLB 4QU7A 3POTB 3ZZOA 2HQIA 4L75A 2E29A 3HYPA 1GMVA 2G1DA 3ENVA 4MLYA 3SEOA 2LU1A 3TOQA 1Q0NA 2K2PA 2OEKA 4ZB9A 5DCHA 2O8VB 4A48A 2M88A 3HFKA 1KOHA 3L3CA 4NLRA 4IG3A 3L0HA 4DSLA 3DLEB 5ETLA 3I0RA 1RCXB 4F4KA 1NM2A 2BACA 1VQYA 1X0FA 4LRCA 4I64A 1IQTA 1G3OA 3OFGA 1SKWA 2F7VA 1FRXA 5E4WA 4AJ7A 5FIIA 1RDRA 1JLBB 3ME7A 5KAKA 4JI1F 3I56S 1K0VA 3W64A 4BPYA 4EXJA 4NASA 4HACA 3MXHP 3P49B 2ZH5A 1OMSA 3DFEA 4ZCKA 4K2DA 1PSDA 4J9KA 4Q2MA 3D68A 3RJMB 4LSNA 1SQEA 2OA7A 1MMDA 4X62J 2IC3A 2Q79A 3L4BC 1S1UA 2E7WA 2KI2A 2ON5A 2XSJA 1FKOB 1SBRA 3AXKA 1RT4B 3T1AA 3GTUB 3L9SA 4C97A 4R0JA 2UXBJ 3A3PB 5KN2A 5AXMA 1XWCA 5FWGA 4RZRA 2DRBA 5DGAA 3FEYB 1BGXT 4ZPVR 2WK4A 4OX9J 2EEYA 2HAFA 2P31A 5F8HA 1THOA 1B4SA 3GYNA 1RISA 2ALBA 3FQLA 4CM0A 2WRMA 1ZL9A 4I6AA 2AW0A 3TA0A 5LL6d 2F1FA 4RWXA 2VJUA 4DR7F 4JU5A 4CY8A 3LPYA 4CO2A 2A10A 3J7A1 2KO1A 2C8UA 4MJCA 3GIMA 4DFPA 2XTJP 4DG1A 3GFKA 1FA0A 3OVSA 2CJKA 5H9FJ 2MB0B 1XMQF 2PIIA 8GSSA 3MURP 2K8VA 1SJ6A 2GSTA 1D9FA 4Y2IA 3G7IA 3E3XA 5KFDA 1VBYA 2K06A 3G6YA 4O92A 1R89A 2ZC3A 3PIOQ 2A4HA 2BX6A 1LWFB 4TN8A 1SKRB 1VQ9S 1R8CA 1PL2A 5K20B 4J7CA 3I43A 2YNGA 2KP1A 2BM1A 3KMOA 1NJZA 4X2BA 3OVBA 3W61A 5A4VA 4J9NA 4G6VB 1XCCA 2M70A 4RUAA 4ID5A 1M99A 2YY3A 5E3PA 1FO1A 2EIOA 3CO0P 1CQMA 1NSKL 2DRDA 1KONA 2C2RA 2JH3A 2YH0A 2KM8C 4KHPF 1U6FA 5BYQA 3NOCA 3J80Y 2RH3A 4KGXB 2HS4A 2HQ3A 2AJQB 2GZYA 1H2VZ 3IN5A 3LGNA 1WSRA 2EFVA 1HD2A 3THVA 1GTHA 2CQ2A 1DLOA 1T9WA 2HZCA 3CWJA 3W9JA 3D3BJ 4F0CA 5I3PA 4RW6A 3E51A 5AN1A 1OE8A 3IBFB 2N4DA 4ITSA 3QLHB 1MTCA 4HQZA 4EO8A 2H6XA 4MJAA 4NA3A 2PFFB 2BKOA 3W2VA 3KDOA 1K1SA 2OI2A 2HBYB 3I5CA 1FVJA 2R8KA 2HHHJ 1S7IA 4CLSA 4U7UD 2Y0SD 4KE5A 3KJYA 2V4RA 2EXUA 2RU9A 4N30A 4FH8A 3LWMA 1B3TA 2HWIA 3CUNA 5ADZA 4MPGA 5AJ3J 1NH7A 4DZ6A 1RXOB 4Q8FA 1AC1A 4K4YA 1NZAA 2KXNB 3C19A 2LDIA 4DQQA 4QZVB 5LMNJ 4K4TA 2FJDB 5BYRA 3MFIA 3UD3P 4AYBD 2R0PA 1XNRF 4ZLNA 3DM2B 