4XHMA

Archaeoglobus fulgidus thioredoxin 3 m60h
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
110
structure length
110
Chain Sequence
ARKVLDSPVKLNSSNFDETLKNNENVVVDFWAEWCHPCKMIAPVIEELAKEYAGKVVFGKLNTDENPTIAARYGISAIPTLIFFKKGKPVDQLVGAMPKSELKRWVQRNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Thioredoxin (Trx-3)
publication title Rheostat Re-Wired: Alternative Hypotheses for the Control of Thioredoxin Reduction Potentials.
pubmed doi rcsb
source organism Archaeoglobus fulgidus (strain atcc 49558 / vc-16 / dsm 4304 / jcm 9628 / nbrc 1
total genus 31
structure length 110
sequence length 110
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4xhmA00
1MDKA 1U6TA 1HNAA 2QC7A 1AC1A 4FYUA 1FB6A 2C0FA 1EEJA 2LTKA 2L5LA 1F2EA 3FYGA 4ACSA 3CSJA 1XW9A 3A2XA 4MJEA 3QMXA 4XS6A 4ECCA 1AW9A 3IHQA 3CTFA 3CRTA 2KOKA 4IW9A 2I4AA 1C72A 4NMUA 2WFCA 2AB6A 5IMDA 2R5GA 1A8YA 5DCGA 4KDUA 5F0GA 4KA0A 3RPPA 5A4UA 12GSA 2O89A 2C0GA 4ISDA 3C73A 1TRSA 4TR1A 1FVJA 1EV9A 1XOAA 4N30A 2H8LA 2C80A 2KHPA 3H4KA 1XPVA 4KUNA 2FA4A 1N8JA 4WR5A 2PN8A 4GCIA 3C7MA 2RM5A 2CQ9A 1Z3EA 3ZVJA 4TKYA 1ML6A 3GMFA 1X9MB 1GL8A 2M72A 5HR1A 3UJ1A 4ZXGA 5GZZB 2L59A 3GTUA 3BCIA 3KP8A 2GQMA 5IMVA 2N5FA 3ZITA 5D9WA 1Z7PA 19GSA 1B4PA 3MDKA 3GTUB 4KCAA 4YAPA 1JZWA 3F4SA 5ECNB 4YQVA 4X0XA 2WCIA 2HSYA 3N9JA 2CVDA 5J9BA 2RUEA 4JZQA 4N10A 4ZIJA 2ES7A 3D0ZA 3U5RE 3H93A 3VWUA 5J4UA 5AIVA 1UN2A 4DSQA 2HI7A 5J41A 3ZIVA 4LMVA 3HZ8A 4IGJA 3TOTA 3GKNA 4K9ZA 2AHEA 4MPGA 4EE0A 4MA9A 3GL5A 4HDEA 1X5CA 2VCXA 4G19A 3LXZA 2H71A 4EL1A 2VL9A 2AYTA 1FB0A 3GKXA 2LEGA 1AQXA 1ABAA 2XPDA 1WRYA 1A0FA 5B6NA 3ERWA 3E0UA 1SKSB 3W6GA 2HLSA 1MDJA 3DYRA 2NDOA 2DC5A 3KCMA 3TGZA 5CRHA 5IM9A 2BTOT 2YOIA 1JHBA 4WEYA 4ZL8A 5A4VA 1V98A 6GSVA 3KGKA 4KCEA 4POMA 1TU8A 1T3BA 4DSRA 1M7TA 1G6WA 2HE3A 4HZ2A 1BQ7A 4X43A 4IVFA 1EEMA 2BMXA 1A23A 5G30A 3ZFBA 5FT3A 2ZCTA 1TDIA 4MF7A 1XVQA 1FO5A 4LA1A 3APOA 3ZL5A 5GSTA 1BG5A 2H72A 4HJMA 3IK7A 1TU7A 1WP0A 1R5AA 2FNOA 1GWCA 3L4NA 1G6YA 3KD0A 1PMTA 4POBA 3CMIA 4OD7A 4TXOA 2O87A 2V41A 5KN2A 3F3RA 2IJYA 2WDUA 3D4TA 4TXOB 3RDWA 3TKQA 1SJIA 5CNWA 5CYYA 3WYWA 3NZNA 1AQVA 1TJDA 4LLRA 2L6CA 2RM6A 2DJ2A 2H6XA 1SD9A 2V32A 4K7IA 1F6MC 3KM6A 1A24A 1A2LA 2H01A 1PQNA 2HFDA 3UARA 1YKAA 3VI5A 3G7IA 4Q5NA 2B5YA 4X1UA 4F2IA 8GSSA 4TRXA 5ECQB 2GZYA 1GSUA 3ZMLA 2H76A 1AQWA 4V2MA 4PURA 3L9VA 4HQZA 2YP6A 1VF2A 1PKZA 3KEBA 4XIHA 1EOHA 2LJKA 1ILOA 1GSEA 3AY8A 3FEUA 2M46A 4TR3A 1PA3A 4OFTA 2IL3A 5HQPA 1K0OA 1SL1B 2DJJA 1HYUA 3TKSE 1B8XA 1FOVA 1U88A 1G0TA 1SKRB 3QOUA 4YQMA 2JL4A 4EC0A 18GSA 3FW2A 4TR4A 4QQ7A 13GSA 4WF4A 2LUSA 3TJFA 1CQGA 1V57A 1GTAA 4TVEA 3TRXA 3MSZA 2MBTA 2QKEA 1B4QA 2DJKA 2L5OA 1U3AA 3DMLA 3EC3A 3IDVA 4HZ4A 3WGEA 4EKZA 3KIJA 4NV5A 3TJBA 1TRVA 1XWKA 4I5QA 1TK5B 3ZYWA 3GYKA 2Z9SA 4H86A 5JCWA 1PL2A 2R2JA 1Y6EA 3EURA 2N5BA 3N5OA 3IAS2 2M80A 2LJAA 2YCDA 3LYKA 2AV4A 3I43A 2VM2A 3F4TA 5DDLA 1A2JA 1GSQA 4V2NA 3BOAA 5G1LA 3IBHA 3GSSA 4L8EA 1MTCA 4D73A 1HNBA 4F03A 3GUSA 2F51A 1GULA 3ZRDA 4EDZA 4D73B 3RHCA 3LEFA 5ECPB 5HR0A 5A5KA 3D4MA 1H75A 1USBA 4JU5A 1F3BA 1OC9A 2O8VB 3TKSA 4TW5A 1NM3A 1YY7A 1OC9B 2X99A 2FWGA 5ENUA 1XBSA 3DXBA 3S9FA 4KAEA 2FUG2 3GX8A 4EXJA 5CP1A 2MBSA 5EY6A 5AISA 1YEPA 1SYRA 4POKA 5D8IA 5H5SA 5JCGA 3D22A 1YEXA 2QSIA 3WGDA 1TI3A 2JZTA 3LJRA 3ME7A 5EL8A 4FIWA 4RQRA 1KBNA 10GSA 3Q6OA 2C3QA 5EPFA 5D9VA 4MZCA 1NSWA 3TCOA 5KEJA 2K8VA 2VLVA 4KSMA 1DSBA 3GHAA 3GH9A 2X8CA 2KP1A 2TIRA 2I1UA 1O8XA 1F9MA 3M8NA 2HYXA 1K0MA 5ECSA 4O5RA 2X64A 1WJKA 3Q74A 6GSUA 2EIRA 4BPYA 2H74A 1BAYA 3WGXA 6GSTA 4XRAA 2R6KA 1IYHA 4IP6A 1OKDA 4PX1A 1U87A 4PNFA 5ECMB 5J9CA 5HR2A 1ERUA 1XFLA 4NAXA 20GSA 3ZTLA 2VM1A 3HHVA 3ZIJA 1KTEA 3E3EA 3UL3A 4IQAA 1PD21 2LSTA 3GV1A 2K9FA 3ZMKA 2IMIA 2LQOA 4ECIA 1ZYQB 3HYPA 1PRXA 3KTLA 4GQFA 1MD3A 2R4VA 5KN0A 1MEKA 3F63A 5LD0A 3IOSA 5CREA 2K6VA 1O85A 1XWCA 3VWXA 4BVXA 4WBRD 1FW1A 3DWVA 2G0FA 5H5RA 3CTGA 2PERA 4MLYA 3APSA 1THOA 4I2TA 4MZWA 4QL9A 1XWBA 2I81A 1TI1A 4P3YB 1TOFA 1O8WA 2PWJA 1QUWA 3GKKA 2L6DA 4PQHA 2LNTA 2FWHA 1JLWA 4JE1A 4KE3A 4NPBA 3DGQA 2VUPA 3GNJA 4TR1B 3CSHA 3EMXA 4N0ZA 2CVBA 1TKDB 4IQ1A 1GSFA 2GGTA 1LU4A 4G10A 3UIWA 2ON5A 3F3QA 1GP1A 1M2BA 2YV7A 1R4WA 3GIXA 5B8AA 3A2WA 3ISOA 3L0HA 2E7PA 2A2RA 2VCTA 4POLA 2WGRA 3HA9A 1EP8A 3KMNA 2WZ9A 1TTZA 1B9YC 1FVKA 4QL7A 4PQIA 1W4VA 1LJRA 4MJAA 1VF3A 2LRNA 1Z5YE 1BEDA 4IHUA 2FD3A 2CZ3A 4BL7A 5GSSA 4NXIA 5DCHA 3ME8A 3I69A 2YANA 3QFAC 2IMDA 3CYNA 4KNDA 3GURA 3KH9A 4KX4A 2K18A 3A3TA 3TRQA 3VPTA 4PXOA 3A2VA 3TKRA 3NOFA 6GSXA 1WMJA 5DAKA 1JZRA 2PVOC 4L0UA 4MJCA 4N11A 1OAZA 2PMTA 2B6MA 3DD3A 5DAKB 2IFQA 1DE1A 1UVZA 1XW5A 2IN3A 2FHEA 3IR4A 2GZZA 2DJ0A 1TRWA 3F6FA 4KDYA 3RAZA 2IFQB 2B1LA 6GSSA 2FA8A 3LQ7A 1U3IA 4WF5A 4L5OA 3P2AA 1SK2A 2O7KA 2H30A 4I8BA 5F07A 1WWJA 3O76A 2AUVA 1HNCA 4MJBA 4XS1A 2LJRA 2B5EA 4F0CA 5IMFA 4BA7A 3O3TA 4AF2A 4ZB9A 3EVIA 2H0GA 2X8GA 1SL0B 3HXSA 1B9XC 3I6AA 4WETA 4MPFA 1W89A 1JLVA 3KXOA 1Z9HA 5DQSA 1DBYA 4JBBA 2PGTA 3H79A 4OCEA 1Q4JA 1VRSD 2QGVA 3I9V2 4HQSA 3HJMA 4F9ZA 1JZDA 6GSWA 1ERVA 4XHMA 1XVWA 4L5LA 17GSA 4JR6A 3O6TA 2E2MA 2P31A 4MCUA 5A4WA 2OBIA 1UA5A 2JACA 1WPIA 3L78A 2GT5A 2VD1A 1T1VA 4GSTA 2VO4A 1TK8B 1OC3A 2OADA 5D9TA 4ML1A 4RUVA 2VCQA 4PQ1A 3M0FA 2F9SA 4LMWA 1GLQA 1GUKA 4OFNA 2DSAA 5IMCA 1GUHA 3QCPA 2JSYA 1M99A 1IYIA 4J57E 2CX3A 3ERGA 3W8SA 3D6IA 2V6KA 2VL2A 2CVKA 1GSSA 3C1SA 3G7YA 2XHFA 4MF6A 2MYGA 2CV4A 2DIZA 3FRCA 5ABRA 3TJGA 3FR6A 2XBQA 1V58A 3QAVA 1NHOA 2AJQB 3GRXA 4ML6A 3QAGA 3IPZA 2C8UA 1DE2A 2JADA 4ZB8A 3GX0A 4AJ7A 2EC4A 4Q5RA 4F0BA 2LQQA 1SJ6A 2EIOA 3C1RA 4ZBBA 3EU3A 5G5FA 1ERWA 1SYXA 2IMKA 2GDRA 4MH2A 4OO5A 2B5XA 3FZ4A 4MDCA 1RQMA 3LSZA 4MK3A 5ECLB 2JSZA 1FHEA 3TUEA 1R7HA 4NHWA 1XXUA 5COHA 4GF0A 2VIMA 1FAAA 3HJOA 4Z7XA 4ID0A 3HY2A 4EVMA 5IOXA 3SBCA 2V6OA 3HVVA 3MAKA 2IMEA 4GSSA 4V2LA 1GNWA 2TRXA 1SK1A 2YWMA 4IJIA 2VD0A 1G7OA 1O81A 2NVLA 3RPNA 4OCFA 4MZBA 4WR4A 4RI7A 5HR3A 4HUAA 1VF4A 3IAM2 4YH2A 2P5RA 2R37A 2VLUA 4ILFA 1WOUA 4IELA 4TXVA 4GRFA 2ZUPA 5HFGA 4MP4A 2NPBA 2DLXA 1HQOA 4NWYA 2H0HA 1B48A 3UBKA 3F0IA 4K8MA 1ZZYA 2IWTA 3A5WA 1K0DA 1PKWA 1F3AA 4GSNA 4I2UA 4KGIA 1YDKA 2PU9C 3PH9A 3V1WA 1GTBA 2GSRA 5C00A 1I5GA 4GWRA 3ZZXA 2YN1A 1ST9A 1V9WA 4OO4A 4OMVA 3EYTA 5KN3A 5LNKe 4HS1A 4ULXA 2F3MA 1F37A 1JFUA 4DEJA 5EVOA 1GSYA 2IMFA 3MNGA 3IE3A 3UVHA 3APQA 5IMAA 4K6XA 3CXGA 1QMVA 1ON4A 4G9HA 1YKCA 1PX7A 3FY7A 2HSHA 5CRDA 2KUCA 3WT1A 3FZ9A 2X8HA 2H73A 2YV9A 2YZUA 2YJ7A 4ZL7A 3FR9A 1EGOA 1GSDA 1GH2A 4O7HA 1K0CA 2KLXA 3JCML 3TKPA 2CA8A 3QDNA 4K0GA 2YNXA 1EZKA 5CRGA 1A8LA 2CX4A 2OKAA 5DQYA 2XC2A 1R26A 1SL2B 1A2MA 5IO0A 1M2AA 2LRCA 4IBPA 1E6BA 2B7KA 2CAIA 2HZFA 2PVQA 2GQLA 1ZMAA 3HVXA 1KEBA 14GSA 3Q19A 2H1AA 1URMA 3G9BA 1QXHA 2H70A 2HNLA 3VI7A 5ID2A 6GSYA 4O92A 1X0RA 2MMOA 1NW2A 1R5PA 5LCZA 3GN3A 5ID2B 1O6JA 1J0FA 1XW6A 4N0VA 4GTUA 3KTBA 2AAWA 3ZLPA 5G31A 4AJ8A 2IIYA 3E9JB 3F4RA 5IPGA 1AXDA 2FCHA 3D5JA 4PUAA 1PSQA 4IKHA 3FHKA 2GS3A 3OR5A 4GLTA 2B1KA 1E2YA 2YWNA 2C3TA 4FO5A 1H4OA 1THXA 5ECHB 5ECKB 2CT6A 5DVBA 4IN0A 4XS4A 2H75A 1Z6MA 3FZAA 2F8AA 1ACVA 2JU5A 2VCWA 4XS4B 2MMNA 3H1NA 3D21A 4NHZA 5DALA 4K7NA 3IV4A 1NHYA 5ECRB 1GUMA 1VGLA 3M1GA 1EV4A 3L9UA 3HDCA 5DALB 2HZEA 4ZBAA 2HRNA 4IS0A 3GKMA 3GSTA 1BX9A 2H6YA 5D93A 3F6DA 2H1GA 2C0EA 2HZEB 3ED3A 2V1MA 3DIEA 1K3LA 2OA7A 3IK9A 3EE2A 3WT2A 3FR3A 4YAVA 3MWHA 1EWXA 4HI7A 1O7UA 4JR4A 1T4YA 1EP7A 5ECOB 2VOCA 1XWGA 3U6VA 2P5QA 1K0AA 4TN8A 5F05A 2NTOA 2L4QA 3SWLA 2L57A 3GFKA 3RBTA 3QPMA 4K0NA 2LRTA 4IP1A 2NBSA 1O73A 1Z6NA 5HFIA 2C3NA 3CSIA 2BJXA 1K3YA 1S3CA 1ZCPA 3F8UA 4XCSA 5INYA 3HKRA 1RW1A 1QK8A 2GQKA 2E0QA 2OACA 2K8SA 3KZQA 3LYPA 1RK4A 2F8FA 1A0RP 1TK0B 3L9SA 3UMAA 2LNSA 2VL3A 1JZOA 3HD5A 4WBJA 4K1FA 3TRPA 1BYEA 1MDIA 3FKFA 4V1Ag 5C04A 1K3OA 1S3DA 3P8WA 2H19A 1GLPA 2VAFA 3C8EA 2B7JA 1LBKA 1SU9A 5G1KA 2H6ZA 3CBUA 3HJPA 3IA1A 3BD2A 2VL2C 5D9XA 4Q5QA 2JZSA 2DJ3A 3NIVA 1GTUA 1PX6A 1VF1A 3BBYA 4FYBA 4YQUA 4K7OA 1GRXA 1YZXA 4AJ6A 1Y25A 3LXTA 4L0WA 3W8JA 1SK0A 4WKWA 5G2ZA 2FGXA 2J23A 5CAXA 3PGTA 4J56E 3C71A 3UBLA 4JRRA 2B3SA 3UVTA 2RIIA 5IMZA 2FWEA 2YWOA 3TB2A 3VLNA 5IQYA 3UOMA 5IPHA 2DBCA 4FYCA 3TJJA 3VK9A 2A2SA 2FY6A 3IRAA 2OE0A 3M9KA 4TR0A 4ZB6A 4HEA2 1AAZA 2WULA 4KSOA 3ZREA 3FZ5A 1T4ZA 2I9HA 1YF1A 2GTUA 1SD8A 1M9AA 2ZNMA 1OC8A 1FG4A 5E4WA 1HD2A 1M9BA 3VURA 4GQCA 3TJKA 2H66A 4FH8A 2FWFA 4O32A 3HVSA 3QR6A 4BVYA 4F82A 1ERTA 1PN9A 4V1Ap 2OJLA 5DJMA 5AGYA 4LL1B 1TW9A 1WE0A 4BWQA 3DEXA 5FWGA 5B7CA 4MMMA 4HJ2A 1MD4A 1GTIA 3GL3A 2YZHA 1QFNA 1J08A 3QD9A 2J9HA 3QAWA 3BJ5A 3ZFLA 1CQHA 5GAPD 5AIXA 2FLSA 4WXTA 3LORA 4RQXA 5CO3A 4E8EA 2WJUA 2OBKA 1WIKA 1N2AA 2PUKC 1BJXA 2C0DA 5JCUA 1OKTA 3KP9A 3VPQA 4PUFC 5H5QA 1ZOFA 4KDXA 5IOWA 1SKWB 4G2EA 5F06A 4IJ3A 4Q5FA 5HFKA 2IPAA 4KB3A 2XBIA 3ZVJD 3HZ4A 3EINA 3TKSC 4EF0A 3ERFA 4JEDA 5GAND 4ECBA 2GSSA 4AGSA 1EGRA 4MABA 2KP2A 4XRDA 2H1BA 3PR8A 2XPEA 4KW6A 3IC4A 3QFBC 5JWQB 4CDOA 1SJZA 2G2QA 2MMAA 5F8BA 1ZGNA 3VWWA 3UEMA 3BCKA 2HRFA 2DMMA 1SENA 4OWYA 1YF0A 2VCZA 3F9UA 2DIYA 5D96A 3EMPA 3KJYA 4NV2A 3FK8A 1M0UA 1S3AA 2GSTA 2GZPA 2PPTA 2CAQA 1G7EA 1DUGA 2GSQA 4OFMA 5DJLA 2JZRA 4ECJA 4HU7A 3PINA 4HOJA 2PBJA 4ZBDA 4DVCA 1PGTA 4EO3A 3IXRA 3VFIA 5B8BA 1AUCA 5JWOB 3LGCA 4MH3A 5L71A 1EOGA 2P0GA 2VCVA 1XIYA 1OVNA 1X5EA 1QQ2A 1AIUA 1V2AA 1X9SB 3EU4A 2ON7A 3LWAA 3DVXA 2LS5A 2CZ2A 3VWVA 3Q18A 5JWRB 2WRTA 4PNGA 4LL4B 3UAPA 2MZCA 3J7Yb 3G7JA 4BWSA 4CHSA 2D2ZA 5E59A 9GSSA 1TRUA 1GNEA 5J5NA 2YPMA 2V2GA 4PGTA 2E2GA 5J3RA 2DMLA 4RI6A 3LFLA 1V40A 1ZYEA 4EDYA 1KNGA 3K8NA 1T8EB 4CW9A 3WD6A 11GSA 4J2FA 4E8HA 5B6MA 2OE1A 2DJ1A 1PL1A 3M3MA 1XWAA 5G5EA 3TOUA 3EWLA 5ELGA 2MMZA 1UC7A 2I3YA 5CRWA 2ALBA 3RHBA 2C1YA 1XCCA 2EIQA 2RLIA 2L4CA 3DVWA 4I6XA 2H1DA 5AN1A 16GSA 3DKSA 5ECIB 2GVPA 1QGVA 2WB9A 4MF5A 1OE7A 1K0BA 1J9BA 2GLRA 1TXXA 2WS2A 3KMOA 1OE8A 3LG6A 5IIZA 22GSA 1TP9A 4I97A 2REMA 2C4JA 1T00A 3CRUA 1ZL9A 2A4VA 1X5DA 4HU9A 1T7PB 5FHIA 5DBQA 1XOBA 2GT6A 2YWIA 3GH6A 2TRCP 3KH7A 3H8QA 1XZOA 3J7Yk 1M2DA 2LKUA 4DSSA 2OE3A 2HXKA 2O85A 3P7XA 5IO2A 5KN1A 2YJHA 3DRNA 3TDGA 4GXZA 1Q98A 4DSSB 4EUYA 4ZILA 7GSSA 4K2DA 1OYJA 2VLTA 3R2QA 4TOPA 2H0IA 2RUFA 3M9JA 5D73A 1I9DA 2N5AA 4KH7A 2HT9A 5ELAA 1YQ1A 1Z7RA 3HCZA 1YJ6A 3P90A 1X9WB 2LV3A 3GA4A 4ZL9A 3US3A 4XTSA 2R3XA 1K0NA
