3EWLA

Crystal structure of conserved protein bf1870 of unknown function from bacteroides fragilis
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
138
structure length
138
Chain Sequence
SNAGMKAADFTYVTVHGDNSRMSRLKAQYTMLFFYDPDCSNCRKFEKLFAEIPAFVEMVENGTLRVLAIYPDENREEWATKAVYMPQGWIVGWNKAGDIRTRQLYDIRATPTIYLLDGRKRVILKDTSMEQLIDYLAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords uncharacterized conserved protein BF1870
publication title Crystal Structure of Conserved protein BF1870 of Unknown Function from Bacteroides fragilis
rcsb
source organism Bacteroides fragilis
total genus 34
structure length 138
sequence length 138
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13098 Thioredoxin_2 Thioredoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3ewlA00
2L57A 1AQVA 3IE3A 5DJLA 1T3BA 5G31A 5G30A 4G9HA 4HQZA 4AJ8A 3ZZXA 3FR3A 1FO5A 5ENUA 2E2MA 1TRSA 1WPIA 6GSVA 4FO5A 4BVYA 2YJHA 4IHUA 16GSA 2IMEA 3LEFA 4ACSA 4G10A 1KNGA 1TK8B 2OADA 4V2MA 2YP6A 3FZ4A 3ZFBA 4KB3A 4K0NA 2LRTA 2FCHA 1USBA 3LGCA 3LWAA 2HLSA 3HA9A 3F4SA 2H71A 2LJAA 2YV9A 3C71A 1ILOA 3ZIJA 1GSSA 1KEBA 5F07A 1GSUA 2VCZA 2L6CA 4J56E 4RI6A 1K3OA 1M2BA 4WETA 3HY2A 1FHEA 4KCAA 4CW9A 1BG5A 3A2XA 2MMNA 3KJYA 1F2EA 1HQOA 2FA8A 3BD2A 4IBPA 3UARA 3US3A 6GSXA 4F82A 4FYBA 3WT1A 4YQVA 4ZB6A 2WULA 2VD1A 2FUG2 2V6OA 1XW6A 2AYTA 3QDNA 2HNLA 3D4TA 5DQYA 4HU9A 3QOUA 4V2LA 1QQ2A 2IPAA 2PN8A 2HZEA 2X8HA 5DBQA 1YKAA 3F0IA 3TKSA 1MEKA 2ES7A 4ECIA 4WF5A 1TU7A 6GSSA 4IVFA 1M99A 4JRRA 1QUWA 3GKXA 1PL2A 4ULXA 2JZTA 12GSA 1PA3A 2IFQB 2O8VB 4JZQA 3HJMA 1UA5A 2GZZA 5CRHA 4WKWA 3M0FA 1R5PA 3DRNA 1SD8A 4RQXA 3F4TA 5J5NA 3IK7A 1V57A 1TK0B 1JZDA 3QAWA 2MMOA 5AISA 1BJXA 1QXHA 4XS4B 1O8WA 9GSSA 2YCDA 3C1RA 4MJEA 1TI3A 1U3IA 2FA4A 4I5QA 1V58A 2DJ1A 4DSSB 2VCXA 2LKUA 2WJUA 4N11A 4MMMA 4DVCA 1S3CA 3D6IA 1SKSB 1F6MC 2NTOA 5HFGA 4KSMA 2TIRA 1K0NA 3PH9A 6GSUA 4ZB8A 4X0XA 3D22A 6GSYA 5ECHB 2MMAA 3GH9A 2VCQA 4RI7A 3KEBA 3FHKA 1SENA 3TRQA 5AN1A 4HQSA 3GHAA 1B4QA 1B9YC 2HSYA 1WIKA 2YANA 5L71A 3EMPA 3EU4A 5ELAA 4QL7A 4HUAA 2YWOA 4MPGA 5CYYA 2CV4A 1VGLA 3W8SA 1V9WA 2YWIA 2V6KA 3HJPA 2H6XA 5IMAA 1TW9A 3E0UA 4HU7A 4L0UA 1EV4A 3KMNA 5G1LA 3VWVA 1JFUA 1SK0A 8GSSA 3VWUA 5HR0A 4EVMA 5B6NA 5CO3A 1F37A 3WGXA 1FOVA 4YAPA 3IV4A 4GWRA 2YWMA 4GSNA 5IMVA 1M7TA 1GTUA 1BAYA 5A4WA 2P31A 4POKA 2LRCA 4BWSA 4OWYA 5JCUA 1VF1A 4K8MA 5GSSA 5KN2A 3WGEA 4POBA 3FY7A 2PGTA 3O76A 2VUPA 1X5DA 5CRGA 2H19A 3HCZA 4IELA 2A4VA 4P3YB 4F03A 1BEDA 3G7IA 3L9VA 4YQMA 1XIYA 3A3TA 1OVNA 4H86A 2FWGA 5ABRA 1G7OA 2Z9SA 3OR5A 4POLA 1AW9A 2H6YA 2B3SA 2VIMA 4PQHA 4BWQA 4JBBA 3TKSC 3GYKA 1ZOFA 3EWLA 5F06A 5D8IA 5B6MA 3LYPA 2YZHA 3ZMLA 1O6JA 2DMLA 3W8JA 4WEYA 3IDVA 3TRXA 2I3YA 2IFQA 3VK9A 3H93A 1NM3A 2H0HA 3GRXA 4HZ4A 2FY6A 1U88A 2E0QA 4XHMA 1YEPA 3IK9A 1XW5A 3QAGA 4ML6A 2JU5A 1JZWA 1DE2A 1K0BA 2FWEA 4Q5FA 2OBIA 2GDRA 4IGJA 2GSRA 5F05A 5DALA 4IW9A 4HJMA 4O5RA 2OACA 3VWXA 3CTFA 1K0OA 2B7KA 5ECOB 1ERWA 1LU4A 4MJAA 1GUHA 1B8XA 4IQ1A 3GURA 2CVDA 1TRWA 3IPZA 4YQUA 2H0GA 1PN9A 3HKRA 1Q98A 5KN3A 1EOGA 1BYEA 1GSEA 4IP6A 1GTIA 2QSIA 2FWHA 4WBRD 3TJBA 3HDCA 5FHIA 3L0HA 2KP2A 1ZYEA 2KOKA 3WT2A 5D93A 1A2MA 2NBSA 5FWGA 3RBTA 5G5FA 5IOWA 2E2GA 6GSWA 2R37A 4V1Ap 1ST9A 2YJ7A 2N5BA 1B48A 3ED3A 2C80A 1H75A 1GSYA 1RQMA 1B4PA 1GNEA 3KTLA 4MF6A 2L5LA 3QPMA 2K9FA 2F3MA 5D9VA 3EURA 3U6VA 2N5FA 2J23A 2BJXA 4HOJA 4KW6A 2MMZA 3GKMA 2OE0A 2HZEB 5LCZA 3ME8A 4K6XA 3BJ5A 1GNWA 4GQFA 3I43A 4PX1A 5E4WA 5IMZA 2ON7A 3IRAA 5IPHA 5C04A 3ME7A 1QK8A 5B7CA 3HYPA 5ID2B 3M9JA 10GSA 2IN3A 1WP0A 5KN0A 1K3LA 3EYTA 1O8XA 4WXTA 5IQYA 5A4UA 2WS2A 2HRNA 1XWKA 1S3DA 2AJQB 2KP1A 1J0FA 1A23A 2IL3A 4IJIA 3G9BA 4MCUA 1W89A 5DCGA 3TUEA 3IOSA 3IHQA 5DCHA 1OE8A 1DUGA 2B5XA 1YQ1A 4IS0A 5CRWA 3FW2A 2HI7A 1WRYA 5IO0A 4GSSA 2IMFA 3FRCA 2XBQA 1R7HA 4XRAA 3UJ1A 4JEDA 4GSTA 1U6TA 1ML6A 4MF5A 3DWVA 3NZNA 1G6WA 3M3MA 1MDJA 2VLVA 1JZRA 2WDUA 3D21A 1SD9A 3F6FA 4OO4A 2GSQA 3LG6A 1G6YA 1ACVA 5IMCA 2B6MA 4CDOA 1TXXA 2FD3A 3TRPA 2AAWA 3G7YA 3DEXA 3F8UA 3GX8A 1T00A 1DE1A 2R2JA 3TOUA 3RHBA 2B5YA 3I9V2 4NHWA 5CAXA 2DJ3A 4MP4A 3MSZA 2OE1A 4HDEA 2LQOA 2K8SA 1EWXA 3HXSA 4EDYA 3ZLPA 2K18A 2MBTA 4KDYA 5AIXA 1JHBA 3RDWA 4X1UA 1LBKA 4KA0A 4PQ1A 3Q18A 4EO3A 4RQRA 2VCWA 3K8NA 4IN0A 19GSA 3A5WA 1TI1A 2I1UA 4HEA2 2IJYA 1X5CA 1R5AA 2C0EA 3FK8A 1VF4A 5ECMB 2VOCA 3CRUA 2VL9A 4TR4A 2JZRA 4XS6A 2DJKA 2DBCA 2GQKA 3GH6A 4AF2A 4OCFA 1XBSA 2CZ3A 4FYCA 2DSAA 4ZB9A 1WE0A 4WF4A 3UVTA 3HVSA 1AIUA 2JZSA 2F9SA 1SL1B 3JCML 2VM1A 3QFAC 2AHEA 4L0WA 3LORA 4EXJA 1PX6A 2WRTA 4MJBA 1S3AA 3DYRA 4GXZA 1N2AA 2B7JA 3J7Yb 2TRCP 2V32A 3IBHA 1XWCA 5ID2A 3GNJA 1XVWA 1T7PB 4O7HA 2GZPA 4IKHA 2OKAA 1UVZA 2YOIA 4GQCA 4MH3A 3VFIA 1FW1A 4TR3A 2XC2A 2XHFA 1A0RP 5DAKA 4NMUA 2XPDA 4IP1A 1Z3EA 2GLRA 5D9TA 4LL4B 4JE1A 4MZWA 4ML1A 3ZMKA 4WR4A 4OCEA 4KCEA 4MZBA 5DALB 5GSTA 4AJ7A 2VLUA 2HSHA 3HVVA 2C3NA 1ZMAA 5HFIA 2XBIA 1HNCA 22GSA 2GZYA 2LV3A 5CNWA 1HD2A 2RIIA 3U5RE 2K8VA 3QD9A 3TJKA 4EKZA 5EL8A 5G2ZA 5ECNB 2VL2C 3TCOA 2IIYA 3CMIA 1GWCA 3TKPA 4V1Ag 1YF1A 1O7UA 4TKYA 3ZFLA 2L4QA 3QCPA 3HHVA 1FAAA 4ID0A 4JU5A 1ERTA 2J9HA 3FZ9A 2GT5A 3ZITA 5DJMA 1K0AA 3C7MA 3ZRDA 4G19A 3IA1A 2V1MA 3TKRA 4KUNA 3TGZA 2D2ZA 2I81A 5IMFA 2P5QA 4NHZA 2GS3A 2OBKA 5D9WA 2LS5A 1SL2B 1TRVA 2CQ9A 4PQIA 3APQA 4FYUA 18GSA 2R3XA 3I6AA 3D5JA 4WBJA 2GQMA 3RPPA 2WGRA 2YZUA 5J3RA 2FNOA 1FVKA 2DIZA 2PVQA 5LD0A 5IPGA 3VWWA 2VO4A 3KIJA 4MJCA 1J9BA 2PU9C 1PKWA 3VI5A 2G0FA 2OE3A 3A2WA 4F9ZA 3VLNA 1M2AA 4LLRA 2JADA 3VURA 3UOMA 1MDKA 3TJGA 3KTBA 3UBKA 1SJZA 1Q4JA 4GF0A 5B8AA 2EIQA 1K0CA 2PUKC 3N9JA 2H1DA 3DKSA 1FVJA 1DBYA 2M72A 1KTEA 2PPTA 1ERUA 1N8JA 2PWJA 3UEMA 2CVKA 2YN1A 5ECRB 1THOA 3H8QA 1A8YA 4N30A 3TKSE 2CAIA 1O73A 2EC4A 3EINA 2IMIA 3P90A 4TR0A 3FEUA 1A8LA 3ZL5A 3Q74A 3CSHA 1XWAA 4ISDA 5HFKA 3R2QA 3FR6A 4HJ2A 1OAZA 1GTAA 4KH7A 3S9FA 14GSA 2E7PA 1FG4A 2AUVA 3ERFA 1XZOA 4MABA 1XWBA 1VF2A 3LFLA 20GSA 2DJ2A 5AGYA 1NHYA 4POMA 3W6GA 1U87A 1GSFA 4KDXA 1TP9A 3BBYA 5F0GA 3IXRA 4YH2A 1HNBA 4N10A 4OMVA 2NDOA 1PSQA 3H79A 5H5QA 5E59A 3ZVJD 2H74A 3LXTA 1TOFA 4ZBBA 4F2IA 5KEJA 2CVBA 1J08A 2IMKA 4D73B 4MLYA 1GRXA 3F63A 4K2DA 1T8EB 3GN3A 1CQHA 2PMTA 1OYJA 1V2AA 1YF0A 3F4RA 2VAFA 4O32A 4EUYA 1SK2A 4TW5A 1WMJA 3CSJA 1PRXA 1UC7A 3FYGA 4NPBA 4DSRA 1A2LA 3Q6OA 4HZ2A 2OA7A 3H4KA 2LQQA 3E9JB 2VLTA 1JLWA 1XVQA 2OJLA 4ILFA 1R26A 3IAM2 2I4AA 3ZREA 1X0RA 2C8UA 4JR6A 2V2GA 5J4UA 1SJIA 2YWNA 4I97A 3UBLA 2XPEA 1QGVA 1CQGA 3TKQA 1YZXA 3IC4A 1TJDA 1M0UA 3BCIA 5ECLB 2L59A 2ZCTA 1TRUA 3WD6A 2CZ2A 3MNGA 2ZNMA 1AAZA 1SKWB 2LEGA 4NXIA 1MDIA 5IOXA 5ECIB 3MWHA 3UVHA 3QAVA 3J7Yk 2TRXA 4ECBA 4HS1A 2L6DA 3LSZA 3KP9A 3FKFA 3C8EA 4NAXA 4K1FA 1SKRB 3LXZA 5JWRB 2JACA 4PUFC 2P0GA 2JSZA 3CSIA 4TN8A 5F8BA 2YV7A 2MYGA 1PMTA 5DAKB 1BX9A 1GLPA 2P5RA 3KCMA 2KLXA 4TRXA 3L78A 1F3BA 2LNTA 2JSYA 4DEJA 3ISOA 3DXBA 4MZCA 5HR2A 4EC0A 3APOA 1Z5YE 3QMXA 2MBSA 3N5OA 1ZCPA 1YJ6A 1OE7A 3MDKA 3P8WA 2YNXA 5JCGA 4ZL7A 1PGTA 1XXUA 1EP8A 3UL3A 4V2NA 5GAND 3RPNA 2BTOT 1EZKA 2WCIA 1M9AA 1O81A 2NVLA 2GT6A 2LJKA 2RUEA 2H6ZA 4Z7XA 1RW1A 2KHPA 5D96A 2AB6A 4Q5QA 1WWJA 1F9MA 4N0VA 4TXOA 3QR6A 5EY6A 1YEXA 3CRTA 2MZCA 3ZIVA 1VF3A 3ZYWA 2FHEA 4OFNA 2H8LA 4D73A 2M46A 4RUVA 4TXVA 3AY8A 2C0GA 4I8BA 1QMVA 2C4JA 4BA7A 4ZBDA 3PGTA 3Q19A 4BL7A 2H30A 3QFBC 2HZFA 2C3TA 2CT6A 2C1YA 4OO5A 4FH8A 1T4ZA 2F8AA 2AV4A 5A5KA 5CREA 1TDIA 2A2SA 2O7KA 1V40A 2EIRA 2PVOC 3D4MA 1AQXA 1SYXA 4TVEA 3HZ4A 2PBJA 3KM6A 4PXOA 4Q5RA 3L9SA 1VRSD 1WJKA 2H73A 1GULA 1SYRA 3KGKA 3KXOA 4LMWA 5HQPA 1ERVA 5IIZA 3ERGA 5IM9A 3M9KA 1EGRA 4TR1A 3CYNA 2HFDA 4K7OA 5D73A 4EF0A 4KDUA 1AUCA 3EU3A 1YY7A 4I2TA 2F51A 5ECKB 2X64A 1M9BA 2V41A 3KD0A 3F3QA 5DQSA 1RK4A 3CBUA 4NV5A 3EC3A 1XWGA 3DD3A 3BCKA 1T4YA 3MAKA 2LJRA 3DIEA 1YDKA 13GSA 3LQ7A 2DJJA 2X8CA 3VPQA 4IJ3A 4JR4A 3GMFA 2K6VA 2B1KA 5G5EA 1AXDA 3NIVA 2DLXA 1WOUA 7GSSA 1ZGNA 2C3QA 1XOBA 1TTZA 2HXKA 4KGIA 2ZUPA 4K0GA 2CAQA 4PNGA 2CX3A 2R5GA 3UAPA 1QFNA 1T1VA 3KMOA 1SL0B 3GV1A 2O85A 2HYXA 3H1NA 3HJOA 4KNDA 3VPTA 1A0FA 3VI7A 2RUFA 3C1SA 1XPVA 1KBNA 3ERWA 3NOFA 5G1KA 2GGTA 3TJFA 4GTUA 1OC9B 4ZL9A 3M8NA 2WFCA 2ALBA 2RLIA 3PINA 2VD0A 2HT9A 2VCVA 3O3TA 4ZILA 4OFTA 5EVOA 2X8GA 3D0ZA 2H76A 2H0IA 1GP1A 4L5LA 4KX4A 2H1BA 1MD3A 1OKDA 4BVXA 3O6TA 1XOAA 1AC1A 2B5EA 2L4CA 4FIWA 4MPFA 3HD5A 1BQ7A 4F0BA 3TB2A 2RM5A 3GL3A 1EP7A 3KP8A 1MTCA 3WYWA 2EIOA 5GAPD 3GFKA 6GSTA 2H75A 4KSOA 4N0ZA 2REMA 4XTSA 4KAEA 2NPBA 4TOPA 1EOHA 3RAZA 1XCCA 3UMAA 5HR3A 1YKCA 1SJ6A 4PURA 4LL1B 3EVIA 3V1WA 1Y6EA 3LJRA 4MH2A 2C0DA 4YAVA 3DVXA 1Z7PA 3CXGA 1E2YA 5GZZB 1W4VA 1OC8A 2LRNA 4PNFA 2CX4A 2DJ0A 1MD4A 17GSA 1K3YA 1GUMA 5A4VA 2H72A 2LTKA 1NSWA 1ON4A 2QGVA 1AQWA 4G2EA 5CRDA 4EDZA 3KZQA 1Z7RA 2FWFA 2C0FA 1X9WB 3GSTA 4F0CA 3GTUB 2H1AA 4LA1A 3FZ5A 1Z6MA 2GSTA 2VL3A 2X99A 1JZOA 3L9UA 4J2FA 3A2VA 2H66A 4MK3A 3IAS2 5ECPB 5KN1A 4XCSA 1LJRA 1K0MA 4L5OA 2N5AA 3KH7A 11GSA 3TDGA 5JWOB 4WR5A 1GSDA 3GUSA 2VCTA 4K7IA 1A24A 5D9XA 1NHOA 3M1GA 1TK5B 4ZBAA 1IYHA 4PUAA 1GLQA 2GQLA 1IYIA 3GX0A 3ZVJA 4LMVA 5IMDA 1UN2A 2QKEA 4ZIJA 3LYKA 2M80A 1PL1A 2CA8A 2O87A 5H5RA 4CHSA 4OD7A 3FR9A 5ECQB 1E6BA 3BOAA 1X9MB 1URMA 1M2DA 1XW9A 2VM2A 1V98A 4TXOB 4L8EA 5LNKe 4NWYA 4GRFA 1NW2A 1FB0A 4MA9A 3PR8A 2IMDA 1JLVA 1B9XC 1EGOA 3EMXA 4BPYA 4ECCA 4EL1A 1I9DA 3IR4A 4XS4A 1PQNA 4OFMA 1OC9A 3I69A 4EE0A 1EEJA 4E8EA 4DSSA 2WB9A 4DSQA 4MDCA 5J41A 2B1LA 2H70A 3F3RA 2GVPA 5DDLA 5JWQB 1R4WA 3F9UA 3GL5A 3RHCA 2R6KA 1OC3A 4ZL8A 3SWLA 1ZZYA 4PGTA 4ZXGA 5COHA 1EEMA 2DC5A 3GKKA 3EE2A 1C72A 4XIHA 2HE3A 1TU8A 5B8BA 2HRFA 4TR1B 1PKZA 5INYA 4XS1A 3DVWA 5H5SA 4IQAA 3FZAA 4XRDA 1GUKA 1PD21 2GSSA 1GL8A 4QQ7A 3APSA 4K9ZA 1OKTA 3C73A 4K7NA 5HR1A 4Q5NA 1ABAA 5IO2A 4I6XA 1SK1A 3TOTA 2LSTA 2LUSA 3SBCA 1Z9HA 4HI7A 3G7JA 4O92A 5JCWA 1XFLA 1X5EA 2PERA 2L5OA 4AGSA 2O89A 1THXA 2H1GA 5ECSA 5AIVA 2R4VA 2QC7A 1Y25A 2WZ9A 3DGQA 1H4OA 3P2AA 2BMXA 1F3AA 1G0TA 1K0DA 3L4NA 4NV2A 1HNAA 2DIYA 4GLTA 2F8FA 1U3AA 2H01A 5J9CA 3HVXA 4AJ6A 1SU9A 1ZYQB 5ELGA 2JL4A 3P7XA 4X43A 3UIWA 3GIXA 3E3EA 3GTUA 2IWTA 1I5GA 1G7EA 4KE3A 5CP1A 5DVBA 4GCIA 2FGXA 4I2UA 1GH2A 1Z6NA 2A2RA 3F6DA 3GA4A 3GSSA 2KUCA 1GSQA 3GKNA 5FT3A 3WGDA 1DSBA 4E8HA 1X9SB 2LNSA 4ECJA 4QL9A 1HYUA 5EPFA 1PX7A 1GTBA 2DMMA 5C00A 4MF7A 3KH9A 5J9BA 2ON5A 3HZ8A 1TKDB 2FLSA 2YPMA 2I9HA 1ZL9A 2VL2A 3DMLA 3TJJA 1O85A 4J57E 2GTUA 1A2JA 1FB6A 3ZTLA 3CTGA 1EV9A 2G2QA 2RM6A