1SL2B 3KJFB 4UT4A 2L9WA 2JC0A 3HKZD 2PN8A 4X4PA 2R0GA 3KXOA 4ZVRB 3DLHA 4HUAA 4XHMA 1WI6A 1BEDA 3F41A 1TI3A 5KFMA 4MA9A 4YAVA 1TV6A 3TUEA 3IV4A 2K1RA 4E8EA 1M2BA 4W4MA 1EEJA 4TRXA 3Q74A 1JNRB 1DY3A 4HTJA 2VL3A 5F8MA 4V19X 3WIUA 1FRHA 4MK9A 3LPEA 1WACA 4EWTA 2G0FA 1Q86T 2GQMA 3EVMA 3ZTQA 3HJMA 2FJBB 3Q19A 4Y2MA 2LQ9A 1FJGF 1KRPA 4OV1A 4RW4B 3TA2A 3FUYA 3TA1A 1HYSA 1UAWA 2VASA 2EFNA 5ECRB 1F0XA 5HL7Q 3LGCA 4TQRA 4QYRA 5GSSA 2V41A 3MM9B 1ZAXA 2HQDA 5FDLA 1JJ4A 4JBCA 1XBWA 2AYMA 2DH9A 2A4VA 3DRYA 1GTAA 2OMOA 2RUEA 2WAQD 1LWEB 3IAS9 4A4JA 1QD1A 5ECIB 5LSLA 3NEKA 3IWLA 3FRYA 3QPIA 2HHQA 2Z8QA 5BR8F 1WEYA 2BANA 4JI4J 2W9BB 4FXWA 2M80A 1IBKF 4TVEA 2L08A 2O5DA 2Y8WA 1N88A 4NA2A 1JLWA 4J9MA 1C2PA 2FZKB 4HZ2A 1RK4A 1U1PA 5IMZA 4KCAA 1FKPA 3IWNC 1X4BA 5GMKa 1TU7A 4BIKA 1N36F 4RO0A 4O5UA 2ZOGA 3MTKA 4TY8B 4FNIA 4ILLA 2OUGA 1W2IA 3KLVA 1UL3A 4Y0FA 5GAEU 4N41A 3GUSA 1VK3A 1M5PC 3MD1A 2NYHA 4LSLA 3FC9A 1R5AA 2AUVA 4NPOA 3VI5A 5ETNA 2UXCJ 2F3MA 1XOAA 2OTLS 2DR6A 4M1KA 1LBKA 4DV5J 2BMXA 3G4SS 4P10A 3GSTA 2XYHB 4YQUA 3G86A 1EARA 1AYEA 1J5OA 4OI1A 5A8KA 4O3SA 2LQQA 3M1GA 2D3UA 1K9MT 1N34F 4KIAA 4B17A 2YQ0A 3F63A 4O5QA 1C1BB 2REMA 5A8RA 4A46A 4IQ1A 3J7YU 2MYGA 4GRFA 2R4VA 4BBYA 4YKGA 3ET6B 4TU9A 2YV9A 3VVTA 3JSMB 2E66A 1K0DA 4K0KF 2XYPB 4NXNF 2LTKA 5HJYA 1MDIA 3HVSA 4F50A 3J7AN 1PFOA 10GSA 5KG3A 3T5KA 4GWRA 2CVDA 4OJ3A 2W4PA 5AGYA 1NXIA 3D6FB 3H42A 1UC7A 2MGZA 2C1EB 5CAAA 1U1KA 3BKTA 3NOFA 2IFQB 2LJAA 3I31A 3T3FA 4H4OB 2CPXA 4OZ0A 1RJJA 4JI6J 2CQ3A 3QAVA 3ADAC 2ZBPA 1V58A 4F3OA 1WIKA 5LT5A 1YZXA 3FGVA 4LFCF 1NLKL 1FD8A 1X0PA 1M7TA 3TOUA 1KBNA 2B0GA 5CO3A 2CQ1A 2DGVA 1PAUB 5D3GA 4RU2A 4GKJJ 5LCZA 1H74A 4K4SA 1QGVA 4Z2TA 3ERWA 2RM5A 3ENWA 3V5RA 4P75A 2N5BA 1RBOB 2BJ8A 2B7KA 4KH1B 4UOHA 2EIRA 2OPPB 3IC8A 2GT5A 1T95A 4RPFA 2VICA 2A1BA 1EZZB 2ZJPQ 4MH8A 3FR3A 2FUG2 3GPAA 4ZCMA 4NCAA 3DMJB 4B3TF 3HO1A 1BJXA 1KHWA 