4I6XA

Crystal structure of non-catalyic domain of protein disulfide isomerase-related (pdir) protein
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
117
structure length
117
Chain Sequence
b'MLIERISDPKDLKKLLRTRNNVLVLYSKSEVAAENHLRLLSTVAQAVKGQGTICWVDCGDAESRKLCKKMKVDLSPKDKKVELFHYQDGAFHTEYNRAVTFKSIVAFLKDPKGPPLW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein disulfide-isomerase A5
publication title Structure of the Non-Catalytic Domain of the Protein Disulfide Isomerase-Related Protein (PDIR) Reveals Function in Protein Binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 37
structure length 117
sequence length 117
ec nomenclature ec 5.3.4.1: Protein disulfide-isomerase.
pdb deposition date 2012-11-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4i6xA00
2IMDA 1BG5A 3QR6A 5J9BA 1AAZA 1OC9B 4I2TA 2ZUPA 3GN3A 5C00A 2L59A 2OBKA 1OC9A 4K7OA 1ZGNA 1AQVA 2H19A 1NSWA 5C04A 2LKUA 4N0ZA 1USBA 2YANA 5G1KA 3CRTA 4L8EA 2CT6A 1A2LA 2C1YA 2O85A 1O6JA 3ME8A 2OA7A 2H6YA 3EC3A 2DJJA 4NV5A 5L71A 2YJHA 4EXJA 3QFBC 1BEDA 2B3SA 3IHQA 2GGTA 3EWLA 4JZQA 20GSA 1TK0B 4DSRA 2GQLA 3IR4A 2E2MA 2H1BA 2TRCP 1FHEA 2WB9A 3GRXA 2HRFA 4IQAA 4PX1A 4MCUA 4WEYA 5HR0A 1FOVA 3PGTA 3TJGA 1TKDB 1TP9A 2OJLA 4WF5A 1GNWA 2PUKC 2H0HA 4K0GA 4Q5RA 1R26A 4MJBA 2MMNA 4TR3A 3DIEA 3TKPA 1E2YA 1QXHA 1TU8A 1HYUA 5J41A 4PQ1A 2KHPA 3HVSA 3RHBA 1WOUA 3ZFBA 1XZOA 2H75A 2I9HA 1EV4A 1SJZA 5IMAA 1SKSB 1VRSD 2QSIA 4ML1A 1GTAA 2GSQA 4OFMA 5DQYA 4IJ3A 3E3EA 2N5BA 3E9JB 3G7IA 2GDRA 4PXOA 5J4UA 4LA1A 5DAKB 3NIVA 1K0AA 3N9JA 6GSXA 4CHSA 4JBBA 5DAKA 1O7UA 1I9DA 1AQXA 2KP2A 3M8NA 2CZ3A 4HQZA 1ON4A 3G7JA 2L6DA 3P2AA 4HZ4A 2C0DA 1TW9A 1TXXA 4MDCA 3EMPA 3FZ9A 1Z3EA 5IMFA 3VPQA 2LRNA 11GSA 1Z6MA 1FVKA 1WJKA 2H0GA 4KSOA 3WT1A 4G2EA 3F4SA 4TRXA 2AJQB 1EP8A 1H4OA 2EC4A 5G5EA 1Z5YE 1URMA 2JZRA 1THXA 2RUEA 1O81A 4BVXA 4X43A 5G5FA 4IS0A 2RIIA 5HFGA 4MJAA 4PNFA 4GF0A 2YNXA 8GSSA 5HFIA 3EVIA 4D73B 1ERWA 4XS1A 4ISDA 4FH8A 4D73A 3TRXA 4OMVA 3Q19A 7GSSA 1XOBA 2L5LA 3IOSA 3GX0A 2OE3A 2VM1A 1AQWA 3L4NA 3HVXA 4AJ8A 3IPZA 2GZYA 6GSTA 1N8JA 5DJLA 4KA0A 2OE0A 2A4VA 4L5OA 4J56E 3TJFA 2M80A 1XOAA 1PX6A 2DLXA 1K0CA 3IXRA 3H8QA 2FGXA 4N11A 1SD9A 1W89A 2XHFA 3QD9A 3Q6OA 2VL2C 3ZVJA 3TKSA 5DALB 5EPFA 1ZCPA 2PPTA 3UJ1A 4G9HA 3DRNA 3TOUA 4KE3A 5CO3A 5DALA 2RM6A 4HU7A 1ZMAA 2CAQA 2L57A 2PBJA 5KN2A 1RK4A 1M2BA 2GT6A 1U88A 5D9WA 5EY6A 4MZCA 1TRSA 3O6TA 2HXKA 4IKHA 2WJUA 1E6BA 4CW9A 4K1FA 5F06A 4RQXA 3Q18A 5ECHB 3WT2A 2OACA 2HNLA 4MZWA 2JL4A 5GZZB 2B7KA 3EU4A 3FY7A 2L4CA 4BL7A 3ZL5A 1K3LA 4JE1A 1F2EA 1R4WA 2BJXA 5JCGA 5KN0A 5COHA 5D93A 5INYA 3SBCA 4GSSA 3D4TA 4KB3A 5J3RA 4EF0A 1A8LA 4EDYA 3UMAA 1R7HA 2VIMA 1TOFA 5F0GA 2V41A 2YJ7A 3EURA 1JHBA 2N5FA 3EE2A 4K9ZA 4K2DA 1SENA 4HEA2 1OC8A 1S3AA 1KBNA 2VAFA 4YQVA 4POLA 4TXVA 3CTGA 1GWCA 4KSMA 2NPBA 3TJKA 1EV9A 1SD8A 2I3YA 1SU9A 1THOA 1UA5A 3VWUA 1OE8A 1LBKA 3FR9A 3IAS2 4QL9A 2OKAA 2B5XA 2PERA 4EE0A 3TKQA 4RI7A 4J2FA 1B4PA 1DSBA 1X0RA 2KP1A 3IK7A 1O73A 3FZ5A 1EGRA 3HZ4A 3PINA 3IE3A 4WXTA 3S9FA 4V2MA 4TOPA 1QMVA 4OO5A 3WYWA 3FK8A 4AF2A 5CYYA 4ID0A 1YQ1A 5IQYA 3GHAA 1KTEA 3GKNA 5ECSA 2IIYA 4DSQA 3ERWA 4F03A 3A2VA 5CRDA 4O32A 3VK9A 3UVTA 3FW2A 5H5SA 1UN2A 1SKWB 1GLQA 4ECBA 2R5GA 2IMFA 3DVXA 5CRGA 2K18A 1A0RP 2VLUA 3HCZA 3BCIA 1GSUA 4KH7A 2H73A 2DC5A 1QGVA 3P90A 2JU5A 3F63A 4P3YB 2YZHA 4I8BA 1M7TA 1TRUA 3TJBA 3DYRA 4IJIA 1YF0A 1X9WB 4MZBA 4LLRA 3GUSA 2H0IA 1XWKA 3ZVJD 2ZCTA 3L78A 4MPGA 4BWQA 1LJRA 18GSA 3RDWA 1U6TA 2YWMA 2P5QA 1EOHA 3HYPA 2LJAA 2IWTA 1NW2A 4FYUA 3GA4A 4V1Ag 4ECCA 2EIRA 2H6XA 4LMVA 3PR8A 4MP4A 3ZFLA 4J57E 5ECNB 3U5RE 1KNGA 1FB0A 4PQIA 4F0CA 3KTLA 2A2SA 2VCTA 2H1DA 4NHZA 3V1WA 1GRXA 2P31A 1BQ7A 4WF4A 3LG6A 4MMMA 2A2RA 2DMMA 3US3A 1J08A 2E7PA 5KEJA 5CNWA 5GSSA 3ME7A 1TJDA 2IN3A 4KUNA 2WZ9A 4MH2A 3SWLA 3O76A 4WR5A 2EIOA 6GSVA 2MMAA 2LSTA 4DEJA 3TKSE 2PVOC 4I2UA 4O5RA 4HU9A 3TKRA 2B5EA 4L0WA 3FZ4A 3D6IA 1PX7A 4XRDA 1GUKA 3CBUA 4QQ7A 1U3IA 1N2AA 3D5JA 3VFIA 2VM2A 2GTUA 1XVQA 2B1LA 3C1SA 2HZEB 1G6WA 2DIYA 3D0ZA 2PN8A 2VL9A 3BJ5A 2HZEA 3ERGA 4ZIJA 3J7Yk 4I97A 2GSTA 5IPHA 3W8SA 2CVBA 4HI7A 1ILOA 3LXZA 3KXOA 5DBQA 2M72A 2IMKA 1Q4JA 4IBPA 2J23A 4KGIA 4OFTA 3RPNA 3TJJA 1B9XC 5ELAA 5B8BA 1XFLA 2LQOA 3C8EA 3FHKA 3APQA 3GSTA 1XW6A 3HDCA 4NPBA 1B4QA 1WWJA 4MJEA 19GSA 1FVJA 2FA4A 4KX4A 4I6XA 4EDZA 1Z7RA 1Z7PA 2L6CA 1OKDA 1PQNA 3KMNA 5FHIA 4XS6A 1T8EB 3HD5A 2WS2A 3RPPA 3L9VA 3IBHA 2V32A 4Q5QA 1C72A 3QOUA 1DBYA 2NDOA 1G0TA 3W8JA 3GSSA 3ZIJA 1TU7A 2MYGA 9GSSA 6GSYA 2HT9A 2C3QA 2FUG2 1JFUA 2WGRA 5ELGA 2GLRA 4RQRA 3GIXA 2WRTA 1YJ6A 1YKCA 5GSTA 5HFKA 3MWHA 1GUMA 2C8UA 1WE0A 5IIZA 2ON5A 3KH7A 5J9CA 2LJRA 2FHEA 4K6XA 2BTOT 4N30A 4N10A 4O92A 2VCXA 3RBTA 3A2XA 2V2GA 4GLTA 3KCMA 2C0FA 1ZYEA 5ECRB 2CZ2A 4OFNA 4TR0A 4ZL9A 5AGYA 3UBKA 4BWSA 1TDIA 2YP6A 2FWGA 3KJYA 5G1LA 1WRYA 1X9MB 1PKZA 1GH2A 1WIKA 3IRAA 3M3MA 5ID2B 3W6GA 2R4VA 5ECKB 2HYXA 4PURA 3HVVA 1GSYA 3K8NA 5CP1A 2PVQA 2V6OA 1DUGA 4TXOB 1YEPA 4O7HA 4YAVA 1VF2A 4GSTA 2WULA 2YWNA 2FNOA 2NTOA 3GKMA 3GH6A 5H5RA 3ZYWA 2XPEA 3HJOA 1R5AA 4XIHA 13GSA 3H4KA 1V2AA 2JACA 4Z7XA 1GSEA 4K7IA 2F9SA 5A5KA 2VD1A 1GTUA 1SYRA 3IA1A 3I43A 4L0UA 2XBQA 1MTCA 3GKKA 3HHVA 2DMLA 1I5GA 5DDLA 2LS5A 2NVLA 3TUEA 3CSIA 4GQFA 4ZB8A 2HRNA 2XBIA 4KDXA 1OKTA 3HA9A 4K7NA 4HQSA 3EINA 3FZAA 1HD2A 5DJMA 3QMXA 2HFDA 4F82A 1T7PB 2V6KA 1YEXA 5D9XA 3WGEA 4IELA 5GAPD 2HE3A 2LV3A 3TCOA 2C4JA 5AISA 3FYGA 2FA8A 4JRRA 1SL0B 4IP6A 3UAPA 2M46A 2VL3A 4WBRD 2XC2A 4OCFA 1PL2A 2IPAA 6GSSA 4N0VA 2VLVA 2LRTA 1Z9HA 5JWQB 5ECQB 5JCWA 5G30A 3IDVA 2AUVA 3APSA 3H93A 3DWVA 4E8EA 1PA3A 1VF4A 5IM9A 4IVFA 3VLNA 2ZNMA 1OVNA 1WPIA 3ISOA 3F9UA 3M9JA 2RLIA 4ML6A 2JSZA 2JADA 1VGLA 1ZOFA 4GRFA 2CAIA 1YDKA 3HZ8A 4IP1A 5CRWA 2LNTA 4PUAA 2EIQA 4MPFA 4TN8A 4ULXA 5LNKe 3F6FA 3M1GA 5A4WA 2RUFA 1B48A 4ACSA 2AV4A 3KTBA 2R6KA 1MDIA 5EVOA 1ST9A 1PKWA 3VWWA 4MF7A 3MSZA 5H5QA 2VCWA 3H1NA 1K0MA 2E0QA 1T4ZA 1PGTA 2X8CA 3LXTA 3CSJA 3CXGA 1K3OA 1YZXA 5F05A 1MD4A 5B8AA 2F3MA 3CSHA 1EP7A 4TW5A 4RUVA 1S3CA 2C0GA 1FG4A 1QK8A 3ZZXA 2P0GA 1W4VA 16GSA 4YQUA 2JZTA 2CX4A 3BD2A 2LQQA 1HQOA 3KH9A 2GT5A 1TK8B 3VI7A 5ABRA 4G10A 3BOAA 4X1UA 3RAZA 2AHEA 1YY7A 4IN0A 5DQSA 4I5QA 1ACVA 3UARA 1FB6A 2RM5A 3LFLA 3LEFA 1XXUA 3UOMA 4TVEA 2KOKA 2AAWA 5ENUA 4FIWA 1K0DA 4F9ZA 3ZRDA 2J9HA 2HSYA 2H8LA 5E59A 4K8MA 3ZMKA 2BMXA 2MBSA 1NHOA 2YV9A 2FWHA 3UIWA 2YCDA 3HKRA 1OC3A 4X0XA 1EWXA 1V9WA 3Q74A 2C0EA 2HSHA 5D96A 2LUSA 4ZBBA 3TKSC 3DEXA 3LORA 2YWOA 1XWBA 1NM3A 2WDUA 1ERVA 1XW5A 1JZWA 1O8WA 2OADA 5IMZA 1A2MA 3I69A 1XBSA 5F8BA 3FRCA 3KMOA 3DMLA 5ECLB 1PN9A 1J0FA 3GH9A 1M9AA 2VO4A 3RHCA 4DVCA 3A2WA 1FO5A 5IMCA 4YQMA 1OAZA 17GSA 5B6NA 5FWGA 4XTSA 1XVWA 1BJXA 2YWIA 2O87A 2B5YA 1ZYQB 3NZNA 4GWRA 3OR5A 3JCML 3F0IA 1IYIA 1XWAA 5D9VA 3VWXA 1XPVA 3P8WA 4HDEA 3C1RA 4GTUA 4Q5FA 1FW1A 1PD21 2AYTA 4EO3A 4KNDA 1GLPA 2PU9C 1GNEA 3GV1A 2PMTA 1DE2A 2JZSA 1TRWA 1YF1A 5CRHA 5IPGA 1B9YC 2R3XA 3I6AA 5IMVA 2R37A 5HR1A 1F3AA 1TK5B 3GKXA 4ZL8A 2MMZA 1UVZA 6GSUA 1JZOA 4POKA 3EYTA 3WD6A 2GQKA 3CYNA 1AC1A 2K8SA 4XRAA 1JLVA 1GL8A 4KAEA 5IO2A 1SL2B 4KCEA 2O7KA 2WCIA 3F4TA 2E2GA 1OYJA 4ZBAA 1X5DA 1TRVA 3FR6A 3P7XA 1OE7A 1CQGA 5G31A 3GFKA 2FCHA 1T00A 4CDOA 1ERTA 3GYKA 2PGTA 3R2QA 1J9BA 2B1KA 3QAVA 2LTKA 1YKAA 5JCUA 3D22A 3IK9A 1KEBA 1T3BA 2CQ9A 2V1MA 3F8UA 4WETA 3C71A 3N5OA 3ZLPA 1TI1A 4MA9A 2CV4A 4MH3A 2DJ1A 5DCGA 3FEUA 5HQPA 2AB6A 4V1Ap 12GSA 1XCCA 4IHUA 1EEMA 4L5LA 1SJIA 3QFAC 4E8HA 3KP8A 5B7CA 2ES7A 2R2JA 2CVKA 4YAPA 5HR2A 3VURA 3ED3A 2OBIA 5ECOB 3KIJA 1M99A 1U3AA 3I9V2 4MJCA 1X5EA 1SYXA 3TOTA 4KCAA 2FY6A 4V2NA 2OE1A 5EL8A 2GZZA 3LJRA 2K8VA 4LMWA 3M9KA 2TRXA 4F2IA 2IFQB 1JZRA 2YZUA 1M2DA 2IFQA 3UL3A 1ABAA 1EZKA 2QC7A 1TTZA 1Z6NA 1F6MC 3QCPA 2VL2A 1TI3A 4V2LA 5D8IA 2FWFA 4ZB9A 4WR4A 3MNGA 3A3TA 4OO4A 3BBYA 1PMTA 2GZPA 3GMFA 2IL3A 2X99A 2X64A 3H79A 5KN3A 3F4RA 5A4UA 4QL7A 1PRXA 3ZTLA 5AIXA 2GSRA 2L4QA 5A4VA 2G0FA 1BAYA 2ALBA 2H72A 3MAKA 2H74A 4K0NA 5ID2A 1SK1A 1GP1A 1V58A 3IAM2 4BA7A 2DSAA 1M0UA 4KDYA 4KDUA 3G7YA 2IMIA 4FYBA 1Q98A 1G7EA 2G2QA 2DJ0A 1S3DA 1CQHA 5IOWA 4TXOA 4FYCA 5E4WA 2C3TA 3LQ7A 1NHYA 1ZL9A 1X9SB 3KP9A 4XCSA 2LEGA 2VUPA 3ZREA 2H70A 2GSSA 3MDKA 4ECJA 2DIZA 1O8XA 1AW9A 1A2JA 2I1UA 3TRQA 1UC7A 3M0FA 1PSQA 4PGTA 2X8GA 2Z9SA 4AJ7A 1XW9A 4EC0A 4YH2A 1QFNA 3UEMA 4PQHA 1A0FA 3C73A 1GSFA 3GL3A 3PH9A 1K0BA 4OCEA 6GSWA 2X8HA 2B6MA 1U87A 4PNGA 1MD3A 1FAAA 1A23A 3L9SA 5HR3A 3LWAA 1IYHA 1AXDA 3DGQA 3GNJA 2C3NA 5ECPB 2D2ZA 4ZB6A 3ERFA 3A5WA 3F3QA 2P5RA 4ECIA 5ECMB 3WGXA 2LRCA 2FD3A 4NWYA 1XWCA 4HOJA 1AUCA 3QAGA 4JR4A 5D73A 3AY8A 14GSA 5G2ZA 1SJ6A 2H30A 3BCKA 1ERUA 4MF6A 5JWOB 1EEJA 1K3YA 2NBSA 4XHMA 3LYKA 1VF1A 3G9BA 4RI6A 2H1GA 4GQCA 2CX3A 3F3RA 1PL1A 1M9BA 1WMJA 4MLYA 4ZILA 2H66A 1GSDA 1G7OA 4H86A 4IW9A 5KN1A 1A24A 4EUYA 1SK2A 3UVHA 3APOA 3TRPA 5F07A 2WFCA 5AIVA 2H01A 1K0OA 2VCQA 1ZZYA 4NV2A 1T4YA 1JZDA 2YN1A 2F51A 4F0BA 2F8FA 2KLXA 3DKSA 5LCZA 2VLTA 2F8AA 2LJKA 2L5OA 1HNBA 4BVYA 3ZIVA 4GXZA 5IOXA 3FKFA 3TDGA 4IQ1A 1M2AA 4HJ2A 4JR6A 1Y6EA 2K6VA 2N5AA 2MBTA 4ILFA 2O8VB 3DXBA 3U6VA 4EL1A 1BX9A 1XWGA 3IV4A 2XPDA 1BYEA 3CRUA 2IMEA 1MDJA 2HI7A 1GULA 1GSSA 2QGVA 3GX8A 2REMA 3LSZA 3D21A 1GTIA 1MEKA 5D9TA 1MDKA 3CTFA 2TIRA 4TR1B 4JEDA 1GUHA 4BPYA 1X5CA 3EU3A 1XIYA 4GCIA 2H76A 1VF3A 4TR1A 1ML6A 4LL4B 5JWRB 4LL1B 1SKRB 4XS4B 2DBCA 1A8YA 3HXSA 2GQMA 3KD0A 3UBLA 5DCHA 3L0HA 4XS4A 1O85A 4ZL7A 2YPMA 3KGKA 4AJ6A 10GSA 4WKWA 1SL1B 2GS3A 1F37A 3QPMA 2K9FA 3GURA 5ECIB 4HZ2A 2DJKA 1T1VA 5IMDA 3WGDA 2FWEA 1F3BA 1DE1A 3VI5A 3IC4A 5GAND 2MMOA 3DD3A 3C7MA 4ZBDA 4FO5A 1V57A 4EKZA 1Y25A 3HJPA 1GSQA 1F9MA 4WBJA 3EMXA 2VCVA 2GVPA 2VCZA 1G6YA 4OD7A 3HJMA 3NOFA 2VOCA 4MABA 5FT3A 4PUFC 5B6MA 2LNSA 3GL5A 1LU4A 2QKEA 3CMIA 3KZQA 2I81A 4NAXA 1HNCA 3LYPA 3VWVA 5AN1A 4DSSB 1H75A 1V98A 5LD0A 5CAXA 3KM6A 1RQMA 2B7JA 4DSSA 2DJ2A 3DVWA 2H6ZA 4EVMA 1R5PA 3LGCA 2C80A 4G19A 4GSNA 3VPTA 1B8XA 4KW6A 2KUCA 4JU5A 2YV7A 2HLSA 3ZMLA 1QQ2A 3J7Yb 1EOGA 3QDNA 2YOIA 5IO0A 4AGSA 3L9UA 1HNAA 2H1AA 2DJ3A 4POMA 2VD0A 3F6DA 2CA8A 3QAWA 4ZXGA 1V40A 2HZFA 4NHWA 4TR4A 4NMUA 3ZITA 1EGOA 3TGZA 4MK3A 2O89A 3GTUB 4MF5A 5DVBA 1GTBA 3TB2A 1JLWA 5CREA 2CVDA 4HJMA 3E0UA 3GTUA 3O3TA 1RW1A 4TKYA 4HUAA 3D4MA 2I4AA 3FR3A 2H71A 4NXIA 1AIUA 4HS1A 4OWYA 2MZCA 22GSA 2ON7A 1K0NA 1QUWA 4Q5NA 1SK0A 3HY2A 3KEBA 2PWJA 4POBA 2IJYA 4IGJA 5J5NA 1WP0A 2JSYA 2FLSA