chains in the Genus database with same CATH superfamily
2L57A 1AQVA 3IE3A 5DJLA 1M3JA 1T3BA 5G31A 5G30A 4G9HA 4HQZA 4AJ8A 3ZZXA 3FR3A 1FO5A 5ENUA 2E2MA 1TRSA 1WPIA 6GSVA 4FO5A 4BVYA 2YJHA 4IHUA 16GSA 2IMEA 3LEFA 4ACSA 4G10A 1KNGA 1TK8B 2OADA 4V2MA 2YP6A 2R0GA 3FZ4A 3ZFBA 4KB3A 4K0NA 2LRTA 2FCHA 1USBA 3LGCA 3LWAA 2HLSA 3HA9A 3F4SA 2H71A 2LJAA 2YV9A 3C71A 1ILOA 3ZIJA 1GSSA 1KEBA 5F07A 1GSUA 2VCZA 2L6CA 4J56E 4RI6A 1K3OA 1M2BA 4WETA 3HY2A 1FHEA 4KCAA 4CW9A 1BG5A 3A2XA 2MMNA 3KJYA 1F2EA 1HQOA 2FA8A 3BD2A 4IBPA 3UARA 3US3A 6GSXA 4F82A 4FYBA 3WT1A 3IC8A 4YQVA 4ZB6A 2WULA 2VD1A 2FUG2 2V6OA 1XW6A 2AYTA 3QDNA 2HNLA 3D4TA 5DQYA 4HU9A 3QOUA 5BMUA 4V2LA 1QQ2A 2IPAA 2PN8A 2HZEA 2X8HA 5DBQA 1YKAA 3F0IA 3TKSA 1MEKA 2ES7A 4ECIA 4WF5A 4O5UA 1TU7A 6GSSA 4IVFA 1M99A 3HVNA 4JRRA 1QUWA 3GKXA 1PL2A 4ULXA 2JZTA 5KOXA 12GSA 1PA3A 2IFQB 2O8VB 4JZQA 3HJMA 1UA5A 2GZZA 5CRHA 4WKWA 3M0FA 1R5PA 3DRNA 1SD8A 4RQXA 3F4TA 5J5NA 3IK7A 1V57A 1TK0B 1JZDA 3QAWA 2MMOA 5AISA 1BJXA 1QXHA 4XS4B 1O8WA 9GSSA 2YCDA 3C1RA 4BIKA 4MJEA 1TI3A 1U3IA 2FA4A 4I5QA 1V58A 2DJ1A 4DSSB 2VCXA 2LKUA 2WJUA 4N11A 4MMMA 4DVCA 1S3CA 3D6IA 2UZ8A 1SKSB 1F6MC 2NTOA 5HFGA 4KSMA 2TIRA 1K0NA 3PH9A 6GSUA 4ZB8A 4X0XA 3D22A 6GSYA 5ECHB 2MMAA 3GH9A 2VCQA 4RI7A 3KEBA 3FHKA 1SENA 3TRQA 5AN1A 4HQSA 3GHAA 1B4QA 1B9YC 4K5SA 2HSYA 4CY8A 1WIKA 2YANA 5L71A 3EMPA 3EU4A 5ELAA 4QL7A 4HUAA 3A5IA 2YWOA 4MPGA 5CYYA 2CV4A 1VGLA 3W8SA 1V9WA 2YWIA 2V6KA 3HJPA 2H6XA 5IMAA 1TW9A 3E0UA 4HU7A 4L0UA 1EV4A 3KMNA 5G1LA 3VWVA 1JFUA 1SK0A 8GSSA 4Z2RA 3VWUA 5HR0A 4EVMA 5B6NA 5CO3A 1F37A 3WGXA 1FOVA 4YAPA 3IV4A 4GWRA 2YWMA 4GSNA 5IMVA 1M7TA 1GTUA 1BAYA 5A4WA 2P31A 4POKA 2LRCA 4BWSA 4OWYA 5JCUA 1VF1A 4K8MA 5GSSA 5KN2A 3WGEA 4POBA 3FY7A 2PGTA 3O76A 2VUPA 1X5DA 5CRGA 2H19A 3HCZA 4IELA 2A4VA 4P3YB 4F03A 1BEDA 3G7IA 3L9VA 4YQMA 1XIYA 3A3TA 1OVNA 4H86A 2FWGA 5ABRA 1G7OA 2Z9SA 3OR5A 4POLA 1AW9A 2H6YA 2B3SA 2VIMA 4PQHA 4BWQA 4JBBA 3TKSC 3GYKA 1ZOFA 3EWLA 5F06A 5D8IA 5B6MA 3LYPA 2YZHA 3ZMLA 1O6JA 2DMLA 3W8JA 4WEYA 3IDVA 3TRXA 2I3YA 2IFQA 3VK9A 3H93A 1NM3A 2H0HA 3GRXA 4HZ4A 1ZYPA 2FY6A 1U88A 2E0QA 4XHMA 1YEPA 3IK9A 1XW5A 3QAGA 4ML6A 2JU5A 1JZWA 1DE2A 1K0BA 2FWEA 4Q5FA 2OBIA 4BVYB 2GDRA 4IGJA 2GSRA 5F05A 5DALA 4IW9A 4HJMA 4O5RA 2OACA 3VWXA 3CTFA 1K0OA 2B7KA 5ECOB 1ERWA 1LU4A 4MJAA 1GUHA 1B8XA 4IQ1A 3GURA 2CVDA 1TRWA 3IPZA 4YQUA 2H0GA 1PN9A 3HKRA 1Q98A 5KN3A 1EOGA 1BYEA 1GSEA 4IP6A 1GTIA 2QSIA 2FWHA 4WBRD 3TJBA 3HDCA 5FHIA 3L0HA 2KP2A 1ZYEA 2KOKA 3WT2A 5D93A 1A2MA 2NBSA 5FWGA 3RBTA 5G5FA 5IOWA 2E2GA 6GSWA 2R37A 4V1Ap 1ST9A 2YJ7A 2N5BA 1B48A 3ED3A 2C80A 2HSMA 1H75A 1GSYA 1RQMA 1B4PA 1GNEA 3KTLA 4MF6A 2L5LA 3QPMA 2K9FA 2F3MA 5D9VA 3EURA 3U6VA 2N5FA 2J23A 2BJXA 4HOJA 4KW6A 2MMZA 3GKMA 2OE0A 2HZEB 5LCZA 3ME8A 4K6XA 3BJ5A 1GNWA 4GQFA 3I43A 4PX1A 5E4WA 5IMZA 2ON7A 5BRTA 3IRAA 5IPHA 5C04A 3ME7A 1QK8A 5B7CA 3HYPA 5ID2B 3M9JA 10GSA 2IN3A 1WP0A 5KN0A 1K3LA 3EYTA 1O8XA 4WXTA 2QA2A 5IQYA 5A4UA 2WS2A 2HRNA 1XWKA 1S3DA 2AJQB 2KP1A 1J0FA 1A23A 2IL3A 4IJIA 3G9BA 4MCUA 1W89A 5DCGA 3TUEA 3IOSA 3IHQA 5DCHA 1OE8A 1DUGA 2B5XA 1YQ1A 4IS0A 5CRWA 3FW2A 2HI7A 1WRYA 5IO0A 4GSSA 2IMFA 3FRCA 2XBQA 1R7HA 4XRAA 3UJ1A 4JEDA 4GSTA 1U6TA 1ML6A 4MF5A 3DWVA 3IHGA 3NZNA 1G6WA 3M3MA 1MDJA 2VLVA 1JZRA 2WDUA 3D21A 1SD9A 3F6FA 4OO4A 2GSQA 3LG6A 1G6YA 1ACVA 5IMCA 2B6MA 4CDOA 1TXXA 1XG8A 2FD3A 3TRPA 2AAWA 4YKFA 3G7YA 3DEXA 3F8UA 3GX8A 1T00A 1DE1A 2R2JA 3TOUA 3RHBA 2B5YA 3I9V2 4NHWA 5CAXA 2DJ3A 4MP4A 3MSZA 2OE1A 4HDEA 2LQOA 2K8SA 1EWXA 3HXSA 4EDYA 4G0IA 3ZLPA 2K18A 2MBTA 4KDYA 5AIXA 2X4AA 1JHBA 3RDWA 4X1UA 1LBKA 4KA0A 4PQ1A 3Q18A 4EO3A 4RQRA 2VCWA 3K8NA 4IN0A 19GSA 3A5WA 1TI1A 2I1UA 4HEA2 2IJYA 1X5CA 1R5AA 2C0EA 3FK8A 1VF4A 5ECMB 2VOCA 3CRUA 2VL9A 4TR4A 2JZRA 4XS6A 2DJKA 4K5RA 2DBCA 2GQKA 3GH6A 4AF2A 4OCFA 1XBSA 2CZ3A 4FYCA 2DSAA 4ZB9A 1WE0A 4WF4A 3UVTA 3HVSA 1AIUA 2JZSA 2F9SA 1SL1B 3JCML 2VM1A 3QFAC 2AHEA 4L0WA 3LORA 4EXJA 1PX6A 2WRTA 4MJBA 1S3AA 3DYRA 4GXZA 1N2AA 2B7JA 3J7Yb 2TRCP 2V32A 3IBHA 1XWCA 5ID2A 3GNJA 1XVWA 1T7PB 4O7HA 2GZPA 4O5QA 4IKHA 2OKAA 1UVZA 2YOIA 4GQCA 4MH3A 3VFIA 1FW1A 4TR3A 2XC2A 2XHFA 1A0RP 5DAKA 4NMUA 2XPDA 4IP1A 1Z3EA 2GLRA 5D9TA 4LL4B 4JE1A 4MZWA 4ML1A 3ZMKA 4WR4A 4OCEA 4KCEA 4MZBA 5DALB 5GSTA 4AJ7A 2VLUA 2HSHA 3HVVA 2C3NA 1ZMAA 5HFIA 2XBIA 1HNCA 22GSA 2GZYA 2LV3A 5CNWA 1HD2A 2DKHA 2RIIA 3U5RE 2K8VA 3QD9A 3TJKA 4EKZA 5EL8A 5G2ZA 5ECNB 2VL2C 3TCOA 2IIYA 3CMIA 1GWCA 3TKPA 4V1Ag 1YF1A 1O7UA 4TKYA 3ZFLA 2L4QA 2DKIA 3QCPA 3HHVA 1FAAA 4ID0A 4JU5A 1ERTA 2J9HA 3FZ9A 2GT5A 3ZITA 5DJMA 1K0AA 3C7MA 3ZRDA 4G19A 3IA1A 2V1MA 3TKRA 4KUNA 3TGZA 2D2ZA 2I81A 5IMFA 2P5QA 4NHZA 2GS3A 2OBKA 5D9WA 2LS5A 1SL2B 1TRVA 2CQ9A 4PQIA 3APQA 4FYUA 18GSA 2R3XA 3I6AA 3D5JA 4WBJA 2GQMA 3RPPA 2WGRA 2YZUA 5J3RA 2FNOA 1FVKA 2DIZA 2PVQA 5LD0A 5IPGA 3VWWA 4MNNA 2VO4A 3KIJA 4MJCA 1J9BA 2PU9C 1PKWA 3VI5A 2G0FA 2OE3A 3A2WA 4F9ZA 3VLNA 1M2AA 4LLRA 2JADA 3VURA 3UOMA 5KOWA 1MDKA 3TJGA 3KTBA 3UBKA 1SJZA 1Q4JA 4GF0A 5B8AA 2EIQA 1K0CA 1ZYNA 2PUKC 3N9JA 2H1DA 3DKSA 1FVJA 1DBYA 2M72A 1KTEA 2PPTA 1ERUA 1N8JA 2PWJA 3UEMA 2CVKA 2YN1A 5ECRB 1THOA 4KF9A 3H8QA 1A8YA 4N30A 3TKSE 2CAIA 1O73A 2EC4A 3EINA 2IMIA 3P90A 4TR0A 3FEUA 1A8LA 3ZL5A 3Q74A 3CSHA 1XWAA 4ISDA 5HFKA 3R2QA 3FR6A 4HJ2A 1OAZA 1GTAA 4KH7A 3S9FA 14GSA 2E7PA 1FG4A 3LW9A 2AUVA 3ERFA 1XZOA 4MABA 1XWBA 1VF2A 3LFLA 20GSA 2DJ2A 5AGYA 1NHYA 3EPTA 4POMA 3W6GA 1U87A 2R0PA 1GSFA 4KDXA 1TP9A 3BBYA 5F0GA 3IXRA 4YH2A 1HNBA 4N10A 4OMVA 2NDOA 1PSQA 3H79A 5H5QA 5E59A 3ZVJD 2H74A 3LXTA 1TOFA 4ZBBA 4F2IA 5KEJA 2CVBA 1J08A 2IMKA 4D73B 4MLYA 1S3RA 1GRXA 3F63A 4K2DA 1T8EB 3GN3A 4Z2TA 1CQHA 4G0LA 2PMTA 1OYJA 1V2AA 1YF0A 3F4RA 2VAFA 4O32A 4EUYA 1SK2A 4TW5A 1WMJA 3CSJA 4USSA 1PRXA 1UC7A 3FYGA 4NPBA 3R3EA 4DSRA 1A2LA 3Q6OA 2HRAA 4HZ2A 2OA7A 3H4KA 2LQQA 3E9JB 2VLTA 1JLWA 1XVQA 2OJLA 4ILFA 1R26A 3IAM2 2I4AA 3ZREA 1X0RA 2C8UA 4JR6A 2V2GA 5J4UA 1SJIA 2YWNA 4I97A 3UBLA 2XPEA 1QGVA 1CQGA 3TKQA 1YZXA 3IC4A 1TJDA 1M0UA 3BCIA 5ECLB 2L59A 2ZCTA 1TRUA 3WD6A 2CZ2A 3MNGA 2ZNMA 1AAZA 1SKWB 2LEGA 4NXIA 2X49A 1MDIA 5IOXA 5ECIB 3MWHA 3UVHA 3QAVA 3J7Yk 2TRXA 4ECBA 4HS1A 2L6DA 3LSZA 3KP9A 3FKFA 3C8EA 4NAXA 4K1FA 1SKRB 3LXZA 5JWRB 2JACA 4PUFC 2P0GA 2JSZA 3CSIA 4TN8A 5F8BA 2YV7A 2MYGA 1PMTA 5DAKB 1BX9A 1GLPA 2P5RA 3KCMA 2KLXA 4TRXA 3L78A 1F3BA 2LNTA 2JSYA 4G0KA 4EIQA 4DEJA 3ISOA 3DXBA 4MZCA 5HR2A 4EC0A 3APOA 1Z5YE 3QMXA 2MBSA 3N5OA 1ZCPA 1YJ6A 1OE7A 3MDKA 3P8WA 2YNXA 5JCGA 4ZL7A 1PGTA 1XXUA 1EP8A 4FQUA 3UL3A 4V2NA 5GAND 3RPNA 2BTOT 1EZKA 2WCIA 1M9AA 1O81A 2NVLA 2GT6A 2LJKA 2RUEA 2H6ZA 4Z7XA 1RW1A 2R0CA 2KHPA 5D96A 2AB6A 4BVXB 4Q5QA 1WWJA 1F9MA 4N0VA 4TXOA 3QR6A 5EY6A 1YEXA 3CRTA 2MZCA 3ZIVA 1VF3A 3ZYWA 2FHEA 4OFNA 2H8LA 4D73A 2M46A 4RUVA 4TXVA 3AY8A 2C0GA 4I8BA 1QMVA 2C4JA 4BA7A 4ZBDA 3PGTA 3Q19A 4BL7A 2H30A 3QFBC 2HZFA 2C3TA 2CT6A 2C1YA 4OO5A 4FH8A 1T4ZA 2F8AA 2AV4A 5A5KA 5CREA 1TDIA 2HRKA 2A2SA 2O7KA 1V40A 2EIRA 2PVOC 3D4MA 1AQXA 1SYXA 4TVEA 3HZ4A 2PBJA 3KM6A 4PXOA 4Q5RA 3L9SA 1VRSD 1WJKA 2H73A 1GULA 1SYRA 3KGKA 3KXOA 4LMWA 5HQPA 1ERVA 5IIZA 3ERGA 5IM9A 3M9KA 1EGRA 4TR1A 3CYNA 2HFDA 2QA1A 4K7OA 5D73A 4EF0A 4KDUA 4PTSA 1AUCA 3EU3A 1YY7A 4I2TA 2F51A 5ECKB 2X64A 1M9BA 1PN0A 2V41A 3KD0A 3F3QA 5DQSA 1RK4A 3CBUA 4NV5A 3EC3A 1XWGA 3DD3A 3BCKA 3PPUA 1T4YA 3MAKA 2LJRA 3DIEA 1YDKA 3CQFA 13GSA 3LQ7A 4Z2UA 2DJJA 2X8CA 3VPQA 4IJ3A 4JR4A 3GMFA 2K6VA 2B1KA 5G5EA 1AXDA 3NIVA 2DLXA 1WOUA 7GSSA 1ZGNA 2C3QA 1XOBA 1TTZA 2HXKA 4KGIA 2ZUPA 4K0GA 2CAQA 4PNGA 2CX3A 2R5GA 3UAPA 1QFNA 1T1VA 3KMOA 1SL0B 3GV1A 2O85A 4YKGA 2HYXA 3H1NA 3HJOA 4KNDA 3VPTA 1A0FA 3VI7A 2RUFA 3C1SA 1XPVA 1KBNA 3ERWA 3NOFA 5G1KA 2GGTA 3TJFA 4GTUA 1OC9B 4ZL9A 3M8NA 2WFCA 2ALBA 2RLIA 3PINA 2VD0A 2HT9A 2VCVA 3O3TA 4ZILA 4OFTA 5EVOA 2X8GA 3D0ZA 2H76A 2H0IA 1GP1A 4L5LA 4KX4A 2H1BA 1MD3A 1OKDA 4BVXA 3O6TA 1XOAA 1AC1A 2B5EA 2L4CA 4FIWA 4MPFA 3HD5A 1BQ7A 4F0BA 3TB2A 2RM5A 3GL3A 1EP7A 3KP8A 1MTCA 3WYWA 2EIOA 5GAPD 3GFKA 6GSTA 2H75A 4KSOA 4N0ZA 2REMA 4XTSA 4KAEA 2NPBA 4TOPA 1EOHA 3RAZA 1XCCA 3UMAA 5HR3A 1M3IA 1YKCA 1SJ6A 4PURA 4LL1B 3EVIA 3V1WA 1Y6EA 3LJRA 4MH2A 4HSCX 2C0DA 4YAVA 3DVXA 1Z7PA 3CXGA 1E2YA 5GZZB 1W4VA 1OC8A 2LRNA 4PNFA 2CX4A 2DJ0A 1MD4A 17GSA 1K3YA 1GUMA 5A4VA 3MYDA 2H72A 2LTKA 1NSWA 1ON4A 2QGVA 1AQWA 4G2EA 5CRDA 4EDZA 3KZQA 1Z7RA 2FWFA 2C0FA 1X9WB 3GSTA 4F0CA 3GTUB 