4I6XA

Crystal structure of non-catalyic domain of protein disulfide isomerase-related (pdir) protein
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
117
structure length
117
Chain Sequence
MLIERISDPKDLKKLLRTRNNVLVLYSKSEVAAENHLRLLSTVAQAVKGQGTICWVDCGDAESRKLCKKMKVDLSPKDKKVELFHYQDGAFHTEYNRAVTFKSIVAFLKDPKGPPLW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Protein disulfide-isomerase A5
publication title Structure of the Non-Catalytic Domain of the Protein Disulfide Isomerase-Related Protein (PDIR) Reveals Function in Protein Binding.
pubmed doi rcsb
source organism Homo sapiens
total genus 37
structure length 117
sequence length 117
ec nomenclature ec 5.3.4.1: Protein disulfide-isomerase.
pdb deposition date 2012-11-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4i6xA00
1EOGA 5J5NA 2VCWA 2ZNMA 1QUWA 2EC4A 2O89A 4LL1B 1GSSA 1SL2B 4KAEA 5ECSA 5F05A 2IMKA 1OC3A 1HYUA 1B4PA 3U5RE 3UAPA 1V98A 2QGVA 4N30A 3VI5A 1A23A 2K9FA 3P8WA 3M9JA 3EE2A 4MZCA 2H0IA 5ECQB 2FCHA 1QXHA 3FY7A 1YF1A 2VIMA 4KSOA 2IN3A 4HUAA 3IR4A 5IPHA 4POLA 3N5OA 4Q5FA 2XHFA 2VLVA 4F2IA 1I5GA 4XS1A 4V1Ag 1BG5A 5HQPA 3EMXA 2YJ7A 5JCUA 2L6DA 3ERFA 1PQNA 3VLNA 2GTUA 1XW6A 3ZIVA 1HNBA 3TJGA 1BQ7A 3A3TA 4OO4A 2VD0A 3CYNA 1X5DA 2PVOC 4IKHA 4V2MA 1WP0A 3A5WA 2FLSA 4MF7A 3QCPA 1ZCPA 5FHIA 3FZ9A 4LMWA 2N5BA 3MNGA 3KMNA 2GQMA 1VF2A 4PXOA 5DALB 1TI1A 1TU8A 1HNCA 4K1FA 5COHA 1MDIA 2HT9A 4ZIJA 1GTBA 4KUNA 2CVBA 4MZWA 5D93A 1MEKA 5GAPD 5ECPB 1GSEA 3WGXA 1GWCA 4IJIA 3IDVA 4ZILA 1SENA 4K7OA 4MH2A 3TKSC 1TK8B 3GH6A 4GXZA 1SD9A 4Q5RA 3QOUA 1K0MA 1TI3A 2B7JA 1VGLA 4H86A 3D21A 3DVXA 2L57A 2VOCA 1GTUA 3F4RA 3QDNA 3D4TA 5D8IA 5EPFA 2VLTA 1N2AA 1U87A 2BJXA 1SK1A 4MF5A 4G10A 4JR4A 1E2YA 4Q5NA 3QD9A 2NDOA 3A2XA 1MD4A 1WMJA 2DSAA 4OFNA 1ERVA 2FWEA 1PL2A 4WF4A 2YOIA 4YAPA 2C0DA 1EWXA 2H0GA 3H1NA 5H5SA 14GSA 4ZBBA 1Q98A 1U6TA 5ECIB 1BX9A 1SJ6A 1T00A 2HRNA 1K0OA 5EY6A 3BCIA 4IELA 4NV5A 5G1LA 2WDUA 2YANA 4K8MA 2ES7A 1TDIA 1WOUA 2DJ3A 3IPZA 3ME8A 2NVLA 1NM3A 3VPTA 4KDUA 3ZRDA 2F51A 4HQSA 2J9HA 1ABAA 1A0RP 2VLUA 4J2FA 4WBJA 2WGRA 4GF0A 2H1GA 2GQKA 1T4YA 4TR4A 5G5EA 1AQXA 5CNWA 4QL9A 1WWJA 4O32A 5D9XA 3KCMA 1M2BA 3GKMA 3VURA 2M80A 1WPIA 2I9HA 4MP4A 1O85A 3L78A 3DYRA 5ENUA 4GQCA 4ECCA 3GKKA 1M0UA 1AXDA 1FG4A 1SL0B 2GZZA 1LU4A 2HFDA 2WJUA 2DBCA 4L5LA 3LYKA 4JE1A 5IQYA 3A2VA 1OKDA 3HVVA 1ST9A 2YZHA 3L9VA 4WBRD 4HU9A 1JLWA 2H8LA 2X8GA 4L0WA 5IMVA 1TXXA 2HZEA 4HJMA 2I4AA 3F4SA 5C00A 4CDOA 5D9TA 1R4WA 2GZYA 4MPFA 4BWSA 1YQ1A 2HRFA 2H0HA 4AJ7A 3FHKA 4TW5A 5IMFA 2DLXA 5ECRB 1TRUA 1FOVA 5G31A 5KN1A 2CZ3A 2CA8A 4EF0A 4MDCA 1OAZA 3ED3A 4MJCA 4FIWA 1X9MB 3F9UA 5J3RA 5ID2B 5J9BA 3H93A 3F3QA 3ZFBA 4WR5A 3IV4A 3QAVA 3TKRA 1UN2A 1Z6NA 5KEJA 2RLIA 1XW5A 2WB9A 4L0UA 4ML6A 2FWFA 4OCFA 1G6WA 3ZLPA 2HI7A 10GSA 4CHSA 3VWXA 1GSQA 1YF0A 2GSQA 3G7JA 2MMOA 1SYRA 2J23A 1XWKA 1RW1A 2H1BA 1GUHA 18GSA 1S3DA 4LL4B 4D73A 1V58A 4X1UA 2REMA 1NHOA 3WYWA 3PH9A 4G9HA 4N0VA 1K0CA 2K8SA 5HR3A 16GSA 1PX7A 3I6AA 1XWGA 2H71A 4ZB6A 1QK8A 3ZIJA 2GT6A 2HYXA 1SD8A 1TK0B 2C8UA 4IW9A 5IMCA 3G7IA 4KGIA 1GNWA 3TOUA 2QC7A 1XIYA 3IRAA 4NWYA 4K9ZA 2DC5A 2WULA 5A4WA 4PNFA 4PGTA 3WT2A 1DBYA 1ON4A 4MMMA 4ZL8A 4OFTA 5D9WA 3ERWA 4TR0A 3M9KA 2H6YA 4NHZA 4TRXA 3FR9A 1B48A 1ERWA 3RPNA 2CAIA 2X64A 2JACA 1PMTA 1G7EA 1K0AA 3KM6A 2AAWA 1XXUA 4PUFC 3LWAA 4EDZA 3H79A 2GSTA 1G6YA 2LQOA 3F3RA 3SBCA 1TRSA 4POKA 2PN8A 3O6TA 1MDJA 2P5RA 1ZL9A 3M3MA 2OBIA 1YDKA 2XBQA 1EEJA 2DJ1A 2IFQB 3DXBA 2DJ0A 5E59A 1GTIA 1JZRA 1XOBA 4RI6A 2QKEA 1LBKA 2VL3A 4ECIA 3C1RA 4OWYA 4ULXA 1X0RA 1AC1A 1C72A 3NZNA 3US3A 2N5AA 3KTBA 1FO5A 1EOHA 1PKWA 4EVMA 4N11A 1XVQA 2R6KA 5DALA 2V6KA 4HEA2 3L9SA 2YJHA 3TKSA 3HDCA 2GT5A 1UA5A 1TRVA 5CYYA 2VCVA 3C71A 2CX4A 4AJ6A 2FGXA 2VCZA 2C0EA 5KN2A 1JZWA 2B7KA 4EL1A 2YNXA 3ZVJD 2QSIA 2IJYA 4JBBA 1SKWB 2FWGA 5AGYA 1KEBA 3FZAA 1XWBA 4FH8A 4DSRA 1QMVA 1F2EA 2PERA 5D96A 3TJKA 5DCGA 6GSWA 3HJMA 3GX8A 4JRRA 5B8AA 1FB0A 2KUCA 8GSSA 4TN8A 4KA0A 2ZCTA 1NW2A 4KH7A 3QMXA 3P90A 2DIYA 5B7CA 1YKCA 1YEPA 3ZYWA 1ML6A 1ACVA 2JU5A 3BOAA 2PGTA 1VF4A 1SKSB 1HQOA 2CVKA 