chains in the Genus database with same CATH superfamily
2IMDA 1BG5A 3QR6A 5J9BA 1AAZA 1OC9B 4I2TA 2ZUPA 3GN3A 5C00A 2L59A 1FOHA 2OBKA 1OC9A 4K7OA 1ZGNA 1AQVA 2H19A 1NSWA 5C04A 2LKUA 4N0ZA 1USBA 2YANA 5G1KA 3CRTA 4L8EA 2CT6A 1A2LA 2C1YA 2O85A 1O6JA 3ME8A 2OA7A 2H6YA 3EC3A 2DJJA 4NV5A 5L71A 2YJHA 4EXJA 3QFBC 1BEDA 2B3SA 3IHQA 2GGTA 3EWLA 4JZQA 20GSA 1TK0B 4DSRA 2GQLA 3IR4A 2E2MA 2H1BA 2TRCP 1FHEA 2WB9A 3GRXA 2HRFA 4IQAA 4PX1A 4MCUA 4WEYA 5HR0A 1FOVA 3PGTA 3TJGA 1TKDB 1TP9A 2OJLA 4WF5A 1GNWA 2PUKC 2H0HA 4K0GA 4Q5RA 1R26A 4MJBA 2MMNA 4TR3A 3DIEA 3TKPA 1E2YA 1QXHA 1TU8A 1HYUA 5J41A 4PQ1A 2KHPA 3HVSA 3RHBA 1WOUA 3ZFBA 1XZOA 2H75A 2I9HA 1EV4A 1SJZA 5IMAA 1SKSB 1VRSD 2QSIA 4ML1A 1GTAA 2GSQA 4OFMA 5DQYA 4IJ3A 3E3EA 2N5BA 3E9JB 3G7IA 2GDRA 4PXOA 5J4UA 4LA1A 5DAKB 3NIVA 1K0AA 3N9JA 6GSXA 4CHSA 4JBBA 5DAKA 1O7UA 1I9DA 1AQXA 2KP2A 3M8NA 2CZ3A 4HQZA 3HVNA 1ON4A 3G7JA 2L6DA 3P2AA 4HZ4A 2C0DA 1TW9A 1TXXA 4MDCA 3EMPA 3FZ9A 1Z3EA 5IMFA 3VPQA 2LRNA 11GSA 1Z6MA 1FVKA 1WJKA 2H0GA 4KSOA 3WT1A 4G2EA 3F4SA 4TRXA 2AJQB 1EP8A 1H4OA 2EC4A 4BVXB 5G5EA 1Z5YE 1URMA 2JZRA 1THXA 2RUEA 1O81A 4BVXA 4X43A 5G5FA 4IS0A 2RIIA 5HFGA 4MJAA 4PNFA 4GF0A 2YNXA 8GSSA 5HFIA 4K2XA 3EVIA 4D73B 1ERWA 4KF9A 4XS1A 4ISDA 4FH8A 4D73A 3TRXA 4OMVA 3Q19A 7GSSA 1XOBA 2L5LA 3IOSA 3GX0A 2OE3A 2VM1A 1AQWA 3L4NA 3HVXA 4AJ8A 3IPZA 2GZYA 6GSTA 1N8JA 5DJLA 2A2PA 4KA0A 4ICYA 2OE0A 2A4VA 4L5OA 4J56E 3TJFA 2M80A 1XOAA 1PX6A 2DLXA 1K0CA 3IXRA 3H8QA 2FGXA 4N11A 1SD9A 1W89A 2XHFA 3QD9A 3Q6OA 2VL2C 3ZVJA 3TKSA 5DALB 5EPFA 1ZCPA 2PPTA 3UJ1A 4G9HA 3DRNA 3TOUA 4KE3A 5CO3A 5DALA 2RM6A 4USSA 4HU7A 1ZMAA 2CAQA 2L57A 2PBJA 5KN2A 1RK4A 1M2BA 2GT6A 1U88A 5D9WA 5EY6A 4MZCA 1TRSA 3O6TA 2HXKA 4IKHA 2WJUA 1E6BA 4CW9A 4FQUA 4K1FA 5F06A 4RQXA 3Q18A 5ECHB 3WT2A 2OACA 2HNLA 4MZWA 2JL4A 5GZZB 2B7KA 3EU4A 3FY7A 2L4CA 1M3JA 4BL7A 3ZL5A 1K3LA 4JE1A 1F2EA 1R4WA 2A4HA 2BJXA 5JCGA 5KN0A 5COHA 5D93A 5INYA 3SBCA 4GSSA 3D4TA 4KB3A 5J3RA 4EF0A 1A8LA 4EDYA 3UMAA 1R7HA 2VIMA 1TOFA 5F0GA 2V41A 2YJ7A 3EURA 1JHBA 2N5FA 3EE2A 4K9ZA 4K2DA 1SENA 4HEA2 1OC8A 1S3AA 1KBNA 2VAFA 4YQVA 4POLA 4TXVA 3CTGA 1GWCA 4KSMA 2NPBA 3TJKA 1EV9A 1SD8A 2I3YA 1SU9A 5BMUA 1THOA 1UA5A 3VWUA 1OE8A 1LBKA 3FR9A 3IAS2 4QL9A 2OKAA 2B5XA 2PERA 4EE0A 3TKQA 4RI7A 4J2FA 1B4PA 1DSBA 1X0RA 2KP1A 3IK7A 1O73A 3FZ5A 1EGRA 4BIKA 3HZ4A 3PINA 3IE3A 4WXTA 3S9FA 4HSCX 4V2MA 4TOPA 1QMVA 4OO5A 3WYWA 3FK8A 4AF2A 5CYYA 4ID0A 1YQ1A 5IQYA 3GHAA 1KTEA 3GKNA 5ECSA 2IIYA 4DSQA 3ERWA 4F03A 3A2VA 5CRDA 4O32A 3VK9A 3UVTA 3FW2A 5H5SA 1UN2A 1SKWB 1GLQA 4ECBA 2R5GA 2IMFA 2HRKA 3DVXA 5CRGA 2K18A 1A0RP 2VLUA 3HCZA 3BCIA 1GSUA 5BRTA 4KH7A 2H73A 2DC5A 1QGVA 3P90A 2JU5A 3F63A 4P3YB 2YZHA 4I8BA 1M7TA 1TRUA 3TJBA 2DKIA 3DYRA 4IJIA 1YF0A 1X9WB 4MZBA 4LLRA 3GUSA 2H0IA 1XWKA 3ZVJD 2ZCTA 3L78A 4MPGA 4BWQA 1LJRA 18GSA 3RDWA 1U6TA 2YWMA 3R3EA 2P5QA 1EOHA 3HYPA 2LJAA 2IWTA 1NW2A 4FYUA 3GA4A 4V1Ag 4ECCA 2EIRA 2H6XA 4LMVA 3PR8A 4MP4A 3ZFLA 4J57E 5ECNB 3U5RE 1KNGA 1FB0A 4PQIA 4F0CA 3KTLA 2A2SA 2VCTA 2H1DA 4NHZA 3V1WA 1GRXA 2P31A 1BQ7A 4WF4A 3LG6A 4MMMA 2A2RA 2DMMA 3US3A 1J08A 2E7PA 5KEJA 5CNWA 5GSSA 3ME7A 1TJDA 2IN3A 4KUNA 2WZ9A 4MH2A 3SWLA 3O76A 4WR5A 2EIOA 6GSVA 2MMAA 2LSTA 4DEJA 3TKSE 2PVOC 4I2UA 4O5RA 4HU9A 3TKRA 2B5EA 4L0WA 3FZ4A 3D6IA 1PX7A 4XRDA 1GUKA 5KOWA 3CBUA 4QQ7A 1U3IA 1N2AA 3D5JA 3VFIA 2VM2A 2GTUA 1XVQA 2B1LA 3C1SA 4YKGA 2HSMA 2HZEB 1G6WA 2DIYA 3D0ZA 2PN8A 2VL9A 3BJ5A 2HZEA 3ERGA 4ZIJA 3J7Yk 4I97A 2GSTA 5IPHA 3W8SA 2CVBA 4HI7A 2R0GA 1ILOA 3LXZA 3KXOA 5DBQA 2M72A 2IMKA 1Q4JA 4IBPA 2J23A 4KGIA 4OFTA 3RPNA 3CQFA 3TJJA 1B9XC 5ELAA 5B8BA 1XFLA 2LQOA 3C8EA 3FHKA 3APQA 3GSTA 1XW6A 3HDCA 4NPBA 1B4QA 2HRAA 1WWJA 4MJEA 1M3IA 19GSA 1FVJA 2FA4A 4KX4A 4I6XA 4EDZA 1Z7RA 1Z7PA 2L6CA 1OKDA 1PQNA 3KMNA 5FHIA 4XS6A 1T8EB 3HD5A 4G0KA 2WS2A 3RPPA 3L9VA 3IBHA 2V32A 4Q5QA 1C72A 4O5QA 1PN0A 3QOUA 1DBYA 2NDOA 1G0TA 3W8JA 3GSSA 3ZIJA 1TU7A 2MYGA 9GSSA 1XG8A 6GSYA 2HT9A 2C3QA 2FUG2 1JFUA 2WGRA 5ELGA 2GLRA 4RQRA 3GIXA 2WRTA 1YJ6A 1YKCA 5GSTA 5HFKA 3MWHA 1GUMA 2C8UA 1WE0A 5IIZA 2ON5A 3KH7A 5J9CA 2LJRA 2FHEA 4K6XA 2BTOT 4O5UA 4N30A 4N10A 4O92A 2VCXA 3RBTA 3A2XA 2V2GA 4GLTA 3KCMA 2C0FA 1ZYEA 5ECRB 2CZ2A 4OFNA 4TR0A 4ZL9A 5AGYA 3UBKA 4BWSA 1TDIA 2YP6A 2FWGA 3KJYA 5G1LA 1WRYA 1X9MB 1PKZA 1GH2A 1WIKA 3IRAA 3M3MA 5ID2B 3W6GA 2R4VA 5ECKB 2HYXA 4PURA 3HVVA 1GSYA 3K8NA 5CP1A 2PVQA 2V6OA 1DUGA 4TXOB 1YEPA 4O7HA 4YAVA 1VF2A 4GSTA 2WULA 2YWNA 2FNOA 2NTOA 3GKMA 3GH6A 5H5RA 3ZYWA 2XPEA 3HJOA 1R5AA 4XIHA 13GSA 3H4KA 1V2AA 2JACA 4Z7XA 1GSEA 4K7IA 2F9SA 5A5KA 2VD1A 1GTUA 1SYRA 3IA1A 3I43A 4L0UA 2XBQA 1MTCA 3GKKA 3HHVA 2DMLA 1I5GA 5DDLA 2LS5A 2NVLA 3TUEA 3CSIA 4GQFA 4ZB8A 2HRNA 4G0LA 2XBIA 4KDXA 1OKTA 3HA9A 4K7NA 4HQSA 3EINA 3FZAA 1HD2A 5DJMA 3QMXA 2X4AA 2HFDA 4F82A 1T7PB 2V6KA 1YEXA 5D9XA 3WGEA 1ZYPA 4IELA 5GAPD 2HE3A 2LV3A 3TCOA 2C4JA 5AISA 3FYGA 2FA8A 4JRRA 1SL0B 4IP6A 3UAPA 2M46A 2QA2A 2VL3A 4WBRD 2XC2A 4Z2TA 4OCFA 1PL2A 2IPAA 6GSSA 4N0VA 2VLVA 2LRTA 1Z9HA 5JWQB 5ECQB 5JCWA 5G30A 3IDVA 2AUVA 3APSA 3H93A 3DWVA 4E8EA 1PA3A 1VF4A 5IM9A 4IVFA 3VLNA 2ZNMA 1OVNA 1WPIA 3ISOA 3F9UA 3M9JA 2RLIA 4ML6A 2JSZA 2JADA 4YKFA 1VGLA 1ZOFA 4GRFA 2CAIA 1YDKA 3HZ8A 4IP1A 5CRWA 2LNTA 4PUAA 2EIQA 4MPFA 4TN8A 4ULXA 5LNKe 3F6FA 3M1GA 5A4WA 2RUFA 1B48A 4ACSA 2AV4A 2X49A 3KTBA 2R6KA 1MDIA 5EVOA 1ST9A 5KOXA 1PKWA 3VWWA 4MF7A 3MSZA 5H5QA 2VCWA 3H1NA 1K0MA 2E0QA 1T4ZA 1PGTA 2X8CA 3LXTA 3CSJA 3CXGA 1K3OA 1YZXA 5F05A 1MD4A 5B8AA 2F3MA 3CSHA 1EP7A 4TW5A 4RUVA 1S3CA 2C0GA 1FG4A 1QK8A 3ZZXA 2P0GA 1W4VA 16GSA 4YQUA 2JZTA 2CX4A 3BD2A 2LQQA 1HQOA 3KH9A 2GT5A 3MYDA 1TK8B 3VI7A 5ABRA 4G10A 3BOAA 4X1UA 3RAZA 2AHEA 1YY7A 4IN0A 5DQSA 4I5QA 1ACVA 3UARA 1FB6A 2RM5A 3LFLA 3LEFA 1XXUA 3UOMA 3PPUA 4TVEA 2KOKA 2AAWA 5ENUA 3MIXA 4FIWA 1K0DA 4F9ZA 3ZRDA 2J9HA 2HSYA 2H8LA 5E59A 3EPTA 4K8MA 3ZMKA 2BMXA 2MBSA 1NHOA 2YV9A 2FWHA 3UIWA 2YCDA 3HKRA 3FMWA 1OC3A 4X0XA 1EWXA 1V9WA 3Q74A 2C0EA 2HSHA 5D96A 4CY8A 2LUSA 4ZBBA 3TKSC 3DEXA 3LORA 2YWOA 1XWBA 1NM3A 2WDUA 1ERVA 1XW5A 1JZWA 1O8WA 2OADA 5IMZA 1A2MA 3I69A 1XBSA 5F8BA 3FRCA 3KMOA 3DMLA 5ECLB 1PN9A 1J0FA 3GH9A 1M9AA 2VO4A 3RHCA 4DVCA 3A2WA 1FO5A 5IMCA 4YQMA 1OAZA 17GSA 5B6NA 5FWGA 4XTSA 1XVWA 1BJXA 2YWIA 2O87A 2B5YA 1ZYQB 3NZNA 4GWRA 3OR5A 3JCML 3F0IA 1IYIA 1XWAA 5D9VA 3VWXA 1XPVA 3P8WA 4HDEA 3C1RA 4GTUA 4Q5FA 1FW1A 1PD21 2AYTA 4EO3A 4KNDA 1GLPA 2PU9C 1GNEA 3GV1A 2PMTA 1DE2A 2JZSA 1TRWA 1YF1A 5CRHA 4K5RA 5IPGA 1ZYNA 1B9YC 2R3XA 3I6AA 5IMVA 2R37A 5HR1A 1F3AA 1TK5B 3GKXA 4ZL8A 2MMZA 1UVZA 6GSUA 1JZOA 4POKA 3EYTA 3WD6A 2GQKA 3CYNA 1AC1A 2K8SA 4XRAA 1JLVA 1GL8A 4KAEA 5IO2A 1SL2B 4KCEA 2O7KA 2WCIA 3F4TA 2E2GA 1OYJA 4ZBAA 1X5DA 1TRVA 3FR6A 3P7XA 1OE7A 4EIQA 5G31A 3GFKA 1CQGA 2FCHA 1T00A 4CDOA 1ERTA 3GYKA 2PGTA 3R2QA 1J9BA 2B1KA 3QAVA 4Z2UA 2LTKA 1YKAA 5JCUA 3D22A 3IK9A 1KEBA 1T3BA 2CQ9A 2V1MA 3F8UA 4WETA 3C71A 3N5OA 3ZLPA 4K5SA 1TI1A 4MA9A 2CV4A 4MH3A 2DJ1A 5DCGA 3FEUA 5HQPA 2AB6A 4V1Ap 12GSA 1XCCA 4IHUA 1EEMA 4L5LA 1SJIA 3QFAC 4E8HA 2R0CA 3KP8A 5B7CA 2ES7A 2R2JA 2CVKA 4YAPA 5HR2A 3VURA 3ED3A 2OBIA 5ECOB 3KIJA 1M99A 1U3AA 3I9V2 4MJCA 1X5EA 1SYXA 3TOTA 4KCAA 2FY6A 4V2NA 2OE1A 5EL8A 2GZZA 3LJRA 2K8VA 4LMWA 3M9KA 2TRXA 4F2IA 2IFQB 1JZRA 2YZUA 1M2DA 2IFQA 3UL3A 1ABAA 1EZKA 2QC7A 1TTZA 1Z6NA 1F6MC 3QCPA 2VL2A 1TI3A 4V2LA 5D8IA 2FWFA 4ZB9A 4WR4A 3MNGA 3A3TA 4OO4A 3BBYA 1PMTA 2GZPA 3GMFA 2IL3A 2X99A 4Z2RA 2X64A 3H79A 5KN3A 3F4RA 5A4UA 4QL7A 1PRXA 3ZTLA 5AIXA 2GSRA 2L4QA 5A4VA 2G0FA 1BAYA 2ALBA 2H72A 3MAKA 2H74A 4K0NA 2R0PA 5ID2A 1SK1A 1GP1A 1V58A 3IAM2 4BA7A 2DSAA 1M0UA 4KDYA 4KDUA 3G7YA 2IMIA 4FYBA 1Q98A 1G7EA 2G2QA 2DJ0A 1S3DA 1CQHA 5IOWA 4TXOA 4FYCA 5E4WA 2C3TA 3LQ7A 1NHYA 1ZL9A 3A5IA 1X9SB 3KP9A 4XCSA 2LEGA 2VUPA 3ZREA 2H70A 2GSSA 3MDKA 4ECJA 2DIZA 1O8XA 1AW9A 1A2JA 2I1UA 3TRQA 1UC7A 3M0FA 1PSQA 4PGTA 2X8GA 2Z9SA 4AJ7A 1XW9A 4EC0A 4YH2A 1QFNA 3UEMA 4PQHA 1A0FA 3C73A 1GSFA 3GL3A 3PH9A 1K0BA 4OCEA 6GSWA 2X8HA 2B6MA 1U87A 4PNGA 1MD3A 1FAAA 1A23A 3L9SA 5HR3A 3LWAA 1IYHA 1AXDA 3DGQA 3GNJA 2C3NA 5ECPB 2D2ZA 4ZB6A 3ERFA 3A5WA 3F3QA 2P5RA 4ECIA 5ECMB 3WGXA 2LRCA 2FD3A 4NWYA 1XWCA 4HOJA 1AUCA 3QAGA 4JR4A 5D73A 3AY8A 14GSA 5G2ZA 1SJ6A 2H30A 3BCKA 1ERUA 4MF6A 5JWOB 1EEJA 1K3YA 2NBSA 4XHMA 3LYKA 1VF1A 3G9BA 2UZ8A 4RI6A 2H1GA 4GQCA 2CX3A 3F3RA 1PL1A 1M9BA 1WMJA 4MLYA 4ZILA 2H66A 