chains in the Genus database with same CATH superfamily
3EPTA 1MDKA 1U6TA 1HNAA 2QC7A 1AC1A 4FYUA 1FB6A 2C0FA 1EEJA 2LTKA 2L5LA 1F2EA 3FYGA 4ACSA 3CSJA 1XW9A 3A2XA 4MJEA 3QMXA 4XS6A 4ECCA 1AW9A 3IHQA 3CTFA 3CRTA 2KOKA 4IW9A 3FMWA 2I4AA 1C72A 4NMUA 2WFCA 2AB6A 5IMDA 1ZYPA 2R5GA 1A8YA 5DCGA 4KDUA 5F0GA 4KA0A 3RPPA 5A4UA 12GSA 2O89A 2C0GA 4ISDA 3C73A 1TRSA 4TR1A 1FVJA 1EV9A 1XOAA 4N30A 2H8LA 2C80A 2KHPA 3H4KA 1XPVA 4KUNA 4CY8A 2FA4A 2DKHA 1N8JA 4WR5A 2X4AA 2PN8A 4GCIA 3C7MA 2RM5A 2CQ9A 1Z3EA 3ZVJA 4TKYA 1ML6A 3GMFA 1X9MB 1GL8A 2M72A 5HR1A 3UJ1A 4ZXGA 5GZZB 2L59A 3GTUA 3BCIA 3KP8A 2GQMA 5IMVA 2N5FA 3ZITA 3MIXA 5D9WA 1Z7PA 19GSA 1B4PA 3MDKA 3GTUB 4KCAA 4YAPA 1JZWA 3F4SA 5ECNB 4YQVA 4X0XA 2WCIA 2HSYA 3N9JA 2CVDA 5J9BA 2RUEA 4JZQA 4N10A 4ZIJA 2ES7A 3D0ZA 3U5RE 3H93A 3VWUA 5J4UA 5AIVA 1UN2A 4DSQA 2HI7A 5J41A 3ZIVA 4LMVA 3HZ8A 4IGJA 3TOTA 3GKNA 4K9ZA 2AHEA 4MPGA 4EE0A 4MA9A 3GL5A 4HDEA 1X5CA 2VCXA 4G19A 3LXZA 2H71A 4EL1A 2VL9A 2AYTA 1FB0A 3GKXA 2LEGA 1AQXA 1ABAA 2XPDA 1WRYA 1A0FA 5B6NA 3ERWA 3E0UA 2UZ8A 1SKSB 3W6GA 2HLSA 1MDJA 4Z2RA 3DYRA 2NDOA 2DC5A 3KCMA 3TGZA 5CRHA 4CY6A 5IM9A 2BTOT 2YOIA 1JHBA 4WEYA 4ZL8A 5A4VA 1V98A 6GSVA 3KGKA 4KCEA 4POMA 1TU8A 1T3BA 4DSRA 1M7TA 1G6WA 2HE3A 4HZ2A 1BQ7A 4X43A 4IVFA 1EEMA 2BMXA 1A23A 5G30A 3ZFBA 5FT3A 2ZCTA 1TDIA 4MF7A 1XVQA 1FO5A 4LA1A 3APOA 3ZL5A 5GSTA 1BG5A 2H72A 4HJMA 3IK7A 1TU7A 1WP0A 1R5AA 2FNOA 1GWCA 3L4NA 1G6YA 3KD0A 1PMTA 4POBA 3CMIA 4OD7A 4TXOA 2O87A 2V41A 5KN2A 3F3RA 2IJYA 2WDUA 3D4TA 4TXOB 3RDWA 3TKQA 1SJIA 5CNWA 5CYYA 3WYWA 3NZNA 1AQVA 1TJDA 4LLRA 2L6CA 2RM6A 2DJ2A 2H6XA 1SD9A 2V32A 4K7IA 1F6MC 1M3IA 3KM6A 1A24A 1A2LA 2H01A 1PQNA 2HFDA 3UARA 1YKAA 3VI5A 3G7IA 4Q5NA 2B5YA 4X1UA 4F2IA 8GSSA 4TRXA 5ECQB 2GZYA 1GSUA 3ZMLA 2H76A 1AQWA 4V2MA 4PURA 3A5IA 3L9VA 4G0IA 4HQZA 2YP6A 1VF2A 1PKZA 3KEBA 4XIHA 1EOHA 2LJKA 1ILOA 4EIPA 1GSEA 3AY8A 3FEUA 2M46A 4TR3A 1PA3A 4OFTA 2IL3A 5HQPA 1K0OA 1SL1B 2DJJA 1HYUA 3TKSE 1B8XA 1FOVA 1U88A 1G0TA 1SKRB 3QOUA 4YQMA 2JL4A 4EC0A 18GSA 3FW2A 4TR4A 4QQ7A 13GSA 4WF4A 2LUSA 3TJFA 1CQGA 1V57A 1GTAA 4K5RA 4TVEA 3TRXA 3MSZA 2MBTA 2QKEA 1B4QA 2DJKA 2L5OA 1U3AA 3DMLA 3EC3A 3IDVA 4HZ4A 3WGEA 4EKZA 3KIJA 4NV5A 3TJBA 1TRVA 1XWKA 4I5QA 1TK5B 3ZYWA 3GYKA 2Z9SA 4H86A 5JCWA 1PL2A 2R2JA 1Y6EA 3EURA 2N5BA 3N5OA 3IAS2 2M80A 2LJAA 2YCDA 3LYKA 2AV4A 3I43A 2VM2A 3F4TA 5DDLA 1A2JA 1GSQA 4V2NA 3BOAA 5G1LA 3IBHA 3GSSA 4L8EA 1MTCA 4D73A 1HNBA 4F03A 3GUSA 2F51A 1GULA 3ZRDA 2DKIA 4EDZA 4D73B 3RHCA 3LEFA 5ECPB 5HR0A 5A5KA 3D4MA 1H75A 1USBA 4JU5A 1F3BA 1OC9A 2O8VB 3TKSA 4TW5A 1NM3A 1YY7A 1OC9B 2X99A 2FWGA 1FOHA 5ENUA 1XBSA 3DXBA 3S9FA 4KAEA 2FUG2 3GX8A 4EXJA 5CP1A 2MBSA 5EY6A 5AISA 1YEPA 1SYRA 4POKA 5D8IA 5H5SA 4HSCX 5JCGA 3D22A 1YEXA 2QSIA 3WGDA 1TI3A 2JZTA 3LJRA 3ME7A 5EL8A 4FIWA 4RQRA 1KBNA 10GSA 3Q6OA 2C3QA 5EPFA 5D9VA 4MZCA 1NSWA 3TCOA 5KEJA 2K8VA 2VLVA 4KSMA 1DSBA 3GHAA 4BIKA 3GH9A 2X8CA 2KP1A 2TIRA 2HSMA 2I1UA 1O8XA 1F9MA 3M8NA 2HYXA 1K0MA 5ECSA 4O5RA 2X64A 1WJKA 3Q74A 6GSUA 2EIRA 4BPYA 2H74A 1BAYA 3WGXA 4USSA 6GSTA 4XRAA 2R6KA 1IYHA 4IP6A 1OKDA 4PX1A 1U87A 4PNFA 5ECMB 5J9CA 5HR2A 1ERUA 1XFLA 4NAXA 20GSA 3ZTLA 2VM1A 3HHVA 3ZIJA 1KTEA 3E3EA 3UL3A 4IQAA 1PD21 2LSTA 3GV1A 2K9FA 3ZMKA 2IMIA 2LQOA 4ECIA 1ZYQB 3HYPA 1PRXA 2R0PA 3KTLA 4GQFA 1MD3A 2R4VA 5KOXA 4O5QA 5KN0A 1MEKA 3F63A 5LD0A 3IOSA 5CREA 2K6VA 1O85A 1XWCA 3VWXA 4BVXA 4WBRD 1FW1A 3DWVA 2G0FA 5H5RA 3CTGA 2PERA 4MLYA 3APSA 1THOA 4BVXB 4I2TA 4MZWA 4QL9A 4Z2UA 1XWBA 2I81A 1TI1A 4P3YB 1TOFA 1O8WA 2PWJA 1PN0A 1QUWA 3GKKA 2L6DA 4PQHA 2LNTA 2FWHA 1JLWA 4JE1A 4KE3A 4NPBA 3DGQA 2VUPA 3GNJA 3HVNA 4TR1B 3CSHA 3EMXA 4N0ZA 2CVBA 1TKDB 4IQ1A 1GSFA 2GGTA 1LU4A 3LW9A 4G10A 3UIWA 2ON5A 3F3QA 1GP1A 1M2BA 2YV7A 1R4WA 3GIXA 5B8AA 3A2WA 3ISOA 3L0HA 2E7PA 2A2RA 2VCTA 4Z2TA 4POLA 2WGRA 3HA9A 1EP8A 3KMNA 2WZ9A 1TTZA 1B9YC 1FVKA 4QL7A 4PQIA 1W4VA 1LJRA 4MJAA 1VF3A 2LRNA 1Z5YE 1BEDA 4IHUA 2FD3A 2CZ3A 4BL7A 5GSSA 4NXIA 1S3RA 5DCHA 3ME8A 1M3JA 3I69A 2X49A 2YANA 2QA1A 3QFAC 2IMDA 3CYNA 4KNDA 4BL7B 3GURA 3KH9A 4KX4A 2K18A 3A3TA 3TRQA 3VPTA 4PXOA 3A2VA 4ICYA 3TKRA 3NOFA 6GSXA 1WMJA 2A2PA 5DAKA 1JZRA 2PVOC 4L0UA 4MJCA 4N11A 1OAZA 2PMTA 2B6MA 3DD3A 5DAKB 2IFQA 1DE1A 1UVZA 1XW5A 2IN3A 2FHEA 3IR4A 2GZZA 2DJ0A 1TRWA 3F6FA 4KDYA 3RAZA 2IFQB 2B1LA 6GSSA 2FA8A 3LQ7A 1U3IA 4WF5A 4L5OA 3P2AA 1SK2A 2O7KA 2H30A 4I8BA 5F07A 1WWJA 3O76A 2AUVA 1HNCA 4MJBA 4XS1A 2LJRA 2B5EA 4F0CA 5IMFA 4BA7A 3O3TA 4AF2A 4ZB9A 3EVIA 2H0GA 2X8GA 1SL0B 3HXSA 1B9XC 3I6AA 4WETA 4MPFA 1W89A 1JLVA 3KXOA 1Z9HA 5DQSA 4O5UA 1DBYA 4JBBA 2PGTA 3H79A 4OCEA 1Q4JA 1VRSD 2QGVA 3I9V2 4HQSA 4A5PA 3HJMA 4F9ZA 1JZDA 6GSWA 1ERVA 4XHMA 1XVWA 4L5LA 17GSA 4JR6A 3O6TA 2E2MA 2P31A 4MCUA 5A4WA 2OBIA 1UA5A 2JACA 1WPIA 3L78A 2GT5A 2VD1A 1T1VA 4GSTA 2VO4A 1TK8B 1OC3A 2OADA 5D9TA 4ML1A 4RUVA 2VCQA 4PQ1A 3M0FA 2F9SA 4LMWA 1GLQA 1GUKA 4OFNA 2DSAA 5IMCA 1GUHA 3QCPA 2JSYA 1M99A 1IYIA 4J57E 2CX3A 3ERGA 3W8SA 3D6IA 2V6KA 2VL2A 2CVKA 1GSSA 3C1SA 3G7YA 2XHFA 4MF6A 2MYGA 2CV4A 2DIZA 3FRCA 5ABRA 3TJGA 3FR6A 2XBQA 1V58A 3QAVA 1NHOA 2AJQB 3GRXA 4ML6A 3QAGA 3IPZA 2C8UA 1DE2A 2JADA 4ZB8A 3GX0A 4AJ7A 2EC4A 4Q5RA 4F0BA 2LQQA 1SJ6A 2EIOA 3C1RA 4ZBBA 3EU3A 5G5FA 1ERWA 1SYXA 4X4JA 2IMKA 2GDRA 4MH2A 4OO5A 2B5XA 3FZ4A 4MDCA 1RQMA 3LSZA 4MK3A 5ECLB 2JSZA 1FHEA 3TUEA 1R7HA 4NHWA 1XXUA 5COHA 4GF0A 2VIMA 1FAAA 3HJOA 4Z7XA 4ID0A 3HY2A 4EVMA 5IOXA 3SBCA 1XG8A 2V6OA 3HVVA 3MAKA 2IMEA 4GSSA 4V2LA 1GNWA 2TRXA 1SK1A 2YWMA 4IJIA 2VD0A 1G7OA 1O81A 2NVLA 3RPNA 4OCFA 4MZBA 4WR4A 4RI7A 5HR3A 4HUAA 1VF4A 3IAM2 4YH2A 2P5RA 2R37A 2VLUA 4ILFA 3IC8A 1WOUA 4IELA 4TXVA 4GRFA 2ZUPA 5HFGA 4MP4A 5BRTA 2NPBA 2DLXA 1HQOA 4NWYA 2H0HA 1B48A 3UBKA 3F0IA 4K8MA 1ZZYA 2IWTA 3A5WA 1K0DA 1PKWA 1F3AA 4GSNA 4I2UA 4KGIA 1YDKA 2PU9C 3PH9A 3V1WA 1GTBA 2GSRA 5C00A 1I5GA 4GWRA 3ZZXA 2YN1A 1ST9A 1V9WA 4OO4A 4OMVA 3EYTA 5KN3A 5LNKe 4HS1A 4ULXA 2F3MA 1F37A 1JFUA 4DEJA 5EVOA 1GSYA 2IMFA 3MNGA 3IE3A 3UVHA 3APQA 5IMAA 4K6XA 3CXGA 1QMVA 1ON4A 4G9HA 1YKCA 1PX7A 3FY7A 2HSHA 5CRDA 2KUCA 3WT1A 3FZ9A 2X8HA 2H73A 2YV9A 2YZUA 2YJ7A 4ZL7A 3FR9A 1EGOA 3PPUA 1GSDA 1GH2A 4O7HA 1K0CA 2KLXA 3JCML 3TKPA 2CA8A 3QDNA 4K0GA 2YNXA 1EZKA 5CRGA 1A8LA 2CX4A 2OKAA 5DQYA 2XC2A 1R26A 1SL2B 1A2MA 5IO0A 1M2AA 2LRCA 4IBPA 1E6BA 2B7KA 2CAIA 2HZFA 2PVQA 2GQLA 1ZMAA 3HVXA 1KEBA 14GSA 3Q19A 2H1AA 4G0LA 1URMA 3G9BA 1QXHA 2H70A 2HNLA 3VI7A 5ID2A 6GSYA 4O92A 1X0RA 2MMOA 1NW2A 1R5PA 5LCZA 3GN3A 5ID2B 1O6JA 1J0FA 1XW6A 4N0VA 4GTUA 3KTBA 2AAWA 3ZLPA 5G31A 4AJ8A 2IIYA 3E9JB 3F4RA 5IPGA 1AXDA 2FCHA 4YKFA 3D5JA 4PUAA 1PSQA 4IKHA 3FHKA 2GS3A 3OR5A 4GLTA 2B1KA 1E2YA 2YWNA 2C3TA 4FO5A 4MNNA 1H4OA 1THXA 5ECHB 5ECKB 2CT6A 5DVBA 4IN0A 4XS4A 2H75A 1Z6MA 3FZAA 2F8AA 1ACVA 2JU5A 2VCWA 5KOWA 4XS4B 2MMNA 3H1NA 3D21A 4NHZA 5DALA 4K7NA 3IV4A 1NHYA 5ECRB 1GUMA 1VGLA 1ZYNA 3M1GA 1EV4A 3L9UA 2R0CA 3HDCA 5DALB 2HZEA 4ZBAA 2HRNA 4IS0A 3GKMA 3GSTA 1BX9A 2H6YA 5D93A 3F6DA 2H1GA 2C0EA 2HZEB 3ED3A 2V1MA 3DIEA 1K3LA 2OA7A 3IK9A 3EE2A 3WT2A 3FR3A 4YAVA 3MWHA 1EWXA 4HI7A 1O7UA 4JR4A 1T4YA 1EP7A 5ECOB 2VOCA 1XWGA 3U6VA 2P5QA 1K0AA 4TN8A 5F05A 2NTOA 2L4QA 3SWLA 2L57A 3GFKA 3RBTA 3QPMA 4K0NA 2LRTA 4IP1A 4K5SA 2NBSA 1O73A 1Z6NA 2R0GA 5HFIA 2C3NA 3CSIA 2BJXA 1K3YA 1S3CA 1ZCPA 2A4HA 3F8UA 4XCSA 5INYA 3HKRA 1RW1A 1QK8A 2GQKA 2E0QA 4YKGA 2OACA 2K8SA 3KZQA 3LYPA 1RK4A 2F8FA 1A0RP 1TK0B 3L9SA 3UMAA 2LNSA 2VL3A 1JZOA 3HD5A 4WBJA 4K1FA 3TRPA 1BYEA 1MDIA 3FKFA 4V1Ag 5C04A 1K3OA 1S3DA 3P8WA 2H19A 1GLPA 3IHGA 2VAFA 3C8EA 2B7JA 1LBKA 1SU9A 5G1KA 2H6ZA 3CBUA 3HJPA 3IA1A 3BD2A 2VL2C 5D9XA 4Q5QA 3R3EA 2JZSA 2DJ3A 3NIVA 1GTUA 1PX6A 1VF1A 3BBYA 4FYBA 4YQUA 4K7OA 1GRXA 1YZXA 4AJ6A 1Y25A 3LXTA 4L0WA 3W8JA 1SK0A 4WKWA 5G2ZA 2FGXA 2J23A 5CAXA 3PGTA 4J56E 3C71A 3UBLA 4JRRA 2B3SA 3UVTA 2RIIA 5IMZA 2FWEA 2YWOA 3TB2A 3VLNA 5IQYA 3UOMA 5IPHA 2DBCA 4FYCA 3TJJA 3VK9A 2A2SA 2FY6A 3IRAA 2OE0A 3M9KA 4G0KA 4TR0A 4HEA2 4ZB6A 1AAZA 2WULA 4KSOA 3ZREA 3FZ5A 1T4ZA 2I9HA 1YF1A 2GTUA 1SD8A 1M9AA 2ZNMA 1OC8A 2QA2A 1FG4A 5E4WA 1HD2A 1M9BA 4FQUA 3VURA 4GQCA 3TJKA 2H66A 4FH8A 2FWFA 2HRKA 4O32A 3HVSA 3QR6A 4BVYA 4F82A 1ERTA 1PN9A 4V1Ap 2OJLA 5DJMA 5AGYA 4LL1B 1TW9A 1WE0A 4BWQA 3DEXA 4BVYB 5FWGA 4K2XA 5B7CA 4MMMA 4HJ2A 1MD4A 1GTIA 3GL3A 2YZHA 1QFNA 1J08A 3QD9A 2J9HA 3QAWA 3BJ5A 3ZFLA 1CQHA 5GAPD 5AIXA 2FLSA 4WXTA 3LORA 4RQXA 5CO3A 4E8EA 2WJUA 2OBKA 1WIKA 1N2AA 2PUKC 1BJXA 2HRAA 2C0DA 5JCUA 1OKTA 3KP9A 3VPQA 4PUFC 