4KNDA 4K7NA 1ZOFA 1QFNA 1R26A 1I9DA 1O7UA 1GSUA 5F06A 5G5FA 4NMUA 3PINA 3APOA 4LLRA 1M9BA 4PNGA 3UVHA 2WRTA 3L9UA 1PD21 2ON7A 2TRCP 3A2WA 1ZMAA 1U3AA 1X9SB 1PL1A 12GSA 1BAYA 3GSTA 5DJLA 1TK5B 4CW9A 3TOTA 1XVWA 3JCML 3TB2A 2PWJA 2P0GA 2TRXA 4LMVA 4GLTA 4NXIA 2IWTA 3CBUA 1SK0A 3GKXA 5D73A 2AV4A 5DBQA 2YV7A 1S3AA 3I69A 4ZBAA 1UC7A 3M1GA 6GSYA 1TP9A 4ZXGA 4F0BA 3IOSA 2B5XA 3EU3A 3CMIA 4K0GA 3ZVJA 1Z7PA 3RBTA 2YWNA 1DE2A 2C3NA 1B4QA 2FA8A 4ID0A 3BJ5A 4XCSA 4KW6A 4PQ1A 4YQMA 2DJ2A 1AQWA 4IBPA 2MMNA 4O5RA 1M2AA 1OE8A 2E0QA 3MDKA 4FO5A 3KIJA 3DMLA 2RUFA 4GSSA 3MSZA 4QL7A 3FKFA 3CSHA 4E8HA 4DSQA 3F63A 4WKWA 4NHWA 4TXOB 2VO4A 1GH2A 3IK7A 3VWVA 4MJEA 5ID2A 1QGVA 3L4NA 2IPAA 2N5FA 5A5KA 1TOFA 1WIKA 3LQ7A 4XS4A 2JSYA 1GNEA 1M99A 3TJBA 1F3AA 5CRHA 9GSSA 1OC9B 1AAZA 4IN0A 4EE0A 2H75A 4DVCA 2EIOA 5F07A 3HA9A 4I2TA 4O92A 3VWWA 3TKSE 3N9JA 4WR4A 3GRXA 1ZYEA 4ISDA 1YKAA 1V2AA 3HVSA 1FW1A 3V1WA 1FHEA 2I1UA 5ECHB 1EV9A 1ILOA 4WETA 2IL3A 3KMOA 3IXRA 3IE3A 4ZBDA 2Z9SA 3BBYA 4F82A 2GVPA 4XRDA 3Q74A 2F8FA 5B6MA 3GHAA 4KB3A 1DE1A 2C0FA 4I8BA 5KN3A 1EEMA 5DJMA 4K6XA 2M72A 5F0GA 1X9WB 5IM9A 2MBSA 4YAVA 1AUCA 4V1Ap 3LG6A 4PQHA 3QAWA 1GLQA 2CQ9A 3DRNA 1K0NA 4JR6A 5IMAA 2V32A 3E9JB 2VAFA 4AJ8A 1GULA 3GTUB 3KTLA 4TOPA 2RIIA 3LFLA 3DD3A 1PKZA 2HE3A 1PGTA 2FWHA 2NTOA 5KN0A 2R37A 4PQIA 2K8VA 3QAGA 5HFGA 1J0FA 1THXA 3EMPA 3NIVA 1A8LA 1N8JA 1XBSA 2JZRA 5A4VA 3LYPA 2LEGA 5FWGA 5B8BA 1K3OA 2MZCA 3SWLA 1MD3A 2VL2C 2KHPA 1SYXA 1BYEA 2IFQA 2GQLA 4JEDA 2LJRA 4FYCA 3WT1A 3Q6OA 3KH7A 2YWMA 5JWQB 4ML1A 2AUVA 2H1AA 3WGEA 4HZ2A 2WFCA 3RPPA 2FUG2 4ZB8A 3TKQA 3EU4A 2CVDA 2F9SA 2AB6A 4YQVA 3F6DA 1FVKA 3ME7A 3FZ4A 1EGRA 4XS4B 2DMMA 4TR3A 3P2AA 2M46A 5J4UA 4GSTA 3UARA 1Z9HA 3ZMKA 1JLVA 1URMA 3VWUA 4I6XA 4IQ1A 4OO5A 4FYBA 1GUKA 2FA4A 1AIUA 2F8AA 3P7XA 3DWVA 2IMDA 6GSUA 1H4OA 3QFBC 5ABRA 3TJFA 3TDGA 4N0ZA 6GSTA 1YJ6A 2A2SA 1SK2A 3FRCA 4RQRA 4KCAA 3OR5A 3LXZA 4OFMA 3C7MA 1ERUA 4X0XA 2XPDA 3TKPA 4HJ2A 1WE0A 2GLRA 1YEXA 5IMZA 2I81A 1A2JA 1T7PB 2VM1A 4PURA 3GV1A 1A2MA 1W89A 5ECKB 2GSSA 1TJDA 3MWHA 3EURA 4BL7A 1B9YC 1PRXA 2H72A 2JL4A 2L5LA 4GSNA 3M8NA 5LCZA 1KTEA 3GN3A 3GSSA 1Y6EA 4XTSA 2AJQB 2BMXA 2PBJA 3W6GA 3EVIA 5G2ZA 3GX0A 1OYJA 2FNOA 4G2EA 3CXGA 1G7OA 2LKUA 4I2UA 2LRNA 5G30A 1Z7RA 2LNSA 4PUAA 2CAQA 4OCEA 3DKSA 3W8JA 4GCIA 3HXSA 1VRSD 4FYUA 1XFLA 4YQUA 5H5RA 2L6CA 4IP1A 1F37A 5ELAA 3HHVA 1GTAA 2CZ2A 2X8HA 2L4CA 2O87A 5DQSA 3RAZA 3HJOA 2O8VB 4LA1A 3IHQA 3TRPA 2H73A 5HFIA 3D0ZA 4AF2A 4MLYA 1GSDA 1XOAA 2G0FA 1HNAA 2KP2A 3LEFA 1O81A 4Q5QA 2C3QA 4XIHA 4HOJA 5IOXA 2XPEA 4BVXA 2PPTA 3U6VA 3ZTLA 2ALBA 4QQ7A 3UMAA 3VI7A 1NSWA 3KP8A 2LRTA 3WGDA 4X43A 3IA1A 5ELGA 5AISA 4ZL7A 2H1DA 1GLPA 5GSSA 4NAXA 1EGOA 1GP1A 2AHEA 4TXOA 2R3XA 2CX3A 4XHMA 5GZZB 3TRXA 4DSSB 3UOMA 3FYGA 4ECJA 4TR1B 1DUGA 4GTUA 3HYPA 4GRFA 2CV4A 3D22A 2LJAA 4KX4A 4F0CA 2A2RA 1OC9A 4WEYA 2K18A 5LD0A 5J9CA 3HZ8A 1MDKA 3GURA 4KCEA 3I43A 2WS2A 4RQXA 1NHYA 3UVTA 5HFKA 5DDLA 5HR1A 2LNTA 3DEXA 3GFKA 2D2ZA 4P3YB 1V40A 3GIXA 1YZXA 3ISOA 1R7HA 20GSA 3D6IA 2O7KA 1GSYA 6GSXA 5JWRB 1EP8A 2HLSA 3ERGA 3UBLA 1K3YA 5GAND 3IK9A 4K7IA 2YWIA 4HU7A 2VM2A 4HZ4A 4BWQA 5HR0A 4F9ZA 5AIXA 3UBKA 6GSVA 1SJIA 4GQFA 1R5PA 1XPVA 1CQHA 2YWOA 1SJZA 1A8YA 3APQA 5IMDA 1Y25A 1T4ZA 1G0TA 4IJ3A 2OBKA 2GS3A 3GTUA 3KZQA 4WF5A 3TUEA 3IAM2 5ECLB 6GSSA 2OJLA 2P31A 2X99A 2GDRA 3DGQA 3GUSA 3GYKA 22GSA 2ZUPA 2EIQA 3CTFA 2KP1A 2NPBA 4MJBA 3APSA 2DMLA 2R2JA 2H19A 3O3TA 2DJJA 3ZFLA 1O73A 2VL2A 2YCDA 1A0FA 4BVYA 1GSFA 3GNJA 1VF1A 3KH9A 2RM6A 1RQMA 2I3YA 1Z6MA 2B3SA 4Z7XA 3EWLA 3GL3A 2V41A 2OE3A 4MK3A 3CSIA 5EVOA 3KD0A 5C04A 1XW9A 3LGCA 1OE7A 5DAKB 3Q18A 1RK4A 2R5GA 3RDWA 5IO2A 3AY8A 3GMFA 4IHUA 2MYGA 3TJJA 2O85A 3LJRA 4L8EA 3ZL5A 2OE0A 1KNGA 2LTKA 1U3IA 4RUVA 4OD7A 3W8SA 2PMTA 3VK9A 2L4QA 1SU9A 2PUKC 4XRAA 2GZPA 4ZL9A 3TRQA 1Z3EA 3J7Yk 3RHCA 4XS6A 17GSA 5IIZA 3UIWA 3D5JA 3C1SA 4I5QA 4KSMA 3FR3A 1OKTA 2XC2A 3ZZXA 2L5OA 5CO3A 3HY2A 2ON5A 2FY6A 3FEUA 2VCTA 1E6BA 3GA4A 1SL1B 2HSYA 4N10A 2LSTA 2JZSA 4MA9A 4IP6A 4O7HA 3HD5A 1K3LA 2C0GA 3QR6A 2X8CA 4E8EA 2C4JA 1EV4A 4ECBA 3D4MA 5DCHA 