1GSDA 1G7OA 4H86A 4IW9A 5KN1A 1A24A 4EUYA 1SK2A 3UVHA 3APOA 3TRPA 5F07A 2WFCA 1PFOA 5AIVA 2H01A 1K0OA 2VCQA 1ZZYA 4NV2A 1T4YA 3IC8A 1JZDA 2YN1A 4BVYB 2F51A 4F0BA 2F8FA 2KLXA 3DKSA 5LCZA 2VLTA 2F8AA 2LJKA 2L5OA 1HNBA 4BVYA 3ZIVA 4GXZA 5IOXA 3FKFA 3TDGA 4BL7B 4IQ1A 1M2AA 4HJ2A 4JR6A 1Y6EA 2K6VA 2N5AA 2MBTA 4ILFA 2O8VB 3DXBA 3U6VA 4EL1A 1S3RA 1BX9A 1XWGA 3IV4A 2XPDA 1BYEA 3CRUA 2IMEA 1MDJA 2HI7A 1GULA 1GSSA 2QGVA 3GX8A 2REMA 3LSZA 3D21A 1GTIA 1MEKA 5D9TA 4X4JA 1MDKA 3CTFA 2TIRA 4TR1B 4JEDA 1GUHA 4BPYA 1X5CA 3EU3A 1XIYA 4GCIA 2H76A 1VF3A 4TR1A 1ML6A 4LL4B 5JWRB 3IHGA 4LL1B 1SKRB 4XS4B 2DBCA 1A8YA 4A5PA 3HXSA 2GQMA 3KD0A 3UBLA 5DCHA 3L0HA 4XS4A 1O85A 4ZL7A 2YPMA 3KGKA 4AJ6A 10GSA 4WKWA 1SL1B 2GS3A 1F37A 3QPMA 2K9FA 3GURA 5ECIB 4HZ2A 2DJKA 1T1VA 5IMDA 3WGDA 2FWEA 1F3BA 1DE1A 3VI5A 3IC4A 5GAND 2MMOA 3DD3A 3C7MA 4ZBDA 4FO5A 1V57A 2QA1A 4EKZA 1Y25A 3HJPA 1GSQA 1F9MA 4WBJA 3EMXA 2VCVA 2GVPA 2VCZA 1G6YA 4OD7A 3HJMA 3NOFA 2VOCA 4MABA 5FT3A 4PUFC 4PTSA 5B6MA 2LNSA 3GL5A 1LU4A 2QKEA 3CMIA 3KZQA 4MNNA 2I81A 4NAXA 1HNCA 3LYPA 3VWVA 5AN1A 4DSSB 1H75A 1V98A 5LD0A 5CAXA 3KM6A 1RQMA 2B7JA 4DSSA 2DJ2A 3DVWA 2H6ZA 4EVMA 1R5PA 3LGCA 2C80A 4G0IA 4G19A 4GSNA 3VPTA 1B8XA 4KW6A 4EIPA 2KUCA 4JU5A 2YV7A 2HLSA 3ZMLA 1QQ2A 3J7Yb 1EOGA 3QDNA 2YOIA 5IO0A 4AGSA 3L9UA 1HNAA 2H1AA 2DJ3A 4POMA 2VD0A 3F6DA 2CA8A 3QAWA 4ZXGA 1V40A 2HZFA 4NHWA 4TR4A 4NMUA 3ZITA 1EGOA 3TGZA 4MK3A 2O89A 3GTUB 2DKHA 4MF5A 5DVBA 1GTBA 3TB2A 1JLWA 5CREA 2CVDA 4HJMA 3E0UA 3GTUA 3O3TA 1RW1A 4TKYA 4HUAA 3D4MA 2I4AA 3FR3A 2H71A 4NXIA 1AIUA 4HS1A 4OWYA 2MZCA 22GSA 2ON7A 1K0NA 1QUWA 4Q5NA 3LW9A 1SK0A 3HY2A 3KEBA 2PWJA 4POBA 2IJYA 4IGJA 4CY6A 5J5NA 1WP0A 2JSYA 2FLSA
chains in the Genus database with same CATH topology
2IMDA 1BG5A 3QR6A 5J9BA 1AAZA 1OC9B 4I2TA 2ZUPA 3GN3A 5C00A 2L59A 1FOHA 2OBKA 1OC9A 4K7OA 1ZGNA 1AQVA 2H19A 1NSWA 5C04A 2LKUA 4N0ZA 1USBA 2YANA 5G1KA 3CRTA 4L8EA 2CT6A 1A2LA 2C1YA 2O85A 1O6JA 3ME8A 2OA7A 2H6YA 3EC3A 2DJJA 4NV5A 5L71A 2YJHA 4EXJA 3QFBC 1BEDA 2B3SA 3IHQA 2GGTA 3EWLA 4JZQA 20GSA 1TK0B 4DSRA 2GQLA 3IR4A 2E2MA 2H1BA 2TRCP 1FHEA 2WB9A 3GRXA 2HRFA 4IQAA 4PX1A 4MCUA 4WEYA 5HR0A 1FOVA 3PGTA 3TJGA 1TKDB 1TP9A 2OJLA 4WF5A 1GNWA 2PUKC 2H0HA 4K0GA 4Q5RA 1R26A 4MJBA 2MMNA 4TR3A 3DIEA 3TKPA 1E2YA 1QXHA 1TU8A 1HYUA 5J41A 4PQ1A 2KHPA 3HVSA 3RHBA 1WOUA 3ZFBA 1XZOA 2H75A 2I9HA 1EV4A 1SJZA 5IMAA 1SKSB 1VRSD 2QSIA 4ML1A 1GTAA 2GSQA 4OFMA 5DQYA 4IJ3A 3E3EA 2N5BA 3E9JB 3G7IA 2GDRA 4PXOA 5J4UA 4LA1A 5DAKB 3NIVA 1K0AA 3N9JA 6GSXA 4CHSA 4JBBA 5DAKA 1O7UA 1I9DA 1AQXA 2KP2A 3M8NA 2CZ3A 4HQZA 1ON4A 3G7JA 2L6DA 3P2AA 4HZ4A 2C0DA 1TW9A 1TXXA 4MDCA 3EMPA 3FZ9A 1Z3EA 5IMFA 3VPQA 2LRNA 11GSA 1Z6MA 1FVKA 1WJKA 2H0GA 4KSOA 3WT1A 4G2EA 3F4SA 4TRXA 2AJQB 1EP8A 1H4OA 2EC4A 4BVXB 5G5EA 1Z5YE 1URMA 2JZRA 1THXA 2RUEA 1O81A 4BVXA 4X43A 5G5FA 4IS0A 2RIIA 5HFGA 4MJAA 4PNFA 4GF0A 2YNXA 8GSSA 5HFIA 4K2XA 3EVIA 4D73B 1ERWA 4KF9A 4XS1A 4ISDA 4FH8A 4D73A 3TRXA 4OMVA 3Q19A 7GSSA 1XOBA 2L5LA 3IOSA 3GX0A 2OE3A 2VM1A 1AQWA 3L4NA 3HVXA 4AJ8A 3IPZA 2GZYA 6GSTA 1N8JA 5DJLA 2A2PA 4KA0A 4ICYA 2OE0A 2A4VA 4L5OA 4J56E 3TJFA 2M80A 1XOAA 1PX6A 2DLXA 1K0CA 3IXRA 3H8QA 2FGXA 4N11A 1SD9A 1W89A 2XHFA 3QD9A 3Q6OA 2VL2C 3ZVJA 3TKSA 5DALB 5EPFA 1ZCPA 2PPTA 3UJ1A 4G9HA 3DRNA 3TOUA 4KE3A 5CO3A 5DALA 2RM6A 4USSA 4HU7A 1ZMAA 2CAQA 2L57A 2PBJA 5KN2A 1RK4A 1M2BA 2GT6A 1U88A 5D9WA 5EY6A 4MZCA 1TRSA 3O6TA 2HXKA 4IKHA 2WJUA 1E6BA 4CW9A 4FQUA 4K1FA 5F06A 4RQXA 3Q18A 5ECHB 3WT2A 2OACA 2HNLA 4MZWA 2JL4A 5GZZB 2B7KA 3EU4A 3FY7A 2L4CA 4BL7A 3ZL5A 1K3LA 4JE1A 1F2EA 1R4WA 2A4HA 2BJXA 5JCGA 5KN0A 5COHA 5D93A 5INYA 3SBCA 4GSSA 3D4TA 4KB3A 5J3RA 4EF0A 1A8LA 4EDYA 3UMAA 1R7HA 2VIMA 1TOFA 5F0GA 2V41A 2YJ7A 3EURA 1JHBA 2N5FA 3EE2A 4K9ZA 4K2DA 1SENA 4HEA2 1OC8A 1S3AA 1KBNA 2VAFA 4YQVA 4POLA 4TXVA 3CTGA 1GWCA 4KSMA 2NPBA 3TJKA 1EV9A 1SD8A 2I3YA 1SU9A 5BMUA 1THOA 1UA5A 3VWUA 1OE8A 1LBKA 3FR9A 3IAS2 4QL9A 2OKAA 2B5XA 2PERA 4EE0A 3TKQA 4RI7A 4J2FA 1B4PA 1DSBA 1X0RA 2KP1A 3IK7A 1O73A 3FZ5A 1EGRA 3HZ4A 3PINA 3IE3A 4WXTA 3S9FA 4V2MA 4TOPA 1QMVA 4OO5A 3WYWA 3FK8A 4AF2A 5CYYA 4ID0A 1YQ1A 5IQYA 3GHAA 1KTEA 3GKNA 5ECSA 2IIYA 4DSQA 3ERWA 4F03A 3A2VA 5CRDA 4O32A 3VK9A 3UVTA 3FW2A 5H5SA 1UN2A 1SKWB 1GLQA 4ECBA 2R5GA 2IMFA 2HRKA 3DVXA 5CRGA 2K18A 1A0RP 2VLUA 3HCZA 3BCIA 1GSUA 5BRTA 4KH7A 2H73A 2DC5A 1QGVA 3P90A 2JU5A 3F63A 4P3YB 2YZHA 4I8BA 1M7TA 1TRUA 3TJBA 2DKIA 3DYRA 4IJIA 1YF0A 1X9WB 4MZBA 4LLRA 3GUSA 2H0IA 1XWKA 3ZVJD 2ZCTA 3L78A 4MPGA 4BWQA 1LJRA 18GSA 3RDWA 1U6TA 2YWMA 3R3EA 2P5QA 1EOHA 3HYPA 2LJAA 2IWTA 1NW2A 4FYUA 3GA4A 4V1Ag 4ECCA 2EIRA 2H6XA 4LMVA 3PR8A 4MP4A 3ZFLA 4J57E 5ECNB 3U5RE 1KNGA 1FB0A 4PQIA 4F0CA 3KTLA 2A2SA 2VCTA 2H1DA 4NHZA 3V1WA 1GRXA 2P31A 1BQ7A 4WF4A 3LG6A 4MMMA 2A2RA 2DMMA 3US3A 1J08A 2E7PA 5KEJA 5CNWA 5GSSA 3ME7A 1TJDA 2IN3A 4KUNA 2WZ9A 4MH2A 3SWLA 3O76A 4WR5A 2EIOA 6GSVA 2MMAA 2LSTA 4DEJA 3TKSE 2PVOC 4I2UA 4O5RA 4HU9A 3TKRA 2B5EA 4L0WA 3FZ4A 3D6IA 1PX7A 4XRDA 1GUKA 5KOWA 3CBUA 4QQ7A 1U3IA 1N2AA 3D5JA 3VFIA 2VM2A 2GTUA 1XVQA 2B1LA 3C1SA 4YKGA 2HSMA 2HZEB 1G6WA 2DIYA 3D0ZA 2PN8A 2VL9A 3BJ5A 2HZEA 3ERGA 4ZIJA 3J7Yk 4I97A 2GSTA 5IPHA 3W8SA 2CVBA 4HI7A 2R0GA 1ILOA 3LXZA 3KXOA 5DBQA 2M72A 2IMKA 1Q4JA 4IBPA 2J23A 4KGIA 4OFTA 3RPNA 3TJJA 1B9XC 5ELAA 5B8BA 1XFLA 2LQOA 3C8EA 3FHKA 3APQA 3GSTA 1XW6A 3HDCA 4NPBA 1B4QA 2HRAA 1WWJA 4MJEA 19GSA 1FVJA 2FA4A 4KX4A 4I6XA 4EDZA 1Z7RA 1Z7PA 2L6CA 1OKDA 1PQNA 3KMNA 5FHIA 4XS6A 1T8EB 3HD5A 4G0KA 2WS2A 3RPPA 3L9VA 3IBHA 2V32A 4Q5QA 1C72A 4O5QA 1PN0A 3QOUA 1DBYA 2NDOA 1G0TA 3W8JA 3GSSA 3ZIJA 1TU7A 2MYGA 9GSSA 6GSYA 2HT9A 2C3QA 2FUG2 1JFUA 2WGRA 5ELGA 2GLRA 4RQRA 3GIXA 2WRTA 1YJ6A 1YKCA 5GSTA 5HFKA 3MWHA 1GUMA 2C8UA 1WE0A 5IIZA 2ON5A 3KH7A 5J9CA 2LJRA 2FHEA 4K6XA 2BTOT 4O5UA 4N30A 4N10A 4O92A 2VCXA 3RBTA 3A2XA 2V2GA 4GLTA 3KCMA 2C0FA 1ZYEA 5ECRB 2CZ2A 4OFNA 4TR0A 4ZL9A 5AGYA 3UBKA 4BWSA 1TDIA 2YP6A 2FWGA 3KJYA 5G1LA 1WRYA 1X9MB 1PKZA 1GH2A 1WIKA 3IRAA 3M3MA 5ID2B 3W6GA 2R4VA 5ECKB 2HYXA 4PURA 3HVVA 1GSYA 3K8NA 5CP1A 2PVQA 2V6OA 1DUGA 4TXOB 1YEPA 4O7HA 4YAVA 1VF2A 4GSTA 2WULA 2YWNA 2FNOA 2NTOA 3GKMA 3GH6A 5H5RA 3ZYWA 2XPEA 3HJOA 1R5AA 4XIHA 13GSA 3H4KA 1V2AA 2JACA 4Z7XA 1GSEA 4K7IA 2F9SA 5A5KA 2VD1A 1GTUA 1SYRA 3IA1A 3I43A 4L0UA 2XBQA 1MTCA 3GKKA 3HHVA 2DMLA 1I5GA 5DDLA 2LS5A 2NVLA 3TUEA 3CSIA 4GQFA 4ZB8A 2HRNA 4G0LA 2XBIA 4KDXA 1OKTA 3HA9A 4K7NA 4HQSA 3EINA 3FZAA 1HD2A 5DJMA 3QMXA 2X4AA 2HFDA 4F82A 1T7PB 2V6KA 1YEXA 5D9XA 3WGEA 1ZYPA 4IELA 5GAPD 2HE3A 2LV3A 3TCOA 2C4JA 5AISA 3FYGA 2FA8A 4JRRA 1SL0B 4IP6A 3UAPA 2M46A 2QA2A 2VL3A 4WBRD 2XC2A 4Z2TA 4OCFA 1PL2A 2IPAA 6GSSA 4N0VA 2VLVA 2LRTA 1Z9HA 5JWQB 5ECQB 5JCWA 5G30A 3IDVA 2AUVA 3APSA 3H93A 3DWVA 4E8EA 1PA3A 1VF4A 5IM9A 4IVFA 3VLNA 2ZNMA 1OVNA 1WPIA 3ISOA 3F9UA 3M9JA 2RLIA 4ML6A 2JSZA 2JADA 4YKFA 1VGLA 1ZOFA 4GRFA 2CAIA 1YDKA 3HZ8A 4IP1A 5CRWA 2LNTA 4PUAA 2EIQA 4MPFA 4TN8A 4ULXA 5LNKe 3F6FA 3M1GA 5A4WA 2RUFA 1B48A 4ACSA 2AV4A 2X49A 3KTBA 2R6KA 1MDIA 5EVOA 1ST9A 5KOXA 1PKWA 3VWWA 4MF7A 3MSZA 5H5QA 2VCWA 3H1NA 1K0MA 2E0QA 1T4ZA 1PGTA 2X8CA 3LXTA 3CSJA 3CXGA 1K3OA 1YZXA 5F05A 1MD4A 5B8AA 2F3MA 3CSHA 1EP7A 4TW5A 4RUVA 1S3CA 2C0GA 1FG4A 1QK8A 3ZZXA 2P0GA 1W4VA 16GSA 4YQUA 2JZTA 2CX4A 3BD2A 2LQQA 1HQOA 3KH9A 2GT5A 3MYDA 1TK8B 3VI7A 5ABRA 4G10A 3BOAA 4X1UA 3RAZA 2AHEA 1YY7A 4IN0A 5DQSA 4I5QA 1ACVA 3UARA 1FB6A 2RM5A 3LFLA 3LEFA 1XXUA 3UOMA 3PPUA 4TVEA 2KOKA 2AAWA 5ENUA 3MIXA 4FIWA 1K0DA 4F9ZA 3ZRDA 2J9HA 2HSYA 2H8LA 5E59A 3EPTA 4K8MA 3ZMKA 2BMXA 2MBSA 1NHOA 2YV9A 2FWHA 3UIWA 2YCDA 3HKRA 3FMWA 1OC3A 4X0XA 1EWXA 1V9WA 3Q74A 2C0EA 2HSHA 5D96A 4CY8A 2LUSA 4ZBBA 3TKSC 3DEXA 3LORA 2YWOA 1XWBA 1NM3A 2WDUA 1ERVA 1XW5A 1JZWA 1O8WA 2OADA 5IMZA 1A2MA 3I69A 1XBSA 5F8BA 3FRCA 3KMOA 3DMLA 5ECLB 1PN9A 1J0FA 3GH9A 1M9AA 2VO4A 3RHCA 4DVCA 3A2WA 1FO5A 5IMCA 4YQMA 1OAZA 17GSA 5B6NA 5FWGA 4XTSA 1XVWA 1BJXA 2YWIA 2O87A 2B5YA 1ZYQB 3NZNA 4GWRA 3OR5A 3JCML 3F0IA 1IYIA 1XWAA 5D9VA 3VWXA 1XPVA 3P8WA 4HDEA 3C1RA 4GTUA 4Q5FA 1FW1A 1PD21 2AYTA 4EO3A 4KNDA 1GLPA 2PU9C 1GNEA 3GV1A 2PMTA 1DE2A 2JZSA 1TRWA 1YF1A 5CRHA 4K5RA 5IPGA 1ZYNA 1B9YC 2R3XA 3I6AA 5IMVA 2R37A 5HR1A 1F3AA 1TK5B 3GKXA 4ZL8A 2MMZA 1UVZA 6GSUA 1JZOA 4POKA 3EYTA 3WD6A 2GQKA 3CYNA 1AC1A 2K8SA 4XRAA 1JLVA 1GL8A 4KAEA 5IO2A 1SL2B 4KCEA 2O7KA 2WCIA 3F4TA 2E2GA 1OYJA 4ZBAA 1X5DA 1TRVA 3FR6A 3P7XA 1OE7A 4EIQA 5G31A 3GFKA 1CQGA 2FCHA 1T00A 4CDOA 1ERTA 3GYKA 2PGTA 3R2QA 1J9BA 2B1KA 3QAVA 4Z2UA 2LTKA 1YKAA 5JCUA 3D22A 3IK9A 1KEBA 1T3BA 2CQ9A 2V1MA 3F8UA 4WETA 3C71A 3N5OA 3ZLPA 4K5SA 1TI1A 4MA9A 2CV4A 4MH3A 2DJ1A 5DCGA 3FEUA 5HQPA 2AB6A 4V1Ap 12GSA 1XCCA 4IHUA 1EEMA 4L5LA 1SJIA 3QFAC 4E8HA 2R0CA 3KP8A 5B7CA 2ES7A 2R2JA 2CVKA 4YAPA 5HR2A 3VURA 3ED3A 2OBIA 5ECOB 3KIJA 1M99A 1U3AA 3I9V2 4MJCA 1X5EA 1SYXA 3TOTA 4KCAA 2FY6A 4V2NA 2OE1A 5EL8A 2GZZA 3LJRA 2K8VA 4LMWA 3M9KA 2TRXA 4F2IA 2IFQB 1JZRA 2YZUA 1M2DA 2IFQA 3UL3A 1ABAA 1EZKA 2QC7A 1TTZA 1Z6NA 1F6MC 3QCPA 2VL2A 1TI3A 4V2LA 5D8IA 2FWFA 4ZB9A 4WR4A 3MNGA 3A3TA 4OO4A 3BBYA 1PMTA 2GZPA 3GMFA 2IL3A 2X99A 4Z2RA 2X64A 3H79A 5KN3A 3F4RA 5A4UA 4QL7A 1PRXA 3ZTLA 5AIXA 2GSRA 2L4QA 5A4VA 2G0FA 1BAYA 2ALBA 2H72A 3MAKA 2H74A 4K0NA 2R0PA 5ID2A 1SK1A 1GP1A 1V58A 3IAM2 4BA7A 2DSAA 1M0UA 4KDYA 4KDUA 3G7YA 2IMIA 4FYBA 1Q98A 1G7EA 2G2QA 2DJ0A 1S3DA 1CQHA 5IOWA 4TXOA 4FYCA 5E4WA 2C3TA 3LQ7A 