5H5QA 1ZOFA 4KDXA 5IOWA 4KF9A 1SKWB 4G2EA 5F06A 4IJ3A 4Q5FA 5HFKA 2IPAA 4KB3A 2XBIA 3ZVJD 3HZ4A 3EINA 3TKSC 4EF0A 3ERFA 4JEDA 5GAND 4ECBA 2GSSA 4AGSA 1EGRA 4MABA 2KP2A 4XRDA 2H1BA 3PR8A 2XPEA 4KW6A 3IC4A 3QFBC 5JWQB 4CDOA 1SJZA 2G2QA 2MMAA 5F8BA 1ZGNA 3VWWA 3UEMA 3BCKA 2HRFA 2DMMA 1SENA 4OWYA 1YF0A 2VCZA 3F9UA 2DIYA 5D96A 3EMPA 3KJYA 1PFOA 4NV2A 3FK8A 1M0UA 1S3AA 2GSTA 2GZPA 2PPTA 2CAQA 1G7EA 1DUGA 2GSQA 4OFMA 5DJLA 2JZRA 4ECJA 4EIQA 4HU7A 3PINA 4HOJA 2PBJA 4ZBDA 4DVCA 1PGTA 4EO3A 3IXRA 3VFIA 5B8BA 1AUCA 5JWOB 3LGCA 4MH3A 5L71A 1EOGA 2P0GA 2VCVA 3MYDA 1XIYA 1OVNA 1X5EA 1QQ2A 1AIUA 1V2AA 1X9SB 3EU4A 2ON7A 3LWAA 3DVXA 2LS5A 2CZ2A 3VWVA 3Q18A 5JWRB 2WRTA 4PNGA 4LL4B 3UAPA 2MZCA 3J7Yb 3G7JA 4BWSA 4CHSA 2D2ZA 5E59A 9GSSA 1TRUA 1GNEA 5J5NA 2YPMA 2V2GA 4PGTA 2E2GA 5J3RA 2DMLA 4RI6A 3LFLA 1V40A 1ZYEA 4EDYA 1KNGA 3K8NA 1T8EB 4CW9A 3WD6A 11GSA 4J2FA 4E8HA 5B6MA 2OE1A 2DJ1A 1PL1A 3M3MA 1XWAA 5G5EA 3TOUA 3EWLA 5ELGA 5BMUA 2MMZA 1UC7A 2I3YA 4PTSA 5CRWA 2ALBA 3RHBA 2C1YA 1XCCA 2EIQA 2RLIA 2L4CA 3DVWA 4I6XA 2H1DA 5AN1A 16GSA 3DKSA 5ECIB 2GVPA 1QGVA 2WB9A 4MF5A 1OE7A 1K0BA 1J9BA 2GLRA 1TXXA 2WS2A 3KMOA 1OE8A 3LG6A 5IIZA 22GSA 1TP9A 4I97A 2REMA 2C4JA 1T00A 3CRUA 1ZL9A 2A4VA 1X5DA 4HU9A 1T7PB 5FHIA 5DBQA 1XOBA 2GT6A 2YWIA 3GH6A 2TRCP 3KH7A 3H8QA 1XZOA 3J7Yk 1M2DA 2LKUA 4DSSA 2OE3A 2HXKA 2O85A 3P7XA 5IO2A 5KN1A 2YJHA 3DRNA 3TDGA 4GXZA 1Q98A 4DSSB 4EUYA 4ZILA 7GSSA 3CQFA 4K2DA 1OYJA 2VLTA 3R2QA 4TOPA 2H0IA 2RUFA 3M9JA 5D73A 1I9DA 2N5AA 4KH7A 2HT9A 5ELAA 1YQ1A 1Z7RA 3HCZA 1YJ6A 3P90A 1X9WB 2LV3A 3GA4A 4ZL9A 3US3A 4XTSA 2R3XA 1K0NA
chains in the Genus database with same CATH topology
3EPTA 1MDKA 1U6TA 1HNAA 2QC7A 1AC1A 4FYUA 1FB6A 2C0FA 1EEJA 2LTKA 2L5LA 1F2EA 3FYGA 4ACSA 3CSJA 1XW9A 3A2XA 4MJEA 3QMXA 4XS6A 4ECCA 1AW9A 3IHQA 3CTFA 3CRTA 2KOKA 4IW9A 3FMWA 2I4AA 1C72A 4NMUA 2WFCA 2AB6A 5IMDA 1ZYPA 2R5GA 1A8YA 5DCGA 4KDUA 5F0GA 4KA0A 3RPPA 5A4UA 12GSA 2O89A 2C0GA 4ISDA 3C73A 1TRSA 4TR1A 1FVJA 1EV9A 1XOAA 4N30A 2H8LA 2C80A 2KHPA 3H4KA 1XPVA 4KUNA 4CY8A 2FA4A 2DKHA 1N8JA 4WR5A 2X4AA 2PN8A 4GCIA 3C7MA 2RM5A 2CQ9A 1Z3EA 3ZVJA 4TKYA 1ML6A 3GMFA 1X9MB 1GL8A 2M72A 5HR1A 3UJ1A 4ZXGA 5GZZB 2L59A 3GTUA 3BCIA 3KP8A 2GQMA 5IMVA 2N5FA 3ZITA 3MIXA 5D9WA 1Z7PA 19GSA 1B4PA 3MDKA 3GTUB 4KCAA 4YAPA 1JZWA 3F4SA 5ECNB 4YQVA 4X0XA 2WCIA 2HSYA 3N9JA 2CVDA 5J9BA 2RUEA 4JZQA 4N10A 4ZIJA 2ES7A 3D0ZA 3U5RE 3H93A 3VWUA 5J4UA 5AIVA 1UN2A 4DSQA 2HI7A 5J41A 3ZIVA 4LMVA 3HZ8A 4IGJA 3TOTA 3GKNA 4K9ZA 2AHEA 4MPGA 4EE0A 4MA9A 3GL5A 4HDEA 1X5CA 2VCXA 4G19A 3LXZA 2H71A 4EL1A 2VL9A 2AYTA 1FB0A 3GKXA 2LEGA 1AQXA 1ABAA 2XPDA 1WRYA 1A0FA 5B6NA 3ERWA 3E0UA 2UZ8A 1SKSB 3W6GA 2HLSA 1MDJA 4Z2RA 3DYRA 2NDOA 2DC5A 3KCMA 3TGZA 5CRHA 4CY6A 5IM9A 2BTOT 2YOIA 1JHBA 4WEYA 4ZL8A 5A4VA 1V98A 6GSVA 3KGKA 4KCEA 4POMA 1TU8A 1T3BA 4DSRA 1M7TA 1G6WA 2HE3A 4HZ2A 1BQ7A 4X43A 4IVFA 1EEMA 2BMXA 1A23A 5G30A 3ZFBA 5FT3A 2ZCTA 1TDIA 4MF7A 1XVQA 1FO5A 4LA1A 3APOA 3ZL5A 5GSTA 1BG5A 2H72A 4HJMA 3IK7A 1TU7A 1WP0A 1R5AA 2FNOA 1GWCA 3L4NA 1G6YA 3KD0A 1PMTA 4POBA 3CMIA 4OD7A 4TXOA 2O87A 2V41A 5KN2A 3F3RA 2IJYA 2WDUA 3D4TA 4TXOB 3RDWA 3TKQA 1SJIA 5CNWA 5CYYA 3WYWA 3NZNA 1AQVA 1TJDA 4LLRA 2L6CA 2RM6A 2DJ2A 2H6XA 1SD9A 2V32A 4K7IA 1F6MC 3KM6A 1A24A 1A2LA 2H01A 1PQNA 2HFDA 3UARA 1YKAA 3VI5A 3G7IA 4Q5NA 2B5YA 4X1UA 4F2IA 8GSSA 4TRXA 5ECQB 2GZYA 1GSUA 3ZMLA 2H76A 1AQWA 4V2MA 4PURA 3A5IA 3L9VA 4G0IA 4HQZA 2YP6A 1VF2A 1PKZA 3KEBA 4XIHA 1EOHA 2LJKA 1ILOA 4EIPA 1GSEA 3AY8A 3FEUA 2M46A 4TR3A 1PA3A 4OFTA 2IL3A 5HQPA 1K0OA 1SL1B 2DJJA 1HYUA 3TKSE 1B8XA 1FOVA 1U88A 1G0TA 1SKRB 3QOUA 4YQMA 2JL4A 4EC0A 18GSA 3FW2A 4TR4A 4QQ7A 13GSA 4WF4A 2LUSA 3TJFA 1CQGA 1V57A 1GTAA 4K5RA 4TVEA 3TRXA 3MSZA 2MBTA 2QKEA 1B4QA 2DJKA 2L5OA 1U3AA 3DMLA 3EC3A 3IDVA 4HZ4A 3WGEA 4EKZA 3KIJA 4NV5A 3TJBA 1TRVA 1XWKA 4I5QA 1TK5B 3ZYWA 3GYKA 2Z9SA 4H86A 5JCWA 1PL2A 2R2JA 1Y6EA 3EURA 2N5BA 3N5OA 3IAS2 2M80A 2LJAA 2YCDA 3LYKA 2AV4A 3I43A 2VM2A 3F4TA 5DDLA 1A2JA 1GSQA 4V2NA 3BOAA 5G1LA 3IBHA 3GSSA 4L8EA 1MTCA 4D73A 1HNBA 4F03A 3GUSA 2F51A 1GULA 3ZRDA 2DKIA 4EDZA 4D73B 3RHCA 3LEFA 5ECPB 5HR0A 5A5KA 3D4MA 1H75A 1USBA 4JU5A 1F3BA 1OC9A 2O8VB 3TKSA 4TW5A 1NM3A 1YY7A 1OC9B 2X99A 2FWGA 1FOHA 5ENUA 1XBSA 3DXBA 3S9FA 4KAEA 2FUG2 3GX8A 4EXJA 5CP1A 2MBSA 5EY6A 5AISA 1YEPA 1SYRA 4POKA 5D8IA 5H5SA 5JCGA 3D22A 1YEXA 2QSIA 3WGDA 1TI3A 2JZTA 3LJRA 3ME7A 5EL8A 4FIWA 4RQRA 1KBNA 10GSA 3Q6OA 2C3QA 5EPFA 5D9VA 4MZCA 1NSWA 3TCOA 5KEJA 2K8VA 2VLVA 4KSMA 1DSBA 3GHAA 3GH9A 2X8CA 2KP1A 2TIRA 2HSMA 2I1UA 1O8XA 1F9MA 3M8NA 2HYXA 1K0MA 5ECSA 4O5RA 2X64A 1WJKA 3Q74A 6GSUA 2EIRA 4BPYA 2H74A 1BAYA 3WGXA 4USSA 6GSTA 4XRAA 2R6KA 1IYHA 4IP6A 1OKDA 4PX1A 1U87A 4PNFA 5ECMB 5J9CA 5HR2A 1ERUA 1XFLA 4NAXA 20GSA 3ZTLA 2VM1A 3HHVA 3ZIJA 1KTEA 3E3EA 3UL3A 4IQAA 1PD21 2LSTA 3GV1A 2K9FA 3ZMKA 2IMIA 2LQOA 4ECIA 1ZYQB 3HYPA 1PRXA 2R0PA 3KTLA 4GQFA 1MD3A 2R4VA 5KOXA 4O5QA 5KN0A 1MEKA 3F63A 5LD0A 3IOSA 5CREA 2K6VA 1O85A 1XWCA 3VWXA 4BVXA 4WBRD 1FW1A 3DWVA 2G0FA 5H5RA 3CTGA 2PERA 4MLYA 3APSA 1THOA 4BVXB 4I2TA 4MZWA 4QL9A 4Z2UA 1XWBA 2I81A 1TI1A 4P3YB 1TOFA 1O8WA 2PWJA 1PN0A 1QUWA 3GKKA 2L6DA 4PQHA 2LNTA 2FWHA 1JLWA 4JE1A 4KE3A 4NPBA 3DGQA 2VUPA 3GNJA 4TR1B 3CSHA 3EMXA 4N0ZA 2CVBA 1TKDB 4IQ1A 1GSFA 2GGTA 1LU4A 3LW9A 4G10A 3UIWA 2ON5A 3F3QA 1GP1A 1M2BA 2YV7A 1R4WA 3GIXA 5B8AA 3A2WA 3ISOA 3L0HA 2E7PA 2A2RA 2VCTA 4Z2TA 4POLA 2WGRA 3HA9A 1EP8A 3KMNA 2WZ9A 1TTZA 1B9YC 1FVKA 4QL7A 4PQIA 1W4VA 1LJRA 4MJAA 1VF3A 2LRNA 1Z5YE 1BEDA 4IHUA 2FD3A 2CZ3A 4BL7A 5GSSA 4NXIA 5DCHA 3ME8A 3I69A 2X49A 2YANA 2QA1A 3QFAC 2IMDA 3CYNA 4KNDA 4BL7B 3GURA 3KH9A 4KX4A 2K18A 3A3TA 3TRQA 3VPTA 4PXOA 3A2VA 4ICYA 3TKRA 3NOFA 6GSXA 1WMJA 2A2PA 5DAKA 1JZRA 2PVOC 4L0UA 4MJCA 4N11A 1OAZA 2PMTA 2B6MA 3DD3A 5DAKB 2IFQA 1DE1A 1UVZA 1XW5A 2IN3A 2FHEA 3IR4A 2GZZA 2DJ0A 1TRWA 3F6FA 4KDYA 3RAZA 2IFQB 2B1LA 6GSSA 2FA8A 3LQ7A 1U3IA 4WF5A 4L5OA 3P2AA 1SK2A 2O7KA 2H30A 4I8BA 5F07A 1WWJA 3O76A 2AUVA 1HNCA 4MJBA 4XS1A 2LJRA 2B5EA 4F0CA 5IMFA 4BA7A 3O3TA 4AF2A 4ZB9A 3EVIA 2H0GA 2X8GA 1SL0B 3HXSA 1B9XC 3I6AA 4WETA 4MPFA 1W89A 1JLVA 3KXOA 1Z9HA 5DQSA 4O5UA 1DBYA 4JBBA 2PGTA 3H79A 4OCEA 1Q4JA 1VRSD 2QGVA 3I9V2 4HQSA 4A5PA 3HJMA 4F9ZA 1JZDA 6GSWA 1ERVA 4XHMA 1XVWA 4L5LA 17GSA 4JR6A 3O6TA 2E2MA 2P31A 4MCUA 5A4WA 2OBIA 1UA5A 2JACA 1WPIA 3L78A 2GT5A 2VD1A 1T1VA 4GSTA 2VO4A 1TK8B 1OC3A 2OADA 5D9TA 4ML1A 4RUVA 2VCQA 4PQ1A 3M0FA 2F9SA 4LMWA 1GLQA 1GUKA 4OFNA 2DSAA 5IMCA 1GUHA 3QCPA 2JSYA 1M99A 1IYIA 4J57E 2CX3A 3ERGA 3W8SA 3D6IA 2V6KA 2VL2A 2CVKA 1GSSA 3C1SA 3G7YA 2XHFA 4MF6A 2MYGA 2CV4A 2DIZA 3FRCA 5ABRA 3TJGA 3FR6A 2XBQA 1V58A 3QAVA 1NHOA 2AJQB 3GRXA 4ML6A 3QAGA 3IPZA 2C8UA 1DE2A 2JADA 4ZB8A 3GX0A 4AJ7A 2EC4A 4Q5RA 4F0BA 2LQQA 1SJ6A 2EIOA 3C1RA 4ZBBA 3EU3A 5G5FA 1ERWA 1SYXA 4X4JA 2IMKA 2GDRA 4MH2A 4OO5A 2B5XA 3FZ4A 4MDCA 1RQMA 3LSZA 4MK3A 5ECLB 2JSZA 1FHEA 3TUEA 1R7HA 4NHWA 1XXUA 5COHA 4GF0A 2VIMA 1FAAA 3HJOA 4Z7XA 4ID0A 3HY2A 4EVMA 5IOXA 3SBCA 2V6OA 3HVVA 3MAKA 2IMEA 4GSSA 4V2LA 1GNWA 2TRXA 1SK1A 2YWMA 4IJIA 2VD0A 1G7OA 1O81A 2NVLA 3RPNA 4OCFA 4MZBA 4WR4A 4RI7A 5HR3A 4HUAA 1VF4A 3IAM2 4YH2A 2P5RA 2R37A 2VLUA 4ILFA 3IC8A 1WOUA 4IELA 4TXVA 4GRFA 2ZUPA 5HFGA 4MP4A 5BRTA 2NPBA 2DLXA 1HQOA 4NWYA 2H0HA 1B48A 3UBKA 3F0IA 4K8MA 1ZZYA 2IWTA 3A5WA 1K0DA 1PKWA 1F3AA 4GSNA 4I2UA 4KGIA 1YDKA 2PU9C 3PH9A 3V1WA 1GTBA 2GSRA 5C00A 1I5GA 4GWRA 3ZZXA 2YN1A 1ST9A 1V9WA 4OO4A 4OMVA 3EYTA 5KN3A 5LNKe 4HS1A 4ULXA 2F3MA 1F37A 1JFUA 4DEJA 5EVOA 1GSYA 2IMFA 3MNGA 3IE3A 3UVHA 3APQA 5IMAA 4K6XA 3CXGA 1QMVA 1ON4A 4G9HA 1YKCA 1PX7A 3FY7A 2HSHA 5CRDA 2KUCA 3WT1A 3FZ9A 2X8HA 2H73A 2YV9A 2YZUA 2YJ7A 4ZL7A 3FR9A 1EGOA 3PPUA 1GSDA 1GH2A 4O7HA 1K0CA 2KLXA 3JCML 3TKPA 2CA8A 3QDNA 4K0GA 2YNXA 1EZKA 5CRGA 1A8LA 2CX4A 2OKAA 5DQYA 2XC2A 1R26A 1SL2B 1A2MA 5IO0A 1M2AA 2LRCA 4IBPA 1E6BA 2B7KA 2CAIA 2HZFA 2PVQA 2GQLA 1ZMAA 3HVXA 1KEBA 14GSA 3Q19A 2H1AA 4G0LA 1URMA 3G9BA 1QXHA 2H70A 2HNLA 3VI7A 5ID2A 6GSYA 4O92A 1X0RA 2MMOA 1NW2A 1R5PA 5LCZA 3GN3A 5ID2B 1O6JA 1J0FA 1XW6A 4N0VA 4GTUA 3KTBA 2AAWA 3ZLPA 5G31A 4AJ8A 2IIYA 3E9JB 3F4RA 5IPGA 1AXDA 2FCHA 4YKFA 3D5JA 4PUAA 1PSQA 4IKHA 3FHKA 2GS3A 3OR5A 4GLTA 2B1KA 1E2YA 2YWNA 2C3TA 4FO5A 4MNNA 1H4OA 1THXA 5ECHB 5ECKB 2CT6A 5DVBA 4IN0A 4XS4A 2H75A 1Z6MA 3FZAA 2F8AA 1ACVA 2JU5A 2VCWA 5KOWA 4XS4B 2MMNA 3H1NA 3D21A 4NHZA 5DALA 4K7NA 3IV4A 1NHYA 5ECRB 1GUMA 1VGLA 1ZYNA 3M1GA 1EV4A 3L9UA 2R0CA 3HDCA 5DALB 2HZEA 4ZBAA 2HRNA 4IS0A 3GKMA 3GSTA 1BX9A 2H6YA 5D93A 3F6DA 2H1GA 2C0EA 2HZEB 3ED3A 2V1MA 3DIEA 1K3LA 2OA7A 3IK9A 3EE2A 3WT2A 3FR3A 4YAVA 3MWHA 1EWXA 4HI7A 1O7UA 4JR4A 1T4YA 1EP7A 5ECOB 2VOCA 1XWGA 3U6VA 2P5QA 1K0AA 4TN8A 5F05A 2NTOA 2L4QA 3SWLA 2L57A 3GFKA 3RBTA 3QPMA 4K0NA 2LRTA 4IP1A 4K5SA 2NBSA 1O73A 1Z6NA 2R0GA 5HFIA 2C3NA 3CSIA 2BJXA 1K3YA 1S3CA 1ZCPA 2A4HA 3F8UA 4XCSA 5INYA 3HKRA 1RW1A 1QK8A 2GQKA 2E0QA 4YKGA 2OACA 2K8SA 3KZQA 3LYPA 1RK4A 2F8FA 1A0RP 1TK0B 3L9SA 3UMAA 2LNSA 2VL3A 1JZOA 3HD5A 4WBJA 4K1FA 3TRPA 1BYEA 1MDIA 3FKFA 4V1Ag 5C04A 1K3OA 1S3DA 3P8WA 2H19A 1GLPA 3IHGA 2VAFA 3C8EA 2B7JA 1LBKA 1SU9A 5G1KA 2H6ZA 3CBUA 3HJPA 3IA1A 3BD2A 2VL2C 5D9XA 4Q5QA 3R3EA 2JZSA 2DJ3A 3NIVA 1GTUA 1PX6A 1VF1A 3BBYA 4FYBA 4YQUA 4K7OA 1GRXA 1YZXA 4AJ6A 1Y25A 3LXTA 4L0WA 3W8JA 1SK0A 4WKWA 5G2ZA 2FGXA 2J23A 5CAXA 3PGTA 4J56E 3C71A 3UBLA 4JRRA 