2H1AA 4LA1A 3FZ5A 1Z6MA 2GSTA 2VL3A 2X99A 1JZOA 3L9UA 4J2FA 3A2VA 2H66A 4MK3A 3IAS2 5ECPB 5KN1A 4XCSA 1LJRA 1PFOA 1K0MA 4L5OA 2N5AA 3KH7A 1FOHA 11GSA 3TDGA 4K2XA 5JWOB 4WR5A 1GSDA 3GUSA 2VCTA 4K7IA 1A24A 4A5PA 5D9XA 1NHOA 3M1GA 1TK5B 4ZBAA 1IYHA 4PUAA 1GLQA 2GQLA 1IYIA 3GX0A 3ZVJA 4LMVA 5IMDA 1UN2A 2QKEA 4ZIJA 3LYKA 2M80A 1PL1A 2CA8A 2O87A 5H5RA 3FMWA 4CHSA 4OD7A 3FR9A 5ECQB 1E6BA 3BOAA 1X9MB 1URMA 1M2DA 1XW9A 2VM2A 1V98A 4TXOB 4L8EA 5LNKe 4NWYA 4GRFA 1NW2A 1FB0A 4MA9A 3PR8A 2IMDA 1JLVA 1B9XC 1EGOA 4BL7B 3EMXA 4BPYA 4ECCA 4EL1A 1I9DA 3IR4A 4XS4A 1PQNA 4OFMA 1OC9A 3I69A 4EE0A 1EEJA 4E8EA 4DSSA 2WB9A 4DSQA 4MDCA 5J41A 2B1LA 2H70A 3F3RA 2GVPA 5DDLA 5JWQB 1R4WA 3F9UA 3GL5A 3RHCA 2R6KA 1OC3A 4ZL8A 3SWLA 1ZZYA 4PGTA 4ZXGA 5COHA 1EEMA 2DC5A 3GKKA 3EE2A 1C72A 4XIHA 2HE3A 1TU8A 5B8BA 2HRFA 4TR1B 1PKZA 5INYA 4XS1A 3DVWA 5H5SA 4IQAA 3FZAA 4XRDA 1GUKA 1PD21 2GSSA 1GL8A 4QQ7A 3APSA 4K9ZA 1OKTA 3C73A 4K7NA 5HR1A 4Q5NA 1ABAA 4EIPA 4I6XA 5IO2A 1SK1A 3TOTA 2LSTA 2LUSA 3SBCA 1Z9HA 2A4HA 4HI7A 3G7JA 4O92A 5JCWA 1XFLA 1X5EA 2PERA 2L5OA 4ICYA 4AGSA 2O89A 1THXA 2H1GA 5ECSA 5AIVA 2R4VA 2QC7A 1Y25A 2WZ9A 3DGQA 1H4OA 3P2AA 2BMXA 1F3AA 1G0TA 1K0DA 3L4NA 4NV2A 1HNAA 2DIYA 4GLTA 2F8FA 1U3AA 2H01A 5J9CA 3HVXA 4AJ6A 3MIXA 4CY6A 1SU9A 1ZYQB 2A2PA 5ELGA 2JL4A 3P7XA 4X43A 3UIWA 3GIXA 3E3EA 3GTUA 4X4JA 2IWTA 1I5GA 1G7EA 4KE3A 5CP1A 5DVBA 4GCIA 2FGXA 4I2UA 1GH2A 1Z6NA 2A2RA 3F6DA 3GA4A 3GSSA 2KUCA 1GSQA 3GKNA 5FT3A 3WGDA 1DSBA 4E8HA 1X9SB 2LNSA 4ECJA 4QL9A 1HYUA 5EPFA 1PX7A 1GTBA 2DMMA 5C00A 4MF7A 3KH9A 5J9BA 2ON5A 3HZ8A 1TKDB 2FLSA 2YPMA 2I9HA 1ZL9A 2VL2A 3DMLA 3TJJA 1O85A 4J57E 2GTUA 1A2JA 1FB6A 3ZTLA 3CTGA 1EV9A 2G2QA 2RM6A
chains in the Genus database with same CATH topology
2L57A 1AQVA 3IE3A 5DJLA 1T3BA 5G31A 5G30A 4G9HA 4HQZA 4AJ8A 3ZZXA 3FR3A 1FO5A 5ENUA 2E2MA 1TRSA 1WPIA 6GSVA 4FO5A 4BVYA 2YJHA 4IHUA 16GSA 2IMEA 3LEFA 4ACSA 4G10A 1KNGA 1TK8B 2OADA 4V2MA 2YP6A 2R0GA 3FZ4A 3ZFBA 4KB3A 4K0NA 2LRTA 2FCHA 1USBA 3LGCA 3LWAA 2HLSA 3HA9A 3F4SA 2H71A 2LJAA 2YV9A 3C71A 1ILOA 3ZIJA 1GSSA 1KEBA 5F07A 1GSUA 2VCZA 2L6CA 4J56E 4RI6A 1K3OA 1M2BA 4WETA 3HY2A 1FHEA 4KCAA 4CW9A 1BG5A 3A2XA 2MMNA 3KJYA 1F2EA 1HQOA 2FA8A 3BD2A 4IBPA 3UARA 3US3A 6GSXA 4F82A 4FYBA 3WT1A 3IC8A 4YQVA 4ZB6A 2WULA 2VD1A 2FUG2 2V6OA 1XW6A 2AYTA 3QDNA 2HNLA 3D4TA 5DQYA 4HU9A 3QOUA 5BMUA 4V2LA 1QQ2A 2IPAA 2PN8A 2HZEA 2X8HA 5DBQA 1YKAA 3F0IA 3TKSA 1MEKA 2ES7A 4ECIA 4WF5A 4O5UA 1TU7A 6GSSA 4IVFA 1M99A 4JRRA 1QUWA 3GKXA 1PL2A 4ULXA 2JZTA 5KOXA 12GSA 1PA3A 2IFQB 2O8VB 4JZQA 3HJMA 1UA5A 2GZZA 5CRHA 4WKWA 3M0FA 1R5PA 3DRNA 1SD8A 4RQXA 3F4TA 5J5NA 3IK7A 1V57A 1TK0B 1JZDA 3QAWA 2MMOA 5AISA 1BJXA 1QXHA 4XS4B 1O8WA 9GSSA 2YCDA 3C1RA 4MJEA 1TI3A 1U3IA 2FA4A 4I5QA 1V58A 2DJ1A 4DSSB 2VCXA 2LKUA 2WJUA 4N11A 4MMMA 4DVCA 1S3CA 3D6IA 2UZ8A 1SKSB 1F6MC 2NTOA 5HFGA 4KSMA 2TIRA 1K0NA 3PH9A 6GSUA 4ZB8A 4X0XA 3D22A 6GSYA 5ECHB 2MMAA 3GH9A 2VCQA 4RI7A 3KEBA 3FHKA 1SENA 3TRQA 5AN1A 4HQSA 3GHAA 1B4QA 1B9YC 4K5SA 2HSYA 4CY8A 1WIKA 2YANA 5L71A 3EMPA 3EU4A 5ELAA 4QL7A 4HUAA 3A5IA 2YWOA 4MPGA 5CYYA 2CV4A 1VGLA 3W8SA 1V9WA 2YWIA 2V6KA 3HJPA 2H6XA 5IMAA 1TW9A 3E0UA 4HU7A 4L0UA 1EV4A 3KMNA 5G1LA 3VWVA 1JFUA 1SK0A 8GSSA 4Z2RA 3VWUA 5HR0A 4EVMA 5B6NA 5CO3A 1F37A 3WGXA 1FOVA 4YAPA 3IV4A 4GWRA 2YWMA 4GSNA 5IMVA 1M7TA 1GTUA 1BAYA 5A4WA 2P31A 4POKA 2LRCA 4BWSA 4OWYA 5JCUA 1VF1A 4K8MA 5GSSA 5KN2A 3WGEA 4POBA 3FY7A 2PGTA 3O76A 2VUPA 1X5DA 5CRGA 2H19A 3HCZA 4IELA 2A4VA 4P3YB 4F03A 1BEDA 3G7IA 3L9VA 4YQMA 1XIYA 3A3TA 1OVNA 4H86A 2FWGA 5ABRA 1G7OA 2Z9SA 3OR5A 4POLA 1AW9A 2H6YA 2B3SA 2VIMA 4PQHA 4BWQA 4JBBA 3TKSC 3GYKA 1ZOFA 3EWLA 5F06A 5D8IA 5B6MA 3LYPA 2YZHA 3ZMLA 1O6JA 2DMLA 3W8JA 4WEYA 3IDVA 3TRXA 2I3YA 2IFQA 3VK9A 3H93A 1NM3A 2H0HA 3GRXA 4HZ4A 1ZYPA 2FY6A 1U88A 2E0QA 4XHMA 1YEPA 3IK9A 1XW5A 3QAGA 4ML6A 2JU5A 1JZWA 1DE2A 1K0BA 2FWEA 4Q5FA 2OBIA 4BVYB 2GDRA 4IGJA 2GSRA 5F05A 5DALA 4IW9A 4HJMA 4O5RA 2OACA 3VWXA 3CTFA 1K0OA 2B7KA 5ECOB 1ERWA 1LU4A 4MJAA 1GUHA 1B8XA 4IQ1A 3GURA 2CVDA 1TRWA 3IPZA 4YQUA 2H0GA 1PN9A 3HKRA 1Q98A 5KN3A 1EOGA 1BYEA 1GSEA 4IP6A 1GTIA 2QSIA 2FWHA 4WBRD 3TJBA 3HDCA 5FHIA 3L0HA 2KP2A 1ZYEA 2KOKA 3WT2A 5D93A 1A2MA 2NBSA 5FWGA 3RBTA 5G5FA 5IOWA 2E2GA 6GSWA 2R37A 4V1Ap 1ST9A 2YJ7A 2N5BA 1B48A 3ED3A 2C80A 2HSMA 1H75A 1GSYA 1RQMA 1B4PA 1GNEA 3KTLA 4MF6A 2L5LA 3QPMA 2K9FA 2F3MA 5D9VA 3EURA 3U6VA 2N5FA 2J23A 2BJXA 4HOJA 4KW6A 2MMZA 3GKMA 2OE0A 2HZEB 5LCZA 3ME8A 4K6XA 3BJ5A 1GNWA 4GQFA 3I43A 4PX1A 5E4WA 5IMZA 2ON7A 5BRTA 3IRAA 5IPHA 5C04A 3ME7A 1QK8A 5B7CA 3HYPA 5ID2B 3M9JA 10GSA 2IN3A 1WP0A 5KN0A 1K3LA 3EYTA 1O8XA 4WXTA 2QA2A 5IQYA 5A4UA 2WS2A 2HRNA 1XWKA 1S3DA 2AJQB 2KP1A 1J0FA 1A23A 2IL3A 4IJIA 3G9BA 4MCUA 1W89A 5DCGA 3TUEA 3IOSA 3IHQA 5DCHA 1OE8A 1DUGA 2B5XA 1YQ1A 4IS0A 5CRWA 3FW2A 2HI7A 1WRYA 5IO0A 4GSSA 2IMFA 3FRCA 2XBQA 1R7HA 4XRAA 3UJ1A 4JEDA 4GSTA 1U6TA 1ML6A 4MF5A 3DWVA 3IHGA 3NZNA 1G6WA 3M3MA 1MDJA 2VLVA 1JZRA 2WDUA 3D21A 1SD9A 3F6FA 4OO4A 2GSQA 3LG6A 1G6YA 1ACVA 5IMCA 2B6MA 4CDOA 1TXXA 2FD3A 3TRPA 2AAWA 4YKFA 3G7YA 3DEXA 3F8UA 3GX8A 1T00A 1DE1A 2R2JA 3TOUA 3RHBA 2B5YA 3I9V2 4NHWA 5CAXA 2DJ3A 4MP4A 3MSZA 2OE1A 4HDEA 2LQOA 2K8SA 1EWXA 3HXSA 4EDYA 4G0IA 3ZLPA 2K18A 2MBTA 4KDYA 5AIXA 2X4AA 1JHBA 3RDWA 4X1UA 1LBKA 4KA0A 4PQ1A 3Q18A 4EO3A 4RQRA 2VCWA 3K8NA 4IN0A 19GSA 3A5WA 1TI1A 2I1UA 4HEA2 2IJYA 1X5CA 1R5AA 2C0EA 3FK8A 1VF4A 5ECMB 2VOCA 3CRUA 2VL9A 4TR4A 2JZRA 4XS6A 2DJKA 4K5RA 2DBCA 2GQKA 3GH6A 4AF2A 4OCFA 1XBSA 2CZ3A 4FYCA 2DSAA 4ZB9A 1WE0A 4WF4A 3UVTA 3HVSA 1AIUA 2JZSA 2F9SA 1SL1B 3JCML 2VM1A 3QFAC 2AHEA 4L0WA 3LORA 4EXJA 1PX6A 2WRTA 4MJBA 1S3AA 3DYRA 4GXZA 1N2AA 2B7JA 3J7Yb 2TRCP 2V32A 3IBHA 1XWCA 5ID2A 3GNJA 1XVWA 1T7PB 4O7HA 2GZPA 4O5QA 4IKHA 2OKAA 1UVZA 2YOIA 4GQCA 4MH3A 3VFIA 1FW1A 4TR3A 2XC2A 2XHFA 1A0RP 5DAKA 4NMUA 2XPDA 4IP1A 1Z3EA 2GLRA 5D9TA 4LL4B 4JE1A 4MZWA 4ML1A 3ZMKA 4WR4A 4OCEA 4KCEA 4MZBA 5DALB 5GSTA 4AJ7A 2VLUA 2HSHA 3HVVA 2C3NA 1ZMAA 5HFIA 2XBIA 1HNCA 22GSA 2GZYA 2LV3A 5CNWA 1HD2A 2DKHA 2RIIA 3U5RE 2K8VA 3QD9A 3TJKA 4EKZA 5EL8A 5G2ZA 5ECNB 2VL2C 3TCOA 2IIYA 3CMIA 1GWCA 3TKPA 4V1Ag 1YF1A 1O7UA 4TKYA 3ZFLA 2L4QA 2DKIA 3QCPA 3HHVA 1FAAA 4ID0A 4JU5A 1ERTA 2J9HA 3FZ9A 2GT5A 3ZITA 5DJMA 1K0AA 3C7MA 3ZRDA 4G19A 3IA1A 2V1MA 3TKRA 4KUNA 3TGZA 2D2ZA 2I81A 5IMFA 2P5QA 4NHZA 2GS3A 2OBKA 5D9WA 2LS5A 1SL2B 1TRVA 2CQ9A 4PQIA 3APQA 4FYUA 18GSA 2R3XA 3I6AA 3D5JA 4WBJA 2GQMA 3RPPA 2WGRA 2YZUA 5J3RA 2FNOA 1FVKA 2DIZA 2PVQA 5LD0A 5IPGA 3VWWA 4MNNA 2VO4A 3KIJA 4MJCA 1J9BA 2PU9C 1PKWA 3VI5A 2G0FA 2OE3A 3A2WA 4F9ZA 3VLNA 1M2AA 4LLRA 2JADA 3VURA 3UOMA 5KOWA 1MDKA 3TJGA 3KTBA 3UBKA 1SJZA 1Q4JA 4GF0A 5B8AA 2EIQA 1K0CA 1ZYNA 2PUKC 3N9JA 2H1DA 3DKSA 1FVJA 1DBYA 2M72A 1KTEA 2PPTA 1ERUA 1N8JA 2PWJA 3UEMA 2CVKA 2YN1A 5ECRB 1THOA 4KF9A 3H8QA 1A8YA 4N30A 3TKSE 2CAIA 1O73A 2EC4A 3EINA 2IMIA 3P90A 4TR0A 3FEUA 1A8LA 3ZL5A 3Q74A 3CSHA 1XWAA 4ISDA 5HFKA 3R2QA 3FR6A 4HJ2A 1OAZA 1GTAA 4KH7A 3S9FA 14GSA 2E7PA 1FG4A 3LW9A 2AUVA 3ERFA 1XZOA 4MABA 1XWBA 1VF2A 3LFLA 20GSA 2DJ2A 5AGYA 1NHYA 3EPTA 4POMA 3W6GA 1U87A 2R0PA 1GSFA 4KDXA 1TP9A 3BBYA 5F0GA 3IXRA 4YH2A 1HNBA 4N10A 4OMVA 2NDOA 1PSQA 3H79A 5H5QA 5E59A 3ZVJD 2H74A 3LXTA 1TOFA 4ZBBA 4F2IA 5KEJA 2CVBA 1J08A 2IMKA 4D73B 4MLYA 1GRXA 3F63A 4K2DA 1T8EB 3GN3A 4Z2TA 1CQHA 4G0LA 2PMTA 1OYJA 1V2AA 1YF0A 3F4RA 2VAFA 4O32A 4EUYA 1SK2A 4TW5A 1WMJA 3CSJA 4USSA 1PRXA 1UC7A 3FYGA 4NPBA 3R3EA 4DSRA 1A2LA 3Q6OA 2HRAA 4HZ2A 2OA7A 3H4KA 2LQQA 3E9JB 2VLTA 1JLWA 1XVQA 2OJLA 4ILFA 1R26A 3IAM2 2I4AA 3ZREA 1X0RA 2C8UA 4JR6A 2V2GA 5J4UA 1SJIA 2YWNA 4I97A 3UBLA 2XPEA 1QGVA 1CQGA 3TKQA 1YZXA 3IC4A 1TJDA 1M0UA 3BCIA 5ECLB 2L59A 2ZCTA 1TRUA 3WD6A 2CZ2A 3MNGA 2ZNMA 1AAZA 1SKWB 2LEGA 4NXIA 2X49A 1MDIA 5IOXA 5ECIB 3MWHA 3UVHA 3QAVA 3J7Yk 2TRXA 4ECBA 4HS1A 2L6DA 3LSZA 3KP9A 3FKFA 3C8EA 4NAXA 4K1FA 1SKRB 3LXZA 5JWRB 2JACA 4PUFC 2P0GA 2JSZA 3CSIA 4TN8A 5F8BA 2YV7A 2MYGA 1PMTA 5DAKB 1BX9A 1GLPA 2P5RA 3KCMA 2KLXA 4TRXA 3L78A 1F3BA 2LNTA 2JSYA 4G0KA 4EIQA 4DEJA 3ISOA 3DXBA 4MZCA 5HR2A 4EC0A 3APOA 1Z5YE 3QMXA 2MBSA 3N5OA 1ZCPA 1YJ6A 1OE7A 3MDKA 3P8WA 2YNXA 5JCGA 4ZL7A 1PGTA 1XXUA 1EP8A 4FQUA 3UL3A 4V2NA 5GAND 3RPNA 2BTOT 1EZKA 2WCIA 1M9AA 1O81A 2NVLA 2GT6A 2LJKA 2RUEA 2H6ZA 4Z7XA 1RW1A 2R0CA 2KHPA 5D96A 2AB6A 4BVXB 4Q5QA 1WWJA 1F9MA 4N0VA 4TXOA 3QR6A 5EY6A 1YEXA 3CRTA 2MZCA 3ZIVA 1VF3A 3ZYWA 2FHEA 4OFNA 2H8LA 4D73A 2M46A 4RUVA 4TXVA 3AY8A 2C0GA 4I8BA 1QMVA 2C4JA 4BA7A 4ZBDA 3PGTA 3Q19A 4BL7A 2H30A 3QFBC 2HZFA 2C3TA 2CT6A 2C1YA 4OO5A 4FH8A 1T4ZA 2F8AA 2AV4A 5A5KA 5CREA 1TDIA 2HRKA 2A2SA 2O7KA 1V40A 2EIRA 2PVOC 3D4MA 1AQXA 1SYXA 4TVEA 3HZ4A 2PBJA 3KM6A 4PXOA 4Q5RA 3L9SA 1VRSD 1WJKA 2H73A 1GULA 1SYRA 3KGKA 3KXOA 4LMWA 5HQPA 1ERVA 5IIZA 3ERGA 5IM9A 3M9KA 1EGRA 4TR1A 3CYNA 2HFDA 2QA1A 4K7OA 5D73A 4EF0A 4KDUA 4PTSA 1AUCA 3EU3A 1YY7A 4I2TA 2F51A 5ECKB 2X64A 1M9BA 1PN0A 2V41A 3KD0A 3F3QA 5DQSA 1RK4A 3CBUA 4NV5A 3EC3A 1XWGA 3DD3A 3BCKA 3PPUA 1T4YA 3MAKA 2LJRA 3DIEA 1YDKA 13GSA 3LQ7A 4Z2UA 2DJJA 2X8CA 3VPQA 4IJ3A 4JR4A 3GMFA 2K6VA 2B1KA 5G5EA 1AXDA 3NIVA 2DLXA 1WOUA 7GSSA 1ZGNA 2C3QA 1XOBA 1TTZA 2HXKA 4KGIA 2ZUPA 4K0GA 2CAQA 4PNGA 2CX3A 2R5GA 3UAPA 1QFNA 1T1VA 3KMOA 1SL0B 3GV1A 2O85A 4YKGA 2HYXA 3H1NA 3HJOA 4KNDA 3VPTA 1A0FA 3VI7A 2RUFA 3C1SA 1XPVA 1KBNA 3ERWA 3NOFA 5G1KA 2GGTA 3TJFA 4GTUA 1OC9B 4ZL9A 3M8NA 