1NHYA 1ZL9A 3A5IA 1X9SB 3KP9A 4XCSA 2LEGA 2VUPA 3ZREA 2H70A 2GSSA 3MDKA 4ECJA 2DIZA 1O8XA 1AW9A 1A2JA 2I1UA 3TRQA 1UC7A 3M0FA 1PSQA 4PGTA 2X8GA 2Z9SA 4AJ7A 1XW9A 4EC0A 4YH2A 1QFNA 3UEMA 4PQHA 1A0FA 3C73A 1GSFA 3GL3A 3PH9A 1K0BA 4OCEA 6GSWA 2X8HA 2B6MA 1U87A 4PNGA 1MD3A 1FAAA 1A23A 3L9SA 5HR3A 3LWAA 1IYHA 1AXDA 3DGQA 3GNJA 2C3NA 5ECPB 2D2ZA 4ZB6A 3ERFA 3A5WA 3F3QA 2P5RA 4ECIA 5ECMB 3WGXA 2LRCA 2FD3A 4NWYA 1XWCA 4HOJA 1AUCA 3QAGA 4JR4A 5D73A 3AY8A 14GSA 5G2ZA 1SJ6A 2H30A 3BCKA 1ERUA 4MF6A 5JWOB 1EEJA 1K3YA 2NBSA 4XHMA 3LYKA 1VF1A 3G9BA 2UZ8A 4RI6A 2H1GA 4GQCA 2CX3A 3F3RA 1PL1A 1M9BA 1WMJA 4MLYA 4ZILA 2H66A 1GSDA 1G7OA 4H86A 4IW9A 5KN1A 1A24A 4EUYA 1SK2A 3UVHA 3APOA 3TRPA 5F07A 2WFCA 5AIVA 2H01A 1K0OA 2VCQA 1ZZYA 4NV2A 1T4YA 3IC8A 1JZDA 2YN1A 4BVYB 2F51A 4F0BA 2F8FA 2KLXA 3DKSA 5LCZA 2VLTA 2F8AA 2LJKA 2L5OA 1HNBA 4BVYA 3ZIVA 4GXZA 5IOXA 3FKFA 3TDGA 4BL7B 4IQ1A 1M2AA 4HJ2A 4JR6A 1Y6EA 2K6VA 2N5AA 2MBTA 4ILFA 2O8VB 3DXBA 3U6VA 4EL1A 1BX9A 1XWGA 3IV4A 2XPDA 1BYEA 3CRUA 2IMEA 1MDJA 2HI7A 1GULA 1GSSA 2QGVA 3GX8A 2REMA 3LSZA 3D21A 1GTIA 1MEKA 5D9TA 4X4JA 1MDKA 3CTFA 2TIRA 4TR1B 4JEDA 1GUHA 4BPYA 1X5CA 3EU3A 1XIYA 4GCIA 2H76A 1VF3A 4TR1A 1ML6A 4LL4B 5JWRB 3IHGA 4LL1B 1SKRB 4XS4B 2DBCA 1A8YA 4A5PA 3HXSA 2GQMA 3KD0A 3UBLA 5DCHA 3L0HA 4XS4A 1O85A 4ZL7A 2YPMA 3KGKA 4AJ6A 10GSA 4WKWA 1SL1B 2GS3A 1F37A 3QPMA 2K9FA 3GURA 5ECIB 4HZ2A 2DJKA 1T1VA 5IMDA 3WGDA 2FWEA 1F3BA 1DE1A 3VI5A 3IC4A 5GAND 2MMOA 3DD3A 3C7MA 4ZBDA 4FO5A 1V57A 2QA1A 4EKZA 1Y25A 3HJPA 1GSQA 1F9MA 4WBJA 3EMXA 2VCVA 2GVPA 2VCZA 1G6YA 4OD7A 3HJMA 3NOFA 2VOCA 4MABA 5FT3A 4PUFC 4PTSA 5B6MA 2LNSA 3GL5A 1LU4A 2QKEA 3CMIA 3KZQA 4MNNA 2I81A 4NAXA 1HNCA 3LYPA 3VWVA 5AN1A 4DSSB 1H75A 1V98A 5LD0A 5CAXA 3KM6A 1RQMA 2B7JA 4DSSA 2DJ2A 3DVWA 2H6ZA 4EVMA 1R5PA 3LGCA 2C80A 4G0IA 4G19A 4GSNA 3VPTA 1B8XA 4KW6A 4EIPA 2KUCA 4JU5A 2YV7A 2HLSA 3ZMLA 1QQ2A 3J7Yb 1EOGA 3QDNA 2YOIA 5IO0A 4AGSA 3L9UA 1HNAA 2H1AA 2DJ3A 4POMA 2VD0A 3F6DA 2CA8A 3QAWA 4ZXGA 1V40A 2HZFA 4NHWA 4TR4A 4NMUA 3ZITA 1EGOA 3TGZA 4MK3A 2O89A 3GTUB 2DKHA 4MF5A 5DVBA 1GTBA 3TB2A 1JLWA 5CREA 2CVDA 4HJMA 3E0UA 3GTUA 3O3TA 1RW1A 4TKYA 4HUAA 3D4MA 2I4AA 3FR3A 2H71A 4NXIA 1AIUA 4HS1A 4OWYA 2MZCA 22GSA 2ON7A 1K0NA 1QUWA 4Q5NA 3LW9A 1SK0A 3HY2A 3KEBA 2PWJA 4POBA 2IJYA 4IGJA 4CY6A 5J5NA 1WP0A 2JSYA 2FLSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IMD A;  1BG5 A;  3QR6 A;  5J9B A;  1AAZ A;  1OC9 B;  4I2T A;  2ZUP A;  3GN3 A;  5C00 A;  2L59 A;  2OBK A;  1OC9 A;  4K7O A;  1ZGN A;  1AQV A;  2H19 A;  1NSW A;  5C04 A;  2LKU A;  4N0Z A;  1USB A;  2YAN A;  5G1K A;  3CRT A;  4L8E A;  2CT6 A;  1A2L A;  2C1Y A;  2O85 A;  1O6J A;  3ME8 A;  2OA7 A;  2H6Y A;  3EC3 A;  2DJJ A;  4NV5 A;  5L71 A;  2YJH A;  4EXJ A;  3QFB C;  1BED A;  2B3S A;  3IHQ A;  2GGT A;  3EWL A;  4JZQ A;  20GS A;  1TK0 B;  4DSR A;  2GQL A;  3IR4 A;  2E2M A;  2H1B A;  2TRC P;  1FHE A;  2WB9 A;  3GRX A;  2HRF A;  4IQA A;  4PX1 A;  4MCU A;  4WEY A;  5HR0 A;  1FOV A;  3PGT A;  3TJG A;  1TKD B;  1TP9 A;  2OJL A;  4WF5 A;  1GNW A;  2PUK C;  2H0H A;  4K0G A;  4Q5R A;  1R26 A;  4MJB A;  2MMN A;  4TR3 A;  3DIE A;  3TKP A;  1E2Y A;  1QXH A;  1TU8 A;  1HYU A;  5J41 A;  4PQ1 A;  2KHP A;  3HVS A;  3RHB A;  1WOU A;  3ZFB A;  1XZO A;  2H75 A;  2I9H A;  1EV4 A;  1SJZ A;  5IMA A;  1SKS B;  1VRS D;  2QSI A;  4ML1 A;  1GTA A;  2GSQ A;  4OFM A;  5DQY A;  4IJ3 A;  3E3E A;  2N5B A;  3E9J B;  3G7I A;  2GDR A;  4PXO A;  5J4U A;  4LA1 A;  5DAK B;  3NIV A;  1K0A A;  3N9J A;  6GSX A;  4CHS A;  4JBB A;  5DAK A;  1O7U A;  1I9D A;  1AQX A;  2KP2 A;  3M8N A;  2CZ3 A;  4HQZ A;  1ON4 A;  3G7J A;  2L6D A;  3P2A A;  4HZ4 A;  2C0D A;  1TW9 A;  1TXX A;  4MDC A;  3EMP A;  3FZ9 A;  1Z3E A;  5IMF A;  3VPQ A;  2LRN A;  11GS A;  1Z6M A;  1FVK A;  1WJK A;  2H0G A;  4KSO A;  3WT1 A;  4G2E A;  3F4S A;  4TRX A;  2AJQ B;  1EP8 A;  1H4O A;  2EC4 A;  5G5E A;  1Z5Y E;  1URM A;  2JZR A;  1THX A;  2RUE A;  1O81 A;  4BVX A;  4X43 A;  5G5F A;  4IS0 A;  2RII A;  5HFG A;  4MJA A;  4PNF A;  4GF0 A;  2YNX A;  8GSS A;  5HFI A;  3EVI A;  4D73 B;  1ERW A;  4XS1 A;  4ISD A;  4FH8 A;  4D73 A;  3TRX A;  4OMV A;  3Q19 A;  7GSS A;  1XOB A;  2L5L A;  3IOS A;  3GX0 A;  2OE3 A;  2VM1 A;  1AQW A;  3L4N A;  3HVX A;  4AJ8 A;  3IPZ A;  2GZY A;  6GST A;  1N8J A;  5DJL A;  4KA0 A;  2OE0 A;  2A4V A;  4L5O A;  4J56 E;  3TJF A;  2M80 A;  1XOA A;  1PX6 A;  2DLX A;  1K0C A;  3IXR A;  3H8Q A;  2FGX A;  4N11 A;  1SD9 A;  1W89 A;  2XHF A;  3QD9 A;  3Q6O A;  2VL2 C;  3ZVJ A;  3TKS A;  5DAL B;  5EPF A;  1ZCP A;  2PPT A;  3UJ1 A;  4G9H A;  3DRN A;  3TOU A;  4KE3 A;  5CO3 A;  5DAL A;  2RM6 A;  4HU7 A;  1ZMA A;  2CAQ A;  2L57 A;  2PBJ A;  5KN2 A;  1RK4 A;  1M2B A;  2GT6 A;  1U88 A;  5D9W A;  5EY6 A;  4MZC A;  1TRS A;  3O6T A;  2HXK A;  4IKH A;  2WJU A;  1E6B A;  4CW9 A;  4K1F A;  5F06 A;  4RQX A;  3Q18 A;  5ECH B;  3WT2 A;  2OAC A;  2HNL A;  4MZW A;  2JL4 A;  5GZZ B;  2B7K A;  3EU4 A;  3FY7 A;  2L4C A;  4BL7 A;  3ZL5 A;  1K3L A;  4JE1 A;  1F2E A;  1R4W A;  2BJX A;  5JCG A;  5KN0 A;  5COH A;  5D93 A;  5INY A;  3SBC A;  4GSS A;  3D4T A;  4KB3 A;  5J3R A;  4EF0 A;  1A8L A;  4EDY A;  3UMA A;  1R7H A;  2VIM A;  1TOF A;  5F0G A;  2V41 A;  2YJ7 A;  3EUR A;  1JHB A;  2N5F A;  3EE2 A;  4K9Z A;  4K2D A;  1SEN A;  4HEA 2;  1OC8 A;  1S3A A;  1KBN A;  2VAF A;  4YQV A;  4POL A;  4TXV A;  3CTG A;  1GWC A;  4KSM A;  2NPB A;  3TJK A;  1EV9 A;  1SD8 A;  2I3Y A;  1SU9 A;  1THO A;  1UA5 A;  3VWU A;  1OE8 A;  1LBK A;  3FR9 A;  3IAS 2;  4QL9 A;  2OKA A;  2B5X A;  2PER A;  4EE0 A;  3TKQ A;  4RI7 A;  4J2F A;  1B4P A;  1DSB A;  1X0R A;  2KP1 A;  3IK7 A;  1O73 A;  3FZ5 A;  1EGR A;  3HZ4 A;  3PIN A;  3IE3 A;  4WXT A;  3S9F A;  4V2M A;  4TOP A;  1QMV A;  4OO5 A;  3WYW A;  3FK8 A;  4AF2 A;  5CYY A;  4ID0 A;  1YQ1 A;  5IQY A;  3GHA A;  1KTE A;  3GKN A;  5ECS A;  2IIY A;  4DSQ A;  3ERW A;  4F03 A;  3A2V A;  5CRD A;  4O32 A;  3VK9 A;  3UVT A;  3FW2 A;  5H5S A;  1UN2 A;  1SKW B;  1GLQ A;  4ECB A;  2R5G A;  2IMF A;  3DVX A;  5CRG A;  2K18 A;  1A0R P;  2VLU A;  3HCZ A;  3BCI A;  1GSU A;  4KH7 A;  2H73 A;  2DC5 A;  1QGV A;  3P90 A;  2JU5 A;  3F63 A;  4P3Y B;  2YZH A;  4I8B A;  1M7T A;  1TRU A;  3TJB A;  3DYR A;  4IJI A;  1YF0 A;  1X9W B;  4MZB A;  4LLR A;  3GUS A;  2H0I A;  1XWK A;  3ZVJ D;  2ZCT A;  3L78 A;  4MPG A;  4BWQ A;  1LJR A;  18GS A;  3RDW A;  1U6T A;  2YWM A;  2P5Q A;  1EOH A;  3HYP A;  2LJA A;  2IWT A;  1NW2 A;  4FYU A;  3GA4 A;  4V1A g;  4ECC A;  2EIR A;  2H6X A;  4LMV A;  3PR8 A;  4MP4 A;  3ZFL A;  4J57 E;  5ECN B;  3U5R E;  1KNG A;  1FB0 A;  4PQI A;  4F0C A;  3KTL A;  2A2S A;  2VCT A;  2H1D A;  4NHZ A;  3V1W A;  1GRX A;  2P31 A;  1BQ7 A;  4WF4 A;  3LG6 A;  4MMM A;  2A2R A;  2DMM A;  3US3 A;  1J08 A;  2E7P A;  5KEJ A;  5CNW A;  5GSS A;  3ME7 A;  1TJD A;  2IN3 A;  4KUN A;  2WZ9 A;  4MH2 A;  3SWL A;  3O76 A;  4WR5 A;  2EIO A;  6GSV A;  2MMA A;  2LST A;  4DEJ A;  3TKS E;  2PVO C;  4I2U A;  4O5R A;  4HU9 A;  3TKR A;  2B5E A;  4L0W A;  3FZ4 A;  3D6I A;  1PX7 A;  4XRD A;  1GUK A;  3CBU A;  4QQ7 A;  1U3I A;  1N2A A;  3D5J A;  3VFI A;  2VM2 A;  2GTU A;  1XVQ A;  2B1L A;  3C1S A;  2HZE B;  1G6W A;  2DIY A;  3D0Z A;  2PN8 A;  2VL9 A;  3BJ5 A;  2HZE A;  3ERG A;  4ZIJ A;  3J7Y k;  4I97 A;  2GST A;  5IPH A;  3W8S A;  2CVB A;  4HI7 A;  1ILO A;  3LXZ A;  3KXO A;  5DBQ A;  2M72 A;  2IMK A;  1Q4J A;  4IBP A;  2J23 A;  4KGI A;  4OFT A;  3RPN A;  3TJJ A;  1B9X C;  5ELA A;  5B8B A;  1XFL A;  2LQO A;  3C8E A;  3FHK A;  3APQ A;  3GST A;  1XW6 A;  3HDC A;  4NPB A;  1B4Q A;  1WWJ A;  4MJE A;  19GS A;  1FVJ A;  2FA4 A;  4KX4 A;  4I6X A;  4EDZ A;  1Z7R A;  1Z7P A;  2L6C A;  1OKD A;  1PQN A;  3KMN A;  5FHI A;  4XS6 A;  1T8E B;  3HD5 A;  2WS2 A;  3RPP A;  3L9V A;  3IBH A;  2V32 A;  4Q5Q A;  1C72 A;  3QOU A;  1DBY A;  2NDO A;  1G0T A;  3W8J A;  3GSS A;  3ZIJ A;  1TU7 A;  2MYG A;  9GSS A;  6GSY A;  2HT9 A;  2C3Q A;  2FUG 2;  1JFU A;  2WGR A;  5ELG A;  2GLR A;  4RQR A;  3GIX A;  2WRT A;  1YJ6 A;  1YKC A;  5GST A;  5HFK A;  3MWH A;  1GUM A;  2C8U A;  1WE0 A;  5IIZ A;  2ON5 A;  3KH7 A;  5J9C A;  2LJR A;  2FHE A;  4K6X A;  2BTO T;  4N30 A;  4N10 A;  4O92 A;  2VCX A;  3RBT A;  3A2X A;  2V2G A;  4GLT A;  3KCM A;  2C0F A;  1ZYE A;  5ECR B;  2CZ2 A;  4OFN A;  4TR0 A;  4ZL9 A;  5AGY A;  3UBK A;  4BWS A;  1TDI A;  2YP6 A;  2FWG A;  3KJY A;  5G1L A;  1WRY A;  1X9M B;  1PKZ A;  1GH2 A;  1WIK A;  3IRA A;  3M3M A;  5ID2 B;  3W6G A;  2R4V A;  5ECK B;  2HYX A;  4PUR A;  3HVV A;  1GSY A;  3K8N A;  5CP1 A;  2PVQ A;  2V6O A;  1DUG A;  4TXO B;  1YEP A;  4O7H A;  4YAV A;  1VF2 A;  4GST A;  2WUL A;  2YWN A;  2FNO A;  2NTO A;  3GKM A;  3GH6 A;  5H5R A;  3ZYW A;  2XPE A;  3HJO A;  1R5A A;  4XIH A;  13GS A;  3H4K A;  1V2A A;  2JAC A;  4Z7X A;  1GSE A;  4K7I A;  2F9S A;  5A5K A;  2VD1 A;  1GTU A;  1SYR A;  3IA1 A;  3I43 A;  4L0U A;  2XBQ A;  1MTC A;  3GKK A;  3HHV A;  2DML A;  1I5G A;  5DDL A;  2LS5 A;  2NVL A;  3TUE A;  3CSI A;  4GQF A;  4ZB8 A;  2HRN A;  2XBI A;  4KDX A;  1OKT A;  3HA9 A;  4K7N A;  4HQS A;  3EIN A;  3FZA A;  1HD2 A;  5DJM A;  3QMX A;  2HFD A;  4F82 A;  1T7P B;  2V6K A;  1YEX A;  5D9X A;  3WGE A;  4IEL A;  5GAP D;  2HE3 A;  2LV3 A;  3TCO A;  2C4J A;  5AIS A;  3FYG A;  2FA8 A;  4JRR A;  1SL0 B;  4IP6 