3EWLA

Crystal structure of conserved protein bf1870 of unknown function from bacteroides fragilis
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
138
structure length
138
Chain Sequence
SNAGMKAADFTYVTVHGDNSRMSRLKAQYTMLFFYDPDCSNCRKFEKLFAEIPAFVEMVENGTLRVLAIYPDENREEWATKAVYMPQGWIVGWNKAGDIRTRQLYDIRATPTIYLLDGRKRVILKDTSMEQLIDYLAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized conserved protein BF1870
publication title Crystal Structure of Conserved protein BF1870 of Unknown Function from Bacteroides fragilis
rcsb
source organism Bacteroides fragilis
molecule tags Structural genomics, unknown function
total genus 34
structure length 138
sequence length 138
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13098 Thioredoxin_2 Thioredoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3ewlA00
2DLXA 1JZOA 4KDUA 4K0GA 2E2GA 1B9XC 4WF5A 3IR4A 1RQMA 2R3XA 3D0ZA 5AIXA 1N2AA 1PKZA 2GGTA 3GRXA 3TOTA 1KTEA 2VLUA 1R7HA 5J5NA 2R4VA 2IFQB 4HJ2A 1TK5B 3GH9A 5KN2A 3PH9A 3IPZA 1EP8A 1AXDA 1GRXA 1SKRB 2HI7A 3I6AA 1NHOA 5IIZA 4XIHA 3ISOA 5IMZA 3KP9A 2RUFA 3LWAA 4F9ZA 1GTBA 3KH7A 2P0GA 4MDCA 4BVXA 1DUGA 2JADA 1F9MA 1XOAA 1THXA 3TKSA 3QDNA 1PMTA 4TR4A 5ID2B 4TXOB 2H75A 1X5EA 1GSYA 2GZZA 6GSWA 3DVWA 1U87A 2MMNA 4HS1A 1A2MA 4OO5A 3FR3A 3W8JA 3HZ8A 4LMWA 5LCZA 4JU5A 1I5GA 1FG4A 2XBQA 2XBIA 5DBQA 3IA1A 6GSTA 2RM5A 3WGDA 2FCHA 1F3BA 4V1Ap 1TDIA 1GSUA 1OC9A 2HSHA 2CX3A 5JCWA 4MF7A 1GSDA 2YWNA 5CAXA 4I2UA 2CZ2A 1MDJA 2CX4A 1Z5YE 2LUSA 3KEBA 2R6KA 3LXZA 3QAWA 20GSA 2HT9A 2C1YA 4EVMA 1NW2A 4H86A 3GIXA 2KP1A 4I97A 3VFIA 5IM9A 4BVYA 12GSA 4NV2A 2VL9A 3IXRA 4YQMA 3F4TA 2JL4A 2NDOA 4K9ZA 1XIYA 1M2BA 4JE1A 3Q18A 2KUCA 1XW9A 4PQ1A 5KN0A 5DCGA 4MZBA 4XS4B 5LD0A 1O73A 4E8HA 5B7CA 4QQ7A 5CRHA 4IJ3A 4J56E 3BBYA 5GSTA 3L4NA 3MWHA 2B6MA 2F8FA 3KZQA 1FHEA 2CVDA 3CTGA 5KN3A 1ERUA 1SJZA 3EURA 4F0CA 3F4SA 3VWVA 2ALBA 4NAXA 3MAKA 2IPAA 3KGKA 5EY6A 3EC3A 3TCOA 2GT6A 2DJ3A 3F3QA 3DYRA 3F3RA 1TOFA 5INYA 2HZEB 3F6DA 1K0AA 4ZB9A 2LNSA 5G30A 2CV4A 2MBTA 1M2DA 3FK8A 1FOVA 1MTCA 1TU7A 4MABA 3HY2A 3ME8A 2C0GA 5IMCA 1J0FA 1C72A 2LKUA 1M99A 1EP7A 1N8JA 4BA7A 5KEJA 3QD9A 3ERFA 2YWIA 3P90A 2MMZA 2YZUA 1GNEA 2H0GA 3WGEA 5D9WA 2DC5A 3G9BA 1M7TA 5HFGA 3TJGA 1YKCA 3M1GA 2MBSA 4XS6A 5IMDA 2F51A 3F6FA 1TI3A 1Z6MA 1VGLA 4TOPA 3DMLA 5CREA 2VLTA 4MP4A 2H1DA 1VF4A 2CVKA 4IVFA 3VI5A 1A23A 2YWMA 2XC2A 4CW9A 2DJ0A 3TJFA 3VK9A 1U3IA 3LFLA 2C8UA 2IMFA 1OKTA 1PL1A 1TU8A 2WRTA 5D9TA 4TR0A 4EE0A 2FUG2 2GVPA 3QR6A 2X8CA 4KSMA 3HVVA 2B3SA 4L0WA 3GTUA 4MPGA 3O3TA 1B4QA 2AV4A 1EV4A 3IHQA 5F07A 2FA4A 4BL7A 4F2IA 4ZB8A 1T00A 3E3EA 9GSSA 4KCAA 2JSYA 4N30A 2BJXA 14GSA 2HXKA 3LYKA 3DXBA 5COHA 4V2NA 5D9XA 2AJQB 4F82A 3ZMLA 10GSA 2GQMA 3BCIA 4N10A 1K0BA 4TR1A 2P31A 4ACSA 1XZOA 3HA9A 3H93A 1SD9A 1JHBA 4MLYA 5JCGA 2LQQA 1V57A 1F6MC 3APOA 2VAFA 4MJEA 5IMFA 1V98A 2X8HA 4PURA 3TRPA 3H8QA 3TKPA 4MJBA 4HU9A 4J2FA 3CTFA 2YOIA 3FYGA 3IRAA 1O8XA 3A2XA 4MA9A 4KA0A 2GSSA 4EF0A 4LA1A 4ZL7A 2H6ZA 2NBSA 2C3NA 4I6XA 5GZZB 1GTIA 3HDCA 4Q5RA 1SYXA 4YQUA 1LJRA 2WCIA 1FO5A 5EL8A 2O89A 1Z9HA 4ECIA 1XVWA 1T3BA 2IWTA 8GSSA 3TJBA 3UJ1A 1ERWA 2FLSA 4POLA 1TXXA 5DQSA 4TVEA 4WBJA 3WGXA 2GZPA 1GLPA 5DJMA 3J7Yb 4ECBA 2EC4A 3LORA 1Q4JA 2JSZA 2LNTA 2H6XA 4KDYA 3GL3A 5DAKB 4GTUA 4TKYA 1K0OA 3G7YA 3M3MA 1A2JA 4AJ8A 2HSYA 2YJHA 2A2RA 5ENUA 1UC7A 1YZXA 4K7NA 1JZRA 2NVLA 5E4WA 2OKAA 2L5OA 1GWCA 1X5CA 2N5FA 4KB3A 5B6MA 2IFQA 4N11A 1J9BA 4WR4A 4FYCA 4POBA 3QFBC 1X9WB 4IGJA 1XWAA 4OFTA 2O85A 3IK7A 2LJKA 4CDOA 3HVXA 2GQLA 1TI1A 4D73B 5H5QA 4ZBAA 4KX4A 3D6IA 3KMNA 2OE1A 4E8EA 3U6VA 3UVTA 1OC8A 2FA8A 2TIRA 1B48A 3PGTA 1QUWA 2B5EA 5G5FA 2JZRA 3D4TA 2PMTA 4K0NA 4TXOA 5ID2A 2VD0A 4JR4A 4EO3A 1F3AA 4ZXGA 3F0IA 4IW9A 2JZTA 5ECHB 4MJCA 3VWXA 1U6TA 3TOUA 4X1UA 5JCUA 3QCPA 3WT1A 17GSA 1GNWA 3P7XA 2I4AA 4HZ2A 2H76A 1O8WA 2WJUA 4FYUA 4OFMA 1AUCA 3H4KA 5DDLA 2TRCP 1G7EA 1TRUA 4Q5NA 2LRNA 1IYHA 2LQOA 1AW9A 5FT3A 4GXZA 1URMA 1MD3A 2PVOC 4K6XA 1PA3A 3GX0A 2JZSA 3BOAA 3L78A 1GP1A 1BYEA 2PU9C 2VCQA 1U88A 5DJLA 1VF2A 4HEA2 2H70A 3F63A 1WRYA 3RHBA 5IO0A 2H8LA 2PERA 6GSXA 3ZIJA 5A4WA 2V6KA 4MCUA 4P3YB 4IBPA 2VCWA 2EIRA 3PINA 1SENA 2VL2A 3VWWA 1GTAA 3VLNA 2VCZA 2KOKA 4I5QA 5IO2A 2I1UA 1WIKA 2B7KA 2GTUA 4MJAA 1J08A 2D2ZA 3TKRA 4NPBA 1FVKA 5AN1A 4XS4A 1OE7A 1E6BA 4AJ7A 1X9MB 1AIUA 4WETA 3A2WA 2HRNA 2H71A 3LEFA 1O6JA 3ZYWA 4GQCA 2F9SA 4IP6A 4OD7A 5IOXA 1EGOA 1M2AA 1DE2A 5G5EA 3S9FA 2H19A 1BJXA 4K2DA 4POKA 3KD0A 4K7IA 22GSA 1ST9A 2VOCA 2IMEA 11GSA 3APQA 3AY8A 4IJIA 2OA7A 2CZ3A 1UA5A 3CBUA 2CT6A 3DEXA 3F4RA 2C0DA 2HZEA 1SYRA 1TK8B 1ZL9A 1ACVA 1VF3A 2LJRA 3CYNA 3RPNA 3FZ9A 1S3DA 2N5AA 2R5GA 4QL7A 4OCEA 3FR6A 1WJKA 3R2QA 3M0FA 4MH3A 4GF0A 3GHAA 4MZWA 3EMPA 5D93A 2V2GA 3C7MA 3IE3A 2I81A 1EV9A 4TN8A 5DALB 2L5LA 4L0UA 4EDZA 2J9HA 5G1KA 5G1LA 3GN3A 1XW5A 1VRSD 2CA8A 2E7PA 3QOUA 3TKSE 1SL0B 1W89A 1FVJA 3UEMA 1OAZA 4KGIA 1TW9A 4N0VA 3O6TA 5DQYA 3UBKA 1BX9A 3TGZA 4MMMA 4O7HA 4LMVA 1PRXA 4WR5A 3GSTA 1PD21 3KXOA 2PUKC 3H1NA 2N5BA 1HNBA 3ZITA 4K7OA 3ZVJD 2MZCA 2FHEA 3NZNA 5H5SA 1TRSA 4WKWA 2CAQA 13GSA 1ON4A 3ERWA 2L4QA 1BQ7A 4GCIA 1KBNA 4XRDA 3GNJA 5ELAA 2B1KA 1GUMA 2VCTA 5IMAA 3CXGA 4ML6A 5AISA 5B8AA 5J3RA 4AJ6A 1SL2B 3GUSA 2QC7A 1MDKA 1A2LA 3ZIVA 2DJ2A 1ZOFA 4RI6A 5JWQB 1XPVA 4ML1A 3VWUA 3EVIA 2H0IA 4HJMA 1XW6A 3PR8A 5ECRB 4RQRA 1AAZA 2YANA 1YKAA 5DVBA 2QKEA 4KDXA 2B1LA 2FD3A 1B4PA 1PKWA 2L6DA 4TRXA 5IPGA 3ZFLA 3NIVA 1XXUA 3LYPA 3ERGA 4EC0A 4L5OA 1EEJA 1K3LA 3GH6A 1FW1A 1R4WA 4BWSA 4XCSA 2YWOA 4ZB6A 2AHEA 5ECQB 1ML6A 1GUHA 1SJ6A 2ON5A 3GSSA 3DD3A 3TKSC 3Q74A 4NXIA 2C80A 2M80A 1V9WA 1I9DA 3C1SA 1PX6A 1ZYEA 5J4UA 3HKRA 4HU7A 4GSSA 1OVNA 3FHKA 2GT5A 2PN8A 4F0BA 2MYGA 3RDWA 1UN2A 1YDKA 3M9KA 1NM3A 4O92A 4LLRA 7GSSA 5JWRB 2JU5A 4KH7A 5KN1A 1YEXA 1YQ1A 1WP0A 3MNGA 5CRWA 1TRVA 2GSTA 4DSSB 2BMXA 2VIMA 3D22A 1G6YA 5ELGA 2LRCA 4NV5A 4IS0A 1KEBA 2I9HA 18GSA 1PN9A 3TRXA 1GUKA 1A8LA 2E0QA 3GFKA 5DAKA 4WEYA 4MH2A 2GLRA 2WZ9A 2GS3A 2VUPA 6GSVA 5D9VA 3SWLA 4IN0A 4XRAA 4CHSA 4KNDA 1JLWA 4BWQA 1Q98A 2LJAA 3QAGA 3IBHA 3GKMA 2QGVA 1TJDA 2P5RA 3HJMA 5F8BA 1WMJA 3HYPA 3HCZA 2C3QA 5FWGA 3ZZXA 2FNOA 2IIYA 4D73A 3A5WA 1B9YC 4EXJA 5L71A 1YF1A 1X5DA 1XWKA 4K1FA 1Z7RA 1B8XA 3Q6OA 2VM1A 4JEDA 3LXTA 5HR3A 5B8BA 2WFCA 1SKWB 4DEJA 3ZLPA 4LL4B 1A24A 3D4MA 1M9BA 1O81A 1ZGNA 2VLVA 4OMVA 2H66A 2KHPA 4RUVA 2BTOT 2V32A 3D21A 1VF1A 4DSRA 4EDYA 2IJYA 4X0XA 16GSA 4JR6A 2ON7A 1X0RA 4L8EA 4RQXA 4XS1A 5G2ZA 1DBYA 3KTBA 2LEGA 1H75A 3F9UA 3OR5A 1O7UA 3VURA 5CO3A 4GLTA 5E59A 1YF0A 6GSYA 1T8EB 3HVSA 2HE3A 1QK8A 2FY6A 3N5OA 2HRFA 4NHZA 3IDVA 2OACA 2EIQA 5A4VA 1GSFA 2L4CA 3LG6A 2LRTA 5FHIA 2MMOA 3GX8A 4GWRA 5F0GA 2RLIA 2ES7A 1OC3A 4IP1A 1XBSA 2AYTA 4ZBDA 3ZVJA 2EIOA 1OKDA 4IQAA 4KE3A 3W6GA 2WB9A 1SU9A 3HJOA 2HNLA 1GTUA 4XTSA 2PVQA 3G7IA 3IOSA 3C1RA 2YV9A 5ECSA 3TJJA 3DGQA 3IAS2 2MMAA 1XFLA 2RUEA 2XPEA 3DVXA 3TB2A 4PQIA 3C8EA 3GL5A 3WD6A 4YAVA 2X8GA 3BD2A 5F06A 4KUNA 3KIJA 4ZL8A 3DRNA 3LSZA 5CRGA 4ZBBA 2GDRA 5ECIB 2HZFA 2H6YA 4IHUA 2FWGA 5ECPB 2GZYA 1E2YA 1X9SB 5ABRA 2AUVA 3EYTA 5IOWA 1Y25A 5GAPD 1KNGA 2XPDA 2F8AA 3GV1A 1GL8A 2IL3A 3BJ5A 4JZQA 1OE8A 2GSQA 1JLVA 3IK9A 3GMFA 4MPFA 2VCXA 1FB0A 3TKQA 2IN3A 4O32A 3FY7A 3KM6A 4IKHA 3LJRA 4KCEA 2CAIA 3H79A 1QQ2A 3C71A 1HQOA 5ECKB 1ZZYA 5ECOB 2X99A 3LQ7A 5DALA 1AQXA 4HZ4A 1THOA 5IQYA 5J41A 2A2SA 2K18A 1G7OA 2X64A 1T4ZA 2OJLA 2TRXA 4TXVA 2IMDA 4O5RA 4V2LA 3EE2A 4NMUA 2PBJA 2DIZA 2V41A 2CVBA 4HI7A 2O87A 1SD8A 3G7JA 4HUAA 4QL9A 3I43A 1M0UA 4OCFA 4GRFA 4FYBA 5D96A 2DJJA 4NWYA 2LTKA 1WPIA 1GSQA 3A3TA 2HLSA 1QGVA 3KTLA 4PUAA 2LS5A 2V1MA 2PPTA 1NSWA 2VO4A 3VI7A 2VM2A 2ZUPA 4ULXA 1EGRA 4G2EA 4AF2A 4PXOA 2H1AA 4Q5FA 3HXSA 1WE0A 1XOBA 1JZDA 3FKFA 3UIWA 1V2AA 3CRUA 3MSZA 3FZAA 1HYUA 3RAZA 1O85A 3CSJA 3IV4A 3HHVA 3HD5A 2KLXA 2OBKA 4OFNA 1QXHA 4I2TA 1ERVA 3APSA 1H4OA 3CRTA 2K8SA 1BEDA 1SJIA 4ZILA 2LSTA 3FR9A 4FIWA 3W8SA 3I69A 5J9BA 5HFKA 5AIVA 1W4VA 3MDKA 3UARA 5IPHA 1GULA 3GA4A 1V40A 1S3AA 5B6NA 5HQPA 2Z9SA 1A0FA 4G10A 1YEPA 2YPMA 1LU4A 5G31A 2H01A 3K8NA 4HQZA 2M46A 1EWXA 4MZCA 1F37A 3DWVA 1AQWA 5GSSA 1F2EA 2WS2A 2WULA 3EU4A 3E0UA 3RHCA 3U5RE 3ZFBA 3ZMKA 1A0RP 5ECMB 1EOGA 3HZ4A 4IELA 3UAPA 4YH2A 3F8UA 4PGTA 2H73A 5D8IA 4WF4A 3FW2A 3QAVA 1OC9B 2DIYA 2L6CA 4V1Ag 3DIEA 3RBTA 4WBRD 2H74A 2WDUA 2HFDA 1XCCA 4V2MA 3NOFA 2C3TA 4Q5QA 2H30A 5C04A 5HFIA 2F3MA 4KAEA 4XHMA 3ZREA 1SL1B 1K0CA 1U3AA 2AAWA 3L9VA 1AQVA 1TKDB 2IMKA 3CMIA 1PL2A 3QMXA 1BAYA 1WWJA 4DSSA 4KW6A 3CSHA 2DSAA 2R37A 3EMXA 4AGSA 2YZHA 1IYIA 1ABAA 1WOUA 3D5JA 2B5XA 3A2VA 3IC4A 4YQVA 1SK0A 2C0EA 4MK3A 5LNKe 3GYKA 1RK4A 2REMA 2FWFA 3ED3A 3BCKA 3IAM2 2JACA 3M9JA 3TRQA 1G6WA 2VL2C 3LGCA 3KP8A 1R26A 1CQHA 3US3A 4KSOA 1ZMAA 3KMOA 3KH9A 1Z3EA 1K0MA 1PX7A 4GQFA 1Z6NA 3E9JB 1ZCPA 4TR3A 1OYJA 5D73A 3CSIA 1TK0B 3GURA 1K0DA 2H72A 4F03A 1DSBA 5AGYA 2K8VA 5JWOB 2R2JA 1XWCA 2KP2A 3JCML 4EL1A 1USBA 2I3YA 5IMVA 1V58A 1SK2A 2FWEA 2AB6A 5ECNB 3RPPA 3GKKA 1MEKA 1XWGA 5HR2A 3O76A 1HNCA 3UL3A 3L9SA 4DVCA 2B7JA 5CRDA 4Z7XA 4G19A 3V1WA 1ERTA 1T4YA 2GQKA 3N9JA 5A5KA 3UVHA 3VPTA 1EOHA 1TP9A 2PGTA 5EVOA 1M9AA 2DMMA 4PUFC 4I8BA 4WXTA 4GSNA 1Z7PA 1GSEA 1PGTA 3FRCA 2PWJA 4HQSA 3FEUA 4JBBA 4G9HA 3ZL5A 4POMA 3ME7A 2YP6A 2OADA 1ZYQB 4K8MA 4ID0A 4TW5A 3SBCA 2RM6A 4FO5A 3TDGA 4ZIJA 1RW1A 1YJ6A 2XHFA 3GKXA 2C0FA 3EINA 1GSSA 4LL1B 2QSIA 3C73A 3TJKA 2HYXA 1EZKA 2YCDA 2G0FA 2IMIA 1K0NA 3KJYA 3EU3A 19GSA 5C00A 4ILFA 4ECCA 5CYYA 4YAPA 4PNFA 4HOJA 2ZNMA 2O8VB 3Q19A 2L59A 2YJ7A 5ECLB 2NPBA 3QPMA 3DKSA 4NHWA 5H5RA 1YY7A 3P8WA 2V6OA 3GTUB 2WGRA 1T1VA 2VL3A 2A4VA 4X43A 1FAAA 4PX1A 4PNGA 2K9FA 2FWHA 5F05A 3UBLA 4ZL9A 3UMAA 5DCHA 1XWBA 1QFNA 4BPYA 3UOMA 1NHYA 4OWYA 5GAND 4J57E 1GH2A 3TUEA 5CP1A 1SK1A 2YNXA 3ZTLA 2DBCA 3FZ4A 1MD4A 6GSUA 1G0TA 2OBIA 4FH8A 2LV3A 2K6VA 4N0ZA 1LBKA 4TR1B 1UVZA 1ILOA 1HNAA 2CQ9A 3GKNA 3VPQA 3ZRDA 3FZ5A 3I9V2 3L9UA 4EUYA 5HR1A 1MDIA 4DSQA 1HD2A 2G2QA 2VCVA 5HR0A 1A8YA 4EKZA 1JFUA 2RIIA 2YN1A 2DJ1A 6GSSA 2H1BA 2DMLA 5A4UA 1S3CA 1TTZA 1K3OA 4ECJA 5J9CA 1PSQA 1QMVA 2OE0A 2YV7A 3QFAC 2GSRA 4JRRA 2OE3A 3WYWA 4IQ1A 2M72A 1SKSB 5EPFA 1GLQA 1T7PB 1JZWA 1K3YA 3EWLA 2H1GA 1CQGA 1Y6EA 4MF5A 2B5YA 3KCMA 2VD1A 4RI7A 3L0HA 2P5QA 2ZCTA 3WT2A 2J23A 4L5LA 4GSTA 3P2AA 1R5PA 2H0HA 2FGXA 4MF6A 1FB6A 1PQNA 1EEMA 4PQHA 2DJKA 3HJPA 1R5AA 2NTOA 4ISDA 5CNWA 4OO4A 2E2MA 3J7Yk 2O7KA 4HDEA 1BG5A 1AC1A 1XVQA 1DE1A 2C4JA 3M8NA 1TRWA 2L57A