2WFCA 2ALBA 2RLIA 3PINA 2VD0A 2HT9A 2VCVA 3O3TA 4ZILA 4OFTA 5EVOA 2X8GA 3D0ZA 2H76A 2H0IA 1GP1A 4L5LA 4KX4A 2H1BA 1MD3A 1OKDA 4BVXA 3O6TA 1XOAA 1AC1A 2B5EA 2L4CA 4FIWA 4MPFA 3HD5A 1BQ7A 4F0BA 3TB2A 2RM5A 3GL3A 1EP7A 3KP8A 1MTCA 3WYWA 2EIOA 5GAPD 3GFKA 6GSTA 2H75A 4KSOA 4N0ZA 2REMA 4XTSA 4KAEA 2NPBA 4TOPA 1EOHA 3RAZA 1XCCA 3UMAA 5HR3A 1YKCA 1SJ6A 4PURA 4LL1B 3EVIA 3V1WA 1Y6EA 3LJRA 4MH2A 2C0DA 4YAVA 3DVXA 1Z7PA 3CXGA 1E2YA 5GZZB 1W4VA 1OC8A 2LRNA 4PNFA 2CX4A 2DJ0A 1MD4A 17GSA 1K3YA 1GUMA 5A4VA 3MYDA 2H72A 2LTKA 1NSWA 1ON4A 2QGVA 1AQWA 4G2EA 5CRDA 4EDZA 3KZQA 1Z7RA 2FWFA 2C0FA 1X9WB 3GSTA 4F0CA 3GTUB 2H1AA 4LA1A 3FZ5A 1Z6MA 2GSTA 2VL3A 2X99A 1JZOA 3L9UA 4J2FA 3A2VA 2H66A 4MK3A 3IAS2 5ECPB 5KN1A 4XCSA 1LJRA 1K0MA 4L5OA 2N5AA 3KH7A 1FOHA 11GSA 3TDGA 4K2XA 5JWOB 4WR5A 1GSDA 3GUSA 2VCTA 4K7IA 1A24A 4A5PA 5D9XA 1NHOA 3M1GA 1TK5B 4ZBAA 1IYHA 4PUAA 1GLQA 2GQLA 1IYIA 3GX0A 3ZVJA 4LMVA 5IMDA 1UN2A 2QKEA 4ZIJA 3LYKA 2M80A 1PL1A 2CA8A 2O87A 5H5RA 3FMWA 4CHSA 4OD7A 3FR9A 5ECQB 1E6BA 3BOAA 1X9MB 1URMA 1M2DA 1XW9A 2VM2A 1V98A 4TXOB 4L8EA 5LNKe 4NWYA 4GRFA 1NW2A 1FB0A 4MA9A 3PR8A 2IMDA 1JLVA 1B9XC 1EGOA 4BL7B 3EMXA 4BPYA 4ECCA 4EL1A 1I9DA 3IR4A 4XS4A 1PQNA 4OFMA 1OC9A 3I69A 4EE0A 1EEJA 4E8EA 4DSSA 2WB9A 4DSQA 4MDCA 5J41A 2B1LA 2H70A 3F3RA 2GVPA 5DDLA 5JWQB 1R4WA 3F9UA 3GL5A 3RHCA 2R6KA 1OC3A 4ZL8A 3SWLA 1ZZYA 4PGTA 4ZXGA 5COHA 1EEMA 2DC5A 3GKKA 3EE2A 1C72A 4XIHA 2HE3A 1TU8A 5B8BA 2HRFA 4TR1B 1PKZA 5INYA 4XS1A 3DVWA 5H5SA 4IQAA 3FZAA 4XRDA 1GUKA 1PD21 2GSSA 1GL8A 4QQ7A 3APSA 4K9ZA 1OKTA 3C73A 4K7NA 5HR1A 4Q5NA 1ABAA 4EIPA 4I6XA 5IO2A 1SK1A 3TOTA 2LSTA 2LUSA 3SBCA 1Z9HA 2A4HA 4HI7A 3G7JA 4O92A 5JCWA 1XFLA 1X5EA 2PERA 2L5OA 4ICYA 4AGSA 2O89A 1THXA 2H1GA 5ECSA 5AIVA 2R4VA 2QC7A 1Y25A 2WZ9A 3DGQA 1H4OA 3P2AA 2BMXA 1F3AA 1G0TA 1K0DA 3L4NA 4NV2A 1HNAA 2DIYA 4GLTA 2F8FA 1U3AA 2H01A 5J9CA 3HVXA 4AJ6A 3MIXA 4CY6A 1SU9A 1ZYQB 2A2PA 5ELGA 2JL4A 3P7XA 4X43A 3UIWA 3GIXA 3E3EA 3GTUA 4X4JA 2IWTA 1I5GA 1G7EA 4KE3A 5CP1A 5DVBA 4GCIA 2FGXA 4I2UA 1GH2A 1Z6NA 2A2RA 3F6DA 3GA4A 3GSSA 2KUCA 1GSQA 3GKNA 5FT3A 3WGDA 1DSBA 4E8HA 1X9SB 2LNSA 4ECJA 4QL9A 1HYUA 5EPFA 1PX7A 1GTBA 2DMMA 5C00A 4MF7A 3KH9A 5J9BA 2ON5A 3HZ8A 1TKDB 2FLSA 2YPMA 2I9HA 1ZL9A 2VL2A 3DMLA 3TJJA 1O85A 4J57E 2GTUA 1A2JA 1FB6A 3ZTLA 3CTGA 1EV9A 2G2QA 2RM6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L57 A;  1AQV A;  3IE3 A;  5DJL A;  1T3B A;  5G31 A;  5G30 A;  4G9H A;  4HQZ A;  4AJ8 A;  3ZZX A;  3FR3 A;  1FO5 A;  5ENU A;  2E2M A;  1TRS A;  1WPI A;  6GSV A;  4FO5 A;  4BVY A;  2YJH A;  4IHU A;  16GS A;  2IME A;  3LEF A;  4ACS A;  4G10 A;  1KNG A;  1TK8 B;  2OAD A;  4V2M A;  2YP6 A;  3FZ4 A;  3ZFB A;  4KB3 A;  4K0N A;  2LRT A;  2FCH A;  1USB A;  3LGC A;  3LWA A;  2HLS A;  3HA9 A;  3F4S A;  2H71 A;  2LJA A;  2YV9 A;  3C71 A;  1ILO A;  3ZIJ A;  1GSS A;  1KEB A;  5F07 A;  1GSU A;  2VCZ A;  2L6C A;  4J56 E;  4RI6 A;  1K3O A;  1M2B A;  4WET A;  3HY2 A;  1FHE A;  4KCA A;  4CW9 A;  1BG5 A;  3A2X A;  2MMN A;  3KJY A;  1F2E A;  1HQO A;  2FA8 A;  3BD2 A;  4IBP A;  3UAR A;  3US3 A;  6GSX A;  4F82 A;  4FYB A;  3WT1 A;  4YQV A;  4ZB6 A;  2WUL A;  2VD1 A;  2FUG 2;  2V6O A;  1XW6 A;  2AYT A;  3QDN A;  2HNL A;  3D4T A;  5DQY A;  4HU9 A;  3QOU A;  4V2L A;  1QQ2 A;  2IPA A;  2PN8 A;  2HZE A;  2X8H A;  5DBQ A;  1YKA A;  3F0I A;  3TKS A;  1MEK A;  2ES7 A;  4ECI A;  4WF5 A;  1TU7 A;  6GSS A;  4IVF A;  1M99 A;  4JRR A;  1QUW A;  3GKX A;  1PL2 A;  4ULX A;  2JZT A;  12GS A;  1PA3 A;  2IFQ B;  2O8V B;  4JZQ A;  3HJM A;  1UA5 A;  2GZZ A;  5CRH A;  4WKW A;  3M0F A;  1R5P A;  3DRN A;  1SD8 A;  4RQX A;  3F4T A;  5J5N A;  3IK7 A;  1V57 A;  1TK0 B;  1JZD A;  3QAW A;  2MMO A;  5AIS A;  1BJX A;  1QXH A;  4XS4 B;  1O8W A;  9GSS A;  2YCD A;  3C1R A;  4MJE A;  1TI3 A;  1U3I A;  2FA4 A;  4I5Q A;  1V58 A;  2DJ1 A;  4DSS B;  2VCX A;  2LKU A;  2WJU A;  4N11 A;  4MMM A;  4DVC A;  1S3C A;  3D6I A;  1SKS B;  1F6M C;  2NTO A;  5HFG A;  4KSM A;  2TIR A;  1K0N A;  3PH9 A;  6GSU A;  4ZB8 A;  4X0X A;  3D22 A;  6GSY A;  5ECH B;  2MMA A;  3GH9 A;  2VCQ A;  4RI7 A;  3KEB A;  3FHK A;  1SEN A;  3TRQ A;  5AN1 A;  4HQS A;  3GHA A;  1B4Q A;  1B9Y C;  2HSY A;  1WIK A;  2YAN A;  5L71 A;  3EMP A;  3EU4 A;  5ELA A;  4QL7 A;  4HUA A;  2YWO A;  4MPG A;  5CYY A;  2CV4 A;  1VGL A;  3W8S A;  1V9W A;  2YWI A;  2V6K A;  3HJP A;  2H6X A;  5IMA A;  1TW9 A;  3E0U A;  4HU7 A;  4L0U A;  1EV4 A;  3KMN A;  5G1L A;  3VWV A;  1JFU A;  1SK0 A;  8GSS A;  3VWU A;  5HR0 A;  4EVM A;  5B6N A;  5CO3 A;  1F37 A;  3WGX A;  1FOV A;  4YAP A;  3IV4 A;  4GWR A;  2YWM A;  4GSN A;  5IMV A;  1M7T A;  1GTU A;  1BAY A;  5A4W A;  2P31 A;  4POK A;  2LRC A;  4BWS A;  4OWY A;  5JCU A;  1VF1 A;  4K8M A;  5GSS A;  5KN2 A;  3WGE A;  4POB A;  3FY7 A;  2PGT A;  3O76 A;  2VUP A;  1X5D A;  5CRG A;  2H19 A;  3HCZ A;  4IEL A;  2A4V A;  4P3Y B;  4F03 A;  1BED A;  3G7I A;  3L9V A;  4YQM A;  1XIY A;  3A3T A;  1OVN A;  4H86 A;  2FWG A;  5ABR A;  1G7O A;  2Z9S A;  3OR5 A;  4POL A;  1AW9 A;  2H6Y A;  2B3S A;  2VIM A;  4PQH A;  4BWQ A;  4JBB A;  3TKS C;  3GYK A;  1ZOF A;  3EWL A;  5F06 A;  5D8I A;  5B6M A;  3LYP A;  2YZH A;  3ZML A;  1O6J A;  2DML A;  3W8J A;  4WEY A;  3IDV A;  3TRX A;  2I3Y A;  2IFQ A;  3VK9 A;  3H93 A;  1NM3 A;  2H0H A;  3GRX A;  4HZ4 A;  2FY6 A;  1U88 A;  2E0Q A;  4XHM A;  1YEP A;  3IK9 A;  1XW5 A;  3QAG A;  4ML6 A;  2JU5 A;  1JZW A;  1DE2 A;  1K0B A;  2FWE A;  4Q5F A;  2OBI A;  2GDR A;  4IGJ A;  2GSR A;  5F05 A;  5DAL A;  4IW9 A;  4HJM A;  4O5R A;  2OAC A;  3VWX A;  3CTF A;  1K0O A;  2B7K A;  5ECO B;  1ERW A;  1LU4 A;  4MJA A;  1GUH A;  1B8X A;  4IQ1 A;  3GUR A;  2CVD A;  1TRW A;  3IPZ A;  4YQU A;  2H0G A;  1PN9 A;  3HKR A;  1Q98 A;  5KN3 A;  1EOG A;  1BYE A;  1GSE A;  4IP6 A;  1GTI A;  2QSI A;  2FWH A;  4WBR D;  3TJB A;  3HDC A;  5FHI A;  3L0H A;  2KP2 A;  1ZYE A;  2KOK A;  3WT2 A;  5D93 A;  1A2M A;  2NBS A;  5FWG A;  3RBT A;  5G5F A;  5IOW A;  2E2G A;  6GSW A;  2R37 A;  4V1A p;  1ST9 A;  2YJ7 A;  2N5B A;  1B48 A;  3ED3 A;  2C80 A;  1H75 A;  1GSY A;  1RQM A;  1B4P A;  1GNE A;  3KTL A;  4MF6 A;  2L5L A;  3QPM A;  2K9F A;  2F3M A;  5D9V A;  3EUR A;  3U6V A;  2N5F A;  2J23 A;  2BJX A;  4HOJ A;  4KW6 A;  2MMZ A;  3GKM A;  2OE0 A;  2HZE B;  5LCZ A;  3ME8 A;  4K6X A;  3BJ5 A;  1GNW A;  4GQF A;  3I43 A;  4PX1 A;  5E4W A;  5IMZ A;  2ON7 A;  3IRA A;  5IPH A;  5C04 A;  3ME7 A;  1QK8 A;  5B7C A;  3HYP A;  5ID2 B;  3M9J A;  10GS A;  2IN3 A;  1WP0 A;  5KN0 A;  1K3L A;  3EYT A;  1O8X A;  4WXT A;  5IQY A;  5A4U A;  2WS2 A;  2HRN A;  1XWK A;  1S3D A;  2AJQ B;  2KP1 A;  1J0F A;  1A23 A;  2IL3 A;  4IJI A;  3G9B A;  4MCU A;  1W89 A;  5DCG A;  3TUE A;  3IOS A;  3IHQ A;  5DCH A;  1OE8 A;  1DUG A;  2B5X A;  1YQ1 A;  4IS0 A;  5CRW A;  3FW2 A;  2HI7 A;  1WRY A;  5IO0 A;  4GSS A;  2IMF A;  3FRC A;  2XBQ A;  1R7H A;  4XRA A;  3UJ1 A;  4JED A;  4GST A;  1U6T A;  1ML6 A;  4MF5 A;  3DWV A;  3NZN A;  1G6W A;  3M3M A;  1MDJ A;  2VLV A;  1JZR A;  2WDU A;  3D21 A;  1SD9 A;  3F6F A;  4OO4 A;  2GSQ A;  3LG6 A;  1G6Y A;  1ACV A;  5IMC A;  2B6M A;  4CDO A;  1TXX A;  2FD3 A;  3TRP A;  2AAW A;  3G7Y A;  3DEX A;  3F8U A;  3GX8 A;  1T00 A;  1DE1 A;  2R2J A;  3TOU A;  3RHB A;  2B5Y A;  3I9V 2;  4NHW A;  5CAX A;  2DJ3 A;  4MP4 A;  3MSZ A;  2OE1 A;  4HDE A;  2LQO A;  2K8S A;  1EWX A;  3HXS A;  4EDY A;  3ZLP A;  2K18 A;  2MBT A;  4KDY A;  5AIX A;  1JHB A;  3RDW A;  4X1U A;  1LBK A;  4KA0 A;  4PQ1 A;  3Q18 A;  4EO3 A;  4RQR A;  2VCW A;  3K8N A;  4IN0 A;  19GS A;  3A5W A;  1TI1 A;  2I1U A;  4HEA 2;  2IJY A;  1X5C A;  1R5A A;  2C0E A;  3FK8 A;  1VF4 A;  5ECM B;  2VOC A;  3CRU A;  2VL9 A;  4TR4 A;  2JZR A;  4XS6 A;  2DJK A;  2DBC A;  2GQK A;  3GH6 A;  4AF2 A;  4OCF A;  1XBS A;  2CZ3 A;  4FYC A;  2DSA A;  4ZB9 A;  1WE0 A;  4WF4 A;  3UVT A;  3HVS A;  1AIU A;  2JZS A;  2F9S A;  1SL1 B;  3JCM L;  2VM1 A;  3QFA C;  2AHE A;  4L0W A;  3LOR A;  4EXJ A;  1PX6 A;  2WRT A;  4MJB A;  1S3A A;  3DYR A;  4GXZ A;  1N2A A;  2B7J A;  3J7Y b;  2TRC P;  2V32 A;  3IBH A;  1XWC A;  5ID2 A;  3GNJ A;  1XVW A;  1T7P B;  4O7H A;  2GZP A;  4IKH A;  2OKA A;  1UVZ A;  2YOI A;  4GQC A;  4MH3 A;  3VFI A;  1FW1 A;  4TR3 A;  2XC2 A;  2XHF A;  1A0R P;  5DAK A;  4NMU A;  2XPD A;  4IP1 A;  1Z3E A;  2GLR A;  5D9T A;  4LL4 B;  4JE1 A;  4MZW A;  4ML1 A;  3ZMK A;  4WR4 A;  4OCE A;  4KCE A;  4MZB A;  5DAL B;  5GST A;  4AJ7 A;  2VLU A;  2HSH A;  3HVV A;  2C3N A;  1ZMA A;  5HFI A;  2XBI A;  1HNC A;  22GS A;  2GZY A;  2LV3 A;  5CNW A;  1HD2 A;  2RII A;  3U5R E;  2K8V A;  3QD9 A;  3TJK A;  4EKZ A;  5EL8 A;  5G2Z A;  5ECN B;  2VL2 C;  3TCO A;  2IIY A;  3CMI A;  1GWC A;  3TKP A;  4V1A g;  1YF1 A;  1O7U A;  4TKY A;  3ZFL A;  2L4Q A;  3QCP A;  3HHV A;  1FAA A;  4ID0 A;  4JU5 A;  1ERT A;  2J9H A;  3FZ9 A;  2GT5 A;  3ZIT A;  5DJM A;  1K0A A;  3C7M A;  3ZRD A;  4G19 A;  3IA1 A;  2V1M A;  3TKR A;  4KUN A;  3TGZ A;  2D2Z A;  2I81 A;  5IMF A;  2P5Q A;  4NHZ A;  2GS3 A;  2OBK A;  5D9W A;  2LS5 A;  1SL2 B;  1TRV A;  2CQ9 A;  4PQI A;  3APQ A;  4FYU A;  18GS A;  2R3X A;  3I6A A;  3D5J A;  4WBJ A;  2GQM A;  3RPP A;  2WGR A;  2YZU A;  5J3R A;  2FNO A;  1FVK A;  2DIZ A;  2PVQ A;  5LD0 A;  5IPG A;  3VWW A;  2VO4 A;  3KIJ A;  4MJC A;  1J9B A;  2PU9 C;  1PKW A;  3VI5 