A;  3UAP A;  2M46 A;  2VL3 A;  4WBR D;  2XC2 A;  4OCF A;  1PL2 A;  2IPA A;  6GSS A;  4N0V A;  2VLV A;  2LRT A;  1Z9H A;  5JWQ B;  5ECQ B;  5JCW A;  5G30 A;  3IDV A;  2AUV A;  3APS A;  3H93 A;  3DWV A;  4E8E A;  1PA3 A;  1VF4 A;  5IM9 A;  4IVF A;  3VLN A;  2ZNM A;  1OVN A;  1WPI A;  3ISO A;  3F9U A;  3M9J A;  2RLI A;  4ML6 A;  2JSZ A;  2JAD A;  1VGL A;  1ZOF A;  4GRF A;  2CAI A;  1YDK A;  3HZ8 A;  4IP1 A;  5CRW A;  2LNT A;  4PUA A;  2EIQ A;  4MPF A;  4TN8 A;  4ULX A;  5LNK e;  3F6F A;  3M1G A;  5A4W A;  2RUF A;  1B48 A;  4ACS A;  2AV4 A;  3KTB A;  2R6K A;  1MDI A;  5EVO A;  1ST9 A;  1PKW A;  3VWW A;  4MF7 A;  3MSZ A;  5H5Q A;  2VCW A;  3H1N A;  1K0M A;  2E0Q A;  1T4Z A;  1PGT A;  2X8C A;  3LXT A;  3CSJ A;  3CXG A;  1K3O A;  1YZX A;  5F05 A;  1MD4 A;  5B8A A;  2F3M A;  3CSH A;  1EP7 A;  4TW5 A;  4RUV A;  1S3C A;  2C0G A;  1FG4 A;  1QK8 A;  3ZZX A;  2P0G A;  1W4V A;  16GS A;  4YQU A;  2JZT A;  2CX4 A;  3BD2 A;  2LQQ A;  1HQO A;  3KH9 A;  2GT5 A;  1TK8 B;  3VI7 A;  5ABR A;  4G10 A;  3BOA A;  4X1U A;  3RAZ A;  2AHE A;  1YY7 A;  4IN0 A;  5DQS A;  4I5Q A;  1ACV A;  3UAR A;  1FB6 A;  2RM5 A;  3LFL A;  3LEF A;  1XXU A;  3UOM A;  4TVE A;  2KOK A;  2AAW A;  5ENU A;  4FIW A;  1K0D A;  4F9Z A;  3ZRD A;  2J9H A;  2HSY A;  2H8L A;  5E59 A;  4K8M A;  3ZMK A;  2BMX A;  2MBS A;  1NHO A;  2YV9 A;  2FWH A;  3UIW A;  2YCD A;  3HKR A;  1OC3 A;  4X0X A;  1EWX A;  1V9W A;  3Q74 A;  2C0E A;  2HSH A;  5D96 A;  2LUS A;  4ZBB A;  3TKS C;  3DEX A;  3LOR A;  2YWO A;  1XWB A;  1NM3 A;  2WDU A;  1ERV A;  1XW5 A;  1JZW A;  1O8W A;  2OAD A;  5IMZ A;  1A2M A;  3I69 A;  1XBS A;  5F8B A;  3FRC A;  3KMO A;  3DML A;  5ECL B;  1PN9 A;  1J0F A;  3GH9 A;  1M9A A;  2VO4 A;  3RHC A;  4DVC A;  3A2W A;  1FO5 A;  5IMC A;  4YQM A;  1OAZ A;  17GS A;  5B6N A;  5FWG A;  4XTS A;  1XVW A;  1BJX A;  2YWI A;  2O87 A;  2B5Y A;  1ZYQ B;  3NZN A;  4GWR A;  3OR5 A;  3JCM L;  3F0I A;  1IYI A;  1XWA A;  5D9V A;  3VWX A;  1XPV A;  3P8W A;  4HDE A;  3C1R A;  4GTU A;  4Q5F A;  1FW1 A;  1PD2 1;  2AYT A;  4EO3 A;  4KND A;  1GLP A;  2PU9 C;  1GNE A;  3GV1 A;  2PMT A;  1DE2 A;  2JZS A;  1TRW A;  1YF1 A;  5CRH A;  5IPG A;  1B9Y C;  2R3X A;  3I6A A;  5IMV A;  2R37 A;  5HR1 A;  1F3A A;  1TK5 B;  3GKX A;  4ZL8 A;  2MMZ A;  1UVZ A;  6GSU A;  1JZO A;  4POK A;  3EYT A;  3WD6 A;  2GQK A;  3CYN A;  1AC1 A;  2K8S A;  4XRA A;  1JLV A;  1GL8 A;  4KAE A;  5IO2 A;  1SL2 B;  4KCE A;  2O7K A;  2WCI A;  3F4T A;  2E2G A;  1OYJ A;  4ZBA A;  1X5D A;  1TRV A;  3FR6 A;  3P7X A;  1OE7 A;  1CQG A;  5G31 A;  3GFK A;  2FCH A;  1T00 A;  4CDO A;  1ERT A;  3GYK A;  2PGT A;  3R2Q A;  1J9B A;  2B1K A;  3QAV A;  2LTK A;  1YKA A;  5JCU A;  3D22 A;  3IK9 A;  1KEB A;  1T3B A;  2CQ9 A;  2V1M A;  3F8U A;  4WET A;  3C71 A;  3N5O A;  3ZLP A;  1TI1 A;  4MA9 A;  2CV4 A;  4MH3 A;  2DJ1 A;  5DCG A;  3FEU A;  5HQP A;  2AB6 A;  4V1A p;  12GS A;  1XCC A;  4IHU A;  1EEM A;  4L5L A;  1SJI A;  3QFA C;  4E8H A;  3KP8 A;  5B7C A;  2ES7 A;  2R2J A;  2CVK A;  4YAP A;  5HR2 A;  3VUR A;  3ED3 A;  2OBI A;  5ECO B;  3KIJ A;  1M99 A;  1U3A A;  3I9V 2;  4MJC A;  1X5E A;  1SYX A;  3TOT A;  4KCA A;  2FY6 A;  4V2N A;  2OE1 A;  5EL8 A;  2GZZ A;  3LJR A;  2K8V A;  4LMW A;  3M9K A;  2TRX A;  4F2I A;  2IFQ B;  1JZR A;  2YZU A;  1M2D A;  2IFQ A;  3UL3 A;  1ABA A;  1EZK A;  2QC7 A;  1TTZ A;  1Z6N A;  1F6M C;  3QCP A;  2VL2 A;  1TI3 A;  4V2L A;  5D8I A;  2FWF A;  4ZB9 A;  4WR4 A;  3MNG A;  3A3T A;  4OO4 A;  3BBY A;  1PMT A;  2GZP A;  3GMF A;  2IL3 A;  2X99 A;  2X64 A;  3H79 A;  5KN3 A;  3F4R A;  5A4U A;  4QL7 A;  1PRX A;  3ZTL A;  5AIX A;  2GSR A;  2L4Q A;  5A4V A;  2G0F A;  1BAY A;  2ALB A;  2H72 A;  3MAK A;  2H74 A;  4K0N A;  5ID2 A;  1SK1 A;  1GP1 A;  1V58 A;  3IAM 2;  4BA7 A;  2DSA A;  1M0U A;  4KDY A;  4KDU A;  3G7Y A;  2IMI A;  4FYB A;  1Q98 A;  1G7E A;  2G2Q A;  2DJ0 A;  1S3D A;  1CQH A;  5IOW A;  4TXO A;  4FYC A;  5E4W A;  2C3T A;  3LQ7 A;  1NHY A;  1ZL9 A;  1X9S B;  3KP9 A;  4XCS A;  2LEG A;  2VUP A;  3ZRE A;  2H70 A;  2GSS A;  3MDK A;  4ECJ A;  2DIZ A;  1O8X A;  1AW9 A;  1A2J A;  2I1U A;  3TRQ A;  1UC7 A;  3M0F A;  1PSQ A;  4PGT A;  2X8G A;  2Z9S A;  4AJ7 A;  1XW9 A;  4EC0 A;  4YH2 A;  1QFN A;  3UEM A;  4PQH A;  1A0F A;  3C73 A;  1GSF A;  3GL3 A;  3PH9 A;  1K0B A;  4OCE A;  6GSW A;  2X8H A;  2B6M A;  1U87 A;  4PNG A;  1MD3 A;  1FAA A;  1A23 A;  3L9S A;  5HR3 A;  3LWA A;  1IYH A;  1AXD A;  3DGQ A;  3GNJ A;  2C3N A;  5ECP B;  2D2Z A;  4ZB6 A;  3ERF A;  3A5W A;  3F3Q A;  2P5R A;  4ECI A;  5ECM B;  3WGX A;  2LRC A;  2FD3 A;  4NWY A;  1XWC A;  4HOJ A;  1AUC A;  3QAG A;  4JR4 A;  5D73 A;  3AY8 A;  14GS A;  5G2Z A;  1SJ6 A;  2H30 A;  3BCK A;  1ERU A;  4MF6 A;  5JWO B;  1EEJ A;  1K3Y A;  2NBS A;  4XHM A;  3LYK A;  1VF1 A;  3G9B A;  4RI6 A;  2H1G A;  4GQC A;  2CX3 A;  3F3R A;  1PL1 A;  1M9B A;  1WMJ A;  4MLY A;  4ZIL A;  2H66 A;  1GSD A;  1G7O A;  4H86 A;  4IW9 A;  5KN1 A;  1A24 A;  4EUY A;  1SK2 A;  3UVH A;  3APO A;  3TRP A;  5F07 A;  2WFC A;  5AIV A;  2H01 A;  1K0O A;  2VCQ A;  1ZZY A;  4NV2 A;  1T4Y A;  1JZD A;  2YN1 A;  2F51 A;  4F0B A;  2F8F A;  2KLX A;  3DKS A;  5LCZ A;  2VLT A;  2F8A A;  2LJK A;  2L5O A;  1HNB A;  4BVY A;  3ZIV A;  4GXZ A;  5IOX A;  3FKF A;  3TDG A;  4IQ1 A;  1M2A A;  4HJ2 A;  4JR6 A;  1Y6E A;  2K6V A;  2N5A A;  2MBT A;  4ILF A;  2O8V B;  3DXB A;  3U6V A;  4EL1 A;  1BX9 A;  1XWG A;  3IV4 A;  2XPD A;  1BYE A;  3CRU A;  2IME A;  1MDJ A;  2HI7 A;  1GUL A;  1GSS A;  2QGV A;  3GX8 A;  2REM A;  3LSZ A;  3D21 A;  1GTI A;  1MEK A;  5D9T A;  1MDK A;  3CTF A;  2TIR A;  4TR1 B;  4JED A;  1GUH A;  4BPY A;  1X5C A;  3EU3 A;  1XIY A;  4GCI A;  2H76 A;  1VF3 A;  4TR1 A;  1ML6 A;  4LL4 B;  5JWR B;  4LL1 B;  1SKR B;  4XS4 B;  2DBC A;  1A8Y A;  3HXS A;  2GQM A;  3KD0 A;  3UBL A;  5DCH A;  3L0H A;  4XS4 A;  1O85 A;  4ZL7 A;  2YPM A;  3KGK A;  4AJ6 A;  10GS A;  4WKW A;  1SL1 B;  2GS3 A;  1F37 A;  3QPM A;  2K9F A;  3GUR A;  5ECI B;  4HZ2 A;  2DJK A;  1T1V A;  5IMD A;  3WGD A;  2FWE A;  1F3B A;  1DE1 A;  3VI5 A;  3IC4 A;  5GAN D;  2MMO A;  3DD3 A;  3C7M A;  4ZBD A;  4FO5 A;  1V57 A;  4EKZ A;  1Y25 A;  3HJP A;  1GSQ A;  1F9M A;  4WBJ A;  3EMX A;  2VCV A;  2GVP A;  2VCZ A;  1G6Y A;  4OD7 A;  3HJM A;  3NOF A;  2VOC A;  4MAB A;  5FT3 A;  4PUF C;  5B6M A;  2LNS A;  3GL5 A;  1LU4 A;  2QKE A;  3CMI A;  3KZQ A;  2I81 A;  4NAX A;  1HNC A;  3LYP A;  3VWV A;  5AN1 A;  4DSS B;  1H75 A;  1V98 A;  5LD0 A;  5CAX A;  3KM6 A;  1RQM A;  2B7J A;  4DSS A;  2DJ2 A;  3DVW A;  2H6Z A;  4EVM A;  1R5P A;  3LGC A;  2C80 A;  4G19 A;  4GSN A;  3VPT A;  1B8X A;  4KW6 A;  2KUC A;  4JU5 A;  2YV7 A;  2HLS A;  3ZML A;  1QQ2 A;  3J7Y b;  1EOG A;  3QDN A;  2YOI A;  5IO0 A;  4AGS A;  3L9U A;  1HNA A;  2H1A A;  2DJ3 A;  4POM A;  2VD0 A;  3F6D A;  2CA8 A;  3QAW A;  4ZXG A;  1V40 A;  2HZF A;  4NHW A;  4TR4 A;  4NMU A;  3ZIT A;  1EGO A;  3TGZ A;  4MK3 A;  2O89 A;  3GTU B;  4MF5 A;  5DVB A;  1GTB A;  3TB2 A;  1JLW A;  5CRE A;  2CVD A;  4HJM A;  3E0U A;  3GTU A;  3O3T A;  1RW1 A;  4TKY A;  4HUA A;  3D4M A;  2I4A A;  3FR3 A;  2H71 A;  4NXI A;  1AIU A;  4HS1 A;  4OWY A;  2MZC A;  22GS A;  2ON7 A;  1K0N A;  1QUW A;  4Q5N A;  1SK0 A;  3HY2 A;  3KEB A;  2PWJ A;  4POB A;  2IJY A;  4IGJ A;  5J5N A;  1WP0 A;  2JSY A;  2FLS A; 
#chains in the Genus database with same CATH topology
 2IMD A;  1BG5 A;  3QR6 A;  5J9B A;  1AAZ A;  1OC9 B;  4I2T A;  2ZUP A;  3GN3 A;  5C00 A;  2L59 A;  1FOH A;  2OBK A;  1OC9 A;  4K7O A;  1ZGN A;  1AQV A;  2H19 A;  1NSW A;  5C04 A;  2LKU A;  4N0Z A;  1USB A;  2YAN A;  5G1K A;  3CRT A;  4L8E A;  2CT6 A;  1A2L A;  2C1Y A;  2O85 A;  1O6J A;  3ME8 A;  2OA7 A;  2H6Y A;  3EC3 A;  2DJJ A;  4NV5 A;  5L71 A;  2YJH A;  4EXJ A;  3QFB C;  1BED A;  2B3S A;  3IHQ A;  2GGT A;  3EWL A;  4JZQ A;  20GS A;  1TK0 B;  4DSR A;  2GQL A;  3IR4 A;  2E2M A;  2H1B A;  2TRC P;  1FHE A;  2WB9 A;  3GRX A;  2HRF A;  4IQA A;  4PX1 A;  4MCU A;  4WEY A;  5HR0 A;  1FOV A;  3PGT A;  3TJG A;  1TKD B;  1TP9 A;  2OJL A;  4WF5 A;  1GNW A;  2PUK C;  2H0H A;  4K0G A;  4Q5R A;  1R26 A;  4MJB A;  2MMN A;  4TR3 A;  3DIE A;  3TKP A;  1E2Y A;  1QXH A;  1TU8 A;  1HYU A;  5J41 A;  4PQ1 A;  2KHP A;  3HVS A;  3RHB A;  1WOU A;  3ZFB A;  1XZO A;  2H75 A;  2I9H A;  1EV4 A;  1SJZ A;  5IMA A;  1SKS B;  1VRS D;  2QSI A;  4ML1 A;  1GTA A;  2GSQ A;  4OFM A;  5DQY A;  4IJ3 A;  3E3E A;  2N5B A;  3E9J B;  3G7I A;  2GDR A;  4PXO A;  5J4U A;  4LA1 A;  5DAK B;  3NIV A;  1K0A A;  3N9J A;  6GSX A;  4CHS A;  4JBB A;  5DAK A;  1O7U A;  1I9D A;  1AQX A;  2KP2 A;  3M8N A;  2CZ3 A;  4HQZ A;  3HVN A;  1ON4 A;  3G7J A;  2L6D A;  3P2A A;  4HZ4 A;  2C0D A;  1TW9 A;  1TXX A;  4MDC A;  3EMP A;  3FZ9 A;  1Z3E A;  5IMF A;  3VPQ A;  2LRN A;  11GS A;  1Z6M A;  1FVK A;  1WJK A;  2H0G A;  4KSO A;  3WT1 A;  4G2E A;  3F4S A;  4TRX A;  2AJQ B;  1EP8 A;  1H4O A;  2EC4 A;  4BVX B;  5G5E A;  1Z5Y E;  1URM A;  2JZR A;  1THX A;  2RUE A;  1O81 A;  4BVX A;  4X43 A;  5G5F A;  4IS0 A;  2RII A;  5HFG A;  4MJA A;  4PNF A;  4GF0 A;  2YNX A;  8GSS A;  5HFI A;  4K2X A;  3EVI A;  4D73 B;  1ERW A;  4KF9 A;  4XS1 A;  4ISD A;  4FH8 A;  4D73 A;  3TRX A;  4OMV A;  3Q19 A;  7GSS A;  1XOB A;  2L5L A;  3IOS A;  3GX0 A;  2OE3 A;  2VM1 A;  1AQW A;  3L4N A;  3HVX