2B3SA 3UVTA 2RIIA 5IMZA 2FWEA 2YWOA 3TB2A 3VLNA 5IQYA 3UOMA 5IPHA 2DBCA 4FYCA 3TJJA 3VK9A 2A2SA 2FY6A 3IRAA 2OE0A 3M9KA 4G0KA 4TR0A 4HEA2 4ZB6A 1AAZA 2WULA 4KSOA 3ZREA 3FZ5A 1T4ZA 2I9HA 1YF1A 2GTUA 1SD8A 1M9AA 2ZNMA 1OC8A 2QA2A 1FG4A 5E4WA 1HD2A 1M9BA 4FQUA 3VURA 4GQCA 3TJKA 2H66A 4FH8A 2FWFA 2HRKA 4O32A 3HVSA 3QR6A 4BVYA 4F82A 1ERTA 1PN9A 4V1Ap 2OJLA 5DJMA 5AGYA 4LL1B 1TW9A 1WE0A 4BWQA 3DEXA 4BVYB 5FWGA 4K2XA 5B7CA 4MMMA 4HJ2A 1MD4A 1GTIA 3GL3A 2YZHA 1QFNA 1J08A 3QD9A 2J9HA 3QAWA 3BJ5A 3ZFLA 1CQHA 5GAPD 5AIXA 2FLSA 4WXTA 3LORA 4RQXA 5CO3A 4E8EA 2WJUA 2OBKA 1WIKA 1N2AA 2PUKC 1BJXA 2HRAA 2C0DA 5JCUA 1OKTA 3KP9A 3VPQA 4PUFC 5H5QA 1ZOFA 4KDXA 5IOWA 4KF9A 1SKWB 4G2EA 5F06A 4IJ3A 4Q5FA 5HFKA 2IPAA 4KB3A 2XBIA 3ZVJD 3HZ4A 3EINA 3TKSC 4EF0A 3ERFA 4JEDA 5GAND 4ECBA 2GSSA 4AGSA 1EGRA 4MABA 2KP2A 4XRDA 2H1BA 3PR8A 2XPEA 4KW6A 3IC4A 3QFBC 5JWQB 4CDOA 1SJZA 2G2QA 2MMAA 5F8BA 1ZGNA 3VWWA 3UEMA 3BCKA 2HRFA 2DMMA 1SENA 4OWYA 1YF0A 2VCZA 3F9UA 2DIYA 5D96A 3EMPA 3KJYA 4NV2A 3FK8A 1M0UA 1S3AA 2GSTA 2GZPA 2PPTA 2CAQA 1G7EA 1DUGA 2GSQA 4OFMA 5DJLA 2JZRA 4ECJA 4EIQA 4HU7A 3PINA 4HOJA 2PBJA 4ZBDA 4DVCA 1PGTA 4EO3A 3IXRA 3VFIA 5B8BA 1AUCA 5JWOB 3LGCA 4MH3A 5L71A 1EOGA 2P0GA 2VCVA 3MYDA 1XIYA 1OVNA 1X5EA 1QQ2A 1AIUA 1V2AA 1X9SB 3EU4A 2ON7A 3LWAA 3DVXA 2LS5A 2CZ2A 3VWVA 3Q18A 5JWRB 2WRTA 4PNGA 4LL4B 3UAPA 2MZCA 3J7Yb 3G7JA 4BWSA 4CHSA 2D2ZA 5E59A 9GSSA 1TRUA 1GNEA 5J5NA 2YPMA 2V2GA 4PGTA 2E2GA 5J3RA 2DMLA 4RI6A 3LFLA 1V40A 1ZYEA 4EDYA 1KNGA 3K8NA 1T8EB 4CW9A 3WD6A 11GSA 4J2FA 4E8HA 5B6MA 2OE1A 2DJ1A 1PL1A 3M3MA 1XWAA 5G5EA 3TOUA 3EWLA 5ELGA 5BMUA 2MMZA 1UC7A 2I3YA 4PTSA 5CRWA 2ALBA 3RHBA 2C1YA 1XCCA 2EIQA 2RLIA 2L4CA 3DVWA 4I6XA 2H1DA 5AN1A 16GSA 3DKSA 5ECIB 2GVPA 1QGVA 2WB9A 4MF5A 1OE7A 1K0BA 1J9BA 2GLRA 1TXXA 2WS2A 3KMOA 1OE8A 3LG6A 5IIZA 22GSA 1TP9A 4I97A 2REMA 2C4JA 1T00A 3CRUA 1ZL9A 2A4VA 1X5DA 4HU9A 1T7PB 5FHIA 5DBQA 1XOBA 2GT6A 2YWIA 3GH6A 2TRCP 3KH7A 3H8QA 1XZOA 3J7Yk 1M2DA 2LKUA 4DSSA 2OE3A 2HXKA 2O85A 3P7XA 5IO2A 5KN1A 2YJHA 3DRNA 3TDGA 4GXZA 1Q98A 4DSSB 4EUYA 4ZILA 7GSSA 4K2DA 1OYJA 2VLTA 3R2QA 4TOPA 2H0IA 2RUFA 3M9JA 5D73A 1I9DA 2N5AA 4KH7A 2HT9A 5ELAA 1YQ1A 1Z7RA 3HCZA 1YJ6A 3P90A 1X9WB 2LV3A 3GA4A 4ZL9A 3US3A 4XTSA 2R3XA 1K0NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MDK A;  1U6T A;  1HNA A;  2QC7 A;  1AC1 A;  4FYU A;  1FB6 A;  2C0F A;  1EEJ A;  2LTK A;  2L5L A;  1F2E A;  3FYG A;  4ACS A;  3CSJ A;  1XW9 A;  3A2X A;  4MJE A;  3QMX A;  4XS6 A;  4ECC A;  1AW9 A;  3IHQ A;  3CTF A;  3CRT A;  2KOK A;  4IW9 A;  2I4A A;  1C72 A;  4NMU A;  2WFC A;  2AB6 A;  5IMD A;  2R5G A;  1A8Y A;  5DCG A;  4KDU A;  5F0G A;  4KA0 A;  3RPP A;  5A4U A;  12GS A;  2O89 A;  2C0G A;  4ISD A;  3C73 A;  1TRS A;  4TR1 A;  1FVJ A;  1EV9 A;  1XOA A;  4N30 A;  2H8L A;  2C80 A;  2KHP A;  3H4K A;  1XPV A;  4KUN A;  2FA4 A;  1N8J A;  4WR5 A;  2PN8 A;  4GCI A;  3C7M A;  2RM5 A;  2CQ9 A;  1Z3E A;  3ZVJ A;  4TKY A;  1ML6 A;  3GMF A;  1X9M B;  1GL8 A;  2M72 A;  5HR1 A;  3UJ1 A;  4ZXG A;  5GZZ B;  2L59 A;  3GTU A;  3BCI A;  3KP8 A;  2GQM A;  5IMV A;  2N5F A;  3ZIT A;  5D9W A;  1Z7P A;  19GS A;  1B4P A;  3MDK A;  3GTU B;  4KCA A;  4YAP A;  1JZW A;  3F4S A;  5ECN B;  4YQV A;  4X0X A;  2WCI A;  2HSY A;  3N9J A;  2CVD A;  5J9B A;  2RUE A;  4JZQ A;  4N10 A;  4ZIJ A;  2ES7 A;  3D0Z A;  3U5R E;  3H93 A;  3VWU A;  5J4U A;  5AIV A;  1UN2 A;  4DSQ A;  2HI7 A;  5J41 A;  3ZIV A;  4LMV A;  3HZ8 A;  4IGJ A;  3TOT A;  3GKN A;  4K9Z A;  2AHE A;  4MPG A;  4EE0 A;  4MA9 A;  3GL5 A;  4HDE A;  1X5C A;  2VCX A;  4G19 A;  3LXZ A;  2H71 A;  4EL1 A;  2VL9 A;  2AYT A;  1FB0 A;  3GKX A;  2LEG A;  1AQX A;  1ABA A;  2XPD A;  1WRY A;  1A0F A;  5B6N A;  3ERW A;  3E0U A;  1SKS B;  3W6G A;  2HLS A;  1MDJ A;  3DYR A;  2NDO A;  2DC5 A;  3KCM A;  3TGZ A;  5CRH A;  5IM9 A;  2BTO T;  2YOI A;  1JHB A;  4WEY A;  4ZL8 A;  5A4V A;  1V98 A;  6GSV A;  3KGK A;  4KCE A;  4POM A;  1TU8 A;  1T3B A;  4DSR A;  1M7T A;  1G6W A;  2HE3 A;  4HZ2 A;  1BQ7 A;  4X43 A;  4IVF A;  1EEM A;  2BMX A;  1A23 A;  5G30 A;  3ZFB A;  5FT3 A;  2ZCT A;  1TDI A;  4MF7 A;  1XVQ A;  1FO5 A;  4LA1 A;  3APO A;  3ZL5 A;  5GST A;  1BG5 A;  2H72 A;  4HJM A;  3IK7 A;  1TU7 A;  1WP0 A;  1R5A A;  2FNO A;  1GWC A;  3L4N A;  1G6Y A;  3KD0 A;  1PMT A;  4POB A;  3CMI A;  4OD7 A;  4TXO A;  2O87 A;  2V41 A;  5KN2 A;  3F3R A;  2IJY A;  2WDU A;  3D4T A;  4TXO B;  3RDW A;  3TKQ A;  1SJI A;  5CNW A;  5CYY A;  3WYW A;  3NZN A;  1AQV A;  1TJD A;  4LLR A;  2L6C A;  2RM6 A;  2DJ2 A;  2H6X A;  1SD9 A;  2V32 A;  4K7I A;  1F6M C;  3KM6 A;  1A24 A;  1A2L A;  2H01 A;  1PQN A;  2HFD A;  3UAR A;  1YKA A;  3VI5 A;  3G7I A;  4Q5N A;  2B5Y A;  4X1U A;  4F2I A;  8GSS A;  4TRX A;  5ECQ B;  2GZY A;  1GSU A;  3ZML A;  2H76 A;  1AQW A;  4V2M A;  4PUR A;  3L9V A;  4HQZ A;  2YP6 A;  1VF2 A;  1PKZ A;  3KEB A;  4XIH A;  1EOH A;  2LJK A;  1ILO A;  1GSE A;  3AY8 A;  3FEU A;  2M46 A;  4TR3 A;  1PA3 A;  4OFT A;  2IL3 A;  5HQP A;  1K0O A;  1SL1 B;  2DJJ A;  1HYU A;  3TKS E;  1B8X A;  1FOV A;  1U88 A;  1G0T A;  1SKR B;  3QOU A;  4YQM A;  2JL4 A;  4EC0 A;  18GS A;  3FW2 A;  4TR4 A;  4QQ7 A;  13GS A;  4WF4 A;  2LUS A;  3TJF A;  1CQG A;  1V57 A;  1GTA A;  4TVE A;  3TRX A;  3MSZ A;  2MBT A;  2QKE A;  1B4Q A;  2DJK A;  2L5O A;  1U3A A;  3DML A;  3EC3 A;  3IDV A;  4HZ4 A;  3WGE A;  4EKZ A;  3KIJ A;  4NV5 A;  3TJB A;  1TRV A;  1XWK A;  4I5Q A;  1TK5 B;  3ZYW A;  3GYK A;  2Z9S A;  4H86 A;  5JCW A;  1PL2 A;  2R2J A;  1Y6E A;  3EUR A;  2N5B A;  3N5O A;  3IAS 2;  2M80 A;  2LJA A;  2YCD A;  3LYK A;  2AV4 A;  3I43 A;  2VM2 A;  3F4T A;  5DDL A;  1A2J A;  1GSQ A;  4V2N A;  3BOA A;  5G1L A;  3IBH A;  3GSS A;  4L8E A;  1MTC A;  4D73 A;  1HNB A;  4F03 A;  3GUS A;  2F51 A;  1GUL A;  3ZRD A;  4EDZ A;  4D73 B;  3RHC A;  3LEF A;  5ECP B;  5HR0 A;  5A5K A;  3D4M A;  1H75 A;  1USB A;  4JU5 A;  1F3B A;  1OC9 A;  2O8V B;  3TKS A;  4TW5 A;  1NM3 A;  1YY7 A;  1OC9 B;  2X99 A;  2FWG A;  5ENU A;  1XBS A;  3DXB A;  3S9F A;  4KAE A;  2FUG 2;  3GX8 A;  4EXJ A;  5CP1 A;  2MBS A;  5EY6 A;  5AIS A;  1YEP A;  1SYR A;  4POK A;  5D8I A;  5H5S A;  5JCG A;  3D22 A;  1YEX A;  2QSI A;  3WGD A;  1TI3 A;  2JZT A;  3LJR A;  3ME7 A;  5EL8 A;  4FIW A;  4RQR A;  1KBN A;  10GS A;  3Q6O A;  2C3Q A;  5EPF A;  5D9V A;  4MZC A;  1NSW A;  3TCO A;  5KEJ A;  2K8V A;  2VLV A;  4KSM A;  1DSB A;  3GHA A;  3GH9 A;  2X8C A;  2KP1 A;  2TIR A;  2I1U A;  1O8X A;  1F9M A;  3M8N A;  2HYX A;  1K0M A;  5ECS A;  4O5R A;  2X64 A;  1WJK A;  3Q74 A;  6GSU A;  2EIR A;  4BPY A;  2H74 A;  1BAY A;  3WGX A;  6GST A;  4XRA A;  2R6K A;  1IYH A;  4IP6 A;  1OKD A;  4PX1 A;  1U87 A;  4PNF A;  5ECM B;  5J9C A;  5HR2 A;  1ERU A;  1XFL A;  4NAX A;  20GS A;  3ZTL A;  2VM1 A;  3HHV A;  3ZIJ A;  1KTE A;  3E3E A;  3UL3 A;  4IQA A;  1PD2 1;  2LST A;  3GV1 A;  2K9F A;  3ZMK A;  2IMI A;  2LQO A;  4ECI A;  1ZYQ B;  3HYP A;  1PRX A;  3KTL A;  4GQF A;  1MD3 A;  2R4V A;  5KN0 A;  1MEK A;  3F63 A;  5LD0 A;  3IOS A;  5CRE A;  2K6V A;  1O85 A;  1XWC A;  3VWX A;  4BVX A;  4WBR D;  1FW1 A;  3DWV A;  2G0F A;  5H5R A;  3CTG A;  2PER A;  4MLY A;  3APS A;  1THO A;  4I2T A;  4MZW A;  4QL9 A;  1XWB A;  2I81 A;  1TI1 A;  4P3Y B;  1TOF A;  1O8W A;  2PWJ A;  1QUW A;  3GKK A;  2L6D A;  4PQH A;  2LNT A;  2FWH A;  1JLW A;  4JE1 A;  4KE3 A;  4NPB A;  3DGQ A;  2VUP A;  3GNJ A;  4TR1 B;  3CSH A;  3EMX A;  4N0Z A;  2CVB A;  1TKD B;  4IQ1 A;  1GSF A;  2GGT A;  1LU4 A;  4G10 A;  3UIW A;  2ON5 A;  3F3Q A;  1GP1 A;  1M2B A;  2YV7 A;  1R4W A;  3GIX A;  5B8A A;  3A2W A;  3ISO A;  3L0H A;  2E7P A;  2A2R A;  2VCT A;  4POL A;  2WGR A;  3HA9 A;  1EP8 A;  3KMN A;  2WZ9 A;  1TTZ A;  1B9Y C;  1FVK A;  4QL7 A;  4PQI A;  1W4V A;  1LJR A;  4MJA A;  1VF3 A;  2LRN A;  1Z5Y E;  1BED A;  4IHU A;  2FD3 A;  2CZ3 A;  4BL7 A;  5GSS A;  4NXI A;  5DCH A;  3ME8 A;  3I69 A;  2YAN A;  3QFA C;  2IMD A;  3CYN A;  4KND A;  3GUR A;  3KH9 A;  4KX4 A;  2K18 A;  3A3T A;  3TRQ A;  3VPT A;  4PXO A;  3A2V A;  3TKR A;  3NOF A;  6GSX A;  1WMJ A;  5DAK A;  1JZR A;  2PVO C;  4L0U A;  4MJC A;  4N11 A;  1OAZ A;  2PMT A;  2B6M A;  3DD3 A;  5DAK B;  2IFQ A;  1DE1 A;  1UVZ A;  1XW5 A;  2IN3 A;  2FHE A;  3IR4 A;  2GZZ A;  2DJ0 A;  1TRW A;  3F6F A;  4KDY A;  3RAZ A;  2IFQ B;  2B1L A;  6GSS A;  2FA8 A;  3LQ7 A;  1U3I A;  4WF5 A;  4L5O A;  3P2A A;  1SK2 A;  2O7K A;  2H30 A;  4I8B A;  5F07 A;  1WWJ A;  3O76 A;  2AUV A;  1HNC A;  4MJB A;  4XS1 A;  2LJR A;  2B5E A;  4F0C A;  5IMF A;  4BA7 A;  3O3T A;  4AF2 A;  4ZB9 A;  3EVI A;  2H0G A;  2X8G A;  1SL0 B;  3HXS A;  1B9X C;  3I6A A;  4WET A;  4MPF A;  1W89 A;  1JLV A;  3KXO A;  1Z9H A;  5DQS A;  1DBY A;  4JBB A;  2PGT A;  3H79 A;  4OCE A;  1Q4J A;  1VRS D;  2QGV A;  3I9V 2;  4HQS A;  3HJM A;  4F9Z A;  1JZD A;  6GSW A;  1ERV A;  4XHM A;  1XVW A;  4L5L A;  17GS A;  4JR6 A;  3O6T A;  2E2M A;  2P31 A;  4MCU A;  5A4W A;  2OBI A;  1UA5 A;  2JAC A;  1WPI A;  3L78 A;  2GT5 A;  2VD1 A;  1T1V A;  4GST A;  2VO4 A;  1TK8 B;  1OC3 A;  2OAD A;  5D9T A;  4ML1 A;  4RUV A;  2VCQ A;  4PQ1 A;  3M0F A;  2F9S A;  4LMW A;  1GLQ A;  1GUK A;  4OFN A;  2DSA A;  5IMC A;  1GUH A;  3QCP A;  2JSY A;  1M99 A;  1IYI A;  4J57 E;  2CX3 A;  3ERG A;  3W8S A;  3D6I A;  2V6K A;  2VL2 A;  2CVK A;  1GSS A;  