4XHMA

Archaeoglobus fulgidus thioredoxin 3 m60h
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
110
structure length
110
Chain Sequence
ARKVLDSPVKLNSSNFDETLKNNENVVVDFWAEWCHPCKMIAPVIEELAKEYAGKVVFGKLNTDENPTIAARYGISAIPTLIFFKKGKPVDQLVGAMPKSELKRWVQRNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thioredoxin (Trx-3)
publication title Rheostat Re-Wired: Alternative Hypotheses for the Control of Thioredoxin Reduction Potentials.
pubmed doi rcsb
source organism Archaeoglobus fulgidus (strain atcc 49558 / vc-16 / dsm 4304 / jcm 9628 / nbrc 1
molecule tags Oxidoreductase
total genus 31
structure length 110
sequence length 110
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4xhmA00
2JZTA 4PQIA 1QMVA 2DJ1A 1TRVA 1FB6A 5ECRB 4HZ4A 4GXZA 3SWLA 2CX4A 5G1LA 5HFKA 2PBJA 2E2MA 3UARA 5FWGA 3ZRDA 2VOCA 3H79A 1H4OA 1QUWA 4IS0A 4I8BA 3TDGA 1YJ6A 4NV2A 1OAZA 2DMMA 2LNTA 1ZYQB 2XPDA 1UVZA 1A8YA 3KP8A 3BCIA 3DGQA 4FYBA 6GSXA 2VUPA 2OACA 1TI1A 1KTEA 2GVPA 3HDCA 1F3AA 1U6TA 2VCWA 3CBUA 4DSSA 1O7UA 2DLXA 4OD7A 3ISOA 5AISA 5ECKB 2CAIA 4L0WA 4NAXA 3HZ4A 2AJQB 2BTOT 2O7KA 2VLUA 5IPHA 2RLIA 2LSTA 2IL3A 2YZHA 5D8IA 2GSTA 1HQOA 2C3QA 5DDLA 3F6DA 1SKSB 5KN3A 1OYJA 3A2VA 2AUVA 1X5EA 1LJRA 4MCUA 1ZZYA 2I9HA 3EC3A 4POBA 4BVYA 1OVNA 2V6KA 3TJGA 4G9HA 1K0CA 4OO4A 1XZOA 3GHAA 2X99A 1EP8A 1Z7PA 4XS1A 4L5OA 1GSYA 1TDIA 4NHWA 4JBBA 4MF6A 2TIRA 3IBHA 4OCEA 2L6CA 3VLNA 2B5EA 2AHEA 4J56E 3CSHA 1Z6NA 2E7PA 1PL1A 3L9UA 3F9UA 4BVXA 3QD9A 1RW1A 1MD4A 3Q18A 3A5WA 4DSSB 4MF5A 1J9BA 3DIEA 3GX8A 2F51A 9GSSA 1VF4A 5CRGA 1SK2A 3FZ4A 4HS1A 5IMZA 2H6XA 1PA3A 1OC9A 5AIXA 1TRUA 4XTSA 3CTGA 1R4WA 4MJBA 1B4QA 4HU9A 4DEJA 3C1SA 2MMAA 1K0NA 4RQRA 4EDZA 1B8XA 1GSSA 2GSRA 1UN2A 4OFMA 4ML6A 2YV7A 4YAVA 1YQ1A 3KGKA 3KMOA 3D6IA 2RIIA 3I9V2 5DALA 1NM3A 4AJ7A 3TKSC 3VURA 3APOA 3TKSA 2YZUA 16GSA 1T4YA 3E0UA 3L9SA 3BBYA 3L78A 2H73A 1XXUA 5JWQB 2WJUA 2YWMA 1EZKA 1WP0A 3QDNA 4JR4A 3H8QA 1GTAA 3GMFA 1A23A 4XIHA 5D9WA 2L6DA 1J08A 3EVIA 4O92A 1JZOA 4Q5FA 4WF4A 3HCZA 2L4QA 4TVEA 1BX9A 3LWAA 1OC9B 4PX1A 2H1AA 3ZVJA 5A5KA 1YY7A 1OC3A 1YF0A 1GTBA 2H8LA 4L0UA 3MNGA 2HRNA 2MMOA 1B4PA 4XRDA 4EKZA 1PX7A 4IQ1A 3UJ1A 3GL5A 2BMXA 1PN9A 2FA8A 3IE3A 4N0VA 2VCZA 2VD0A 4PQ1A 1FVKA 3TKSE 3UAPA 5DALB 4ECJA 5HFGA 3H4KA 3ERWA 3P90A 4PUFC 4BL7A 1GWCA 3FRCA 2V6OA 1A2LA 1QK8A 3EURA 1K0MA 1F9MA 3IXRA 3TJBA 1PD21 2P5RA 4MDCA 4MJAA 2I3YA 4ECCA 2LRCA 3MAKA 4MPGA 2YOIA 1W89A 5D73A 3CRTA 4XRAA 4IN0A 2H70A 5CRHA 3GKXA 1SYXA 5CNWA 4MMMA 1BEDA 4O5RA 3VPQA 2GZZA 3W8SA 1N2AA 3ERFA 1OC8A 3H1NA 3J7Yk 1JHBA 4G10A 3BD2A 1TW9A 3L9VA 5L71A 5EPFA 2XHFA 3GSTA 4IQAA 1SD8A 4ML1A 5IIZA 4KGIA 1ST9A 2YP6A 4QL9A 2A4VA 6GSWA 5B8BA 1OKTA 3HJMA 2KP2A 4ACSA 1EOGA 2WRTA 5A4UA 3IAS2 4MZBA 4HDEA 2FNOA 2WULA 2IMDA 2NPBA 4E8EA 2DJ3A 2LJKA 4EUYA 3RPPA 3KXOA 4OO5A 5EVOA 5DQSA 4Q5NA 1DSBA 3FZ5A 4IJ3A 1S3DA 5JCGA 2FWGA 2TRXA 3FW2A 2IN3A 2JL4A 4K0NA 1GH2A 1DE2A 2YPMA 1M9AA 2G2QA 4HI7A 3KD0A 4JRRA 1GULA 2JSYA 1GTIA 5CAXA 2VM1A 3LJRA 4N10A 1FB0A 3CTFA 2HE3A 1T3BA 1ABAA 2FHEA 5D9XA 3GYKA 1B9YC 3KH7A 2IFQA 4EVMA 3EWLA 3O6TA 2LJAA 4EL1A 4TRXA 1EEJA 5ECSA 1F3BA 3TKRA 1NHYA 1Q4JA 1XW9A 1EWXA 3LORA 1Z7RA 2OKAA 3QFAC 1T8EB 2OE0A 5E4WA 1FAAA 1M0UA 2VL2A 3F6FA 3APQA 1HD2A 3E9JB 3P8WA 4IBPA 3F0IA 2R2JA 4V2NA 1V2AA 4H86A 3DEXA 3F4TA 1YDKA 4PXOA 4I2UA 2GT6A 3KJYA 1TRSA 2PPTA 2F9SA 4ILFA 1TU7A 3LFLA 3IA1A 5DCGA 2C3NA 3GV1A 4K7IA 3VI7A 2JSZA 4IELA 5EY6A 4FYUA 4I2TA 1M99A 3ZZXA 5IQYA 4ULXA 5IMVA 2J23A 4YQMA 1ERTA 1XOBA 4LMVA 3E3EA 3IV4A 5AGYA 1GUHA 4TN8A 3TJJA 5JWRB 1THOA 2B3SA 5ECOB 4JZQA 2O89A 3D4TA 3W6GA 1J0FA 3MDKA 1XWKA 4IJIA 1CQGA 4ZIJA 2PWJA 2DJJA 2RUFA 4ZBAA 2LV3A 2IFQB 3GA4A 4MF7A 4Q5QA 2M46A 1T1VA 4IKHA 5ECNB 2CVKA 6GSUA 4FH8A 5HR2A 1PGTA 4KNDA 3HKRA 6GSYA 1AUCA 3GURA 3AY8A 4TR1A 4DSRA 2X64A 1S3AA 3LXTA 1MDJA 3U6VA 2YJHA 4AGSA 2B5YA 1TJDA 3Q74A 2YV9A 4G19A 1U87A 2R4VA 4WF5A 1ERWA 5HQPA 4ZILA 3OR5A 4KAEA 5HR3A 2IPAA 2VAFA 1IYIA 1K3LA 4FO5A 5J41A 1B9XC 5CRWA 2EIOA 1SD9A 1TP9A 5CP1A 3G7IA 4KDUA 2FY6A 2YCDA 1GSUA 4O32A 4YAPA 1FG4A 3HXSA 1M2AA 4P3YB 1H75A 20GSA 4Q5RA 5ECQB 10GSA 2EIRA 3EE2A 2YWOA 4MP4A 2WDUA 2NVLA 2PMTA 1F37A 2CX3A 2V41A 3IPZA 3DYRA 1ERUA 1XWCA 5D9TA 2YJ7A 2CT6A 5D96A 1F2EA 3CXGA 4GF0A 2LRNA 3VWWA 1ZCPA 4F0CA 11GSA 3CSIA 2LUSA 5ID2A 3DXBA 3RBTA 5C04A 2L4CA 4I5QA 1JLVA 4TR1B 7GSSA 5G5FA 1GNWA 3FHKA 4IVFA 6GSVA 4ZBDA 1FVJA 3NOFA 5F05A 4EC0A 1PKWA 5GSSA 4KX4A 5B6MA 1XVQA 1I9DA 1FOVA 2YANA 4MZWA 1BYEA 3QOUA 2R5GA 1TU8A 5IOXA 5ECLB 5A4WA 1ZGNA 5F8BA 1VRSD 3TRQA 4GRFA 3FKFA 3QAVA 3LXZA 4KH7A 3QAGA 1AIUA 3UOMA 1TTZA 3FY7A 4JR6A 2VL9A 1XOAA 3MWHA 1U88A 2G0FA 4K1FA 1OE7A 3GKKA 2C0GA 1TK5B 3GL3A 3FZ9A 3C73A 2DJ2A 3HHVA 1SJIA 5FT3A 1THXA 5KEJA 5DJLA 2B7JA 3UVHA 4GCIA 2H75A 19GSA 4PGTA 5ID2B 1X9SB 5F07A 1XW5A 2P0GA 2DIYA 4E8HA 2HFDA 1Z6MA 4ZL9A 4GQFA 2LS5A 4MH2A 1VGLA 4MZCA 4I97A 3TCOA 2HZEA 1E2YA 2VCTA 3G9BA 4F82A 2R6KA 2E0QA 3LYPA 1YKCA 3DVXA 1XIYA 4BWQA 4KW6A 1O85A 1S3CA 1O73A 1R5AA 1R7HA 1E6BA 1Y6EA 2MMZA 2CAQA 1AQVA 2FGXA 1KEBA 2KOKA 1V58A 2L59A 4MJEA 5EL8A 5GAND 5A4VA 1I5GA 4F0BA 1PX6A 2J9HA 3PINA 2DMLA 2H01A 2VD1A 3ZIJA 4CHSA 5HR1A 3ZYWA 5DQYA 1YKAA 4KSOA 3HJPA 3HVXA 1WWJA 2DIZA 3D22A 3IAM2 4TR3A 3DMLA 2ZUPA 1ERVA 4IP1A 3TJKA 1K0DA 4KCAA 4YH2A 4L5LA 2QSIA 4GSSA 5CREA 3CSJA 4LL1B 2VL3A 4KCEA 4EXJA 2GSQA 5DAKB 1U3IA 2LNSA 1XW6A 3BOAA 1N8JA 2OADA 3BCKA 3FR3A 4POKA 3DD3A 1A0RP 3G7JA 1T7PB 2KUCA 3M0FA 2HZEB 4MPFA 2AAWA 1XWBA 1KNGA 4HOJA 3GX0A 2VLTA 3LSZA 4ECBA 3KTLA 2M80A 2C0FA 3HZ8A 1NW2A 3HVSA 3CYNA 1A24A 2V1MA 4RI6A 2HSYA 2PN8A 1ZYEA 1HYUA 1HNCA 4X43A 3KTBA 5DCHA 2AB6A 1FW1A 2FWFA 4PNGA 4GSNA 5J3RA 2CZ3A 3HY2A 2DSAA 1LU4A 1AQWA 3KP9A 2CVBA 1TKDB 2CZ2A 1XFLA 5E59A 4HJ2A 4OFTA 4KDYA 3WGXA 2CQ9A 1RK4A 3HD5A 3F63A 5H5SA 2IWTA 3VI5A 4KDXA 2OJLA 2VCQA 3TB2A 1QGVA 3GN3A 1AW9A 1PKZA 4AF2A 2N5FA 3L0HA 3ZVJD 4K9ZA 2GLRA 1SKWB 1X9MB 2XPEA 2CA8A 2M72A 3KZQA 1SU9A 1X5CA 5J9CA 1VF3A 4LMWA 5CYYA 1Z9HA 1QXHA 4O7HA 2HSHA 2GQKA 4G2EA 3UEMA 1YEXA 5JCWA 3LYKA 4OWYA 5C00A 1EV4A 1GL8A 3WT1A 3A2WA 3ED3A 2H71A 2AV4A 1M2BA 3US3A 3ZREA 2L5LA 2VO4A 1O8XA 1FHEA 3D21A 1A8LA 3M9KA 4K2DA 3WGDA 4KSMA 3GKNA 2YNXA 1SK0A 1GP1A 2B1LA 3ZL5A 4V1Ag 3D0ZA 4TW5A 4IP6A 1ON4A 4K6XA 1XCCA 1HNBA 3FEUA 2P5QA 3C71A 3DWVA 1O6JA 1MEKA 2P31A 1TK0B 1WIKA 3UBKA 3IK9A 2HI7A 4D73A 2H72A 5FHIA 4ZL7A 3CMIA 2B5XA 1TRWA 1AC1A 2X8HA 1Z3EA 2YWNA 2CVDA 12GSA 3IC4A 3ZLPA 1HNAA 2VCVA 3EU4A 5D93A 1WPIA 1XBSA 1PSQA 3UBLA 4POLA 2VL2C 5GSTA 3UVTA 3GIXA 2B6MA 2H0GA 2GS3A 1K3OA 5KN1A 4OFNA 1JZRA 1K3YA 3I43A 3LEFA 5JWOB 2C0DA 3F3RA 5LD0A 4IGJA 3IR4A 1SENA 5DBQA 3APSA 3GRXA 2LJRA 4KE3A 4V2LA 1ILOA 5AIVA 1ZMAA 18GSA 2KP1A 2QKEA 2OE1A 1GRXA 2ZCTA 4LL4B 2DJKA 2H76A 4HJMA 3LGCA 2FD3A 1M2DA 3I69A 5IO2A 1U3AA 4V2MA 4D73B 4JU5A 4AJ6A 3EU3A 2GGTA 3QR6A 2YN1A 2VLVA 2OA7A 3QAWA 4MK3A 3EINA 1QFNA 1JFUA 3WGEA 4LLRA 4ZB6A 2C0EA 1AXDA 2MMNA 1MDKA 3O3TA 2FLSA 4MA9A 2FCHA 3RHBA 4WR4A 2XBQA 1V98A 4POMA 5ECHB 2C3TA 2BJXA 2HNLA 1G6WA 4F9ZA 1CQHA 3KMNA 5ELGA 3P2AA 1PQNA 2HT9A 4TXVA 4X1UA 4PNFA 4V1Ap 2F3MA 3HVVA 2H66A 1USBA 2HXKA 2RM6A 1YEPA 3S9FA 3VPTA 2GQMA 2WS2A 5IM9A 1C72A 1EOHA 4YQUA 5JCUA 3F4RA 1V57A 2F8AA 1PMTA 1EV9A 2L5OA 1YZXA 1EEMA 4GQCA 1UA5A 3TRXA 2LKUA 2HYXA 1JLWA 3TKQA 3IK7A 4ZXGA 2PERA 4WBRD 1Y25A 1WJKA 2K18A 2ON5A 1SYRA 5G2ZA 4NV5A 1DBYA 5IMFA 2XC2A 2VM2A 2PVQA 4N11A 3DVWA 2IMFA 4JE1A 3Q19A 4TR0A 3TUEA 3P7XA 4QL7A 3NIVA 3IHQA 2C8UA 2Z9SA 1URMA 2X8GA 1W4VA 4GSTA 2QC7A 1YF1A 4TXOA 3NZNA 4ZL8A 1K0OA 1SKRB 1K0BA 2GSSA 4HQZA 3ERGA 3VK9A 5LNKe 2V32A 4WEYA 3ZMLA 8GSSA 2AYTA 4J57E 3D4MA 4BA7A 3GSSA 3M1GA 2LQOA 2QGVA 1WMJA 2NDOA 2ALBA 1OE8A 5HFIA 1DUGA 5HR0A 1ACVA 3TOUA 17GSA 3GFKA 2K9FA 3IDVA 1JZWA 2LEGA 2VIMA 1EGRA 3WT2A 5B6NA 3L4NA 1MDIA 3W8JA 2F8FA 4AJ8A 2IIYA 4HU7A 4MABA 1GSEA 2PVOC 2H6YA 5ECIB 3M8NA 4N0ZA 4ECIA 2GT5A 3C1RA 2WFCA 1T4ZA 1TXXA 2K6VA 3RAZA 5DAKA 3N9JA 4HUAA 4X0XA 4TXOB 2O87A 4BPYA 1F6MC 5G5EA 5KN0A 2JZRA 1WRYA 2ZNMA 3WYWA 5D9VA 4ZBBA 2HRFA 2A2RA 1G0TA 5IPGA 2IJYA 3A3TA 3UL3A 5B8AA 4XS6A 1XPVA 1VF1A 2REMA 4ID0A 2DBCA 3RPNA 1X5DA 1JZDA 2MZCA 3G7YA 4ISDA 3FZAA 1LBKA 2LQQA 4PQHA 1XVWA 2ES7A 4K7OA 1O81A 4IHUA 5J5NA 2GQLA 4F03A 5ECMB 4GWRA 4L8EA 4MH3A 3MSZA 4CDOA 2OBIA 3RHCA 2KLXA 2O8VB 2LTKA 4FIWA 5B7CA 1O8WA 2EIQA 4CW9A 2N5BA 4ZB8A 4BWSA 1B48A 3FR9A 1R26A 1NSWA 2R3XA 2JU5A 1Q98A 2PUKC 2I1UA 2DC5A 1MD3A 3C8EA 1M9BA 3LQ7A 2X8CA 3K8NA 2WGRA 3D5JA 4TR4A 3GH6A 3F8UA 3CRUA 5INYA 3HJOA 2O85A 3TGZA 5DJMA 4XHMA 3ZMKA 1TOFA 1Z5YE 3U5RE 2JADA 1IYHA 1V40A 1BAYA 5F06A 3HYPA 4I6XA 1A2JA 1VF2A 2GTUA 2H1GA 3QMXA 4NPBA 5IMCA 3EMPA 2A2SA 1GSDA 4DVCA 3O76A 2E2GA 2IMEA 1K0AA 2NBSA 4PUAA 3SBCA 1G6YA 3ZIVA 2FWEA 1XWAA 2EC4A 5COHA 2GDRA 1EGOA 2MBSA 4NWYA 13GSA 1M7TA 5G31A 2C4JA 1TK8B 1WE0A 2VCXA 4HQSA 3GNJA 2H0IA 1GSQA 2OE3A 1SL1B 2GZYA 2I4AA 4FYCA 4WR5A 3ME8A 2RUEA 2H19A 6GSSA 14GSA 4K8MA 1AAZA 5J4UA 2HZFA 1MTCA 4EE0A 3EMXA 1UC7A 2FWHA 3FR6A 4GTUA 3DKSA 2GZPA 5H5RA 3VWXA 3KCMA 3V1WA 4IW9A 2JACA 3QCPA 2YWIA 1RQMA 3KM6A 2CV4A 4WXTA 1GUMA 4NXIA 4XS4A 2NTOA 5CRDA 2K8VA 22GSA 4PURA 2IMKA 3PGTA 2WB9A 4Z7XA 3KH9A 4HEA2 1GUKA 1A0FA 4EF0A 3QPMA 4GLTA 4RI7A 5IOWA 5G30A 2H1BA 1ML6A 5G1KA 1EP7A 1FO5A 3JCML 3PR8A 5J9BA 1WOUA 2KHPA 3TKPA 5IMDA 5GAPD 2TRCP 1G7EA 4N30A 1AQXA 4RQXA 4WETA 2XBIA 3J7Yb 5ECPB 3VWUA 3BJ5A 2PU9C 5AN1A 3ME7A 1DE1A 3GTUA 3ZFLA 2FUG2 1OKDA 2RM5A 5ELAA 3Q6OA 5IO0A 1T00A 1GTUA 3GKMA 3KIJA 6GSTA 2WCIA 4K7NA 3GH9A 4K0GA 2IMIA 3C7MA 5ABRA 4NMUA 1G7OA 4XS4B 1SJ6A 4J2FA 1PL2A 3A2XA 3QFBC 2WZ9A 2H0HA 4KUNA 2H74A 1V9WA 1KBNA 3WD6A 2V2GA 4XCSA 5KN2A 2DJ0A 3I6AA 4KA0A 1GNEA 4OMVA 5H5QA 4LA1A 1SL0B 1X0RA 5F0GA 4DSQA 3TOTA 1SL2B 1QQ2A 4KB3A 1R5PA 4TOPA 1NHOA 2I81A 3LG6A 3IRAA 3UIWA 2K8SA 3DRNA 2MYGA 2N5AA 2LRTA 1BJXA 3M9JA 2JZSA 4EO3A 1BQ7A 2OBKA 5DVBA 2ON7A 1TI3A 3ZFBA 3UMAA 5IMAA 3KEBA 1X9WB 3N5OA 2L57A 3GUSA 1ZL9A 2H1DA 1A2MA 3M3MA 4TKYA 1ZOFA 1GLPA 4F2IA 3GTUB 1GSFA 4HZ2A 2HLSA 5CO3A 3FK8A 4NHZA 1XWGA 3VWVA 3H93A 4MJCA 2H30A 3PH9A 2PGTA 3ZITA 4MLYA 2B1KA 2MBTA 3VFIA 5ENUA 4JEDA 4OCFA 2C1YA 2B7KA 3RDWA 5LCZA 3TJFA 3R2QA 4WBJA 4ZB9A 4EDYA 5GZZB 1BG5A 2C80A 3F3QA 2D2ZA 3TRPA 1SK1A 1GLQA 4WKWA 3ZTLA 3F4SA 2H6ZA 3EYTA 1SJZA 4QQ7A 3HA9A 2FA4A 3FYGA 2R37A 4RUVA 1PRXA 4YQVA 3IOSA