A;  2G0F A;  2OE3 A;  3A2W A;  4F9Z A;  3VLN A;  1M2A A;  4LLR A;  2JAD A;  3VUR A;  3UOM A;  1MDK A;  3TJG A;  3KTB A;  3UBK A;  1SJZ A;  1Q4J A;  4GF0 A;  5B8A A;  2EIQ A;  1K0C A;  2PUK C;  3N9J A;  2H1D A;  3DKS A;  1FVJ A;  1DBY A;  2M72 A;  1KTE A;  2PPT A;  1ERU A;  1N8J A;  2PWJ A;  3UEM A;  2CVK A;  2YN1 A;  5ECR B;  1THO A;  3H8Q A;  1A8Y A;  4N30 A;  3TKS E;  2CAI A;  1O73 A;  2EC4 A;  3EIN A;  2IMI A;  3P90 A;  4TR0 A;  3FEU A;  1A8L A;  3ZL5 A;  3Q74 A;  3CSH A;  1XWA A;  4ISD A;  5HFK A;  3R2Q A;  3FR6 A;  4HJ2 A;  1OAZ A;  1GTA A;  4KH7 A;  3S9F A;  14GS A;  2E7P A;  1FG4 A;  2AUV A;  3ERF A;  1XZO A;  4MAB A;  1XWB A;  1VF2 A;  3LFL A;  20GS A;  2DJ2 A;  5AGY A;  1NHY A;  4POM A;  3W6G A;  1U87 A;  1GSF A;  4KDX A;  1TP9 A;  3BBY A;  5F0G A;  3IXR A;  4YH2 A;  1HNB A;  4N10 A;  4OMV A;  2NDO A;  1PSQ A;  3H79 A;  5H5Q A;  5E59 A;  3ZVJ D;  2H74 A;  3LXT A;  1TOF A;  4ZBB A;  4F2I A;  5KEJ A;  2CVB A;  1J08 A;  2IMK A;  4D73 B;  4MLY A;  1GRX A;  3F63 A;  4K2D A;  1T8E B;  3GN3 A;  1CQH A;  2PMT A;  1OYJ A;  1V2A A;  1YF0 A;  3F4R A;  2VAF A;  4O32 A;  4EUY A;  1SK2 A;  4TW5 A;  1WMJ A;  3CSJ A;  1PRX A;  1UC7 A;  3FYG A;  4NPB A;  4DSR A;  1A2L A;  3Q6O A;  4HZ2 A;  2OA7 A;  3H4K A;  2LQQ A;  3E9J B;  2VLT A;  1JLW A;  1XVQ A;  2OJL A;  4ILF A;  1R26 A;  3IAM 2;  2I4A A;  3ZRE A;  1X0R A;  2C8U A;  4JR6 A;  2V2G A;  5J4U A;  1SJI A;  2YWN A;  4I97 A;  3UBL A;  2XPE A;  1QGV A;  1CQG A;  3TKQ A;  1YZX A;  3IC4 A;  1TJD A;  1M0U A;  3BCI A;  5ECL B;  2L59 A;  2ZCT A;  1TRU A;  3WD6 A;  2CZ2 A;  3MNG A;  2ZNM A;  1AAZ A;  1SKW B;  2LEG A;  4NXI A;  1MDI A;  5IOX A;  5ECI B;  3MWH A;  3UVH A;  3QAV A;  3J7Y k;  2TRX A;  4ECB A;  4HS1 A;  2L6D A;  3LSZ A;  3KP9 A;  3FKF A;  3C8E A;  4NAX A;  4K1F A;  1SKR B;  3LXZ A;  5JWR B;  2JAC A;  4PUF C;  2P0G A;  2JSZ A;  3CSI A;  4TN8 A;  5F8B A;  2YV7 A;  2MYG A;  1PMT A;  5DAK B;  1BX9 A;  1GLP A;  2P5R A;  3KCM A;  2KLX A;  4TRX A;  3L78 A;  1F3B A;  2LNT A;  2JSY A;  4DEJ A;  3ISO A;  3DXB A;  4MZC A;  5HR2 A;  4EC0 A;  3APO A;  1Z5Y E;  3QMX A;  2MBS A;  3N5O A;  1ZCP A;  1YJ6 A;  1OE7 A;  3MDK A;  3P8W A;  2YNX A;  5JCG A;  4ZL7 A;  1PGT A;  1XXU A;  1EP8 A;  3UL3 A;  4V2N A;  5GAN D;  3RPN A;  2BTO T;  1EZK A;  2WCI A;  1M9A A;  1O81 A;  2NVL A;  2GT6 A;  2LJK A;  2RUE A;  2H6Z A;  4Z7X A;  1RW1 A;  2KHP A;  5D96 A;  2AB6 A;  4Q5Q A;  1WWJ A;  1F9M A;  4N0V A;  4TXO A;  3QR6 A;  5EY6 A;  1YEX A;  3CRT A;  2MZC A;  3ZIV A;  1VF3 A;  3ZYW A;  2FHE A;  4OFN A;  2H8L A;  4D73 A;  2M46 A;  4RUV A;  4TXV A;  3AY8 A;  2C0G A;  4I8B A;  1QMV A;  2C4J A;  4BA7 A;  4ZBD A;  3PGT A;  3Q19 A;  4BL7 A;  2H30 A;  3QFB C;  2HZF A;  2C3T A;  2CT6 A;  2C1Y A;  4OO5 A;  4FH8 A;  1T4Z A;  2F8A A;  2AV4 A;  5A5K A;  5CRE A;  1TDI A;  2A2S A;  2O7K A;  1V40 A;  2EIR A;  2PVO C;  3D4M A;  1AQX A;  1SYX A;  4TVE A;  3HZ4 A;  2PBJ A;  3KM6 A;  4PXO A;  4Q5R A;  3L9S A;  1VRS D;  1WJK A;  2H73 A;  1GUL A;  1SYR A;  3KGK A;  3KXO A;  4LMW A;  5HQP A;  1ERV A;  5IIZ A;  3ERG A;  5IM9 A;  3M9K A;  1EGR A;  4TR1 A;  3CYN A;  2HFD A;  4K7O A;  5D73 A;  4EF0 A;  4KDU A;  1AUC A;  3EU3 A;  1YY7 A;  4I2T A;  2F51 A;  5ECK B;  2X64 A;  1M9B A;  2V41 A;  3KD0 A;  3F3Q A;  5DQS A;  1RK4 A;  3CBU A;  4NV5 A;  3EC3 A;  1XWG A;  3DD3 A;  3BCK A;  1T4Y A;  3MAK A;  2LJR A;  3DIE A;  1YDK A;  13GS A;  3LQ7 A;  2DJJ A;  2X8C A;  3VPQ A;  4IJ3 A;  4JR4 A;  3GMF A;  2K6V A;  2B1K A;  5G5E A;  1AXD A;  3NIV A;  2DLX A;  1WOU A;  7GSS A;  1ZGN A;  2C3Q A;  1XOB A;  1TTZ A;  2HXK A;  4KGI A;  2ZUP A;  4K0G A;  2CAQ A;  4PNG A;  2CX3 A;  2R5G A;  3UAP A;  1QFN A;  1T1V A;  3KMO A;  1SL0 B;  3GV1 A;  2O85 A;  2HYX A;  3H1N A;  3HJO A;  4KND A;  3VPT A;  1A0F A;  3VI7 A;  2RUF A;  3C1S A;  1XPV A;  1KBN A;  3ERW A;  3NOF A;  5G1K A;  2GGT A;  3TJF A;  4GTU A;  1OC9 B;  4ZL9 A;  3M8N A;  2WFC A;  2ALB A;  2RLI A;  3PIN A;  2VD0 A;  2HT9 A;  2VCV A;  3O3T A;  4ZIL A;  4OFT A;  5EVO A;  2X8G A;  3D0Z A;  2H76 A;  2H0I A;  1GP1 A;  4L5L A;  4KX4 A;  2H1B A;  1MD3 A;  1OKD A;  4BVX A;  3O6T A;  1XOA A;  1AC1 A;  2B5E A;  2L4C A;  4FIW A;  4MPF A;  3HD5 A;  1BQ7 A;  4F0B A;  3TB2 A;  2RM5 A;  3GL3 A;  1EP7 A;  3KP8 A;  1MTC A;  3WYW A;  2EIO A;  5GAP D;  3GFK A;  6GST A;  2H75 A;  4KSO A;  4N0Z A;  2REM A;  4XTS A;  4KAE A;  2NPB A;  4TOP A;  1EOH A;  3RAZ A;  1XCC A;  3UMA A;  5HR3 A;  1YKC A;  1SJ6 A;  4PUR A;  4LL1 B;  3EVI A;  3V1W A;  1Y6E A;  3LJR A;  4MH2 A;  2C0D A;  4YAV A;  3DVX A;  1Z7P A;  3CXG A;  1E2Y A;  5GZZ B;  1W4V A;  1OC8 A;  2LRN A;  4PNF A;  2CX4 A;  2DJ0 A;  1MD4 A;  17GS A;  1K3Y A;  1GUM A;  5A4V A;  2H72 A;  2LTK A;  1NSW A;  1ON4 A;  2QGV A;  1AQW A;  4G2E A;  5CRD A;  4EDZ A;  3KZQ A;  1Z7R A;  2FWF A;  2C0F A;  1X9W B;  3GST A;  4F0C A;  3GTU B;  2H1A A;  4LA1 A;  3FZ5 A;  1Z6M A;  2GST A;  2VL3 A;  2X99 A;  1JZO A;  3L9U A;  4J2F A;  3A2V A;  2H66 A;  4MK3 A;  3IAS 2;  5ECP B;  5KN1 A;  4XCS A;  1LJR A;  1K0M A;  4L5O A;  2N5A A;  3KH7 A;  11GS A;  3TDG A;  5JWO B;  4WR5 A;  1GSD A;  3GUS A;  2VCT A;  4K7I A;  1A24 A;  5D9X A;  1NHO A;  3M1G A;  1TK5 B;  4ZBA A;  1IYH A;  4PUA A;  1GLQ A;  2GQL A;  1IYI A;  3GX0 A;  3ZVJ A;  4LMV A;  5IMD A;  1UN2 A;  2QKE A;  4ZIJ A;  3LYK A;  2M80 A;  1PL1 A;  2CA8 A;  2O87 A;  5H5R A;  4CHS A;  4OD7 A;  3FR9 A;  5ECQ B;  1E6B A;  3BOA A;  1X9M B;  1URM A;  1M2D A;  1XW9 A;  2VM2 A;  1V98 A;  4TXO B;  4L8E A;  5LNK e;  4NWY A;  4GRF A;  1NW2 A;  1FB0 A;  4MA9 A;  3PR8 A;  2IMD A;  1JLV A;  1B9X C;  1EGO A;  3EMX A;  4BPY A;  4ECC A;  4EL1 A;  1I9D A;  3IR4 A;  4XS4 A;  1PQN A;  4OFM A;  1OC9 A;  3I69 A;  4EE0 A;  1EEJ A;  4E8E A;  4DSS A;  2WB9 A;  4DSQ A;  4MDC A;  5J41 A;  2B1L A;  2H70 A;  3F3R A;  2GVP A;  5DDL A;  5JWQ B;  1R4W A;  3F9U A;  3GL5 A;  3RHC A;  2R6K A;  1OC3 A;  4ZL8 A;  3SWL A;  1ZZY A;  4PGT A;  4ZXG A;  5COH A;  1EEM A;  2DC5 A;  3GKK A;  3EE2 A;  1C72 A;  4XIH A;  2HE3 A;  1TU8 A;  5B8B A;  2HRF A;  4TR1 B;  1PKZ A;  5INY A;  4XS1 A;  3DVW A;  5H5S A;  4IQA A;  3FZA A;  4XRD A;  1GUK A;  1PD2 1;  2GSS A;  1GL8 A;  4QQ7 A;  3APS A;  4K9Z A;  1OKT A;  3C73 A;  4K7N A;  5HR1 A;  4Q5N A;  1ABA A;  5IO2 A;  4I6X A;  1SK1 A;  3TOT A;  2LST A;  2LUS A;  3SBC A;  1Z9H A;  4HI7 A;  3G7J A;  4O92 A;  5JCW A;  1XFL A;  1X5E A;  2PER A;  2L5O A;  4AGS A;  2O89 A;  1THX A;  2H1G A;  5ECS A;  5AIV A;  2R4V A;  2QC7 A;  1Y25 A;  2WZ9 A;  3DGQ A;  1H4O A;  3P2A A;  2BMX A;  1F3A A;  1G0T A;  1K0D A;  3L4N A;  4NV2 A;  1HNA A;  2DIY A;  4GLT A;  2F8F A;  1U3A A;  2H01 A;  5J9C A;  3HVX A;  4AJ6 A;  1SU9 A;  1ZYQ B;  5ELG A;  2JL4 A;  3P7X A;  4X43 A;  3UIW A;  3GIX A;  3E3E A;  3GTU A;  2IWT A;  1I5G A;  1G7E A;  4KE3 A;  5CP1 A;  5DVB A;  4GCI A;  2FGX A;  4I2U A;  1GH2 A;  1Z6N A;  2A2R A;  3F6D A;  3GA4 A;  3GSS A;  2KUC A;  1GSQ A;  3GKN A;  5FT3 A;  3WGD A;  1DSB A;  4E8H A;  1X9S B;  2LNS A;  4ECJ A;  4QL9 A;  1HYU A;  5EPF A;  1PX7 A;  1GTB A;  2DMM A;  5C00 A;  4MF7 A;  3KH9 A;  5J9B A;  2ON5 A;  3HZ8 A;  1TKD B;  2FLS A;  2YPM A;  2I9H A;  1ZL9 A;  2VL2 A;  3DML A;  3TJJ A;  1O85 A;  4J57 E;  2GTU A;  1A2J A;  1FB6 A;  3ZTL A;  3CTG A;  1EV9 A;  2G2Q A;  2RM6 A; 
#chains in the Genus database with same CATH topology
 2L57 A;  1AQV A;  3IE3 A;  5DJL A;  1M3J A;  1T3B A;  5G31 A;  5G30 A;  4G9H A;  4HQZ A;  4AJ8 A;  3ZZX A;  3FR3 A;  1FO5 A;  5ENU A;  2E2M A;  1TRS A;  1WPI A;  6GSV A;  4FO5 A;  4BVY A;  2YJH A;  4IHU A;  16GS A;  2IME A;  3LEF A;  4ACS A;  4G10 A;  1KNG A;  1TK8 B;  2OAD A;  4V2M A;  2YP6 A;  2R0G A;  3FZ4 A;  3ZFB A;  4KB3 A;  4K0N A;  2LRT A;  2FCH A;  1USB A;  3LGC A;  3LWA A;  2HLS A;  3HA9 A;  3F4S A;  2H71 A;  2LJA A;  2YV9 A;  3C71 A;  1ILO A;  3ZIJ A;  1GSS A;  1KEB A;  5F07 A;  1GSU A;  2VCZ A;  2L6C A;  4J56 E;  4RI6 A;  1K3O A;  1M2B A;  4WET A;  3HY2 A;  1FHE A;  4KCA A;  4CW9 A;  1BG5 A;  3A2X A;  2MMN A;  3KJY A;  1F2E A;  1HQO A;  2FA8 A;  3BD2 A;  4IBP A;  3UAR A;  3US3 A;  6GSX A;  4F82 A;  4FYB A;  3WT1 A;  3IC8 A;  4YQV A;  4ZB6 A;  2WUL A;  2VD1 A;  2FUG 2;  2V6O A;  1XW6 A;  2AYT A;  3QDN A;  2HNL A;  3D4T A;  5DQY A;  4HU9 A;  3QOU A;  5BMU A;  4V2L A;  1QQ2 A;  2IPA A;  2PN8 A;  2HZE A;  2X8H A;  5DBQ A;  1YKA A;  3F0I A;  3TKS A;  1MEK A;  2ES7 A;  4ECI A;  4WF5 A;  4O5U A;  1TU7 A;  6GSS A;  4IVF A;  1M99 A;  3HVN A;  4JRR A;  1QUW A;  3GKX A;  1PL2 A;  4ULX A;  2JZT A;  5KOX A;  12GS A;  1PA3 A;  2IFQ B;  2O8V B;  4JZQ A;  3HJM A;  1UA5 A;  2GZZ A;  5CRH A;  4WKW A;  3M0F A;  1R5P A;  3DRN A;  1SD8 A;  4RQX A;  3F4T A;  5J5N A;  3IK7 A;  1V57 A;  1TK0 B;  1JZD A;  3QAW A;  2MMO A;  5AIS A;  1BJX A;  1QXH A;  4XS4 B;  1O8W A;  9GSS A;  2YCD A;  3C1R A;  4BIK A;  4MJE A;  1TI3 A;  1U3I A;  2FA4 A;  4I5Q A;  1V58 A;  2DJ1 A;  4DSS B;  2VCX A;  2LKU A;  2WJU A;  4N11 A;  4MMM A;  4DVC A;  1S3C A;  3D6I A;  2UZ8 A;  1SKS B;  1F6M C;  2NTO A;  5HFG A;  4KSM A;  2TIR A;  1K0N A;  3PH9 A;  6GSU A;  4ZB8 A;  4X0X A;  3D22 A;  6GSY A;  5ECH B;  2MMA A;  3GH9 A;  2VCQ A;  4RI7 A;  3KEB A;  3FHK A;  1SEN A;  3TRQ A;  5AN1 A;  4HQS A;  3GHA A;  1B4Q A;  1B9Y C;  4K5S A;  2HSY A;  4CY8 