2NBSA 3LXTA 3PR8A 13GSA 4NV2A 2JZTA 4EC0A 2JADA 3E3EA 2LS5A 1DSBA 1S3CA 5E4WA 1OC8A 3ZITA 4L5OA 2MMAA 1FB6A 2V6OA 1M7TA 4BA7A 19GSA 2H30A 2B5YA 4IQAA 2IMEA 1T8EB 2HNLA 1JZDA 4HI7A 3HCZA 4EDYA 5ECNB 1B8XA 3KXOA 3CTGA 1M2DA 2JSZA 5L71A 4J56E 3L0HA 2R4VA 1Q4JA 3IC4A 1WRYA 1PA3A 3VPQA 3MAKA 1U88A 4MZBA 2H6XA 5CAXA 1ZZYA 4KE3A 3F0IA 3HZ4A 1A24A 1M9AA 1TW9A 2B5EA 4BPYA 4EUYA 1LJRA 1EZKA 1TRWA 3KEBA 1XWAA 2A4VA 2OADA 1K0BA 5CRWA 4IVFA 2YV9A 3F6FA 3H4KA 3G7YA 1FVJA 1O6JA 2IMFA 2G2QA 2E7PA 3F4TA 3GKNA 5D9VA 5DQYA 4JZQA 3QPMA 3J7Yb 1A2LA 3UL3A 3HVXA 1KBNA 2P5QA 2VD1A 2PU9C 3Q19A 3VFIA 1JFUA 2IIYA 4POBA 1V57A 3G9BA 3FW2A 4MJAA 4MABA 4F03A 2VUPA 4EXJA 3NOFA 5JCWA 3M0FA 3S9FA 2B1LA 2VCXA 3PGTA 2FD3A 1H75A 1T1VA 3QFAC 4HDEA 2OKAA 2BTOT 5IOWA 2C80A 5AN1A 3UJ1A 1QQ2A 2GGTA 4KDXA 4ILFA 4DSSA 3C8EA 1XZOA 4K2DA 4TR1A 3KP9A 2YZUA 3HKRA 1V9WA 1TU7A 1F3BA 2HSHA 1GUMA 1X5CA 3LSZA 1HD2A 1VF3A 1AW9A 1IYIA 1GRXA 1O8XA 2E2GA 1K0DA 2RM5A 2KLXA 5JCGA 5B6NA 2MMZA 2PVQA 4OMVA 2YP6A 4TVEA 1F9MA 1PSQA 2FHEA 2XBIA 1F6MC 2LQQA 3WD6A 3GH9A 3EYTA 5HR2A 4NPBA 2LRCA 2RUEA 2YN1A 1TTZA 5FT3A 4WXTA 1MTCA 1FAAA 3KJYA 1XWCA 2C3TA 4MH3A 1EP7A 2WCIA 5A4UA 2V2GA 4V2LA 1ZYQB 1AQVA 2KOKA 2B6MA 5CP1A 3K8NA 1J08A 3GL5A 3DIEA 2VL9A 2LV3A 4MCUA 4YH2A 5CRGA 4J57E 7GSSA 1YY7A 4MPGA 2HXKA 5JWOB 3FK8A 3TCOA 2H6ZA 5ECOB 2DJKA 3I9V2 1X5EA 4ACSA 3H8QA 3IBHA 5LNKe 1W4VA 5CRDA 5INYA 4HQZA 4JU5A 1JZOA 4MF6A 5F8BA 4ZB9A 2OACA 2HZEB 3O76A 4V2NA 2DIZA 2E2MA 5EL8A 2LJKA 3EINA 3HJPA 3ZREA 5GSTA 2C1YA 2V1MA 1PX6A 3TGZA 1R5AA 5J41A 2EIRA 4K0NA 2VCQA 3CSJA 4DEJA 4IS0A 1TKDB 4EKZA 4PX1A 2YPMA 2F3MA 4KDYA 1CQGA 1BJXA 2AYTA 5G1KA 5ECMB 2H01A 4EO3A 1T3BA 2TIRA 1B9XC 1GL8A 5DAKA 3FR6A 3CRTA 3E0UA 2K6VA 2LUSA 3EC3A 2MBTA 5DVBA 2H66A 1JHBA 2HZFA 1THOA 3KGKA 3BD2A 3F8UA 4POMA 3C73A 3RHBA 1BEDA 3IAS2 4I97A 3FZ5A 3UEMA 4G19A 1ZGNA 3R2QA 4AGSA 4IGJA 4D73B 2H76A 2OE1A 2CT6A 1IYHA 4GWRA 3DVWA 2H70A 3ZMLA 1WJKA 1XCCA 1OVNA 2B1KA 2WZ9A 1PN9A 5AIVA 2OA7A 1O8WA 1UVZA 3CRUA 4TXVA 1ERTA 5CREA 2GSRA 3LORA 5IPGA 11GSA 4RI7A 1USBA 5IO0A 2L59A 1J9BA 1SKRB 1Z5YE 5H5QA 3BCKA 2IMIA 2H74A 4HS1A 4TKYA
chains in the Genus database with same CATH superfamily
1EOGA 5J5NA 2VCWA 2ZNMA 1QUWA 2EC4A 2O89A 4LL1B 1GSSA 1SL2B 4KAEA 5ECSA 5F05A 4USSA 2IMKA 1OC3A 1HYUA 1B4PA 3U5RE 3UAPA 1V98A 2QGVA 4N30A 3VI5A 1A23A 2K9FA 3P8WA 3M9JA 3EPTA 3EE2A 4MZCA 2H0IA 5ECQB 2FCHA 1QXHA 3FY7A 1YF1A 2VIMA 4KSOA 2IN3A 4HUAA 3IR4A 5IPHA 4POLA 3N5OA 4Q5FA 2XHFA 2VLVA 4F2IA 1I5GA 4XS1A 4V1Ag 1BG5A 5HQPA 3EMXA 2YJ7A 5JCUA 2L6DA 3ERFA 1PQNA 3VLNA 2GTUA 1XW6A 3ZIVA 1HNBA 3TJGA 1BQ7A 3A3TA 4OO4A 2VD0A 3CYNA 1X5DA 2PVOC 4IKHA 4V2MA 1WP0A 3A5WA 2FLSA 4MF7A 3QCPA 1ZCPA 5FHIA 3FZ9A 4LMWA 2N5BA 3MNGA 3KMNA 2GQMA 1VF2A 4PXOA 5DALB 1TI1A 1TU8A 1HNCA 4K1FA 5COHA 1MDIA 2HT9A 4ZIJA 1GTBA 4KUNA 2CVBA 4MZWA 5D93A 1MEKA 5GAPD 5ECPB 1GSEA 3WGXA 1GWCA 4IJIA 3IDVA 4ZILA 1SENA 4K7OA 4MH2A 3TKSC 1TK8B 3GH6A 2QA2A 4GXZA 1SD9A 4Q5RA 3QOUA 1K0MA 1TI3A 2B7JA 1VGLA 4H86A 3D21A 3DVXA 2L57A 2VOCA 1GTUA 4O5UA 3F4RA 3QDNA 3D4TA 5D8IA 5EPFA 2VLTA 1N2AA 1U87A 2BJXA 1SK1A 4MF5A 4G10A 4JR4A 1E2YA 4Q5NA 3QD9A 2NDOA 3A2XA 1MD4A 1WMJA 2DSAA 4OFNA 1ERVA 2FWEA 1PL2A 4FQUA 4WF4A 2YOIA 4YAPA 2C0DA 1EWXA 2H0GA 3H1NA 5H5SA 14GSA 4ZBBA 1Q98A 1U6TA 5ECIB 1BX9A 1SJ6A 1PN0A 1T00A 2HRNA 1K0OA 5EY6A 3BCIA 4IELA 4NV5A 5G1LA 2WDUA 2YANA 4K8MA 2ES7A 1TDIA 1WOUA 2DJ3A 3IPZA 3ME8A 2NVLA 1NM3A 3VPTA 4KDUA 3ZRDA 1PFOA 2F51A 4HQSA 2J9HA 1ABAA 1A0RP 2VLUA 4J2FA 4WBJA 4G0KA 4CY6A 2WGRA 4GF0A 2H1GA 2GQKA 1T4YA 4TR4A 5G5EA 1AQXA 5CNWA 4QL9A 1WWJA 4O32A 5D9XA 3KCMA 1M2BA 3GKMA 3VURA 2M80A 1WPIA 2I9HA 4MNNA 4MP4A 1O85A 3L78A 3DYRA 5ENUA 4GQCA 4ECCA 3GKKA 1M0UA 1AXDA 1FG4A 1SL0B 2GZZA 1LU4A 2HFDA 2WJUA 2DBCA 4L5LA 3LYKA 4JE1A 5IQYA 3A2VA 1OKDA 3HVVA 1ST9A 2YZHA 3L9VA 4WBRD 4HU9A 1JLWA 2H8LA 2X8GA 4L0WA 5IMVA 1TXXA 2HZEA 4HJMA 2I4AA 3F4SA 5C00A 4CDOA 5D9TA 1R4WA 2GZYA 4MPFA 4BWSA 1YQ1A 2HRFA 2H0HA 4AJ7A 3FHKA 4TW5A 5IMFA 2DLXA 5ECRB 1TRUA 1FOVA 5G31A 5KN1A 2CZ3A 2CA8A 4EF0A 4MDCA 1OAZA 3ED3A 4MJCA 4FIWA 1X9MB 3F9UA 