A;  4AJ8 A;  3IPZ A;  2GZY A;  6GST A;  1N8J A;  5DJL A;  2A2P A;  4KA0 A;  4ICY A;  2OE0 A;  2A4V A;  4L5O A;  4J56 E;  3TJF A;  2M80 A;  1XOA A;  1PX6 A;  2DLX A;  1K0C A;  3IXR A;  3H8Q A;  2FGX A;  4N11 A;  1SD9 A;  1W89 A;  2XHF A;  3QD9 A;  3Q6O A;  2VL2 C;  3ZVJ A;  3TKS A;  5DAL B;  5EPF A;  1ZCP A;  2PPT A;  3UJ1 A;  4G9H A;  3DRN A;  3TOU A;  4KE3 A;  5CO3 A;  5DAL A;  2RM6 A;  4USS A;  4HU7 A;  1ZMA A;  2CAQ A;  2L57 A;  2PBJ A;  5KN2 A;  1RK4 A;  1M2B A;  2GT6 A;  1U88 A;  5D9W A;  5EY6 A;  4MZC A;  1TRS A;  3O6T A;  2HXK A;  4IKH A;  2WJU A;  1E6B A;  4CW9 A;  4FQU A;  4K1F A;  5F06 A;  4RQX A;  3Q18 A;  5ECH B;  3WT2 A;  2OAC A;  2HNL A;  4MZW A;  2JL4 A;  5GZZ B;  2B7K A;  3EU4 A;  3FY7 A;  2L4C A;  1M3J A;  4BL7 A;  3ZL5 A;  1K3L A;  4JE1 A;  1F2E A;  1R4W A;  2A4H A;  2BJX A;  5JCG A;  5KN0 A;  5COH A;  5D93 A;  5INY A;  3SBC A;  4GSS A;  3D4T A;  4KB3 A;  5J3R A;  4EF0 A;  1A8L A;  4EDY A;  3UMA A;  1R7H A;  2VIM A;  1TOF A;  5F0G A;  2V41 A;  2YJ7 A;  3EUR A;  1JHB A;  2N5F A;  3EE2 A;  4K9Z A;  4K2D A;  1SEN A;  4HEA 2;  1OC8 A;  1S3A A;  1KBN A;  2VAF A;  4YQV A;  4POL A;  4TXV A;  3CTG A;  1GWC A;  4KSM A;  2NPB A;  3TJK A;  1EV9 A;  1SD8 A;  2I3Y A;  1SU9 A;  5BMU A;  1THO A;  1UA5 A;  3VWU A;  1OE8 A;  1LBK A;  3FR9 A;  3IAS 2;  4QL9 A;  2OKA A;  2B5X A;  2PER A;  4EE0 A;  3TKQ A;  4RI7 A;  4J2F A;  1B4P A;  1DSB A;  1X0R A;  2KP1 A;  3IK7 A;  1O73 A;  3FZ5 A;  1EGR A;  4BIK A;  3HZ4 A;  3PIN A;  3IE3 A;  4WXT A;  3S9F A;  4HSC X;  4V2M A;  4TOP A;  1QMV A;  4OO5 A;  3WYW A;  3FK8 A;  4AF2 A;  5CYY A;  4ID0 A;  1YQ1 A;  5IQY A;  3GHA A;  1KTE A;  3GKN A;  5ECS A;  2IIY A;  4DSQ A;  3ERW A;  4F03 A;  3A2V A;  5CRD A;  4O32 A;  3VK9 A;  3UVT A;  3FW2 A;  5H5S A;  1UN2 A;  1SKW B;  1GLQ A;  4ECB A;  2R5G A;  2IMF A;  2HRK A;  3DVX A;  5CRG A;  2K18 A;  1A0R P;  2VLU A;  3HCZ A;  3BCI A;  1GSU A;  5BRT A;  4KH7 A;  2H73 A;  2DC5 A;  1QGV A;  3P90 A;  2JU5 A;  3F63 A;  4P3Y B;  2YZH A;  4I8B A;  1M7T A;  1TRU A;  3TJB A;  2DKI A;  3DYR A;  4IJI A;  1YF0 A;  1X9W B;  4MZB A;  4LLR A;  3GUS A;  2H0I A;  1XWK A;  3ZVJ D;  2ZCT A;  3L78 A;  4MPG A;  4BWQ A;  1LJR A;  18GS A;  3RDW A;  1U6T A;  2YWM A;  3R3E A;  2P5Q A;  1EOH A;  3HYP A;  2LJA A;  2IWT A;  1NW2 A;  4FYU A;  3GA4 A;  4V1A g;  4ECC A;  2EIR A;  2H6X A;  4LMV A;  3PR8 A;  4MP4 A;  3ZFL A;  4J57 E;  5ECN B;  3U5R E;  1KNG A;  1FB0 A;  4PQI A;  4F0C A;  3KTL A;  2A2S A;  2VCT A;  2H1D A;  4NHZ A;  3V1W A;  1GRX A;  2P31 A;  1BQ7 A;  4WF4 A;  3LG6 A;  4MMM A;  2A2R A;  2DMM A;  3US3 A;  1J08 A;  2E7P A;  5KEJ A;  5CNW A;  5GSS A;  3ME7 A;  1TJD A;  2IN3 A;  4KUN A;  2WZ9 A;  4MH2 A;  3SWL A;  3O76 A;  4WR5 A;  2EIO A;  6GSV A;  2MMA A;  2LST A;  4DEJ A;  3TKS E;  2PVO C;  4I2U A;  4O5R A;  4HU9 A;  3TKR A;  2B5E A;  4L0W A;  3FZ4 A;  3D6I A;  1PX7 A;  4XRD A;  1GUK A;  5KOW A;  3CBU A;  4QQ7 A;  1U3I A;  1N2A A;  3D5J A;  3VFI A;  2VM2 A;  2GTU A;  1XVQ A;  2B1L A;  3C1S A;  4YKG A;  2HSM A;  2HZE B;  1G6W A;  2DIY A;  3D0Z A;  2PN8 A;  2VL9 A;  3BJ5 A;  2HZE A;  3ERG A;  4ZIJ A;  3J7Y k;  4I97 A;  2GST A;  5IPH A;  3W8S A;  2CVB A;  4HI7 A;  2R0G A;  1ILO A;  3LXZ A;  3KXO A;  5DBQ A;  2M72 A;  2IMK A;  1Q4J A;  4IBP A;  2J23 A;  4KGI A;  4OFT A;  3RPN A;  3CQF A;  3TJJ A;  1B9X C;  5ELA A;  5B8B A;  1XFL A;  2LQO A;  3C8E A;  3FHK A;  3APQ A;  3GST A;  1XW6 A;  3HDC A;  4NPB A;  1B4Q A;  2HRA A;  1WWJ A;  4MJE A;  1M3I A;  19GS A;  1FVJ A;  2FA4 A;  4KX4 A;  4I6X A;  4EDZ A;  1Z7R A;  1Z7P A;  2L6C A;  1OKD A;  1PQN A;  3KMN A;  5FHI A;  4XS6 A;  1T8E B;  3HD5 A;  4G0K A;  2WS2 A;  3RPP A;  3L9V A;  3IBH A;  2V32 A;  4Q5Q A;  1C72 A;  4O5Q A;  1PN0 A;  3QOU A;  1DBY A;  2NDO A;  1G0T A;  3W8J A;  3GSS A;  3ZIJ A;  1TU7 A;  2MYG A;  9GSS A;  1XG8 A;  6GSY A;  2HT9 A;  2C3Q A;  2FUG 2;  1JFU A;  2WGR A;  5ELG A;  2GLR A;  4RQR A;  3GIX A;  2WRT A;  1YJ6 A;  1YKC A;  5GST A;  5HFK A;  3MWH A;  1GUM A;  2C8U A;  1WE0 A;  5IIZ A;  2ON5 A;  3KH7 A;  5J9C A;  2LJR A;  2FHE A;  4K6X A;  2BTO T;  4O5U A;  4N30 A;  4N10 A;  4O92 A;  2VCX A;  3RBT A;  3A2X A;  2V2G A;  4GLT A;  3KCM A;  2C0F A;  1ZYE A;  5ECR B;  2CZ2 A;  4OFN A;  4TR0 A;  4ZL9 A;  5AGY A;  3UBK A;  4BWS A;  1TDI A;  2YP6 A;  2FWG A;  3KJY A;  5G1L A;  1WRY A;  1X9M B;  1PKZ A;  1GH2 A;  1WIK A;  3IRA A;  3M3M A;  5ID2 B;  3W6G A;  2R4V A;  5ECK B;  2HYX A;  4PUR A;  3HVV A;  1GSY A;  3K8N A;  5CP1 A;  2PVQ A;  2V6O A;  1DUG A;  4TXO B;  1YEP A;  4O7H A;  4YAV A;  1VF2 A;  4GST A;  2WUL A;  2YWN A;  2FNO A;  2NTO A;  3GKM A;  3GH6 A;  5H5R A;  3ZYW A;  2XPE A;  3HJO A;  1R5A A;  4XIH A;  13GS A;  3H4K A;  1V2A A;  2JAC A;  4Z7X A;  1GSE A;  4K7I A;  2F9S A;  5A5K A;  2VD1 A;  1GTU A;  1SYR A;  3IA1 A;  3I43 A;  4L0U A;  2XBQ A;  1MTC A;  3GKK A;  3HHV A;  2DML A;  1I5G A;  5DDL A;  2LS5 A;  2NVL A;  3TUE A;  3CSI A;  4GQF A;  4ZB8 A;  2HRN A;  4G0L A;  2XBI A;  4KDX A;  1OKT A;  3HA9 A;  4K7N A;  4HQS A;  3EIN A;  3FZA A;  1HD2 A;  5DJM A;  3QMX A;  2X4A A;  2HFD A;  4F82 A;  1T7P B;  2V6K A;  1YEX A;  5D9X A;  3WGE A;  1ZYP A;  4IEL A;  5GAP D;  2HE3 A;  2LV3 A;  3TCO A;  2C4J A;  5AIS A;  3FYG A;  2FA8 A;  4JRR A;  1SL0 B;  4IP6 A;  3UAP A;  2M46 A;  2QA2 A;  2VL3 A;  4WBR D;  2XC2 A;  4Z2T A;  4OCF A;  1PL2 A;  2IPA A;  6GSS A;  4N0V A;  2VLV A;  2LRT A;  1Z9H A;  5JWQ B;  5ECQ B;  5JCW A;  5G30 A;  3IDV A;  2AUV A;  3APS A;  3H93 A;  3DWV A;  4E8E A;  1PA3 A;  1VF4 A;  5IM9 A;  4IVF A;  3VLN A;  2ZNM A;  1OVN A;  1WPI A;  3ISO A;  3F9U A;  3M9J A;  2RLI A;  4ML6 A;  2JSZ A;  2JAD A;  4YKF A;  1VGL A;  1ZOF A;  4GRF A;  2CAI A;  1YDK A;  3HZ8 A;  4IP1 A;  5CRW A;  2LNT A;  4PUA A;  2EIQ A;  4MPF A;  4TN8 A;  4ULX A;  5LNK e;  3F6F A;  3M1G A;  5A4W A;  2RUF A;  1B48 A;  4ACS A;  2AV4 A;  2X49 A;  3KTB A;  2R6K A;  1MDI A;  5EVO A;  1ST9 A;  5KOX A;  1PKW A;  3VWW A;  4MF7 A;  3MSZ A;  5H5Q A;  2VCW A;  3H1N A;  1K0M A;  2E0Q A;  1T4Z A;  1PGT A;  2X8C A;  3LXT A;  3CSJ A;  3CXG A;  1K3O A;  1YZX A;  5F05 A;  1MD4 A;  5B8A A;  2F3M A;  3CSH A;  1EP7 A;  4TW5 A;  4RUV A;  1S3C A;  2C0G A;  1FG4 A;  1QK8 A;  3ZZX A;  2P0G A;  1W4V A;  16GS A;  4YQU A;  2JZT A;  2CX4 A;  3BD2 A;  2LQQ A;  1HQO A;  3KH9 A;  2GT5 A;  3MYD A;  1TK8 B;  3VI7 A;  5ABR A;  4G10 A;  3BOA A;  4X1U A;  3RAZ A;  2AHE A;  1YY7 A;  4IN0 A;  5DQS A;  4I5Q A;  1ACV A;  3UAR A;  1FB6 A;  2RM5 A;  3LFL A;  3LEF A;  1XXU A;  3UOM A;  3PPU A;  4TVE A;  2KOK A;  2AAW A;  5ENU A;  3MIX A;  4FIW A;  1K0D A;  4F9Z A;  3ZRD A;  2J9H A;  2HSY A;  2H8L A;  5E59 A;  3EPT A;  4K8M A;  3ZMK A;  2BMX A;  2MBS A;  1NHO A;  2YV9 A;  2FWH A;  3UIW A;  2YCD A;  3HKR A;  3FMW A;  1OC3 A;  4X0X A;  1EWX A;  1V9W A;  3Q74 A;  2C0E A;  2HSH A;  5D96 A;  4CY8 A;  2LUS A;  4ZBB A;  3TKS C;  3DEX A;  3LOR A;  2YWO A;  1XWB A;  1NM3 A;  2WDU A;  1ERV A;  1XW5 A;  1JZW A;  1O8W A;  2OAD A;  5IMZ A;  1A2M A;  3I69 A;  1XBS A;  5F8B A;  3FRC A;  3KMO A;  3DML A;  5ECL B;  1PN9 A;  1J0F A;  3GH9 A;  1M9A A;  2VO4 A;  3RHC A;  4DVC A;  3A2W A;  1FO5 A;  5IMC A;  4YQM A;  1OAZ A;  17GS A;  5B6N A;  5FWG A;  4XTS A;  1XVW A;  1BJX A;  2YWI A;  2O87 A;  2B5Y A;  1ZYQ B;  3NZN A;  4GWR A;  3OR5 A;  3JCM L;  3F0I A;  1IYI A;  1XWA A;  5D9V A;  3VWX A;  1XPV A;  3P8W A;  4HDE A;  3C1R A;  4GTU A;  4Q5F A;  1FW1 A;  1PD2 1;  2AYT A;  4EO3 A;  4KND A;  1GLP A;  2PU9 C;  1GNE A;  3GV1 A;  2PMT A;  1DE2 A;  2JZS A;  1TRW A;  1YF1 A;  5CRH A;  4K5R A;  5IPG A;  1ZYN A;  1B9Y C;  2R3X A;  3I6A A;  5IMV A;  2R37 A;  5HR1 A;  1F3A A;  1TK5 B;  3GKX A;  4ZL8 A;  2MMZ A;  1UVZ A;  6GSU A;  1JZO A;  4POK A;  3EYT A;  3WD6 A;  2GQK A;  3CYN A;  1AC1 A;  2K8S A;  4XRA A;  1JLV A;  1GL8 A;  4KAE A;  5IO2 A;  1SL2 B;  4KCE A;  2O7K A;  2WCI A;  3F4T A;  2E2G A;  1OYJ A;  4ZBA A;  1X5D A;  1TRV A;  3FR6 A;  3P7X A;  1OE7 A;  4EIQ A;  5G31 A;  3GFK A;  1CQG A;  2FCH A;  1T00 A;  4CDO A;  1ERT A;  3GYK A;  2PGT A;  3R2Q A;  1J9B A;  2B1K A;  3QAV A;  4Z2U A;  2LTK A;  1YKA A;  5JCU A;  3D22 A;  3IK9 A;  1KEB A;  1T3B A;  2CQ9 A;  2V1M A;  3F8U A;  4WET A;  3C71 A;  3N5O A;  3ZLP A;  4K5S A;  1TI1 A;  4MA9 A;  2CV4 A;  4MH3 A;  2DJ1 A;  5DCG A;  3FEU A;  5HQP A;  2AB6 A;  4V1A p;  12GS A;  1XCC A;  4IHU A;  1EEM A;  4L5L A;  1SJI A;  3QFA C;  4E8H A;  2R0C A;  3KP8 A;  5B7C A;  2ES7 A;  2R2J A;  2CVK A;  4YAP A;  5HR2 A;  3VUR A;  3ED3 A;  2OBI A;  5ECO B;  3KIJ A;  1M99 A;  1U3A A;  3I9V 2;  4MJC A;  1X5E A;  1SYX A;  3TOT A;  4KCA A;  2FY6 A;  4V2N A;  2OE1 A;  5EL8 A;  2GZZ A;  3LJR A;  2K8V A;  4LMW A;  3M9K A;  2TRX A;  4F2I A;  2IFQ B;  1JZR A;  2YZU A;  1M2D A;  2IFQ A;  3UL3 A;  1ABA A;  1EZK A;  2QC7 A;  1TTZ A;  1Z6N A;  1F6M C;  3QCP A;  2VL2 A;  1TI3 A;  4V2L A;  5D8I A;  2FWF A;  4ZB9 A;  4WR4 A;  3MNG A;  3A3T A;  4OO4 A;  3BBY A;  1PMT A;  2GZP A;  3GMF A;  2IL3 A;  2X99 A;  4Z2R A;  2X64 A;  3H79 A;  5KN3 A;  3F4R A;  5A4U A;  4QL7 A;  1PRX A;  3ZTL A;  5AIX A;  2GSR A;  2L4Q A;  5A4V A;  2G0F A;  1BAY A;  2ALB A;  2H72 A;  3MAK A;  2H74 A;  4K0N A;  2R0P A;  5ID2 A;  1SK1 A;  1GP1 A;  1V58 A;  3IAM 2;  4BA7 A;  2DSA A;  1M0U A;  4KDY