chains in the Genus database with same CATH superfamily
2DLXA 1JZOA 4KDUA 4K0GA 2E2GA 1B9XC 4WF5A 3IR4A 1RQMA 2R3XA 3D0ZA 5AIXA 1N2AA 1PKZA 2GGTA 3GRXA 3TOTA 1KTEA 2VLUA 1R7HA 5J5NA 2QA2A 2R4VA 2IFQB 4HJ2A 1TK5B 3GH9A 5KN2A 3PH9A 3IPZA 1EP8A 1AXDA 1GRXA 1SKRB 2HI7A 3I6AA 1NHOA 5IIZA 4XIHA 3ISOA 3FMWA 5IMZA 3KP9A 2RUFA 3LWAA 4YKGA 4F9ZA 4O5QA 1GTBA 3KH7A 2P0GA 4MDCA 4BVXA 1DUGA 2JADA 1F9MA 1XOAA 1THXA 3TKSA 3QDNA 1PMTA 4TR4A 5ID2B 4TXOB 2H75A 1X5EA 1GSYA 2GZZA 6GSWA 3DVWA 4BIKA 1U87A 2MMNA 4HS1A 1A2MA 4OO5A 3FR3A 3W8JA 3HZ8A 4LMWA 5LCZA 4JU5A 1I5GA 1FG4A 2XBQA 2XBIA 5DBQA 3IA1A 6GSTA 2RM5A 3WGDA 2FCHA 1F3BA 4V1Ap 1TDIA 1GSUA 1OC9A 2HSHA 2CX3A 5JCWA 4MF7A 1GSDA 2YWNA 5CAXA 4I2UA 2CZ2A 1MDJA 2CX4A 1Z5YE 2LUSA 3KEBA 2R6KA 3LXZA 3QAWA 20GSA 2HT9A 2C1YA 4EVMA 1NW2A 4H86A 3GIXA 2KP1A 4I97A 1ZYPA 3VFIA 5IM9A 4BVYA 12GSA 4NV2A 2VL9A 3LW9A 3IXRA 4YQMA 3F4TA 2JL4A 2NDOA 4K9ZA 1XIYA 1M2BA 4JE1A 3Q18A 2KUCA 1XW9A 4PQ1A 5KN0A 5DCGA 4MZBA 4XS4B 5LD0A 1O73A 4E8HA 5B7CA 4QQ7A 5CRHA 4IJ3A 4J56E 3BBYA 5GSTA 3L4NA 3MWHA 2B6MA 2F8FA 3KZQA 1FHEA 2CVDA 3CTGA 4HSCX 5KN3A 1ERUA 1SJZA 3EURA 4F0CA 3F4SA 3VWVA 2ALBA 4NAXA 3MAKA 2IPAA 3KGKA 5EY6A 3EC3A 3TCOA 2GT6A 2DJ3A 3F3QA 3DYRA 3F3RA 1TOFA 5INYA 2HZEB 3F6DA 1K0AA 4ZB9A 2LNSA 5G30A 2CV4A 2MBTA 1M2DA 3FK8A 1FOVA 1MTCA 1TU7A 4Z2TA 4MABA 3HY2A 3ME8A 2C0GA 5IMCA 1J0FA 1C72A 2LKUA 1M99A 1EP7A 1N8JA 4BA7A 5KEJA 3QD9A 3ERFA 2YWIA 3P90A 2MMZA 2YZUA 1GNEA 2H0GA 3WGEA 5D9WA 2DC5A 3G9BA 1M7TA 5HFGA 3TJGA 1YKCA 3M1GA 2MBSA 1PN0A 4XS6A 5IMDA 2F51A 3F6FA 1TI3A 1Z6MA 1VGLA 4TOPA 3DMLA 5CREA 2VLTA 2DKIA 4MP4A 2H1DA 1VF4A 2CVKA 4IVFA 3MIXA 1A23A 3VI5A 2YWMA 2XC2A 4CW9A 2DJ0A 3TJFA 3VK9A 1U3IA 3LFLA 2C8UA 2IMFA 1OKTA 1PL1A 1TU8A 2WRTA 5D9TA 4TR0A 4EE0A 2FUG2 2GVPA 3QR6A 2X8CA 4KSMA 3HVVA 2B3SA 4L0WA 3GTUA 4MPGA 3O3TA 1B4QA 2AV4A 1EV4A 3IHQA 5F07A 2FA4A 4BL7A 4F2IA 4ZB8A 1T00A 3E3EA 9GSSA 4KCAA 2JSYA 4N30A 2BJXA 14GSA 2HXKA 3LYKA 3DXBA 5COHA 4V2NA 5D9XA 2AJQB 4F82A 3ZMLA 10GSA 2GQMA 3BCIA 4N10A 1K0BA 4TR1A 2P31A 4ACSA 1XZOA 3HA9A 3H93A 1SD9A 1JHBA 4MLYA 5JCGA 2LQQA 1V57A 1F6MC 3APOA 2VAFA 4MJEA 5IMFA 1V98A 1S3RA 2X8HA 4PURA 3TRPA 3H8QA 3TKPA 4MJBA 4HU9A 4J2FA 3CTFA 2YOIA 3FYGA 3IRAA 1O8XA 3A2XA 4MA9A 4KA0A 2GSSA 4EF0A 4LA1A 4ZL7A 2H6ZA 2NBSA 2C3NA 4I6XA 5GZZB 1GTIA 3HDCA 4FQUA 4Q5RA 1SYXA 4YQUA 1LJRA 2WCIA 1FO5A 5EL8A 2O89A 1Z9HA 4ECIA 1XVWA 1T3BA 2IWTA 8GSSA 3TJBA 3UJ1A 1ERWA 2FLSA 4POLA 1TXXA 5DQSA 4TVEA 4WBJA 3WGXA 2GZPA 1GLPA 5DJMA 3J7Yb 4G0KA 4ECBA 2EC4A 3LORA 1Q4JA 2JSZA 2LNTA 2H6XA 4KDYA 3GL3A 5DAKB 4GTUA 4TKYA 1K0OA 3G7YA 3M3MA 1A2JA 4AJ8A 2HSYA 2YJHA 2A2RA 5ENUA 1UC7A 1YZXA 4K7NA 1JZRA 2NVLA 5E4WA 2OKAA 2L5OA 1GWCA 1X5CA 2HSMA 2N5FA 4KB3A 5B6MA 2IFQA 4N11A 1J9BA 4WR4A 4FYCA 4POBA 3QFBC 1X9WB 4X4JA 4IGJA 1XWAA 4OFTA 2O85A 3IK7A 2LJKA 4CDOA 3HVXA 2GQLA 4KF9A 1TI1A 4D73B 4USSA 5H5QA 4ZBAA 4KX4A 3D6IA 3KMNA 2OE1A 4E8EA 3U6VA 3UVTA 1OC8A 2FA8A 2TIRA 1B48A 3PGTA 1QUWA 2B5EA 5G5FA 2JZRA 3D4TA 2PMTA 4K0NA 4TXOA 5ID2A 2VD0A 4JR4A 4EO3A 1F3AA 4ZXGA 3F0IA 4IW9A 2JZTA 5ECHB 4MJCA 3VWXA 1U6TA 3TOUA 4X1UA 5JCUA 3QCPA 3WT1A 17GSA 1GNWA 3P7XA 2I4AA 4HZ2A 2H76A 1O8WA 2WJUA 4FYUA 4OFMA 1AUCA 3H4KA 5DDLA 2TRCP 1G7EA 1TRUA 4Q5NA 2LRNA 1IYHA 2LQOA 1AW9A 1ZYNA 5FT3A 4YKFA 4GXZA 1URMA 1MD3A 3EPTA 2PVOC 4K6XA 1PA3A 3GX0A 2JZSA 3BOAA 3L78A 1GP1A 1BYEA 2PU9C 2VCQA 1U88A 5DJLA 1VF2A 4HEA2 2H70A 3F63A 1WRYA 3RHBA 5IO0A 2H8LA 2PERA 6GSXA 3ZIJA 5A4WA 2V6KA 4MCUA 4P3YB 4IBPA 2VCWA 2EIRA 3PINA 1SENA 2VL2A 1XG8A 3VWWA 1GTAA 3VLNA 2VCZA 2KOKA 4I5QA 5IO2A 2I1UA 1WIKA 2B7KA 2GTUA 4MJAA 1PFOA 1J08A 2D2ZA 3TKRA 4NPBA 1FVKA 5AN1A 4XS4A 1OE7A 1E6BA 4AJ7A 1X9MB 1AIUA 4WETA 3A2WA 2HRNA 2H71A 3LEFA 1O6JA 3ZYWA 4GQCA 5KOXA 2F9SA 4IP6A 4OD7A 5IOXA 1EGOA 1M2AA 1DE2A 5G5EA 3S9FA 2H19A 1BJXA 2HRAA 4K2DA 4POKA 3KD0A 4K7IA 22GSA 1ST9A 2VOCA 2IMEA 11GSA 3APQA 3AY8A 4IJIA 2OA7A 2CZ3A 1UA5A 3CBUA 2CT6A 3DEXA 3F4RA 2C0DA 2HZEA 1SYRA 1TK8B 1ZL9A 1ACVA 1VF3A 2LJRA 3CYNA 3RPNA 3FZ9A 1S3DA 2N5AA 2R5GA 4QL7A 4OCEA 3FR6A 1WJKA 3R2QA 3M0FA 4MH3A 4GF0A 3GHAA 4MZWA 3EMPA 5D93A 2V2GA 3C7MA 3IE3A 2I81A 1EV9A 4TN8A 5DALB 2L5LA 4L0UA 4EDZA 2J9HA 5G1KA 5G1LA 3GN3A 1XW5A 1VRSD 2CA8A 2E7PA 3QOUA 3TKSE 1SL0B 1W89A 1FVJA 3UEMA 1OAZA 4KGIA 1TW9A 4N0VA 3O6TA 5DQYA 4Z2RA 3UBKA 1BX9A 3TGZA 4MMMA 4O7HA 4LMVA 1PRXA 4WR5A 3GSTA 1PD21 3KXOA 2PUKC 3H1NA 2N5BA 1HNBA 3ZITA 4K7OA 3ZVJD 2MZCA 2FHEA 3NZNA 5H5SA 1TRSA 4WKWA 2CAQA 13GSA 1ON4A 3ERWA 4G0IA 2L4QA 1BQ7A 4GCIA 1KBNA 4XRDA 3GNJA 5ELAA 2B1KA 1GUMA 2VCTA 5IMAA 3CXGA 4ML6A 5AISA 5B8AA 5J3RA 4AJ6A 1SL2B 3GUSA 2QC7A 4PTSA 1MDKA 1A2LA 3ZIVA 2DJ2A 1ZOFA 4RI6A 5JWQB 1XPVA 4ML1A 3VWUA 3EVIA 2H0IA 4HJMA 4K5SA 1XW6A 3PR8A 5ECRB 4RQRA 1AAZA 2YANA 1YKAA 5DVBA 2QKEA 4KDXA 2B1LA 2FD3A 1B4PA 1PKWA 2L6DA 4TRXA 5IPGA 3ZFLA 3NIVA 1XXUA 3LYPA 3ERGA 4EC0A 4L5OA 1EEJA 1K3LA 3GH6A 1FW1A 1R4WA 4BWSA 4XCSA 2YWOA 4ZB6A 2AHEA 5ECQB 1ML6A 1GUHA 1SJ6A 2ON5A 3GSSA 3DD3A 3TKSC 3Q74A 4NXIA 2C80A 4EIPA 2M80A 1V9WA 1I9DA 3C1SA 1PX6A 1ZYEA 5J4UA 3HKRA 4HU7A 4GSSA 1OVNA 3FHKA 2GT5A 2PN8A 4F0BA 2MYGA 3RDWA 1UN2A 1YDKA 3M9KA 1NM3A 4O92A 4LLRA 7GSSA 5JWRB 2JU5A 4KH7A 5KN1A 1YEXA 1YQ1A 1WP0A 3MNGA 5CRWA 1TRVA 2GSTA 4DSSB 2BMXA 2VIMA 3D22A 1G6YA 5KOWA 5ELGA 2LRCA 4NV5A 4IS0A 1KEBA 2I9HA 18GSA 1PN9A 3TRXA 3IHGA 1GUKA 1A8LA 2E0QA 3GFKA 5DAKA 4WEYA 4MH2A 2GLRA 2WZ9A 2GS3A 2VUPA 6GSVA 5D9VA 3SWLA 4IN0A 4XRAA 4CHSA 4KNDA 1JLWA 4BWQA 1Q98A 2LJAA 3QAGA 3IBHA 3GKMA 2QGVA 1TJDA 2P5RA 3HJMA 5F8BA 1WMJA 3HYPA 3HCZA 2C3QA 5FWGA 3ZZXA 2FNOA 2IIYA 4D73A 3A5WA 1B9YC 4EXJA 5L71A 1YF1A 1X5DA 1XWKA 4K1FA 1Z7RA 1B8XA 3Q6OA 2VM1A 4JEDA 3LXTA 5HR3A 5B8BA 2WFCA 1SKWB 4DEJA 3ZLPA 4LL4B 1A24A 3D4MA 1M9BA 1O81A 1ZGNA 2VLVA 4OMVA 2H66A 2KHPA 4RUVA 2BTOT 2V32A 3D21A 1VF1A 4DSRA 4EDYA 2IJYA 4X0XA 4G0LA 16GSA 4JR6A 2ON7A 1X0RA 4L8EA 4RQXA 4XS1A 5G2ZA 1DBYA 3KTBA 4Z2UA 2LEGA 1H75A 3F9UA 3OR5A 1O7UA 3VURA 5CO3A 4GLTA 5E59A 1YF0A 6GSYA 1T8EB 3HVSA 2HE3A 1QK8A 4ICYA 2FY6A 3N5OA 2HRFA 4NHZA 3IDVA 2OACA 2EIQA 5A4VA 1GSFA 2L4CA 3LG6A 2LRTA 5FHIA 2MMOA 3GX8A 4GWRA 5F0GA 2RLIA 2ES7A 1M3JA 1OC3A 4IP1A 1XBSA 2AYTA 4ZBDA 3ZVJA 2EIOA 1OKDA 4IQAA 4KE3A 3W6GA 2WB9A 1SU9A 3HJOA 2HNLA 1GTUA 4XTSA 2PVQA 3G7IA 3IOSA 3C1RA 2YV9A 5ECSA 3TJJA 3DGQA 3IAS2 2MMAA 1XFLA 2RUEA 2XPEA 3DVXA 3TB2A 4PQIA 2R0CA 3C8EA 3GL5A 5BMUA 3WD6A 4YAVA 2X8GA 3BD2A 5F06A 4KUNA 3KIJA 4ZL8A 3DRNA 3LSZA 5CRGA 4ZBBA 2GDRA 5ECIB 2HZFA 2H6YA 4IHUA 2FWGA 5ECPB 2GZYA 1E2YA 4K5RA 2X4AA 1X9SB 5ABRA 2AUVA 3EYTA 5IOWA 1Y25A 5GAPD 1FOHA 1KNGA 2XPDA 2F8AA 3GV1A 1GL8A 2IL3A 3BJ5A 4JZQA 1OE8A 2GSQA 1JLVA 3IK9A 3GMFA 4MPFA 2VCXA 1FB0A 3TKQA 2IN3A 4O32A 3FY7A 3KM6A 4IKHA 3LJRA 4KCEA 2CAIA 3H79A 1QQ2A 3C71A 1HQOA 5ECKB 1ZZYA 5ECOB 2X99A 3LQ7A 5DALA 1AQXA 4HZ4A 1THOA 5IQYA 5J41A 2A2SA 2K18A 1G7OA 2X64A 1T4ZA 2OJLA 2TRXA 4TXVA 2IMDA 4O5RA 4V2LA 3EE2A 4NMUA 2PBJA 2DIZA 2V41A 2CVBA 4HI7A 2O87A 1SD8A 3G7JA 4HUAA 4QL9A 4CY8A 3I43A 3IC8A 1M0UA 4OCFA 4GRFA 4FYBA 5D96A 2DJJA 4NWYA 2LTKA 1WPIA 1GSQA 3A3TA 2HLSA 1QGVA 3KTLA 4PUAA 2LS5A 2V1MA 2PPTA 1NSWA 2VO4A 3VI7A 2VM2A 2ZUPA 4ULXA 1EGRA 4G2EA 4AF2A 4PXOA 2H1AA 4Q5FA 3HXSA 1WE0A 1XOBA 1JZDA 3FKFA 3UIWA 1V2AA 3CRUA 3MSZA 3FZAA 1HYUA 3RAZA 2QA1A 1O85A 3CSJA 3IV4A 3HHVA 3HD5A 2KLXA 2OBKA 4OFNA 1QXHA 4I2TA 1ERVA 3APSA 1H4OA 3CRTA 2K8SA 1BEDA 1SJIA 4ZILA 2LSTA 3FR9A 4FIWA 3W8SA 3I69A 5J9BA 5HFKA 5AIVA 1W4VA 3MDKA 3UARA 5IPHA 1GULA 3GA4A 1V40A 1S3AA 5B6NA 5HQPA 4BVXB 2Z9SA 1A0FA 4G10A 1YEPA 2YPMA 1LU4A 5G31A 2A2PA 2H01A 3K8NA 4HQZA 2M46A 1EWXA 4MZCA 1F37A 3DWVA 1AQWA 5GSSA 1F2EA 2WS2A 2WULA 3EU4A 3E0UA 3RHCA 3U5RE 3ZFBA 3ZMKA 1A0RP 5ECMB 1EOGA 3HZ4A 4IELA 3UAPA 4YH2A 4EIQA 3F8UA 4PGTA 2H73A 5D8IA 4WF4A 3CQFA 3FW2A 3QAVA 1OC9B 2DIYA 2L6CA 4V1Ag 3DIEA 3RBTA 4WBRD 2H74A 2WDUA 2HFDA 1XCCA 4V2MA 3NOFA 2C3TA 4Q5QA 5BRTA 2H30A 5C04A 5HFIA 2F3MA 4KAEA 4XHMA 3ZREA 1SL1B 1K0CA 1U3AA 2AAWA 3L9VA 1AQVA 1TKDB 2IMKA 3CMIA 1PL2A 3QMXA 1BAYA 1WWJA 4DSSA 4KW6A 3CSHA 2DSAA 4BVYB 4CY6A 2R37A 3EMXA 4AGSA 2YZHA 1IYIA 1ABAA 1WOUA 3D5JA 2B5XA 3A2VA 3IC4A 4YQVA 1SK0A 2C0EA 4MK3A 5LNKe 3GYKA 1RK4A 2REMA 2FWFA 3ED3A 3BCKA 3IAM2 2JACA 3M9JA 3TRQA 1G6WA 2VL2C 3LGCA 3KP8A 1R26A 1CQHA 3US3A 4KSOA 1ZMAA 3KMOA 3KH9A 1Z3EA 2R0GA 1K0MA 1PX7A 4GQFA 1Z6NA 3E9JB 1ZCPA 4TR3A 