5J3RA 5ID2B 5J9BA 2QA1A 3H93A 3F3QA 3ZFBA 4WR5A 3IV4A 3QAVA 3TKRA 1UN2A 1Z6NA 5KEJA 2RLIA 1XW5A 2WB9A 4L0UA 4ML6A 2FWFA 4OCFA 1G6WA 3ZLPA 2HI7A 10GSA 4CHSA 3VWXA 1GSQA 2X4AA 1YF0A 2GSQA 3G7JA 2MMOA 1SYRA 2J23A 1XWKA 1RW1A 2H1BA 1GUHA 18GSA 1S3DA 4LL4B 4D73A 1V58A 4X1UA 2REMA 1NHOA 3WYWA 3PH9A 4G9HA 4N0VA 1K0CA 2K8SA 5KOXA 5HR3A 16GSA 1PX7A 3I6AA 1XWGA 2H71A 2DKIA 4ZB6A 1QK8A 3ZIJA 2GT6A 4EIQA 2HYXA 1SD8A 1TK0B 2C8UA 4IW9A 5IMCA 3G7IA 4KGIA 1GNWA 3TOUA 2QC7A 1XIYA 3IRAA 4NWYA 4K9ZA 2DC5A 2WULA 5A4WA 4PNFA 4PGTA 3WT2A 1DBYA 1ON4A 4MMMA 4ZL8A 4OFTA 5D9WA 4EIPA 3ERWA 4TR0A 3M9KA 2H6YA 4NHZA 4TRXA 3FR9A 1B48A 1ERWA 3RPNA 2CAIA 2X64A 2JACA 1PMTA 1G7EA 1K0AA 3KM6A 2AAWA 3R3EA 1XXUA 4PUFC 3LWAA 4EDZA 3H79A 2GSTA 1G6YA 2LQOA 3F3RA 3SBCA 1TRSA 4POKA 2PN8A 3O6TA 1MDJA 2P5RA 1ZL9A 3M3MA 2OBIA 1YDKA 2XBQA 1EEJA 2DJ1A 2IFQB 3DXBA 2DJ0A 5E59A 1GTIA 1JZRA 1XOBA 4RI6A 2QKEA 1LBKA 2VL3A 4ECIA 3C1RA 4OWYA 4ULXA 1X0RA 1AC1A 1C72A 3NZNA 3US3A 2N5AA 3KTBA 1FO5A 1EOHA 1PKWA 4EVMA 4N11A 1XVQA 2R6KA 5DALA 2V6KA 4HEA2 3L9SA 2YJHA 3TKSA 3HDCA 2GT5A 1UA5A 1TRVA 3MIXA 5CYYA 2VCVA 3C71A 2CX4A 4AJ6A 2FGXA 2VCZA 3A5IA 2C0EA 5KN2A 1JZWA 2B7KA 4EL1A 2YNXA 3ZVJD 2QSIA 2IJYA 4JBBA 1SKWB 2FWGA 5AGYA 1KEBA 3FZAA 1XWBA 4FH8A 4DSRA 1QMVA 1F2EA 2PERA 5D96A 3TJKA 5DCGA 6GSWA 3HJMA 3GX8A 4JRRA 5B8AA 1FB0A 2KUCA 8GSSA 4TN8A 4KA0A 2ZCTA 1NW2A 4KH7A 3QMXA 3P90A 2DIYA 5B7CA 1YKCA 1YEPA 3ZYWA 1ML6A 1ACVA 2JU5A 3BOAA 2PGTA 1VF4A 1SKSB 1HQOA 2HSMA 2CVKA 4KNDA 4K7NA 4BL7B 1ZOFA 1QFNA 3HVNA 1FOHA 1I9DA 1O7UA 1R26A 1GSUA 5F06A 5G5FA 4NMUA 3PINA 3APOA 4LLRA 1M9BA 4PNGA 3UVHA 2WRTA 3L9UA 1PD21 2ON7A 2TRCP 3A2WA 1ZMAA 1U3AA 1X9SB 1PL1A 5KOWA 12GSA 1BAYA 3GSTA 5DJLA 1TK5B 4CW9A 3TOTA 1XVWA 3JCML 3TB2A 2PWJA 2P0GA 2TRXA 4LMVA 4GLTA 4NXIA 2IWTA 3CBUA 1SK0A 3GKXA 5D73A 2AV4A 5DBQA 2YV7A 1S3AA 3I69A 4ZBAA 1UC7A 3M1GA 6GSYA 1TP9A 4ZXGA 4F0BA 3IOSA 2B5XA 3EU3A 3CMIA 4K0GA 3ZVJA 1Z7PA 3RBTA 2YWNA 1DE2A 2C3NA 1B4QA 2FA8A 4ID0A 3BJ5A 4XCSA 4KW6A 4PQ1A 4YQMA 3PPUA 2DJ2A 1AQWA 4IBPA 2MMNA 4O5RA 4BVXB 1M2AA 1OE8A 2E0QA 3MDKA 4FO5A 3KIJA 3DMLA 2RUFA 4GSSA 3MSZA 4QL7A 3FKFA 3CSHA 4E8HA 4DSQA 3F63A 4WKWA 4NHWA 4TXOB 2VO4A 1GH2A 3IK7A 3VWVA 4MJEA 5ID2A 1QGVA 3L4NA 2IPAA 2N5FA 5A5KA 1TOFA 1WIKA 3LQ7A 4XS4A 2JSYA 1GNEA 1M99A 3TJBA 1F3AA 4K5RA 5CRHA 9GSSA 4BIKA 1OC9B 1AAZA 4IN0A 4EE0A 2H75A 4DVCA 1ZYNA 2EIOA 5F07A 3HA9A 4I2TA 4O92A 3VWWA 3TKSE 3N9JA 4WR4A 3GRXA 1ZYEA 4ISDA 1YKAA 1V2AA 3HVSA 1FW1A 3V1WA 1FHEA 2I1UA 5ECHB 1EV9A 1ILOA 4WETA 2IL3A 3KMOA 3IXRA 3IE3A 4ZBDA 2Z9SA 3BBYA 1M3JA 4F82A 2GVPA 4XRDA 3Q74A 2F8FA 5B6MA 3GHAA 4KB3A 1DE1A 2C0FA 4I8BA 5KN3A 1EEMA 5DJMA 2A2PA 4K6XA 2M72A 5F0GA 1X9WB 5IM9A 2MBSA 4YAVA 1AUCA 4V1Ap 3LG6A 4PQHA 3QAWA 1GLQA 2CQ9A 3DRNA 1K0NA 4JR6A 5IMAA 2V32A 3E9JB 4A5PA 2VAFA 4AJ8A 1GULA 3GTUB 3KTLA 4TOPA 2RIIA 3LFLA 3DD3A 1PKZA 2HE3A 1PGTA 3IC8A 2FWHA 2NTOA 5KN0A 2R37A 4PQIA 2K8VA 3QAGA 5HFGA 1J0FA 1THXA 3EMPA 3NIVA 1A8LA 1N8JA 1XBSA 2JZRA 5A4VA 3LYPA 2LEGA 5FWGA 5B8BA 4BVYB 1K3OA 2MZCA 3SWLA 1MD3A 2VL2C 2KHPA 1SYXA 1BYEA 2IFQA 2GQLA 3LW9A 4Z2TA 4JEDA 2LJRA 4FYCA 3WT1A 3Q6OA 3KH7A 2YWMA 5JWQB 4ML1A 2AUVA 2H1AA 3WGEA 4HZ2A 4X4JA 2WFCA 3RPPA 2FUG2 4ZB8A 3TKQA 3EU4A 1XG8A 2CVDA 2F9SA 2AB6A 4YQVA 3F6DA 1FVKA 3ME7A 3FZ4A 1EGRA 4XS4B 2DMMA 4TR3A 3P2AA 2M46A 5J4UA 4GSTA 3UARA 1Z9HA 3ZMKA 1JLVA 1URMA 3VWUA 4I6XA 4IQ1A 4OO5A 4FYBA 4K5SA 1GUKA 2FA4A 1AIUA 2F8AA 3P7XA 3DWVA 2IMDA 4CY8A 1H4OA 6GSUA 3QFBC 5ABRA 3TJFA 3TDGA 4N0ZA 6GSTA 1YJ6A 2A2SA 1SK2A 3FRCA 4RQRA 4KCAA 2R0GA 3OR5A 3LXZA 4OFMA 3C7MA 1ERUA 4X0XA 2XPDA 3TKPA 4HJ2A 1WE0A 2GLRA 1YEXA 5IMZA 2I81A 1A2JA 1T7PB 2VM1A 4PURA 3GV1A 1A2MA 1W89A 5ECKB 2GSSA 1TJDA 3MWHA 3EURA 4BL7A 1B9YC 1PRXA 2H72A 2JL4A 2L5LA 4GSNA 3M8NA 5LCZA 1KTEA 3GN3A 3GSSA 1Y6EA 4XTSA 2AJQB 2BMXA 2PBJA 3W6GA 3EVIA 5G2ZA 3GX0A 1OYJA 2FNOA 4G2EA 3CXGA 1G7OA 2LKUA 4I2UA 2LRNA 5G30A 1Z7RA 2LNSA 4PUAA 2CAQA 4OCEA 3DKSA 3W8JA 4GCIA 3HXSA 1VRSD 4FYUA 1XFLA 4YQUA 5H5RA 2L6CA 4IP1A 1F37A 5ELAA 3HHVA 1GTAA 2CZ2A 2X8HA 2L4CA 3IHGA 2O87A 5DQSA 3RAZA 3HJOA 2O8VB 3MYDA 4LA1A 