3C1S A;  3G7Y A;  2XHF A;  4MF6 A;  2MYG A;  2CV4 A;  2DIZ A;  3FRC A;  5ABR A;  3TJG A;  3FR6 A;  2XBQ A;  1V58 A;  3QAV A;  1NHO A;  2AJQ B;  3GRX A;  4ML6 A;  3QAG A;  3IPZ A;  2C8U A;  1DE2 A;  2JAD A;  4ZB8 A;  3GX0 A;  4AJ7 A;  2EC4 A;  4Q5R A;  4F0B A;  2LQQ A;  1SJ6 A;  2EIO A;  3C1R A;  4ZBB A;  3EU3 A;  5G5F A;  1ERW A;  1SYX A;  2IMK A;  2GDR A;  4MH2 A;  4OO5 A;  2B5X A;  3FZ4 A;  4MDC A;  1RQM A;  3LSZ A;  4MK3 A;  5ECL B;  2JSZ A;  1FHE A;  3TUE A;  1R7H A;  4NHW A;  1XXU A;  5COH A;  4GF0 A;  2VIM A;  1FAA A;  3HJO A;  4Z7X A;  4ID0 A;  3HY2 A;  4EVM A;  5IOX A;  3SBC A;  2V6O A;  3HVV A;  3MAK A;  2IME A;  4GSS A;  4V2L A;  1GNW A;  2TRX A;  1SK1 A;  2YWM A;  4IJI A;  2VD0 A;  1G7O A;  1O81 A;  2NVL A;  3RPN A;  4OCF A;  4MZB A;  4WR4 A;  4RI7 A;  5HR3 A;  4HUA A;  1VF4 A;  3IAM 2;  4YH2 A;  2P5R A;  2R37 A;  2VLU A;  4ILF A;  1WOU A;  4IEL A;  4TXV A;  4GRF A;  2ZUP A;  5HFG A;  4MP4 A;  2NPB A;  2DLX A;  1HQO A;  4NWY A;  2H0H A;  1B48 A;  3UBK A;  3F0I A;  4K8M A;  1ZZY A;  2IWT A;  3A5W A;  1K0D A;  1PKW A;  1F3A A;  4GSN A;  4I2U A;  4KGI A;  1YDK A;  2PU9 C;  3PH9 A;  3V1W A;  1GTB A;  2GSR A;  5C00 A;  1I5G A;  4GWR A;  3ZZX A;  2YN1 A;  1ST9 A;  1V9W A;  4OO4 A;  4OMV A;  3EYT A;  5KN3 A;  5LNK e;  4HS1 A;  4ULX A;  2F3M A;  1F37 A;  1JFU A;  4DEJ A;  5EVO A;  1GSY A;  2IMF A;  3MNG A;  3IE3 A;  3UVH A;  3APQ A;  5IMA A;  4K6X A;  3CXG A;  1QMV A;  1ON4 A;  4G9H A;  1YKC A;  1PX7 A;  3FY7 A;  2HSH A;  5CRD A;  2KUC A;  3WT1 A;  3FZ9 A;  2X8H A;  2H73 A;  2YV9 A;  2YZU A;  2YJ7 A;  4ZL7 A;  3FR9 A;  1EGO A;  1GSD A;  1GH2 A;  4O7H A;  1K0C A;  2KLX A;  3JCM L;  3TKP A;  2CA8 A;  3QDN A;  4K0G A;  2YNX A;  1EZK A;  5CRG A;  1A8L A;  2CX4 A;  2OKA A;  5DQY A;  2XC2 A;  1R26 A;  1SL2 B;  1A2M A;  5IO0 A;  1M2A A;  2LRC A;  4IBP A;  1E6B A;  2B7K A;  2CAI A;  2HZF A;  2PVQ A;  2GQL A;  1ZMA A;  3HVX A;  1KEB A;  14GS A;  3Q19 A;  2H1A A;  1URM A;  3G9B A;  1QXH A;  2H70 A;  2HNL A;  3VI7 A;  5ID2 A;  6GSY A;  4O92 A;  1X0R A;  2MMO A;  1NW2 A;  1R5P A;  5LCZ A;  3GN3 A;  5ID2 B;  1O6J A;  1J0F A;  1XW6 A;  4N0V A;  4GTU A;  3KTB A;  2AAW A;  3ZLP A;  5G31 A;  4AJ8 A;  2IIY A;  3E9J B;  3F4R A;  5IPG A;  1AXD A;  2FCH A;  3D5J A;  4PUA A;  1PSQ A;  4IKH A;  3FHK A;  2GS3 A;  3OR5 A;  4GLT A;  2B1K A;  1E2Y A;  2YWN A;  2C3T A;  4FO5 A;  1H4O A;  1THX A;  5ECH B;  5ECK B;  2CT6 A;  5DVB A;  4IN0 A;  4XS4 A;  2H75 A;  1Z6M A;  3FZA A;  2F8A A;  1ACV A;  2JU5 A;  2VCW A;  4XS4 B;  2MMN A;  3H1N A;  3D21 A;  4NHZ A;  5DAL A;  4K7N A;  3IV4 A;  1NHY A;  5ECR B;  1GUM A;  1VGL A;  3M1G A;  1EV4 A;  3L9U A;  3HDC A;  5DAL B;  2HZE A;  4ZBA A;  2HRN A;  4IS0 A;  3GKM A;  3GST A;  1BX9 A;  2H6Y A;  5D93 A;  3F6D A;  2H1G A;  2C0E A;  2HZE B;  3ED3 A;  2V1M A;  3DIE A;  1K3L A;  2OA7 A;  3IK9 A;  3EE2 A;  3WT2 A;  3FR3 A;  4YAV A;  3MWH A;  1EWX A;  4HI7 A;  1O7U A;  4JR4 A;  1T4Y A;  1EP7 A;  5ECO B;  2VOC A;  1XWG A;  3U6V A;  2P5Q A;  1K0A A;  4TN8 A;  5F05 A;  2NTO A;  2L4Q A;  3SWL A;  2L57 A;  3GFK A;  3RBT A;  3QPM A;  4K0N A;  2LRT A;  4IP1 A;  2NBS A;  1O73 A;  1Z6N A;  5HFI A;  2C3N A;  3CSI A;  2BJX A;  1K3Y A;  1S3C A;  1ZCP A;  3F8U A;  4XCS A;  5INY A;  3HKR A;  1RW1 A;  1QK8 A;  2GQK A;  2E0Q A;  2OAC A;  2K8S A;  3KZQ A;  3LYP A;  1RK4 A;  2F8F A;  1A0R P;  1TK0 B;  3L9S A;  3UMA A;  2LNS A;  2VL3 A;  1JZO A;  3HD5 A;  4WBJ A;  4K1F A;  3TRP A;  1BYE A;  1MDI A;  3FKF A;  4V1A g;  5C04 A;  1K3O A;  1S3D A;  3P8W A;  2H19 A;  1GLP A;  2VAF A;  3C8E A;  2B7J A;  1LBK A;  1SU9 A;  5G1K A;  2H6Z A;  3CBU A;  3HJP A;  3IA1 A;  3BD2 A;  2VL2 C;  5D9X A;  4Q5Q A;  2JZS A;  2DJ3 A;  3NIV A;  1GTU A;  1PX6 A;  1VF1 A;  3BBY A;  4FYB A;  4YQU A;  4K7O A;  1GRX A;  1YZX A;  4AJ6 A;  1Y25 A;  3LXT A;  4L0W A;  3W8J A;  1SK0 A;  4WKW A;  5G2Z A;  2FGX A;  2J23 A;  5CAX A;  3PGT A;  4J56 E;  3C71 A;  3UBL A;  4JRR A;  2B3S A;  3UVT A;  2RII A;  5IMZ A;  2FWE A;  2YWO A;  3TB2 A;  3VLN A;  5IQY A;  3UOM A;  5IPH A;  2DBC A;  4FYC A;  3TJJ A;  3VK9 A;  2A2S A;  2FY6 A;  3IRA A;  2OE0 A;  3M9K A;  4TR0 A;  4ZB6 A;  4HEA 2;  1AAZ A;  2WUL A;  4KSO A;  3ZRE A;  3FZ5 A;  1T4Z A;  2I9H A;  1YF1 A;  2GTU A;  1SD8 A;  1M9A A;  2ZNM A;  1OC8 A;  1FG4 A;  5E4W A;  1HD2 A;  1M9B A;  3VUR A;  4GQC A;  3TJK A;  2H66 A;  4FH8 A;  2FWF A;  4O32 A;  3HVS A;  3QR6 A;  4BVY A;  4F82 A;  1ERT A;  1PN9 A;  4V1A p;  2OJL A;  5DJM A;  5AGY A;  4LL1 B;  1TW9 A;  1WE0 A;  4BWQ A;  3DEX A;  5FWG A;  5B7C A;  4MMM A;  4HJ2 A;  1MD4 A;  1GTI A;  3GL3 A;  2YZH A;  1QFN A;  1J08 A;  3QD9 A;  2J9H A;  3QAW A;  3BJ5 A;  3ZFL A;  1CQH A;  5GAP D;  5AIX A;  2FLS A;  4WXT A;  3LOR A;  4RQX A;  5CO3 A;  4E8E A;  2WJU A;  2OBK A;  1WIK A;  1N2A A;  2PUK C;  1BJX A;  2C0D A;  5JCU A;  1OKT A;  3KP9 A;  3VPQ A;  4PUF C;  5H5Q A;  1ZOF A;  4KDX A;  5IOW A;  1SKW B;  4G2E A;  5F06 A;  4IJ3 A;  4Q5F A;  5HFK A;  2IPA A;  4KB3 A;  2XBI A;  3ZVJ D;  3HZ4 A;  3EIN A;  3TKS C;  4EF0 A;  3ERF A;  4JED A;  5GAN D;  4ECB A;  2GSS A;  4AGS A;  1EGR A;  4MAB A;  2KP2 A;  4XRD A;  2H1B A;  3PR8 A;  2XPE A;  4KW6 A;  3IC4 A;  3QFB C;  5JWQ B;  4CDO A;  1SJZ A;  2G2Q A;  2MMA A;  5F8B A;  1ZGN A;  3VWW A;  3UEM A;  3BCK A;  2HRF A;  2DMM A;  1SEN A;  4OWY A;  1YF0 A;  2VCZ A;  3F9U A;  2DIY A;  5D96 A;  3EMP A;  3KJY A;  4NV2 A;  3FK8 A;  1M0U A;  1S3A A;  2GST A;  2GZP A;  2PPT A;  2CAQ A;  1G7E A;  1DUG A;  2GSQ A;  4OFM A;  5DJL A;  2JZR A;  4ECJ A;  4HU7 A;  3PIN A;  4HOJ A;  2PBJ A;  4ZBD A;  4DVC A;  1PGT A;  4EO3 A;  3IXR A;  3VFI A;  5B8B A;  1AUC A;  5JWO B;  3LGC A;  4MH3 A;  5L71 A;  1EOG A;  2P0G A;  2VCV A;  1XIY A;  1OVN A;  1X5E A;  1QQ2 A;  1AIU A;  1V2A A;  1X9S B;  3EU4 A;  2ON7 A;  3LWA A;  3DVX A;  2LS5 A;  2CZ2 A;  3VWV A;  3Q18 A;  5JWR B;  2WRT A;  4PNG A;  4LL4 B;  3UAP A;  2MZC A;  3J7Y b;  3G7J A;  4BWS A;  4CHS A;  2D2Z A;  5E59 A;  9GSS A;  1TRU A;  1GNE A;  5J5N A;  2YPM A;  2V2G A;  4PGT A;  2E2G A;  5J3R A;  2DML A;  4RI6 A;  3LFL A;  1V40 A;  1ZYE A;  4EDY A;  1KNG A;  3K8N A;  1T8E B;  4CW9 A;  3WD6 A;  11GS A;  4J2F A;  4E8H A;  5B6M A;  2OE1 A;  2DJ1 A;  1PL1 A;  3M3M A;  1XWA A;  5G5E A;  3TOU A;  3EWL A;  5ELG A;  2MMZ A;  1UC7 A;  2I3Y A;  5CRW A;  2ALB A;  3RHB A;  2C1Y A;  1XCC A;  2EIQ A;  2RLI A;  2L4C A;  3DVW A;  4I6X A;  2H1D A;  5AN1 A;  16GS A;  3DKS A;  5ECI B;  2GVP A;  1QGV A;  2WB9 A;  4MF5 A;  1OE7 A;  1K0B A;  1J9B A;  2GLR A;  1TXX A;  2WS2 A;  3KMO A;  1OE8 A;  3LG6 A;  5IIZ A;  22GS A;  1TP9 A;  4I97 A;  2REM A;  2C4J A;  1T00 A;  3CRU A;  1ZL9 A;  2A4V A;  1X5D A;  4HU9 A;  1T7P B;  5FHI A;  5DBQ A;  1XOB A;  2GT6 A;  2YWI A;  3GH6 A;  2TRC P;  3KH7 A;  3H8Q A;  1XZO A;  3J7Y k;  1M2D A;  2LKU A;  4DSS A;  2OE3 A;  2HXK A;  2O85 A;  3P7X A;  5IO2 A;  5KN1 A;  2YJH A;  3DRN A;  3TDG A;  4GXZ A;  1Q98 A;  4DSS B;  4EUY A;  4ZIL A;  7GSS A;  4K2D A;  1OYJ A;  2VLT A;  3R2Q A;  4TOP A;  2H0I A;  2RUF A;  3M9J A;  5D73 A;  1I9D A;  2N5A A;  4KH7 A;  2HT9 A;  5ELA A;  1YQ1 A;  1Z7R A;  3HCZ A;  1YJ6 A;  3P90 A;  1X9W B;  2LV3 A;  3GA4 A;  4ZL9 A;  3US3 A;  4XTS A;  2R3X A;  1K0N A; 
#chains in the Genus database with same CATH topology
 3EPT A;  1MDK A;  1U6T A;  1HNA A;  2QC7 A;  1AC1 A;  4FYU A;  1FB6 A;  2C0F A;  1EEJ A;  2LTK A;  2L5L A;  1F2E A;  3FYG A;  4ACS A;  3CSJ A;  1XW9 A;  3A2X A;  4MJE A;  3QMX A;  4XS6 A;  4ECC A;  1AW9 A;  3IHQ A;  3CTF A;  3CRT A;  2KOK A;  4IW9 A;  3FMW A;  2I4A A;  1C72 A;  4NMU A;  2WFC A;  2AB6 A;  5IMD A;  1ZYP A;  2R5G A;  1A8Y A;  5DCG A;  4KDU A;  5F0G A;  4KA0 A;  3RPP A;  5A4U A;  12GS A;  2O89 A;  2C0G A;  4ISD A;  3C73 A;  1TRS A;  4TR1 A;  1FVJ A;  1EV9 A;  1XOA A;  4N30 A;  2H8L A;  2C80 A;  2KHP A;  3H4K A;  1XPV A;  4KUN A;  4CY8 A;  2FA4 A;  2DKH A;  1N8J A;  4WR5 A;  2X4A A;  2PN8 A;  4GCI A;  3C7M A;  2RM5 A;  2CQ9 A;  1Z3E A;  3ZVJ A;  4TKY A;  1ML6 A;  3GMF A;  1X9M B;  1GL8 A;  2M72 A;  5HR1 A;  3UJ1 A;  4ZXG A;  5GZZ B;  2L59 A;  3GTU A;  3BCI A;  3KP8 A;  2GQM A;  5IMV A;  2N5F A;  3ZIT A;  3MIX A;  5D9W A;  1Z7P A;  19GS A;  1B4P A;  3MDK A;  3GTU B;  4KCA A;  4YAP A;  1JZW A;  3F4S A;  5ECN B;  4YQV A;  4X0X A;  2WCI A;  2HSY A;  3N9J A;  2CVD A;  5J9B A;  2RUE A;  4JZQ A;  4N10 A;  4ZIJ A;  2ES7 A;  3D0Z A;  3U5R E;  3H93 A;  3VWU A;  5J4U A;  5AIV A;  1UN2 A;  4DSQ A;  2HI7 A;  5J41 A;  3ZIV A;  4LMV A;  3HZ8 A;  4IGJ A;  3TOT A;  3GKN A;  4K9Z A;  2AHE A;  4MPG A;  4EE0 A;  4MA9 A;  3GL5 A;  4HDE A;  1X5C A;  2VCX A;  4G19 A;  3LXZ A;  2H71 A;  4EL1 A;  2VL9 A;  2AYT A;  1FB0 A;  3GKX A;  2LEG A;  1AQX A;  1ABA A;  2XPD A;  1WRY A;  1A0F A;  5B6N A;  3ERW A;  3E0U A;  2UZ8 A;  1SKS B;  3W6G A;  2HLS A;  1MDJ A;  4Z2R A;  3DYR A;  2NDO A;  2DC5 A;  3KCM A;  3TGZ A;  5CRH A;  4CY6 A;  5IM9 A;  2BTO T;  2YOI A;  1JHB A;  4WEY A;  4ZL8 A;  5A4V A;  1V98 A;  6GSV A;  3KGK A;  4KCE A;  4POM A;  1TU8 A;  1T3B A;  4DSR A;  1M7T A;  1G6W A;  2HE3 A;  4HZ2 A;  1BQ7 A;  4X43 A;  4IVF A;  1EEM A;  2BMX A;  1A23 A;  5G30 A;  3ZFB A;  5FT3 A;  2ZCT A;  1TDI A;  4MF7 A;  1XVQ A;  1FO5 A;  4LA1 A;  3APO A;  3ZL5 A;  5GST A;  