1OYJA 5D73A 3CSIA 1TK0B 3GURA 1K0DA 2H72A 4F03A 1DSBA 5AGYA 2K8VA 5JWOB 2X49A 2R2JA 1XWCA 2KP2A 3JCML 4EL1A 1USBA 2I3YA 5IMVA 1V58A 1SK2A 2FWEA 2AB6A 5ECNB 3RPPA 3GKKA 1MEKA 1XWGA 3MYDA 5HR2A 3O76A 1HNCA 3UL3A 3L9SA 4DVCA 2B7JA 5CRDA 4Z7XA 4G19A 3V1WA 1ERTA 1T4YA 2GQKA 3N9JA 5A5KA 3UVHA 3VPTA 1EOHA 1TP9A 2A4HA 2PGTA 5EVOA 1M9AA 2DMMA 4PUFC 4I8BA 4WXTA 4GSNA 1Z7PA 1GSEA 1PGTA 3FRCA 2PWJA 4HQSA 3FEUA 4JBBA 4G9HA 3ZL5A 4POMA 3ME7A 2YP6A 2OADA 1ZYQB 4K8MA 4ID0A 4TW5A 3SBCA 2RM6A 4FO5A 3TDGA 4ZIJA 4A5PA 1RW1A 2R0PA 1YJ6A 2XHFA 3GKXA 2C0FA 3EINA 1GSSA 4LL1B 4K2XA 2QSIA 3C73A 3TJKA 2HYXA 1EZKA 2YCDA 2G0FA 2IMIA 1K0NA 3KJYA 3EU3A 19GSA 5C00A 4ILFA 4ECCA 5CYYA 4YAPA 4PNFA 4HOJA 2ZNMA 2O8VB 3Q19A 2L59A 2YJ7A 5ECLB 2NPBA 3QPMA 3DKSA 4NHWA 5H5RA 3PPUA 1YY7A 3P8WA 2V6OA 3GTUB 2WGRA 1T1VA 2VL3A 2A4VA 4X43A 1FAAA 4PX1A 4PNGA 2K9FA 2FWHA 5F05A 3UBLA 4ZL9A 3UMAA 4BL7B 5DCHA 1XWBA 3R3EA 1QFNA 4BPYA 3UOMA 1NHYA 4OWYA 5GAND 4J57E 1GH2A 3TUEA 5CP1A 1SK1A 2YNXA 3ZTLA 2DBCA 3FZ4A 2HRKA 1MD4A 6GSUA 3A5IA 1G0TA 2OBIA 4FH8A 2LV3A 2K6VA 4N0ZA 1LBKA 4TR1B 1UVZA 2DKHA 1HNAA 2CQ9A 1ILOA 3GKNA 3VPQA 3ZRDA 3FZ5A 3I9V2 3L9UA 4EUYA 5HR1A 1MDIA 4DSQA 1HD2A 2G2QA 2VCVA 5HR0A 1A8YA 4EKZA 4O5UA 1JFUA 2RIIA 2YN1A 2DJ1A 6GSSA 2H1BA 2DMLA 5A4UA 1S3CA 1TTZA 1K3OA 4ECJA 5J9CA 1PSQA 1QMVA 2OE0A 2YV7A 3QFAC 2GSRA 4JRRA 2OE3A 3WYWA 4IQ1A 2M72A 1SKSB 5EPFA 1GLQA 1T7PB 1JZWA 1K3YA 3EWLA 2H1GA 1CQGA 1Y6EA 4MF5A 1M3IA 2B5YA 3KCMA 2VD1A 4RI7A 3L0HA 2P5QA 2ZCTA 2UZ8A 3WT2A 2J23A 4L5LA 4MNNA 4GSTA 3P2AA 1R5PA 2H0HA 2FGXA 4MF6A 1FB6A 1PQNA 1EEMA 4PQHA 2DJKA 3HJPA 1R5AA 2NTOA 4ISDA 3HVNA 5CNWA 4OO4A 2E2MA 3J7Yk 2O7KA 4HDEA 1BG5A 1AC1A 1XVQA 1DE1A 2C4JA 3M8NA 1TRWA 2L57A
chains in the Genus database with same CATH topology
2DLXA 1JZOA 4KDUA 4K0GA 2E2GA 1B9XC 4WF5A 3IR4A 1RQMA 2R3XA 3D0ZA 5AIXA 1N2AA 1PKZA 2GGTA 3GRXA 3TOTA 1KTEA 2VLUA 1R7HA 5J5NA 2QA2A 2R4VA 2IFQB 4HJ2A 1TK5B 3GH9A 5KN2A 3PH9A 3IPZA 1EP8A 1AXDA 1GRXA 1SKRB 2HI7A 3I6AA 1NHOA 5IIZA 4XIHA 3ISOA 3FMWA 5IMZA 3KP9A 2RUFA 3LWAA 4YKGA 4F9ZA 4O5QA 1GTBA 3KH7A 2P0GA 4MDCA 4BVXA 1DUGA 2JADA 1F9MA 1XOAA 1THXA 3TKSA 3QDNA 1PMTA 4TR4A 5ID2B 4TXOB 2H75A 1X5EA 1GSYA 2GZZA 6GSWA 3DVWA 1U87A 2MMNA 4HS1A 1A2MA 4OO5A 3FR3A 3W8JA 3HZ8A 4LMWA 5LCZA 4JU5A 1I5GA 1FG4A 2XBQA 2XBIA 5DBQA 3IA1A 6GSTA 2RM5A 3WGDA 2FCHA 1F3BA 4V1Ap 1TDIA 1GSUA 1OC9A 2HSHA 2CX3A 5JCWA 4MF7A 1GSDA 2YWNA 5CAXA 4I2UA 2CZ2A 1MDJA 2CX4A 1Z5YE 2LUSA 3KEBA 2R6KA 3LXZA 3QAWA 20GSA 2HT9A 2C1YA 4EVMA 1NW2A 4H86A 3GIXA 2KP1A 4I97A 1ZYPA 3VFIA 5IM9A 4BVYA 12GSA 4NV2A 2VL9A 3LW9A 3IXRA 4YQMA 3F4TA 2JL4A 2NDOA 4K9ZA 1XIYA 1M2BA 4JE1A 3Q18A 2KUCA 1XW9A 4PQ1A 5KN0A 5DCGA 4MZBA 4XS4B 5LD0A 1O73A 4E8HA 5B7CA 4QQ7A 5CRHA 4IJ3A 4J56E 3BBYA 5GSTA 3L4NA 3MWHA 2B6MA 2F8FA 3KZQA 1FHEA 2CVDA 3CTGA 5KN3A 1ERUA 1SJZA 3EURA 4F0CA 3F4SA 3VWVA 2ALBA 4NAXA 3MAKA 2IPAA 3KGKA 5EY6A 3EC3A 3TCOA 2GT6A 2DJ3A 3F3QA 3DYRA 3F3RA 1TOFA 5INYA 2HZEB 3F6DA 1K0AA 4ZB9A 2LNSA 5G30A 2CV4A 2MBTA 1M2DA 3FK8A 1FOVA 1MTCA 1TU7A 4Z2TA 4MABA 3HY2A 3ME8A 2C0GA 5IMCA 1J0FA 1C72A 2LKUA 1M99A 1EP7A 1N8JA 4BA7A 5KEJA 3QD9A 3ERFA 2YWIA 3P90A 2MMZA 2YZUA 1GNEA 2H0GA 3WGEA 5D9WA 2DC5A 3G9BA 1M7TA 5HFGA 3TJGA 1YKCA 3M1GA 2MBSA 1PN0A 4XS6A 5IMDA 2F51A 3F6FA 1TI3A 1Z6MA 1VGLA 4TOPA 3DMLA 5CREA 2VLTA 2DKIA 4MP4A 2H1DA 1VF4A 2CVKA 4IVFA 3MIXA 1A23A 3VI5A 2YWMA 2XC2A 4CW9A 2DJ0A 3TJFA 3VK9A 1U3IA 3LFLA 2C8UA 2IMFA 1OKTA 1PL1A 1TU8A 2WRTA 5D9TA 4TR0A 4EE0A 2FUG2 2GVPA 3QR6A 2X8CA 4KSMA 3HVVA 2B3SA 4L0WA 3GTUA 4MPGA 3O3TA 1B4QA 2AV4A 1EV4A 3IHQA 5F07A 2FA4A 4BL7A 4F2IA 4ZB8A 1T00A 3E3EA 9GSSA 4KCAA 2JSYA 4N30A 2BJXA 14GSA 2HXKA 3LYKA 3DXBA 5COHA 4V2NA 5D9XA 2AJQB 4F82A 3ZMLA 10GSA 2GQMA 3BCIA 4N10A 1K0BA 4TR1A 2P31A 4ACSA 1XZOA 3HA9A 3H93A 1SD9A 1JHBA 4MLYA 5JCGA 2LQQA 1V57A 1F6MC 3APOA 2VAFA 4MJEA 5IMFA 1V98A 2X8HA 4PURA 3TRPA 3H8QA 3TKPA 4MJBA 4HU9A 4J2FA 3CTFA 2YOIA 3FYGA 3IRAA 1O8XA 3A2XA 4MA9A 4KA0A 2GSSA 4EF0A 4LA1A 4ZL7A 2H6ZA 2NBSA 2C3NA 4I6XA 5GZZB 1GTIA 3HDCA 4FQUA 4Q5RA 1SYXA 4YQUA 1LJRA 2WCIA 1FO5A 5EL8A 2O89A 1Z9HA 4ECIA 1XVWA 1T3BA 2IWTA 8GSSA 3TJBA 3UJ1A 1ERWA 2FLSA 4POLA 1TXXA 5DQSA 4TVEA 4WBJA 3WGXA 2GZPA 1GLPA 5DJMA 3J7Yb 4G0KA 4ECBA 2EC4A 3LORA 1Q4JA 2JSZA 2LNTA 2H6XA 4KDYA 3GL3A 5DAKB 4GTUA 4TKYA 1K0OA 3G7YA 3M3MA 1A2JA 4AJ8A 2HSYA 2YJHA 2A2RA 5ENUA 1UC7A 1YZXA 4K7NA 1JZRA 2NVLA 5E4WA 2OKAA 2L5OA 1GWCA 1X5CA 2HSMA 2N5FA 4KB3A 5B6MA 2IFQA 4N11A 1J9BA 4WR4A 4FYCA 4POBA 3QFBC 1X9WB 4X4JA 4IGJA 1XWAA 4OFTA 2O85A 3IK7A 2LJKA 4CDOA 3HVXA 2GQLA 4KF9A 1TI1A 4D73B 4USSA 5H5QA 4ZBAA 4KX4A 3D6IA 3KMNA 2OE1A 4E8EA 3U6VA 3UVTA 1OC8A 2FA8A 2TIRA 1B48A 3PGTA 1QUWA 2B5EA 5G5FA 2JZRA 3D4TA 2PMTA 4K0NA 4TXOA 5ID2A 2VD0A 4JR4A 4EO3A 1F3AA 4ZXGA 3F0IA 4IW9A 2JZTA 5ECHB 4MJCA 3VWXA 1U6TA 3TOUA 4X1UA 5JCUA 3QCPA 3WT1A 17GSA 1GNWA 3P7XA 2I4AA 4HZ2A 2H76A 1O8WA 2WJUA 4FYUA 4OFMA 1AUCA 3H4KA 5DDLA 2TRCP 1G7EA 1TRUA 4Q5NA 2LRNA 1IYHA 2LQOA 1AW9A 1ZYNA 5FT3A 4YKFA 4GXZA 1URMA 1MD3A 3EPTA 2PVOC 4K6XA 1PA3A 3GX0A 2JZSA 3BOAA 3L78A 1GP1A 1BYEA 2PU9C 2VCQA 1U88A 5DJLA 1VF2A 4HEA2 2H70A 3F63A 1WRYA 3RHBA 5IO0A 2H8LA 2PERA 6GSXA 3ZIJA 5A4WA 2V6KA 4MCUA 4P3YB 4IBPA 2VCWA 2EIRA 3PINA 1SENA 2VL2A 3VWWA 1GTAA 3VLNA 2VCZA 2KOKA 4I5QA 5IO2A 2I1UA 1WIKA 2B7KA 2GTUA 4MJAA 1J08A 2D2ZA 3TKRA 4NPBA 1FVKA 5AN1A 4XS4A 1OE7A 1E6BA 4AJ7A 1X9MB 1AIUA 4WETA 3A2WA 2HRNA 2H71A 3LEFA 1O6JA 3ZYWA 4GQCA 5KOXA 2F9SA 4IP6A 4OD7A 5IOXA 1EGOA 1M2AA 1DE2A 5G5EA 3S9FA 2H19A 1BJXA 2HRAA 4K2DA 4POKA 3KD0A 4K7IA 22GSA 1ST9A 2VOCA 2IMEA 11GSA 3APQA 3AY8A 4IJIA 2OA7A 2CZ3A 1UA5A 3CBUA 2CT6A 3DEXA 3F4RA 2C0DA 2HZEA 1SYRA 1TK8B 1ZL9A 1ACVA 1VF3A 2LJRA 3CYNA 3RPNA 3FZ9A 1S3DA 2N5AA 2R5GA 4QL7A 4OCEA 3FR6A 1WJKA 3R2QA 3M0FA 4MH3A 4GF0A 3GHAA 4MZWA 3EMPA 5D93A 2V2GA 3C7MA 3IE3A 2I81A 1EV9A 4TN8A 5DALB 2L5LA 4L0UA 4EDZA 2J9HA 5G1KA 5G1LA 3GN3A 1XW5A 1VRSD 2CA8A 2E7PA 3QOUA 3TKSE 1SL0B 1W89A 1FVJA 3UEMA 1OAZA 4KGIA 1TW9A 4N0VA 3O6TA 5DQYA 4Z2RA 3UBKA 1BX9A 3TGZA 4MMMA 4O7HA 4LMVA 1PRXA 4WR5A 3GSTA 1PD21 3KXOA 2PUKC 3H1NA 2N5BA 1HNBA 3ZITA 4K7OA 3ZVJD 2MZCA 2FHEA 3NZNA 5H5SA 1TRSA 4WKWA 2CAQA 13GSA 1ON4A 3ERWA 4G0IA 2L4QA 1BQ7A 4GCIA 1KBNA 4XRDA 3GNJA 5ELAA 2B1KA 1GUMA 2VCTA 5IMAA 3CXGA 4ML6A 5AISA 5B8AA 5J3RA 4AJ6A 1SL2B 3GUSA 2QC7A 4PTSA 1MDKA 1A2LA 3ZIVA 2DJ2A 1ZOFA 4RI6A 5JWQB 1XPVA 4ML1A 3VWUA 3EVIA 2H0IA 4HJMA 4K5SA 1XW6A 3PR8A 5ECRB 4RQRA 1AAZA 2YANA 1YKAA 5DVBA 2QKEA 4KDXA 2B1LA 2FD3A 1B4PA 1PKWA 2L6DA 4TRXA 5IPGA 3ZFLA 3NIVA 1XXUA 3LYPA 3ERGA 4EC0A 4L5OA 1EEJA 1K3LA 3GH6A 1FW1A 1R4WA 4BWSA 4XCSA 2YWOA 4ZB6A 2AHEA 5ECQB 1ML6A 1GUHA 1SJ6A 2ON5A 3GSSA 3DD3A 3TKSC 3Q74A 4NXIA 2C80A 4EIPA 2M80A 1V9WA 1I9DA 3C1SA 1PX6A 1ZYEA 5J4UA 3HKRA 4HU7A 4GSSA 1OVNA 3FHKA 2GT5A 2PN8A 4F0BA 2MYGA 3RDWA 1UN2A 1YDKA 3M9KA 1NM3A 4O92A 4LLRA 7GSSA 5JWRB 2JU5A 4KH7A 5KN1A 1YEXA 1YQ1A 1WP0A 3MNGA 5CRWA 1TRVA 2GSTA 4DSSB 2BMXA 2VIMA 3D22A 1G6YA 5KOWA 5ELGA 2LRCA 4NV5A 4IS0A 1KEBA 2I9HA 18GSA 1PN9A 3TRXA 3IHGA 1GUKA 1A8LA 2E0QA 3GFKA 5DAKA 4WEYA 4MH2A 2GLRA 2WZ9A 2GS3A 2VUPA 6GSVA 5D9VA 3SWLA 4IN0A 4XRAA 4CHSA 4KNDA 1JLWA 4BWQA 1Q98A 2LJAA 3QAGA 3IBHA 3GKMA 2QGVA 1TJDA 2P5RA 3HJMA 5F8BA 1WMJA 3HYPA 3HCZA 2C3QA 5FWGA 3ZZXA 2FNOA 2IIYA 4D73A 3A5WA 1B9YC 4EXJA 5L71A 1YF1A 1X5DA 1XWKA 4K1FA 1Z7RA 1B8XA 3Q6OA 2VM1A 4JEDA 3LXTA 5HR3A 5B8BA 2WFCA 1SKWB 4DEJA 3ZLPA 4LL4B 1A24A 3D4MA 1M9BA 1O81A 1ZGNA 2VLVA 4OMVA 2H66A 2KHPA 4RUVA 2BTOT 2V32A 3D21A 1VF1A 4DSRA 4EDYA 2IJYA 4X0XA 4G0LA 16GSA 4JR6A 2ON7A 1X0RA 4L8EA 4RQXA 4XS1A 5G2ZA 1DBYA 3KTBA 4Z2UA 2LEGA 1H75A 3F9UA 3OR5A 1O7UA 3VURA 5CO3A 4GLTA 5E59A 1YF0A 6GSYA 1T8EB 3HVSA 2HE3A 1QK8A 4ICYA 2FY6A 3N5OA 2HRFA 4NHZA 3IDVA 2OACA 2EIQA 5A4VA 1GSFA 2L4CA 3LG6A 2LRTA 5FHIA 2MMOA 3GX8A 4GWRA 5F0GA 2RLIA 2ES7A 1OC3A 4IP1A 1XBSA 2AYTA 4ZBDA 3ZVJA 2EIOA 1OKDA 4IQAA 4KE3A 3W6GA 2WB9A 1SU9A 3HJOA 2HNLA 1GTUA 4XTSA 2PVQA 3G7IA 3IOSA 3C1RA 2YV9A 5ECSA 3TJJA 3DGQA 3IAS2 2MMAA 1XFLA 2RUEA 2XPEA 3DVXA 3TB2A 4PQIA 2R0CA 3C8EA 3GL5A 5BMUA 3WD6A 4YAVA 2X8GA 3BD2A 5F06A 4KUNA 3KIJA 4ZL8A 3DRNA 3LSZA 5CRGA 4ZBBA 2GDRA 5ECIB 2HZFA 2H6YA 4IHUA 2FWGA 5ECPB 2GZYA 1E2YA 4K5RA 2X4AA 1X9SB 5ABRA 2AUVA 3EYTA 5IOWA 1Y25A 5GAPD 1FOHA 1KNGA 2XPDA 2F8AA 3GV1A 1GL8A 2IL3A 3BJ5A 4JZQA 1OE8A 2GSQA 1JLVA 3IK9A 3GMFA 4MPFA 2VCXA 1FB0A 3TKQA 2IN3A 4O32A 3FY7A 3KM6A 4IKHA 3LJRA 4KCEA 2CAIA 3H79A 1QQ2A 3C71A 1HQOA 5ECKB 1ZZYA 5ECOB 2X99A 3LQ7A 5DALA 1AQXA 4HZ4A 1THOA 5IQYA 5J41A 2A2SA 2K18A 1G7OA 2X64A 1T4ZA 2OJLA 2TRXA 4TXVA 2IMDA 4O5RA 4V2LA 3EE2A 4NMUA 2PBJA 2DIZA 2V41A 2CVBA 4HI7A 2O87A 1SD8A 3G7JA 4HUAA 4QL9A 4CY8A 3I43A 3IC8A 1M0UA 4OCFA 4GRFA 4FYBA 5D96A 2DJJA 4NWYA 2LTKA 1WPIA 1GSQA 3A3TA 2HLSA 1QGVA 3KTLA 4PUAA 2LS5A 2V1MA 2PPTA 1NSWA 2VO4A 3VI7A 2VM2A 2ZUPA 4ULXA 1EGRA 4G2EA 4AF2A 4PXOA 2H1AA 4Q5FA 3HXSA 1WE0A 1XOBA 1JZDA 3FKFA 3UIWA 1V2AA 3CRUA 3MSZA 3FZAA 1HYUA 3RAZA 2QA1A 1O85A 3CSJA 3IV4A 3HHVA 3HD5A 2KLXA 2OBKA 4OFNA 1QXHA 4I2TA 1ERVA 3APSA 1H4OA 3CRTA 2K8SA 1BEDA 1SJIA 4ZILA 2LSTA 3FR9A 4FIWA 3W8SA 3I69A 5J9BA 5HFKA 5AIVA 1W4VA 3MDKA 3UARA 5IPHA 1GULA 3GA4A 1V40A 1S3AA 5B6NA 5HQPA 4BVXB 2Z9SA 1A0FA 4G10A 1YEPA 2YPMA 1LU4A 5G31A 2A2PA 2H01A 3K8NA 4HQZA 2M46A 1EWXA 4MZCA 1F37A 3DWVA 1AQWA 5GSSA 1F2EA 2WS2A 2WULA 3EU4A 3E0UA 3RHCA 3U5RE 3ZFBA 3ZMKA 1A0RP 