3IHQA 3TRPA 2H73A 5HFIA 3D0ZA 4AF2A 4MLYA 1GSDA 1XOAA 2G0FA 1HNAA 2KP2A 3LEFA 1O81A 4Q5QA 2C3QA 4XIHA 4HOJA 5IOXA 2XPEA 4BVXA 2PPTA 3U6VA 3ZTLA 2ALBA 4QQ7A 3UMAA 3VI7A 1NSWA 3KP8A 2LRTA 3WGDA 4X43A 3IA1A 5ELGA 5AISA 4ZL7A 2H1DA 1GLPA 5GSSA 4NAXA 1EGOA 1GP1A 2AHEA 4TXOA 2R3XA 2CX3A 4XHMA 5GZZB 3TRXA 4DSSB 3UOMA 3FYGA 4ECJA 4TR1B 1DUGA 4GTUA 3HYPA 4GRFA 2CV4A 3D22A 2LJAA 4KX4A 4F0CA 2A2RA 1OC9A 4WEYA 2K18A 5LD0A 5J9CA 3HZ8A 1MDKA 3GURA 4KCEA 3I43A 2WS2A 4RQXA 1NHYA 3UVTA 5HFKA 5DDLA 5HR1A 2LNTA 3DEXA 3GFKA 2D2ZA 4P3YB 1V40A 3GIXA 1YZXA 3ISOA 1R7HA 4YKGA 1S3RA 20GSA 3D6IA 2O7KA 1GSYA 6GSXA 4G0LA 5JWRB 1EP8A 2HLSA 3ERGA 3UBLA 1K3YA 5GAND 3IK9A 4K7IA 2YWIA 4HU7A 2VM2A 4HZ4A 4BWQA 5HR0A 4F9ZA 5AIXA 3UBKA 6GSVA 1SJIA 4GQFA 1R5PA 1XPVA 1CQHA 2YWOA 1SJZA 1A8YA 3APQA 5IMDA 1Y25A 1T4ZA 1G0TA 4IJ3A 2HRAA 2OBKA 2GS3A 3GTUA 3KZQA 4WF5A 3TUEA 3IAM2 5ECLB 6GSSA 2OJLA 2P31A 2X99A 2GDRA 3DGQA 3GUSA 3GYKA 22GSA 2ZUPA 2EIQA 3CTFA 2KP1A 2NPBA 4MJBA 3APSA 2DMLA 2R2JA 2H19A 3O3TA 2DJJA 3ZFLA 1O73A 2VL2A 4PTSA 2YCDA 1A0FA 4BVYA 1GSFA 3GNJA 1VF1A 3KH9A 2RM6A 1RQMA 2I3YA 2R0CA 1Z6MA 2B3SA 4Z7XA 3EWLA 3GL3A 4Z2RA 3FMWA 2V41A 2OE3A 4MK3A 3CSIA 5EVOA 2HRKA 3KD0A 5C04A 1XW9A 3LGCA 1OE7A 5DAKB 3Q18A 1RK4A 2R5GA 3RDWA 5IO2A 3AY8A 3GMFA 4IHUA 2MYGA 3TJJA 2O85A 5BRTA 3LJRA 4L8EA 3ZL5A 2OE0A 1KNGA 2LTKA 1U3IA 4RUVA 4OD7A 3W8SA 2PMTA 3VK9A 2L4QA 1SU9A 2PUKC 4XRAA 2GZPA 4ZL9A 3TRQA 1Z3EA 3J7Yk 3RHCA 4XS6A 17GSA 5IIZA 2DKHA 3UIWA 3D5JA 3C1SA 4I5QA 4KSMA 3FR3A 1OKTA 2XC2A 3ZZXA 2L5OA 5CO3A 1M3IA 3HY2A 2ON5A 2FY6A 3FEUA 2VCTA 1E6BA 3GA4A 1SL1B 2HSYA 4N10A 2LSTA 2JZSA 4MA9A 4IP6A 4O7HA 3HD5A 1K3LA 2C0GA 3QR6A 2X8CA 4E8EA 2C4JA 1EV4A 4KF9A 4ECBA 3D4MA 5DCHA 2NBSA 3LXTA 3PR8A 13GSA 4NV2A 2JZTA 4EC0A 2JADA 3E3EA 2LS5A 1DSBA 4Z2UA 1S3CA 5E4WA 1OC8A 3ZITA 1ZYPA 4L5OA 2MMAA 1FB6A 2V6OA 1M7TA 4BA7A 19GSA 2H30A 2B5YA 4IQAA 2A4HA 2IMEA 1T8EB 2HNLA 1JZDA 4HI7A 3HCZA 4EDYA 5ECNB 1B8XA 3KXOA 3CTGA 1M2DA 2JSZA 5L71A 4J56E 3L0HA 2R4VA 1Q4JA 3IC4A 1WRYA 1PA3A 3VPQA 3MAKA 1U88A 4MZBA 2H6XA 5CAXA 1ZZYA 4KE3A 3F0IA 3HZ4A 1A24A 1M9AA 1TW9A 2B5EA 4BPYA 4EUYA 1LJRA 1EZKA 1TRWA 3KEBA 1XWAA 2A4VA 2OADA 1K0BA 5CRWA 4IVFA 2YV9A 3F6FA 4O5QA 3H4KA 3G7YA 1FVJA 1O6JA 2IMFA 2G2QA 2E7PA 3F4TA 3GKNA 5D9VA 5DQYA 4JZQA 3QPMA 3J7Yb 1A2LA 3UL3A 3HVXA 1KBNA 2P5QA 2VD1A 2PU9C 3Q19A 3VFIA 1JFUA 2IIYA 4POBA 1V57A 3G9BA 3FW2A 4MJAA 4MABA 4F03A 2VUPA 4EXJA 3NOFA 5JCWA 3M0FA 3S9FA 2B1LA 2VCXA 3PGTA 2FD3A 1H75A 1T1VA 3QFAC 4HDEA 2OKAA 2BTOT 5IOWA 2C80A 5AN1A 3UJ1A 1QQ2A 2GGTA 4KDXA 4ILFA 4DSSA 3C8EA 1XZOA 4K2DA 4TR1A 3KP9A 2YZUA 3HKRA 1V9WA 1TU7A 1F3BA 2HSHA 1GUMA 1X5CA 3LSZA 1HD2A 1VF3A 1AW9A 1IYIA 1GRXA 1O8XA 2E2GA 1K0DA 2RM5A 2KLXA 5JCGA 5B6NA 2MMZA 2PVQA 4OMVA 2YP6A 4TVEA 1F9MA 1PSQA 2FHEA 2XBIA 1F6MC 2LQQA 3WD6A 3GH9A 3EYTA 5HR2A 4NPBA 2LRCA 2RUEA 2YN1A 1TTZA 5FT3A 4WXTA 1MTCA 1FAAA 3KJYA 1XWCA 2C3TA 4MH3A 1EP7A 2WCIA 5A4UA 2V2GA 4V2LA 4K2XA 1ZYQB 1AQVA 2KOKA 2B6MA 5CP1A 3K8NA 1J08A 3GL5A 3DIEA 2UZ8A 2VL9A 2LV3A 4MCUA 4YH2A 5CRGA 4J57E 7GSSA 1YY7A 4MPGA 2HXKA 5JWOB 3FK8A 3TCOA 2H6ZA 5ECOB 2DJKA 3I9V2 1X5EA 4ACSA 3H8QA 3IBHA 5LNKe 1W4VA 5CRDA 5INYA 4HQZA 4JU5A 1JZOA 4MF6A 5F8BA 4ZB9A 2OACA 2HZEB 3O76A 4V2NA 2DIZA 2E2MA 4ICYA 5EL8A 2LJKA 3EINA 3HJPA 3ZREA 5GSTA 2C1YA 2V1MA 1PX6A 3TGZA 1R5AA 5J41A 2EIRA 4K0NA 2VCQA 3CSJA 4DEJA 4IS0A 1TKDB 4EKZA 4PX1A 2YPMA 2F3MA 4KDYA 1CQGA 1BJXA 2AYTA 5G1KA 5ECMB 2H01A 4EO3A 1T3BA 2TIRA 1B9XC 1GL8A 5DAKA 3FR6A 3CRTA 3E0UA 2K6VA 2LUSA 3EC3A 2MBTA 5DVBA 2H66A 1JHBA 2HZFA 1THOA 3KGKA 3BD2A 3CQFA 3F8UA 2X49A 4G0IA 4POMA 3C73A 3RHBA 1BEDA 3IAS2 4I97A 3FZ5A 3UEMA 4G19A 1ZGNA 3R2QA 4AGSA 4IGJA 4YKFA 4D73B 2H76A 2OE1A 2CT6A 1IYHA 4GWRA 3DVWA 2H70A 3ZMLA 2R0PA 1WJKA 1XCCA 1OVNA 2B1KA 4HSCX 2WZ9A 1PN9A 5AIVA 2OA7A 1O8WA 1UVZA 3CRUA 4TXVA 1ERTA 5CREA 2GSRA 3LORA 5IPGA 11GSA 4RI7A 5BMUA 1USBA 5IO0A 2L59A 1J9BA 1SKRB 1Z5YE 5H5QA 3BCKA 2IMIA 2H74A 4HS1A 4TKYA
chains in the Genus database with same CATH topology