1BG5 A;  2H72 A;  4HJM A;  3IK7 A;  1TU7 A;  1WP0 A;  1R5A A;  2FNO A;  1GWC A;  3L4N A;  1G6Y A;  3KD0 A;  1PMT A;  4POB A;  3CMI A;  4OD7 A;  4TXO A;  2O87 A;  2V41 A;  5KN2 A;  3F3R A;  2IJY A;  2WDU A;  3D4T A;  4TXO B;  3RDW A;  3TKQ A;  1SJI A;  5CNW A;  5CYY A;  3WYW A;  3NZN A;  1AQV A;  1TJD A;  4LLR A;  2L6C A;  2RM6 A;  2DJ2 A;  2H6X A;  1SD9 A;  2V32 A;  4K7I A;  1F6M C;  1M3I A;  3KM6 A;  1A24 A;  1A2L A;  2H01 A;  1PQN A;  2HFD A;  3UAR A;  1YKA A;  3VI5 A;  3G7I A;  4Q5N A;  2B5Y A;  4X1U A;  4F2I A;  8GSS A;  4TRX A;  5ECQ B;  2GZY A;  1GSU A;  3ZML A;  2H76 A;  1AQW A;  4V2M A;  4PUR A;  3A5I A;  3L9V A;  4G0I A;  4HQZ A;  2YP6 A;  1VF2 A;  1PKZ A;  3KEB A;  4XIH A;  1EOH A;  2LJK A;  1ILO A;  4EIP A;  1GSE A;  3AY8 A;  3FEU A;  2M46 A;  4TR3 A;  1PA3 A;  4OFT A;  2IL3 A;  5HQP A;  1K0O A;  1SL1 B;  2DJJ A;  1HYU A;  3TKS E;  1B8X A;  1FOV A;  1U88 A;  1G0T A;  1SKR B;  3QOU A;  4YQM A;  2JL4 A;  4EC0 A;  18GS A;  3FW2 A;  4TR4 A;  4QQ7 A;  13GS A;  4WF4 A;  2LUS A;  3TJF A;  1CQG A;  1V57 A;  1GTA A;  4K5R A;  4TVE A;  3TRX A;  3MSZ A;  2MBT A;  2QKE A;  1B4Q A;  2DJK A;  2L5O A;  1U3A A;  3DML A;  3EC3 A;  3IDV A;  4HZ4 A;  3WGE A;  4EKZ A;  3KIJ A;  4NV5 A;  3TJB A;  1TRV A;  1XWK A;  4I5Q A;  1TK5 B;  3ZYW A;  3GYK A;  2Z9S A;  4H86 A;  5JCW A;  1PL2 A;  2R2J A;  1Y6E A;  3EUR A;  2N5B A;  3N5O A;  3IAS 2;  2M80 A;  2LJA A;  2YCD A;  3LYK A;  2AV4 A;  3I43 A;  2VM2 A;  3F4T A;  5DDL A;  1A2J A;  1GSQ A;  4V2N A;  3BOA A;  5G1L A;  3IBH A;  3GSS A;  4L8E A;  1MTC A;  4D73 A;  1HNB A;  4F03 A;  3GUS A;  2F51 A;  1GUL A;  3ZRD A;  2DKI A;  4EDZ A;  4D73 B;  3RHC A;  3LEF A;  5ECP B;  5HR0 A;  5A5K A;  3D4M A;  1H75 A;  1USB A;  4JU5 A;  1F3B A;  1OC9 A;  2O8V B;  3TKS A;  4TW5 A;  1NM3 A;  1YY7 A;  1OC9 B;  2X99 A;  2FWG A;  1FOH A;  5ENU A;  1XBS A;  3DXB A;  3S9F A;  4KAE A;  2FUG 2;  3GX8 A;  4EXJ A;  5CP1 A;  2MBS A;  5EY6 A;  5AIS A;  1YEP A;  1SYR A;  4POK A;  5D8I A;  5H5S A;  4HSC X;  5JCG A;  3D22 A;  1YEX A;  2QSI A;  3WGD A;  1TI3 A;  2JZT A;  3LJR A;  3ME7 A;  5EL8 A;  4FIW A;  4RQR A;  1KBN A;  10GS A;  3Q6O A;  2C3Q A;  5EPF A;  5D9V A;  4MZC A;  1NSW A;  3TCO A;  5KEJ A;  2K8V A;  2VLV A;  4KSM A;  1DSB A;  3GHA A;  4BIK A;  3GH9 A;  2X8C A;  2KP1 A;  2TIR A;  2HSM A;  2I1U A;  1O8X A;  1F9M A;  3M8N A;  2HYX A;  1K0M A;  5ECS A;  4O5R A;  2X64 A;  1WJK A;  3Q74 A;  6GSU A;  2EIR A;  4BPY A;  2H74 A;  1BAY A;  3WGX A;  4USS A;  6GST A;  4XRA A;  2R6K A;  1IYH A;  4IP6 A;  1OKD A;  4PX1 A;  1U87 A;  4PNF A;  5ECM B;  5J9C A;  5HR2 A;  1ERU A;  1XFL A;  4NAX A;  20GS A;  3ZTL A;  2VM1 A;  3HHV A;  3ZIJ A;  1KTE A;  3E3E A;  3UL3 A;  4IQA A;  1PD2 1;  2LST A;  3GV1 A;  2K9F A;  3ZMK A;  2IMI A;  2LQO A;  4ECI A;  1ZYQ B;  3HYP A;  1PRX A;  2R0P A;  3KTL A;  4GQF A;  1MD3 A;  2R4V A;  5KOX A;  4O5Q A;  5KN0 A;  1MEK A;  3F63 A;  5LD0 A;  3IOS A;  5CRE A;  2K6V A;  1O85 A;  1XWC A;  3VWX A;  4BVX A;  4WBR D;  1FW1 A;  3DWV A;  2G0F A;  5H5R A;  3CTG A;  2PER A;  4MLY A;  3APS A;  1THO A;  4BVX B;  4I2T A;  4MZW A;  4QL9 A;  4Z2U A;  1XWB A;  2I81 A;  1TI1 A;  4P3Y B;  1TOF A;  1O8W A;  2PWJ A;  1PN0 A;  1QUW A;  3GKK A;  2L6D A;  4PQH A;  2LNT A;  2FWH A;  1JLW A;  4JE1 A;  4KE3 A;  4NPB A;  3DGQ A;  2VUP A;  3GNJ A;  3HVN A;  4TR1 B;  3CSH A;  3EMX A;  4N0Z A;  2CVB A;  1TKD B;  4IQ1 A;  1GSF A;  2GGT A;  1LU4 A;  3LW9 A;  4G10 A;  3UIW A;  2ON5 A;  3F3Q A;  1GP1 A;  1M2B A;  2YV7 A;  1R4W A;  3GIX A;  5B8A A;  3A2W A;  3ISO A;  3L0H A;  2E7P A;  2A2R A;  2VCT A;  4Z2T A;  4POL A;  2WGR A;  3HA9 A;  1EP8 A;  3KMN A;  2WZ9 A;  1TTZ A;  1B9Y C;  1FVK A;  4QL7 A;  4PQI A;  1W4V A;  1LJR A;  4MJA A;  1VF3 A;  2LRN A;  1Z5Y E;  1BED A;  4IHU A;  2FD3 A;  2CZ3 A;  4BL7 A;  5GSS A;  4NXI A;  1S3R A;  5DCH A;  3ME8 A;  1M3J A;  3I69 A;  2X49 A;  2YAN A;  2QA1 A;  3QFA C;  2IMD A;  3CYN A;  4KND A;  4BL7 B;  3GUR A;  3KH9 A;  4KX4 A;  2K18 A;  3A3T A;  3TRQ A;  3VPT A;  4PXO A;  3A2V A;  4ICY A;  3TKR A;  3NOF A;  6GSX A;  1WMJ A;  2A2P A;  5DAK A;  1JZR A;  2PVO C;  4L0U A;  4MJC A;  4N11 A;  1OAZ A;  2PMT A;  2B6M A;  3DD3 A;  5DAK B;  2IFQ A;  1DE1 A;  1UVZ A;  1XW5 A;  2IN3 A;  2FHE A;  3IR4 A;  2GZZ A;  2DJ0 A;  1TRW A;  3F6F A;  4KDY A;  3RAZ A;  2IFQ B;  2B1L A;  6GSS A;  2FA8 A;  3LQ7 A;  1U3I A;  4WF5 A;  4L5O A;  3P2A A;  1SK2 A;  2O7K A;  2H30 A;  4I8B A;  5F07 A;  1WWJ A;  3O76 A;  2AUV A;  1HNC A;  4MJB A;  4XS1 A;  2LJR A;  2B5E A;  4F0C A;  5IMF A;  4BA7 A;  3O3T A;  4AF2 A;  4ZB9 A;  3EVI A;  2H0G A;  2X8G A;  1SL0 B;  3HXS A;  1B9X C;  3I6A A;  4WET A;  4MPF A;  1W89 A;  1JLV A;  3KXO A;  1Z9H A;  5DQS A;  4O5U A;  1DBY A;  4JBB A;  2PGT A;  3H79 A;  4OCE A;  1Q4J A;  1VRS D;  2QGV A;  3I9V 2;  4HQS A;  4A5P A;  3HJM A;  4F9Z A;  1JZD A;  6GSW A;  1ERV A;  4XHM A;  1XVW A;  4L5L A;  17GS A;  4JR6 A;  3O6T A;  2E2M A;  2P31 A;  4MCU A;  5A4W A;  2OBI A;  1UA5 A;  2JAC A;  1WPI A;  3L78 A;  2GT5 A;  2VD1 A;  1T1V A;  4GST A;  2VO4 A;  1TK8 B;  1OC3 A;  2OAD A;  5D9T A;  4ML1 A;  4RUV A;  2VCQ A;  4PQ1 A;  3M0F A;  2F9S A;  4LMW A;  1GLQ A;  1GUK A;  4OFN A;  2DSA A;  5IMC A;  1GUH A;  3QCP A;  2JSY A;  1M99 A;  1IYI A;  4J57 E;  2CX3 A;  3ERG A;  3W8S A;  3D6I A;  2V6K A;  2VL2 A;  2CVK A;  1GSS A;  3C1S A;  3G7Y A;  2XHF A;  4MF6 A;  2MYG A;  2CV4 A;  2DIZ A;  3FRC A;  5ABR A;  3TJG A;  3FR6 A;  2XBQ A;  1V58 A;  3QAV A;  1NHO A;  2AJQ B;  3GRX A;  4ML6 A;  3QAG A;  3IPZ A;  2C8U A;  1DE2 A;  2JAD A;  4ZB8 A;  3GX0 A;  4AJ7 A;  2EC4 A;  4Q5R A;  4F0B A;  2LQQ A;  1SJ6 A;  2EIO A;  3C1R A;  4ZBB A;  3EU3 A;  5G5F A;  1ERW A;  1SYX A;  4X4J A;  2IMK A;  2GDR A;  4MH2 A;  4OO5 A;  2B5X A;  3FZ4 A;  4MDC A;  1RQM A;  3LSZ A;  4MK3 A;  5ECL B;  2JSZ A;  1FHE A;  3TUE A;  1R7H A;  4NHW A;  1XXU A;  5COH A;  4GF0 A;  2VIM A;  1FAA A;  3HJO A;  4Z7X A;  4ID0 A;  3HY2 A;  4EVM A;  5IOX A;  3SBC A;  1XG8 A;  2V6O A;  3HVV A;  3MAK A;  2IME A;  4GSS A;  4V2L A;  1GNW A;  2TRX A;  1SK1 A;  2YWM A;  4IJI A;  2VD0 A;  1G7O A;  1O81 A;  2NVL A;  3RPN A;  4OCF A;  4MZB A;  4WR4 A;  4RI7 A;  5HR3 A;  4HUA A;  1VF4 A;  3IAM 2;  4YH2 A;  2P5R A;  2R37 A;  2VLU A;  4ILF A;  3IC8 A;  1WOU A;  4IEL A;  4TXV A;  4GRF A;  2ZUP A;  5HFG A;  4MP4 A;  5BRT A;  2NPB A;  2DLX A;  1HQO A;  4NWY A;  2H0H A;  1B48 A;  3UBK A;  3F0I A;  4K8M A;  1ZZY A;  2IWT A;  3A5W A;  1K0D A;  1PKW A;  1F3A A;  4GSN A;  4I2U A;  4KGI A;  1YDK A;  2PU9 C;  3PH9 A;  3V1W A;  1GTB A;  2GSR A;  5C00 A;  1I5G A;  4GWR A;  3ZZX A;  2YN1 A;  1ST9 A;  1V9W A;  4OO4 A;  4OMV A;  3EYT A;  5KN3 A;  5LNK e;  4HS1 A;  4ULX A;  2F3M A;  1F37 A;  1JFU A;  4DEJ A;  5EVO A;  1GSY A;  2IMF A;  3MNG A;  3IE3 A;  3UVH A;  3APQ A;  5IMA A;  4K6X A;  3CXG A;  1QMV A;  1ON4 A;  4G9H A;  1YKC A;  1PX7 A;  3FY7 A;  2HSH A;  5CRD A;  2KUC A;  3WT1 A;  3FZ9 A;  2X8H A;  2H73 A;  2YV9 A;  2YZU A;  2YJ7 A;  4ZL7 A;  3FR9 A;  1EGO A;  3PPU A;  1GSD A;  1GH2 A;  4O7H A;  1K0C A;  2KLX A;  3JCM L;  3TKP A;  2CA8 A;  3QDN A;  4K0G A;  2YNX A;  1EZK A;  5CRG A;  1A8L A;  2CX4 A;  2OKA A;  5DQY A;  2XC2 A;  1R26 A;  1SL2 B;  1A2M A;  5IO0 A;  1M2A A;  2LRC A;  4IBP A;  1E6B A;  2B7K A;  2CAI A;  2HZF A;  2PVQ A;  2GQL A;  1ZMA A;  3HVX A;  1KEB A;  14GS A;  3Q19 A;  2H1A A;  4G0L A;  1URM A;  3G9B A;  1QXH A;  2H70 A;  2HNL A;  3VI7 A;  5ID2 A;  6GSY A;  4O92 A;  1X0R A;  2MMO A;  1NW2 A;  1R5P A;  5LCZ A;  3GN3 A;  5ID2 B;  1O6J A;  1J0F A;  1XW6 A;  4N0V A;  4GTU A;  3KTB A;  2AAW A;  3ZLP A;  5G31 A;  4AJ8 A;  2IIY A;  3E9J B;  3F4R A;  5IPG A;  1AXD A;  2FCH A;  4YKF A;  3D5J A;  4PUA A;  1PSQ A;  4IKH A;  3FHK A;  2GS3 A;  3OR5 A;  4GLT A;  2B1K A;  1E2Y A;  2YWN A;  2C3T A;  4FO5 A;  4MNN A;  1H4O A;  1THX A;  5ECH B;  5ECK B;  2CT6 A;  5DVB A;  4IN0 A;  4XS4 A;  2H75 A;  1Z6M A;  3FZA A;  2F8A A;  1ACV A;  2JU5 A;  2VCW A;  5KOW A;  4XS4 B;  2MMN A;  3H1N A;  3D21 A;  4NHZ A;  5DAL A;  4K7N A;  3IV4 A;  1NHY A;  5ECR B;  1GUM A;  1VGL A;  1ZYN A;  3M1G A;  1EV4 A;  3L9U A;  2R0C A;  3HDC A;  5DAL B;  2HZE A;  4ZBA A;  2HRN A;  4IS0 A;  3GKM A;  3GST A;  1BX9 A;  2H6Y A;  5D93 A;  3F6D A;  2H1G A;  2C0E A;  2HZE B;  3ED3 A;  2V1M A;  3DIE A;  1K3L A;  2OA7 A;  3IK9 A;  3EE2 A;  3WT2 A;  3FR3 A;  4YAV A;  3MWH A;  1EWX A;  4HI7 A;  1O7U A;  4JR4 A;  1T4Y A;  1EP7 A;  5ECO B;  2VOC A;  1XWG A;  3U6V A;  2P5Q A;  1K0A A;  4TN8 A;  5F05 A;  2NTO A;  2L4Q A;  3SWL A;  2L57 A;  3GFK A;  3RBT A;  3QPM A;  4K0N A;  2LRT A;  4IP1 A;  4K5S A;  2NBS A;  1O73 A;  1Z6N A;  2R0G A;  5HFI A;  2C3N A;  3CSI A;  2BJX A;  1K3Y A;  1S3C A;  1ZCP A;  2A4H A;  3F8U A;  4XCS A;  5INY A;  3HKR A;  1RW1 A;  1QK8 A;  2GQK A;  2E0Q A;  4YKG A;  2OAC A;  2K8S A;  3KZQ A;  3LYP A;  1RK4 A;  2F8F A;  1A0R P;  1TK0 B;  3L9S A;  3UMA A;  2LNS A;  2VL3 A;  1JZO A;  3HD5 A;  4WBJ A;  4K1F A;  3TRP A;  1BYE A;  1MDI A;  3FKF A;  4V1A g;  5C04 A;  1K3O A;  1S3D A;  3P8W A;  2H19 A;  1GLP A;  3IHG A;  2VAF A;  3C8E A;  2B7J A;  1LBK A;  1SU9 A;  5G1K A;  2H6Z A;  3CBU A;  3HJP A;  3IA1 A;  3BD2 A;  2VL2 C;  5D9X A;  4Q5Q A;  3R3E A;  2JZS A;  2DJ3 A;  3NIV