5ECMB 1EOGA 3HZ4A 4IELA 3UAPA 4YH2A 4EIQA 3F8UA 4PGTA 2H73A 5D8IA 4WF4A 3FW2A 3QAVA 1OC9B 2DIYA 2L6CA 4V1Ag 3DIEA 3RBTA 4WBRD 2H74A 2WDUA 2HFDA 1XCCA 4V2MA 3NOFA 2C3TA 4Q5QA 5BRTA 2H30A 5C04A 5HFIA 2F3MA 4KAEA 4XHMA 3ZREA 1SL1B 1K0CA 1U3AA 2AAWA 3L9VA 1AQVA 1TKDB 2IMKA 3CMIA 1PL2A 3QMXA 1BAYA 1WWJA 4DSSA 4KW6A 3CSHA 2DSAA 4BVYB 4CY6A 2R37A 3EMXA 4AGSA 2YZHA 1IYIA 1ABAA 1WOUA 3D5JA 2B5XA 3A2VA 3IC4A 4YQVA 1SK0A 2C0EA 4MK3A 5LNKe 3GYKA 1RK4A 2REMA 2FWFA 3ED3A 3BCKA 3IAM2 2JACA 3M9JA 3TRQA 1G6WA 2VL2C 3LGCA 3KP8A 1R26A 1CQHA 3US3A 4KSOA 1ZMAA 3KMOA 3KH9A 1Z3EA 2R0GA 1K0MA 1PX7A 4GQFA 1Z6NA 3E9JB 1ZCPA 4TR3A 1OYJA 5D73A 3CSIA 1TK0B 3GURA 1K0DA 2H72A 4F03A 1DSBA 5AGYA 2K8VA 5JWOB 2X49A 2R2JA 1XWCA 2KP2A 3JCML 4EL1A 1USBA 2I3YA 5IMVA 1V58A 1SK2A 2FWEA 2AB6A 5ECNB 3RPPA 3GKKA 1MEKA 1XWGA 3MYDA 5HR2A 3O76A 1HNCA 3UL3A 3L9SA 4DVCA 2B7JA 5CRDA 4Z7XA 4G19A 3V1WA 1ERTA 1T4YA 2GQKA 3N9JA 5A5KA 3UVHA 3VPTA 1EOHA 1TP9A 2A4HA 2PGTA 5EVOA 1M9AA 2DMMA 4PUFC 4I8BA 4WXTA 4GSNA 1Z7PA 1GSEA 1PGTA 3FRCA 2PWJA 4HQSA 3FEUA 4JBBA 4G9HA 3ZL5A 4POMA 3ME7A 2YP6A 2OADA 1ZYQB 4K8MA 4ID0A 4TW5A 3SBCA 2RM6A 4FO5A 3TDGA 4ZIJA 4A5PA 1RW1A 2R0PA 1YJ6A 2XHFA 3GKXA 2C0FA 3EINA 1GSSA 4LL1B 4K2XA 2QSIA 3C73A 3TJKA 2HYXA 1EZKA 2YCDA 2G0FA 2IMIA 1K0NA 3KJYA 3EU3A 19GSA 5C00A 4ILFA 4ECCA 5CYYA 4YAPA 4PNFA 4HOJA 2ZNMA 2O8VB 3Q19A 2L59A 2YJ7A 5ECLB 2NPBA 3QPMA 3DKSA 4NHWA 5H5RA 3PPUA 1YY7A 3P8WA 2V6OA 3GTUB 2WGRA 1T1VA 2VL3A 2A4VA 4X43A 1FAAA 4PX1A 4PNGA 2K9FA 2FWHA 5F05A 3UBLA 4ZL9A 3UMAA 4BL7B 5DCHA 1XWBA 3R3EA 1QFNA 4BPYA 3UOMA 1NHYA 4OWYA 5GAND 4J57E 1GH2A 3TUEA 5CP1A 1SK1A 2YNXA 3ZTLA 2DBCA 3FZ4A 2HRKA 1MD4A 6GSUA 3A5IA 1G0TA 2OBIA 4FH8A 2LV3A 2K6VA 4N0ZA 1LBKA 4TR1B 1UVZA 2DKHA 1HNAA 2CQ9A 1ILOA 3GKNA 3VPQA 3ZRDA 3FZ5A 3I9V2 3L9UA 4EUYA 5HR1A 1MDIA 4DSQA 1HD2A 2G2QA 2VCVA 5HR0A 1A8YA 4EKZA 4O5UA 1JFUA 2RIIA 2YN1A 2DJ1A 6GSSA 2H1BA 2DMLA 5A4UA 1S3CA 1TTZA 1K3OA 4ECJA 5J9CA 1PSQA 1QMVA 2OE0A 2YV7A 3QFAC 2GSRA 4JRRA 2OE3A 3WYWA 4IQ1A 2M72A 1SKSB 5EPFA 1GLQA 1T7PB 1JZWA 1K3YA 3EWLA 2H1GA 1CQGA 1Y6EA 4MF5A 2B5YA 3KCMA 2VD1A 4RI7A 3L0HA 2P5QA 2ZCTA 2UZ8A 3WT2A 2J23A 4L5LA 4MNNA 4GSTA 3P2AA 1R5PA 2H0HA 2FGXA 4MF6A 1FB6A 1PQNA 1EEMA 4PQHA 2DJKA 3HJPA 1R5AA 2NTOA 4ISDA 5CNWA 4OO4A 2E2MA 3J7Yk 2O7KA 4HDEA 1BG5A 1AC1A 1XVQA 1DE1A 2C4JA 3M8NA 1TRWA 2L57A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DLX A;  1JZO A;  4KDU A;  4K0G A;  2E2G A;  1B9X C;  4WF5 A;  3IR4 A;  1RQM A;  2R3X A;  3D0Z A;  5AIX A;  1N2A A;  1PKZ A;  2GGT A;  3GRX A;  3TOT A;  1KTE A;  2VLU A;  1R7H A;  5J5N A;  2R4V A;  2IFQ B;  4HJ2 A;  1TK5 B;  3GH9 A;  5KN2 A;  3PH9 A;  3IPZ A;  1EP8 A;  1AXD A;  1GRX A;  1SKR B;  2HI7 A;  3I6A A;  1NHO A;  5IIZ A;  4XIH A;  3ISO A;  5IMZ A;  3KP9 A;  2RUF A;  3LWA A;  4F9Z A;  1GTB A;  3KH7 A;  2P0G A;  4MDC A;  4BVX A;  1DUG A;  2JAD A;  1F9M A;  1XOA A;  1THX A;  3TKS A;  3QDN A;  1PMT A;  4TR4 A;  5ID2 B;  4TXO B;  2H75 A;  1X5E A;  1GSY A;  2GZZ A;  6GSW A;  3DVW A;  1U87 A;  2MMN A;  4HS1 A;  1A2M A;  4OO5 A;  3FR3 A;  3W8J A;  3HZ8 A;  4LMW A;  5LCZ A;  4JU5 A;  1I5G A;  1FG4 A;  2XBQ A;  2XBI A;  5DBQ A;  3IA1 A;  6GST A;  2RM5 A;  3WGD A;  2FCH A;  1F3B A;  4V1A p;  1TDI A;  1GSU A;  1OC9 A;  2HSH A;  2CX3 A;  5JCW A;  4MF7 A;  1GSD A;  2YWN A;  5CAX A;  4I2U A;  2CZ2 A;  1MDJ A;  2CX4 A;  1Z5Y E;  2LUS A;  3KEB A;  2R6K A;  3LXZ A;  3QAW A;  20GS A;  2HT9 A;  2C1Y A;  4EVM A;  1NW2 A;  4H86 A;  3GIX A;  2KP1 A;  4I97 A;  3VFI A;  5IM9 A;  4BVY A;  12GS A;  4NV2 A;  2VL9 A;  3IXR A;  4YQM A;  3F4T A;  2JL4 A;  2NDO A;  4K9Z A;  1XIY A;  1M2B A;  4JE1 A;  3Q18 A;  2KUC A;  1XW9 A;  4PQ1 A;  5KN0 A;  5DCG A;  4MZB A;  4XS4 B;  5LD0 A;  1O73 A;  4E8H A;  5B7C A;  4QQ7 A;  5CRH A;  4IJ3 A;  4J56 E;  3BBY A;  5GST A;  3L4N A;  3MWH A;  2B6M A;  2F8F A;  3KZQ A;  1FHE A;  2CVD A;  3CTG A;  5KN3 A;  1ERU A;  1SJZ A;  3EUR A;  4F0C A;  3F4S A;  3VWV A;  2ALB A;  4NAX A;  3MAK A;  2IPA A;  3KGK A;  5EY6 A;  3EC3 A;  3TCO A;  2GT6 A;  2DJ3 A;  3F3Q A;  3DYR A;  3F3R A;  1TOF A;  5INY A;  2HZE B;  3F6D A;  1K0A A;  4ZB9 A;  2LNS A;  5G30 A;  2CV4 A;  2MBT A;  1M2D A;  3FK8 A;  1FOV A;  1MTC A;  1TU7 A;  4MAB A;  3HY2 A;  3ME8 A;  2C0G A;  5IMC A;  1J0F A;  1C72 A;  2LKU A;  1M99 A;  1EP7 A;  1N8J A;  4BA7 A;  5KEJ A;  3QD9 A;  3ERF A;  2YWI A;  3P90 A;  2MMZ A;  2YZU A;  1GNE A;  2H0G A;  3WGE A;  5D9W A;  2DC5 A;  3G9B A;  1M7T A;  5HFG A;  3TJG A;  1YKC A;  3M1G A;  2MBS A;  4XS6 A;  5IMD A;  2F51 A;  3F6F A;  1TI3 A;  1Z6M A;  1VGL A;  4TOP A;  3DML A;  5CRE A;  2VLT A;  4MP4 A;  2H1D A;  1VF4 A;  2CVK A;  4IVF A;  3VI5 A;  1A23 A;  2YWM A;  2XC2 A;  4CW9 A;  2DJ0 A;  3TJF A;  3VK9 A;  1U3I A;  3LFL A;  2C8U A;  2IMF A;  1OKT A;  1PL1 A;  1TU8 A;  2WRT A;  5D9T A;  4TR0 A;  4EE0 A;  2FUG 2;  2GVP A;  3QR6 A;  2X8C A;  4KSM A;  3HVV A;  2B3S A;  4L0W A;  3GTU A;  4MPG A;  3O3T A;  1B4Q A;  2AV4 A;  1EV4 A;  3IHQ A;  5F07 A;  2FA4 A;  4BL7 A;  4F2I A;  4ZB8 A;  1T00 A;  3E3E A;  9GSS A;  4KCA A;  2JSY A;  4N30 A;  2BJX A;  14GS A;  2HXK A;  3LYK A;  3DXB A;  5COH A;  4V2N A;  5D9X A;  2AJQ B;  4F82 A;  3ZML A;  10GS A;  2GQM A;  3BCI A;  4N10 A;  1K0B A;  4TR1 A;  2P31 A;  4ACS A;  1XZO A;  3HA9 A;  3H93 A;  1SD9 A;  1JHB A;  4MLY A;  5JCG A;  2LQQ A;  1V57 A;  1F6M C;  3APO A;  2VAF A;  4MJE A;  5IMF A;  1V98 A;  2X8H A;  4PUR A;  3TRP A;  3H8Q A;  3TKP A;  4MJB A;  4HU9 A;  4J2F A;  3CTF A;  2YOI A;  3FYG A;  3IRA A;  1O8X A;  3A2X A;  4MA9 A;  4KA0 A;  2GSS A;  4EF0 A;  4LA1 A;  4ZL7 A;  2H6Z A;  2NBS A;  2C3N A;  4I6X A;  5GZZ B;  1GTI A;  3HDC A;  4Q5R A;  1SYX A;  4YQU A;  1LJR A;  2WCI A;  1FO5 A;  5EL8 A;  2O89 A;  1Z9H A;  4ECI A;  1XVW A;  1T3B A;  2IWT A;  8GSS A;  3TJB A;  3UJ1 A;  1ERW A;  2FLS A;  4POL A;  1TXX A;  5DQS A;  4TVE A;  4WBJ A;  3WGX A;  2GZP A;  1GLP A;  5DJM A;  3J7Y b;  4ECB A;  2EC4 A;  3LOR A;  1Q4J A;  2JSZ A;  2LNT A;  2H6X A;  4KDY A;  3GL3 A;  5DAK B;  4GTU A;  4TKY A;  1K0O A;  3G7Y A;  3M3M A;  1A2J A;  4AJ8 A;  2HSY A;  2YJH A;  2A2R A;  5ENU A;  1UC7 A;  1YZX A;  4K7N A;  1JZR A;  2NVL A;  5E4W A;  2OKA A;  2L5O A;  1GWC A;  1X5C A;  2N5F A;  4KB3 A;  5B6M A;  2IFQ A;  4N11 A;  1J9B A;  4WR4 A;  4FYC A;  4POB A;  3QFB C;  1X9W B;  4IGJ A;  1XWA A;  4OFT A;  2O85 A;  3IK7 A;  2LJK A;  4CDO A;  3HVX A;  2GQL A;  1TI1 A;  4D73 B;  5H5Q A;  4ZBA A;  4KX4 A;  3D6I A;  3KMN A;  2OE1 A;  4E8E A;  3U6V A;  3UVT A;  1OC8 A;  2FA8 A;  2TIR A;  1B48 A;  3PGT A;  1QUW A;  2B5E A;  5G5F A;  2JZR A;  3D4T A;  2PMT A;  4K0N A;  4TXO A;  5ID2 A;  2VD0 A;  4JR4 A;  4EO3 A;  1F3A A;  4ZXG A;  3F0I A;  4IW9 A;  2JZT A;  5ECH B;  4MJC A;  3VWX A;  1U6T A;  3TOU A;  4X1U A;  5JCU A;  3QCP A;  3WT1 A;  17GS A;  1GNW A;  3P7X A;  2I4A A;  4HZ2 A;  2H76 A;  1O8W A;  2WJU A;  4FYU A;  4OFM A;  1AUC A;  3H4K A;  5DDL A;  2TRC P;  1G7E A;  1TRU A;  4Q5N A;  2LRN A;  1IYH A;  2LQO A;  1AW9 A;  5FT3 A;  4GXZ A;  1URM A;  1MD3 A;  2PVO C;  4K6X A;  1PA3 A;  3GX0 A;  2JZS A;  3BOA A;  3L78 A;  1GP1 A;  1BYE A;  2PU9 C;  2VCQ A;  1U88 A;  5DJL A;  1VF2 A;  4HEA 2;  2H70 A;  3F63 A;  1WRY A;  3RHB A;  5IO0 A;  2H8L A;  2PER A;  6GSX A;  3ZIJ A;  5A4W A;  2V6K A;  4MCU A;  4P3Y B;  4IBP A;  2VCW A;  2EIR A;  3PIN A;  1SEN A;  2VL2 A;  3VWW A;  1GTA A;  3VLN A;  2VCZ A;  2KOK A;  4I5Q A;  5IO2 A;  2I1U A;  1WIK A;  2B7K A;  2GTU A;  4MJA A;  1J08 A;  2D2Z A;  3TKR A;  4NPB A;  1FVK A;  5AN1 A;  4XS4 A;  1OE7 A;  1E6B A;  4AJ7 A;  1X9M B;  1AIU A;  4WET A;  3A2W A;  2HRN A;  2H71 A;  3LEF A;  1O6J A;  3ZYW A;  4GQC A;  2F9S A;  4IP6 A;  4OD7 A;  5IOX A;  1EGO A;  1M2A A;  1DE2 A;  5G5E A;  3S9F A;  2H19 A;  1BJX A;  4K2D A;  4POK A;  3KD0 A;  4K7I A;  22GS A;  1ST9 A;  2VOC A;  2IME A;  11GS A;  3APQ A;  3AY8 A;  4IJI A;  2OA7 A;  2CZ3 A;  1UA5 A;  3CBU A;  2CT6 A;  3DEX A;  3F4R A;  2C0D A;  2HZE A;  1SYR A;  1TK8 B;  1ZL9 A;  1ACV A;  1VF3 A;  2LJR A;  3CYN A;  3RPN A;  3FZ9 A;  1S3D A;  2N5A A;  2R5G A;  4QL7 A;  4OCE A;  3FR6 A;  1WJK A;  3R2Q A;  3M0F A;  4MH3 A;  4GF0 A;  3GHA A;  4MZW A;  3EMP A;  5D93 A;  2V2G A;  3C7M A;  3IE3 A;  2I81 A;  1EV9 A;  4TN8 A;  5DAL B;  2L5L A;  4L0U A;  4EDZ A;  2J9H A;  5G1K A;  5G1L A;  3GN3 A;  1XW5 A;  1VRS D;  2CA8 A;  2E7P A;  3QOU A;  3TKS E;  1SL0 B;  1W89 A;  1FVJ A;  3UEM A;  1OAZ A;  4KGI A;  1TW9 A;  4N0V A;  3O6T A;  5DQY A;  3UBK A;  1BX9 A;  3TGZ A;  4MMM A;  4O7H A;  4LMV A;  1PRX A;  4WR5 A;  3GST A;  1PD2 1;  3KXO A;  2PUK C;  3H1N A;  2N5B A;  1HNB A;  3ZIT A;  4K7O A;  3ZVJ D;  2MZC A;  2FHE A;  3NZN A;  5H5S A;  1TRS A;  4WKW A;  2CAQ A;  13GS A;  1ON4 A;  3ERW A;  2L4Q A;  1BQ7 A;  4GCI A;  1KBN A;  4XRD A;  3GNJ A;  5ELA A;  2B1K A;  1GUM A;  2VCT A;  5IMA A;  3CXG A;  4ML6 A;  5AIS A;  5B8A A;  5J3R A;  4AJ6 A;  1SL2 B;  3GUS A;  2QC7 A;  1MDK A;  1A2L A;  3ZIV A;  2DJ2 A;  1ZOF A;  4RI6 A;  5JWQ B;  1XPV A;  4ML1 A;  3VWU A;  3EVI A;  2H0I A;  4HJM A;  1XW6 A;  3PR8 A;  5ECR B;  4RQR A;  1AAZ A;  2YAN A;  1YKA A;  5DVB A;  2QKE A;  4KDX A;  2B1L A;  2FD3 A;  1B4P A;  1PKW A;  2L6D A;  4TRX A;  5IPG A;  3ZFL A;  3NIV A;  1XXU A;  3LYP A;  3ERG A;  4EC0 A;  4L5O A;  1EEJ A;  1K3L A;  3GH6 A;  1FW1 A;  1R4W A;  4BWS A;  4XCS A;  2YWO A;  4ZB6 A;  2AHE A;  5ECQ B;  1ML6 A;  1GUH A;  1SJ6 A;  2ON5 A;  3GSS A;  3DD3 A;  3TKS C;  3Q74 A;  4NXI A;  2C80 A;  2M80 A;  1V9W A;  1I9D A;  3C1S A;  1PX6 A;  1ZYE A;  5J4U A;  3HKR A;  4HU7 A;  4GSS A;  1OVN A;  3FHK A;  2GT5 A;  2PN8 A;  4F0B A;  2MYG A;  3RDW A;  1UN2 A;  1YDK A;  3M9K A;  1NM3 A;  4O92 A;  4LLR A;  7GSS A;  5JWR B;  2JU5 A;  4KH7 A;  5KN1 A;  1YEX A;  1YQ1 A;  1WP0 A;  3MNG A;  5CRW A;  1TRV A;  2GST A;  4DSS B;  2BMX A;  2VIM A;  3D22 A;  1G6Y A;  5ELG A;  2LRC A;  4NV5 A;  4IS0 A;  1KEB A;  2I9H A;  18GS A;  1PN9 A;  3TRX A;  1GUK A;  1A8L A;  2E0Q A;  3GFK A;  5DAK A;  4WEY A;  4MH2 A;  2GLR A;  2WZ9 A;  2GS3 A;  2VUP A;  6GSV A;  5D9V A;  3SWL A;  4IN0 A;  4XRA A;  4CHS A;  4KND A;  1JLW A;  4BWQ A;  1Q98 A;  2LJA A;  3QAG A;  3IBH A;  3GKM A;  2QGV A;  1TJD A;  2P5R A;  3HJM A;  5F8B A;  1WMJ A;  3HYP A;  3HCZ A;  2C3Q A;  5FWG A;  3ZZX A;  2FNO A;  2IIY A;  4D73 A;  3A5W A;  1B9Y C;  4EXJ A;  5L71 A;  1YF1 A;  1X5D A;  1XWK A;  4K1F A;  1Z7R A;  1B8X A;  3Q6O A;  2VM1 A;  4JED A;  3LXT A;  5HR3 A;  5B8B A;  2WFC A;  1SKW B;  4DEJ A;  3ZLP A;  4LL4 B;  1A24 A;  3D4M A;  1M9B A;  1O81 A;  1ZGN A;  2VLV A;  4OMV A;  2H66 A;  2KHP A;  4RUV A;  2BTO T;  2V32 A;  3D21 A;  1VF1 A;  4DSR A;  4EDY A;  2IJY A;  4X0X A;  16GS A;  4JR6 A;  2ON7 A;  1X0R A;  4L8E A;  4RQX A;  4XS1 A;  5G2Z A;  1DBY A;  3KTB A;  2LEG A;  1H75 A;  3F9U A;  3OR5 A;  1O7U A;  3VUR A;  5CO3 A;  4GLT A;  5E59 A;  1YF0 A;  6GSY A;  1T8E B;  3HVS A;  2HE3 A;  1QK8 A;  2FY6 A;  3N5O A;  2HRF A;  4NHZ A;  3IDV A;  2OAC A;  2EIQ A;  5A4V A;  1GSF A;  2L4C A;  3LG6 A;  2LRT A;  5FHI A;  2MMO A;  3GX8 A;  4GWR A;  5F0G A;  2RLI A;  2ES7 A;  1OC3 A;  4IP1 A;  1XBS A;  2AYT A;  4ZBD A;  3ZVJ A;  2EIO A;  1OKD A;  4IQA A;  4KE3 A;  3W6G A;  2WB9 A;  1SU9 A;  3HJO A;  2HNL A;  1GTU A;  4XTS A;  2PVQ A;  3G7I A;  3IOS A;  3C1R A;  2YV9 A;  5ECS A;  3TJJ A;  3DGQ A;  3IAS 2;  2MMA A;  1XFL A;  2RUE A;  2XPE A;  3DVX A;  3TB2 A;  4PQI A;  3C8E A;  3GL5 A;  3WD6 A;  4YAV A;  2X8G A;  3BD2 A;  5F06 A;  4KUN A;  3KIJ A;  4ZL8 A;  3DRN A;  3LSZ A;  5CRG A;  4ZBB A;  2GDR A;  5ECI B;  2HZF A;  2H6Y A;  4IHU A;  2FWG A;  5ECP B;  2GZY A;  1E2Y A;  1X9S B;  5ABR A;  2AUV A;  3EYT A;  5IOW A;  1Y25 A;  5GAP D;  1KNG A;  2XPD A;  2F8A A;  3GV1 A;  1GL8 A;  2IL3 A;  3BJ5 A;  4JZQ A;  1OE8 A;  2GSQ A;  1JLV A;  3IK9 A;  3GMF A;  4MPF A;  2VCX A;  1FB0 A;  3TKQ A;  2IN3 A;  4O32 A;  3FY7 A;  3KM6 A;  4IKH A;  3LJR A;  4KCE A;  2CAI A;  3H79 A;  1QQ2 A;  3C71 A;  1HQO A;  5ECK B;  1ZZY A;  5ECO B;  2X99 A;  3LQ7 A;  5DAL A;  1AQX A;  4HZ4 A;  1THO A;  5IQY A;  5J41 A;  2A2S A;  2K18 A;  1G7O A;  2X64 A;  1T4Z A;  2OJL A;  2TRX A;  4TXV A;  2IMD A;  4O5R A;  4V2L A;  3EE2 A;  4NMU A;  2PBJ A;  2DIZ A;  2V41 A;  2CVB A;  4HI7 A;  2O87 A;  1SD8 A;  3G7J A;  4HUA A;  4QL9 A;  3I43 A;  1M0U A;  4OCF A;  4GRF A;  4FYB A;  5D96 A;  2DJJ A;  4NWY A;  2LTK A;  1WPI A;  1GSQ A;  3A3T A;  2HLS A;  1QGV A;  3KTL A;  4PUA A;  2LS5 A;  2V1M A;  2PPT A;  1NSW A;  2VO4 A;  3VI7 A;  2VM2 A;  2ZUP A;  4ULX A;  1EGR A;  4G2E A;  4AF2 A;  4PXO A;  2H1A A;  4Q5F A;  3HXS A;  1WE0 A;  1XOB A;  1JZD A;  3FKF A;  3UIW A;  1V2A A;  3CRU A;  3MSZ A;  3FZA A;  1HYU A;  3RAZ A;  1O85 A;  3CSJ A;  3IV4 A;  3HHV A;  3HD5 A;  2KLX A;  2OBK A;  4OFN A;  1QXH A;  4I2T A;  1ERV A;  3APS A;  1H4O A;  3CRT A;  2K8S A;  1BED A;  1SJI A;  4ZIL A;  2LST A;  3FR9 A;  4FIW A;  3W8S A;  3I69 A;  5J9B A;  5HFK A;  5AIV A;  1W4V A;  3MDK A;  3UAR A;  5IPH A;  1GUL A;  3GA4 A;  1V40 A;  1S3A A;  5B6N A;  5HQP A;  2Z9S A;  1A0F A;  4G10 A;  1YEP A;  2YPM A;  1LU4 A;  5G31 A;  2H01 A;  3K8N A;  4HQZ A;  2M46 A;  1EWX A;  4MZC A;  1F37 A;  3DWV A;  1AQW A;  5GSS A;  1F2E A;  2WS2 A;  2WUL A;  3EU4 A;  3E0U A;  3RHC A;  3U5R E;  3ZFB A;  3ZMK A;  1A0R P;  5ECM B;  1EOG A;  3HZ4 A;  4IEL A;  3UAP A;  4YH2 A;  3F8U A;  4PGT A;  2H73 A;  5D8I A;  4WF4 A;  3FW2 A;  3QAV A;  1OC9 B;  2DIY A;  2L6C A;  4V1A g;  3DIE A;  3RBT A;  4WBR D;  2H74 A;  2WDU A;  2HFD A;  1XCC A;  4V2M A;  3NOF A;  2C3T A;  4Q5Q A;  2H30 A;  5C04 A;  5HFI A;  2F3M A;  4KAE A;  4XHM A;  3ZRE A;  1SL1 B;  1K0C A;  1U3A A;  2AAW A;  3L9V A;  1AQV A;  1TKD B;  2IMK A;  3CMI A;  1PL2 A;  3QMX A;  1BAY A;  1WWJ A;  4DSS A;  4KW6 A;  3CSH A;  2DSA A;  2R37 A;  3EMX A;  4AGS A;  2YZH A;  1IYI A;  1ABA A;  1WOU A;  3D5J A;  2B5X A;  3A2V A;  3IC4 A;  4YQV A;  1SK0 A;  2C0E A;  4MK3 A;  5LNK e;  3GYK A;  1RK4 A;  2REM A;  2FWF A;  3ED3 A;  3BCK A;  3IAM 2;  2JAC A;  3M9J A;  3TRQ A;  1G6W A;  2VL2 C;  3LGC A;  3KP8 A;  1R26 A;  1CQH A;  3US3 A;  4KSO A;  1ZMA A;  3KMO A;  3KH9 A;  1Z3E A;  1K0M A;  1PX7 A;  4GQF A;  1Z6N A;  3E9J B;  1ZCP A;  4TR3 A;  1OYJ A;  5D73 A;  3CSI A;  1TK0 B;  3GUR A;  1K0D A;  2H72 A;  4F03 A;  1DSB A;  5AGY A;  2K8V A;  5JWO B;  2R2J A;  1XWC A;  2KP2 A;  3JCM L;  4EL1 A;  1USB A;  2I3Y A;  5IMV A;  1V58 A;  1SK2 A;  2FWE A;  2AB6 A;  5ECN B;  3RPP A;  3GKK A;  1MEK A;  1XWG A;  5HR2 A;  3O76 A;  1HNC A;  3UL3 A;  3L9S A;  4DVC A;  2B7J A;  5CRD A;  4Z7X A;  4G19 A;  3V1W A;  1ERT A;  1T4Y A;  2GQK A;  3N9J A;  5A5K A;  3UVH A;  3VPT A;  1EOH A;  1TP9 A;  2PGT A;  5EVO A;  1M9A A;  2DMM A;  4PUF C;  4I8B A;  4WXT A;  4GSN A;  1Z7P A;  1GSE A;  1PGT A;  3FRC A;  2PWJ A;  4HQS A;  3FEU A;  4JBB A;  4G9H A;  3ZL5 A;  4POM A;  3ME7 A;  2YP6 A;  2OAD A;  1ZYQ B;  4K8M A;  4ID0 A;  4TW5 A;  3SBC A;  2RM6 A;  4FO5 A;  3TDG A;  4ZIJ A;  1RW1 A;  1YJ6 A;  2XHF A;  3GKX A;  2C0F A;  3EIN A;  1GSS A;  4LL1 B;  2QSI A;  3C73 A;  3TJK A;  2HYX A;  1EZK A;  2YCD A;  2G0F A;  2IMI A;  1K0N A;  3KJY A;  3EU3 A;  19GS A;  5C00 A;  4ILF A;  4ECC A;  5CYY A;  4YAP A;  4PNF A;  4HOJ A;  2ZNM A;  2O8V B;  3Q19 A;  2L59 A;  2YJ7 A;  5ECL B;  2NPB A;  3QPM A;  3DKS A;  4NHW A;  5H5R A;  1YY7 A;  3P8W A;  2V6O A;  3GTU B;  2WGR A;  1T1V A;  2VL3 A;  2A4V A;  4X43 A;  1FAA A;  4PX1 A;  4PNG A;  2K9F A;  2FWH A;  5F05 A;  3UBL A;  4ZL9 A;  3UMA A;  5DCH A;  1XWB A;  1QFN A;  4BPY A;  3UOM A;  1NHY A;  4OWY A;  5GAN D;  4J57 E;  1GH2 A;  3TUE A;  5CP1 A;  1SK1 A;  2YNX A;  3ZTL A;  2DBC A;  3FZ4 A;  1MD4 A;  6GSU A;  1G0T A;  2OBI A;  4FH8 A;  2LV3 A;  2K6V A;  4N0Z A;  1LBK A;  4TR1 B;  1UVZ A;  1ILO A;  1HNA A;  2CQ9 A;  3GKN A;  3VPQ A;  3ZRD A;  3FZ5 A;  3I9V 2;  3L9U A;  4EUY A;  5HR1 A;  1MDI A;  4DSQ A;  1HD2 A;  2G2Q A;  2VCV A;  5HR0 A;  1A8Y A;  4EKZ A;  1JFU A;  2RII A;  2YN1 A;  2DJ1 A;  6GSS A;  2H1B A;  2DML A;  5A4U A;  1S3C A;  1TTZ A;  1K3O A;  4ECJ A;  5J9C A;  1PSQ A;  1QMV A;  2OE0 A;  2YV7 A;  3QFA C;  2GSR A;  4JRR A;  2OE3 A;  3WYW A;  4IQ1 A;  2M72 A;  1SKS B;  5EPF A;  1GLQ A;  1T7P B;  1JZW A;  1K3Y A;  3EWL A;  2H1G A;  1CQG A;  1Y6E A;  4MF5 A;  2B5Y A;  3KCM A;  2VD1 A;  4RI7 A;  3L0H A;  2P5Q A;  2ZCT A;  3WT2 A;  2J23 A;  4L5L A;  4GST A;  3P2A A;  1R5P A;  2H0H A;  2FGX A;  4MF6 A;  1FB6 A;  1PQN A;  1EEM A;  4PQH A;  2DJK A;  3HJP A;  1R5A A;  2NTO A;  4ISD A;  5CNW A;  4OO4 A;  2E2M A;  3J7Y k;  2O7K A;  4HDE A;  1BG5 A;  1AC1 A;  1XVQ A;  1DE1 A;  2C4J A;  3M8N A;  1TRW A;  2L57 A; 
#chains in the Genus database with same CATH topology
 2DLX A;  1JZO A;  4KDU A;  4K0G A;  2E2G A;  1B9X C;  4WF5 A;  3IR4 A;  1RQM A;  2R3X A;  3D0Z A;  5AIX A;  1N2A A;  1PKZ A;  2GGT A;  3GRX A;  3TOT A;  1KTE A;  2VLU A;  1R7H A;  5J5N A;  2QA2 A;  2R4V A;  2IFQ B;  4HJ2 A;  1TK5 B;  3GH9 A;  5KN2 A;  3PH9 A;  3IPZ A;  1EP8 A;  1AXD A;  1GRX A;  1SKR B;  2HI7 A;  3I6A A;  1NHO A;  5IIZ A;  4XIH A;  3ISO A;  3FMW A;  5IMZ A;  3KP9 A;  2RUF A;  3LWA A;  4YKG A;  4F9Z A;  4O5Q A;  1GTB A;  3KH7 A;  2P0G A;  4MDC A;  4BVX A;  1DUG A;  2JAD A;  1F9M A;  1XOA A;  1THX A;  3TKS A;  3QDN A;  1PMT A;  4TR4 A;  5ID2 B;  4TXO B;  2H75 A;  1X5E A;  1GSY A;  2GZZ A;  6GSW A;  3DVW A;  4BIK A;  1U87 A;  2MMN A;  4HS1 A;  1A2M A;  4OO5 A;  3FR3 A;  3W8J A;  3HZ8 A;  4LMW A;  5LCZ A;  4JU5 A;  1I5G A;  1FG4 A;  2XBQ A;  2XBI A;  5DBQ A;  3IA1 A;  6GST A;  2RM5 A;  3WGD A;  2FCH A;  1F3B A;  4V1A p;  1TDI A;  1GSU A;  1OC9 A;  2HSH A;  2CX3 A;  5JCW A;  4MF7 A;  1GSD A;  2YWN A;  5CAX A;  4I2U A;  2CZ2 A;  1MDJ A;  2CX4 A;  1Z5Y E;  2LUS A;  3KEB A;  2R6K A;  3LXZ A;  3QAW A;  20GS A;  2HT9 A;  2C1Y A;  4EVM A;  1NW2 A;  4H86 A;  3GIX A;  2KP1 A;  4I97 A;  1ZYP A;  3VFI A;  5IM9 A;  4BVY A;  12GS A;  4NV2 A;  2VL9 A;  3LW9 A;  3IXR A;  4YQM A;  3F4T A;  2JL4 A;  2NDO A;  4K9Z A;  1XIY A;  1M2B A;  4JE1 A;  3Q18 A;  2KUC A;  1XW9 A;  4PQ1 A;  5KN0 A;  5DCG A;  4MZB A;  4XS4 B;  5LD0 A;  1O73 A;  4E8H A;  5B7C A;  4QQ7 A;  5CRH A;  4IJ3 A;  4J56 E;  3BBY A;  5GST A;  3L4N A;  3MWH A;  2B6M A;  2F8F A;  3KZQ A;  1FHE A;  2CVD A;  3CTG A;  4HSC X;  5KN3 A;  1ERU A;  1SJZ A;  3EUR A;  4F0C A;  3F4S A;  3VWV A;  2ALB A;  4NAX A;  3MAK A;  2IPA A;  3KGK A;  5EY6 A;  3EC3 A;  3TCO A;  2GT6 A;  2DJ3 A;  3F3Q A;  3DYR A;  3F3R A;  1TOF A;  5INY A;  2HZE B;  3F6D A;  1K0A A;  4ZB9 A;  2LNS A;  5G30 A;  2CV4 A;  2MBT A;  1M2D A;  3FK8 A;  1FOV A;  1MTC A;  1TU7 A;  