1EOGA 5J5NA 2VCWA 2ZNMA 1QUWA 2EC4A 2O89A 4LL1B 1GSSA 1SL2B 4KAEA 5ECSA 5F05A 4USSA 2IMKA 1OC3A 1HYUA 1B4PA 3U5RE 3UAPA 1V98A 2QGVA 4N30A 3VI5A 1A23A 2K9FA 3P8WA 3M9JA 3EPTA 3EE2A 4MZCA 2H0IA 5ECQB 2FCHA 1QXHA 3FY7A 1YF1A 2VIMA 4KSOA 2IN3A 4HUAA 3IR4A 5IPHA 4POLA 3N5OA 4Q5FA 2XHFA 2VLVA 4F2IA 1I5GA 4XS1A 4V1Ag 1BG5A 5HQPA 3EMXA 2YJ7A 5JCUA 2L6DA 3ERFA 1PQNA 3VLNA 2GTUA 1XW6A 3ZIVA 1HNBA 3TJGA 1BQ7A 3A3TA 4OO4A 2VD0A 3CYNA 1X5DA 2PVOC 4IKHA 4V2MA 1WP0A 3A5WA 2FLSA 4MF7A 3QCPA 1ZCPA 5FHIA 3FZ9A 4LMWA 2N5BA 3MNGA 3KMNA 2GQMA 1VF2A 4PXOA 5DALB 1TI1A 1TU8A 1HNCA 4K1FA 5COHA 1MDIA 2HT9A 4ZIJA 1GTBA 4KUNA 2CVBA 4MZWA 5D93A 1MEKA 5GAPD 5ECPB 1GSEA 3WGXA 1GWCA 4IJIA 3IDVA 4ZILA 1SENA 4K7OA 4MH2A 3TKSC 1TK8B 3GH6A 2QA2A 4GXZA 1SD9A 4Q5RA 3QOUA 1K0MA 1TI3A 2B7JA 1VGLA 4H86A 3D21A 3DVXA 2L57A 2VOCA 1GTUA 4O5UA 3F4RA 3QDNA 3D4TA 5D8IA 5EPFA 2VLTA 1N2AA 1U87A 2BJXA 1SK1A 4MF5A 4G10A 4JR4A 1E2YA 4Q5NA 3QD9A 2NDOA 3A2XA 1MD4A 1WMJA 2DSAA 4OFNA 1ERVA 2FWEA 1PL2A 4FQUA 4WF4A 2YOIA 4YAPA 2C0DA 1EWXA 2H0GA 3H1NA 5H5SA 14GSA 4ZBBA 1Q98A 1U6TA 5ECIB 1BX9A 1SJ6A 1PN0A 1T00A 2HRNA 1K0OA 5EY6A 3BCIA 4IELA 4NV5A 5G1LA 2WDUA 2YANA 4K8MA 2ES7A 1TDIA 1WOUA 2DJ3A 3IPZA 3ME8A 2NVLA 1NM3A 3VPTA 4KDUA 3ZRDA 2F51A 4HQSA 2J9HA 1ABAA 1A0RP 2VLUA 4J2FA 4WBJA 4G0KA 4CY6A 2WGRA 4GF0A 2H1GA 2GQKA 1T4YA 4TR4A 5G5EA 1AQXA 5CNWA 4QL9A 1WWJA 4O32A 5D9XA 3KCMA 1M2BA 3GKMA 3VURA 2M80A 1WPIA 2I9HA 4MNNA 4MP4A 1O85A 3L78A 3DYRA 5ENUA 4GQCA 4ECCA 3GKKA 1M0UA 1AXDA 1FG4A 1SL0B 2GZZA 1LU4A 2HFDA 2WJUA 2DBCA 4L5LA 3LYKA 4JE1A 5IQYA 3A2VA 1OKDA 3HVVA 1ST9A 2YZHA 3L9VA 4WBRD 4HU9A 1JLWA 2H8LA 2X8GA 4L0WA 5IMVA 1TXXA 2HZEA 4HJMA 2I4AA 3F4SA 5C00A 4CDOA 5D9TA 1R4WA 2GZYA 4MPFA 4BWSA 1YQ1A 2HRFA 2H0HA 4AJ7A 3FHKA 4TW5A 5IMFA 2DLXA 5ECRB 1TRUA 1FOVA 5G31A 5KN1A 2CZ3A 2CA8A 4EF0A 4MDCA 1OAZA 3ED3A 4MJCA 4FIWA 1X9MB 3F9UA 5J3RA 5ID2B 5J9BA 2QA1A 3H93A 3F3QA 3ZFBA 4WR5A 3IV4A 3QAVA 3TKRA 1UN2A 1Z6NA 5KEJA 2RLIA 1XW5A 2WB9A 4L0UA 4ML6A 2FWFA 4OCFA 1G6WA 3ZLPA 2HI7A 10GSA 4CHSA 3VWXA 1GSQA 2X4AA 1YF0A 2GSQA 3G7JA 2MMOA 1SYRA 2J23A 1XWKA 1RW1A 2H1BA 1GUHA 18GSA 1S3DA 4LL4B 4D73A 1V58A 4X1UA 2REMA 1NHOA 3WYWA 3PH9A 4G9HA 4N0VA 1K0CA 2K8SA 5KOXA 5HR3A 16GSA 1PX7A 3I6AA 1XWGA 2H71A 2DKIA 4ZB6A 1QK8A 3ZIJA 2GT6A 4EIQA 2HYXA 1SD8A 1TK0B 2C8UA 4IW9A 5IMCA 3G7IA 4KGIA 1GNWA 3TOUA 2QC7A 1XIYA 3IRAA 4NWYA 4K9ZA 2DC5A 2WULA 5A4WA 4PNFA 4PGTA 3WT2A 1DBYA 1ON4A 4MMMA 4ZL8A 4OFTA 5D9WA 4EIPA 3ERWA 4TR0A 3M9KA 2H6YA 4NHZA 4TRXA 3FR9A 1B48A 1ERWA 3RPNA 2CAIA 2X64A 2JACA 1PMTA 1G7EA 1K0AA 3KM6A 2AAWA 3R3EA 1XXUA 4PUFC 3LWAA 4EDZA 3H79A 2GSTA 1G6YA 2LQOA 3F3RA 3SBCA 1TRSA 4POKA 2PN8A 3O6TA 1MDJA 2P5RA 1ZL9A 3M3MA 2OBIA 1YDKA 2XBQA 1EEJA 2DJ1A 2IFQB 3DXBA 2DJ0A 5E59A 1GTIA 1JZRA 1XOBA 4RI6A 2QKEA 1LBKA 2VL3A 4ECIA 3C1RA 4OWYA 4ULXA 1X0RA 1AC1A 1C72A 3NZNA 3US3A 2N5AA 3KTBA 1FO5A 1EOHA 1PKWA 4EVMA 4N11A 1XVQA 2R6KA 5DALA 2V6KA 4HEA2 3L9SA 2YJHA 3TKSA 3HDCA 2GT5A 1UA5A 1TRVA 3MIXA 5CYYA 2VCVA 3C71A 2CX4A 4AJ6A 2FGXA 2VCZA 3A5IA 2C0EA 5KN2A 1JZWA 2B7KA 4EL1A 2YNXA 3ZVJD 2QSIA 2IJYA 4JBBA 1SKWB 2FWGA 5AGYA 1KEBA 3FZAA 1XWBA 4FH8A 4DSRA 1QMVA 1F2EA 2PERA 5D96A 3TJKA 5DCGA 6GSWA 3HJMA 3GX8A 4JRRA 5B8AA 1FB0A 2KUCA 8GSSA 4TN8A 4KA0A 2ZCTA 1NW2A 4KH7A 3QMXA 3P90A 2DIYA 5B7CA 1YKCA 1YEPA 3ZYWA 1ML6A 1ACVA 2JU5A 3BOAA 2PGTA 1VF4A 1SKSB 1HQOA 2HSMA 2CVKA 4KNDA 4K7NA 4BL7B 1ZOFA 1QFNA 1FOHA 1I9DA 1O7UA 1R26A 1GSUA 5F06A 5G5FA 4NMUA 3PINA 3APOA 4LLRA 1M9BA 4PNGA 3UVHA 2WRTA 3L9UA 1PD21 2ON7A 2TRCP 3A2WA 1ZMAA 1U3AA 1X9SB 1PL1A 5KOWA 12GSA 1BAYA 3GSTA 5DJLA 1TK5B 4CW9A 3TOTA 1XVWA 3JCML 3TB2A 2PWJA 2P0GA 2TRXA 4LMVA 4GLTA 4NXIA 2IWTA 3CBUA 1SK0A 3GKXA 5D73A 2AV4A 5DBQA 2YV7A 1S3AA 3I69A 4ZBAA 1UC7A 3M1GA 6GSYA 1TP9A 4ZXGA 4F0BA 3IOSA 2B5XA 3EU3A 3CMIA 4K0GA 3ZVJA 1Z7PA 3RBTA 2YWNA 1DE2A 2C3NA 1B4QA 2FA8A 4ID0A 3BJ5A 4XCSA 4KW6A 4PQ1A 4YQMA 3PPUA 2DJ2A 1AQWA 4IBPA 2MMNA 4O5RA 4BVXB 1M2AA 1OE8A 2E0QA 3MDKA 4FO5A 3KIJA 3DMLA 2RUFA 4GSSA 3MSZA 4QL7A 3FKFA 3CSHA 4E8HA 4DSQA 3F63A 4WKWA 4NHWA 4TXOB 2VO4A 1GH2A 3IK7A 3VWVA 4MJEA 5ID2A 1QGVA 3L4NA 2IPAA 2N5FA 5A5KA 1TOFA 1WIKA 3LQ7A 4XS4A 2JSYA 1GNEA 1M99A 3TJBA 