chains in the Genus database with same CATH superfamily
2JZTA 4PQIA 1QMVA 2DJ1A 1TRVA 1FB6A 5ECRB 4HZ4A 4GXZA 3SWLA 2CX4A 5G1LA 5HFKA 2PBJA 2E2MA 3UARA 5FWGA 3ZRDA 2VOCA 3H79A 1H4OA 1QUWA 4IS0A 4I8BA 3TDGA 1YJ6A 4NV2A 1OAZA 2DMMA 2LNTA 1ZYQB 2XPDA 1UVZA 1A8YA 3KP8A 3BCIA 3DGQA 4FYBA 6GSXA 2VUPA 2OACA 1TI1A 1KTEA 2GVPA 3HDCA 1F3AA 1U6TA 2VCWA 3CBUA 4DSSA 1O7UA 2DLXA 4OD7A 3ISOA 5AISA 5ECKB 2CAIA 4L0WA 4NAXA 3HZ4A 2AJQB 2BTOT 2O7KA 2VLUA 5IPHA 2RLIA 2LSTA 2IL3A 2YZHA 5D8IA 2GSTA 1HQOA 2C3QA 5DDLA 3F6DA 1SKSB 5KN3A 1OYJA 3A2VA 2AUVA 1X5EA 1LJRA 4MCUA 1ZZYA 2I9HA 3EC3A 5KOWA 4POBA 4BVYA 3R3EA 1OVNA 2V6KA 3TJGA 4G9HA 1K0CA 4OO4A 1XZOA 3GHAA 2X99A 1EP8A 1Z7PA 4XS1A 4L5OA 1GSYA 1TDIA 4NHWA 4JBBA 4MF6A 2TIRA 3IBHA 4OCEA 2L6CA 3VLNA 2B5EA 2AHEA 4J56E 3CSHA 1Z6NA 2E7PA 1PL1A 3L9UA 3F9UA 4BVXA 3QD9A 1RW1A 1MD4A 3Q18A 3A5WA 4DSSB 4MF5A 1J9BA 3DIEA 3GX8A 2F51A 9GSSA 2HSMA 1VF4A 5CRGA 1SK2A 2DKIA 3FZ4A 4HS1A 5IMZA 2H6XA 1PA3A 1OC9A 5AIXA 1TRUA 4XTSA 3CTGA 1R4WA 4MJBA 1B4QA 4HU9A 3MYDA 4DEJA 3C1SA 2MMAA 1K0NA 4RQRA 4EDZA 1B8XA 1GSSA 2GSRA 1UN2A 4OFMA 4ML6A 2YV7A 4YAVA 1YQ1A 3KGKA 3KMOA 4BVYB 3D6IA 2RIIA 3I9V2 5DALA 1NM3A 4AJ7A 4Z2UA 3TKSC 3VURA 3APOA 3TKSA 2YZUA 16GSA 1T4YA 3E0UA 3L9SA 3BBYA 3L78A 2H73A 1XXUA 5JWQB 2WJUA 2YWMA 1EZKA 1WP0A 3QDNA 4JR4A 4BVXB 3H8QA 1GTAA 3GMFA 1A23A 4XIHA 2HRAA 5D9WA 2L6DA 1J08A 3EVIA 4O92A 1JZOA 4Q5FA 4WF4A 3HCZA 2L4QA 4TVEA 1BX9A 3LWAA 1OC9B 4PX1A 2H1AA 3ZVJA 5A5KA 1YY7A 1OC3A 3HVNA 1YF0A 1GTBA 2H8LA 4L0UA 3MNGA 2HRNA 2MMOA 1B4PA 4XRDA 3MIXA 4EKZA 1PX7A 4IQ1A 3UJ1A 3GL5A 2BMXA 1PN9A 4K5RA 2FA8A 3IE3A 4N0VA 2VCZA 2VD0A 4PQ1A 1FVKA 3TKSE 3UAPA 5DALB 4ECJA 5HFGA 3H4KA 3ERWA 3P90A 2R0PA 4PUFC 4BL7A 1GWCA 3FRCA 2V6OA 1A2LA 1QK8A 3EURA 1K0MA 1F9MA 3IXRA 3TJBA 1PD21 2P5RA 4MDCA 4MJAA 2I3YA 4ECCA 2LRCA 3MAKA 4MPGA 2YOIA 1W89A 5D73A 3CRTA 4XRAA 4IN0A 2H70A 5CRHA 4EIQA 3GKXA 1SYXA 5CNWA 4MMMA 1BEDA 4O5RA 3VPQA 2GZZA 3W8SA 1N2AA 3ERFA 1OC8A 3H1NA 3J7Yk 1JHBA 4G10A 3BD2A 1TW9A 3L9VA 4YKGA 5L71A 5EPFA 2XHFA 3GSTA 4IQAA 1SD8A 4ML1A 5IIZA 4KGIA 1ST9A 2YP6A 4QL9A 2A4VA 6GSWA 4BL7B 5B8BA 1OKTA 2A4HA 3HJMA 2KP2A 4ACSA 1EOGA 2WRTA 5A4UA 3IAS2 4MZBA 4HDEA 2FNOA 2R0CA 2WULA 2IMDA 2NPBA 4E8EA 2DJ3A 2LJKA 4EUYA 3RPPA 3KXOA 4OO5A 5EVOA 5DQSA 4Q5NA 1DSBA 3FZ5A 4IJ3A 1S3DA 5JCGA 2FWGA 2TRXA 3FW2A 2IN3A 2JL4A 4K0NA 1GH2A 1PN0A 1DE2A 2YPMA 1M9AA 2G2QA 4A5PA 4HI7A 3KD0A 4JRRA 1GULA 2JSYA 1GTIA 5CAXA 2VM1A 3LJRA 4N10A 1FB0A 3CTFA 2HE3A 1T3BA 1ZYPA 1ABAA 2FHEA 5D9XA 3GYKA 1B9YC 3KH7A 2IFQA 4EVMA 3EWLA 3O6TA 2LJAA 4EL1A 4TRXA 1EEJA 5ECSA 1F3BA 3TKRA 1NHYA 1Q4JA 1XW9A 1EWXA 3LORA 1Z7RA 2OKAA 3QFAC 1T8EB 4USSA 2OE0A 5E4WA 1FAAA 1M0UA 2VL2A 3F6FA 3APQA 1HD2A 3E9JB 3P8WA 4G0KA 2X49A 4IBPA 3F0IA 2R2JA 4V2NA 1V2AA 4H86A 3DEXA 3F4TA 1YDKA 4PXOA 4I2UA 2GT6A 3KJYA 1TRSA 2PPTA 2F9SA 4ILFA 1TU7A 3LFLA 3IA1A 5DCGA 2C3NA 3GV1A 4K7IA 3VI7A 2JSZA 4IELA 5EY6A 4K2XA 4FYUA 4I2TA 1M99A 3ZZXA 5IQYA 4YKFA 4EIPA 4ULXA 5IMVA 2J23A 4YQMA 1ERTA 2QA1A 2R0GA 1XOBA 4LMVA 3E3EA 3IV4A 4ICYA 5AGYA 1GUHA 4TN8A 3TJJA 5JWRB 1THOA 2B3SA 5ECOB 4JZQA 2O89A 3D4TA 3W6GA 1J0FA 3MDKA 1XWKA 4IJIA 1CQGA 4ZIJA 2PWJA 2DJJA 2RUFA 4ZBAA 2LV3A 2IFQB 3GA4A 4MF7A 4Q5QA 2M46A 1T1VA 4IKHA 5ECNB 2CVKA 6GSUA 4FH8A 5HR2A 1PGTA 4KF9A 4KNDA 3HKRA 6GSYA 1AUCA 3GURA 3AY8A 4TR1A 4DSRA 2X64A 1S3AA 3LXTA 1MDJA 5BMUA 3U6VA 2YJHA 4AGSA 2B5YA 1TJDA 3Q74A 4Z2RA 2YV9A 4G19A 1U87A 2R4VA 4WF5A 1ERWA 5HQPA 4ZILA 3OR5A 4KAEA 5HR3A 2IPAA 2VAFA 1IYIA 1K3LA 4FO5A 5J41A 1B9XC 5CRWA 2EIOA 1SD9A 1TP9A 5CP1A 3G7IA 4KDUA 2FY6A 2YCDA 1GSUA 4O32A 4YAPA 1FG4A 3HXSA 1M2AA 4P3YB 1H75A 20GSA 4Q5RA 5ECQB 10GSA 2EIRA 3EE2A 2YWOA 4MP4A 2WDUA 2NVLA 2PMTA 1F37A 2CX3A 2V41A 3IPZA 3DYRA 1ERUA 1XWCA 5D9TA 2YJ7A 2CT6A 5D96A 1F2EA 3CXGA 4GF0A 2LRNA 3VWWA 1ZCPA 4F0CA 11GSA 3CSIA 2LUSA 5ID2A 3DXBA 3RBTA 5C04A 2L4CA 4I5QA 1JLVA 4TR1B 7GSSA 5G5FA 1GNWA 3FHKA 4IVFA 6GSVA 4ZBDA 1FVJA 3NOFA 5F05A 4EC0A 1PKWA 5GSSA 4KX4A 3FMWA 3IHGA 5B6MA 1XVQA 1I9DA 1FOVA 2YANA 4MZWA 1BYEA 3QOUA 1M3JA 2R5GA 1TU8A 5IOXA 5ECLB 5A4WA 1ZGNA 5F8BA 1VRSD 3TRQA 4GRFA 3FKFA 3LW9A 3QAVA 3LXZA 4KH7A 3QAGA 1AIUA 3UOMA 1TTZA 3FY7A 4JR6A 2VL9A 1XOAA 3MWHA 1U88A 2G0FA 4K1FA 1OE7A 3GKKA 2C0GA 1TK5B 3GL3A 3PPUA 3FZ9A 4CY8A 4MNNA 3C73A 2DJ2A 3HHVA 1SJIA 2A2PA 5FT3A 1THXA 5KEJA 5DJLA 2UZ8A 2B7JA 3UVHA 4GCIA 2H75A 19GSA 4PGTA 5ID2B 1X9SB 5F07A 1XW5A 2P0GA 2DIYA 4E8HA 2HFDA 1Z6MA 4ZL9A 4GQFA 2LS5A 4MH2A 1VGLA 4MZCA 4I97A 3TCOA 2HZEA 1E2YA 2VCTA 3G9BA 4F82A 2R6KA 2E0QA 3LYPA 1YKCA 3DVXA 1XIYA 4BWQA 4KW6A 1O85A 1S3CA 1O73A 1R5AA 1R7HA 1E6BA 1Y6EA 2MMZA 2CAQA 1AQVA 2FGXA 1KEBA 2KOKA 1V58A 2L59A 4MJEA 5EL8A 5GAND 5A4VA 1I5GA 4F0BA 1PX6A 2J9HA 3PINA 2DMLA 2H01A 5KOXA 2VD1A 3ZIJA 4CHSA 5HR1A 3ZYWA 5DQYA 1YKAA 4KSOA 3HJPA 3HVXA 1WWJA 2DIZA 3D22A 3IAM2 4TR3A 3DMLA 2ZUPA 1ERVA 4IP1A 3TJKA 1K0DA 4KCAA 4YH2A 4L5LA 2QSIA 4GSSA 5CREA 3CSJA 4LL1B 1M3IA 2VL3A 4KCEA 4EXJA 2GSQA 5DAKB 1U3IA 2LNSA 1XW6A 3BOAA 1N8JA 2OADA 3BCKA 3FR3A 4POKA 3DD3A 1A0RP 3G7JA 1T7PB 2KUCA 3M0FA 2HZEB 4MPFA 2AAWA 1XWBA 1KNGA 4HOJA 3GX0A 2VLTA 3LSZA 4ECBA 3KTLA 2M80A 2C0FA 3HZ8A 1NW2A 3HVSA 3CYNA 4G0IA 1A24A 2V1MA 4RI6A 2HSYA 2PN8A 1ZYEA 1HYUA 1HNCA 4PTSA 4X43A 3KTBA 5DCHA 2AB6A 1FW1A 2FWFA 4PNGA 4GSNA 5J3RA 2CZ3A 3HY2A 2DSAA 1LU4A 1AQWA 3KP9A 2CVBA 1TKDB 2CZ2A 1XFLA 5E59A 4HJ2A 4OFTA 4KDYA 3WGXA 2CQ9A 1RK4A 3HD5A 3F63A 5H5SA 1ZYNA 2IWTA 3VI5A 4KDXA 2OJLA 2VCQA 3TB2A 1QGVA 3GN3A 1AW9A 1PKZA 4AF2A 2N5FA 3L0HA 3ZVJD 4K9ZA 2GLRA 1SKWB 1X9MB 2XPEA 2CA8A 2M72A 3KZQA 1SU9A 1X5CA 5J9CA 1VF3A 4LMWA 5CYYA 1Z9HA 4X4JA 1QXHA 4O7HA 2HSHA 2GQKA 4G2EA 3UEMA 1YEXA 5JCWA 3LYKA 4OWYA 5C00A 1EV4A 1GL8A 3WT1A 3A2WA 3ED3A 2H71A 2AV4A 1M2BA 3US3A 3ZREA 2L5LA 2VO4A 1O8XA 1FHEA 3D21A 1A8LA 3M9KA 4K2DA 3WGDA 4KSMA 3GKNA 2YNXA 1SK0A 1GP1A 2B1LA 3ZL5A 4V1Ag 3D0ZA 4TW5A 4IP6A 1ON4A 4K6XA 1XCCA 1HNBA 3FEUA 2P5QA 3C71A 3DWVA 1O6JA 1MEKA 2P31A 1TK0B 1WIKA 3UBKA 3IK9A 2HI7A 4D73A 2H72A 5FHIA 4ZL7A 3CMIA 2B5XA 1TRWA 1AC1A 2X8HA 1Z3EA 2YWNA 2CVDA 12GSA 3IC4A 3ZLPA 1HNAA 2VCVA 3EU4A 5D93A 1WPIA 1XBSA 1PSQA 3UBLA 4POLA 2VL2C 5GSTA 3UVTA 3GIXA 2B6MA 2H0GA 2GS3A 1K3OA 5KN1A 4OFNA 1JZRA 1K3YA 3I43A 3LEFA 5JWOB 2C0DA 3F3RA 5LD0A 4IGJA 3IR4A 1SENA 5DBQA 3APSA 3GRXA 2LJRA 4KE3A 4V2LA 1ILOA 5AIVA 1ZMAA 18GSA 2KP1A 2QKEA 2OE1A 1GRXA 2ZCTA 4LL4B 2DJKA 2H76A 4HJMA 3LGCA 2FD3A 1M2DA 3I69A 5IO2A 1U3AA 4V2MA 4D73B 4JU5A 4AJ6A 3EU3A 2GGTA 3QR6A 2YN1A 2VLVA 2OA7A 3QAWA 4MK3A 3EINA 1QFNA 1JFUA 3WGEA 4LLRA 4ZB6A 2C0EA 1AXDA 2MMNA 1MDKA 3O3TA 2FLSA 4MA9A 2FCHA 3RHBA 4WR4A 2XBQA 1V98A 4POMA 5ECHB 2C3TA 2BJXA 2HNLA 1G6WA 4F9ZA 1CQHA 3KMNA 5ELGA 3P2AA 1PQNA 2HT9A 4TXVA 4X1UA 4PNFA 4V1Ap 2F3MA 3HVVA 2H66A 1USBA 2HXKA 2RM6A 1YEPA 3S9FA 3VPTA 2GQMA 2WS2A 5IM9A 1C72A 1EOHA 4YQUA 4K5SA 5JCUA 3F4RA 1V57A 2F8AA 1PMTA 1EV9A 2L5OA 1YZXA 1EEMA 4GQCA 1UA5A 3TRXA 2LKUA 2HYXA 1JLWA 3TKQA 3IK7A 4ZXGA 2PERA 4WBRD 1WJKA 1Y25A 2K18A 4HSCX 2ON5A 1SYRA 5G2ZA 4NV5A 1DBYA 5IMFA 2XC2A 2VM2A 2PVQA 4N11A 3DVWA 2IMFA 4JE1A 3Q19A 4TR0A 3TUEA 3P7XA 4QL7A 3NIVA 3IHQA 2C8UA 2Z9SA 1URMA 2X8GA 1W4VA 4GSTA 2QC7A 1YF1A 4TXOA 3NZNA 4ZL8A 1K0OA 1SKRB 1K0BA 2GSSA 4HQZA 3ERGA 3VK9A 5LNKe 2V32A 4WEYA 3ZMLA 4Z2TA 8GSSA 2AYTA 4J57E 3D4MA 4BA7A 3GSSA 3M1GA 2LQOA 2QGVA 1WMJA 2NDOA 2ALBA 1OE8A 5HFIA 1DUGA 5HR0A 1ACVA 3TOUA 17GSA 3GFKA 2K9FA 3IDVA 1JZWA 2LEGA 2VIMA 1EGRA 3WT2A 5B6NA 3L4NA 1MDIA 3W8JA 2F8FA 4AJ8A 2IIYA 4HU7A 4MABA 1GSEA 2PVOC 2H6YA 5ECIB 3M8NA 4N0ZA 4ECIA 2GT5A 3C1RA 2WFCA 1T4ZA 1TXXA 2K6VA 3RAZA 5DAKA 3N9JA 4HUAA 4X0XA 4TXOB 2O87A 4BPYA 1F6MC 5G5EA 5KN0A 2JZRA 1WRYA 2ZNMA 3WYWA 5D9VA 4ZBBA 2HRFA 2A2RA 1G0TA 5IPGA 2IJYA 3A3TA 3UL3A 5B8AA 4XS6A 1XPVA 1VF1A 2DKHA 2REMA 4ID0A 2DBCA 5BRTA 3RPNA 1X5DA 1JZDA 2MZCA 3G7YA 4ISDA 3FZAA 1LBKA 2LQQA 4PQHA 1XVWA 2X4AA 2ES7A 4K7OA 1O81A 4IHUA 5J5NA 2GQLA 4F03A 5ECMB 4GWRA 2QA2A 4L8EA 4MH3A 3MSZA 4O5QA 4CDOA 2OBIA 3RHCA 2KLXA 2O8VB 2LTKA 4FIWA 5B7CA 1O8WA 2EIQA 4O5UA 4CW9A 2N5BA 3IC8A 4ZB8A 4BWSA 1B48A 3FR9A 1R26A 1NSWA 2R3XA 1PFOA 2JU5A 1Q98A 2PUKC 2I1UA 2DC5A 1MD3A 3C8EA 1M9BA 3LQ7A 2X8CA 3K8NA 2WGRA 3D5JA 4TR4A 3GH6A 3F8UA 3CRUA 5INYA 3HJOA 2O85A 3TGZA 5DJMA 4XHMA 3ZMKA 1TOFA 1Z5YE 3U5RE 2JADA 1IYHA 1V40A 4G0LA 1BAYA 5F06A 3HYPA 4I6XA 1A2JA 1VF2A 2GTUA 2H1GA 3QMXA 4NPBA 5IMCA 3EMPA 1FOHA 2A2SA 1GSDA 4DVCA 3O76A 2E2GA 2IMEA 1K0AA 2NBSA 4PUAA 3SBCA 