A;  4KDU A;  3G7Y A;  2IMI A;  4FYB A;  1Q98 A;  1G7E A;  2G2Q A;  2DJ0 A;  1S3D A;  1CQH A;  5IOW A;  4TXO A;  4FYC A;  5E4W A;  2C3T A;  3LQ7 A;  1NHY A;  1ZL9 A;  3A5I A;  1X9S B;  3KP9 A;  4XCS A;  2LEG A;  2VUP A;  3ZRE A;  2H70 A;  2GSS A;  3MDK A;  4ECJ A;  2DIZ A;  1O8X A;  1AW9 A;  1A2J A;  2I1U A;  3TRQ A;  1UC7 A;  3M0F A;  1PSQ A;  4PGT A;  2X8G A;  2Z9S A;  4AJ7 A;  1XW9 A;  4EC0 A;  4YH2 A;  1QFN A;  3UEM A;  4PQH A;  1A0F A;  3C73 A;  1GSF A;  3GL3 A;  3PH9 A;  1K0B A;  4OCE A;  6GSW A;  2X8H A;  2B6M A;  1U87 A;  4PNG A;  1MD3 A;  1FAA A;  1A23 A;  3L9S A;  5HR3 A;  3LWA A;  1IYH A;  1AXD A;  3DGQ A;  3GNJ A;  2C3N A;  5ECP B;  2D2Z A;  4ZB6 A;  3ERF A;  3A5W A;  3F3Q A;  2P5R A;  4ECI A;  5ECM B;  3WGX A;  2LRC A;  2FD3 A;  4NWY A;  1XWC A;  4HOJ A;  1AUC A;  3QAG A;  4JR4 A;  5D73 A;  3AY8 A;  14GS A;  5G2Z A;  1SJ6 A;  2H30 A;  3BCK A;  1ERU A;  4MF6 A;  5JWO B;  1EEJ A;  1K3Y A;  2NBS A;  4XHM A;  3LYK A;  1VF1 A;  3G9B A;  2UZ8 A;  4RI6 A;  2H1G A;  4GQC A;  2CX3 A;  3F3R A;  1PL1 A;  1M9B A;  1WMJ A;  4MLY A;  4ZIL A;  2H66 A;  1GSD A;  1G7O A;  4H86 A;  4IW9 A;  5KN1 A;  1A24 A;  4EUY A;  1SK2 A;  3UVH A;  3APO A;  3TRP A;  5F07 A;  2WFC A;  1PFO A;  5AIV A;  2H01 A;  1K0O A;  2VCQ A;  1ZZY A;  4NV2 A;  1T4Y A;  3IC8 A;  1JZD A;  2YN1 A;  4BVY B;  2F51 A;  4F0B A;  2F8F A;  2KLX A;  3DKS A;  5LCZ A;  2VLT A;  2F8A A;  2LJK A;  2L5O A;  1HNB A;  4BVY A;  3ZIV A;  4GXZ A;  5IOX A;  3FKF A;  3TDG A;  4BL7 B;  4IQ1 A;  1M2A A;  4HJ2 A;  4JR6 A;  1Y6E A;  2K6V A;  2N5A A;  2MBT A;  4ILF A;  2O8V B;  3DXB A;  3U6V A;  4EL1 A;  1S3R A;  1BX9 A;  1XWG A;  3IV4 A;  2XPD A;  1BYE A;  3CRU A;  2IME A;  1MDJ A;  2HI7 A;  1GUL A;  1GSS A;  2QGV A;  3GX8 A;  2REM A;  3LSZ A;  3D21 A;  1GTI A;  1MEK A;  5D9T A;  4X4J A;  1MDK A;  3CTF A;  2TIR A;  4TR1 B;  4JED A;  1GUH A;  4BPY A;  1X5C A;  3EU3 A;  1XIY A;  4GCI A;  2H76 A;  1VF3 A;  4TR1 A;  1ML6 A;  4LL4 B;  5JWR B;  3IHG A;  4LL1 B;  1SKR B;  4XS4 B;  2DBC A;  1A8Y A;  4A5P A;  3HXS A;  2GQM A;  3KD0 A;  3UBL A;  5DCH A;  3L0H A;  4XS4 A;  1O85 A;  4ZL7 A;  2YPM A;  3KGK A;  4AJ6 A;  10GS A;  4WKW A;  1SL1 B;  2GS3 A;  1F37 A;  3QPM A;  2K9F A;  3GUR A;  5ECI B;  4HZ2 A;  2DJK A;  1T1V A;  5IMD A;  3WGD A;  2FWE A;  1F3B A;  1DE1 A;  3VI5 A;  3IC4 A;  5GAN D;  2MMO A;  3DD3 A;  3C7M A;  4ZBD A;  4FO5 A;  1V57 A;  2QA1 A;  4EKZ A;  1Y25 A;  3HJP A;  1GSQ A;  1F9M A;  4WBJ A;  3EMX A;  2VCV A;  2GVP A;  2VCZ A;  1G6Y A;  4OD7 A;  3HJM A;  3NOF A;  2VOC A;  4MAB A;  5FT3 A;  4PUF C;  4PTS A;  5B6M A;  2LNS A;  3GL5 A;  1LU4 A;  2QKE A;  3CMI A;  3KZQ A;  4MNN A;  2I81 A;  4NAX A;  1HNC A;  3LYP A;  3VWV A;  5AN1 A;  4DSS B;  1H75 A;  1V98 A;  5LD0 A;  5CAX A;  3KM6 A;  1RQM A;  2B7J A;  4DSS A;  2DJ2 A;  3DVW A;  2H6Z A;  4EVM A;  1R5P A;  3LGC A;  2C80 A;  4G0I A;  4G19 A;  4GSN A;  3VPT A;  1B8X A;  4KW6 A;  4EIP A;  2KUC A;  4JU5 A;  2YV7 A;  2HLS A;  3ZML A;  1QQ2 A;  3J7Y b;  1EOG A;  3QDN A;  2YOI A;  5IO0 A;  4AGS A;  3L9U A;  1HNA A;  2H1A A;  2DJ3 A;  4POM A;  2VD0 A;  3F6D A;  2CA8 A;  3QAW A;  4ZXG A;  1V40 A;  2HZF A;  4NHW A;  4TR4 A;  4NMU A;  3ZIT A;  1EGO A;  3TGZ A;  4MK3 A;  2O89 A;  3GTU B;  2DKH A;  4MF5 A;  5DVB A;  1GTB A;  3TB2 A;  1JLW A;  5CRE A;  2CVD A;  4HJM A;  3E0U A;  3GTU A;  3O3T A;  1RW1 A;  4TKY A;  4HUA A;  3D4M A;  2I4A A;  3FR3 A;  2H71 A;  4NXI A;  1AIU A;  4HS1 A;  4OWY A;  2MZC A;  22GS A;  2ON7 A;  1K0N A;  1QUW A;  4Q5N A;  3LW9 A;  1SK0 A;  3HY2 A;  3KEB A;  2PWJ A;  4POB A;  2IJY A;  4IGJ A;  4CY6 A;  5J5N A;  1WP0 A;  2JSY A;  2FLS A; 
#chains in the Genus database with same CATH homology
 2IMD A;  1BG5 A;  3QR6 A;  5J9B A;  1AAZ A;  1OC9 B;  4I2T A;  2ZUP A;  3GN3 A;  5C00 A;  2L59 A;  1FOH A;  2OBK A;  1OC9 A;  4K7O A;  1ZGN A;  1AQV A;  2H19 A;  1NSW A;  5C04 A;  2LKU A;  4N0Z A;  1USB A;  2YAN A;  5G1K A;  3CRT A;  4L8E A;  2CT6 A;  1A2L A;  2C1Y A;  2O85 A;  1O6J A;  3ME8 A;  2OA7 A;  2H6Y A;  3EC3 A;  2DJJ A;  4NV5 A;  5L71 A;  2YJH A;  4EXJ A;  3QFB C;  1BED A;  2B3S A;  3IHQ A;  2GGT A;  3EWL A;  4JZQ A;  20GS A;  1TK0 B;  4DSR A;  2GQL A;  3IR4 A;  2E2M A;  2H1B A;  2TRC P;  1FHE A;  2WB9 A;  3GRX A;  2HRF A;  4IQA A;  4PX1 A;  4MCU A;  4WEY A;  5HR0 A;  1FOV A;  3PGT A;  3TJG A;  1TKD B;  1TP9 A;  2OJL A;  4WF5 A;  1GNW A;  2PUK C;  2H0H A;  4K0G A;  4Q5R A;  1R26 A;  4MJB A;  2MMN A;  4TR3 A;  3DIE A;  3TKP A;  1E2Y A;  1QXH A;  1TU8 A;  1HYU A;  5J41 A;  4PQ1 A;  2KHP A;  3HVS A;  3RHB A;  1WOU A;  3ZFB A;  1XZO A;  2H75 A;  2I9H A;  1EV4 A;  1SJZ A;  5IMA A;  1SKS B;  1VRS D;  2QSI A;  4ML1 A;  1GTA A;  2GSQ A;  4OFM A;  5DQY A;  4IJ3 A;  3E3E A;  2N5B A;  3E9J B;  3G7I A;  2GDR A;  4PXO A;  5J4U A;  4LA1 A;  5DAK B;  3NIV A;  1K0A A;  3N9J A;  6GSX A;  4CHS A;  4JBB A;  5DAK A;  1O7U A;  1I9D A;  1AQX A;  2KP2 A;  3M8N A;  2CZ3 A;  4HQZ A;  1ON4 A;  3G7J A;  2L6D A;  3P2A A;  4HZ4 A;  2C0D A;  1TW9 A;  1TXX A;  4MDC A;  3EMP A;  3FZ9 A;  1Z3E A;  5IMF A;  3VPQ A;  2LRN A;  11GS A;  1Z6M A;  1FVK A;  1WJK A;  2H0G A;  4KSO A;  3WT1 A;  4G2E A;  3F4S A;  4TRX A;  2AJQ B;  1EP8 A;  1H4O A;  2EC4 A;  4BVX B;  5G5E A;  1Z5Y E;  1URM A;  2JZR A;  1THX A;  2RUE A;  1O81 A;  4BVX A;  4X43 A;  5G5F A;  4IS0 A;  2RII A;  5HFG A;  4MJA A;  4PNF A;  4GF0 A;  2YNX A;  8GSS A;  5HFI A;  4K2X A;  3EVI A;  4D73 B;  1ERW A;  4KF9 A;  4XS1 A;  4ISD A;  4FH8 A;  4D73 A;  3TRX A;  4OMV A;  3Q19 A;  7GSS A;  1XOB A;  2L5L A;  3IOS A;  3GX0 A;  2OE3 A;  2VM1 A;  1AQW A;  3L4N A;  3HVX A;  4AJ8 A;  3IPZ A;  2GZY A;  6GST A;  1N8J A;  5DJL A;  2A2P A;  4KA0 A;  4ICY A;  2OE0 A;  2A4V A;  4L5O A;  4J56 E;  3TJF A;  2M80 A;  1XOA A;  1PX6 A;  2DLX A;  1K0C A;  3IXR A;  3H8Q A;  2FGX A;  4N11 A;  1SD9 A;  1W89 A;  2XHF A;  3QD9 A;  3Q6O A;  2VL2 C;  3ZVJ A;  3TKS A;  5DAL B;  5EPF A;  1ZCP A;  2PPT A;  3UJ1 A;  4G9H A;  3DRN A;  3TOU A;  4KE3 A;  5CO3 A;  5DAL A;  2RM6 A;  4USS A;  4HU7 A;  1ZMA A;  2CAQ A;  2L57 A;  2PBJ A;  5KN2 A;  1RK4 A;  1M2B A;  2GT6 A;  1U88 A;  5D9W A;  5EY6 A;  4MZC A;  1TRS A;  3O6T A;  2HXK A;  4IKH A;  2WJU A;  1E6B A;  4CW9 A;  4FQU A;  4K1F A;  5F06 A;  4RQX A;  3Q18 A;  5ECH B;  3WT2 A;  2OAC A;  2HNL A;  4MZW A;  2JL4 A;  5GZZ B;  2B7K A;  3EU4 A;  3FY7 A;  2L4C A;  4BL7 A;  3ZL5 A;  1K3L A;  4JE1 A;  1F2E A;  1R4W A;  2A4H A;  2BJX A;  5JCG A;  5KN0 A;  5COH A;  5D93 A;  5INY A;  3SBC A;  4GSS A;  3D4T A;  4KB3 A;  5J3R A;  4EF0 A;  1A8L A;  4EDY A;  3UMA A;  1R7H A;  2VIM A;  1TOF A;  5F0G A;  2V41 A;  2YJ7 A;  3EUR A;  1JHB A;  2N5F A;  3EE2 A;  4K9Z A;  4K2D A;  1SEN A;  4HEA 2;  1OC8 A;  1S3A A;  1KBN A;  2VAF A;  4YQV A;  4POL A;  4TXV A;  3CTG A;  1GWC A;  4KSM A;  2NPB A;  3TJK A;  1EV9 A;  1SD8 A;  2I3Y A;  1SU9 A;  5BMU A;  1THO A;  1UA5 A;  3VWU A;  1OE8 A;  1LBK A;  3FR9 A;  3IAS 2;  4QL9 A;  2OKA A;  2B5X A;  2PER A;  4EE0 A;  3TKQ A;  4RI7 A;  4J2F A;  1B4P A;  1DSB A;  1X0R A;  2KP1 A;  3IK7 A;  1O73 A;  3FZ5 A;  1EGR A;  3HZ4 A;  3PIN A;  3IE3 A;  4WXT A;  3S9F A;  4V2M A;  4TOP A;  1QMV A;  4OO5 A;  3WYW A;  3FK8 A;  4AF2 A;  5CYY A;  4ID0 A;  1YQ1 A;  5IQY A;  3GHA A;  1KTE A;  3GKN A;  5ECS A;  2IIY A;  4DSQ A;  3ERW A;  4F03 A;  3A2V A;  5CRD A;  4O32 A;  3VK9 A;  3UVT A;  3FW2 A;  5H5S A;  1UN2 A;  1SKW B;  1GLQ A;  4ECB A;  2R5G A;  2IMF A;  2HRK A;  3DVX A;  5CRG A;  2K18 A;  1A0R P;  2VLU A;  3HCZ A;  3BCI A;  1GSU A;  5BRT A;  4KH7 A;  2H73 A;  2DC5 A;  1QGV A;  3P90 A;  2JU5 A;  3F63 A;  4P3Y B;  2YZH A;  4I8B A;  1M7T A;  1TRU A;  3TJB A;  2DKI A;  3DYR A;  4IJI A;  1YF0 A;  1X9W B;  4MZB A;  4LLR A;  3GUS A;  2H0I A;  1XWK A;  3ZVJ D;  2ZCT A;  3L78 A;  4MPG A;  4BWQ A;  1LJR A;  18GS A;  3RDW A;  1U6T A;  2YWM A;  3R3E A;  2P5Q A;  1EOH A;  3HYP A;  2LJA A;  2IWT A;  1NW2 A;  4FYU A;  3GA4 A;  4V1A g;  4ECC A;  2EIR A;  2H6X A;  4LMV A;  3PR8 A;  4MP4 A;  3ZFL A;  4J57 E;  5ECN B;  3U5R E;  1KNG A;  1FB0 A;  4PQI A;  4F0C A;  3KTL A;  2A2S A;  2VCT A;  2H1D A;  4NHZ A;  3V1W A;  1GRX A;  2P31 A;  1BQ7 A;  4WF4 A;  3LG6 A;  4MMM A;  2A2R A;  2DMM A;  3US3 A;  1J08 A;  2E7P A;  5KEJ A;  5CNW A;  5GSS A;  3ME7 A;  1TJD A;  2IN3 A;  4KUN A;  2WZ9 A;  4MH2 A;  3SWL A;  3O76 A;  4WR5 A;  2EIO A;  6GSV A;  2MMA A;  2LST A;  4DEJ A;  3TKS E;  2PVO C;  4I2U A;  4O5R A;  4HU9 A;  3TKR A;  2B5E A;  4L0W A;  3FZ4 A;  3D6I A;  1PX7 A;  4XRD A;  1GUK A;  5KOW A;  3CBU A;  4QQ7 A;  1U3I A;  1N2A A;  3D5J A;  3VFI A;  2VM2 A;  2GTU A;  1XVQ A;  2B1L A;  3C1S A;  4YKG A;  2HSM A;  2HZE B;  1G6W A;  2DIY A;  3D0Z A;  2PN8 A;  2VL9 A;  3BJ5 A;  2HZE A;  3ERG A;  4ZIJ A;  3J7Y k;  4I97 A;  2GST A;  5IPH A;  3W8S A;  2CVB A;  4HI7 A;  2R0G A;  1ILO A;  3LXZ A;  3KXO A;  5DBQ A;  2M72 A;  2IMK A;  1Q4J A;  4IBP A;  2J23 A;  4KGI A;  4OFT A;  3RPN A;  3TJJ A;  1B9X C;  5ELA A;  5B8B A;  1XFL A;  2LQO A;  3C8E A;  3FHK A;  3APQ A;  3GST A;  1XW6 A;  3HDC A;  4NPB A;  1B4Q A;  2HRA A;  1WWJ A;  4MJE A;  19GS A;  1FVJ A;  2FA4 A;  4KX4 A;  4I6X A;  4EDZ A;  1Z7R A;  1Z7P A;  2L6C A;  1OKD A;  1PQN A;  3KMN A;  5FHI A;  4XS6 A;  1T8E B;  3HD5 A;  4G0K A;  2WS2 A;  3RPP