1F3AA 4K5RA 5CRHA 9GSSA 1OC9B 1AAZA 4IN0A 4EE0A 2H75A 4DVCA 1ZYNA 2EIOA 5F07A 3HA9A 4I2TA 4O92A 3VWWA 3TKSE 3N9JA 4WR4A 3GRXA 1ZYEA 4ISDA 1YKAA 1V2AA 3HVSA 1FW1A 3V1WA 1FHEA 2I1UA 5ECHB 1EV9A 1ILOA 4WETA 2IL3A 3KMOA 3IXRA 3IE3A 4ZBDA 2Z9SA 3BBYA 4F82A 2GVPA 4XRDA 3Q74A 2F8FA 5B6MA 3GHAA 4KB3A 1DE1A 2C0FA 4I8BA 5KN3A 1EEMA 5DJMA 2A2PA 4K6XA 2M72A 5F0GA 1X9WB 5IM9A 2MBSA 4YAVA 1AUCA 4V1Ap 3LG6A 4PQHA 3QAWA 1GLQA 2CQ9A 3DRNA 1K0NA 4JR6A 5IMAA 2V32A 3E9JB 4A5PA 2VAFA 4AJ8A 1GULA 3GTUB 3KTLA 4TOPA 2RIIA 3LFLA 3DD3A 1PKZA 2HE3A 1PGTA 3IC8A 2FWHA 2NTOA 5KN0A 2R37A 4PQIA 2K8VA 3QAGA 5HFGA 1J0FA 1THXA 3EMPA 3NIVA 1A8LA 1N8JA 1XBSA 2JZRA 5A4VA 3LYPA 2LEGA 5FWGA 5B8BA 4BVYB 1K3OA 2MZCA 3SWLA 1MD3A 2VL2C 2KHPA 1SYXA 1BYEA 2IFQA 2GQLA 3LW9A 4Z2TA 4JEDA 2LJRA 4FYCA 3WT1A 3Q6OA 3KH7A 2YWMA 5JWQB 4ML1A 2AUVA 2H1AA 3WGEA 4HZ2A 4X4JA 2WFCA 3RPPA 2FUG2 4ZB8A 3TKQA 3EU4A 2CVDA 2F9SA 2AB6A 4YQVA 3F6DA 1FVKA 3ME7A 3FZ4A 1EGRA 4XS4B 2DMMA 4TR3A 3P2AA 2M46A 5J4UA 4GSTA 3UARA 1Z9HA 3ZMKA 1JLVA 1URMA 3VWUA 4I6XA 4IQ1A 4OO5A 4FYBA 4K5SA 1GUKA 2FA4A 1AIUA 2F8AA 3P7XA 3DWVA 2IMDA 4CY8A 1H4OA 6GSUA 3QFBC 5ABRA 3TJFA 3TDGA 4N0ZA 6GSTA 1YJ6A 2A2SA 1SK2A 3FRCA 4RQRA 4KCAA 2R0GA 3OR5A 3LXZA 4OFMA 3C7MA 1ERUA 4X0XA 2XPDA 3TKPA 4HJ2A 1WE0A 2GLRA 1YEXA 5IMZA 2I81A 1A2JA 1T7PB 2VM1A 4PURA 3GV1A 1A2MA 1W89A 5ECKB 2GSSA 1TJDA 3MWHA 3EURA 4BL7A 1B9YC 1PRXA 2H72A 2JL4A 2L5LA 4GSNA 3M8NA 5LCZA 1KTEA 3GN3A 3GSSA 1Y6EA 4XTSA 2AJQB 2BMXA 2PBJA 3W6GA 3EVIA 5G2ZA 3GX0A 1OYJA 2FNOA 4G2EA 3CXGA 1G7OA 2LKUA 4I2UA 2LRNA 5G30A 1Z7RA 2LNSA 4PUAA 2CAQA 4OCEA 3DKSA 3W8JA 4GCIA 3HXSA 1VRSD 4FYUA 1XFLA 4YQUA 5H5RA 2L6CA 4IP1A 1F37A 5ELAA 3HHVA 1GTAA 2CZ2A 2X8HA 2L4CA 3IHGA 2O87A 5DQSA 3RAZA 3HJOA 2O8VB 3MYDA 4LA1A 3IHQA 3TRPA 2H73A 5HFIA 3D0ZA 4AF2A 4MLYA 1GSDA 1XOAA 2G0FA 1HNAA 2KP2A 3LEFA 1O81A 4Q5QA 2C3QA 4XIHA 4HOJA 5IOXA 2XPEA 4BVXA 2PPTA 3U6VA 3ZTLA 2ALBA 4QQ7A 3UMAA 3VI7A 1NSWA 3KP8A 2LRTA 3WGDA 4X43A 3IA1A 5ELGA 5AISA 4ZL7A 2H1DA 1GLPA 5GSSA 4NAXA 1EGOA 1GP1A 2AHEA 4TXOA 2R3XA 2CX3A 4XHMA 5GZZB 3TRXA 4DSSB 3UOMA 3FYGA 4ECJA 4TR1B 1DUGA 4GTUA 3HYPA 4GRFA 2CV4A 3D22A 2LJAA 4KX4A 4F0CA 2A2RA 1OC9A 4WEYA 2K18A 5LD0A 5J9CA 3HZ8A 1MDKA 3GURA 4KCEA 3I43A 2WS2A 4RQXA 1NHYA 3UVTA 5HFKA 5DDLA 5HR1A 2LNTA 3DEXA 3GFKA 2D2ZA 4P3YB 1V40A 3GIXA 1YZXA 3ISOA 1R7HA 4YKGA 20GSA 3D6IA 2O7KA 1GSYA 6GSXA 4G0LA 5JWRB 1EP8A 2HLSA 3ERGA 3UBLA 1K3YA 5GAND 3IK9A 4K7IA 2YWIA 4HU7A 2VM2A 4HZ4A 4BWQA 5HR0A 4F9ZA 5AIXA 3UBKA 6GSVA 1SJIA 4GQFA 1R5PA 1XPVA 1CQHA 2YWOA 1SJZA 1A8YA 3APQA 5IMDA 1Y25A 1T4ZA 1G0TA 4IJ3A 2HRAA 2OBKA 2GS3A 3GTUA 3KZQA 4WF5A 3TUEA 3IAM2 5ECLB 6GSSA 2OJLA 2P31A 2X99A 2GDRA 3DGQA 3GUSA 3GYKA 22GSA 2ZUPA 2EIQA 3CTFA 2KP1A 2NPBA 4MJBA 3APSA 2DMLA 2R2JA 2H19A 3O3TA 2DJJA 3ZFLA 1O73A 2VL2A 4PTSA 2YCDA 1A0FA 4BVYA 1GSFA 3GNJA 1VF1A 3KH9A 2RM6A 1RQMA 2I3YA 2R0CA 1Z6MA 2B3SA 4Z7XA 3EWLA 3GL3A 4Z2RA 3FMWA 2V41A 2OE3A 4MK3A 3CSIA 5EVOA 2HRKA 3KD0A 5C04A 1XW9A 3LGCA 1OE7A 5DAKB 3Q18A 1RK4A 2R5GA 3RDWA 5IO2A 3AY8A 3GMFA 4IHUA 2MYGA 3TJJA 2O85A 5BRTA 3LJRA 4L8EA 3ZL5A 2OE0A 1KNGA 2LTKA 1U3IA 4RUVA 4OD7A 3W8SA 2PMTA 3VK9A 2L4QA 1SU9A 2PUKC 4XRAA 2GZPA 4ZL9A 3TRQA 1Z3EA 3J7Yk 3RHCA 4XS6A 17GSA 5IIZA 2DKHA 3UIWA 3D5JA 3C1SA 4I5QA 4KSMA 3FR3A 1OKTA 2XC2A 3ZZXA 2L5OA 5CO3A 3HY2A 2ON5A 2FY6A 3FEUA 2VCTA 1E6BA 3GA4A 1SL1B 2HSYA 4N10A 2LSTA 2JZSA 4MA9A 4IP6A 4O7HA 3HD5A 1K3LA 2C0GA 3QR6A 2X8CA 4E8EA 2C4JA 1EV4A 4KF9A 4ECBA 3D4MA 5DCHA 2NBSA 3LXTA 3PR8A 13GSA 4NV2A 2JZTA 4EC0A 2JADA 3E3EA 2LS5A 1DSBA 4Z2UA 1S3CA 5E4WA 1OC8A 3ZITA 1ZYPA 4L5OA 2MMAA 1FB6A 2V6OA 1M7TA 4BA7A 19GSA 2H30A 2B5YA 4IQAA 2A4HA 2IMEA 1T8EB 2HNLA 1JZDA 4HI7A 3HCZA 4EDYA 5ECNB 1B8XA 3KXOA 3CTGA 1M2DA 2JSZA 5L71A 4J56E 3L0HA 2R4VA 1Q4JA 3IC4A 1WRYA 1PA3A 3VPQA 3MAKA 1U88A 4MZBA 2H6XA 5CAXA 1ZZYA 4KE3A 3F0IA 3HZ4A 1A24A 1M9AA 1TW9A 2B5EA 4BPYA 4EUYA 1LJRA 1EZKA 1TRWA 3KEBA 1XWAA 2A4VA 2OADA 1K0BA 5CRWA 4IVFA 2YV9A 3F6FA 4O5QA 3H4KA 3G7YA 1FVJA 1O6JA 2IMFA 2G2QA 2E7PA 3F4TA 3GKNA 5D9VA 5DQYA 4JZQA 3QPMA 3J7Yb 1A2LA 3UL3A 3HVXA 1KBNA 2P5QA 