4Z2T A;  4MAB A;  3HY2 A;  3ME8 A;  2C0G A;  5IMC A;  1J0F A;  1C72 A;  2LKU A;  1M99 A;  1EP7 A;  1N8J A;  4BA7 A;  5KEJ A;  3QD9 A;  3ERF A;  2YWI A;  3P90 A;  2MMZ A;  2YZU A;  1GNE A;  2H0G A;  3WGE A;  5D9W A;  2DC5 A;  3G9B A;  1M7T A;  5HFG A;  3TJG A;  1YKC A;  3M1G A;  2MBS A;  1PN0 A;  4XS6 A;  5IMD A;  2F51 A;  3F6F A;  1TI3 A;  1Z6M A;  1VGL A;  4TOP A;  3DML A;  5CRE A;  2VLT A;  2DKI A;  4MP4 A;  2H1D A;  1VF4 A;  2CVK A;  4IVF A;  3MIX A;  1A23 A;  3VI5 A;  2YWM A;  2XC2 A;  4CW9 A;  2DJ0 A;  3TJF A;  3VK9 A;  1U3I A;  3LFL A;  2C8U A;  2IMF A;  1OKT A;  1PL1 A;  1TU8 A;  2WRT A;  5D9T A;  4TR0 A;  4EE0 A;  2FUG 2;  2GVP A;  3QR6 A;  2X8C A;  4KSM A;  3HVV A;  2B3S A;  4L0W A;  3GTU A;  4MPG A;  3O3T A;  1B4Q A;  2AV4 A;  1EV4 A;  3IHQ A;  5F07 A;  2FA4 A;  4BL7 A;  4F2I A;  4ZB8 A;  1T00 A;  3E3E A;  9GSS A;  4KCA A;  2JSY A;  4N30 A;  2BJX A;  14GS A;  2HXK A;  3LYK A;  3DXB A;  5COH A;  4V2N A;  5D9X A;  2AJQ B;  4F82 A;  3ZML A;  10GS A;  2GQM A;  3BCI A;  4N10 A;  1K0B A;  4TR1 A;  2P31 A;  4ACS A;  1XZO A;  3HA9 A;  3H93 A;  1SD9 A;  1JHB A;  4MLY A;  5JCG A;  2LQQ A;  1V57 A;  1F6M C;  3APO A;  2VAF A;  4MJE A;  5IMF A;  1V98 A;  1S3R A;  2X8H A;  4PUR A;  3TRP A;  3H8Q A;  3TKP A;  4MJB A;  4HU9 A;  4J2F A;  3CTF A;  2YOI A;  3FYG A;  3IRA A;  1O8X A;  3A2X A;  4MA9 A;  4KA0 A;  2GSS A;  4EF0 A;  4LA1 A;  4ZL7 A;  2H6Z A;  2NBS A;  2C3N A;  4I6X A;  5GZZ B;  1GTI A;  3HDC A;  4FQU A;  4Q5R A;  1SYX A;  4YQU A;  1LJR A;  2WCI A;  1FO5 A;  5EL8 A;  2O89 A;  1Z9H A;  4ECI A;  1XVW A;  1T3B A;  2IWT A;  8GSS A;  3TJB A;  3UJ1 A;  1ERW A;  2FLS A;  4POL A;  1TXX A;  5DQS A;  4TVE A;  4WBJ A;  3WGX A;  2GZP A;  1GLP A;  5DJM A;  3J7Y b;  4G0K A;  4ECB A;  2EC4 A;  3LOR A;  1Q4J A;  2JSZ A;  2LNT A;  2H6X A;  4KDY A;  3GL3 A;  5DAK B;  4GTU A;  4TKY A;  1K0O A;  3G7Y A;  3M3M A;  1A2J A;  4AJ8 A;  2HSY A;  2YJH A;  2A2R A;  5ENU A;  1UC7 A;  1YZX A;  4K7N A;  1JZR A;  2NVL A;  5E4W A;  2OKA A;  2L5O A;  1GWC A;  1X5C A;  2HSM A;  2N5F A;  4KB3 A;  5B6M A;  2IFQ A;  4N11 A;  1J9B A;  4WR4 A;  4FYC A;  4POB A;  3QFB C;  1X9W B;  4X4J A;  4IGJ A;  1XWA A;  4OFT A;  2O85 A;  3IK7 A;  2LJK A;  4CDO A;  3HVX A;  2GQL A;  4KF9 A;  1TI1 A;  4D73 B;  4USS A;  5H5Q A;  4ZBA A;  4KX4 A;  3D6I A;  3KMN A;  2OE1 A;  4E8E A;  3U6V A;  3UVT A;  1OC8 A;  2FA8 A;  2TIR A;  1B48 A;  3PGT A;  1QUW A;  2B5E A;  5G5F A;  2JZR A;  3D4T A;  2PMT A;  4K0N A;  4TXO A;  5ID2 A;  2VD0 A;  4JR4 A;  4EO3 A;  1F3A A;  4ZXG A;  3F0I A;  4IW9 A;  2JZT A;  5ECH B;  4MJC A;  3VWX A;  1U6T A;  3TOU A;  4X1U A;  5JCU A;  3QCP A;  3WT1 A;  17GS A;  1GNW A;  3P7X A;  2I4A A;  4HZ2 A;  2H76 A;  1O8W A;  2WJU A;  4FYU A;  4OFM A;  1AUC A;  3H4K A;  5DDL A;  2TRC P;  1G7E A;  1TRU A;  4Q5N A;  2LRN A;  1IYH A;  2LQO A;  1AW9 A;  1ZYN A;  5FT3 A;  4YKF A;  4GXZ A;  1URM A;  1MD3 A;  3EPT A;  2PVO C;  4K6X A;  1PA3 A;  3GX0 A;  2JZS A;  3BOA A;  3L78 A;  1GP1 A;  1BYE A;  2PU9 C;  2VCQ A;  1U88 A;  5DJL A;  1VF2 A;  4HEA 2;  2H70 A;  3F63 A;  1WRY A;  3RHB A;  5IO0 A;  2H8L A;  2PER A;  6GSX A;  3ZIJ A;  5A4W A;  2V6K A;  4MCU A;  4P3Y B;  4IBP A;  2VCW A;  2EIR A;  3PIN A;  1SEN A;  2VL2 A;  1XG8 A;  3VWW A;  1GTA A;  3VLN A;  2VCZ A;  2KOK A;  4I5Q A;  5IO2 A;  2I1U A;  1WIK A;  2B7K A;  2GTU A;  4MJA A;  1PFO A;  1J08 A;  2D2Z A;  3TKR A;  4NPB A;  1FVK A;  5AN1 A;  4XS4 A;  1OE7 A;  1E6B A;  4AJ7 A;  1X9M B;  1AIU A;  4WET A;  3A2W A;  2HRN A;  2H71 A;  3LEF A;  1O6J A;  3ZYW A;  4GQC A;  5KOX A;  2F9S A;  4IP6 A;  4OD7 A;  5IOX A;  1EGO A;  1M2A A;  1DE2 A;  5G5E A;  3S9F A;  2H19 A;  1BJX A;  2HRA A;  4K2D A;  4POK A;  3KD0 A;  4K7I A;  22GS A;  1ST9 A;  2VOC A;  2IME A;  11GS A;  3APQ A;  3AY8 A;  4IJI A;  2OA7 A;  2CZ3 A;  1UA5 A;  3CBU A;  2CT6 A;  3DEX A;  3F4R A;  2C0D A;  2HZE A;  1SYR A;  1TK8 B;  1ZL9 A;  1ACV A;  1VF3 A;  2LJR A;  3CYN A;  3RPN A;  3FZ9 A;  1S3D A;  2N5A A;  2R5G A;  4QL7 A;  4OCE A;  3FR6 A;  1WJK A;  3R2Q A;  3M0F A;  4MH3 A;  4GF0 A;  3GHA A;  4MZW A;  3EMP A;  5D93 A;  2V2G A;  3C7M A;  3IE3 A;  2I81 A;  1EV9 A;  4TN8 A;  5DAL B;  2L5L A;  4L0U A;  4EDZ A;  2J9H A;  5G1K A;  5G1L A;  3GN3 A;  1XW5 A;  1VRS D;  2CA8 A;  2E7P A;  3QOU A;  3TKS E;  1SL0 B;  1W89 A;  1FVJ A;  3UEM A;  1OAZ A;  4KGI A;  1TW9 A;  4N0V A;  3O6T A;  5DQY A;  4Z2R A;  3UBK A;  1BX9 A;  3TGZ A;  4MMM A;  4O7H A;  4LMV A;  1PRX A;  4WR5 A;  3GST A;  1PD2 1;  3KXO A;  2PUK C;  3H1N A;  2N5B A;  1HNB A;  3ZIT A;  4K7O A;  3ZVJ D;  2MZC A;  2FHE A;  3NZN A;  5H5S A;  1TRS A;  4WKW A;  2CAQ A;  13GS A;  1ON4 A;  3ERW A;  4G0I A;  2L4Q A;  1BQ7 A;  4GCI A;  1KBN A;  4XRD A;  3GNJ A;  5ELA A;  2B1K A;  1GUM A;  2VCT A;  5IMA A;  3CXG A;  4ML6 A;  5AIS A;  5B8A A;  5J3R A;  4AJ6 A;  1SL2 B;  3GUS A;  2QC7 A;  4PTS A;  1MDK A;  1A2L A;  3ZIV A;  2DJ2 A;  1ZOF A;  4RI6 A;  5JWQ B;  1XPV A;  4ML1 A;  3VWU A;  3EVI A;  2H0I A;  4HJM A;  4K5S A;  1XW6 A;  3PR8 A;  5ECR B;  4RQR A;  1AAZ A;  2YAN A;  1YKA A;  5DVB A;  2QKE A;  4KDX A;  2B1L A;  2FD3 A;  1B4P A;  1PKW A;  2L6D A;  4TRX A;  5IPG A;  3ZFL A;  3NIV A;  1XXU A;  3LYP A;  3ERG A;  4EC0 A;  4L5O A;  1EEJ A;  1K3L A;  3GH6 A;  1FW1 A;  1R4W A;  4BWS A;  4XCS A;  2YWO A;  4ZB6 A;  2AHE A;  5ECQ B;  1ML6 A;  1GUH A;  1SJ6 A;  2ON5 A;  3GSS A;  3DD3 A;  3TKS C;  3Q74 A;  4NXI A;  2C80 A;  4EIP A;  2M80 A;  1V9W A;  1I9D A;  3C1S A;  1PX6 A;  1ZYE A;  5J4U A;  3HKR A;  4HU7 A;  4GSS A;  1OVN A;  3FHK A;  2GT5 A;  2PN8 A;  4F0B A;  2MYG A;  3RDW A;  1UN2 A;  1YDK A;  3M9K A;  1NM3 A;  4O92 A;  4LLR A;  7GSS A;  5JWR B;  2JU5 A;  4KH7 A;  5KN1 A;  1YEX A;  1YQ1 A;  1WP0 A;  3MNG A;  5CRW A;  1TRV A;  2GST A;  4DSS B;  2BMX A;  2VIM A;  3D22 A;  1G6Y A;  5KOW A;  5ELG A;  2LRC A;  4NV5 A;  4IS0 A;  1KEB A;  2I9H A;  18GS A;  1PN9 A;  3TRX A;  3IHG A;  1GUK A;  1A8L A;  2E0Q A;  3GFK A;  5DAK A;  4WEY A;  4MH2 A;  2GLR A;  2WZ9 A;  2GS3 A;  2VUP A;  6GSV A;  5D9V A;  3SWL A;  4IN0 A;  4XRA A;  4CHS A;  4KND A;  1JLW A;  4BWQ A;  1Q98 A;  2LJA A;  3QAG A;  3IBH A;  3GKM A;  2QGV A;  1TJD A;  2P5R A;  3HJM A;  5F8B A;  1WMJ A;  3HYP A;  3HCZ A;  2C3Q A;  5FWG A;  3ZZX A;  2FNO A;  2IIY A;  4D73 A;  3A5W A;  1B9Y C;  4EXJ A;  5L71 A;  1YF1 A;  1X5D A;  1XWK A;  4K1F A;  1Z7R A;  1B8X A;  3Q6O A;  2VM1 A;  4JED A;  3LXT A;  5HR3 A;  5B8B A;  2WFC A;  1SKW B;  4DEJ A;  3ZLP A;  4LL4 B;  1A24 A;  3D4M A;  1M9B A;  1O81 A;  1ZGN A;  2VLV A;  4OMV A;  2H66 A;  2KHP A;  4RUV A;  2BTO T;  2V32 A;  3D21 A;  1VF1 A;  4DSR A;  4EDY A;  2IJY A;  4X0X A;  4G0L A;  16GS A;  4JR6 A;  2ON7 A;  1X0R A;  4L8E A;  4RQX A;  4XS1 A;  5G2Z A;  1DBY A;  3KTB A;  4Z2U A;  2LEG A;  1H75 A;  3F9U A;  3OR5 A;  1O7U A;  3VUR A;  5CO3 A;  4GLT A;  5E59 A;  1YF0 A;  6GSY A;  1T8E B;  3HVS A;  2HE3 A;  1QK8 A;  4ICY A;  2FY6 A;  3N5O A;  2HRF A;  4NHZ A;  3IDV A;  2OAC A;  2EIQ A;  5A4V A;  1GSF A;  2L4C A;  3LG6 A;  2LRT A;  5FHI A;  2MMO A;  3GX8 A;  4GWR A;  5F0G A;  2RLI A;  2ES7 A;  1M3J A;  1OC3 A;  4IP1 A;  1XBS A;  2AYT A;  4ZBD A;  3ZVJ A;  2EIO A;  1OKD A;  4IQA A;  4KE3 A;  3W6G A;  2WB9 A;  1SU9 A;  3HJO A;  2HNL A;  1GTU A;  4XTS A;  2PVQ A;  3G7I A;  3IOS A;  3C1R A;  2YV9 A;  5ECS A;  3TJJ A;  3DGQ A;  3IAS 2;  2MMA A;  1XFL A;  2RUE A;  2XPE A;  3DVX A;  3TB2 A;  4PQI A;  2R0C A;  3C8E A;  3GL5 A;  5BMU A;  3WD6 A;  4YAV A;  2X8G A;  3BD2 A;  5F06 A;  4KUN A;  3KIJ A;  4ZL8 A;  3DRN A;  3LSZ A;  5CRG A;  4ZBB A;  2GDR A;  5ECI B;  2HZF A;  2H6Y A;  4IHU A;  2FWG A;  5ECP B;  2GZY A;  1E2Y A;  4K5R A;  2X4A A;  1X9S B;  5ABR A;  2AUV A;  3EYT A;  5IOW A;  1Y25 A;  5GAP D;  1FOH A;  1KNG A;  2XPD A;  2F8A A;  3GV1 A;  1GL8 A;  2IL3 A;  3BJ5 A;  4JZQ A;  1OE8 A;  2GSQ A;  1JLV A;  3IK9 A;  3GMF A;  4MPF A;  2VCX A;  1FB0 A;  3TKQ A;  2IN3 A;  4O32 A;  3FY7 A;  3KM6 A;  4IKH A;  3LJR A;  4KCE A;  2CAI A;  3H79 A;  1QQ2 A;  3C71 A;  1HQO A;  5ECK B;  1ZZY A;  5ECO B;  2X99 A;  3LQ7 A;  5DAL A;  1AQX A;  4HZ4 A;  1THO A;  5IQY A;  5J41 A;  2A2S A;  2K18 A;  1G7O A;  2X64 A;  1T4Z A;  2OJL A;  2TRX A;  4TXV A;  2IMD A;  4O5R A;  4V2L A;  3EE2 A;  4NMU A;  2PBJ A;  2DIZ A;  2V41 A;  2CVB A;  4HI7 A;  2O87 A;  1SD8 A;  3G7J A;  4HUA A;  4QL9 A;  4CY8 A;  3I43 A;  3IC8 A;  1M0U A;  4OCF A;  4GRF A;  4FYB A;  5D96 A;  2DJJ A;  4NWY A;  2LTK A;  1WPI A;  1GSQ A;  3A3T A;  2HLS A;  1QGV A;  3KTL A;  4PUA A;  2LS5 A;  2V1M A;  2PPT A;  1NSW A;  2VO4 A;  3VI7 A;  2VM2 A;  2ZUP A;  4ULX A;  1EGR A;  4G2E A;  4AF2 A;  4PXO A;  2H1A A;  4Q5F A;  3HXS A;  1WE0 A;  1XOB A;  1JZD A;  3FKF A;  3UIW A;  1V2A A;  3CRU A;  3MSZ A;  3FZA A;  1HYU A;  3RAZ A;  2QA1 A;  1O85 A;  3CSJ A;  3IV4 A;  3HHV A;  3HD5 A;  2KLX A;  2OBK A;  4OFN A;  1QXH A;  4I2T A;  1ERV A;  3APS A;  1H4O A;  3CRT A;  2K8S A;  1BED A;  1SJI A;  4ZIL A;  2LST A;  3FR9 A;  4FIW A;  3W8S A;  3I69 A;  5J9B A;  5HFK A;  5AIV A;  1W4V A;  3MDK A;  3UAR A;  5IPH A;  1GUL A;  3GA4 A;  1V40 A;  1S3A A;  5B6N A;  5HQP A;  4BVX B;  2Z9S A;  1A0F A;  4G10 A;  1YEP A;  2YPM A;  1LU4 A;  5G31 A;  2A2P A;  2H01 A;  3K8N A;  4HQZ A;  2M46 A;  1EWX A;  4MZC A;  1F37 