1G6YA 3ZIVA 2FWEA 1XWAA 2EC4A 5COHA 2GDRA 1EGOA 2MBSA 4NWYA 13GSA 1M7TA 5G31A 2C4JA 1TK8B 1WE0A 2VCXA 4HQSA 3GNJA 2H0IA 1GSQA 2OE3A 1SL1B 2GZYA 2I4AA 4FYCA 4WR5A 3ME8A 2RUEA 2H19A 6GSSA 14GSA 4K8MA 1AAZA 5J4UA 2HZFA 1MTCA 4EE0A 3EMXA 1UC7A 2FWHA 3FR6A 4GTUA 3DKSA 2GZPA 5H5RA 3VWXA 3KCMA 3V1WA 4IW9A 2JACA 3QCPA 2YWIA 1RQMA 3KM6A 2CV4A 4WXTA 1GUMA 4NXIA 4XS4A 2NTOA 5CRDA 2HRKA 2K8VA 22GSA 4PURA 2IMKA 3PGTA 2WB9A 4Z7XA 3KH9A 4HEA2 1GUKA 1A0FA 4EF0A 3QPMA 4GLTA 4RI7A 5IOWA 5G30A 2H1BA 1ML6A 5G1KA 1EP7A 1FO5A 3JCML 3PR8A 5J9BA 1WOUA 2KHPA 3CQFA 3TKPA 5IMDA 5GAPD 2TRCP 1G7EA 4N30A 1AQXA 4RQXA 4WETA 3EPTA 2XBIA 3J7Yb 5ECPB 1S3RA 3VWUA 3BJ5A 2PU9C 5AN1A 4FQUA 3ME7A 1DE1A 3GTUA 3ZFLA 2FUG2 1OKDA 2RM5A 5ELAA 3Q6OA 5IO0A 1T00A 1GTUA 3GKMA 3KIJA 6GSTA 2WCIA 4K7NA 3GH9A 4K0GA 2IMIA 3C7MA 5ABRA 4NMUA 1G7OA 4XS4B 1SJ6A 4J2FA 1PL2A 3A2XA 3QFBC 2WZ9A 2H0HA 4KUNA 2H74A 1V9WA 1KBNA 3WD6A 2V2GA 4XCSA 5KN2A 2DJ0A 3I6AA 4KA0A 1GNEA 4OMVA 5H5QA 4LA1A 1SL0B 1X0RA 5F0GA 4DSQA 3TOTA 1SL2B 1QQ2A 4KB3A 1R5PA 4TOPA 1NHOA 2I81A 3LG6A 3IRAA 3UIWA 2K8SA 3DRNA 2MYGA 2N5AA 2LRTA 4BIKA 1BJXA 3M9JA 2JZSA 4EO3A 1XG8A 1BQ7A 2OBKA 5DVBA 2ON7A 1TI3A 3ZFBA 3UMAA 5IMAA 3KEBA 3A5IA 1X9WB 3N5OA 2L57A 3GUSA 1ZL9A 2H1DA 1A2MA 3M3MA 4TKYA 1ZOFA 1GLPA 4F2IA 3GTUB 1GSFA 4HZ2A 2HLSA 5CO3A 3FK8A 4NHZA 1XWGA 3VWVA 4CY6A 3H93A 4MJCA 2H30A 3PH9A 2PGTA 3ZITA 4MLYA 2B1KA 2MBTA 3VFIA 5ENUA 4JEDA 4OCFA 2C1YA 2B7KA 3RDWA 5LCZA 3TJFA 3R2QA 4WBJA 4ZB9A 4EDYA 5GZZB 1BG5A 2C80A 3F3QA 2D2ZA 3TRPA 1SK1A 1GLQA 4WKWA 3ZTLA 3F4SA 2H6ZA 3EYTA 1SJZA 4QQ7A 3HA9A 2FA4A 3FYGA 2R37A 4RUVA 1PRXA 4YQVA 3IOSA
chains in the Genus database with same CATH topology
2JZTA 4PQIA 1QMVA 2DJ1A 1TRVA 1FB6A 5ECRB 4HZ4A 4GXZA 3SWLA 2CX4A 5G1LA 5HFKA 2PBJA 2E2MA 3UARA 5FWGA 3ZRDA 2VOCA 3H79A 1H4OA 1QUWA 4IS0A 4I8BA 3TDGA 1YJ6A 4NV2A 1OAZA 2DMMA 2LNTA 1ZYQB 2XPDA 1UVZA 1A8YA 3KP8A 3BCIA 3DGQA 4FYBA 6GSXA 2VUPA 2OACA 1TI1A 1KTEA 2GVPA 3HDCA 1F3AA 1U6TA 2VCWA 3CBUA 4DSSA 1O7UA 2DLXA 4OD7A 3ISOA 5AISA 5ECKB 2CAIA 4L0WA 4NAXA 3HZ4A 2AJQB 2BTOT 2O7KA 2VLUA 5IPHA 2RLIA 2LSTA 2IL3A 2YZHA 5D8IA 2GSTA 1HQOA 2C3QA 5DDLA 3F6DA 1SKSB 5KN3A 1OYJA 3A2VA 2AUVA 1X5EA 1LJRA 4MCUA 1ZZYA 2I9HA 3EC3A 5KOWA 4POBA 4BVYA 3R3EA 1OVNA 2V6KA 3TJGA 4G9HA 1K0CA 4OO4A 1XZOA 3GHAA 2X99A 1EP8A 1Z7PA 4XS1A 4L5OA 1GSYA 1TDIA 4NHWA 4JBBA 4MF6A 2TIRA 3IBHA 4OCEA 2L6CA 3VLNA 2B5EA 2AHEA 4J56E 3CSHA 1Z6NA 2E7PA 1PL1A 3L9UA 3F9UA 4BVXA 3QD9A 1RW1A 1MD4A 3Q18A 3A5WA 4DSSB 4MF5A 1J9BA 3DIEA 3GX8A 2F51A 9GSSA 2HSMA 1VF4A 5CRGA 1SK2A 2DKIA 3FZ4A 4HS1A 5IMZA 2H6XA 1PA3A 1OC9A 5AIXA 1TRUA 4XTSA 3CTGA 1R4WA 4MJBA 1B4QA 4HU9A 3MYDA 4DEJA 3C1SA 2MMAA 1K0NA 4RQRA 4EDZA 1B8XA 1GSSA 2GSRA 1UN2A 4OFMA 4ML6A 2YV7A 4YAVA 1YQ1A 3KGKA 3KMOA 4BVYB 3D6IA 2RIIA 3I9V2 5DALA 1NM3A 4AJ7A 4Z2UA 3TKSC 3VURA 3APOA 3TKSA 2YZUA 16GSA 1T4YA 3E0UA 3L9SA 3BBYA 3L78A 2H73A 1XXUA 5JWQB 2WJUA 2YWMA 1EZKA 1WP0A 3QDNA 4JR4A 4BVXB 3H8QA 1GTAA 3GMFA 1A23A 4XIHA 2HRAA 5D9WA 2L6DA 1J08A 3EVIA 4O92A 1JZOA 4Q5FA 4WF4A 3HCZA 2L4QA 4TVEA 1BX9A 3LWAA 1OC9B 4PX1A 2H1AA 3ZVJA 5A5KA 1YY7A 1OC3A 1YF0A 1GTBA 2H8LA 4L0UA 3MNGA 2HRNA 2MMOA 1B4PA 4XRDA 3MIXA 4EKZA 1PX7A 4IQ1A 3UJ1A 3GL5A 2BMXA 1PN9A 4K5RA 2FA8A 3IE3A 4N0VA 2VCZA 2VD0A 4PQ1A 1FVKA 3TKSE 3UAPA 5DALB 4ECJA 5HFGA 3H4KA 3ERWA 3P90A 2R0PA 4PUFC 4BL7A 1GWCA 3FRCA 2V6OA 1A2LA 1QK8A 3EURA 1K0MA 1F9MA 3IXRA 3TJBA 1PD21 2P5RA 4MDCA 4MJAA 2I3YA 4ECCA 2LRCA 3MAKA 4MPGA 2YOIA 1W89A 5D73A 3CRTA 4XRAA 4IN0A 2H70A 5CRHA 4EIQA 3GKXA 1SYXA 5CNWA 4MMMA 1BEDA 4O5RA 3VPQA 2GZZA 3W8SA 1N2AA 3ERFA 1OC8A 3H1NA 3J7Yk 1JHBA 4G10A 3BD2A 1TW9A 3L9VA 4YKGA 5L71A 5EPFA 2XHFA 3GSTA 4IQAA 1SD8A 4ML1A 5IIZA 4KGIA 1ST9A 2YP6A 4QL9A 2A4VA 6GSWA 4BL7B 5B8BA 1OKTA 2A4HA 3HJMA 2KP2A 4ACSA 1EOGA 2WRTA 5A4UA 3IAS2 4MZBA 4HDEA 2FNOA 2R0CA 2WULA 2IMDA 2NPBA 4E8EA 2DJ3A 2LJKA 4EUYA 3RPPA 3KXOA 4OO5A 5EVOA 5DQSA 4Q5NA 1DSBA 3FZ5A 4IJ3A 1S3DA 5JCGA 2FWGA 2TRXA 3FW2A 2IN3A 2JL4A 4K0NA 1GH2A 1PN0A 1DE2A 2YPMA 1M9AA 2G2QA 4A5PA 4HI7A 3KD0A 4JRRA 1GULA 2JSYA 1GTIA 5CAXA 2VM1A 3LJRA 4N10A 1FB0A 3CTFA 2HE3A 1T3BA 1ZYPA 1ABAA 2FHEA 5D9XA 3GYKA 1B9YC 3KH7A 2IFQA 4EVMA 3EWLA 3O6TA 2LJAA 4EL1A 4TRXA 1EEJA 5ECSA 1F3BA 3TKRA 1NHYA 1Q4JA 1XW9A 1EWXA 3LORA 1Z7RA 2OKAA 3QFAC 1T8EB 4USSA 2OE0A 5E4WA 1FAAA 1M0UA 2VL2A 3F6FA 3APQA 1HD2A 3E9JB 3P8WA 4G0KA 2X49A 4IBPA 3F0IA 2R2JA 4V2NA 1V2AA 4H86A 3DEXA 3F4TA 1YDKA 4PXOA 4I2UA 2GT6A 3KJYA 1TRSA 2PPTA 2F9SA 4ILFA 1TU7A 3LFLA 3IA1A 5DCGA 2C3NA 3GV1A 4K7IA 3VI7A 2JSZA 4IELA 5EY6A 4K2XA 4FYUA 4I2TA 1M99A 3ZZXA 5IQYA 4YKFA 4EIPA 4ULXA 5IMVA 2J23A 4YQMA 1ERTA 2QA1A 2R0GA 1XOBA 4LMVA 3E3EA 3IV4A 4ICYA 5AGYA 1GUHA 4TN8A 3TJJA 5JWRB 1THOA 2B3SA 5ECOB 4JZQA 2O89A 3D4TA 3W6GA 1J0FA 3MDKA 1XWKA 4IJIA 1CQGA 4ZIJA 2PWJA 2DJJA 2RUFA 4ZBAA 2LV3A 2IFQB 3GA4A 4MF7A 4Q5QA 2M46A 1T1VA 4IKHA 5ECNB 2CVKA 6GSUA 4FH8A 5HR2A 1PGTA 4KF9A 4KNDA 3HKRA 6GSYA 1AUCA 3GURA 3AY8A 4TR1A 4DSRA 2X64A 1S3AA 3LXTA 1MDJA 5BMUA 3U6VA 2YJHA 4AGSA 2B5YA 1TJDA 3Q74A 4Z2RA 2YV9A 4G19A 1U87A 2R4VA 4WF5A 1ERWA 5HQPA 4ZILA 3OR5A 4KAEA 5HR3A 2IPAA 2VAFA 1IYIA 1K3LA 4FO5A 5J41A 1B9XC 5CRWA 2EIOA 1SD9A 1TP9A 5CP1A 3G7IA 4KDUA 2FY6A 2YCDA 1GSUA 4O32A 4YAPA 1FG4A 3HXSA 1M2AA 4P3YB 1H75A 20GSA 4Q5RA 5ECQB 10GSA 2EIRA 3EE2A 2YWOA 4MP4A 2WDUA 2NVLA 2PMTA 1F37A 2CX3A 2V41A 3IPZA 3DYRA 1ERUA 1XWCA 5D9TA 2YJ7A 2CT6A 5D96A 1F2EA 3CXGA 4GF0A 2LRNA 3VWWA 1ZCPA 4F0CA 11GSA 3CSIA 2LUSA 5ID2A 3DXBA 3RBTA 5C04A 2L4CA 4I5QA 1JLVA 4TR1B 7GSSA 5G5FA 1GNWA 3FHKA 4IVFA 6GSVA 4ZBDA 1FVJA 3NOFA 5F05A 4EC0A 1PKWA 5GSSA 4KX4A 3FMWA 3IHGA 5B6MA 1XVQA 1I9DA 1FOVA 2YANA 4MZWA 1BYEA 3QOUA 2R5GA 1TU8A 5IOXA 5ECLB 5A4WA 1ZGNA 5F8BA 1VRSD 3TRQA 4GRFA 3FKFA 3LW9A 3QAVA 3LXZA 4KH7A 3QAGA 1AIUA 3UOMA 1TTZA 3FY7A 4JR6A 2VL9A 1XOAA 3MWHA 1U88A 2G0FA 4K1FA 1OE7A 3GKKA 2C0GA 1TK5B 3GL3A 3PPUA 3FZ9A 4CY8A 4MNNA 3C73A 2DJ2A 3HHVA 1SJIA 2A2PA 5FT3A 1THXA 5KEJA 5DJLA 2UZ8A 2B7JA 3UVHA 4GCIA 2H75A 19GSA 4PGTA 5ID2B 1X9SB 5F07A 1XW5A 2P0GA 2DIYA 4E8HA 2HFDA 1Z6MA 4ZL9A 4GQFA 2LS5A 4MH2A 1VGLA 4MZCA 4I97A 3TCOA 2HZEA 1E2YA 2VCTA 3G9BA 4F82A 2R6KA 2E0QA 3LYPA 1YKCA 3DVXA 1XIYA 4BWQA 4KW6A 1O85A 1S3CA 1O73A 1R5AA 1R7HA 1E6BA 1Y6EA 2MMZA 2CAQA 1AQVA 2FGXA 1KEBA 2KOKA 1V58A 2L59A 4MJEA 5EL8A 5GAND 5A4VA 1I5GA 4F0BA 1PX6A 2J9HA 3PINA 2DMLA 2H01A 5KOXA 2VD1A 3ZIJA 4CHSA 5HR1A 3ZYWA 5DQYA 1YKAA 4KSOA 3HJPA 3HVXA 1WWJA 2DIZA 3D22A 3IAM2 4TR3A 3DMLA 2ZUPA 1ERVA 4IP1A 3TJKA 1K0DA 4KCAA 4YH2A 4L5LA 2QSIA 4GSSA 5CREA 3CSJA 4LL1B 2VL3A 4KCEA 4EXJA 2GSQA 5DAKB 1U3IA 2LNSA 1XW6A 3BOAA 1N8JA 2OADA 3BCKA 3FR3A 4POKA 3DD3A 1A0RP 3G7JA 1T7PB 2KUCA 3M0FA 2HZEB 4MPFA 2AAWA 1XWBA 1KNGA 4HOJA 3GX0A 2VLTA 3LSZA 4ECBA 3KTLA 2M80A 2C0FA 3HZ8A 1NW2A 3HVSA 3CYNA 4G0IA 1A24A 2V1MA 4RI6A 2HSYA 2PN8A 1ZYEA 1HYUA 1HNCA 4PTSA 4X43A 3KTBA 5DCHA 2AB6A 1FW1A 2FWFA 4PNGA 4GSNA 5J3RA 2CZ3A 3HY2A 2DSAA 1LU4A 1AQWA 3KP9A 2CVBA 1TKDB 2CZ2A 1XFLA 5E59A 4HJ2A 4OFTA 4KDYA 3WGXA 2CQ9A 1RK4A 3HD5A 3F63A 5H5SA 1ZYNA 2IWTA 3VI5A 4KDXA 2OJLA 2VCQA 3TB2A 1QGVA 3GN3A 1AW9A 1PKZA 4AF2A 2N5FA 3L0HA 3ZVJD 4K9ZA 2GLRA 1SKWB 1X9MB 2XPEA 2CA8A 2M72A 3KZQA 1SU9A 1X5CA 5J9CA 1VF3A 4LMWA 5CYYA 1Z9HA 4X4JA 1QXHA 4O7HA 2HSHA 2GQKA 4G2EA 3UEMA 1YEXA 5JCWA 3LYKA 4OWYA 5C00A 1EV4A 1GL8A 3WT1A 3A2WA 3ED3A 2H71A 2AV4A 1M2BA 3US3A 3ZREA 2L5LA 2VO4A 1O8XA 1FHEA 3D21A 1A8LA 3M9KA 4K2DA 3WGDA 4KSMA 3GKNA 2YNXA 1SK0A 1GP1A 2B1LA 3ZL5A 4V1Ag 3D0ZA 4TW5A 4IP6A 1ON4A 4K6XA 1XCCA 1HNBA 3FEUA 2P5QA 3C71A 3DWVA 1O6JA 1MEKA 2P31A 1TK0B 1WIKA 3UBKA 3IK9A 2HI7A 4D73A 2H72A 5FHIA 4ZL7A 3CMIA 2B5XA 1TRWA 1AC1A 2X8HA 1Z3EA 2YWNA 2CVDA 12GSA 3IC4A 3ZLPA 1HNAA 2VCVA 3EU4A 5D93A 1WPIA 1XBSA 1PSQA 3UBLA 4POLA 2VL2C 5GSTA 3UVTA 3GIXA 2B6MA 2H0GA 2GS3A 1K3OA 5KN1A 4OFNA 1JZRA 1K3YA 3I43A 3LEFA 5JWOB 2C0DA 3F3RA 5LD0A 4IGJA 3IR4A 1SENA 5DBQA 3APSA 3GRXA 2LJRA 4KE3A 4V2LA 1ILOA 5AIVA 1ZMAA 18GSA 2KP1A 2QKEA 2OE1A 1GRXA 2ZCTA 4LL4B 2DJKA 2H76A 4HJMA 3LGCA 2FD3A 1M2DA 3I69A 5IO2A 1U3AA 4V2MA 4D73B 4JU5A 4AJ6A 3EU3A 2GGTA 3QR6A 2YN1A 2VLVA 2OA7A 3QAWA 4MK3A 3EINA 1QFNA 1JFUA 3WGEA 4LLRA 4ZB6A 2C0EA 1AXDA 2MMNA 1MDKA 3O3TA 2FLSA 4MA9A 2FCHA 3RHBA 4WR4A 2XBQA 1V98A 4POMA 5ECHB 2C3TA 2BJXA 2HNLA 1G6WA 4F9ZA 1CQHA 3KMNA 5ELGA 3P2AA 1PQNA 2HT9A 4TXVA 4X1UA 4PNFA 4V1Ap 2F3MA 3HVVA 2H66A 1USBA 2HXKA 2RM6A 1YEPA 3S9FA 3VPTA 2GQMA 2WS2A 5IM9A 1C72A 1EOHA 4YQUA 4K5SA 5JCUA 3F4RA 1V57A 2F8AA 1PMTA 1EV9A 2L5OA 1YZXA 1EEMA 4GQCA 1UA5A 3TRXA 2LKUA 2HYXA 1JLWA 3TKQA 3IK7A 4ZXGA 2PERA 4WBRD 1Y25A 1WJKA 2K18A 2ON5A 1SYRA 5G2ZA 4NV5A 1DBYA 5IMFA 2XC2A 2VM2A 2PVQA 4N11A 3DVWA 2IMFA 4JE1A 3Q19A 4TR0A 3TUEA 3P7XA 4QL7A 3NIVA 3IHQA 2C8UA 2Z9SA 1URMA 2X8GA 1W4VA 4GSTA 2QC7A 1YF1A 4TXOA 3NZNA 4ZL8A 1K0OA 1SKRB 1K0BA 2GSSA 4HQZA 3ERGA 3VK9A 5LNKe 2V32A 4WEYA 3ZMLA 4Z2TA 8GSSA 2AYTA 4J57E 3D4MA 4BA7A 3GSSA 3M1GA 2LQOA 2QGVA 1WMJA 2NDOA 2ALBA 1OE8A 5HFIA 1DUGA 5HR0A 1ACVA 3TOUA 17GSA 3GFKA 2K9FA 3IDVA 1JZWA 2LEGA 2VIMA 1EGRA 3WT2A 5B6NA 3L4NA 1MDIA 3W8JA 2F8FA 4AJ8A 2IIYA 4HU7A 4MABA 1GSEA 2PVOC 2H6YA 5ECIB 3M8NA 4N0ZA 4ECIA 2GT5A 3C1RA 2WFCA 1T4ZA 1TXXA 2K6VA 3RAZA 5DAKA 3N9JA 4HUAA 4X0XA 4TXOB 2O87A 4BPYA 1F6MC 5G5EA 5KN0A 2JZRA 1WRYA 2ZNMA 3WYWA 5D9VA 4ZBBA 2HRFA 2A2RA 1G0TA 5IPGA 2IJYA 3A3TA 3UL3A 5B8AA 4XS6A 1XPVA 1VF1A 