A;  3L9V A;  3IBH A;  2V32 A;  4Q5Q A;  1C72 A;  4O5Q A;  1PN0 A;  3QOU A;  1DBY A;  2NDO A;  1G0T A;  3W8J A;  3GSS A;  3ZIJ A;  1TU7 A;  2MYG A;  9GSS A;  6GSY A;  2HT9 A;  2C3Q A;  2FUG 2;  1JFU A;  2WGR A;  5ELG A;  2GLR A;  4RQR A;  3GIX A;  2WRT A;  1YJ6 A;  1YKC A;  5GST A;  5HFK A;  3MWH A;  1GUM A;  2C8U A;  1WE0 A;  5IIZ A;  2ON5 A;  3KH7 A;  5J9C A;  2LJR A;  2FHE A;  4K6X A;  2BTO T;  4O5U A;  4N30 A;  4N10 A;  4O92 A;  2VCX A;  3RBT A;  3A2X A;  2V2G A;  4GLT A;  3KCM A;  2C0F A;  1ZYE A;  5ECR B;  2CZ2 A;  4OFN A;  4TR0 A;  4ZL9 A;  5AGY A;  3UBK A;  4BWS A;  1TDI A;  2YP6 A;  2FWG A;  3KJY A;  5G1L A;  1WRY A;  1X9M B;  1PKZ A;  1GH2 A;  1WIK A;  3IRA A;  3M3M A;  5ID2 B;  3W6G A;  2R4V A;  5ECK B;  2HYX A;  4PUR A;  3HVV A;  1GSY A;  3K8N A;  5CP1 A;  2PVQ A;  2V6O A;  1DUG A;  4TXO B;  1YEP A;  4O7H A;  4YAV A;  1VF2 A;  4GST A;  2WUL A;  2YWN A;  2FNO A;  2NTO A;  3GKM A;  3GH6 A;  5H5R A;  3ZYW A;  2XPE A;  3HJO A;  1R5A A;  4XIH A;  13GS A;  3H4K A;  1V2A A;  2JAC A;  4Z7X A;  1GSE A;  4K7I A;  2F9S A;  5A5K A;  2VD1 A;  1GTU A;  1SYR A;  3IA1 A;  3I43 A;  4L0U A;  2XBQ A;  1MTC A;  3GKK A;  3HHV A;  2DML A;  1I5G A;  5DDL A;  2LS5 A;  2NVL A;  3TUE A;  3CSI A;  4GQF A;  4ZB8 A;  2HRN A;  4G0L A;  2XBI A;  4KDX A;  1OKT A;  3HA9 A;  4K7N A;  4HQS A;  3EIN A;  3FZA A;  1HD2 A;  5DJM A;  3QMX A;  2X4A A;  2HFD A;  4F82 A;  1T7P B;  2V6K A;  1YEX A;  5D9X A;  3WGE A;  1ZYP A;  4IEL A;  5GAP D;  2HE3 A;  2LV3 A;  3TCO A;  2C4J A;  5AIS A;  3FYG A;  2FA8 A;  4JRR A;  1SL0 B;  4IP6 A;  3UAP A;  2M46 A;  2QA2 A;  2VL3 A;  4WBR D;  2XC2 A;  4Z2T A;  4OCF A;  1PL2 A;  2IPA A;  6GSS A;  4N0V A;  2VLV A;  2LRT A;  1Z9H A;  5JWQ B;  5ECQ B;  5JCW A;  5G30 A;  3IDV A;  2AUV A;  3APS A;  3H93 A;  3DWV A;  4E8E A;  1PA3 A;  1VF4 A;  5IM9 A;  4IVF A;  3VLN A;  2ZNM A;  1OVN A;  1WPI A;  3ISO A;  3F9U A;  3M9J A;  2RLI A;  4ML6 A;  2JSZ A;  2JAD A;  4YKF A;  1VGL A;  1ZOF A;  4GRF A;  2CAI A;  1YDK A;  3HZ8 A;  4IP1 A;  5CRW A;  2LNT A;  4PUA A;  2EIQ A;  4MPF A;  4TN8 A;  4ULX A;  5LNK e;  3F6F A;  3M1G A;  5A4W A;  2RUF A;  1B48 A;  4ACS A;  2AV4 A;  2X49 A;  3KTB A;  2R6K A;  1MDI A;  5EVO A;  1ST9 A;  5KOX A;  1PKW A;  3VWW A;  4MF7 A;  3MSZ A;  5H5Q A;  2VCW A;  3H1N A;  1K0M A;  2E0Q A;  1T4Z A;  1PGT A;  2X8C A;  3LXT A;  3CSJ A;  3CXG A;  1K3O A;  1YZX A;  5F05 A;  1MD4 A;  5B8A A;  2F3M A;  3CSH A;  1EP7 A;  4TW5 A;  4RUV A;  1S3C A;  2C0G A;  1FG4 A;  1QK8 A;  3ZZX A;  2P0G A;  1W4V A;  16GS A;  4YQU A;  2JZT A;  2CX4 A;  3BD2 A;  2LQQ A;  1HQO A;  3KH9 A;  2GT5 A;  3MYD A;  1TK8 B;  3VI7 A;  5ABR A;  4G10 A;  3BOA A;  4X1U A;  3RAZ A;  2AHE A;  1YY7 A;  4IN0 A;  5DQS A;  4I5Q A;  1ACV A;  3UAR A;  1FB6 A;  2RM5 A;  3LFL A;  3LEF A;  1XXU A;  3UOM A;  3PPU A;  4TVE A;  2KOK A;  2AAW A;  5ENU A;  3MIX A;  4FIW A;  1K0D A;  4F9Z A;  3ZRD A;  2J9H A;  2HSY A;  2H8L A;  5E59 A;  3EPT A;  4K8M A;  3ZMK A;  2BMX A;  2MBS A;  1NHO A;  2YV9 A;  2FWH A;  3UIW A;  2YCD A;  3HKR A;  3FMW A;  1OC3 A;  4X0X A;  1EWX A;  1V9W A;  3Q74 A;  2C0E A;  2HSH A;  5D96 A;  4CY8 A;  2LUS A;  4ZBB A;  3TKS C;  3DEX A;  3LOR A;  2YWO A;  1XWB A;  1NM3 A;  2WDU A;  1ERV A;  1XW5 A;  1JZW A;  1O8W A;  2OAD A;  5IMZ A;  1A2M A;  3I69 A;  1XBS A;  5F8B A;  3FRC A;  3KMO A;  3DML A;  5ECL B;  1PN9 A;  1J0F A;  3GH9 A;  1M9A A;  2VO4 A;  3RHC A;  4DVC A;  3A2W A;  1FO5 A;  5IMC A;  4YQM A;  1OAZ A;  17GS A;  5B6N A;  5FWG A;  4XTS A;  1XVW A;  1BJX A;  2YWI A;  2O87 A;  2B5Y A;  1ZYQ B;  3NZN A;  4GWR A;  3OR5 A;  3JCM L;  3F0I A;  1IYI A;  1XWA A;  5D9V A;  3VWX A;  1XPV A;  3P8W A;  4HDE A;  3C1R A;  4GTU A;  4Q5F A;  1FW1 A;  1PD2 1;  2AYT A;  4EO3 A;  4KND A;  1GLP A;  2PU9 C;  1GNE A;  3GV1 A;  2PMT A;  1DE2 A;  2JZS A;  1TRW A;  1YF1 A;  5CRH A;  4K5R A;  5IPG A;  1ZYN A;  1B9Y C;  2R3X A;  3I6A A;  5IMV A;  2R37 A;  5HR1 A;  1F3A A;  1TK5 B;  3GKX A;  4ZL8 A;  2MMZ A;  1UVZ A;  6GSU A;  1JZO A;  4POK A;  3EYT A;  3WD6 A;  2GQK A;  3CYN A;  1AC1 A;  2K8S A;  4XRA A;  1JLV A;  1GL8 A;  4KAE A;  5IO2 A;  1SL2 B;  4KCE A;  2O7K A;  2WCI A;  3F4T A;  2E2G A;  1OYJ A;  4ZBA A;  1X5D A;  1TRV A;  3FR6 A;  3P7X A;  1OE7 A;  4EIQ A;  5G31 A;  3GFK A;  1CQG A;  2FCH A;  1T00 A;  4CDO A;  1ERT A;  3GYK A;  2PGT A;  3R2Q A;  1J9B A;  2B1K A;  3QAV A;  4Z2U A;  2LTK A;  1YKA A;  5JCU A;  3D22 A;  3IK9 A;  1KEB A;  1T3B A;  2CQ9 A;  2V1M A;  3F8U A;  4WET A;  3C71 A;  3N5O A;  3ZLP A;  4K5S A;  1TI1 A;  4MA9 A;  2CV4 A;  4MH3 A;  2DJ1 A;  5DCG A;  3FEU A;  5HQP A;  2AB6 A;  4V1A p;  12GS A;  1XCC A;  4IHU A;  1EEM A;  4L5L A;  1SJI A;  3QFA C;  4E8H A;  2R0C A;  3KP8 A;  5B7C A;  2ES7 A;  2R2J A;  2CVK A;  4YAP A;  5HR2 A;  3VUR A;  3ED3 A;  2OBI A;  5ECO B;  3KIJ A;  1M99 A;  1U3A A;  3I9V 2;  4MJC A;  1X5E A;  1SYX A;  3TOT A;  4KCA A;  2FY6 A;  4V2N A;  2OE1 A;  5EL8 A;  2GZZ A;  3LJR A;  2K8V A;  4LMW A;  3M9K A;  2TRX A;  4F2I A;  2IFQ B;  1JZR A;  2YZU A;  1M2D A;  2IFQ A;  3UL3 A;  1ABA A;  1EZK A;  2QC7 A;  1TTZ A;  1Z6N A;  1F6M C;  3QCP A;  2VL2 A;  1TI3 A;  4V2L A;  5D8I A;  2FWF A;  4ZB9 A;  4WR4 A;  3MNG A;  3A3T A;  4OO4 A;  3BBY A;  1PMT A;  2GZP A;  3GMF A;  2IL3 A;  2X99 A;  4Z2R A;  2X64 A;  3H79 A;  5KN3 A;  3F4R A;  5A4U A;  4QL7 A;  1PRX A;  3ZTL A;  5AIX A;  2GSR A;  2L4Q A;  5A4V A;  2G0F A;  1BAY A;  2ALB A;  2H72 A;  3MAK A;  2H74 A;  4K0N A;  2R0P A;  5ID2 A;  1SK1 A;  1GP1 A;  1V58 A;  3IAM 2;  4BA7 A;  2DSA A;  1M0U A;  4KDY A;  4KDU A;  3G7Y A;  2IMI A;  4FYB A;  1Q98 A;  1G7E A;  2G2Q A;  2DJ0 A;  1S3D A;  1CQH A;  5IOW A;  4TXO A;  4FYC A;  5E4W A;  2C3T A;  3LQ7 A;  1NHY A;  1ZL9 A;  3A5I A;  1X9S B;  3KP9 A;  4XCS A;  2LEG A;  2VUP A;  3ZRE A;  2H70 A;  2GSS A;  3MDK A;  4ECJ A;  2DIZ A;  1O8X A;  1AW9 A;  1A2J A;  2I1U A;  3TRQ A;  1UC7 A;  3M0F A;  1PSQ A;  4PGT A;  2X8G A;  2Z9S A;  4AJ7 A;  1XW9 A;  4EC0 A;  4YH2 A;  1QFN A;  3UEM A;  4PQH A;  1A0F A;  3C73 A;  1GSF A;  3GL3 A;  3PH9 A;  1K0B A;  4OCE A;  6GSW A;  2X8H A;  2B6M A;  1U87 A;  4PNG A;  1MD3 A;  1FAA A;  1A23 A;  3L9S A;  5HR3 A;  3LWA A;  1IYH A;  1AXD A;  3DGQ A;  3GNJ A;  2C3N A;  5ECP B;  2D2Z A;  4ZB6 A;  3ERF A;  3A5W A;  3F3Q A;  2P5R A;  4ECI A;  5ECM B;  3WGX A;  2LRC A;  2FD3 A;  4NWY A;  1XWC A;  4HOJ A;  1AUC A;  3QAG A;  4JR4 A;  5D73 A;  3AY8 A;  14GS A;  5G2Z A;  1SJ6 A;  2H30 A;  3BCK A;  1ERU A;  4MF6 A;  5JWO B;  1EEJ A;  1K3Y A;  2NBS A;  4XHM A;  3LYK A;  1VF1 A;  3G9B A;  2UZ8 A;  4RI6 A;  2H1G A;  4GQC A;  2CX3 A;  3F3R A;  1PL1 A;  1M9B A;  1WMJ A;  4MLY A;  4ZIL A;  2H66 A;  1GSD A;  1G7O A;  4H86 A;  4IW9 A;  5KN1 A;  1A24 A;  4EUY A;  1SK2 A;  3UVH A;  3APO A;  3TRP A;  5F07 A;  2WFC A;  5AIV A;  2H01 A;  1K0O A;  2VCQ A;  1ZZY A;  4NV2 A;  1T4Y A;  3IC8 A;  1JZD A;  2YN1 A;  4BVY B;  2F51 A;  4F0B A;  2F8F A;  2KLX A;  3DKS A;  5LCZ A;  2VLT A;  2F8A A;  2LJK A;  2L5O A;  1HNB A;  4BVY A;  3ZIV A;  4GXZ A;  5IOX A;  3FKF A;  3TDG A;  4BL7 B;  4IQ1 A;  1M2A A;  4HJ2 A;  4JR6 A;  1Y6E A;  2K6V A;  2N5A A;  2MBT A;  4ILF A;  2O8V B;  3DXB A;  3U6V A;  4EL1 A;  1BX9 A;  1XWG A;  3IV4 A;  2XPD A;  1BYE A;  3CRU A;  2IME A;  1MDJ A;  2HI7 A;  1GUL A;  1GSS A;  2QGV A;  3GX8 A;  2REM A;  3LSZ A;  3D21 A;  1GTI A;  1MEK A;  5D9T A;  4X4J A;  1MDK A;  3CTF A;  2TIR A;  4TR1 B;  4JED A;  1GUH A;  4BPY A;  1X5C A;  3EU3 A;  1XIY A;  4GCI A;  2H76 A;  1VF3 A;  4TR1 A;  1ML6 A;  4LL4 B;  5JWR B;  3IHG A;  4LL1 B;  1SKR B;  4XS4 B;  2DBC A;  1A8Y A;  4A5P A;  3HXS A;  2GQM A;  3KD0 A;  3UBL A;  5DCH A;  3L0H A;  4XS4 A;  1O85 A;  4ZL7 A;  2YPM A;  3KGK A;  4AJ6 A;  10GS A;  4WKW A;  1SL1 B;  2GS3 A;  1F37 A;  3QPM A;  2K9F A;  3GUR A;  5ECI B;  4HZ2 A;  2DJK A;  1T1V A;  5IMD A;  3WGD A;  2FWE A;  1F3B A;  1DE1 A;  3VI5 A;  3IC4 A;  5GAN D;  2MMO A;  3DD3 A;  3C7M A;  4ZBD A;  4FO5 A;  1V57 A;  2QA1 A;  4EKZ A;  1Y25 A;  3HJP A;  1GSQ A;  1F9M A;  4WBJ A;  3EMX A;  2VCV A;  2GVP A;  2VCZ A;  1G6Y A;  4OD7 A;  3HJM A;  3NOF A;  2VOC A;  4MAB A;  5FT3 A;  4PUF C;  4PTS A;  5B6M A;  2LNS A;  3GL5 A;  1LU4 A;  2QKE A;  3CMI A;  3KZQ A;  4MNN A;  2I81 A;  4NAX A;  1HNC A;  3LYP A;  3VWV A;  5AN1 A;  4DSS B;  1H75 A;  1V98 A;  5LD0 A;  5CAX A;  3KM6 A;  1RQM A;  2B7J A;  4DSS A;  2DJ2 A;  3DVW A;  2H6Z A;  4EVM A;  1R5P A;  3LGC A;  2C80 A;  4G0I A;  4G19 A;  4GSN A;  3VPT A;  1B8X A;  4KW6 A;  4EIP A;  2KUC A;  4JU5 A;  2YV7 A;  2HLS A;  3ZML A;  1QQ2 A;  3J7Y b;  1EOG A;  3QDN A;  2YOI A;  5IO0 A;  4AGS A;  3L9U A;  1HNA A;  2H1A A;  2DJ3 A;  4POM A;  2VD0 A;  3F6D A;  2CA8 A;  3QAW A;  4ZXG A;  1V40 A;  2HZF A;  4NHW A;  4TR4 A;  4NMU A;  3ZIT A;  1EGO A;  3TGZ A;  4MK3 A;  2O89 A;  3GTU B;  2DKH A;  4MF5 A;  5DVB A;  1GTB A;  3TB2 A;  1JLW A;  5CRE A;  2CVD A;  4HJM A;  3E0U A;  3GTU A;  3O3T A;  1RW1 A;  4TKY A;  4HUA A;  3D4M A;  2I4A A;  3FR3 A;  2H71 A;  4NXI A;  1AIU A;  4HS1 A;  4OWY A;  2MZC A;  22GS A;  2ON7 A;  1K0N A;  1QUW A;  4Q5N A;  3LW9 A;  1SK0 A;  3HY2 A;  3KEB A;  2PWJ A;  4POB A;  2IJY A;  4IGJ A;  4CY6 A;  5J5N A;  1WP0 A;  2JSY A;  2FLS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...