A;  3DWV A;  1AQW A;  5GSS A;  1F2E A;  2WS2 A;  2WUL A;  3EU4 A;  3E0U A;  3RHC A;  3U5R E;  3ZFB A;  3ZMK A;  1A0R P;  5ECM B;  1EOG A;  3HZ4 A;  4IEL A;  3UAP A;  4YH2 A;  4EIQ A;  3F8U A;  4PGT A;  2H73 A;  5D8I A;  4WF4 A;  3CQF A;  3FW2 A;  3QAV A;  1OC9 B;  2DIY A;  2L6C A;  4V1A g;  3DIE A;  3RBT A;  4WBR D;  2H74 A;  2WDU A;  2HFD A;  1XCC A;  4V2M A;  3NOF A;  2C3T A;  4Q5Q A;  5BRT A;  2H30 A;  5C04 A;  5HFI A;  2F3M A;  4KAE A;  4XHM A;  3ZRE A;  1SL1 B;  1K0C A;  1U3A A;  2AAW A;  3L9V A;  1AQV A;  1TKD B;  2IMK A;  3CMI A;  1PL2 A;  3QMX A;  1BAY A;  1WWJ A;  4DSS A;  4KW6 A;  3CSH A;  2DSA A;  4BVY B;  4CY6 A;  2R37 A;  3EMX A;  4AGS A;  2YZH A;  1IYI A;  1ABA A;  1WOU A;  3D5J A;  2B5X A;  3A2V A;  3IC4 A;  4YQV A;  1SK0 A;  2C0E A;  4MK3 A;  5LNK e;  3GYK A;  1RK4 A;  2REM A;  2FWF A;  3ED3 A;  3BCK A;  3IAM 2;  2JAC A;  3M9J A;  3TRQ A;  1G6W A;  2VL2 C;  3LGC A;  3KP8 A;  1R26 A;  1CQH A;  3US3 A;  4KSO A;  1ZMA A;  3KMO A;  3KH9 A;  1Z3E A;  2R0G A;  1K0M A;  1PX7 A;  4GQF A;  1Z6N A;  3E9J B;  1ZCP A;  4TR3 A;  1OYJ A;  5D73 A;  3CSI A;  1TK0 B;  3GUR A;  1K0D A;  2H72 A;  4F03 A;  1DSB A;  5AGY A;  2K8V A;  5JWO B;  2X49 A;  2R2J A;  1XWC A;  2KP2 A;  3JCM L;  4EL1 A;  1USB A;  2I3Y A;  5IMV A;  1V58 A;  1SK2 A;  2FWE A;  2AB6 A;  5ECN B;  3RPP A;  3GKK A;  1MEK A;  1XWG A;  3MYD A;  5HR2 A;  3O76 A;  1HNC A;  3UL3 A;  3L9S A;  4DVC A;  2B7J A;  5CRD A;  4Z7X A;  4G19 A;  3V1W A;  1ERT A;  1T4Y A;  2GQK A;  3N9J A;  5A5K A;  3UVH A;  3VPT A;  1EOH A;  1TP9 A;  2A4H A;  2PGT A;  5EVO A;  1M9A A;  2DMM A;  4PUF C;  4I8B A;  4WXT A;  4GSN A;  1Z7P A;  1GSE A;  1PGT A;  3FRC A;  2PWJ A;  4HQS A;  3FEU A;  4JBB A;  4G9H A;  3ZL5 A;  4POM A;  3ME7 A;  2YP6 A;  2OAD A;  1ZYQ B;  4K8M A;  4ID0 A;  4TW5 A;  3SBC A;  2RM6 A;  4FO5 A;  3TDG A;  4ZIJ A;  4A5P A;  1RW1 A;  2R0P A;  1YJ6 A;  2XHF A;  3GKX A;  2C0F A;  3EIN A;  1GSS A;  4LL1 B;  4K2X A;  2QSI A;  3C73 A;  3TJK A;  2HYX A;  1EZK A;  2YCD A;  2G0F A;  2IMI A;  1K0N A;  3KJY A;  3EU3 A;  19GS A;  5C00 A;  4ILF A;  4ECC A;  5CYY A;  4YAP A;  4PNF A;  4HOJ A;  2ZNM A;  2O8V B;  3Q19 A;  2L59 A;  2YJ7 A;  5ECL B;  2NPB A;  3QPM A;  3DKS A;  4NHW A;  5H5R A;  3PPU A;  1YY7 A;  3P8W A;  2V6O A;  3GTU B;  2WGR A;  1T1V A;  2VL3 A;  2A4V A;  4X43 A;  1FAA A;  4PX1 A;  4PNG A;  2K9F A;  2FWH A;  5F05 A;  3UBL A;  4ZL9 A;  3UMA A;  4BL7 B;  5DCH A;  1XWB A;  3R3E A;  1QFN A;  4BPY A;  3UOM A;  1NHY A;  4OWY A;  5GAN D;  4J57 E;  1GH2 A;  3TUE A;  5CP1 A;  1SK1 A;  2YNX A;  3ZTL A;  2DBC A;  3FZ4 A;  2HRK A;  1MD4 A;  6GSU A;  3A5I A;  1G0T A;  2OBI A;  4FH8 A;  2LV3 A;  2K6V A;  4N0Z A;  1LBK A;  4TR1 B;  1UVZ A;  2DKH A;  1HNA A;  2CQ9 A;  1ILO A;  3GKN A;  3VPQ A;  3ZRD A;  3FZ5 A;  3I9V 2;  3L9U A;  4EUY A;  5HR1 A;  1MDI A;  4DSQ A;  1HD2 A;  2G2Q A;  2VCV A;  5HR0 A;  1A8Y A;  4EKZ A;  4O5U A;  1JFU A;  2RII A;  2YN1 A;  2DJ1 A;  6GSS A;  2H1B A;  2DML A;  5A4U A;  1S3C A;  1TTZ A;  1K3O A;  4ECJ A;  5J9C A;  1PSQ A;  1QMV A;  2OE0 A;  2YV7 A;  3QFA C;  2GSR A;  4JRR A;  2OE3 A;  3WYW A;  4IQ1 A;  2M72 A;  1SKS B;  5EPF A;  1GLQ A;  1T7P B;  1JZW A;  1K3Y A;  3EWL A;  2H1G A;  1CQG A;  1Y6E A;  4MF5 A;  1M3I A;  2B5Y A;  3KCM A;  2VD1 A;  4RI7 A;  3L0H A;  2P5Q A;  2ZCT A;  2UZ8 A;  3WT2 A;  2J23 A;  4L5L A;  4MNN A;  4GST A;  3P2A A;  1R5P A;  2H0H A;  2FGX A;  4MF6 A;  1FB6 A;  1PQN A;  1EEM A;  4PQH A;  2DJK A;  3HJP A;  1R5A A;  2NTO A;  4ISD A;  3HVN A;  5CNW A;  4OO4 A;  2E2M A;  3J7Y k;  2O7K A;  4HDE A;  1BG5 A;  1AC1 A;  1XVQ A;  1DE1 A;  2C4J A;  3M8N A;  1TRW A;  2L57 A; 
#chains in the Genus database with same CATH homology
 2DLX A;  1JZO A;  4KDU A;  4K0G A;  2E2G A;  1B9X C;  4WF5 A;  3IR4 A;  1RQM A;  2R3X A;  3D0Z A;  5AIX A;  1N2A A;  1PKZ A;  2GGT A;  3GRX A;  3TOT A;  1KTE A;  2VLU A;  1R7H A;  5J5N A;  2QA2 A;  2R4V A;  2IFQ B;  4HJ2 A;  1TK5 B;  3GH9 A;  5KN2 A;  3PH9 A;  3IPZ A;  1EP8 A;  1AXD A;  1GRX A;  1SKR B;  2HI7 A;  3I6A A;  1NHO A;  5IIZ A;  4XIH A;  3ISO A;  3FMW A;  5IMZ A;  3KP9 A;  2RUF A;  3LWA A;  4YKG A;  4F9Z A;  4O5Q A;  1GTB A;  3KH7 A;  2P0G A;  4MDC A;  4BVX A;  1DUG A;  2JAD A;  1F9M A;  1XOA A;  1THX A;  3TKS A;  3QDN A;  1PMT A;  4TR4 A;  5ID2 B;  4TXO B;  2H75 A;  1X5E A;  1GSY A;  2GZZ A;  6GSW A;  3DVW A;  1U87 A;  2MMN A;  4HS1 A;  1A2M A;  4OO5 A;  3FR3 A;  3W8J A;  3HZ8 A;  4LMW A;  5LCZ A;  4JU5 A;  1I5G A;  1FG4 A;  2XBQ A;  2XBI A;  5DBQ A;  3IA1 A;  6GST A;  2RM5 A;  3WGD A;  2FCH A;  1F3B A;  4V1A p;  1TDI A;  1GSU A;  1OC9 A;  2HSH A;  2CX3 A;  5JCW A;  4MF7 A;  1GSD A;  2YWN A;  5CAX A;  4I2U A;  2CZ2 A;  1MDJ A;  2CX4 A;  1Z5Y E;  2LUS A;  3KEB A;  2R6K A;  3LXZ A;  3QAW A;  20GS A;  2HT9 A;  2C1Y A;  4EVM A;  1NW2 A;  4H86 A;  3GIX A;  2KP1 A;  4I97 A;  1ZYP A;  3VFI A;  5IM9 A;  4BVY A;  12GS A;  4NV2 A;  2VL9 A;  3LW9 A;  3IXR A;  4YQM A;  3F4T A;  2JL4 A;  2NDO A;  4K9Z A;  1XIY A;  1M2B A;  4JE1 A;  3Q18 A;  2KUC A;  1XW9 A;  4PQ1 A;  5KN0 A;  5DCG A;  4MZB A;  4XS4 B;  5LD0 A;  1O73 A;  4E8H A;  5B7C A;  4QQ7 A;  5CRH A;  4IJ3 A;  4J56 E;  3BBY A;  5GST A;  3L4N A;  3MWH A;  2B6M A;  2F8F A;  3KZQ A;  1FHE A;  2CVD A;  3CTG A;  5KN3 A;  1ERU A;  1SJZ A;  3EUR A;  4F0C A;  3F4S A;  3VWV A;  2ALB A;  4NAX A;  3MAK A;  2IPA A;  3KGK A;  5EY6 A;  3EC3 A;  3TCO A;  2GT6 A;  2DJ3 A;  3F3Q A;  3DYR A;  3F3R A;  1TOF A;  5INY A;  2HZE B;  3F6D A;  1K0A A;  4ZB9 A;  2LNS A;  5G30 A;  2CV4 A;  2MBT A;  1M2D A;  3FK8 A;  1FOV A;  1MTC A;  1TU7 A;  4Z2T A;  4MAB A;  3HY2 A;  3ME8 A;  2C0G A;  5IMC A;  1J0F A;  1C72 A;  2LKU A;  1M99 A;  1EP7 A;  1N8J A;  4BA7 A;  5KEJ A;  3QD9 A;  3ERF A;  2YWI A;  3P90 A;  2MMZ A;  2YZU A;  1GNE A;  2H0G A;  3WGE A;  5D9W A;  2DC5 A;  3G9B A;  1M7T A;  5HFG A;  3TJG A;  1YKC A;  3M1G A;  2MBS A;  1PN0 A;  4XS6 A;  5IMD A;  2F51 A;  3F6F A;  1TI3 A;  1Z6M A;  1VGL A;  4TOP A;  3DML A;  5CRE A;  2VLT A;  2DKI A;  4MP4 A;  2H1D A;  1VF4 A;  2CVK A;  4IVF A;  3MIX A;  1A23 A;  3VI5 A;  2YWM A;  2XC2 A;  4CW9 A;  2DJ0 A;  3TJF A;  3VK9 A;  1U3I A;  3LFL A;  2C8U A;  2IMF A;  1OKT A;  1PL1 A;  1TU8 A;  2WRT A;  5D9T A;  4TR0 A;  4EE0 A;  2FUG 2;  2GVP A;  3QR6 A;  2X8C A;  4KSM A;  3HVV A;  2B3S A;  4L0W A;  3GTU A;  4MPG A;  3O3T A;  1B4Q A;  2AV4 A;  1EV4 A;  3IHQ A;  5F07 A;  2FA4 A;  4BL7 A;  4F2I A;  4ZB8 A;  1T00 A;  3E3E A;  9GSS A;  4KCA A;  2JSY A;  4N30 A;  2BJX A;  14GS A;  2HXK A;  3LYK A;  3DXB A;  5COH A;  4V2N A;  5D9X A;  2AJQ B;  4F82 A;  3ZML A;  10GS A;  2GQM A;  3BCI A;  4N10 A;  1K0B A;  4TR1 A;  2P31 A;  4ACS A;  1XZO A;  3HA9 A;  3H93 A;  1SD9 A;  1JHB A;  4MLY A;  5JCG A;  2LQQ A;  1V57 A;  1F6M C;  3APO A;  2VAF A;  4MJE A;  5IMF A;  1V98 A;  2X8H A;  4PUR A;  3TRP A;  3H8Q A;  3TKP A;  4MJB A;  4HU9 A;  4J2F A;  3CTF A;  2YOI A;  3FYG A;  3IRA A;  1O8X A;  3A2X A;  4MA9 A;  4KA0 A;  2GSS A;  4EF0 A;  4LA1 A;  4ZL7 A;  2H6Z A;  2NBS A;  2C3N A;  4I6X A;  5GZZ B;  1GTI A;  3HDC A;  4FQU A;  4Q5R A;  1SYX A;  4YQU A;  1LJR A;  2WCI A;  1FO5 A;  5EL8 A;  2O89 A;  1Z9H A;  4ECI A;  1XVW A;  1T3B A;  2IWT A;  8GSS A;  3TJB A;  3UJ1 A;  1ERW A;  2FLS A;  4POL A;  1TXX A;  5DQS A;  4TVE A;  4WBJ A;  3WGX A;  2GZP A;  1GLP A;  5DJM A;  3J7Y b;  4G0K A;  4ECB A;  2EC4 A;  3LOR A;  1Q4J A;  2JSZ A;  2LNT A;  2H6X A;  4KDY A;  3GL3 A;  5DAK B;  4GTU A;  4TKY A;  1K0O A;  3G7Y A;  3M3M A;  1A2J A;  4AJ8 A;  2HSY A;  2YJH A;  2A2R A;  5ENU A;  1UC7 A;  1YZX A;  4K7N A;  1JZR A;  2NVL A;  5E4W A;  2OKA A;  2L5O A;  1GWC A;  1X5C A;  2HSM A;  2N5F A;  4KB3 A;  5B6M A;  2IFQ A;  4N11 A;  1J9B A;  4WR4 A;  4FYC A;  4POB A;  3QFB C;  1X9W B;  4X4J A;  4IGJ A;  1XWA A;  4OFT A;  2O85 A;  3IK7 A;  2LJK A;  4CDO A;  3HVX A;  2GQL A;  4KF9 A;  1TI1 A;  4D73 B;  4USS A;  5H5Q A;  4ZBA A;  4KX4 A;  3D6I A;  3KMN A;  2OE1 A;  4E8E A;  3U6V A;  3UVT A;  1OC8 A;  2FA8 A;  2TIR A;  1B48 A;  3PGT A;  1QUW A;  2B5E A;  5G5F A;  2JZR A;  3D4T A;  2PMT A;  4K0N A;  4TXO A;  5ID2 A;  2VD0 A;  4JR4 A;  4EO3 A;  1F3A A;  4ZXG A;  3F0I A;  4IW9 A;  2JZT A;  5ECH B;  4MJC A;  3VWX A;  1U6T A;  3TOU A;  4X1U A;  5JCU A;  3QCP A;  3WT1 A;  17GS A;  1GNW A;  3P7X A;  2I4A A;  4HZ2 A;  2H76 A;  1O8W A;  2WJU A;  4FYU A;  4OFM A;  1AUC A;  3H4K A;  5DDL A;  2TRC P;  1G7E A;  1TRU A;  4Q5N A;  2LRN A;  1IYH A;  2LQO A;  1AW9 A;  1ZYN A;  5FT3 A;  4YKF A;  4GXZ A;  1URM A;  1MD3 A;  3EPT A;  2PVO C;  4K6X A;  1PA3 A;  3GX0 A;  2JZS A;  3BOA A;  3L78 A;  1GP1 A;  1BYE A;  2PU9 C;  2VCQ A;  1U88 A;  5DJL A;  1VF2 A;  4HEA 2;  2H70 A;  3F63 A;  1WRY A;  3RHB A;  5IO0 A;  2H8L A;  2PER A;  6GSX A;  3ZIJ A;  5A4W A;  2V6K A;  4MCU A;  4P3Y B;  4IBP A;  2VCW A;  2EIR A;  3PIN A;  1SEN A;  2VL2 A;  3VWW A;  1GTA A;  3VLN A;  2VCZ A;  2KOK A;  4I5Q A;  5IO2 A;  2I1U A;  1WIK A;  2B7K A;  2GTU A;  4MJA A;  1J08 A;  2D2Z A;  3TKR A;  4NPB A;  1FVK A;  5AN1 A;  4XS4 A;  1OE7 A;  1E6B A;  4AJ7 A;  1X9M B;  1AIU A;  4WET A;  3A2W A;  2HRN A;  2H71 A;  3LEF A;  1O6J A;  3ZYW A;  4GQC A;  5KOX A;  2F9S A;  4IP6 A;  4OD7 A;  5IOX A;  1EGO A;  1M2A A;  1DE2 A;  5G5E A;  3S9F A;  2H19 A;  