2DKHA 2REMA 4ID0A 2DBCA 5BRTA 3RPNA 1X5DA 1JZDA 2MZCA 3G7YA 4ISDA 3FZAA 1LBKA 2LQQA 4PQHA 1XVWA 2X4AA 2ES7A 4K7OA 1O81A 4IHUA 5J5NA 2GQLA 4F03A 5ECMB 4GWRA 2QA2A 4L8EA 4MH3A 3MSZA 4O5QA 4CDOA 2OBIA 3RHCA 2KLXA 2O8VB 2LTKA 4FIWA 5B7CA 1O8WA 2EIQA 4O5UA 4CW9A 2N5BA 3IC8A 4ZB8A 4BWSA 1B48A 3FR9A 1R26A 1NSWA 2R3XA 2JU5A 1Q98A 2PUKC 2I1UA 2DC5A 1MD3A 3C8EA 1M9BA 3LQ7A 2X8CA 3K8NA 2WGRA 3D5JA 4TR4A 3GH6A 3F8UA 3CRUA 5INYA 3HJOA 2O85A 3TGZA 5DJMA 4XHMA 3ZMKA 1TOFA 1Z5YE 3U5RE 2JADA 1IYHA 1V40A 4G0LA 1BAYA 5F06A 3HYPA 4I6XA 1A2JA 1VF2A 2GTUA 2H1GA 3QMXA 4NPBA 5IMCA 3EMPA 1FOHA 2A2SA 1GSDA 4DVCA 3O76A 2E2GA 2IMEA 1K0AA 2NBSA 4PUAA 3SBCA 1G6YA 3ZIVA 2FWEA 1XWAA 2EC4A 5COHA 2GDRA 1EGOA 2MBSA 4NWYA 13GSA 1M7TA 5G31A 2C4JA 1TK8B 1WE0A 2VCXA 4HQSA 3GNJA 2H0IA 1GSQA 2OE3A 1SL1B 2GZYA 2I4AA 4FYCA 4WR5A 3ME8A 2RUEA 2H19A 6GSSA 14GSA 4K8MA 1AAZA 5J4UA 2HZFA 1MTCA 4EE0A 3EMXA 1UC7A 2FWHA 3FR6A 4GTUA 3DKSA 2GZPA 5H5RA 3VWXA 3KCMA 3V1WA 4IW9A 2JACA 3QCPA 2YWIA 1RQMA 3KM6A 2CV4A 4WXTA 1GUMA 4NXIA 4XS4A 2NTOA 5CRDA 2HRKA 2K8VA 22GSA 4PURA 2IMKA 3PGTA 2WB9A 4Z7XA 3KH9A 4HEA2 1GUKA 1A0FA 4EF0A 3QPMA 4GLTA 4RI7A 5IOWA 5G30A 2H1BA 1ML6A 5G1KA 1EP7A 1FO5A 3JCML 3PR8A 5J9BA 1WOUA 2KHPA 3TKPA 5IMDA 5GAPD 2TRCP 1G7EA 4N30A 1AQXA 4RQXA 4WETA 3EPTA 2XBIA 3J7Yb 5ECPB 3VWUA 3BJ5A 2PU9C 5AN1A 4FQUA 3ME7A 1DE1A 3GTUA 3ZFLA 2FUG2 1OKDA 2RM5A 5ELAA 3Q6OA 5IO0A 1T00A 1GTUA 3GKMA 3KIJA 6GSTA 2WCIA 4K7NA 3GH9A 4K0GA 2IMIA 3C7MA 5ABRA 4NMUA 1G7OA 4XS4B 1SJ6A 4J2FA 1PL2A 3A2XA 3QFBC 2WZ9A 2H0HA 4KUNA 2H74A 1V9WA 1KBNA 3WD6A 2V2GA 4XCSA 5KN2A 2DJ0A 3I6AA 4KA0A 1GNEA 4OMVA 5H5QA 4LA1A 1SL0B 1X0RA 5F0GA 4DSQA 3TOTA 1SL2B 1QQ2A 4KB3A 1R5PA 4TOPA 1NHOA 2I81A 3LG6A 3IRAA 3UIWA 2K8SA 3DRNA 2MYGA 2N5AA 2LRTA 1BJXA 3M9JA 2JZSA 4EO3A 1BQ7A 2OBKA 5DVBA 2ON7A 1TI3A 3ZFBA 3UMAA 5IMAA 3KEBA 3A5IA 1X9WB 3N5OA 2L57A 3GUSA 1ZL9A 2H1DA 1A2MA 3M3MA 4TKYA 1ZOFA 1GLPA 4F2IA 3GTUB 1GSFA 4HZ2A 2HLSA 5CO3A 3FK8A 4NHZA 1XWGA 3VWVA 4CY6A 3H93A 4MJCA 2H30A 3PH9A 2PGTA 3ZITA 4MLYA 2B1KA 2MBTA 3VFIA 5ENUA 4JEDA 4OCFA 2C1YA 2B7KA 3RDWA 5LCZA 3TJFA 3R2QA 4WBJA 4ZB9A 4EDYA 5GZZB 1BG5A 2C80A 3F3QA 2D2ZA 3TRPA 1SK1A 1GLQA 4WKWA 3ZTLA 3F4SA 2H6ZA 3EYTA 1SJZA 4QQ7A 3HA9A 2FA4A 3FYGA 2R37A 4RUVA 1PRXA 4YQVA 3IOSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JZT A;  4PQI A;  1QMV A;  2DJ1 A;  1TRV A;  1FB6 A;  5ECR B;  4HZ4 A;  4GXZ A;  3SWL A;  2CX4 A;  5G1L A;  5HFK A;  2PBJ A;  2E2M A;  3UAR A;  5FWG A;  3ZRD A;  2VOC A;  3H79 A;  1H4O A;  1QUW A;  4IS0 A;  4I8B A;  3TDG A;  1YJ6 A;  4NV2 A;  1OAZ A;  2DMM A;  2LNT A;  1ZYQ B;  2XPD A;  1UVZ A;  1A8Y A;  3KP8 A;  3BCI A;  3DGQ A;  4FYB A;  6GSX A;  2VUP A;  2OAC A;  1TI1 A;  1KTE A;  2GVP A;  3HDC A;  1F3A A;  1U6T A;  2VCW A;  3CBU A;  4DSS A;  1O7U A;  2DLX A;  4OD7 A;  3ISO A;  5AIS A;  5ECK B;  2CAI A;  4L0W A;  4NAX A;  3HZ4 A;  2AJQ B;  2BTO T;  2O7K A;  2VLU A;  5IPH A;  2RLI A;  2LST A;  2IL3 A;  2YZH A;  5D8I A;  2GST A;  1HQO A;  2C3Q A;  5DDL A;  3F6D A;  1SKS B;  5KN3 A;  1OYJ A;  3A2V A;  2AUV A;  1X5E A;  1LJR A;  4MCU A;  1ZZY A;  2I9H A;  3EC3 A;  4POB A;  4BVY A;  1OVN A;  2V6K A;  3TJG A;  4G9H A;  1K0C A;  4OO4 A;  1XZO A;  3GHA A;  2X99 A;  1EP8 A;  1Z7P A;  4XS1 A;  4L5O A;  1GSY A;  1TDI A;  4NHW A;  4JBB A;  4MF6 A;  2TIR A;  3IBH A;  4OCE A;  2L6C A;  3VLN A;  2B5E A;  2AHE A;  4J56 E;  3CSH A;  1Z6N A;  2E7P A;  1PL1 A;  3L9U A;  3F9U A;  4BVX A;  3QD9 A;  1RW1 A;  1MD4 A;  3Q18 A;  3A5W A;  4DSS B;  4MF5 A;  1J9B A;  3DIE A;  3GX8 A;  2F51 A;  9GSS A;  1VF4 A;  5CRG A;  1SK2 A;  3FZ4 A;  4HS1 A;  5IMZ A;  2H6X A;  1PA3 A;  1OC9 A;  5AIX A;  1TRU A;  4XTS A;  3CTG A;  1R4W A;  4MJB A;  1B4Q A;  4HU9 A;  4DEJ A;  3C1S A;  2MMA A;  1K0N A;  4RQR A;  4EDZ A;  1B8X A;  1GSS A;  2GSR A;  1UN2 A;  4OFM A;  4ML6 A;  2YV7 A;  4YAV A;  1YQ1 A;  3KGK A;  3KMO A;  3D6I A;  2RII A;  3I9V 2;  5DAL A;  1NM3 A;  4AJ7 A;  3TKS C;  3VUR A;  3APO A;  3TKS A;  2YZU A;  16GS A;  1T4Y A;  3E0U A;  3L9S A;  3BBY A;  3L78 A;  2H73 A;  1XXU A;  5JWQ B;  2WJU A;  2YWM A;  1EZK A;  1WP0 A;  3QDN A;  4JR4 A;  3H8Q A;  1GTA A;  3GMF A;  1A23 A;  4XIH A;  5D9W A;  2L6D A;  1J08 A;  3EVI A;  4O92 A;  1JZO A;  4Q5F A;  4WF4 A;  3HCZ A;  2L4Q A;  4TVE A;  1BX9 A;  3LWA A;  1OC9 B;  4PX1 A;  2H1A A;  3ZVJ A;  5A5K A;  1YY7 A;  1OC3 A;  1YF0 A;  1GTB A;  2H8L A;  4L0U A;  3MNG A;  2HRN A;  2MMO A;  1B4P A;  4XRD A;  4EKZ A;  1PX7 A;  4IQ1 A;  3UJ1 A;  3GL5 A;  2BMX A;  1PN9 A;  2FA8 A;  3IE3 A;  4N0V A;  2VCZ A;  2VD0 A;  4PQ1 A;  1FVK A;  3TKS E;  3UAP A;  5DAL B;  4ECJ A;  5HFG A;  3H4K A;  3ERW A;  3P90 A;  4PUF C;  4BL7 A;  1GWC A;  3FRC A;  2V6O A;  1A2L A;  1QK8 A;  3EUR A;  1K0M A;  1F9M A;  3IXR A;  3TJB A;  1PD2 1;  2P5R A;  4MDC A;  4MJA A;  2I3Y A;  4ECC A;  2LRC A;  3MAK A;  4MPG A;  2YOI A;  1W89 A;  5D73 A;  3CRT A;  4XRA A;  4IN0 A;  2H70 A;  5CRH A;  3GKX A;  1SYX A;  5CNW A;  4MMM A;  1BED A;  4O5R A;  3VPQ A;  2GZZ A;  3W8S A;  1N2A A;  3ERF A;  1OC8 A;  3H1N A;  3J7Y k;  1JHB A;  4G10 A;  3BD2 A;  1TW9 A;  3L9V A;  5L71 A;  5EPF A;  2XHF A;  3GST A;  4IQA A;  1SD8 A;  4ML1 A;  5IIZ A;  4KGI A;  1ST9 A;  2YP6 A;  4QL9 A;  2A4V A;  6GSW A;  5B8B A;  1OKT A;  3HJM A;  2KP2 A;  4ACS A;  1EOG A;  2WRT A;  5A4U A;  3IAS 2;  4MZB A;  4HDE A;  2FNO A;  2WUL A;  2IMD A;  2NPB A;  4E8E A;  2DJ3 A;  2LJK A;  4EUY A;  3RPP A;  3KXO A;  4OO5 A;  5EVO A;  5DQS A;  4Q5N A;  1DSB A;  3FZ5 A;  4IJ3 A;  1S3D A;  5JCG A;  2FWG A;  2TRX A;  3FW2 A;  2IN3 A;  2JL4 A;  4K0N A;  1GH2 A;  1DE2 A;  2YPM A;  1M9A A;  2G2Q A;  4HI7 A;  3KD0 A;  4JRR A;  1GUL A;  2JSY A;  1GTI A;  5CAX A;  2VM1 A;  3LJR A;  4N10 A;  1FB0 A;  3CTF A;  2HE3 A;  1T3B A;  1ABA A;  2FHE A;  5D9X A;  3GYK A;  1B9Y C;  3KH7 A;  2IFQ A;  4EVM A;  3EWL A;  3O6T A;  2LJA A;  4EL1 A;  4TRX A;  1EEJ A;  5ECS A;  1F3B A;  3TKR A;  1NHY A;  1Q4J A;  1XW9 A;  1EWX A;  3LOR A;  1Z7R A;  2OKA A;  3QFA C;  1T8E B;  2OE0 A;  5E4W A;  1FAA A;  1M0U A;  2VL2 A;  3F6F A;  3APQ A;  1HD2 A;  3E9J B;  3P8W A;  4IBP A;  3F0I A;  2R2J A;  4V2N A;  1V2A A;  4H86 A;  3DEX A;  3F4T A;  1YDK A;  4PXO A;  4I2U A;  2GT6 A;  3KJY A;  1TRS A;  2PPT A;  2F9S A;  4ILF A;  1TU7 A;  3LFL A;  3IA1 A;  5DCG A;  2C3N A;  3GV1 A;  4K7I A;  3VI7 A;  2JSZ A;  4IEL A;  5EY6 A;  4FYU A;  4I2T A;  1M99 A;  3ZZX A;  5IQY A;  4ULX A;  5IMV A;  2J23 A;  4YQM A;  1ERT A;  1XOB A;  4LMV A;  3E3E A;  3IV4 A;  5AGY A;  1GUH A;  4TN8 A;  3TJJ A;  5JWR B;  1THO A;  2B3S A;  5ECO B;  4JZQ A;  2O89 A;  3D4T A;  3W6G A;  1J0F A;  3MDK A;  1XWK A;  4IJI A;  1CQG A;  4ZIJ A;  2PWJ A;  2DJJ A;  2RUF A;  4ZBA A;  2LV3 A;  2IFQ B;  3GA4 A;  4MF7 A;  4Q5Q A;  2M46 A;  1T1V A;  4IKH A;  5ECN B;  2CVK A;  6GSU A;  4FH8 A;  5HR2 A;  1PGT A;  4KND A;  3HKR A;  6GSY A;  1AUC A;  3GUR A;  3AY8 A;  4TR1 A;  4DSR A;  2X64 A;  1S3A A;  3LXT A;  1MDJ A;  3U6V A;  2YJH A;  4AGS A;  2B5Y A;  1TJD A;  3Q74 A;  2YV9 A;  4G19 A;  1U87 A;  2R4V A;  4WF5 A;  1ERW A;  5HQP A;  4ZIL A;  3OR5 A;  4KAE A;  5HR3 A;  2IPA A;  2VAF A;  1IYI A;  1K3L A;  4FO5 A;  5J41 A;  1B9X C;  5CRW A;  2EIO A;  1SD9 A;  1TP9 A;  5CP1 A;  3G7I A;  4KDU A;  2FY6 A;  2YCD A;  1GSU A;  4O32 A;  4YAP A;  1FG4 A;  3HXS A;  1M2A A;  4P3Y B;  1H75 A;  20GS A;  4Q5R A;  5ECQ B;  10GS A;  2EIR A;  3EE2 A;  2YWO A;  4MP4 A;  2WDU A;  2NVL A;  2PMT A;  1F37 A;  2CX3 A;  2V41 A;  3IPZ A;  3DYR A;  1ERU A;  1XWC A;  5D9T A;  2YJ7 A;  2CT6 A;  5D96 A;  1F2E A;  3CXG A;  4GF0 A;  2LRN A;  3VWW A;  1ZCP A;  4F0C A;  11GS A;  3CSI A;  2LUS A;  5ID2 A;  3DXB A;  3RBT A;  5C04 A;  2L4C A;  4I5Q A;  1JLV A;  4TR1 B;  7GSS A;  5G5F A;  1GNW A;  3FHK A;  4IVF A;  6GSV A;  4ZBD A;  1FVJ A;  3NOF A;  5F05 A;  4EC0 A;  1PKW A;  5GSS A;  4KX4 A;  5B6M A;  1XVQ A;  1I9D A;  1FOV A;  2YAN A;  4MZW A;  1BYE A;  3QOU A;  2R5G A;  1TU8 A;  5IOX A;  5ECL B;  5A4W A;  1ZGN A;  5F8B A;  1VRS D;  3TRQ A;  4GRF A;  3FKF A;  3QAV A;  3LXZ A;  4KH7 A;  3QAG A;  1AIU A;  3UOM A;  1TTZ A;  3FY7 A;  4JR6 A;  2VL9 A;  1XOA A;  3MWH A;  1U88 A;  2G0F A;  4K1F A;  1OE7 A;  3GKK A;  2C0G A;  1TK5 B;  3GL3 A;  3FZ9 A;  3C73 A;  2DJ2 A;  3HHV A;  1SJI A;  5FT3 A;  1THX A;  5KEJ A;  5DJL A;  2B7J A;  3UVH A;  4GCI A;  2H75 A;  19GS A;  4PGT A;  5ID2 B;  1X9S B;  5F07 A;  1XW5 A;  2P0G A;  2DIY A;  4E8H A;  2HFD A;  1Z6M A;  4ZL9 A;  4GQF A;  2LS5 A;  4MH2 A;  1VGL A;  4MZC A;  4I97 A;  3TCO A;  2HZE A;  1E2Y A;  2VCT A;  3G9B A;  4F82 A;  2R6K A;  2E0Q A;  3LYP A;  1YKC A;  3DVX A;  1XIY A;  4BWQ A;  4KW6 A;  1O85 A;  1S3C A;  1O73 A;  1R5A A;  1R7H A;  1E6B A;  1Y6E A;  2MMZ A;  2CAQ A;  1AQV A;  2FGX A;  1KEB A;  2KOK A;  1V58 A;  2L59 A;  4MJE A;  5EL8 A;  5GAN D;  5A4V A;  1I5G A;  4F0B A;  1PX6 A;  2J9H A;  3PIN A;  2DML A;  2H01 A;  2VD1 A;  3ZIJ A;  4CHS A;  5HR1 A;  3ZYW A;  5DQY A;  1YKA A;  4KSO A;  3HJP A;  3HVX A;  1WWJ A;  2DIZ A;  3D22 A;  3IAM 2;  4TR3 A;  3DML A;  2ZUP A;  1ERV A;  4IP1 A;  3TJK A;  1K0D A;  4KCA A;  4YH2 A;  4L5L A;  2QSI A;  4GSS A;  5CRE A;  3CSJ A;  4LL1 B;  2VL3 A;  4KCE A;  4EXJ A;  2GSQ A;  5DAK B;  1U3I A;  2LNS A;  1XW6 A;  3BOA A;  1N8J A;  2OAD A;  3BCK A;  3FR3 A;  4POK A;  3DD3 A;  1A0R P;  3G7J A;  1T7P B;  2KUC A;  3M0F A;  2HZE B;  4MPF A;  2AAW A;  1XWB A;  1KNG A;  4HOJ A;  3GX0 A;  2VLT A;  3LSZ A;  4ECB A;  3KTL A;  2M80 A;  2C0F A;  3HZ8 A;  1NW2 A;  3HVS A;  3CYN A;  1A24 A;  2V1M A;  4RI6 A;  2HSY A;  2PN8 A;  1ZYE A;  1HYU A;  1HNC A;  4X43 A;  3KTB A;  5DCH A;  2AB6 A;  1FW1 A;  2FWF A;  4PNG A;  4GSN A;  5J3R A;  2CZ3 A;  3HY2 A;  2DSA A;  1LU4 A;  1AQW A;  3KP9 A;  2CVB A;  1TKD B;  2CZ2 A;  1XFL A;  5E59 A;  4HJ2 A;  4OFT A;  4KDY A;  3WGX A;  2CQ9 A;  1RK4 A;  3HD5 A;  3F63 A;  5H5S A;  2IWT A;  3VI5 A;  4KDX A;  2OJL A;  2VCQ A;  3TB2 A;  1QGV A;  3GN3 A;  1AW9 A;  1PKZ A;  4AF2 A;  2N5F A;  3L0H A;  3ZVJ D;  4K9Z A;  2GLR A;  1SKW B;  1X9M B;  2XPE A;  2CA8 A;  2M72 A;  3KZQ A;  1SU9 A;  1X5C A;  5J9C A;  1VF3 A;  4LMW A;  5CYY A;  1Z9H A;  1QXH A;  4O7H A;  2HSH A;  2GQK A;  4G2E A;  3UEM A;  1YEX A;  5JCW A;  3LYK A;  4OWY A;  5C00 A;  1EV4 A;  1GL8 A;  3WT1 A;  3A2W A;  3ED3 A;  2H71 A;  2AV4 A;  1M2B A;  3US3 A;  3ZRE A;  2L5L A;  2VO4 A;  1O8X A;  1FHE A;  3D21 A;  1A8L A;  3M9K A;  4K2D A;  3WGD A;  4KSM A;  3GKN A;  2YNX A;  1SK0 A;  1GP1 A;  2B1L A;  3ZL5 A;  4V1A g;  3D0Z A;  4TW5 A;  4IP6 A;  1ON4 A;  4K6X A;  1XCC A;  1HNB A;  3FEU A;  2P5Q A;  3C71 A;  3DWV A;  1O6J A;  1MEK A;  2P31 A;  1TK0 B;  1WIK A;  3UBK A;  3IK9 A;  2HI7 A;  4D73 A;  2H72 A;  5FHI A;  4ZL7 A;  3CMI A;  2B5X A;  1TRW A;  1AC1 A;  2X8H A;  1Z3E A;  2YWN A;  2CVD A;  12GS A;  3IC4 A;  3ZLP A;  1HNA A;  2VCV A;  3EU4 A;  5D93 A;  1WPI A;  1XBS A;  1PSQ A;  3UBL A;  4POL A;  2VL2 C;  5GST A;  3UVT A;  3GIX A;  2B6M A;  2H0G A;  2GS3 A;  1K3O A;  5KN1 A;  4OFN A;  1JZR A;  1K3Y A;  3I43 A;  3LEF A;  5JWO B;  2C0D A;  3F3R A;  5LD0 A;  4IGJ A;  3IR4 A;  1SEN A;  5DBQ A;  3APS A;  3GRX A;  2LJR A;  4KE3 A;  4V2L A;  1ILO A;  5AIV A;  1ZMA A;  18GS A;  2KP1 A;  2QKE A;  2OE1 A;  1GRX A;  2ZCT A;  4LL4 B;  2DJK A;  2H76 A;  4HJM A;  3LGC A;  2FD3 A;  1M2D A;  3I69 A;  5IO2 A;  1U3A A;  4V2M A;  4D73 B;  4JU5 A;  4AJ6 A;  3EU3 A;  2GGT A;  3QR6 A;  2YN1 A;  2VLV A;  2OA7 A;  3QAW A;  4MK3 A;  3EIN A;  1QFN A;  1JFU A;  3WGE A;  4LLR A;  4ZB6 A;  2C0E A;  1AXD A;  2MMN A;  1MDK A;  3O3T A;  2FLS A;  4MA9 A;  2FCH A;  3RHB A;  4WR4 A;  2XBQ A;  1V98 A;  4POM A;  5ECH B;  2C3T A;  2BJX A;  2HNL A;  1G6W A;  4F9Z A;  1CQH A;  3KMN A;  5ELG A;  3P2A A;  1PQN A;  2HT9 A;  4TXV A;  4X1U A;  4PNF A;  4V1A p;  2F3M A;  3HVV A;  2H66 A;  1USB A;  2HXK A;  2RM6 A;  1YEP A;  3S9F A;  3VPT A;  2GQM A;  2WS2 A;  5IM9 A;  1C72 A;  1EOH A;  4YQU A;  5JCU A;  3F4R A;  1V57 A;  2F8A A;  1PMT A;  1EV9 A;  2L5O A;  1YZX A;  1EEM A;  4GQC A;  1UA5 A;  3TRX A;  2LKU A;  2HYX A;  1JLW A;  3TKQ A;  3IK7 A;  4ZXG A;  2PER A;  4WBR D;  1Y25 A;  1WJK A;  2K18 A;  2ON5 A;  1SYR A;  5G2Z A;  4NV5 A;  1DBY A;  5IMF A;  2XC2 A;  2VM2 A;  2PVQ A;  4N11 A;  3DVW A;  2IMF A;  4JE1 A;  3Q19 A;  4TR0 A;  3TUE A;  3P7X A;  4QL7 A;  3NIV A;  3IHQ A;  2C8U A;  2Z9S A;  1URM A;  2X8G A;  1W4V A;  4GST A;  2QC7 A;  1YF1 A;  4TXO A;  3NZN A;  4ZL8 A;  1K0O A;  1SKR B;  1K0B A;  2GSS A;  4HQZ A;  3ERG A;  3VK9 A;  5LNK e;  2V32 A;  4WEY A;  3ZML A;  8GSS A;  2AYT A;  4J57 E;  3D4M A;  4BA7 A;  3GSS A;  3M1G A;  2LQO A;  2QGV A;  1WMJ A;  2NDO A;  2ALB A;  1OE8 A;  5HFI A;  1DUG A;  5HR0 A;  1ACV A;  3TOU A;  17GS A;  3GFK A;  2K9F A;  3IDV A;  1JZW A;  2LEG A;  2VIM A;  1EGR A;  3WT2 A;  5B6N A;  3L4N A;  1MDI A;  3W8J A;  2F8F A;  4AJ8 A;  2IIY A;  4HU7 A;  4MAB A;  1GSE A;  2PVO C;  2H6Y A;  5ECI B;  3M8N A;  4N0Z A;  4ECI A;  2GT5 A;  3C1R A;  2WFC A;  1T4Z A;  1TXX A;  2K6V A;  3RAZ A;  5DAK A;  3N9J A;  4HUA A;  4X0X A;  4TXO B;  2O87 A;  4BPY A;  1F6M C;  5G5E A;  5KN0 A;  2JZR A;  1WRY A;  2ZNM A;  3WYW A;  5D9V A;  4ZBB A;  2HRF A;  2A2R A;  1G0T A;  5IPG A;  2IJY A;  3A3T A;  3UL3 A;  5B8A A;  4XS6 A;  1XPV A;  1VF1 A;  2REM A;  4ID0 A;  2DBC A;  3RPN A;  1X5D A;  1JZD A;  2MZC A;  3G7Y A;  4ISD A;  3FZA A;  1LBK A;  2LQQ A;  4PQH A;  1XVW A;  2ES7 A;  4K7O A;  1O81 A;  4IHU A;  5J5N A;  2GQL A;  4F03 A;  5ECM B;  4GWR A;  4L8E A;  4MH3 A;  3MSZ A;  4CDO A;  2OBI A;  3RHC A;  2KLX A;  2O8V B;  2LTK A;  4FIW A;  5B7C A;  1O8W A;  2EIQ A;  4CW9 A;  2N5B A;  4ZB8 A;  4BWS A;  1B48 A;  3FR9 A;  1R26 A;  1NSW A;  2R3X A;  2JU5 A;  1Q98 A;  2PUK C;  2I1U A;  2DC5 A;  1MD3 A;  3C8E A;  1M9B A;  3LQ7 A;  2X8C A;  3K8N A;  2WGR A;  3D5J A;  4TR4 A;  3GH6 A;  3F8U A;  3CRU A;  5INY A;  3HJO A;  2O85 A;  3TGZ A;  5DJM A;  4XHM A;  3ZMK A;  1TOF A;  1Z5Y E;  3U5R E;  2JAD A;  1IYH A;  1V40 A;  1BAY A;  5F06 A;  3HYP A;  4I6X A;  1A2J A;  1VF2 A;  2GTU A;  2H1G A;  3QMX A;  4NPB A;  5IMC A;  3EMP A;  2A2S A;  1GSD A;  4DVC A;  3O76 A;  2E2G A;  2IME A;  1K0A A;  2NBS A;  4PUA A;  3SBC A;  1G6Y A;  3ZIV A;  2FWE A;  1XWA A;  2EC4 A;  5COH A;  2GDR A;  1EGO A;  2MBS A;  4NWY A;  13GS A;  1M7T A;  5G31 A;  2C4J A;  1TK8 B;  1WE0 A;  2VCX A;  4HQS A;  3GNJ A;  2H0I A;  1GSQ A;  2OE3 A;  1SL1 B;  2GZY A;  2I4A A;  4FYC A;  4WR5 A;  3ME8 A;  2RUE A;  2H19 A;  6GSS A;  14GS A;  4K8M A;  1AAZ A;  5J4U A;  2HZF A;  1MTC A;  4EE0 A;  3EMX A;  1UC7 A;  2FWH A;  3FR6 A;  4GTU A;  3DKS A;  2GZP A;  5H5R A;  3VWX A;  3KCM A;  3V1W A;  4IW9 A;  2JAC A;  3QCP A;  2YWI A;  1RQM A;  3KM6 A;  2CV4 A;  4WXT A;  1GUM A;  4NXI A;  4XS4 A;  2NTO A;  5CRD A;  2K8V A;  22GS A;  4PUR A;  2IMK A;  3PGT A;  2WB9 A;  4Z7X A;  3KH9 A;  4HEA 2;  1GUK A;  1A0F A;  4EF0 A;  3QPM A;  4GLT A;  4RI7 A;  5IOW A;  5G30 A;  2H1B A;  1ML6 A;  5G1K A;  1EP7 A;  1FO5 A;  3JCM L;  3PR8 A;  5J9B A;  1WOU A;  2KHP A;  3TKP A;  5IMD A;  5GAP D;  2TRC P;  1G7E A;  4N30 A;  1AQX A;  4RQX A;  4WET A;  2XBI A;  3J7Y b;  5ECP B;  3VWU A;  3BJ5 A;  2PU9 C;  5AN1 A;  3ME7 A;  1DE1 A;  3GTU A;  3ZFL A;  2FUG 2;  1OKD A;  2RM5 A;  5ELA A;  3Q6O A;  5IO0 A;  1T00 A;  1GTU A;  3GKM A;  3KIJ A;  6GST A;  2WCI A;  4K7N A;  3GH9 A;  4K0G A;  2IMI A;  3C7M A;  5ABR A;  4NMU A;  1G7O A;  4XS4 B;  1SJ6 A;  4J2F A;  1PL2 A;  3A2X A;  3QFB C;  2WZ9 A;  2H0H A;  4KUN A;  2H74 A;  1V9W A;  1KBN A;  3WD6 A;  2V2G A;  4XCS A;  5KN2 A;  2DJ0 A;  3I6A A;  4KA0 A;  1GNE A;  4OMV A;  5H5Q A;  4LA1 A;  1SL0 B;  1X0R A;  5F0G A;  4DSQ A;  3TOT A;  1SL2 B;  1QQ2 A;  4KB3 A;  1R5P A;  4TOP A;  1NHO A;  2I81 A;  3LG6 A;  3IRA A;  3UIW A;  2K8S A;  3DRN A;  2MYG A;  2N5A A;  2LRT A;  1BJX A;  3M9J A;  2JZS A;  4EO3 A;  1BQ7 A;  2OBK A;  5DVB A;  2ON7 A;  1TI3 A;  3ZFB A;  3UMA A;  5IMA A;  3KEB A;  1X9W B;  3N5O A;  2L57 A;  3GUS A;  1ZL9 A;  2H1D A;  1A2M A;  3M3M A;  4TKY A;  1ZOF A;  1GLP A;  4F2I A;  3GTU B;  1GSF A;  4HZ2 A;  2HLS A;  5CO3 A;  3FK8 A;  4NHZ A;  1XWG A;  3VWV A;  3H93 A;  4MJC A;  2H30 A;  3PH9 A;  2PGT A;  3ZIT A;  4MLY A;  2B1K A;  2MBT A;  3VFI A;  5ENU A;  4JED A;  4OCF A;  2C1Y A;  2B7K A;  3RDW A;  5LCZ A;  3TJF A;  3R2Q A;  4WBJ A;  4ZB9 A;  4EDY A;  5GZZ B;  1BG5 A;  2C80 A;  3F3Q A;  2D2Z A;  3TRP A;  1SK1 A;  1GLQ A;  4WKW A;  3ZTL A;  3F4S A;  2H6Z A;  3EYT A;  1SJZ A;  4QQ7 A;  3HA9 A;  2FA4 A;  3FYG A;  2R37 A;  4RUV A;  1PRX A;  4YQV A;  3IOS A; 
#chains in the Genus database with same CATH topology
 2JZT A;  4PQI A;  1QMV A;  2DJ1 A;  1TRV A;  1FB6 A;  5ECR B;  4HZ4 A;  4GXZ A;  3SWL A;  2CX4 A;  5G1L A;  5HFK A;  2PBJ A;  2E2M A;  3UAR A;  5FWG A;  3ZRD A;  2VOC A;  3H79 A;  1H4O A;  1QUW A;  4IS0 A;  4I8B A;  3TDG A;  1YJ6 A;  4NV2 A;  1OAZ A;  2DMM A;  2LNT A;  1ZYQ B;  2XPD A;  1UVZ A;  1A8Y A;  3KP8 A;  3BCI A;  3DGQ A;  4FYB A;  6GSX A;  2VUP A;  2OAC A;  1TI1 A;  1KTE A;  2GVP A;  3HDC A;  1F3A A;  1U6T A;  2VCW A;  3CBU A;  4DSS A;  1O7U A;  2DLX A;  4OD7 A;  3ISO A;  5AIS A;  5ECK B;  2CAI A;  4L0W A;  4NAX A;  3HZ4 A;  2AJQ B;  2BTO T;  2O7K A;  2VLU A;  5IPH A;  2RLI A;  2LST A;  2IL3 A;  2YZH A;  5D8I A;  2GST A;  1HQO A;  2C3Q A;  5DDL A;  3F6D A;  1SKS B;  5KN3 A;  1OYJ A;  3A2V A;  2AUV A;  1X5E A;  1LJR A;  4MCU A;  1ZZY A;  2I9H A;  3EC3 A;  5KOW A;  4POB A;  4BVY A;  3R3E A;  1OVN A;  2V6K A;  3TJG A;  4G9H A;  1K0C A;  4OO4 A;  1XZO A;  3GHA A;  2X99 A;  1EP8 A;  1Z7P A;  4XS1 A;  4L5O A;  1GSY A;  1TDI A;  4NHW A;  4JBB A;  4MF6 A;  2TIR A;  3IBH A;  4OCE A;  2L6C A;  3VLN A;  2B5E A;  2AHE A;  4J56 E;  3CSH A;  1Z6N A;  2E7P A;  1PL1 A;  3L9U A;  3F9U A;  4BVX A;  3QD9 A;  1RW1 A;  1MD4 A;  3Q18 A;  3A5W A;  4DSS B;  4MF5 A;  1J9B A;  3DIE A;  3GX8 A;  2F51 A;  9GSS A;  2HSM A;  1VF4 A;  5CRG A;  1SK2 A;  2DKI A;  3FZ4 A;  4HS1 A;  5IMZ A;  2H6X A;  1PA3 A;  1OC9 A;  5AIX A;  1TRU A;  4XTS A;  3CTG A;  1R4W A;  4MJB A;  1B4Q A;  4HU9 A;  3MYD A;  4DEJ A;  3C1S A;  2MMA A;  1K0N A;  4RQR A;  4EDZ A;  1B8X A;  1GSS A;  2GSR A;  1UN2 A;  4OFM A;  4ML6 A;  2YV7 A;  4YAV A;  1YQ1 A;  3KGK A;  3KMO A;  4BVY B;  3D6I A;  2RII A;  3I9V 2;  5DAL A;  1NM3 A;  4AJ7 A;  4Z2U A;  3TKS C;  3VUR A;  3APO A;  3TKS A;  2YZU A;  16GS A;  1T4Y A;  3E0U A;  3L9S A;  3BBY A;  3L78 A;  2H73 A;  1XXU A;  5JWQ B;  2WJU A;  2YWM A;  1EZK A;  1WP0 A;  3QDN A;  4JR4 A;  4BVX B;  3H8Q A;  1GTA A;  3GMF A;  1A23 A;  4XIH A;  2HRA A;  