A;  1GTU A;  1PX6 A;  1VF1 A;  3BBY A;  4FYB A;  4YQU A;  4K7O A;  1GRX A;  1YZX A;  4AJ6 A;  1Y25 A;  3LXT A;  4L0W A;  3W8J A;  1SK0 A;  4WKW A;  5G2Z A;  2FGX A;  2J23 A;  5CAX A;  3PGT A;  4J56 E;  3C71 A;  3UBL A;  4JRR A;  2B3S A;  3UVT A;  2RII A;  5IMZ A;  2FWE A;  2YWO A;  3TB2 A;  3VLN A;  5IQY A;  3UOM A;  5IPH A;  2DBC A;  4FYC A;  3TJJ A;  3VK9 A;  2A2S A;  2FY6 A;  3IRA A;  2OE0 A;  3M9K A;  4G0K A;  4TR0 A;  4HEA 2;  4ZB6 A;  1AAZ A;  2WUL A;  4KSO A;  3ZRE A;  3FZ5 A;  1T4Z A;  2I9H A;  1YF1 A;  2GTU A;  1SD8 A;  1M9A A;  2ZNM A;  1OC8 A;  2QA2 A;  1FG4 A;  5E4W A;  1HD2 A;  1M9B A;  4FQU A;  3VUR A;  4GQC A;  3TJK A;  2H66 A;  4FH8 A;  2FWF A;  2HRK A;  4O32 A;  3HVS A;  3QR6 A;  4BVY A;  4F82 A;  1ERT A;  1PN9 A;  4V1A p;  2OJL A;  5DJM A;  5AGY A;  4LL1 B;  1TW9 A;  1WE0 A;  4BWQ A;  3DEX A;  4BVY B;  5FWG A;  4K2X A;  5B7C A;  4MMM A;  4HJ2 A;  1MD4 A;  1GTI A;  3GL3 A;  2YZH A;  1QFN A;  1J08 A;  3QD9 A;  2J9H A;  3QAW A;  3BJ5 A;  3ZFL A;  1CQH A;  5GAP D;  5AIX A;  2FLS A;  4WXT A;  3LOR A;  4RQX A;  5CO3 A;  4E8E A;  2WJU A;  2OBK A;  1WIK A;  1N2A A;  2PUK C;  1BJX A;  2HRA A;  2C0D A;  5JCU A;  1OKT A;  3KP9 A;  3VPQ A;  4PUF C;  5H5Q A;  1ZOF A;  4KDX A;  5IOW A;  4KF9 A;  1SKW B;  4G2E A;  5F06 A;  4IJ3 A;  4Q5F A;  5HFK A;  2IPA A;  4KB3 A;  2XBI A;  3ZVJ D;  3HZ4 A;  3EIN A;  3TKS C;  4EF0 A;  3ERF A;  4JED A;  5GAN D;  4ECB A;  2GSS A;  4AGS A;  1EGR A;  4MAB A;  2KP2 A;  4XRD A;  2H1B A;  3PR8 A;  2XPE A;  4KW6 A;  3IC4 A;  3QFB C;  5JWQ B;  4CDO A;  1SJZ A;  2G2Q A;  2MMA A;  5F8B A;  1ZGN A;  3VWW A;  3UEM A;  3BCK A;  2HRF A;  2DMM A;  1SEN A;  4OWY A;  1YF0 A;  2VCZ A;  3F9U A;  2DIY A;  5D96 A;  3EMP A;  3KJY A;  1PFO A;  4NV2 A;  3FK8 A;  1M0U A;  1S3A A;  2GST A;  2GZP A;  2PPT A;  2CAQ A;  1G7E A;  1DUG A;  2GSQ A;  4OFM A;  5DJL A;  2JZR A;  4ECJ A;  4EIQ A;  4HU7 A;  3PIN A;  4HOJ A;  2PBJ A;  4ZBD A;  4DVC A;  1PGT A;  4EO3 A;  3IXR A;  3VFI A;  5B8B A;  1AUC A;  5JWO B;  3LGC A;  4MH3 A;  5L71 A;  1EOG A;  2P0G A;  2VCV A;  3MYD A;  1XIY A;  1OVN A;  1X5E A;  1QQ2 A;  1AIU A;  1V2A A;  1X9S B;  3EU4 A;  2ON7 A;  3LWA A;  3DVX A;  2LS5 A;  2CZ2 A;  3VWV A;  3Q18 A;  5JWR B;  2WRT A;  4PNG A;  4LL4 B;  3UAP A;  2MZC A;  3J7Y b;  3G7J A;  4BWS A;  4CHS A;  2D2Z A;  5E59 A;  9GSS A;  1TRU A;  1GNE A;  5J5N A;  2YPM A;  2V2G A;  4PGT A;  2E2G A;  5J3R A;  2DML A;  4RI6 A;  3LFL A;  1V40 A;  1ZYE A;  4EDY A;  1KNG A;  3K8N A;  1T8E B;  4CW9 A;  3WD6 A;  11GS A;  4J2F A;  4E8H A;  5B6M A;  2OE1 A;  2DJ1 A;  1PL1 A;  3M3M A;  1XWA A;  5G5E A;  3TOU A;  3EWL A;  5ELG A;  5BMU A;  2MMZ A;  1UC7 A;  2I3Y A;  4PTS A;  5CRW A;  2ALB A;  3RHB A;  2C1Y A;  1XCC A;  2EIQ A;  2RLI A;  2L4C A;  3DVW A;  4I6X A;  2H1D A;  5AN1 A;  16GS A;  3DKS A;  5ECI B;  2GVP A;  1QGV A;  2WB9 A;  4MF5 A;  1OE7 A;  1K0B A;  1J9B A;  2GLR A;  1TXX A;  2WS2 A;  3KMO A;  1OE8 A;  3LG6 A;  5IIZ A;  22GS A;  1TP9 A;  4I97 A;  2REM A;  2C4J A;  1T00 A;  3CRU A;  1ZL9 A;  2A4V A;  1X5D A;  4HU9 A;  1T7P B;  5FHI A;  5DBQ A;  1XOB A;  2GT6 A;  2YWI A;  3GH6 A;  2TRC P;  3KH7 A;  3H8Q A;  1XZO A;  3J7Y k;  1M2D A;  2LKU A;  4DSS A;  2OE3 A;  2HXK A;  2O85 A;  3P7X A;  5IO2 A;  5KN1 A;  2YJH A;  3DRN A;  3TDG A;  4GXZ A;  1Q98 A;  4DSS B;  4EUY A;  4ZIL A;  7GSS A;  3CQF A;  4K2D A;  1OYJ A;  2VLT A;  3R2Q A;  4TOP A;  2H0I A;  2RUF A;  3M9J A;  5D73 A;  1I9D A;  2N5A A;  4KH7 A;  2HT9 A;  5ELA A;  1YQ1 A;  1Z7R A;  3HCZ A;  1YJ6 A;  3P90 A;  1X9W B;  2LV3 A;  3GA4 A;  4ZL9 A;  3US3 A;  4XTS A;  2R3X A;  1K0N A; 
#chains in the Genus database with same CATH homology
 3EPT A;  1MDK A;  1U6T A;  1HNA A;  2QC7 A;  1AC1 A;  4FYU A;  1FB6 A;  2C0F A;  1EEJ A;  2LTK A;  2L5L A;  1F2E A;  3FYG A;  4ACS A;  3CSJ A;  1XW9 A;  3A2X A;  4MJE A;  3QMX A;  4XS6 A;  4ECC A;  1AW9 A;  3IHQ A;  3CTF A;  3CRT A;  2KOK A;  4IW9 A;  3FMW A;  2I4A A;  1C72 A;  4NMU A;  2WFC A;  2AB6 A;  5IMD A;  1ZYP A;  2R5G A;  1A8Y A;  5DCG A;  4KDU A;  5F0G A;  4KA0 A;  3RPP A;  5A4U A;  12GS A;  2O89 A;  2C0G A;  4ISD A;  3C73 A;  1TRS A;  4TR1 A;  1FVJ A;  1EV9 A;  1XOA A;  4N30 A;  2H8L A;  2C80 A;  2KHP A;  3H4K A;  1XPV A;  4KUN A;  4CY8 A;  2FA4 A;  2DKH A;  1N8J A;  4WR5 A;  2X4A A;  2PN8 A;  4GCI A;  3C7M A;  2RM5 A;  2CQ9 A;  1Z3E A;  3ZVJ A;  4TKY A;  1ML6 A;  3GMF A;  1X9M B;  1GL8 A;  2M72 A;  5HR1 A;  3UJ1 A;  4ZXG A;  5GZZ B;  2L59 A;  3GTU A;  3BCI A;  3KP8 A;  2GQM A;  5IMV A;  2N5F A;  3ZIT A;  3MIX A;  5D9W A;  1Z7P A;  19GS A;  1B4P A;  3MDK A;  3GTU B;  4KCA A;  4YAP A;  1JZW A;  3F4S A;  5ECN B;  4YQV A;  4X0X A;  2WCI A;  2HSY A;  3N9J A;  2CVD A;  5J9B A;  2RUE A;  4JZQ A;  4N10 A;  4ZIJ A;  2ES7 A;  3D0Z A;  3U5R E;  3H93 A;  3VWU A;  5J4U A;  5AIV A;  1UN2 A;  4DSQ A;  2HI7 A;  5J41 A;  3ZIV A;  4LMV A;  3HZ8 A;  4IGJ A;  3TOT A;  3GKN A;  4K9Z A;  2AHE A;  4MPG A;  4EE0 A;  4MA9 A;  3GL5 A;  4HDE A;  1X5C A;  2VCX A;  4G19 A;  3LXZ A;  2H71 A;  4EL1 A;  2VL9 A;  2AYT A;  1FB0 A;  3GKX A;  2LEG A;  1AQX A;  1ABA A;  2XPD A;  1WRY A;  1A0F A;  5B6N A;  3ERW A;  3E0U A;  2UZ8 A;  1SKS B;  3W6G A;  2HLS A;  1MDJ A;  4Z2R A;  3DYR A;  2NDO A;  2DC5 A;  3KCM A;  3TGZ A;  5CRH A;  4CY6 A;  5IM9 A;  2BTO T;  2YOI A;  1JHB A;  4WEY A;  4ZL8 A;  5A4V A;  1V98 A;  6GSV A;  3KGK A;  4KCE A;  4POM A;  1TU8 A;  1T3B A;  4DSR A;  1M7T A;  1G6W A;  2HE3 A;  4HZ2 A;  1BQ7 A;  4X43 A;  4IVF A;  1EEM A;  2BMX A;  1A23 A;  5G30 A;  3ZFB A;  5FT3 A;  2ZCT A;  1TDI A;  4MF7 A;  1XVQ A;  1FO5 A;  4LA1 A;  3APO A;  3ZL5 A;  5GST A;  1BG5 A;  2H72 A;  4HJM A;  3IK7 A;  1TU7 A;  1WP0 A;  1R5A A;  2FNO A;  1GWC A;  3L4N A;  1G6Y A;  3KD0 A;  1PMT A;  4POB A;  3CMI A;  4OD7 A;  4TXO A;  2O87 A;  2V41 A;  5KN2 A;  3F3R A;  2IJY A;  2WDU A;  3D4T A;  4TXO B;  3RDW A;  3TKQ A;  1SJI A;  5CNW A;  5CYY A;  3WYW A;  3NZN A;  1AQV A;  1TJD A;  4LLR A;  2L6C A;  2RM6 A;  2DJ2 A;  2H6X A;  1SD9 A;  2V32 A;  4K7I A;  1F6M C;  3KM6 A;  1A24 A;  1A2L A;  2H01 A;  1PQN A;  2HFD A;  3UAR A;  1YKA A;  3VI5 A;  3G7I A;  4Q5N A;  2B5Y A;  4X1U A;  4F2I A;  8GSS A;  4TRX A;  5ECQ B;  2GZY A;  1GSU A;  3ZML A;  2H76 A;  1AQW A;  4V2M A;  4PUR A;  3A5I A;  3L9V A;  4G0I A;  4HQZ A;  2YP6 A;  1VF2 A;  1PKZ A;  3KEB A;  4XIH A;  1EOH A;  2LJK A;  1ILO A;  4EIP A;  1GSE A;  3AY8 A;  3FEU A;  2M46 A;  4TR3 A;  1PA3 A;  4OFT A;  2IL3 A;  5HQP A;  1K0O A;  1SL1 B;  2DJJ A;  1HYU A;  3TKS E;  1B8X A;  1FOV A;  1U88 A;  1G0T A;  1SKR B;  3QOU A;  4YQM A;  2JL4 A;  4EC0 A;  18GS A;  3FW2 A;  4TR4 A;  4QQ7 A;  13GS A;  4WF4 A;  2LUS A;  3TJF A;  1CQG A;  1V57 A;  1GTA A;  4K5R A;  4TVE A;  3TRX A;  3MSZ A;  2MBT A;  2QKE A;  1B4Q A;  2DJK A;  2L5O A;  1U3A A;  3DML A;  3EC3 A;  3IDV A;  4HZ4 A;  3WGE A;  4EKZ A;  3KIJ A;  4NV5 A;  3TJB A;  1TRV A;  1XWK A;  4I5Q A;  1TK5 B;  3ZYW A;  3GYK A;  2Z9S A;  4H86 A;  5JCW A;  1PL2 A;  2R2J A;  1Y6E A;  3EUR A;  2N5B A;  3N5O A;  3IAS 2;  2M80 A;  2LJA A;  2YCD A;  3LYK A;  2AV4 A;  3I43 A;  2VM2 A;  3F4T A;  5DDL A;  1A2J A;  1GSQ A;  4V2N A;  3BOA A;  5G1L A;  3IBH A;  3GSS A;  4L8E A;  1MTC A;  4D73 A;  1HNB A;  4F03 A;  3GUS A;  2F51 A;  1GUL A;  3ZRD A;  2DKI A;  4EDZ A;  4D73 B;  3RHC A;  3LEF A;  5ECP B;  5HR0 A;  5A5K A;  3D4M A;  1H75 A;  1USB A;  4JU5 A;  1F3B A;  1OC9 A;  2O8V B;  3TKS A;  4TW5 A;  1NM3 A;  1YY7 A;  1OC9 B;  2X99 A;  2FWG A;  1FOH A;  5ENU A;  1XBS A;  3DXB A;  3S9F A;  4KAE A;  2FUG 2;  3GX8 A;  4EXJ A;  5CP1 A;  2MBS A;  5EY6 A;  5AIS A;  1YEP A;  1SYR A;  4POK A;  5D8I A;  5H5S A;  5JCG A;  3D22 A;  1YEX A;  2QSI A;  3WGD A;  1TI3 A;  2JZT A;  3LJR A;  3ME7 A;  5EL8 A;  4FIW A;  4RQR A;  1KBN A;  10GS A;  3Q6O A;  2C3Q A;  5EPF A;  5D9V A;  4MZC A;  1NSW A;  3TCO A;  5KEJ A;  2K8V A;  2VLV A;  4KSM A;  1DSB A;  3GHA A;  3GH9 A;  2X8C A;  2KP1 A;  2TIR A;  2HSM A;  2I1U A;  1O8X A;  1F9M A;  3M8N A;  2HYX A;  1K0M A;  5ECS A;  4O5R A;  2X64 A;  1WJK A;  3Q74 A;  6GSU A;  2EIR A;  4BPY A;  2H74 A;  1BAY A;  3WGX A;  4USS A;  6GST A;  4XRA A;  2R6K A;  1IYH A;  4IP6 A;  1OKD A;  4PX1 A;  1U87 A;  4PNF A;  5ECM B;  5J9C A;  5HR2 A;  1ERU A;  1XFL A;  4NAX A;  20GS A;  3ZTL A;  2VM1 A;  3HHV A;  3ZIJ A;  1KTE A;  3E3E A;  3UL3 A;  4IQA A;  1PD2 1;  2LST A;  3GV1 A;  2K9F A;  3ZMK A;  2IMI A;  2LQO A;  4ECI A;  1ZYQ B;  3HYP A;  1PRX A;  2R0P A;  3KTL A;  4GQF A;  1MD3 A;  2R4V A;  5KOX A;  4O5Q A;  5KN0 A;  1MEK A;  3F63 A;  5LD0 A;  3IOS A;  5CRE A;  2K6V A;  1O85 A;  1XWC A;  3VWX A;  4BVX A;  4WBR D;  1FW1 A;  3DWV A;  2G0F A;  5H5R A;  3CTG A;  2PER A;  4MLY A;  3APS A;  1THO A;  4BVX B;  4I2T A;  4MZW A;  4QL9 A;  4Z2U A;  1XWB A;  2I81 A;  1TI1 A;  4P3Y B;  1TOF A;  1O8W A;  2PWJ A;  1PN0 A;  1QUW A;  3GKK A;  2L6D A;  4PQH A;  2LNT A;  2FWH A;  1JLW A;  4JE1 A;  4KE3 A;  4NPB A;  3DGQ A;  2VUP A;  3GNJ A;  4TR1 B;  3CSH A;  3EMX A;  4N0Z A;  2CVB A;  1TKD B;  4IQ1 A;  1GSF A;  2GGT A;  1LU4 A;  3LW9 A;  4G10 A;  3UIW A;  2ON5 A;  3F3Q A;  1GP1 A;  1M2B A;  2YV7 A;  1R4W A;  3GIX A;  5B8A A;  3A2W A;  3ISO A;  3L0H A;  2E7P A;  2A2R A;  2VCT A;  4Z2T A;  4POL A;  2WGR A;  