A;  1WIK A;  2YAN A;  5L71 A;  3EMP A;  3EU4 A;  5ELA A;  4QL7 A;  4HUA A;  3A5I A;  2YWO A;  4MPG A;  5CYY A;  2CV4 A;  1VGL A;  3W8S A;  1V9W A;  2YWI A;  2V6K A;  3HJP A;  2H6X A;  5IMA A;  1TW9 A;  3E0U A;  4HU7 A;  4L0U A;  1EV4 A;  3KMN A;  5G1L A;  3VWV A;  1JFU A;  1SK0 A;  8GSS A;  4Z2R A;  3VWU A;  5HR0 A;  4EVM A;  5B6N A;  5CO3 A;  1F37 A;  3WGX A;  1FOV A;  4YAP A;  3IV4 A;  4GWR A;  2YWM A;  4GSN A;  5IMV A;  1M7T A;  1GTU A;  1BAY A;  5A4W A;  2P31 A;  4POK A;  2LRC A;  4BWS A;  4OWY A;  5JCU A;  1VF1 A;  4K8M A;  5GSS A;  5KN2 A;  3WGE A;  4POB A;  3FY7 A;  2PGT A;  3O76 A;  2VUP A;  1X5D A;  5CRG A;  2H19 A;  3HCZ A;  4IEL A;  2A4V A;  4P3Y B;  4F03 A;  1BED A;  3G7I A;  3L9V A;  4YQM A;  1XIY A;  3A3T A;  1OVN A;  4H86 A;  2FWG A;  5ABR A;  1G7O A;  2Z9S A;  3OR5 A;  4POL A;  1AW9 A;  2H6Y A;  2B3S A;  2VIM A;  4PQH A;  4BWQ A;  4JBB A;  3TKS C;  3GYK A;  1ZOF A;  3EWL A;  5F06 A;  5D8I A;  5B6M A;  3LYP A;  2YZH A;  3ZML A;  1O6J A;  2DML A;  3W8J A;  4WEY A;  3IDV A;  3TRX A;  2I3Y A;  2IFQ A;  3VK9 A;  3H93 A;  1NM3 A;  2H0H A;  3GRX A;  4HZ4 A;  1ZYP A;  2FY6 A;  1U88 A;  2E0Q A;  4XHM A;  1YEP A;  3IK9 A;  1XW5 A;  3QAG A;  4ML6 A;  2JU5 A;  1JZW A;  1DE2 A;  1K0B A;  2FWE A;  4Q5F A;  2OBI A;  4BVY B;  2GDR A;  4IGJ A;  2GSR A;  5F05 A;  5DAL A;  4IW9 A;  4HJM A;  4O5R A;  2OAC A;  3VWX A;  3CTF A;  1K0O A;  2B7K A;  5ECO B;  1ERW A;  1LU4 A;  4MJA A;  1GUH A;  1B8X A;  4IQ1 A;  3GUR A;  2CVD A;  1TRW A;  3IPZ A;  4YQU A;  2H0G A;  1PN9 A;  3HKR A;  1Q98 A;  5KN3 A;  1EOG A;  1BYE A;  1GSE A;  4IP6 A;  1GTI A;  2QSI A;  2FWH A;  4WBR D;  3TJB A;  3HDC A;  5FHI A;  3L0H A;  2KP2 A;  1ZYE A;  2KOK A;  3WT2 A;  5D93 A;  1A2M A;  2NBS A;  5FWG A;  3RBT A;  5G5F A;  5IOW A;  2E2G A;  6GSW A;  2R37 A;  4V1A p;  1ST9 A;  2YJ7 A;  2N5B A;  1B48 A;  3ED3 A;  2C80 A;  2HSM A;  1H75 A;  1GSY A;  1RQM A;  1B4P A;  1GNE A;  3KTL A;  4MF6 A;  2L5L A;  3QPM A;  2K9F A;  2F3M A;  5D9V A;  3EUR A;  3U6V A;  2N5F A;  2J23 A;  2BJX A;  4HOJ A;  4KW6 A;  2MMZ A;  3GKM A;  2OE0 A;  2HZE B;  5LCZ A;  3ME8 A;  4K6X A;  3BJ5 A;  1GNW A;  4GQF A;  3I43 A;  4PX1 A;  5E4W A;  5IMZ A;  2ON7 A;  5BRT A;  3IRA A;  5IPH A;  5C04 A;  3ME7 A;  1QK8 A;  5B7C A;  3HYP A;  5ID2 B;  3M9J A;  10GS A;  2IN3 A;  1WP0 A;  5KN0 A;  1K3L A;  3EYT A;  1O8X A;  4WXT A;  2QA2 A;  5IQY A;  5A4U A;  2WS2 A;  2HRN A;  1XWK A;  1S3D A;  2AJQ B;  2KP1 A;  1J0F A;  1A23 A;  2IL3 A;  4IJI A;  3G9B A;  4MCU A;  1W89 A;  5DCG A;  3TUE A;  3IOS A;  3IHQ A;  5DCH A;  1OE8 A;  1DUG A;  2B5X A;  1YQ1 A;  4IS0 A;  5CRW A;  3FW2 A;  2HI7 A;  1WRY A;  5IO0 A;  4GSS A;  2IMF A;  3FRC A;  2XBQ A;  1R7H A;  4XRA A;  3UJ1 A;  4JED A;  4GST A;  1U6T A;  1ML6 A;  4MF5 A;  3DWV A;  3IHG A;  3NZN A;  1G6W A;  3M3M A;  1MDJ A;  2VLV A;  1JZR A;  2WDU A;  3D21 A;  1SD9 A;  3F6F A;  4OO4 A;  2GSQ A;  3LG6 A;  1G6Y A;  1ACV A;  5IMC A;  2B6M A;  4CDO A;  1TXX A;  1XG8 A;  2FD3 A;  3TRP A;  2AAW A;  4YKF A;  3G7Y A;  3DEX A;  3F8U A;  3GX8 A;  1T00 A;  1DE1 A;  2R2J A;  3TOU A;  3RHB A;  2B5Y A;  3I9V 2;  4NHW A;  5CAX A;  2DJ3 A;  4MP4 A;  3MSZ A;  2OE1 A;  4HDE A;  2LQO A;  2K8S A;  1EWX A;  3HXS A;  4EDY A;  4G0I A;  3ZLP A;  2K18 A;  2MBT A;  4KDY A;  5AIX A;  2X4A A;  1JHB A;  3RDW A;  4X1U A;  1LBK A;  4KA0 A;  4PQ1 A;  3Q18 A;  4EO3 A;  4RQR A;  2VCW A;  3K8N A;  4IN0 A;  19GS A;  3A5W A;  1TI1 A;  2I1U A;  4HEA 2;  2IJY A;  1X5C A;  1R5A A;  2C0E A;  3FK8 A;  1VF4 A;  5ECM B;  2VOC A;  3CRU A;  2VL9 A;  4TR4 A;  2JZR A;  4XS6 A;  2DJK A;  4K5R A;  2DBC A;  2GQK A;  3GH6 A;  4AF2 A;  4OCF A;  1XBS A;  2CZ3 A;  4FYC A;  2DSA A;  4ZB9 A;  1WE0 A;  4WF4 A;  3UVT A;  3HVS A;  1AIU A;  2JZS A;  2F9S A;  1SL1 B;  3JCM L;  2VM1 A;  3QFA C;  2AHE A;  4L0W A;  3LOR A;  4EXJ A;  1PX6 A;  2WRT A;  4MJB A;  1S3A A;  3DYR A;  4GXZ A;  1N2A A;  2B7J A;  3J7Y b;  2TRC P;  2V32 A;  3IBH A;  1XWC A;  5ID2 A;  3GNJ A;  1XVW A;  1T7P B;  4O7H A;  2GZP A;  4O5Q A;  4IKH A;  2OKA A;  1UVZ A;  2YOI A;  4GQC A;  4MH3 A;  3VFI A;  1FW1 A;  4TR3 A;  2XC2 A;  2XHF A;  1A0R P;  5DAK A;  4NMU A;  2XPD A;  4IP1 A;  1Z3E A;  2GLR A;  5D9T A;  4LL4 B;  4JE1 A;  4MZW A;  4ML1 A;  3ZMK A;  4WR4 A;  4OCE A;  4KCE A;  4MZB A;  5DAL B;  5GST A;  4AJ7 A;  2VLU A;  2HSH A;  3HVV A;  2C3N A;  1ZMA A;  5HFI A;  2XBI A;  1HNC A;  22GS A;  2GZY A;  2LV3 A;  5CNW A;  1HD2 A;  2DKH A;  2RII A;  3U5R E;  2K8V A;  3QD9 A;  3TJK A;  4EKZ A;  5EL8 A;  5G2Z A;  5ECN B;  2VL2 C;  3TCO A;  2IIY A;  3CMI A;  1GWC A;  3TKP A;  4V1A g;  1YF1 A;  1O7U A;  4TKY A;  3ZFL A;  2L4Q A;  2DKI A;  3QCP A;  3HHV A;  1FAA A;  4ID0 A;  4JU5 A;  1ERT A;  2J9H A;  3FZ9 A;  2GT5 A;  3ZIT A;  5DJM A;  1K0A A;  3C7M A;  3ZRD A;  4G19 A;  3IA1 A;  2V1M A;  3TKR A;  4KUN A;  3TGZ A;  2D2Z A;  2I81 A;  5IMF A;  2P5Q A;  4NHZ A;  2GS3 A;  2OBK A;  5D9W A;  2LS5 A;  1SL2 B;  1TRV A;  2CQ9 A;  4PQI A;  3APQ A;  4FYU A;  18GS A;  2R3X A;  3I6A A;  3D5J A;  4WBJ A;  2GQM A;  3RPP A;  2WGR A;  2YZU A;  5J3R A;  2FNO A;  1FVK A;  2DIZ A;  2PVQ A;  5LD0 A;  5IPG A;  3VWW A;  4MNN A;  2VO4 A;  3KIJ A;  4MJC A;  1J9B A;  2PU9 C;  1PKW A;  3VI5 A;  2G0F A;  2OE3 A;  3A2W A;  4F9Z A;  3VLN A;  1M2A A;  4LLR A;  2JAD A;  3VUR A;  3UOM A;  5KOW A;  1MDK A;  3TJG A;  3KTB A;  3UBK A;  1SJZ A;  1Q4J A;  4GF0 A;  5B8A A;  2EIQ A;  1K0C A;  1ZYN A;  2PUK C;  3N9J A;  2H1D A;  3DKS A;  1FVJ A;  1DBY A;  2M72 A;  1KTE A;  2PPT A;  1ERU A;  1N8J A;  2PWJ A;  3UEM A;  2CVK A;  2YN1 A;  5ECR B;  1THO A;  4KF9 A;  3H8Q A;  1A8Y A;  4N30 A;  3TKS E;  2CAI A;  1O73 A;  2EC4 A;  3EIN A;  2IMI A;  3P90 A;  4TR0 A;  3FEU A;  1A8L A;  3ZL5 A;  3Q74 A;  3CSH A;  1XWA A;  4ISD A;  5HFK A;  3R2Q A;  3FR6 A;  4HJ2 A;  1OAZ A;  1GTA A;  4KH7 A;  3S9F A;  14GS A;  2E7P A;  1FG4 A;  3LW9 A;  2AUV A;  3ERF A;  1XZO A;  4MAB A;  1XWB A;  1VF2 A;  3LFL A;  20GS A;  2DJ2 A;  5AGY A;  1NHY A;  3EPT A;  4POM A;  3W6G A;  1U87 A;  2R0P A;  1GSF A;  4KDX A;  1TP9 A;  3BBY A;  5F0G A;  3IXR A;  4YH2 A;  1HNB A;  4N10 A;  4OMV A;  2NDO A;  1PSQ A;  3H79 A;  5H5Q A;  5E59 A;  3ZVJ D;  2H74 A;  3LXT A;  1TOF A;  4ZBB A;  4F2I A;  5KEJ A;  2CVB A;  1J08 A;  2IMK A;  4D73 B;  4MLY A;  1S3R A;  1GRX A;  3F63 A;  4K2D A;  1T8E B;  3GN3 A;  4Z2T A;  1CQH A;  4G0L A;  2PMT A;  1OYJ A;  1V2A A;  1YF0 A;  3F4R A;  2VAF A;  4O32 A;  4EUY A;  1SK2 A;  4TW5 A;  1WMJ A;  3CSJ A;  4USS A;  1PRX A;  1UC7 A;  3FYG A;  4NPB A;  3R3E A;  4DSR A;  1A2L A;  3Q6O A;  2HRA A;  4HZ2 A;  2OA7 A;  3H4K A;  2LQQ A;  3E9J B;  2VLT A;  1JLW A;  1XVQ A;  2OJL A;  4ILF A;  1R26 A;  3IAM 2;  2I4A A;  3ZRE A;  1X0R A;  2C8U A;  4JR6 A;  2V2G A;  5J4U A;  1SJI A;  2YWN A;  4I97 A;  3UBL A;  2XPE A;  1QGV A;  1CQG A;  3TKQ A;  1YZX A;  3IC4 A;  1TJD A;  1M0U A;  3BCI A;  5ECL B;  2L59 A;  2ZCT A;  1TRU A;  3WD6 A;  2CZ2 A;  3MNG A;  2ZNM A;  1AAZ A;  1SKW B;  2LEG A;  4NXI A;  2X49 A;  1MDI A;  5IOX A;  5ECI B;  3MWH A;  3UVH A;  3QAV A;  3J7Y k;  2TRX A;  4ECB A;  4HS1 A;  2L6D A;  3LSZ A;  3KP9 A;  3FKF A;  3C8E A;  4NAX A;  4K1F A;  1SKR B;  3LXZ A;  5JWR B;  2JAC A;  4PUF C;  2P0G A;  2JSZ A;  3CSI A;  4TN8 A;  5F8B A;  2YV7 A;  2MYG A;  1PMT A;  5DAK B;  1BX9 A;  1GLP A;  2P5R A;  3KCM A;  2KLX A;  4TRX A;  3L78 A;  1F3B A;  2LNT A;  2JSY A;  4G0K A;  4EIQ A;  4DEJ A;  3ISO A;  3DXB A;  4MZC A;  5HR2 A;  4EC0 A;  3APO A;  1Z5Y E;  3QMX A;  2MBS A;  3N5O A;  1ZCP A;  1YJ6 A;  1OE7 A;  3MDK A;  3P8W A;  2YNX A;  5JCG A;  4ZL7 A;  1PGT A;  1XXU A;  1EP8 A;  4FQU A;  3UL3 A;  4V2N A;  5GAN D;  3RPN A;  2BTO T;  1EZK A;  2WCI A;  1M9A A;  1O81 A;  2NVL A;  2GT6 A;  2LJK A;  2RUE A;  2H6Z A;  4Z7X A;  1RW1 A;  2R0C A;  2KHP A;  5D96 A;  2AB6 A;  4BVX B;  4Q5Q A;  1WWJ A;  1F9M A;  4N0V A;  4TXO A;  3QR6 A;  5EY6 A;  1YEX A;  3CRT A;  2MZC A;  3ZIV A;  1VF3 A;  3ZYW A;  2FHE A;  4OFN A;  2H8L A;  4D73 A;  2M46 A;  4RUV A;  4TXV A;  3AY8 A;  2C0G A;  4I8B A;  1QMV A;  2C4J A;  4BA7 A;  4ZBD A;  3PGT A;  3Q19 A;  4BL7 A;  2H30 A;  3QFB C;  2HZF A;  2C3T A;  2CT6 A;  2C1Y A;  4OO5 A;  4FH8 A;  1T4Z A;  2F8A A;  2AV4 A;  5A5K A;  5CRE A;  1TDI A;  2HRK A;  2A2S A;  2O7K A;  1V40 A;  2EIR A;  2PVO C;  3D4M A;  1AQX A;  1SYX A;  4TVE A;  3HZ4 A;  2PBJ A;  3KM6 A;  4PXO A;  4Q5R A;  3L9S A;  1VRS D;  1WJK A;  2H73 A;  1GUL A;  1SYR A;  3KGK A;  3KXO A;  4LMW A;  5HQP A;  1ERV A;  5IIZ A;  3ERG A;  5IM9 A;  3M9K A;  1EGR A;  4TR1 A;  3CYN A;  2HFD A;  2QA1 A;  4K7O A;  5D73 A;  4EF0 A;  4KDU A;  4PTS A;  1AUC A;  3EU3 A;  1YY7 A;  4I2T A;  2F51 A;  5ECK B;  2X64 A;  1M9B A;  1PN0 A;  2V41 A;  3KD0 A;  3F3Q A;  5DQS A;  1RK4 A;  3CBU A;  4NV5 A;  3EC3 A;  1XWG A;  3DD3 A;  3BCK A;  3PPU A;  1T4Y A;  3MAK A;  2LJR A;  3DIE A;  1YDK A;  3CQF A;  13GS A;  3LQ7 A;  4Z2U A;  2DJJ A;  2X8C A;  3VPQ A;  4IJ3 A;  4JR4 A;  3GMF A;  2K6V A;  2B1K A;  5G5E A;  1AXD A;  3NIV A;  2DLX A;  1WOU A;  7GSS A;  1ZGN A;  2C3Q A;  1XOB A;  1TTZ A;  2HXK A;  4KGI A;  2ZUP A;  4K0G A;  2CAQ A;  4PNG A;  2CX3 A;  2R5G A;  3UAP A;  1QFN A;  1T1V A;  3KMO A;  1SL0 B;  3GV1 A;  2O85 A;  4YKG A;  2HYX A;  3H1N A;  3HJO A;  4KND