5D9W A;  2L6D A;  1J08 A;  3EVI A;  4O92 A;  1JZO A;  4Q5F A;  4WF4 A;  3HCZ A;  2L4Q A;  4TVE A;  1BX9 A;  3LWA A;  1OC9 B;  4PX1 A;  2H1A A;  3ZVJ A;  5A5K A;  1YY7 A;  1OC3 A;  3HVN A;  1YF0 A;  1GTB A;  2H8L A;  4L0U A;  3MNG A;  2HRN A;  2MMO A;  1B4P A;  4XRD A;  3MIX A;  4EKZ A;  1PX7 A;  4IQ1 A;  3UJ1 A;  3GL5 A;  2BMX A;  1PN9 A;  4K5R A;  2FA8 A;  3IE3 A;  4N0V A;  2VCZ A;  2VD0 A;  4PQ1 A;  1FVK A;  3TKS E;  3UAP A;  5DAL B;  4ECJ A;  5HFG A;  3H4K A;  3ERW A;  3P90 A;  2R0P A;  4PUF C;  4BL7 A;  1GWC A;  3FRC A;  2V6O A;  1A2L A;  1QK8 A;  3EUR A;  1K0M A;  1F9M A;  3IXR A;  3TJB A;  1PD2 1;  2P5R A;  4MDC A;  4MJA A;  2I3Y A;  4ECC A;  2LRC A;  3MAK A;  4MPG A;  2YOI A;  1W89 A;  5D73 A;  3CRT A;  4XRA A;  4IN0 A;  2H70 A;  5CRH A;  4EIQ A;  3GKX A;  1SYX A;  5CNW A;  4MMM A;  1BED A;  4O5R A;  3VPQ A;  2GZZ A;  3W8S A;  1N2A A;  3ERF A;  1OC8 A;  3H1N A;  3J7Y k;  1JHB A;  4G10 A;  3BD2 A;  1TW9 A;  3L9V A;  4YKG A;  5L71 A;  5EPF A;  2XHF A;  3GST A;  4IQA A;  1SD8 A;  4ML1 A;  5IIZ A;  4KGI A;  1ST9 A;  2YP6 A;  4QL9 A;  2A4V A;  6GSW A;  4BL7 B;  5B8B A;  1OKT A;  2A4H A;  3HJM A;  2KP2 A;  4ACS A;  1EOG A;  2WRT A;  5A4U A;  3IAS 2;  4MZB A;  4HDE A;  2FNO A;  2R0C A;  2WUL A;  2IMD A;  2NPB A;  4E8E A;  2DJ3 A;  2LJK A;  4EUY A;  3RPP A;  3KXO A;  4OO5 A;  5EVO A;  5DQS A;  4Q5N A;  1DSB A;  3FZ5 A;  4IJ3 A;  1S3D A;  5JCG A;  2FWG A;  2TRX A;  3FW2 A;  2IN3 A;  2JL4 A;  4K0N A;  1GH2 A;  1PN0 A;  1DE2 A;  2YPM A;  1M9A A;  2G2Q A;  4A5P A;  4HI7 A;  3KD0 A;  4JRR A;  1GUL A;  2JSY A;  1GTI A;  5CAX A;  2VM1 A;  3LJR A;  4N10 A;  1FB0 A;  3CTF A;  2HE3 A;  1T3B A;  1ZYP A;  1ABA A;  2FHE A;  5D9X A;  3GYK A;  1B9Y C;  3KH7 A;  2IFQ A;  4EVM A;  3EWL A;  3O6T A;  2LJA A;  4EL1 A;  4TRX A;  1EEJ A;  5ECS A;  1F3B A;  3TKR A;  1NHY A;  1Q4J A;  1XW9 A;  1EWX A;  3LOR A;  1Z7R A;  2OKA A;  3QFA C;  1T8E B;  4USS A;  2OE0 A;  5E4W A;  1FAA A;  1M0U A;  2VL2 A;  3F6F A;  3APQ A;  1HD2 A;  3E9J B;  3P8W A;  4G0K A;  2X49 A;  4IBP A;  3F0I A;  2R2J A;  4V2N A;  1V2A A;  4H86 A;  3DEX A;  3F4T A;  1YDK A;  4PXO A;  4I2U A;  2GT6 A;  3KJY A;  1TRS A;  2PPT A;  2F9S A;  4ILF A;  1TU7 A;  3LFL A;  3IA1 A;  5DCG A;  2C3N A;  3GV1 A;  4K7I A;  3VI7 A;  2JSZ A;  4IEL A;  5EY6 A;  4K2X A;  4FYU A;  4I2T A;  1M99 A;  3ZZX A;  5IQY A;  4YKF A;  4EIP A;  4ULX A;  5IMV A;  2J23 A;  4YQM A;  1ERT A;  2QA1 A;  2R0G A;  1XOB A;  4LMV A;  3E3E A;  3IV4 A;  4ICY A;  5AGY A;  1GUH A;  4TN8 A;  3TJJ A;  5JWR B;  1THO A;  2B3S A;  5ECO B;  4JZQ A;  2O89 A;  3D4T A;  3W6G A;  1J0F A;  3MDK A;  1XWK A;  4IJI A;  1CQG A;  4ZIJ A;  2PWJ A;  2DJJ A;  2RUF A;  4ZBA A;  2LV3 A;  2IFQ B;  3GA4 A;  4MF7 A;  4Q5Q A;  2M46 A;  1T1V A;  4IKH A;  5ECN B;  2CVK A;  6GSU A;  4FH8 A;  5HR2 A;  1PGT A;  4KF9 A;  4KND A;  3HKR A;  6GSY A;  1AUC A;  3GUR A;  3AY8 A;  4TR1 A;  4DSR A;  2X64 A;  1S3A A;  3LXT A;  1MDJ A;  5BMU A;  3U6V A;  2YJH A;  4AGS A;  2B5Y A;  1TJD A;  3Q74 A;  4Z2R A;  2YV9 A;  4G19 A;  1U87 A;  2R4V A;  4WF5 A;  1ERW A;  5HQP A;  4ZIL A;  3OR5 A;  4KAE A;  5HR3 A;  2IPA A;  2VAF A;  1IYI A;  1K3L A;  4FO5 A;  5J41 A;  1B9X C;  5CRW A;  2EIO A;  1SD9 A;  1TP9 A;  5CP1 A;  3G7I A;  4KDU A;  2FY6 A;  2YCD A;  1GSU A;  4O32 A;  4YAP A;  1FG4 A;  3HXS A;  1M2A A;  4P3Y B;  1H75 A;  20GS A;  4Q5R A;  5ECQ B;  10GS A;  2EIR A;  3EE2 A;  2YWO A;  4MP4 A;  2WDU A;  2NVL A;  2PMT A;  1F37 A;  2CX3 A;  2V41 A;  3IPZ A;  3DYR A;  1ERU A;  1XWC A;  5D9T A;  2YJ7 A;  2CT6 A;  5D96 A;  1F2E A;  3CXG A;  4GF0 A;  2LRN A;  3VWW A;  1ZCP A;  4F0C A;  11GS A;  3CSI A;  2LUS A;  5ID2 A;  3DXB A;  3RBT A;  5C04 A;  2L4C A;  4I5Q A;  1JLV A;  4TR1 B;  7GSS A;  5G5F A;  1GNW A;  3FHK A;  4IVF A;  6GSV A;  4ZBD A;  1FVJ A;  3NOF A;  5F05 A;  4EC0 A;  1PKW A;  5GSS A;  4KX4 A;  3FMW A;  3IHG A;  5B6M A;  1XVQ A;  1I9D A;  1FOV A;  2YAN A;  4MZW A;  1BYE A;  3QOU A;  1M3J A;  2R5G A;  1TU8 A;  5IOX A;  5ECL B;  5A4W A;  1ZGN A;  5F8B A;  1VRS D;  3TRQ A;  4GRF A;  3FKF A;  3LW9 A;  3QAV A;  3LXZ A;  4KH7 A;  3QAG A;  1AIU A;  3UOM A;  1TTZ A;  3FY7 A;  4JR6 A;  2VL9 A;  1XOA A;  3MWH A;  1U88 A;  2G0F A;  4K1F A;  1OE7 A;  3GKK A;  2C0G A;  1TK5 B;  3GL3 A;  3PPU A;  3FZ9 A;  4CY8 A;  4MNN A;  3C73 A;  2DJ2 A;  3HHV A;  1SJI A;  2A2P A;  5FT3 A;  1THX A;  5KEJ A;  5DJL A;  2UZ8 A;  2B7J A;  3UVH A;  4GCI A;  2H75 A;  19GS A;  4PGT A;  5ID2 B;  1X9S B;  5F07 A;  1XW5 A;  2P0G A;  2DIY A;  4E8H A;  2HFD A;  1Z6M A;  4ZL9 A;  4GQF A;  2LS5 A;  4MH2 A;  1VGL A;  4MZC A;  4I97 A;  3TCO A;  2HZE A;  1E2Y A;  2VCT A;  3G9B A;  4F82 A;  2R6K A;  2E0Q A;  3LYP A;  1YKC A;  3DVX A;  1XIY A;  4BWQ A;  4KW6 A;  1O85 A;  1S3C A;  1O73 A;  1R5A A;  1R7H A;  1E6B A;  1Y6E A;  2MMZ A;  2CAQ A;  1AQV A;  2FGX A;  1KEB A;  2KOK A;  1V58 A;  2L59 A;  4MJE A;  5EL8 A;  5GAN D;  5A4V A;  1I5G A;  4F0B A;  1PX6 A;  2J9H A;  3PIN A;  2DML A;  2H01 A;  5KOX A;  2VD1 A;  3ZIJ A;  4CHS A;  5HR1 A;  3ZYW A;  5DQY A;  1YKA A;  4KSO A;  3HJP A;  3HVX A;  1WWJ A;  2DIZ A;  3D22 A;  3IAM 2;  4TR3 A;  3DML A;  2ZUP A;  1ERV A;  4IP1 A;  3TJK A;  1K0D A;  4KCA A;  4YH2 A;  4L5L A;  2QSI A;  4GSS A;  5CRE A;  3CSJ A;  4LL1 B;  1M3I A;  2VL3 A;  4KCE A;  4EXJ A;  2GSQ A;  5DAK B;  1U3I A;  2LNS A;  1XW6 A;  3BOA A;  1N8J A;  2OAD A;  3BCK A;  3FR3 A;  4POK A;  3DD3 A;  1A0R P;  3G7J A;  1T7P B;  2KUC A;  3M0F A;  2HZE B;  4MPF A;  2AAW A;  1XWB A;  1KNG A;  4HOJ A;  3GX0 A;  2VLT A;  3LSZ A;  4ECB A;  3KTL A;  2M80 A;  2C0F A;  3HZ8 A;  1NW2 A;  3HVS A;  3CYN A;  4G0I A;  1A24 A;  2V1M A;  4RI6 A;  2HSY A;  2PN8 A;  1ZYE A;  1HYU A;  1HNC A;  4PTS A;  4X43 A;  3KTB A;  5DCH A;  2AB6 A;  1FW1 A;  2FWF A;  4PNG A;  4GSN A;  5J3R A;  2CZ3 A;  3HY2 A;  2DSA A;  1LU4 A;  1AQW A;  3KP9 A;  2CVB A;  1TKD B;  2CZ2 A;  1XFL A;  5E59 A;  4HJ2 A;  4OFT A;  4KDY A;  3WGX A;  2CQ9 A;  1RK4 A;  3HD5 A;  3F63 A;  5H5S A;  1ZYN A;  2IWT A;  3VI5 A;  4KDX A;  2OJL A;  2VCQ A;  3TB2 A;  1QGV A;  3GN3 A;  1AW9 A;  1PKZ A;  4AF2 A;  2N5F A;  3L0H A;  3ZVJ D;  4K9Z A;  2GLR A;  1SKW B;  1X9M B;  2XPE A;  2CA8 A;  2M72 A;  3KZQ A;  1SU9 A;  1X5C A;  5J9C A;  1VF3 A;  4LMW A;  5CYY A;  1Z9H A;  4X4J A;  1QXH A;  4O7H A;  2HSH A;  2GQK A;  4G2E A;  3UEM A;  1YEX A;  5JCW A;  3LYK A;  4OWY A;  5C00 A;  1EV4 A;  1GL8 A;  3WT1 A;  3A2W A;  3ED3 A;  2H71 A;  2AV4 A;  1M2B A;  3US3 A;  3ZRE A;  2L5L A;  2VO4 A;  1O8X A;  1FHE A;  3D21 A;  1A8L A;  3M9K A;  4K2D A;  3WGD A;  4KSM A;  3GKN A;  2YNX A;  1SK0 A;  1GP1 A;  2B1L A;  3ZL5 A;  4V1A g;  3D0Z A;  4TW5 A;  4IP6 A;  1ON4 A;  4K6X A;  1XCC A;  1HNB A;  3FEU A;  2P5Q A;  3C71 A;  3DWV A;  1O6J A;  1MEK A;  2P31 A;  1TK0 B;  1WIK A;  3UBK A;  3IK9 A;  2HI7 A;  4D73 A;  2H72 A;  5FHI A;  4ZL7 A;  3CMI A;  2B5X A;  1TRW A;  1AC1 A;  2X8H A;  1Z3E A;  2YWN A;  2CVD A;  12GS A;  3IC4 A;  3ZLP A;  1HNA A;  2VCV A;  3EU4 A;  5D93 A;  1WPI A;  1XBS A;  1PSQ A;  3UBL A;  4POL A;  2VL2 C;  5GST A;  3UVT A;  3GIX A;  2B6M A;  2H0G A;  2GS3 A;  1K3O A;  5KN1 A;  4OFN A;  1JZR A;  1K3Y A;  3I43 A;  3LEF A;  5JWO B;  2C0D A;  3F3R A;  5LD0 A;  4IGJ A;  3IR4 A;  1SEN A;  5DBQ A;  3APS A;  3GRX A;  2LJR A;  4KE3 A;  4V2L A;  1ILO A;  5AIV A;  1ZMA A;  18GS A;  2KP1 A;  2QKE A;  2OE1 A;  1GRX A;  2ZCT A;  4LL4 B;  2DJK A;  2H76 A;  4HJM A;  3LGC A;  2FD3 A;  1M2D A;  3I69 A;  5IO2 A;  1U3A A;  4V2M A;  4D73 B;  4JU5 A;  4AJ6 A;  3EU3 A;  2GGT A;  3QR6 A;  2YN1 A;  2VLV A;  2OA7 A;  3QAW A;  4MK3 A;  3EIN A;  1QFN A;  1JFU A;  3WGE A;  4LLR A;  4ZB6 A;  2C0E A;  1AXD A;  2MMN A;  1MDK A;  3O3T A;  2FLS A;  4MA9 A;  2FCH A;  3RHB A;  4WR4 A;  2XBQ A;  1V98 A;  4POM A;  5ECH B;  2C3T A;  2BJX A;  2HNL A;  1G6W A;  4F9Z A;  1CQH A;  3KMN A;  5ELG A;  3P2A A;  1PQN A;  2HT9 A;  4TXV A;  4X1U A;  4PNF A;  4V1A p;  2F3M A;  3HVV A;  2H66 A;  1USB A;  2HXK A;  2RM6 A;  1YEP A;  3S9F A;  3VPT A;  2GQM A;  2WS2 A;  5IM9 A;  1C72 A;  1EOH A;  4YQU A;  4K5S A;  5JCU A;  3F4R A;  1V57 A;  2F8A A;  1PMT A;  1EV9 A;  2L5O A;  1YZX A;  1EEM A;  4GQC A;  1UA5 A;  3TRX A;  2LKU A;  2HYX A;  1JLW A;  3TKQ A;  3IK7 A;  4ZXG A;  2PER A;  4WBR D;  1WJK A;  1Y25 A;  2K18 A;  4HSC X;  2ON5 A;  1SYR A;  5G2Z A;  4NV5 A;  1DBY A;  5IMF A;  2XC2 A;  2VM2 A;  2PVQ A;  4N11 A;  3DVW A;  2IMF A;  4JE1 A;  3Q19 A;  4TR0 A;  3TUE A;  3P7X A;  4QL7 A;  3NIV A;  3IHQ A;  2C8U A;  2Z9S A;  1URM A;  2X8G A;  1W4V A;  4GST A;  2QC7 A;  1YF1 A;  4TXO A;  3NZN A;  4ZL8 A;  1K0O A;  1SKR B;  1K0B A;  2GSS A;  4HQZ A;  3ERG A;  3VK9 A;  5LNK e;  2V32 A;  4WEY A;  3ZML A;  4Z2T A;  8GSS A;  2AYT A;  4J57 E;  3D4M A;  4BA7 A;  3GSS A;  3M1G A;  2LQO A;  2QGV A;  1WMJ A;  2NDO A;  2ALB A;  1OE8 A;  5HFI A;  1DUG A;  5HR0 A;  1ACV A;  3TOU A;  17GS A;  3GFK A;  2K9F A;  3IDV A;  1JZW A;  2LEG A;  2VIM A;  1EGR A;  3WT2 A;  5B6N A;  3L4N A;  1MDI A;  3W8J A;  2F8F A;  4AJ8 A;  2IIY A;  4HU7 A;  4MAB A;  1GSE A;  2PVO C;  2H6Y A;  5ECI B;  3M8N A;  4N0Z A;  4ECI A;  2GT5 A;  3C1R A;  2WFC A;  1T4Z A;  1TXX A;  2K6V A;  3RAZ A;  5DAK A;  3N9J A;  4HUA A;  4X0X A;  4TXO B;  2O87 A;  4BPY A;  