3MMAB 4CLUA 5JMNA 1DBYA 3CMAS 1RHRB 1NSWA 2CVIA 1QMVA 1S7HA 1A8LA 5HMZA 4RKUC 4YR3A 1LK7A 1XR5A 2BV3A 3M1VB 1GNWA 1NO8A 1ERVA 3QQCD 2ZM6J 4KAEA 5DALB 3AHPA 1M5VC 2CPHA 3NKYA 2FLNA 3GH9A 2GHPA 2MMZA 2RAQA 4DZDA 3FR6A 4P72A 2A2CA 5D96A 1SC3B 3HLUA 1ON4A 2E1RA 3FBFA 2ILYA 1XWAA 4G2EA 2YTCA 1U3IA 3LO3A 2K6VA 1MD4A 3P5BP 3T1HF 5CD4H 4X65F 3PYDA 3M8ZA 1F6TA 4HJMA 4IJ3A 1SL1A 5GAGI 1JIHA 4R0EA 3GCXP 2HWTA 2N7CA 5HSPA 4J9OA 3FBCA 2MHNA 5CXTA 3UDEA 2UVWA 1SD9A 3EPGA 3QRQA 4FQUA 4JOUA 3WT2A 4EF0A 4PUOB 1CJKB 4ZVOB 2X7IA 2MJNA 2JEJA 1Q5YA 1YBAA 3DOLA 3MMCB 4IKAA 2XG8A 2D3OR 2R7VA 2BZ2A 3RBTA 3BSCA 5J2NB 5G0RB 1Z1ZA 4GC7A 3HJPA 4F36A 1G6BA 1V3SA 4J9SA 2DJ2A 2DKIA 1FRMA 2JFDA 3WDOA 3WX8A 1UFKA 2ZNYA 2RVJA 4PXBA 2K18A 2CVKA 1VQ8S 4AE5A 4OFTA 3VALA 2WS2A 5JXSA 1PJ5A 2LEBA 1FDBA 2ZZNA 3FBEA 3HVVA 1LFPA 4AL5A 3L7UA 2YWFA 3DGPB 5HQLA 2GQ2A 4C4WA 4P2XA 2CV4A 3PZPA 4AL7A 2M52A 4YMEA 5E3QA 3GR0A 1Q7YT 1JLBA 1QFNA 3W8SA 1RKJA 2EFOA 3DD3A 4IH5A 4IQAA 2DGOA 3ENAA 3ISND 3V2UC 4YS2A 3FEZA 3NCRA 3OHBA 2V68A 1UPMB 3QIDA 3NNHA 3E9JB 4RBTA 1AW0A 1VR6A 1KR4A 2ES7A 1H38A 1DTTB 4P7VA 4LL1B 4XDCA 4ID8A 2OEMA 2YWNA 2UVRA 4PCQA 2F65A 1FKOA 5IT0A 2DR9A 1RT4A 4AL6A 4A8WA 1RHUB 1YSJA 5KFFA 2WONB 3TAQA 3NZNA 4ML1A 3IA0A 5D15A 3RR8A 4AUKA 2C80A 2OBIA 4QL7A 2DKOB 2XNRA 2YWIA 3QDNA 1S1XA 3V1WA 1TI1A 3ZLPA 2FVSA 4MKYA 5JWQB 1GK8A 4G0KA 3P45B 1QLNA 3MIXA 2IJRA 2OACA 1F5AA 4MP4A 5CYQB 2BM0A 5D6GA 2AV4A 2BJXA 1N6QB 4OHZA 3NGKA 3NP5A 5L39A 5K8NA 2LEPA 2X51A 3LQ7A 3C6UB 1NCLA 3PO5A 2JZSA 5ETPA 2CWXA 2PI5A 2QL9B 1JLAB 3MZIA 3PFOA 5G2ZA 2OD4A 2B9EA 1LWFA 2KFZA 3M8PB 3Q86A 1SKRA 1UVJA 5AE2A 2FY1A 1U48A 2EW9A 5C00A 3DXSX 3HHLC 2XM3A 1HIYA 2SXLA 5B08A 3AY8A 5HLFA 2XY5A 1JLVA 5ETKA 4WYLA 4PYAA 5H5QA 4OI6A 1TKXB 1Z7PA 4M5KA 2LEGA 3R3TA 4EGLA 4EYHB 4Q7AA 3BPSP 1VHFA 5L1JA 2ZNMA 2ZKTA 3FSYA 3D7SB 2J6UA 2DGXA 1SXLA 3F6FA 2AJQA 2CQBA 2AEMA 