3HA9 A;  1EP8 A;  3KMN A;  2WZ9 A;  1TTZ A;  1B9Y C;  1FVK A;  4QL7 A;  4PQI A;  1W4V A;  1LJR A;  4MJA A;  1VF3 A;  2LRN A;  1Z5Y E;  1BED A;  4IHU A;  2FD3 A;  2CZ3 A;  4BL7 A;  5GSS A;  4NXI A;  5DCH A;  3ME8 A;  3I69 A;  2X49 A;  2YAN A;  2QA1 A;  3QFA C;  2IMD A;  3CYN A;  4KND A;  4BL7 B;  3GUR A;  3KH9 A;  4KX4 A;  2K18 A;  3A3T A;  3TRQ A;  3VPT A;  4PXO A;  3A2V A;  4ICY A;  3TKR A;  3NOF A;  6GSX A;  1WMJ A;  2A2P A;  5DAK A;  1JZR A;  2PVO C;  4L0U A;  4MJC A;  4N11 A;  1OAZ A;  2PMT A;  2B6M A;  3DD3 A;  5DAK B;  2IFQ A;  1DE1 A;  1UVZ A;  1XW5 A;  2IN3 A;  2FHE A;  3IR4 A;  2GZZ A;  2DJ0 A;  1TRW A;  3F6F A;  4KDY A;  3RAZ A;  2IFQ B;  2B1L A;  6GSS A;  2FA8 A;  3LQ7 A;  1U3I A;  4WF5 A;  4L5O A;  3P2A A;  1SK2 A;  2O7K A;  2H30 A;  4I8B A;  5F07 A;  1WWJ A;  3O76 A;  2AUV A;  1HNC A;  4MJB A;  4XS1 A;  2LJR A;  2B5E A;  4F0C A;  5IMF A;  4BA7 A;  3O3T A;  4AF2 A;  4ZB9 A;  3EVI A;  2H0G A;  2X8G A;  1SL0 B;  3HXS A;  1B9X C;  3I6A A;  4WET A;  4MPF A;  1W89 A;  1JLV A;  3KXO A;  1Z9H A;  5DQS A;  4O5U A;  1DBY A;  4JBB A;  2PGT A;  3H79 A;  4OCE A;  1Q4J A;  1VRS D;  2QGV A;  3I9V 2;  4HQS A;  4A5P A;  3HJM A;  4F9Z A;  1JZD A;  6GSW A;  1ERV A;  4XHM A;  1XVW A;  4L5L A;  17GS A;  4JR6 A;  3O6T A;  2E2M A;  2P31 A;  4MCU A;  5A4W A;  2OBI A;  1UA5 A;  2JAC A;  1WPI A;  3L78 A;  2GT5 A;  2VD1 A;  1T1V A;  4GST A;  2VO4 A;  1TK8 B;  1OC3 A;  2OAD A;  5D9T A;  4ML1 A;  4RUV A;  2VCQ A;  4PQ1 A;  3M0F A;  2F9S A;  4LMW A;  1GLQ A;  1GUK A;  4OFN A;  2DSA A;  5IMC A;  1GUH A;  3QCP A;  2JSY A;  1M99 A;  1IYI A;  4J57 E;  2CX3 A;  3ERG A;  3W8S A;  3D6I A;  2V6K A;  2VL2 A;  2CVK A;  1GSS A;  3C1S A;  3G7Y A;  2XHF A;  4MF6 A;  2MYG A;  2CV4 A;  2DIZ A;  3FRC A;  5ABR A;  3TJG A;  3FR6 A;  2XBQ A;  1V58 A;  3QAV A;  1NHO A;  2AJQ B;  3GRX A;  4ML6 A;  3QAG A;  3IPZ A;  2C8U A;  1DE2 A;  2JAD A;  4ZB8 A;  3GX0 A;  4AJ7 A;  2EC4 A;  4Q5R A;  4F0B A;  2LQQ A;  1SJ6 A;  2EIO A;  3C1R A;  4ZBB A;  3EU3 A;  5G5F A;  1ERW A;  1SYX A;  4X4J A;  2IMK A;  2GDR A;  4MH2 A;  4OO5 A;  2B5X A;  3FZ4 A;  4MDC A;  1RQM A;  3LSZ A;  4MK3 A;  5ECL B;  2JSZ A;  1FHE A;  3TUE A;  1R7H A;  4NHW A;  1XXU A;  5COH A;  4GF0 A;  2VIM A;  1FAA A;  3HJO A;  4Z7X A;  4ID0 A;  3HY2 A;  4EVM A;  5IOX A;  3SBC A;  2V6O A;  3HVV A;  3MAK A;  2IME A;  4GSS A;  4V2L A;  1GNW A;  2TRX A;  1SK1 A;  2YWM A;  4IJI A;  2VD0 A;  1G7O A;  1O81 A;  2NVL A;  3RPN A;  4OCF A;  4MZB A;  4WR4 A;  4RI7 A;  5HR3 A;  4HUA A;  1VF4 A;  3IAM 2;  4YH2 A;  2P5R A;  2R37 A;  2VLU A;  4ILF A;  3IC8 A;  1WOU A;  4IEL A;  4TXV A;  4GRF A;  2ZUP A;  5HFG A;  4MP4 A;  5BRT A;  2NPB A;  2DLX A;  1HQO A;  4NWY A;  2H0H A;  1B48 A;  3UBK A;  3F0I A;  4K8M A;  1ZZY A;  2IWT A;  3A5W A;  1K0D A;  1PKW A;  1F3A A;  4GSN A;  4I2U A;  4KGI A;  1YDK A;  2PU9 C;  3PH9 A;  3V1W A;  1GTB A;  2GSR A;  5C00 A;  1I5G A;  4GWR A;  3ZZX A;  2YN1 A;  1ST9 A;  1V9W A;  4OO4 A;  4OMV A;  3EYT A;  5KN3 A;  5LNK e;  4HS1 A;  4ULX A;  2F3M A;  1F37 A;  1JFU A;  4DEJ A;  5EVO A;  1GSY A;  2IMF A;  3MNG A;  3IE3 A;  3UVH A;  3APQ A;  5IMA A;  4K6X A;  3CXG A;  1QMV A;  1ON4 A;  4G9H A;  1YKC A;  1PX7 A;  3FY7 A;  2HSH A;  5CRD A;  2KUC A;  3WT1 A;  3FZ9 A;  2X8H A;  2H73 A;  2YV9 A;  2YZU A;  2YJ7 A;  4ZL7 A;  3FR9 A;  1EGO A;  3PPU A;  1GSD A;  1GH2 A;  4O7H A;  1K0C A;  2KLX A;  3JCM L;  3TKP A;  2CA8 A;  3QDN A;  4K0G A;  2YNX A;  1EZK A;  5CRG A;  1A8L A;  2CX4 A;  2OKA A;  5DQY A;  2XC2 A;  1R26 A;  1SL2 B;  1A2M A;  5IO0 A;  1M2A A;  2LRC A;  4IBP A;  1E6B A;  2B7K A;  2CAI A;  2HZF A;  2PVQ A;  2GQL A;  1ZMA A;  3HVX A;  1KEB A;  14GS A;  3Q19 A;  2H1A A;  4G0L A;  1URM A;  3G9B A;  1QXH A;  2H70 A;  2HNL A;  3VI7 A;  5ID2 A;  6GSY A;  4O92 A;  1X0R A;  2MMO A;  1NW2 A;  1R5P A;  5LCZ A;  3GN3 A;  5ID2 B;  1O6J A;  1J0F A;  1XW6 A;  4N0V A;  4GTU A;  3KTB A;  2AAW A;  3ZLP A;  5G31 A;  4AJ8 A;  2IIY A;  3E9J B;  3F4R A;  5IPG A;  1AXD A;  2FCH A;  4YKF A;  3D5J A;  4PUA A;  1PSQ A;  4IKH A;  3FHK A;  2GS3 A;  3OR5 A;  4GLT A;  2B1K A;  1E2Y A;  2YWN A;  2C3T A;  4FO5 A;  4MNN A;  1H4O A;  1THX A;  5ECH B;  5ECK B;  2CT6 A;  5DVB A;  4IN0 A;  4XS4 A;  2H75 A;  1Z6M A;  3FZA A;  2F8A A;  1ACV A;  2JU5 A;  2VCW A;  5KOW A;  4XS4 B;  2MMN A;  3H1N A;  3D21 A;  4NHZ A;  5DAL A;  4K7N A;  3IV4 A;  1NHY A;  5ECR B;  1GUM A;  1VGL A;  1ZYN A;  3M1G A;  1EV4 A;  3L9U A;  2R0C A;  3HDC A;  5DAL B;  2HZE A;  4ZBA A;  2HRN A;  4IS0 A;  3GKM A;  3GST A;  1BX9 A;  2H6Y A;  5D93 A;  3F6D A;  2H1G A;  2C0E A;  2HZE B;  3ED3 A;  2V1M A;  3DIE A;  1K3L A;  2OA7 A;  3IK9 A;  3EE2 A;  3WT2 A;  3FR3 A;  4YAV A;  3MWH A;  1EWX A;  4HI7 A;  1O7U A;  4JR4 A;  1T4Y A;  1EP7 A;  5ECO B;  2VOC A;  1XWG A;  3U6V A;  2P5Q A;  1K0A A;  4TN8 A;  5F05 A;  2NTO A;  2L4Q A;  3SWL A;  2L57 A;  3GFK A;  3RBT A;  3QPM A;  4K0N A;  2LRT A;  4IP1 A;  4K5S A;  2NBS A;  1O73 A;  1Z6N A;  2R0G A;  5HFI A;  2C3N A;  3CSI A;  2BJX A;  1K3Y A;  1S3C A;  1ZCP A;  2A4H A;  3F8U A;  4XCS A;  5INY A;  3HKR A;  1RW1 A;  1QK8 A;  2GQK A;  2E0Q A;  4YKG A;  2OAC A;  2K8S A;  3KZQ A;  3LYP A;  1RK4 A;  2F8F A;  1A0R P;  1TK0 B;  3L9S A;  3UMA A;  2LNS A;  2VL3 A;  1JZO A;  3HD5 A;  4WBJ A;  4K1F A;  3TRP A;  1BYE A;  1MDI A;  3FKF A;  4V1A g;  5C04 A;  1K3O A;  1S3D A;  3P8W A;  2H19 A;  1GLP A;  3IHG A;  2VAF A;  3C8E A;  2B7J A;  1LBK A;  1SU9 A;  5G1K A;  2H6Z A;  3CBU A;  3HJP A;  3IA1 A;  3BD2 A;  2VL2 C;  5D9X A;  4Q5Q A;  3R3E A;  2JZS A;  2DJ3 A;  3NIV A;  1GTU A;  1PX6 A;  1VF1 A;  3BBY A;  4FYB A;  4YQU A;  4K7O A;  1GRX A;  1YZX A;  4AJ6 A;  1Y25 A;  3LXT A;  4L0W A;  3W8J A;  1SK0 A;  4WKW A;  5G2Z A;  2FGX A;  2J23 A;  5CAX A;  3PGT A;  4J56 E;  3C71 A;  3UBL A;  4JRR A;  2B3S A;  3UVT A;  2RII A;  5IMZ A;  2FWE A;  2YWO A;  3TB2 A;  3VLN A;  5IQY A;  3UOM A;  5IPH A;  2DBC A;  4FYC A;  3TJJ A;  3VK9 A;  2A2S A;  2FY6 A;  3IRA A;  2OE0 A;  3M9K A;  4G0K A;  4TR0 A;  4HEA 2;  4ZB6 A;  1AAZ A;  2WUL A;  4KSO A;  3ZRE A;  3FZ5 A;  1T4Z A;  2I9H A;  1YF1 A;  2GTU A;  1SD8 A;  1M9A A;  2ZNM A;  1OC8 A;  2QA2 A;  1FG4 A;  5E4W A;  1HD2 A;  1M9B A;  4FQU A;  3VUR A;  4GQC A;  3TJK A;  2H66 A;  4FH8 A;  2FWF A;  2HRK A;  4O32 A;  3HVS A;  3QR6 A;  4BVY A;  4F82 A;  1ERT A;  1PN9 A;  4V1A p;  2OJL A;  5DJM A;  5AGY A;  4LL1 B;  1TW9 A;  1WE0 A;  4BWQ A;  3DEX A;  4BVY B;  5FWG A;  4K2X A;  5B7C A;  4MMM A;  4HJ2 A;  1MD4 A;  1GTI A;  3GL3 A;  2YZH A;  1QFN A;  1J08 A;  3QD9 A;  2J9H A;  3QAW A;  3BJ5 A;  3ZFL A;  1CQH A;  5GAP D;  5AIX A;  2FLS A;  4WXT A;  3LOR A;  4RQX A;  5CO3 A;  4E8E A;  2WJU A;  2OBK A;  1WIK A;  1N2A A;  2PUK C;  1BJX A;  2HRA A;  2C0D A;  5JCU A;  1OKT A;  3KP9 A;  3VPQ A;  4PUF C;  5H5Q A;  1ZOF A;  4KDX A;  5IOW A;  4KF9 A;  1SKW B;  4G2E A;  5F06 A;  4IJ3 A;  4Q5F A;  5HFK A;  2IPA A;  4KB3 A;  2XBI A;  3ZVJ D;  3HZ4 A;  3EIN A;  3TKS C;  4EF0 A;  3ERF A;  4JED A;  5GAN D;  4ECB A;  2GSS A;  4AGS A;  1EGR A;  4MAB A;  2KP2 A;  4XRD A;  2H1B A;  3PR8 A;  2XPE A;  4KW6 A;  3IC4 A;  3QFB C;  5JWQ B;  4CDO A;  1SJZ A;  2G2Q A;  2MMA A;  5F8B A;  1ZGN A;  3VWW A;  3UEM A;  3BCK A;  2HRF A;  2DMM A;  1SEN A;  4OWY A;  1YF0 A;  2VCZ A;  3F9U A;  2DIY A;  5D96 A;  3EMP A;  3KJY A;  4NV2 A;  3FK8 A;  1M0U A;  1S3A A;  2GST A;  2GZP A;  2PPT A;  2CAQ A;  1G7E A;  1DUG A;  2GSQ A;  4OFM A;  5DJL A;  2JZR A;  4ECJ A;  4EIQ A;  4HU7 A;  3PIN A;  4HOJ A;  2PBJ A;  4ZBD A;  4DVC A;  1PGT A;  4EO3 A;  3IXR A;  3VFI A;  5B8B A;  1AUC A;  5JWO B;  3LGC A;  4MH3 A;  5L71 A;  1EOG A;  2P0G A;  2VCV A;  3MYD A;  1XIY A;  1OVN A;  1X5E A;  1QQ2 A;  1AIU A;  1V2A A;  1X9S B;  3EU4 A;  2ON7 A;  3LWA A;  3DVX A;  2LS5 A;  2CZ2 A;  3VWV A;  3Q18 A;  5JWR B;  2WRT A;  4PNG A;  4LL4 B;  3UAP A;  2MZC A;  3J7Y b;  3G7J A;  4BWS A;  4CHS A;  2D2Z A;  5E59 A;  9GSS A;  1TRU A;  1GNE A;  5J5N A;  2YPM A;  2V2G A;  4PGT A;  2E2G A;  5J3R A;  2DML A;  4RI6 A;  3LFL A;  1V40 A;  1ZYE A;  4EDY A;  1KNG A;  3K8N A;  1T8E B;  4CW9 A;  3WD6 A;  11GS A;  4J2F A;  4E8H A;  5B6M A;  2OE1 A;  2DJ1 A;  1PL1 A;  3M3M A;  1XWA A;  5G5E A;  3TOU A;  3EWL A;  5ELG A;  5BMU A;  2MMZ A;  1UC7 A;  2I3Y A;  4PTS A;  5CRW A;  2ALB A;  3RHB A;  2C1Y A;  1XCC A;  2EIQ A;  2RLI A;  2L4C A;  3DVW A;  4I6X A;  2H1D A;  5AN1 A;  16GS A;  3DKS A;  5ECI B;  2GVP A;  1QGV A;  2WB9 A;  4MF5 A;  1OE7 A;  1K0B A;  1J9B A;  2GLR A;  1TXX A;  2WS2 A;  3KMO A;  1OE8 A;  3LG6 A;  5IIZ A;  22GS A;  1TP9 A;  4I97 A;  2REM A;  2C4J A;  1T00 A;  3CRU A;  1ZL9 A;  2A4V A;  1X5D A;  4HU9 A;  1T7P B;  5FHI A;  5DBQ A;  1XOB A;  2GT6 A;  2YWI A;  3GH6 A;  2TRC P;  3KH7 A;  3H8Q A;  1XZO A;  3J7Y k;  1M2D A;  2LKU A;  4DSS A;  2OE3 A;  2HXK A;  2O85 A;  3P7X A;  5IO2 A;  5KN1 A;  2YJH A;  3DRN A;  3TDG A;  4GXZ A;  1Q98 A;  4DSS B;  4EUY A;  4ZIL A;  7GSS A;  4K2D A;  1OYJ A;  2VLT A;  3R2Q A;  4TOP A;  2H0I A;  2RUF A;  3M9J A;  5D73 A;  1I9D A;  2N5A A;  4KH7 A;  2HT9 A;  5ELA A;  1YQ1 A;  1Z7R A;  3HCZ A;  1YJ6 A;  3P90 A;  1X9W B;  2LV3 A;  3GA4 A;  4ZL9 A;  3US3 A;  4XTS A;  2R3X A;  1K0N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...