1F6M C;  5G5E A;  5KN0 A;  2JZR A;  1WRY A;  2ZNM A;  3WYW A;  5D9V A;  4ZBB A;  2HRF A;  2A2R A;  1G0T A;  5IPG A;  2IJY A;  3A3T A;  3UL3 A;  5B8A A;  4XS6 A;  1XPV A;  1VF1 A;  2DKH A;  2REM A;  4ID0 A;  2DBC A;  5BRT A;  3RPN A;  1X5D A;  1JZD A;  2MZC A;  3G7Y A;  4ISD A;  3FZA A;  1LBK A;  2LQQ A;  4PQH A;  1XVW A;  2X4A A;  2ES7 A;  4K7O A;  1O81 A;  4IHU A;  5J5N A;  2GQL A;  4F03 A;  5ECM B;  4GWR A;  2QA2 A;  4L8E A;  4MH3 A;  3MSZ A;  4O5Q A;  4CDO A;  2OBI A;  3RHC A;  2KLX A;  2O8V B;  2LTK A;  4FIW A;  5B7C A;  1O8W A;  2EIQ A;  4O5U A;  4CW9 A;  2N5B A;  3IC8 A;  4ZB8 A;  4BWS A;  1B48 A;  3FR9 A;  1R26 A;  1NSW A;  2R3X A;  1PFO A;  2JU5 A;  1Q98 A;  2PUK C;  2I1U A;  2DC5 A;  1MD3 A;  3C8E A;  1M9B A;  3LQ7 A;  2X8C A;  3K8N A;  2WGR A;  3D5J A;  4TR4 A;  3GH6 A;  3F8U A;  3CRU A;  5INY A;  3HJO A;  2O85 A;  3TGZ A;  5DJM A;  4XHM A;  3ZMK A;  1TOF A;  1Z5Y E;  3U5R E;  2JAD A;  1IYH A;  1V40 A;  4G0L A;  1BAY A;  5F06 A;  3HYP A;  4I6X A;  1A2J A;  1VF2 A;  2GTU A;  2H1G A;  3QMX A;  4NPB A;  5IMC A;  3EMP A;  1FOH A;  2A2S A;  1GSD A;  4DVC A;  3O76 A;  2E2G A;  2IME A;  1K0A A;  2NBS A;  4PUA A;  3SBC A;  1G6Y A;  3ZIV A;  2FWE A;  1XWA A;  2EC4 A;  5COH A;  2GDR A;  1EGO A;  2MBS A;  4NWY A;  13GS A;  1M7T A;  5G31 A;  2C4J A;  1TK8 B;  1WE0 A;  2VCX A;  4HQS A;  3GNJ A;  2H0I A;  1GSQ A;  2OE3 A;  1SL1 B;  2GZY A;  2I4A A;  4FYC A;  4WR5 A;  3ME8 A;  2RUE A;  2H19 A;  6GSS A;  14GS A;  4K8M A;  1AAZ A;  5J4U A;  2HZF A;  1MTC A;  4EE0 A;  3EMX A;  1UC7 A;  2FWH A;  3FR6 A;  4GTU A;  3DKS A;  2GZP A;  5H5R A;  3VWX A;  3KCM A;  3V1W A;  4IW9 A;  2JAC A;  3QCP A;  2YWI A;  1RQM A;  3KM6 A;  2CV4 A;  4WXT A;  1GUM A;  4NXI A;  4XS4 A;  2NTO A;  5CRD A;  2HRK A;  2K8V A;  22GS A;  4PUR A;  2IMK A;  3PGT A;  2WB9 A;  4Z7X A;  3KH9 A;  4HEA 2;  1GUK A;  1A0F A;  4EF0 A;  3QPM A;  4GLT A;  4RI7 A;  5IOW A;  5G30 A;  2H1B A;  1ML6 A;  5G1K A;  1EP7 A;  1FO5 A;  3JCM L;  3PR8 A;  5J9B A;  1WOU A;  2KHP A;  3CQF A;  3TKP A;  5IMD A;  5GAP D;  2TRC P;  1G7E A;  4N30 A;  1AQX A;  4RQX A;  4WET A;  3EPT A;  2XBI A;  3J7Y b;  5ECP B;  1S3R A;  3VWU A;  3BJ5 A;  2PU9 C;  5AN1 A;  4FQU A;  3ME7 A;  1DE1 A;  3GTU A;  3ZFL A;  2FUG 2;  1OKD A;  2RM5 A;  5ELA A;  3Q6O A;  5IO0 A;  1T00 A;  1GTU A;  3GKM A;  3KIJ A;  6GST A;  2WCI A;  4K7N A;  3GH9 A;  4K0G A;  2IMI A;  3C7M A;  5ABR A;  4NMU A;  1G7O A;  4XS4 B;  1SJ6 A;  4J2F A;  1PL2 A;  3A2X A;  3QFB C;  2WZ9 A;  2H0H A;  4KUN A;  2H74 A;  1V9W A;  1KBN A;  3WD6 A;  2V2G A;  4XCS A;  5KN2 A;  2DJ0 A;  3I6A A;  4KA0 A;  1GNE A;  4OMV A;  5H5Q A;  4LA1 A;  1SL0 B;  1X0R A;  5F0G A;  4DSQ A;  3TOT A;  1SL2 B;  1QQ2 A;  4KB3 A;  1R5P A;  4TOP A;  1NHO A;  2I81 A;  3LG6 A;  3IRA A;  3UIW A;  2K8S A;  3DRN A;  2MYG A;  2N5A A;  2LRT A;  4BIK A;  1BJX A;  3M9J A;  2JZS A;  4EO3 A;  1XG8 A;  1BQ7 A;  2OBK A;  5DVB A;  2ON7 A;  1TI3 A;  3ZFB A;  3UMA A;  5IMA A;  3KEB A;  3A5I A;  1X9W B;  3N5O A;  2L57 A;  3GUS A;  1ZL9 A;  2H1D A;  1A2M A;  3M3M A;  4TKY A;  1ZOF A;  1GLP A;  4F2I A;  3GTU B;  1GSF A;  4HZ2 A;  2HLS A;  5CO3 A;  3FK8 A;  4NHZ A;  1XWG A;  3VWV A;  4CY6 A;  3H93 A;  4MJC A;  2H30 A;  3PH9 A;  2PGT A;  3ZIT A;  4MLY A;  2B1K A;  2MBT A;  3VFI A;  5ENU A;  4JED A;  4OCF A;  2C1Y A;  2B7K A;  3RDW A;  5LCZ A;  3TJF A;  3R2Q A;  4WBJ A;  4ZB9 A;  4EDY A;  5GZZ B;  1BG5 A;  2C80 A;  3F3Q A;  2D2Z A;  3TRP A;  1SK1 A;  1GLQ A;  4WKW A;  3ZTL A;  3F4S A;  2H6Z A;  3EYT A;  1SJZ A;  4QQ7 A;  3HA9 A;  2FA4 A;  3FYG A;  2R37 A;  4RUV A;  1PRX A;  4YQV A;  3IOS A; 
#chains in the Genus database with same CATH homology
 2JZT A;  4PQI A;  1QMV A;  2DJ1 A;  1TRV A;  1FB6 A;  5ECR B;  4HZ4 A;  4GXZ A;  3SWL A;  2CX4 A;  5G1L A;  5HFK A;  2PBJ A;  2E2M A;  3UAR A;  5FWG A;  3ZRD A;  2VOC A;  3H79 A;  1H4O A;  1QUW A;  4IS0 A;  4I8B A;  3TDG A;  1YJ6 A;  4NV2 A;  1OAZ A;  2DMM A;  2LNT A;  1ZYQ B;  2XPD A;  1UVZ A;  1A8Y A;  3KP8 A;  3BCI A;  3DGQ A;  4FYB A;  6GSX A;  2VUP A;  2OAC A;  1TI1 A;  1KTE A;  2GVP A;  3HDC A;  1F3A A;  1U6T A;  2VCW A;  3CBU A;  4DSS A;  1O7U A;  2DLX A;  4OD7 A;  3ISO A;  5AIS A;  5ECK B;  2CAI A;  4L0W A;  4NAX A;  3HZ4 A;  2AJQ B;  2BTO T;  2O7K A;  2VLU A;  5IPH A;  2RLI A;  2LST A;  2IL3 A;  2YZH A;  5D8I A;  2GST A;  1HQO A;  2C3Q A;  5DDL A;  3F6D A;  1SKS B;  5KN3 A;  1OYJ A;  3A2V A;  2AUV A;  1X5E A;  1LJR A;  4MCU A;  1ZZY A;  2I9H A;  3EC3 A;  5KOW A;  4POB A;  4BVY A;  3R3E A;  1OVN A;  2V6K A;  3TJG A;  4G9H A;  1K0C A;  4OO4 A;  1XZO A;  3GHA A;  2X99 A;  1EP8 A;  1Z7P A;  4XS1 A;  4L5O A;  1GSY A;  1TDI A;  4NHW A;  4JBB A;  4MF6 A;  2TIR A;  3IBH A;  4OCE A;  2L6C A;  3VLN A;  2B5E A;  2AHE A;  4J56 E;  3CSH A;  1Z6N A;  2E7P A;  1PL1 A;  3L9U A;  3F9U A;  4BVX A;  3QD9 A;  1RW1 A;  1MD4 A;  3Q18 A;  3A5W A;  4DSS B;  4MF5 A;  1J9B A;  3DIE A;  3GX8 A;  2F51 A;  9GSS A;  2HSM A;  1VF4 A;  5CRG A;  1SK2 A;  2DKI A;  3FZ4 A;  4HS1 A;  5IMZ A;  2H6X A;  1PA3 A;  1OC9 A;  5AIX A;  1TRU A;  4XTS A;  3CTG A;  1R4W A;  4MJB A;  1B4Q A;  4HU9 A;  3MYD A;  4DEJ A;  3C1S A;  2MMA A;  1K0N A;  4RQR A;  4EDZ A;  1B8X A;  1GSS A;  2GSR A;  1UN2 A;  4OFM A;  4ML6 A;  2YV7 A;  4YAV A;  1YQ1 A;  3KGK A;  3KMO A;  4BVY B;  3D6I A;  2RII A;  3I9V 2;  5DAL A;  1NM3 A;  4AJ7 A;  4Z2U A;  3TKS C;  3VUR A;  3APO A;  3TKS A;  2YZU A;  16GS A;  1T4Y A;  3E0U A;  3L9S A;  3BBY A;  3L78 A;  2H73 A;  1XXU A;  5JWQ B;  2WJU A;  2YWM A;  1EZK A;  1WP0 A;  3QDN A;  4JR4 A;  4BVX B;  3H8Q A;  1GTA A;  3GMF A;  1A23 A;  4XIH A;  2HRA A;  5D9W A;  2L6D A;  1J08 A;  3EVI A;  4O92 A;  1JZO A;  4Q5F A;  4WF4 A;  3HCZ A;  2L4Q A;  4TVE A;  1BX9 A;  3LWA A;  1OC9 B;  4PX1 A;  2H1A A;  3ZVJ A;  5A5K A;  1YY7 A;  1OC3 A;  1YF0 A;  1GTB A;  2H8L A;  4L0U A;  3MNG A;  2HRN A;  2MMO A;  1B4P A;  4XRD A;  3MIX A;  4EKZ A;  1PX7 A;  4IQ1 A;  3UJ1 A;  3GL5 A;  2BMX A;  1PN9 A;  4K5R A;  2FA8 A;  3IE3 A;  4N0V A;  2VCZ A;  2VD0 A;  4PQ1 A;  1FVK A;  3TKS E;  3UAP A;  5DAL B;  4ECJ A;  5HFG A;  3H4K A;  3ERW A;  3P90 A;  2R0P A;  4PUF C;  4BL7 A;  1GWC A;  3FRC A;  2V6O A;  1A2L A;  1QK8 A;  3EUR A;  1K0M A;  1F9M A;  3IXR A;  3TJB A;  1PD2 1;  2P5R A;  4MDC A;  4MJA A;  2I3Y A;  4ECC A;  2LRC A;  3MAK A;  4MPG A;  2YOI A;  1W89 A;  5D73 A;  3CRT A;  4XRA A;  4IN0 A;  2H70 A;  5CRH A;  4EIQ A;  3GKX A;  1SYX A;  5CNW A;  4MMM A;  1BED A;  4O5R A;  3VPQ A;  2GZZ A;  3W8S A;  1N2A A;  3ERF A;  1OC8 A;  3H1N A;  3J7Y k;  1JHB A;  4G10 A;  3BD2 A;  1TW9 A;  3L9V A;  4YKG A;  5L71 A;  5EPF A;  2XHF A;  3GST A;  4IQA A;  1SD8 A;  4ML1 A;  5IIZ A;  4KGI A;  1ST9 A;  2YP6 A;  4QL9 A;  2A4V A;  6GSW A;  4BL7 B;  5B8B A;  1OKT A;  2A4H A;  3HJM A;  2KP2 A;  4ACS A;  1EOG A;  2WRT A;  5A4U A;  3IAS 2;  4MZB A;  4HDE A;  2FNO A;  2R0C A;  2WUL A;  2IMD A;  2NPB A;  4E8E A;  2DJ3 A;  2LJK A;  4EUY A;  3RPP A;  3KXO A;  4OO5 A;  5EVO A;  5DQS A;  4Q5N A;  1DSB A;  3FZ5 A;  4IJ3 A;  1S3D A;  5JCG A;  2FWG A;  2TRX A;  3FW2 A;  2IN3 A;  2JL4 A;  4K0N A;  1GH2 A;  1PN0 A;  1DE2 A;  2YPM A;  1M9A A;  2G2Q A;  4A5P A;  4HI7 A;  3KD0 A;  4JRR A;  1GUL A;  2JSY A;  1GTI A;  5CAX A;  2VM1 A;  3LJR A;  4N10 A;  1FB0 A;  3CTF A;  2HE3 A;  1T3B A;  1ZYP A;  1ABA A;  2FHE A;  5D9X A;  3GYK A;  1B9Y C;  3KH7 A;  2IFQ A;  4EVM A;  3EWL A;  3O6T A;  2LJA A;  4EL1 A;  4TRX A;  1EEJ A;  5ECS A;  1F3B A;  3TKR A;  1NHY A;  1Q4J A;  1XW9 A;  1EWX A;  3LOR A;  1Z7R A;  2OKA A;  3QFA C;  1T8E B;  4USS A;  2OE0 A;  5E4W A;  1FAA A;  1M0U A;  2VL2 A;  3F6F A;  3APQ A;  1HD2 A;  3E9J B;  3P8W A;  4G0K A;  2X49 A;  4IBP A;  3F0I A;  2R2J A;  4V2N A;  1V2A A;  4H86 A;  3DEX A;  3F4T A;  1YDK A;  4PXO A;  4I2U A;  2GT6 A;  3KJY A;  1TRS A;  2PPT A;  2F9S A;  4ILF A;  1TU7 A;  3LFL A;  3IA1 A;  5DCG A;  2C3N A;  3GV1 A;  4K7I A;  3VI7 A;  2JSZ A;  4IEL A;  5EY6 A;  4K2X A;  4FYU A;  4I2T A;  1M99 A;  3ZZX A;  5IQY A;  4YKF A;  4EIP A;  4ULX A;  5IMV A;  2J23 A;  4YQM A;  1ERT A;  2QA1 A;  2R0G A;  1XOB A;  4LMV A;  3E3E A;  3IV4 A;  4ICY A;  5AGY A;  1GUH A;  4TN8 A;  3TJJ A;  5JWR B;  1THO A;  2B3S A;  5ECO B;  4JZQ A;  2O89 A;  3D4T A;  3W6G A;  1J0F A;  3MDK A;  1XWK A;  4IJI A;  1CQG A;  4ZIJ A;  2PWJ A;  2DJJ A;  2RUF A;  4ZBA A;  2LV3 A;  2IFQ B;  3GA4 A;  4MF7 A;  4Q5Q A;  2M46 A;  1T1V A;  4IKH A;  5ECN B;  2CVK A;  6GSU A;  4FH8 A;  5HR2 A;  1PGT A;  4KF9 A;  4KND A;  3HKR A;  6GSY A;  1AUC A;  3GUR A;  3AY8 A;  4TR1 A;  4DSR A;  2X64 A;  1S3A A;  3LXT A;  1MDJ A;  5BMU A;  3U6V A;  2YJH A;  4AGS A;  2B5Y A;  1TJD A;  3Q74 A;  4Z2R A;  2YV9 A;  4G19 A;  1U87 A;  2R4V A;  4WF5 A;  1ERW A;  5HQP A;  4ZIL A;  3OR5 A;  4KAE A;  5HR3 A;  2IPA A;  2VAF A;  1IYI A;  1K3L A;  4FO5 A;  5J41 A;  1B9X C;  5CRW A;  2EIO A;  1SD9 A;  1TP9 A;  5CP1 A;  3G7I A;  4KDU A;  2FY6 A;  2YCD A;  1GSU A;  4O32 A;  4YAP A;  1FG4 A;  3HXS A;  1M2A A;  4P3Y B;  1H75 A;  20GS A;  4Q5R A;  5ECQ B;  10GS A;  2EIR A;  3EE2 A;  2YWO A;  4MP4 A;  2WDU A;  2NVL A;  2PMT A;  1F37 A;  2CX3 A;  2V41 A;  3IPZ A;  3DYR A;  1ERU A;  1XWC A;  5D9T A;  2YJ7 A;  2CT6 A;  5D96 A;  1F2E A;  3CXG A;  4GF0 A;  2LRN