A;  3VPT A;  1A0F A;  3VI7 A;  2RUF A;  3C1S A;  1XPV A;  1KBN A;  3ERW A;  3NOF A;  5G1K A;  2GGT A;  3TJF A;  4GTU A;  1OC9 B;  4ZL9 A;  3M8N A;  2WFC A;  2ALB A;  2RLI A;  3PIN A;  2VD0 A;  2HT9 A;  2VCV A;  3O3T A;  4ZIL A;  4OFT A;  5EVO A;  2X8G A;  3D0Z A;  2H76 A;  2H0I A;  1GP1 A;  4L5L A;  4KX4 A;  2H1B A;  1MD3 A;  1OKD A;  4BVX A;  3O6T A;  1XOA A;  1AC1 A;  2B5E A;  2L4C A;  4FIW A;  4MPF A;  3HD5 A;  1BQ7 A;  4F0B A;  3TB2 A;  2RM5 A;  3GL3 A;  1EP7 A;  3KP8 A;  1MTC A;  3WYW A;  2EIO A;  5GAP D;  3GFK A;  6GST A;  2H75 A;  4KSO A;  4N0Z A;  2REM A;  4XTS A;  4KAE A;  2NPB A;  4TOP A;  1EOH A;  3RAZ A;  1XCC A;  3UMA A;  5HR3 A;  1M3I A;  1YKC A;  1SJ6 A;  4PUR A;  4LL1 B;  3EVI A;  3V1W A;  1Y6E A;  3LJR A;  4MH2 A;  4HSC X;  2C0D A;  4YAV A;  3DVX A;  1Z7P A;  3CXG A;  1E2Y A;  5GZZ B;  1W4V A;  1OC8 A;  2LRN A;  4PNF A;  2CX4 A;  2DJ0 A;  1MD4 A;  17GS A;  1K3Y A;  1GUM A;  5A4V A;  3MYD A;  2H72 A;  2LTK A;  1NSW A;  1ON4 A;  2QGV A;  1AQW A;  4G2E A;  5CRD A;  4EDZ A;  3KZQ A;  1Z7R A;  2FWF A;  2C0F A;  1X9W B;  3GST A;  4F0C A;  3GTU B;  2H1A A;  4LA1 A;  3FZ5 A;  1Z6M A;  2GST A;  2VL3 A;  2X99 A;  1JZO A;  3L9U A;  4J2F A;  3A2V A;  2H66 A;  4MK3 A;  3IAS 2;  5ECP B;  5KN1 A;  4XCS A;  1LJR A;  1PFO A;  1K0M A;  4L5O A;  2N5A A;  3KH7 A;  1FOH A;  11GS A;  3TDG A;  4K2X A;  5JWO B;  4WR5 A;  1GSD A;  3GUS A;  2VCT A;  4K7I A;  1A24 A;  4A5P A;  5D9X A;  1NHO A;  3M1G A;  1TK5 B;  4ZBA A;  1IYH A;  4PUA A;  1GLQ A;  2GQL A;  1IYI A;  3GX0 A;  3ZVJ A;  4LMV A;  5IMD A;  1UN2 A;  2QKE A;  4ZIJ A;  3LYK A;  2M80 A;  1PL1 A;  2CA8 A;  2O87 A;  5H5R A;  3FMW A;  4CHS A;  4OD7 A;  3FR9 A;  5ECQ B;  1E6B A;  3BOA A;  1X9M B;  1URM A;  1M2D A;  1XW9 A;  2VM2 A;  1V98 A;  4TXO B;  4L8E A;  5LNK e;  4NWY A;  4GRF A;  1NW2 A;  1FB0 A;  4MA9 A;  3PR8 A;  2IMD A;  1JLV A;  1B9X C;  1EGO A;  4BL7 B;  3EMX A;  4BPY A;  4ECC A;  4EL1 A;  1I9D A;  3IR4 A;  4XS4 A;  1PQN A;  4OFM A;  1OC9 A;  3I69 A;  4EE0 A;  1EEJ A;  4E8E A;  4DSS A;  2WB9 A;  4DSQ A;  4MDC A;  5J41 A;  2B1L A;  2H70 A;  3F3R A;  2GVP A;  5DDL A;  5JWQ B;  1R4W A;  3F9U A;  3GL5 A;  3RHC A;  2R6K A;  1OC3 A;  4ZL8 A;  3SWL A;  1ZZY A;  4PGT A;  4ZXG A;  5COH A;  1EEM A;  2DC5 A;  3GKK A;  3EE2 A;  1C72 A;  4XIH A;  2HE3 A;  1TU8 A;  5B8B A;  2HRF A;  4TR1 B;  1PKZ A;  5INY A;  4XS1 A;  3DVW A;  5H5S A;  4IQA A;  3FZA A;  4XRD A;  1GUK A;  1PD2 1;  2GSS A;  1GL8 A;  4QQ7 A;  3APS A;  4K9Z A;  1OKT A;  3C73 A;  4K7N A;  5HR1 A;  4Q5N A;  1ABA A;  4EIP A;  4I6X A;  5IO2 A;  1SK1 A;  3TOT A;  2LST A;  2LUS A;  3SBC A;  1Z9H A;  2A4H A;  4HI7 A;  3G7J A;  4O92 A;  5JCW A;  1XFL A;  1X5E A;  2PER A;  2L5O A;  4ICY A;  4AGS A;  2O89 A;  1THX A;  2H1G A;  5ECS A;  5AIV A;  2R4V A;  2QC7 A;  1Y25 A;  2WZ9 A;  3DGQ A;  1H4O A;  3P2A A;  2BMX A;  1F3A A;  1G0T A;  1K0D A;  3L4N A;  4NV2 A;  1HNA A;  2DIY A;  4GLT A;  2F8F A;  1U3A A;  2H01 A;  5J9C A;  3HVX A;  4AJ6 A;  3MIX A;  4CY6 A;  1SU9 A;  1ZYQ B;  2A2P A;  5ELG A;  2JL4 A;  3P7X A;  4X43 A;  3UIW A;  3GIX A;  3E3E A;  3GTU A;  4X4J A;  2IWT A;  1I5G A;  1G7E A;  4KE3 A;  5CP1 A;  5DVB A;  4GCI A;  2FGX A;  4I2U A;  1GH2 A;  1Z6N A;  2A2R A;  3F6D A;  3GA4 A;  3GSS A;  2KUC A;  1GSQ A;  3GKN A;  5FT3 A;  3WGD A;  1DSB A;  4E8H A;  1X9S B;  2LNS A;  4ECJ A;  4QL9 A;  1HYU A;  5EPF A;  1PX7 A;  1GTB A;  2DMM A;  5C00 A;  4MF7 A;  3KH9 A;  5J9B A;  2ON5 A;  3HZ8 A;  1TKD B;  2FLS A;  2YPM A;  2I9H A;  1ZL9 A;  2VL2 A;  3DML A;  3TJJ A;  1O85 A;  4J57 E;  2GTU A;  1A2J A;  1FB6 A;  3ZTL A;  3CTG A;  1EV9 A;  2G2Q A;  2RM6 A; 
#chains in the Genus database with same CATH homology
 2L57 A;  1AQV A;  3IE3 A;  5DJL A;  1T3B A;  5G31 A;  5G30 A;  4G9H A;  4HQZ A;  4AJ8 A;  3ZZX A;  3FR3 A;  1FO5 A;  5ENU A;  2E2M A;  1TRS A;  1WPI A;  6GSV A;  4FO5 A;  4BVY A;  2YJH A;  4IHU A;  16GS A;  2IME A;  3LEF A;  4ACS A;  4G10 A;  1KNG A;  1TK8 B;  2OAD A;  4V2M A;  2YP6 A;  2R0G A;  3FZ4 A;  3ZFB A;  4KB3 A;  4K0N A;  2LRT A;  2FCH A;  1USB A;  3LGC A;  3LWA A;  2HLS A;  3HA9 A;  3F4S A;  2H71 A;  2LJA A;  2YV9 A;  3C71 A;  1ILO A;  3ZIJ A;  1GSS A;  1KEB A;  5F07 A;  1GSU A;  2VCZ A;  2L6C A;  4J56 E;  4RI6 A;  1K3O A;  1M2B A;  4WET A;  3HY2 A;  1FHE A;  4KCA A;  4CW9 A;  1BG5 A;  3A2X A;  2MMN A;  3KJY A;  1F2E A;  1HQO A;  2FA8 A;  3BD2 A;  4IBP A;  3UAR A;  3US3 A;  6GSX A;  4F82 A;  4FYB A;  3WT1 A;  3IC8 A;  4YQV A;  4ZB6 A;  2WUL A;  2VD1 A;  2FUG 2;  2V6O A;  1XW6 A;  2AYT A;  3QDN A;  2HNL A;  3D4T A;  5DQY A;  4HU9 A;  3QOU A;  5BMU A;  4V2L A;  1QQ2 A;  2IPA A;  2PN8 A;  2HZE A;  2X8H A;  5DBQ A;  1YKA A;  3F0I A;  3TKS A;  1MEK A;  2ES7 A;  4ECI A;  4WF5 A;  4O5U A;  1TU7 A;  6GSS A;  4IVF A;  1M99 A;  4JRR A;  1QUW A;  3GKX A;  1PL2 A;  4ULX A;  2JZT A;  5KOX A;  12GS A;  1PA3 A;  2IFQ B;  2O8V B;  4JZQ A;  3HJM A;  1UA5 A;  2GZZ A;  5CRH A;  4WKW A;  3M0F A;  1R5P A;  3DRN A;  1SD8 A;  4RQX A;  3F4T A;  5J5N A;  3IK7 A;  1V57 A;  1TK0 B;  1JZD A;  3QAW A;  2MMO A;  5AIS A;  1BJX A;  1QXH A;  4XS4 B;  1O8W A;  9GSS A;  2YCD A;  3C1R A;  4MJE A;  1TI3 A;  1U3I A;  2FA4 A;  4I5Q A;  1V58 A;  2DJ1 A;  4DSS B;  2VCX A;  2LKU A;  2WJU A;  4N11 A;  4MMM A;  4DVC A;  1S3C A;  3D6I A;  2UZ8 A;  1SKS B;  1F6M C;  2NTO A;  5HFG A;  4KSM A;  2TIR A;  1K0N A;  3PH9 A;  6GSU A;  4ZB8 A;  4X0X A;  3D22 A;  6GSY A;  5ECH B;  2MMA A;  3GH9 A;  2VCQ A;  4RI7 A;  3KEB A;  3FHK A;  1SEN A;  3TRQ A;  5AN1 A;  4HQS A;  3GHA A;  1B4Q A;  1B9Y C;  4K5S A;  2HSY A;  4CY8 A;  1WIK A;  2YAN A;  5L71 A;  3EMP A;  3EU4 A;  5ELA A;  4QL7 A;  4HUA A;  3A5I A;  2YWO A;  4MPG A;  5CYY A;  2CV4 A;  1VGL A;  3W8S A;  1V9W A;  2YWI A;  2V6K A;  3HJP A;  2H6X A;  5IMA A;  1TW9 A;  3E0U A;  4HU7 A;  4L0U A;  1EV4 A;  3KMN A;  5G1L A;  3VWV A;  1JFU A;  1SK0 A;  8GSS A;  4Z2R A;  3VWU A;  5HR0 A;  4EVM A;  5B6N A;  5CO3 A;  1F37 A;  3WGX A;  1FOV A;  4YAP A;  3IV4 A;  4GWR A;  2YWM A;  4GSN A;  5IMV A;  1M7T A;  1GTU A;  1BAY A;  5A4W A;  2P31 A;  4POK A;  2LRC A;  4BWS A;  4OWY A;  5JCU A;  1VF1 A;  4K8M A;  5GSS A;  5KN2 A;  3WGE A;  4POB A;  3FY7 A;  2PGT A;  3O76 A;  2VUP A;  1X5D A;  5CRG A;  2H19 A;  3HCZ A;  4IEL A;  2A4V A;  4P3Y B;  4F03 A;  1BED A;  3G7I A;  3L9V A;  4YQM A;  1XIY A;  3A3T A;  1OVN A;  4H86 A;  2FWG A;  5ABR A;  1G7O A;  2Z9S A;  3OR5 A;  4POL A;  1AW9 A;  2H6Y A;  2B3S A;  2VIM A;  4PQH A;  4BWQ A;  4JBB A;  3TKS C;  3GYK A;  1ZOF A;  3EWL A;  5F06 A;  5D8I A;  5B6M A;  3LYP A;  2YZH A;  3ZML A;  1O6J A;  2DML A;  3W8J A;  4WEY A;  3IDV A;  3TRX A;  2I3Y A;  2IFQ A;  3VK9 A;  3H93 A;  1NM3 A;  2H0H A;  3GRX A;  4HZ4 A;  1ZYP A;  2FY6 A;  1U88 A;  2E0Q A;  4XHM A;  1YEP A;  3IK9 A;  1XW5 A;  3QAG A;  4ML6 A;  2JU5 A;  1JZW A;  1DE2 A;  1K0B A;  2FWE A;  4Q5F A;  2OBI A;  4BVY B;  2GDR A;  4IGJ A;  2GSR A;  5F05 A;  5DAL A;  4IW9 A;  4HJM A;  4O5R A;  2OAC A;  3VWX A;  3CTF A;  1K0O A;  2B7K A;  5ECO B;  1ERW A;  1LU4 A;  4MJA A;  1GUH A;  1B8X A;  4IQ1 A;  3GUR A;  2CVD A;  1TRW A;  3IPZ A;  4YQU A;  2H0G A;  1PN9 A;  3HKR A;  1Q98 A;  5KN3 A;  1EOG A;  1BYE A;  1GSE A;  4IP6 A;  1GTI A;  2QSI A;  2FWH A;  4WBR D;  3TJB A;  3HDC A;  5FHI A;  3L0H A;  2KP2 A;  1ZYE A;  2KOK A;  3WT2 A;  5D93 A;  1A2M A;  2NBS A;  5FWG A;  3RBT A;  5G5F A;  5IOW A;  2E2G A;  6GSW A;  2R37 A;  4V1A p;  1ST9 A;  2YJ7 A;  2N5B A;  1B48 A;  3ED3 A;  2C80 A;  2HSM A;  1H75 A;  1GSY A;  1RQM A;  1B4P A;  1GNE A;  3KTL A;  4MF6 A;  2L5L A;  3QPM A;  2K9F A;  2F3M A;  5D9V A;  3EUR A;  3U6V A;  2N5F A;  2J23 A;  2BJX A;  4HOJ A;  4KW6 A;  2MMZ A;  3GKM A;  2OE0 A;  2HZE B;  5LCZ A;  3ME8 A;  4K6X A;  3BJ5 A;  1GNW A;  4GQF A;  3I43 A;  4PX1 A;  5E4W A;  5IMZ A;  2ON7 A;  5BRT A;  3IRA A;  5IPH A;  5C04 A;  3ME7 A;  1QK8 A;  5B7C A;  3HYP A;  5ID2 B;  3M9J A;  10GS A;  2IN3 A;  1WP0 A;  5KN0 A;  1K3L A;  3EYT A;  1O8X A;  4WXT A;  2QA2 A;  5IQY A;  5A4U A;  2WS2 A;  2HRN A;  1XWK A;  1S3D A;  2AJQ B;  2KP1 A;  1J0F A;  1A23 A;  2IL3 A;  4IJI A;  3G9B A;  4MCU A;  1W89 A;  5DCG A;  3TUE A;  3IOS A;  3IHQ A;  5DCH A;  1OE8 A;  1DUG A;  2B5X A;  1YQ1 A;  4IS0 A;  5CRW A;  3FW2 A;  2HI7 A;  1WRY A;  5IO0 A;  4GSS A;  2IMF A;  3FRC A;  2XBQ A;  1R7H A;  4XRA A;  3UJ1 A;  4JED A;  4GST A;  1U6T A;  1ML6 A;  4MF5 A;  3DWV A;  3IHG A;  3NZN A;  1G6W A;  3M3M A;  1MDJ A;  2VLV A;  1JZR A;  2WDU A;  3D21 A;  1SD9 A;  3F6F A;  4OO4 A;  2GSQ A;  3LG6 A;  1G6Y A;  1ACV A;  5IMC A;  2B6M A;  4CDO A;  1TXX A;  2FD3 A;  3TRP A;  2AAW A;  4YKF A;  3G7Y A;  3DEX A;  3F8U A;  3GX8 A;  1T00 A;  1DE1 A;  2R2J A;  3TOU A;  3RHB A;  2B5Y A;  3I9V 2;  4NHW A;  5CAX A;  2DJ3 A;  4MP4 A;  3MSZ A;  2OE1 A;  4HDE A;  2LQO A;  2K8S A;  1EWX A;  3HXS A;  4EDY A;  4G0I A;  3ZLP A;  2K18 A;  2MBT A;  4KDY A;  5AIX A;  2X4A A;  1JHB A;  3RDW A;  4X1U A;  1LBK A;  4KA0 A;  4PQ1 A;  3Q18 A;  4EO3 A;  4RQR A;  2VCW A;  3K8N A;  4IN0 A;  19GS A;  3A5W A;  1TI1 A;  2I1U A;  4HEA 2;  2IJY A;  1X5C A;  1R5A A;  2C0E A;  3FK8 A;  1VF4 A;  5ECM B;  2VOC A;  3CRU A;  2VL9 A;  4TR4 A;  2JZR A;  4XS6 A;  2DJK A;  4K5R A;  2DBC A;  2GQK A;  3GH6 A;  4AF2 A;  4OCF