1BJX A;  2HRA A;  4K2D A;  4POK A;  3KD0 A;  4K7I A;  22GS A;  1ST9 A;  2VOC A;  2IME A;  11GS A;  3APQ A;  3AY8 A;  4IJI A;  2OA7 A;  2CZ3 A;  1UA5 A;  3CBU A;  2CT6 A;  3DEX A;  3F4R A;  2C0D A;  2HZE A;  1SYR A;  1TK8 B;  1ZL9 A;  1ACV A;  1VF3 A;  2LJR A;  3CYN A;  3RPN A;  3FZ9 A;  1S3D A;  2N5A A;  2R5G A;  4QL7 A;  4OCE A;  3FR6 A;  1WJK A;  3R2Q A;  3M0F A;  4MH3 A;  4GF0 A;  3GHA A;  4MZW A;  3EMP A;  5D93 A;  2V2G A;  3C7M A;  3IE3 A;  2I81 A;  1EV9 A;  4TN8 A;  5DAL B;  2L5L A;  4L0U A;  4EDZ A;  2J9H A;  5G1K A;  5G1L A;  3GN3 A;  1XW5 A;  1VRS D;  2CA8 A;  2E7P A;  3QOU A;  3TKS E;  1SL0 B;  1W89 A;  1FVJ A;  3UEM A;  1OAZ A;  4KGI A;  1TW9 A;  4N0V A;  3O6T A;  5DQY A;  4Z2R A;  3UBK A;  1BX9 A;  3TGZ A;  4MMM A;  4O7H A;  4LMV A;  1PRX A;  4WR5 A;  3GST A;  1PD2 1;  3KXO A;  2PUK C;  3H1N A;  2N5B A;  1HNB A;  3ZIT A;  4K7O A;  3ZVJ D;  2MZC A;  2FHE A;  3NZN A;  5H5S A;  1TRS A;  4WKW A;  2CAQ A;  13GS A;  1ON4 A;  3ERW A;  4G0I A;  2L4Q A;  1BQ7 A;  4GCI A;  1KBN A;  4XRD A;  3GNJ A;  5ELA A;  2B1K A;  1GUM A;  2VCT A;  5IMA A;  3CXG A;  4ML6 A;  5AIS A;  5B8A A;  5J3R A;  4AJ6 A;  1SL2 B;  3GUS A;  2QC7 A;  4PTS A;  1MDK A;  1A2L A;  3ZIV A;  2DJ2 A;  1ZOF A;  4RI6 A;  5JWQ B;  1XPV A;  4ML1 A;  3VWU A;  3EVI A;  2H0I A;  4HJM A;  4K5S A;  1XW6 A;  3PR8 A;  5ECR B;  4RQR A;  1AAZ A;  2YAN A;  1YKA A;  5DVB A;  2QKE A;  4KDX A;  2B1L A;  2FD3 A;  1B4P A;  1PKW A;  2L6D A;  4TRX A;  5IPG A;  3ZFL A;  3NIV A;  1XXU A;  3LYP A;  3ERG A;  4EC0 A;  4L5O A;  1EEJ A;  1K3L A;  3GH6 A;  1FW1 A;  1R4W A;  4BWS A;  4XCS A;  2YWO A;  4ZB6 A;  2AHE A;  5ECQ B;  1ML6 A;  1GUH A;  1SJ6 A;  2ON5 A;  3GSS A;  3DD3 A;  3TKS C;  3Q74 A;  4NXI A;  2C80 A;  4EIP A;  2M80 A;  1V9W A;  1I9D A;  3C1S A;  1PX6 A;  1ZYE A;  5J4U A;  3HKR A;  4HU7 A;  4GSS A;  1OVN A;  3FHK A;  2GT5 A;  2PN8 A;  4F0B A;  2MYG A;  3RDW A;  1UN2 A;  1YDK A;  3M9K A;  1NM3 A;  4O92 A;  4LLR A;  7GSS A;  5JWR B;  2JU5 A;  4KH7 A;  5KN1 A;  1YEX A;  1YQ1 A;  1WP0 A;  3MNG A;  5CRW A;  1TRV A;  2GST A;  4DSS B;  2BMX A;  2VIM A;  3D22 A;  1G6Y A;  5KOW A;  5ELG A;  2LRC A;  4NV5 A;  4IS0 A;  1KEB A;  2I9H A;  18GS A;  1PN9 A;  3TRX A;  3IHG A;  1GUK A;  1A8L A;  2E0Q A;  3GFK A;  5DAK A;  4WEY A;  4MH2 A;  2GLR A;  2WZ9 A;  2GS3 A;  2VUP A;  6GSV A;  5D9V A;  3SWL A;  4IN0 A;  4XRA A;  4CHS A;  4KND A;  1JLW A;  4BWQ A;  1Q98 A;  2LJA A;  3QAG A;  3IBH A;  3GKM A;  2QGV A;  1TJD A;  2P5R A;  3HJM A;  5F8B A;  1WMJ A;  3HYP A;  3HCZ A;  2C3Q A;  5FWG A;  3ZZX A;  2FNO A;  2IIY A;  4D73 A;  3A5W A;  1B9Y C;  4EXJ A;  5L71 A;  1YF1 A;  1X5D A;  1XWK A;  4K1F A;  1Z7R A;  1B8X A;  3Q6O A;  2VM1 A;  4JED A;  3LXT A;  5HR3 A;  5B8B A;  2WFC A;  1SKW B;  4DEJ A;  3ZLP A;  4LL4 B;  1A24 A;  3D4M A;  1M9B A;  1O81 A;  1ZGN A;  2VLV A;  4OMV A;  2H66 A;  2KHP A;  4RUV A;  2BTO T;  2V32 A;  3D21 A;  1VF1 A;  4DSR A;  4EDY A;  2IJY A;  4X0X A;  4G0L A;  16GS A;  4JR6 A;  2ON7 A;  1X0R A;  4L8E A;  4RQX A;  4XS1 A;  5G2Z A;  1DBY A;  3KTB A;  4Z2U A;  2LEG A;  1H75 A;  3F9U A;  3OR5 A;  1O7U A;  3VUR A;  5CO3 A;  4GLT A;  5E59 A;  1YF0 A;  6GSY A;  1T8E B;  3HVS A;  2HE3 A;  1QK8 A;  4ICY A;  2FY6 A;  3N5O A;  2HRF A;  4NHZ A;  3IDV A;  2OAC A;  2EIQ A;  5A4V A;  1GSF A;  2L4C A;  3LG6 A;  2LRT A;  5FHI A;  2MMO A;  3GX8 A;  4GWR A;  5F0G A;  2RLI A;  2ES7 A;  1OC3 A;  4IP1 A;  1XBS A;  2AYT A;  4ZBD A;  3ZVJ A;  2EIO A;  1OKD A;  4IQA A;  4KE3 A;  3W6G A;  2WB9 A;  1SU9 A;  3HJO A;  2HNL A;  1GTU A;  4XTS A;  2PVQ A;  3G7I A;  3IOS A;  3C1R A;  2YV9 A;  5ECS A;  3TJJ A;  3DGQ A;  3IAS 2;  2MMA A;  1XFL A;  2RUE A;  2XPE A;  3DVX A;  3TB2 A;  4PQI A;  2R0C A;  3C8E A;  3GL5 A;  5BMU A;  3WD6 A;  4YAV A;  2X8G A;  3BD2 A;  5F06 A;  4KUN A;  3KIJ A;  4ZL8 A;  3DRN A;  3LSZ A;  5CRG A;  4ZBB A;  2GDR A;  5ECI B;  2HZF A;  2H6Y A;  4IHU A;  2FWG A;  5ECP B;  2GZY A;  1E2Y A;  4K5R A;  2X4A A;  1X9S B;  5ABR A;  2AUV A;  3EYT A;  5IOW A;  1Y25 A;  5GAP D;  1FOH A;  1KNG A;  2XPD A;  2F8A A;  3GV1 A;  1GL8 A;  2IL3 A;  3BJ5 A;  4JZQ A;  1OE8 A;  2GSQ A;  1JLV A;  3IK9 A;  3GMF A;  4MPF A;  2VCX A;  1FB0 A;  3TKQ A;  2IN3 A;  4O32 A;  3FY7 A;  3KM6 A;  4IKH A;  3LJR A;  4KCE A;  2CAI A;  3H79 A;  1QQ2 A;  3C71 A;  1HQO A;  5ECK B;  1ZZY A;  5ECO B;  2X99 A;  3LQ7 A;  5DAL A;  1AQX A;  4HZ4 A;  1THO A;  5IQY A;  5J41 A;  2A2S A;  2K18 A;  1G7O A;  2X64 A;  1T4Z A;  2OJL A;  2TRX A;  4TXV A;  2IMD A;  4O5R A;  4V2L A;  3EE2 A;  4NMU A;  2PBJ A;  2DIZ A;  2V41 A;  2CVB A;  4HI7 A;  2O87 A;  1SD8 A;  3G7J A;  4HUA A;  4QL9 A;  4CY8 A;  3I43 A;  3IC8 A;  1M0U A;  4OCF A;  4GRF A;  4FYB A;  5D96 A;  2DJJ A;  4NWY A;  2LTK A;  1WPI A;  1GSQ A;  3A3T A;  2HLS A;  1QGV A;  3KTL A;  4PUA A;  2LS5 A;  2V1M A;  2PPT A;  1NSW A;  2VO4 A;  3VI7 A;  2VM2 A;  2ZUP A;  4ULX A;  1EGR A;  4G2E A;  4AF2 A;  4PXO A;  2H1A A;  4Q5F A;  3HXS A;  1WE0 A;  1XOB A;  1JZD A;  3FKF A;  3UIW A;  1V2A A;  3CRU A;  3MSZ A;  3FZA A;  1HYU A;  3RAZ A;  2QA1 A;  1O85 A;  3CSJ A;  3IV4 A;  3HHV A;  3HD5 A;  2KLX A;  2OBK A;  4OFN A;  1QXH A;  4I2T A;  1ERV A;  3APS A;  1H4O A;  3CRT A;  2K8S A;  1BED A;  1SJI A;  4ZIL A;  2LST A;  3FR9 A;  4FIW A;  3W8S A;  3I69 A;  5J9B A;  5HFK A;  5AIV A;  1W4V A;  3MDK A;  3UAR A;  5IPH A;  1GUL A;  3GA4 A;  1V40 A;  1S3A A;  5B6N A;  5HQP A;  4BVX B;  2Z9S A;  1A0F A;  4G10 A;  1YEP A;  2YPM A;  1LU4 A;  5G31 A;  2A2P A;  2H01 A;  3K8N A;  4HQZ A;  2M46 A;  1EWX A;  4MZC A;  1F37 A;  3DWV A;  1AQW A;  5GSS A;  1F2E A;  2WS2 A;  2WUL A;  3EU4 A;  3E0U A;  3RHC A;  3U5R E;  3ZFB A;  3ZMK A;  1A0R P;  5ECM B;  1EOG A;  3HZ4 A;  4IEL A;  3UAP A;  4YH2 A;  4EIQ A;  3F8U A;  4PGT A;  2H73 A;  5D8I A;  4WF4 A;  3FW2 A;  3QAV A;  1OC9 B;  2DIY A;  2L6C A;  4V1A g;  3DIE A;  3RBT A;  4WBR D;  2H74 A;  2WDU A;  2HFD A;  1XCC A;  4V2M A;  3NOF A;  2C3T A;  4Q5Q A;  5BRT A;  2H30 A;  5C04 A;  5HFI A;  2F3M A;  4KAE A;  4XHM A;  3ZRE A;  1SL1 B;  1K0C A;  1U3A A;  2AAW A;  3L9V A;  1AQV A;  1TKD B;  2IMK A;  3CMI A;  1PL2 A;  3QMX A;  1BAY A;  1WWJ A;  4DSS A;  4KW6 A;  3CSH A;  2DSA A;  4BVY B;  4CY6 A;  2R37 A;  3EMX A;  4AGS A;  2YZH A;  1IYI A;  1ABA A;  1WOU A;  3D5J A;  2B5X A;  3A2V A;  3IC4 A;  4YQV A;  1SK0 A;  2C0E A;  4MK3 A;  5LNK e;  3GYK A;  1RK4 A;  2REM A;  2FWF A;  3ED3 A;  3BCK A;  3IAM 2;  2JAC A;  3M9J A;  3TRQ A;  1G6W A;  2VL2 C;  3LGC A;  3KP8 A;  1R26 A;  1CQH A;  3US3 A;  4KSO A;  1ZMA A;  3KMO A;  3KH9 A;  1Z3E A;  2R0G A;  1K0M A;  1PX7 A;  4GQF A;  1Z6N A;  3E9J B;  1ZCP A;  4TR3 A;  1OYJ A;  5D73 A;  3CSI A;  1TK0 B;  3GUR A;  1K0D A;  2H72 A;  4F03 A;  1DSB A;  5AGY A;  2K8V A;  5JWO B;  2X49 A;  2R2J A;  1XWC A;  2KP2 A;  3JCM L;  4EL1 A;  1USB A;  2I3Y A;  5IMV A;  1V58 A;  1SK2 A;  2FWE A;  2AB6 A;  5ECN B;  3RPP A;  3GKK A;  1MEK A;  1XWG A;  3MYD A;  5HR2 A;  3O76 A;  1HNC A;  3UL3 A;  3L9S A;  4DVC A;  2B7J A;  5CRD A;  4Z7X A;  4G19 A;  3V1W A;  1ERT A;  1T4Y A;  2GQK A;  3N9J A;  5A5K A;  3UVH A;  3VPT A;  1EOH A;  1TP9 A;  2A4H A;  2PGT A;  5EVO A;  1M9A A;  2DMM A;  4PUF C;  4I8B A;  4WXT A;  4GSN A;  1Z7P A;  1GSE A;  1PGT A;  3FRC A;  2PWJ A;  4HQS A;  3FEU A;  4JBB A;  4G9H A;  3ZL5 A;  4POM A;  3ME7 A;  2YP6 A;  2OAD A;  1ZYQ B;  4K8M A;  4ID0 A;  4TW5 A;  3SBC A;  2RM6 A;  4FO5 A;  3TDG A;  4ZIJ A;  4A5P A;  1RW1 A;  2R0P A;  1YJ6 A;  2XHF A;  3GKX A;  2C0F A;  3EIN A;  1GSS A;  4LL1 B;  4K2X A;  2QSI A;  3C73 A;  3TJK A;  2HYX A;  1EZK A;  2YCD A;  2G0F A;  2IMI A;  1K0N A;  3KJY A;  3EU3 A;  19GS A;  5C00 A;  4ILF A;  4ECC A;  5CYY A;  4YAP A;  4PNF A;  4HOJ A;  2ZNM A;  2O8V B;  3Q19 A;  2L59 A;  2YJ7 A;  5ECL B;  2NPB A;  3QPM A;  3DKS A;  4NHW A;  5H5R A;  3PPU A;  1YY7 A;  3P8W A;  2V6O A;  3GTU B;  2WGR A;  1T1V A;  2VL3 A;  2A4V A;  4X43 A;  1FAA A;  4PX1 A;  4PNG A;  2K9F A;  2FWH A;  5F05 A;  3UBL A;  4ZL9 A;  3UMA A;  4BL7 B;  5DCH A;  1XWB A;  3R3E A;  1QFN A;  4BPY A;  3UOM A;  1NHY A;  4OWY A;  5GAN D;  4J57 E;  1GH2 A;  3TUE A;  5CP1 A;  1SK1 A;  2YNX A;  3ZTL A;  2DBC A;  3FZ4 A;  2HRK A;  1MD4 A;  6GSU A;  3A5I A;  1G0T A;  2OBI A;  4FH8 A;  2LV3 A;  2K6V A;  4N0Z A;  1LBK A;  4TR1 B;  1UVZ A;  2DKH A;  1HNA A;  2CQ9 A;  1ILO A;  3GKN A;  3VPQ A;  3ZRD A;  3FZ5 A;  3I9V 2;  3L9U A;  4EUY A;  5HR1 A;  1MDI A;  4DSQ A;  1HD2 A;  2G2Q A;  2VCV A;  5HR0 A;  1A8Y A;  4EKZ A;  4O5U A;  1JFU A;  2RII A;  2YN1 A;  2DJ1 A;  6GSS A;  2H1B A;  2DML A;  5A4U A;  1S3C A;  1TTZ A;  1K3O A;  4ECJ A;  5J9C A;  1PSQ A;  1QMV A;  2OE0 A;  2YV7 A;  3QFA C;  2GSR A;  4JRR A;  2OE3 A;  3WYW A;  4IQ1 A;  2M72 A;  1SKS B;  5EPF A;  1GLQ A;  1T7P B;  1JZW A;  1K3Y A;  3EWL A;  2H1G A;  1CQG A;  1Y6E A;  4MF5 A;  2B5Y A;  3KCM A;  2VD1 A;  4RI7 A;  3L0H A;  2P5Q A;  2ZCT A;  2UZ8 A;  3WT2 A;  2J23 A;  4L5L A;  4MNN A;  4GST A;  3P2A A;  1R5P A;  2H0H A;  2FGX A;  4MF6 A;  1FB6 A;  1PQN A;  1EEM A;  4PQH A;  2DJK A;  3HJP A;  1R5A A;  2NTO A;  4ISD A;  5CNW A;  4OO4 A;  2E2M A;  3J7Y k;  2O7K A;  4HDE A;  1BG5 A;  1AC1 A;  1XVQ A;  1DE1 A;  2C4J A;  3M8N A;  1TRW A;  2L57 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...