A;  3VWW A;  1ZCP A;  4F0C A;  11GS A;  3CSI A;  2LUS A;  5ID2 A;  3DXB A;  3RBT A;  5C04 A;  2L4C A;  4I5Q A;  1JLV A;  4TR1 B;  7GSS A;  5G5F A;  1GNW A;  3FHK A;  4IVF A;  6GSV A;  4ZBD A;  1FVJ A;  3NOF A;  5F05 A;  4EC0 A;  1PKW A;  5GSS A;  4KX4 A;  3FMW A;  3IHG A;  5B6M A;  1XVQ A;  1I9D A;  1FOV A;  2YAN A;  4MZW A;  1BYE A;  3QOU A;  2R5G A;  1TU8 A;  5IOX A;  5ECL B;  5A4W A;  1ZGN A;  5F8B A;  1VRS D;  3TRQ A;  4GRF A;  3FKF A;  3LW9 A;  3QAV A;  3LXZ A;  4KH7 A;  3QAG A;  1AIU A;  3UOM A;  1TTZ A;  3FY7 A;  4JR6 A;  2VL9 A;  1XOA A;  3MWH A;  1U88 A;  2G0F A;  4K1F A;  1OE7 A;  3GKK A;  2C0G A;  1TK5 B;  3GL3 A;  3PPU A;  3FZ9 A;  4CY8 A;  4MNN A;  3C73 A;  2DJ2 A;  3HHV A;  1SJI A;  2A2P A;  5FT3 A;  1THX A;  5KEJ A;  5DJL A;  2UZ8 A;  2B7J A;  3UVH A;  4GCI A;  2H75 A;  19GS A;  4PGT A;  5ID2 B;  1X9S B;  5F07 A;  1XW5 A;  2P0G A;  2DIY A;  4E8H A;  2HFD A;  1Z6M A;  4ZL9 A;  4GQF A;  2LS5 A;  4MH2 A;  1VGL A;  4MZC A;  4I97 A;  3TCO A;  2HZE A;  1E2Y A;  2VCT A;  3G9B A;  4F82 A;  2R6K A;  2E0Q A;  3LYP A;  1YKC A;  3DVX A;  1XIY A;  4BWQ A;  4KW6 A;  1O85 A;  1S3C A;  1O73 A;  1R5A A;  1R7H A;  1E6B A;  1Y6E A;  2MMZ A;  2CAQ A;  1AQV A;  2FGX A;  1KEB A;  2KOK A;  1V58 A;  2L59 A;  4MJE A;  5EL8 A;  5GAN D;  5A4V A;  1I5G A;  4F0B A;  1PX6 A;  2J9H A;  3PIN A;  2DML A;  2H01 A;  5KOX A;  2VD1 A;  3ZIJ A;  4CHS A;  5HR1 A;  3ZYW A;  5DQY A;  1YKA A;  4KSO A;  3HJP A;  3HVX A;  1WWJ A;  2DIZ A;  3D22 A;  3IAM 2;  4TR3 A;  3DML A;  2ZUP A;  1ERV A;  4IP1 A;  3TJK A;  1K0D A;  4KCA A;  4YH2 A;  4L5L A;  2QSI A;  4GSS A;  5CRE A;  3CSJ A;  4LL1 B;  2VL3 A;  4KCE A;  4EXJ A;  2GSQ A;  5DAK B;  1U3I A;  2LNS A;  1XW6 A;  3BOA A;  1N8J A;  2OAD A;  3BCK A;  3FR3 A;  4POK A;  3DD3 A;  1A0R P;  3G7J A;  1T7P B;  2KUC A;  3M0F A;  2HZE B;  4MPF A;  2AAW A;  1XWB A;  1KNG A;  4HOJ A;  3GX0 A;  2VLT A;  3LSZ A;  4ECB A;  3KTL A;  2M80 A;  2C0F A;  3HZ8 A;  1NW2 A;  3HVS A;  3CYN A;  4G0I A;  1A24 A;  2V1M A;  4RI6 A;  2HSY A;  2PN8 A;  1ZYE A;  1HYU A;  1HNC A;  4PTS A;  4X43 A;  3KTB A;  5DCH A;  2AB6 A;  1FW1 A;  2FWF A;  4PNG A;  4GSN A;  5J3R A;  2CZ3 A;  3HY2 A;  2DSA A;  1LU4 A;  1AQW A;  3KP9 A;  2CVB A;  1TKD B;  2CZ2 A;  1XFL A;  5E59 A;  4HJ2 A;  4OFT A;  4KDY A;  3WGX A;  2CQ9 A;  1RK4 A;  3HD5 A;  3F63 A;  5H5S A;  1ZYN A;  2IWT A;  3VI5 A;  4KDX A;  2OJL A;  2VCQ A;  3TB2 A;  1QGV A;  3GN3 A;  1AW9 A;  1PKZ A;  4AF2 A;  2N5F A;  3L0H A;  3ZVJ D;  4K9Z A;  2GLR A;  1SKW B;  1X9M B;  2XPE A;  2CA8 A;  2M72 A;  3KZQ A;  1SU9 A;  1X5C A;  5J9C A;  1VF3 A;  4LMW A;  5CYY A;  1Z9H A;  4X4J A;  1QXH A;  4O7H A;  2HSH A;  2GQK A;  4G2E A;  3UEM A;  1YEX A;  5JCW A;  3LYK A;  4OWY A;  5C00 A;  1EV4 A;  1GL8 A;  3WT1 A;  3A2W A;  3ED3 A;  2H71 A;  2AV4 A;  1M2B A;  3US3 A;  3ZRE A;  2L5L A;  2VO4 A;  1O8X A;  1FHE A;  3D21 A;  1A8L A;  3M9K A;  4K2D A;  3WGD A;  4KSM A;  3GKN A;  2YNX A;  1SK0 A;  1GP1 A;  2B1L A;  3ZL5 A;  4V1A g;  3D0Z A;  4TW5 A;  4IP6 A;  1ON4 A;  4K6X A;  1XCC A;  1HNB A;  3FEU A;  2P5Q A;  3C71 A;  3DWV A;  1O6J A;  1MEK A;  2P31 A;  1TK0 B;  1WIK A;  3UBK A;  3IK9 A;  2HI7 A;  4D73 A;  2H72 A;  5FHI A;  4ZL7 A;  3CMI A;  2B5X A;  1TRW A;  1AC1 A;  2X8H A;  1Z3E A;  2YWN A;  2CVD A;  12GS A;  3IC4 A;  3ZLP A;  1HNA A;  2VCV A;  3EU4 A;  5D93 A;  1WPI A;  1XBS A;  1PSQ A;  3UBL A;  4POL A;  2VL2 C;  5GST A;  3UVT A;  3GIX A;  2B6M A;  2H0G A;  2GS3 A;  1K3O A;  5KN1 A;  4OFN A;  1JZR A;  1K3Y A;  3I43 A;  3LEF A;  5JWO B;  2C0D A;  3F3R A;  5LD0 A;  4IGJ A;  3IR4 A;  1SEN A;  5DBQ A;  3APS A;  3GRX A;  2LJR A;  4KE3 A;  4V2L A;  1ILO A;  5AIV A;  1ZMA A;  18GS A;  2KP1 A;  2QKE A;  2OE1 A;  1GRX A;  2ZCT A;  4LL4 B;  2DJK A;  2H76 A;  4HJM A;  3LGC A;  2FD3 A;  1M2D A;  3I69 A;  5IO2 A;  1U3A A;  4V2M A;  4D73 B;  4JU5 A;  4AJ6 A;  3EU3 A;  2GGT A;  3QR6 A;  2YN1 A;  2VLV A;  2OA7 A;  3QAW A;  4MK3 A;  3EIN A;  1QFN A;  1JFU A;  3WGE A;  4LLR A;  4ZB6 A;  2C0E A;  1AXD A;  2MMN A;  1MDK A;  3O3T A;  2FLS A;  4MA9 A;  2FCH A;  3RHB A;  4WR4 A;  2XBQ A;  1V98 A;  4POM A;  5ECH B;  2C3T A;  2BJX A;  2HNL A;  1G6W A;  4F9Z A;  1CQH A;  3KMN A;  5ELG A;  3P2A A;  1PQN A;  2HT9 A;  4TXV A;  4X1U A;  4PNF A;  4V1A p;  2F3M A;  3HVV A;  2H66 A;  1USB A;  2HXK A;  2RM6 A;  1YEP A;  3S9F A;  3VPT A;  2GQM A;  2WS2 A;  5IM9 A;  1C72 A;  1EOH A;  4YQU A;  4K5S A;  5JCU A;  3F4R A;  1V57 A;  2F8A A;  1PMT A;  1EV9 A;  2L5O A;  1YZX A;  1EEM A;  4GQC A;  1UA5 A;  3TRX A;  2LKU A;  2HYX A;  1JLW A;  3TKQ A;  3IK7 A;  4ZXG A;  2PER A;  4WBR D;  1Y25 A;  1WJK A;  2K18 A;  2ON5 A;  1SYR A;  5G2Z A;  4NV5 A;  1DBY A;  5IMF A;  2XC2 A;  2VM2 A;  2PVQ A;  4N11 A;  3DVW A;  2IMF A;  4JE1 A;  3Q19 A;  4TR0 A;  3TUE A;  3P7X A;  4QL7 A;  3NIV A;  3IHQ A;  2C8U A;  2Z9S A;  1URM A;  2X8G A;  1W4V A;  4GST A;  2QC7 A;  1YF1 A;  4TXO A;  3NZN A;  4ZL8 A;  1K0O A;  1SKR B;  1K0B A;  2GSS A;  4HQZ A;  3ERG A;  3VK9 A;  5LNK e;  2V32 A;  4WEY A;  3ZML A;  4Z2T A;  8GSS A;  2AYT A;  4J57 E;  3D4M A;  4BA7 A;  3GSS A;  3M1G A;  2LQO A;  2QGV A;  1WMJ A;  2NDO A;  2ALB A;  1OE8 A;  5HFI A;  1DUG A;  5HR0 A;  1ACV A;  3TOU A;  17GS A;  3GFK A;  2K9F A;  3IDV A;  1JZW A;  2LEG A;  2VIM A;  1EGR A;  3WT2 A;  5B6N A;  3L4N A;  1MDI A;  3W8J A;  2F8F A;  4AJ8 A;  2IIY A;  4HU7 A;  4MAB A;  1GSE A;  2PVO C;  2H6Y A;  5ECI B;  3M8N A;  4N0Z A;  4ECI A;  2GT5 A;  3C1R A;  2WFC A;  1T4Z A;  1TXX A;  2K6V A;  3RAZ A;  5DAK A;  3N9J A;  4HUA A;  4X0X A;  4TXO B;  2O87 A;  4BPY A;  1F6M C;  5G5E A;  5KN0 A;  2JZR A;  1WRY A;  2ZNM A;  3WYW A;  5D9V A;  4ZBB A;  2HRF A;  2A2R A;  1G0T A;  5IPG A;  2IJY A;  3A3T A;  3UL3 A;  5B8A A;  4XS6 A;  1XPV A;  1VF1 A;  2DKH A;  2REM A;  4ID0 A;  2DBC A;  5BRT A;  3RPN A;  1X5D A;  1JZD A;  2MZC A;  3G7Y A;  4ISD A;  3FZA A;  1LBK A;  2LQQ A;  4PQH A;  1XVW A;  2X4A A;  2ES7 A;  4K7O A;  1O81 A;  4IHU A;  5J5N A;  2GQL A;  4F03 A;  5ECM B;  4GWR A;  2QA2 A;  4L8E A;  4MH3 A;  3MSZ A;  4O5Q A;  4CDO A;  2OBI A;  3RHC A;  2KLX A;  2O8V B;  2LTK A;  4FIW A;  5B7C A;  1O8W A;  2EIQ A;  4O5U A;  4CW9 A;  2N5B A;  3IC8 A;  4ZB8 A;  4BWS A;  1B48 A;  3FR9 A;  1R26 A;  1NSW A;  2R3X A;  2JU5 A;  1Q98 A;  2PUK C;  2I1U A;  2DC5 A;  1MD3 A;  3C8E A;  1M9B A;  3LQ7 A;  2X8C A;  3K8N A;  2WGR A;  3D5J A;  4TR4 A;  3GH6 A;  3F8U A;  3CRU A;  5INY A;  3HJO A;  2O85 A;  3TGZ A;  5DJM A;  4XHM A;  3ZMK A;  1TOF A;  1Z5Y E;  3U5R E;  2JAD A;  1IYH A;  1V40 A;  4G0L A;  1BAY A;  5F06 A;  3HYP A;  4I6X A;  1A2J A;  1VF2 A;  2GTU A;  2H1G A;  3QMX A;  4NPB A;  5IMC A;  3EMP A;  1FOH A;  2A2S A;  1GSD A;  4DVC A;  3O76 A;  2E2G A;  2IME A;  1K0A A;  2NBS A;  4PUA A;  3SBC A;  1G6Y A;  3ZIV A;  2FWE A;  1XWA A;  2EC4 A;  5COH A;  2GDR A;  1EGO A;  2MBS A;  4NWY A;  13GS A;  1M7T A;  5G31 A;  2C4J A;  1TK8 B;  1WE0 A;  2VCX A;  4HQS A;  3GNJ A;  2H0I A;  1GSQ A;  2OE3 A;  1SL1 B;  2GZY A;  2I4A A;  4FYC A;  4WR5 A;  3ME8 A;  2RUE A;  2H19 A;  6GSS A;  14GS A;  4K8M A;  1AAZ A;  5J4U A;  2HZF A;  1MTC A;  4EE0 A;  3EMX A;  1UC7 A;  2FWH A;  3FR6 A;  4GTU A;  3DKS A;  2GZP A;  5H5R A;  3VWX A;  3KCM A;  3V1W A;  4IW9 A;  2JAC A;  3QCP A;  2YWI A;  1RQM A;  3KM6 A;  2CV4 A;  4WXT A;  1GUM A;  4NXI A;  4XS4 A;  2NTO A;  5CRD A;  2HRK A;  2K8V A;  22GS A;  4PUR A;  2IMK A;  3PGT A;  2WB9 A;  4Z7X A;  3KH9 A;  4HEA 2;  1GUK A;  1A0F A;  4EF0 A;  3QPM A;  4GLT A;  4RI7 A;  5IOW A;  5G30 A;  2H1B A;  1ML6 A;  5G1K A;  1EP7 A;  1FO5 A;  3JCM L;  3PR8 A;  5J9B A;  1WOU A;  2KHP A;  3TKP A;  5IMD A;  5GAP D;  2TRC P;  1G7E A;  4N30 A;  1AQX A;  4RQX A;  4WET A;  3EPT A;  2XBI A;  3J7Y b;  5ECP B;  3VWU A;  3BJ5 A;  2PU9 C;  5AN1 A;  4FQU A;  3ME7 A;  1DE1 A;  3GTU A;  3ZFL A;  2FUG 2;  1OKD A;  2RM5 A;  5ELA A;  3Q6O A;  5IO0 A;  1T00 A;  1GTU A;  3GKM A;  3KIJ A;  6GST A;  2WCI A;  4K7N A;  3GH9 A;  4K0G A;  2IMI A;  3C7M A;  5ABR A;  4NMU A;  1G7O A;  4XS4 B;  1SJ6 A;  4J2F A;  1PL2 A;  3A2X A;  3QFB C;  2WZ9 A;  2H0H A;  4KUN A;  2H74 A;  1V9W A;  1KBN A;  3WD6 A;  2V2G A;  4XCS A;  5KN2 A;  2DJ0 A;  3I6A A;  4KA0 A;  1GNE A;  4OMV A;  5H5Q A;  4LA1 A;  1SL0 B;  1X0R A;  5F0G A;  4DSQ A;  3TOT A;  1SL2 B;  1QQ2 A;  4KB3 A;  1R5P A;  4TOP A;  1NHO A;  2I81 A;  3LG6 A;  3IRA A;  3UIW A;  2K8S A;  3DRN A;  2MYG A;  2N5A A;  2LRT A;  1BJX A;  3M9J A;  2JZS A;  4EO3 A;  1BQ7 A;  2OBK A;  5DVB A;  2ON7 A;  1TI3 A;  3ZFB A;  3UMA A;  5IMA A;  3KEB A;  3A5I A;  1X9W B;  3N5O A;  2L57 A;  3GUS A;  1ZL9 A;  2H1D A;  1A2M A;  3M3M A;  4TKY A;  1ZOF A;  1GLP A;  4F2I A;  3GTU B;  1GSF A;  4HZ2 A;  2HLS A;  5CO3 A;  3FK8 A;  4NHZ A;  1XWG A;  3VWV A;  4CY6 A;  3H93 A;  4MJC A;  2H30 A;  3PH9 A;  2PGT A;  3ZIT A;  4MLY A;  2B1K A;  2MBT A;  3VFI A;  5ENU A;  4JED A;  4OCF A;  2C1Y A;  2B7K A;  3RDW A;  5LCZ A;  3TJF A;  3R2Q A;  4WBJ A;  4ZB9 A;  4EDY A;  5GZZ B;  1BG5 A;  2C80 A;  3F3Q A;  2D2Z A;  3TRP A;  1SK1 A;  1GLQ A;  4WKW A;  3ZTL A;  3F4S A;  2H6Z A;  3EYT A;  1SJZ A;  4QQ7 A;  3HA9 A;  2FA4 A;  3FYG A;  2R37 A;  4RUV A;  1PRX A;  4YQV A;  3IOS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...