1NB7A 2CG8A 3BBCA 5IM0A 3EZUA 4G1PA 3JYTB 3CB4A 4K5RA 2F3JA 1GUHA 4JV0A 1T9YA 2L4CA 3W9HA 2HPUA 4MTPA 2KB2A 3KHGA 2C1YA 1E6VB 3KLIB 1P27B 3CC7S 2P0GA 5A8WB 4UY85 2E5HA 4JI8J 5CH7B 4MK8A 2HWHA 2B4PA 4M5GA 3LFLA 4DV6F 4QW8A 3G71S 3ERFA 4KYZA 1Q8LA 3S1TA 4LMVA 4GSSA 1XEZA 5DDLA 3C71A 5ID2A 1KKHA 4JR6A 5KFSA 4KC5A 1SC6A 2MLYA 3GV5B 3ONQA 3DNCA 4QIGA 2H1AA 2MQOA 3CCVS 5KFTA 4ECYA 3BYRA 3QNWB 2JEIA 1UWBB 3JTNA 4OQJA 2NUUG 4C8NA 3OL6A 1YBTA 3FRCA 4HU9A 3DM2A 1SL2A 3TDGA 3A2WA 4YY3F 3UBKA 4ZVGA 3D0HE 1S6QB 5B0GA 4RW8B 2K9FA 3KCMA 5DQSA 5F3TA 1T11A 5ETQA 2VCTA 3RAQA 1XWLA 2VD3A 3ZYWA 2ZC4A 2HNYB 3IWXA 3ISOA 3W8PA 2BJ1A 2CAIA 1UA5A 4XS1A 2P2CB 4WU2A 3F0IA 1YWXA 3QO9B 5LM7E 4D3HA 1HI8A 2G1HA 1TK8B 1GTEA 3BB5A 2OKQA 3IGNA 2FHMA 2Z2YB 3NWGA 4BVYB 1N33F 3GLJA 3KD0A 2PO4A 3I6PA 1SV5B 5IOWA 1ST9A 2XSFA 4RW4A 5IIZA 2CFXA 4DF8A 4A8YA 1I94J 3BBBA 4RNOA 2OMLA 4P9SA 4QR1A 1TK0B 1Q98A 4TN2A 3GJQB 4OCFA 2ON7A 3NMAA 2ZH1A 1K0AA 1YRXA 4DPTA 2W4CA 5GADI 1PKWA 3VPQA 5IT9U 3OPKA 1HD1A 1U0SA 5DS7A 1UA0A 4CWBA 3LYKA 1RKIA 2B3SA 4PXEA 1KTQA 2HK3A 1LWEA 5M2PA 1WELA 3ETMA 1QAYA 2X8CA 1LXNA 4CI0B 3P3DA 1U6BA 2FWHA 2XMVA 1X5EA 3P6YC 2W9BA 1KS2A 3S7RA 2DR8A 3ILIA 5EGYA 2PDAA 2ALYB 5F8JA 4GRSA 4F82A 1UVKA 2Z2MA 3GL3A 1S12A 5ECPB 1WSVA 2I1RA 2JWNA 2AJ2A 2L9DA 3RRGA 2YZUA 5L71A 3DHWC 4ZPDA 4IG0B 9GSSA 2UXDF 4FXVA 2VPXB 5DJBA 4N47A 2LA6A 4TY8A 4PQHA 4P2MA 4WFYA 3JCML 5J9BA 2VQFJ 4Q2LA 1WHVA 2VOPA 4K4VA 4ZP7A 1IWGA 3OL7A 3FCHA 1VBXA 2OSQA 4ID0A 2VDHA 4UZCA 3W5ZA 4I2TA 2TRCP 5LXYA 1C4AA 4NXMF 2YCDA 1SKSB 3MR6A 1LNQA 3RB4A 4B3SJ 5DQIA 1X4CA 5SUHA 3D0GE 3IG1B 2B7JA 3M9KA 5HMXA 4BDPA 3J7Z5 4DFMA 3CDEA 4IP6A 4CY6A 2XS7A 4NLUA 1XK8A 3ET6A 3GB0A 3LW5C 2ZZTA 4ZBBA 3JSMA 1NBEB 3U27A 2OE0A 2X8HA 3FKFA 2VU5A 2DRAA 3CTRA 3W1YC 2CT6A 4ICLB 2W8KA 1FDNA 1PJ6A 3UDLA 3C1SA 5JCWA 1JXLA 2IMKA 2N3LA 2IFQA 3U7JA 1U25A 2MQMA 4QWEA 5A2QU 4H4OA 1O5JA