A;  1XBS A;  2CZ3 A;  4FYC A;  2DSA A;  4ZB9 A;  1WE0 A;  4WF4 A;  3UVT A;  3HVS A;  1AIU A;  2JZS A;  2F9S A;  1SL1 B;  3JCM L;  2VM1 A;  3QFA C;  2AHE A;  4L0W A;  3LOR A;  4EXJ A;  1PX6 A;  2WRT A;  4MJB A;  1S3A A;  3DYR A;  4GXZ A;  1N2A A;  2B7J A;  3J7Y b;  2TRC P;  2V32 A;  3IBH A;  1XWC A;  5ID2 A;  3GNJ A;  1XVW A;  1T7P B;  4O7H A;  2GZP A;  4O5Q A;  4IKH A;  2OKA A;  1UVZ A;  2YOI A;  4GQC A;  4MH3 A;  3VFI A;  1FW1 A;  4TR3 A;  2XC2 A;  2XHF A;  1A0R P;  5DAK A;  4NMU A;  2XPD A;  4IP1 A;  1Z3E A;  2GLR A;  5D9T A;  4LL4 B;  4JE1 A;  4MZW A;  4ML1 A;  3ZMK A;  4WR4 A;  4OCE A;  4KCE A;  4MZB A;  5DAL B;  5GST A;  4AJ7 A;  2VLU A;  2HSH A;  3HVV A;  2C3N A;  1ZMA A;  5HFI A;  2XBI A;  1HNC A;  22GS A;  2GZY A;  2LV3 A;  5CNW A;  1HD2 A;  2DKH A;  2RII A;  3U5R E;  2K8V A;  3QD9 A;  3TJK A;  4EKZ A;  5EL8 A;  5G2Z A;  5ECN B;  2VL2 C;  3TCO A;  2IIY A;  3CMI A;  1GWC A;  3TKP A;  4V1A g;  1YF1 A;  1O7U A;  4TKY A;  3ZFL A;  2L4Q A;  2DKI A;  3QCP A;  3HHV A;  1FAA A;  4ID0 A;  4JU5 A;  1ERT A;  2J9H A;  3FZ9 A;  2GT5 A;  3ZIT A;  5DJM A;  1K0A A;  3C7M A;  3ZRD A;  4G19 A;  3IA1 A;  2V1M A;  3TKR A;  4KUN A;  3TGZ A;  2D2Z A;  2I81 A;  5IMF A;  2P5Q A;  4NHZ A;  2GS3 A;  2OBK A;  5D9W A;  2LS5 A;  1SL2 B;  1TRV A;  2CQ9 A;  4PQI A;  3APQ A;  4FYU A;  18GS A;  2R3X A;  3I6A A;  3D5J A;  4WBJ A;  2GQM A;  3RPP A;  2WGR A;  2YZU A;  5J3R A;  2FNO A;  1FVK A;  2DIZ A;  2PVQ A;  5LD0 A;  5IPG A;  3VWW A;  4MNN A;  2VO4 A;  3KIJ A;  4MJC A;  1J9B A;  2PU9 C;  1PKW A;  3VI5 A;  2G0F A;  2OE3 A;  3A2W A;  4F9Z A;  3VLN A;  1M2A A;  4LLR A;  2JAD A;  3VUR A;  3UOM A;  5KOW A;  1MDK A;  3TJG A;  3KTB A;  3UBK A;  1SJZ A;  1Q4J A;  4GF0 A;  5B8A A;  2EIQ A;  1K0C A;  1ZYN A;  2PUK C;  3N9J A;  2H1D A;  3DKS A;  1FVJ A;  1DBY A;  2M72 A;  1KTE A;  2PPT A;  1ERU A;  1N8J A;  2PWJ A;  3UEM A;  2CVK A;  2YN1 A;  5ECR B;  1THO A;  4KF9 A;  3H8Q A;  1A8Y A;  4N30 A;  3TKS E;  2CAI A;  1O73 A;  2EC4 A;  3EIN A;  2IMI A;  3P90 A;  4TR0 A;  3FEU A;  1A8L A;  3ZL5 A;  3Q74 A;  3CSH A;  1XWA A;  4ISD A;  5HFK A;  3R2Q A;  3FR6 A;  4HJ2 A;  1OAZ A;  1GTA A;  4KH7 A;  3S9F A;  14GS A;  2E7P A;  1FG4 A;  3LW9 A;  2AUV A;  3ERF A;  1XZO A;  4MAB A;  1XWB A;  1VF2 A;  3LFL A;  20GS A;  2DJ2 A;  5AGY A;  1NHY A;  3EPT A;  4POM A;  3W6G A;  1U87 A;  2R0P A;  1GSF A;  4KDX A;  1TP9 A;  3BBY A;  5F0G A;  3IXR A;  4YH2 A;  1HNB A;  4N10 A;  4OMV A;  2NDO A;  1PSQ A;  3H79 A;  5H5Q A;  5E59 A;  3ZVJ D;  2H74 A;  3LXT A;  1TOF A;  4ZBB A;  4F2I A;  5KEJ A;  2CVB A;  1J08 A;  2IMK A;  4D73 B;  4MLY A;  1GRX A;  3F63 A;  4K2D A;  1T8E B;  3GN3 A;  4Z2T A;  1CQH A;  4G0L A;  2PMT A;  1OYJ A;  1V2A A;  1YF0 A;  3F4R A;  2VAF A;  4O32 A;  4EUY A;  1SK2 A;  4TW5 A;  1WMJ A;  3CSJ A;  4USS A;  1PRX A;  1UC7 A;  3FYG A;  4NPB A;  3R3E A;  4DSR A;  1A2L A;  3Q6O A;  2HRA A;  4HZ2 A;  2OA7 A;  3H4K A;  2LQQ A;  3E9J B;  2VLT A;  1JLW A;  1XVQ A;  2OJL A;  4ILF A;  1R26 A;  3IAM 2;  2I4A A;  3ZRE A;  1X0R A;  2C8U A;  4JR6 A;  2V2G A;  5J4U A;  1SJI A;  2YWN A;  4I97 A;  3UBL A;  2XPE A;  1QGV A;  1CQG A;  3TKQ A;  1YZX A;  3IC4 A;  1TJD A;  1M0U A;  3BCI A;  5ECL B;  2L59 A;  2ZCT A;  1TRU A;  3WD6 A;  2CZ2 A;  3MNG A;  2ZNM A;  1AAZ A;  1SKW B;  2LEG A;  4NXI A;  2X49 A;  1MDI A;  5IOX A;  5ECI B;  3MWH A;  3UVH A;  3QAV A;  3J7Y k;  2TRX A;  4ECB A;  4HS1 A;  2L6D A;  3LSZ A;  3KP9 A;  3FKF A;  3C8E A;  4NAX A;  4K1F A;  1SKR B;  3LXZ A;  5JWR B;  2JAC A;  4PUF C;  2P0G A;  2JSZ A;  3CSI A;  4TN8 A;  5F8B A;  2YV7 A;  2MYG A;  1PMT A;  5DAK B;  1BX9 A;  1GLP A;  2P5R A;  3KCM A;  2KLX A;  4TRX A;  3L78 A;  1F3B A;  2LNT A;  2JSY A;  4G0K A;  4EIQ A;  4DEJ A;  3ISO A;  3DXB A;  4MZC A;  5HR2 A;  4EC0 A;  3APO A;  1Z5Y E;  3QMX A;  2MBS A;  3N5O A;  1ZCP A;  1YJ6 A;  1OE7 A;  3MDK A;  3P8W A;  2YNX A;  5JCG A;  4ZL7 A;  1PGT A;  1XXU A;  1EP8 A;  4FQU A;  3UL3 A;  4V2N A;  5GAN D;  3RPN A;  2BTO T;  1EZK A;  2WCI A;  1M9A A;  1O81 A;  2NVL A;  2GT6 A;  2LJK A;  2RUE A;  2H6Z A;  4Z7X A;  1RW1 A;  2R0C A;  2KHP A;  5D96 A;  2AB6 A;  4BVX B;  4Q5Q A;  1WWJ A;  1F9M A;  4N0V A;  4TXO A;  3QR6 A;  5EY6 A;  1YEX A;  3CRT A;  2MZC A;  3ZIV A;  1VF3 A;  3ZYW A;  2FHE A;  4OFN A;  2H8L A;  4D73 A;  2M46 A;  4RUV A;  4TXV A;  3AY8 A;  2C0G A;  4I8B A;  1QMV A;  2C4J A;  4BA7 A;  4ZBD A;  3PGT A;  3Q19 A;  4BL7 A;  2H30 A;  3QFB C;  2HZF A;  2C3T A;  2CT6 A;  2C1Y A;  4OO5 A;  4FH8 A;  1T4Z A;  2F8A A;  2AV4 A;  5A5K A;  5CRE A;  1TDI A;  2HRK A;  2A2S A;  2O7K A;  1V40 A;  2EIR A;  2PVO C;  3D4M A;  1AQX A;  1SYX A;  4TVE A;  3HZ4 A;  2PBJ A;  3KM6 A;  4PXO A;  4Q5R A;  3L9S A;  1VRS D;  1WJK A;  2H73 A;  1GUL A;  1SYR A;  3KGK A;  3KXO A;  4LMW A;  5HQP A;  1ERV A;  5IIZ A;  3ERG A;  5IM9 A;  3M9K A;  1EGR A;  4TR1 A;  3CYN A;  2HFD A;  2QA1 A;  4K7O A;  5D73 A;  4EF0 A;  4KDU A;  4PTS A;  1AUC A;  3EU3 A;  1YY7 A;  4I2T A;  2F51 A;  5ECK B;  2X64 A;  1M9B A;  1PN0 A;  2V41 A;  3KD0 A;  3F3Q A;  5DQS A;  1RK4 A;  3CBU A;  4NV5 A;  3EC3 A;  1XWG A;  3DD3 A;  3BCK A;  3PPU A;  1T4Y A;  3MAK A;  2LJR A;  3DIE A;  1YDK A;  13GS A;  3LQ7 A;  4Z2U A;  2DJJ A;  2X8C A;  3VPQ A;  4IJ3 A;  4JR4 A;  3GMF A;  2K6V A;  2B1K A;  5G5E A;  1AXD A;  3NIV A;  2DLX A;  1WOU A;  7GSS A;  1ZGN A;  2C3Q A;  1XOB A;  1TTZ A;  2HXK A;  4KGI A;  2ZUP A;  4K0G A;  2CAQ A;  4PNG A;  2CX3 A;  2R5G A;  3UAP A;  1QFN A;  1T1V A;  3KMO A;  1SL0 B;  3GV1 A;  2O85 A;  4YKG A;  2HYX A;  3H1N A;  3HJO A;  4KND A;  3VPT A;  1A0F A;  3VI7 A;  2RUF A;  3C1S A;  1XPV A;  1KBN A;  3ERW A;  3NOF A;  5G1K A;  2GGT A;  3TJF A;  4GTU A;  1OC9 B;  4ZL9 A;  3M8N A;  2WFC A;  2ALB A;  2RLI A;  3PIN A;  2VD0 A;  2HT9 A;  2VCV A;  3O3T A;  4ZIL A;  4OFT A;  5EVO A;  2X8G A;  3D0Z A;  2H76 A;  2H0I A;  1GP1 A;  4L5L A;  4KX4 A;  2H1B A;  1MD3 A;  1OKD A;  4BVX A;  3O6T A;  1XOA A;  1AC1 A;  2B5E A;  2L4C A;  4FIW A;  4MPF A;  3HD5 A;  1BQ7 A;  4F0B A;  3TB2 A;  2RM5 A;  3GL3 A;  1EP7 A;  3KP8 A;  1MTC A;  3WYW A;  2EIO A;  5GAP D;  3GFK A;  6GST A;  2H75 A;  4KSO A;  4N0Z A;  2REM A;  4XTS A;  4KAE A;  2NPB A;  4TOP A;  1EOH A;  3RAZ A;  1XCC A;  3UMA A;  5HR3 A;  1YKC A;  1SJ6 A;  4PUR A;  4LL1 B;  3EVI A;  3V1W A;  1Y6E A;  3LJR A;  4MH2 A;  2C0D A;  4YAV A;  3DVX A;  1Z7P A;  3CXG A;  1E2Y A;  5GZZ B;  1W4V A;  1OC8 A;  2LRN A;  4PNF A;  2CX4 A;  2DJ0 A;  1MD4 A;  17GS A;  1K3Y A;  1GUM A;  5A4V A;  3MYD A;  2H72 A;  2LTK A;  1NSW A;  1ON4 A;  2QGV A;  1AQW A;  4G2E A;  5CRD A;  4EDZ A;  3KZQ A;  1Z7R A;  2FWF A;  2C0F A;  1X9W B;  3GST A;  4F0C A;  3GTU B;  2H1A A;  4LA1 A;  3FZ5 A;  1Z6M A;  2GST A;  2VL3 A;  2X99 A;  1JZO A;  3L9U A;  4J2F A;  3A2V A;  2H66 A;  4MK3 A;  3IAS 2;  5ECP B;  5KN1 A;  4XCS A;  1LJR A;  1K0M A;  4L5O A;  2N5A A;  3KH7 A;  1FOH A;  11GS A;  3TDG A;  4K2X A;  5JWO B;  4WR5 A;  1GSD A;  3GUS A;  2VCT A;  4K7I A;  1A24 A;  4A5P A;  5D9X A;  1NHO A;  3M1G A;  1TK5 B;  4ZBA A;  1IYH A;  4PUA A;  1GLQ A;  2GQL A;  1IYI A;  3GX0 A;  3ZVJ A;  4LMV A;  5IMD A;  1UN2 A;  2QKE A;  4ZIJ A;  3LYK A;  2M80 A;  1PL1 A;  2CA8 A;  2O87 A;  5H5R A;  3FMW A;  4CHS A;  4OD7 A;  3FR9 A;  5ECQ B;  1E6B A;  3BOA A;  1X9M B;  1URM A;  1M2D A;  1XW9 A;  2VM2 A;  1V98 A;  4TXO B;  4L8E A;  5LNK e;  4NWY A;  4GRF A;  1NW2 A;  1FB0 A;  4MA9 A;  3PR8 A;  2IMD A;  1JLV A;  1B9X C;  1EGO A;  4BL7 B;  3EMX A;  4BPY A;  4ECC A;  4EL1 A;  1I9D A;  3IR4 A;  4XS4 A;  1PQN A;  4OFM A;  1OC9 A;  3I69 A;  4EE0 A;  1EEJ A;  4E8E A;  4DSS A;  2WB9 A;  4DSQ A;  4MDC A;  5J41 A;  2B1L A;  2H70 A;  3F3R A;  2GVP A;  5DDL A;  5JWQ B;  1R4W A;  3F9U A;  3GL5 A;  3RHC A;  2R6K A;  1OC3 A;  4ZL8 A;  3SWL A;  1ZZY A;  4PGT A;  4ZXG A;  5COH A;  1EEM A;  2DC5 A;  3GKK A;  3EE2 A;  1C72 A;  4XIH A;  2HE3 A;  1TU8 A;  5B8B A;  2HRF A;  4TR1 B;  1PKZ A;  5INY A;  4XS1 A;  3DVW A;  5H5S A;  4IQA A;  3FZA A;  4XRD A;  1GUK A;  1PD2 1;  2GSS A;  1GL8 A;  4QQ7 A;  3APS A;  4K9Z A;  1OKT A;  3C73 A;  4K7N A;  5HR1 A;  4Q5N A;  1ABA A;  4EIP A;  4I6X A;  5IO2 A;  1SK1 A;  3TOT A;  2LST A;  2LUS A;  3SBC A;  1Z9H A;  2A4H A;  4HI7 A;  3G7J A;  4O92 A;  5JCW A;  1XFL A;  1X5E A;  2PER A;  2L5O A;  4ICY A;  4AGS A;  2O89 A;  1THX A;  2H1G A;  5ECS A;  5AIV A;  2R4V A;  2QC7 A;  1Y25 A;  2WZ9 A;  3DGQ A;  1H4O A;  3P2A A;  2BMX A;  1F3A A;  1G0T A;  1K0D A;  3L4N A;  4NV2 A;  1HNA A;  2DIY A;  4GLT A;  2F8F A;  1U3A A;  2H01 A;  5J9C A;  3HVX A;  4AJ6 A;  3MIX A;  4CY6 A;  1SU9 A;  1ZYQ B;  2A2P A;  5ELG A;  2JL4 A;  3P7X A;  4X43 A;  3UIW A;  3GIX A;  3E3E A;  3GTU A;  4X4J A;  2IWT A;  1I5G A;  1G7E A;  4KE3 A;  5CP1 A;  5DVB A;  4GCI A;  2FGX A;  4I2U A;  1GH2 A;  1Z6N A;  2A2R A;  3F6D A;  3GA4 A;  3GSS A;  2KUC A;  1GSQ A;  3GKN A;  5FT3 A;  3WGD A;  1DSB A;  4E8H A;  1X9S B;  2LNS A;  4ECJ A;  4QL9 A;  1HYU A;  5EPF A;  1PX7 A;  1GTB A;  2DMM A;  5C00 A;  4MF7 A;  3KH9 A;  5J9B A;  2ON5 A;  3HZ8 A;  1TKD B;  2FLS A;  2YPM A;  2I9H A;  1ZL9 A;  2VL2 A;  3DML A;  3TJJ A;  1O85 A;  4J57 E;  2GTU A;  1A2J A;  1FB6 A;  3ZTL A;  3CTG A;  1EV9 A;  2G2Q A;  2RM6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...