2VD1A 2PU9C 3Q19A 3VFIA 1JFUA 2IIYA 4POBA 1V57A 3G9BA 3FW2A 4MJAA 4MABA 4F03A 2VUPA 4EXJA 3NOFA 5JCWA 3M0FA 3S9FA 2B1LA 2VCXA 3PGTA 2FD3A 1H75A 1T1VA 3QFAC 4HDEA 2OKAA 2BTOT 5IOWA 2C80A 5AN1A 3UJ1A 1QQ2A 2GGTA 4KDXA 4ILFA 4DSSA 3C8EA 1XZOA 4K2DA 4TR1A 3KP9A 2YZUA 3HKRA 1V9WA 1TU7A 1F3BA 2HSHA 1GUMA 1X5CA 3LSZA 1HD2A 1VF3A 1AW9A 1IYIA 1GRXA 1O8XA 2E2GA 1K0DA 2RM5A 2KLXA 5JCGA 5B6NA 2MMZA 2PVQA 4OMVA 2YP6A 4TVEA 1F9MA 1PSQA 2FHEA 2XBIA 1F6MC 2LQQA 3WD6A 3GH9A 3EYTA 5HR2A 4NPBA 2LRCA 2RUEA 2YN1A 1TTZA 5FT3A 4WXTA 1MTCA 1FAAA 3KJYA 1XWCA 2C3TA 4MH3A 1EP7A 2WCIA 5A4UA 2V2GA 4V2LA 4K2XA 1ZYQB 1AQVA 2KOKA 2B6MA 5CP1A 3K8NA 1J08A 3GL5A 3DIEA 2UZ8A 2VL9A 2LV3A 4MCUA 4YH2A 5CRGA 4J57E 7GSSA 1YY7A 4MPGA 2HXKA 5JWOB 3FK8A 3TCOA 2H6ZA 5ECOB 2DJKA 3I9V2 1X5EA 4ACSA 3H8QA 3IBHA 5LNKe 1W4VA 5CRDA 5INYA 4HQZA 4JU5A 1JZOA 4MF6A 5F8BA 4ZB9A 2OACA 2HZEB 3O76A 4V2NA 2DIZA 2E2MA 4ICYA 5EL8A 2LJKA 3EINA 3HJPA 3ZREA 5GSTA 2C1YA 2V1MA 1PX6A 3TGZA 1R5AA 5J41A 2EIRA 4K0NA 2VCQA 3CSJA 4DEJA 4IS0A 1TKDB 4EKZA 4PX1A 2YPMA 2F3MA 4KDYA 1CQGA 1BJXA 2AYTA 5G1KA 5ECMB 2H01A 4EO3A 1T3BA 2TIRA 1B9XC 1GL8A 5DAKA 3FR6A 3CRTA 3E0UA 2K6VA 2LUSA 3EC3A 2MBTA 5DVBA 2H66A 1JHBA 2HZFA 1THOA 3KGKA 3BD2A 3F8UA 2X49A 4G0IA 4POMA 3C73A 3RHBA 1BEDA 3IAS2 4I97A 3FZ5A 3UEMA 4G19A 1ZGNA 3R2QA 4AGSA 4IGJA 4YKFA 4D73B 2H76A 2OE1A 2CT6A 1IYHA 4GWRA 3DVWA 2H70A 3ZMLA 2R0PA 1WJKA 1XCCA 1OVNA 2B1KA 2WZ9A 1PN9A 5AIVA 2OA7A 1O8WA 1UVZA 3CRUA 4TXVA 1ERTA 5CREA 2GSRA 3LORA 5IPGA 11GSA 4RI7A 5BMUA 1USBA 5IO0A 2L59A 1J9BA 1SKRB 1Z5YE 5H5QA 3BCKA 2IMIA 2H74A 4HS1A 4TKYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EOG A;  5J5N A;  2VCW A;  2ZNM A;  1QUW A;  2EC4 A;  2O89 A;  4LL1 B;  1GSS A;  1SL2 B;  4KAE A;  5ECS A;  5F05 A;  2IMK A;  1OC3 A;  1HYU A;  1B4P A;  3U5R E;  3UAP A;  1V98 A;  2QGV A;  4N30 A;  3VI5 A;  1A23 A;  2K9F A;  3P8W A;  3M9J A;  3EE2 A;  4MZC A;  2H0I A;  5ECQ B;  2FCH A;  1QXH A;  3FY7 A;  1YF1 A;  2VIM A;  4KSO A;  2IN3 A;  4HUA A;  3IR4 A;  5IPH A;  4POL A;  3N5O A;  4Q5F A;  2XHF A;  2VLV A;  4F2I A;  1I5G A;  4XS1 A;  4V1A g;  1BG5 A;  5HQP A;  3EMX A;  2YJ7 A;  5JCU A;  2L6D A;  3ERF A;  1PQN A;  3VLN A;  2GTU A;  1XW6 A;  3ZIV A;  1HNB A;  3TJG A;  1BQ7 A;  3A3T A;  4OO4 A;  2VD0 A;  3CYN A;  1X5D A;  2PVO C;  4IKH A;  4V2M A;  1WP0 A;  3A5W A;  2FLS A;  4MF7 A;  3QCP A;  1ZCP A;  5FHI A;  3FZ9 A;  4LMW A;  2N5B A;  3MNG A;  3KMN A;  2GQM A;  1VF2 A;  4PXO A;  5DAL B;  1TI1 A;  1TU8 A;  1HNC A;  4K1F A;  5COH A;  1MDI A;  2HT9 A;  4ZIJ A;  1GTB A;  4KUN A;  2CVB A;  4MZW A;  5D93 A;  1MEK A;  5GAP D;  5ECP B;  1GSE A;  3WGX A;  1GWC A;  4IJI A;  3IDV A;  4ZIL A;  1SEN A;  4K7O A;  4MH2 A;  3TKS C;  1TK8 B;  3GH6 A;  4GXZ A;  1SD9 A;  4Q5R A;  3QOU A;  1K0M A;  1TI3 A;  2B7J A;  1VGL A;  4H86 A;  3D21 A;  3DVX A;  2L57 A;  2VOC A;  1GTU A;  3F4R A;  3QDN A;  3D4T A;  5D8I A;  5EPF A;  2VLT A;  1N2A A;  1U87 A;  2BJX A;  1SK1 A;  4MF5 A;  4G10 A;  4JR4 A;  1E2Y A;  4Q5N A;  3QD9 A;  2NDO A;  3A2X A;  1MD4 A;  1WMJ A;  2DSA A;  4OFN A;  1ERV A;  2FWE A;  1PL2 A;  4WF4 A;  2YOI A;  4YAP A;  2C0D A;  1EWX A;  2H0G A;  3H1N A;  5H5S A;  14GS A;  4ZBB A;  1Q98 A;  1U6T A;  5ECI B;  1BX9 A;  1SJ6 A;  1T00 A;  2HRN A;  1K0O A;  5EY6 A;  3BCI A;  4IEL A;  4NV5 A;  5G1L A;  2WDU A;  2YAN A;  4K8M A;  2ES7 A;  1TDI A;  1WOU A;  2DJ3 A;  3IPZ A;  3ME8 A;  2NVL A;  1NM3 A;  3VPT A;  4KDU A;  3ZRD A;  2F51 A;  4HQS A;  2J9H A;  1ABA A;  1A0R P;  2VLU A;  4J2F A;  4WBJ A;  2WGR A;  4GF0 A;  2H1G A;  2GQK A;  1T4Y A;  4TR4 A;  5G5E A;  1AQX A;  5CNW A;  4QL9 A;  1WWJ A;  4O32 A;  5D9X A;  3KCM A;  1M2B A;  3GKM A;  3VUR A;  2M80 A;  1WPI A;  2I9H A;  4MP4 A;  1O85 A;  3L78 A;  3DYR A;  5ENU A;  4GQC A;  4ECC A;  3GKK A;  1M0U A;  1AXD A;  1FG4 A;  1SL0 B;  2GZZ A;  1LU4 A;  2HFD A;  2WJU A;  2DBC A;  4L5L A;  3LYK A;  4JE1 A;  5IQY A;  3A2V A;  1OKD A;  3HVV A;  1ST9 A;  2YZH A;  3L9V A;  4WBR D;  4HU9 A;  1JLW A;  2H8L A;  2X8G A;  4L0W A;  5IMV A;  1TXX A;  2HZE A;  4HJM A;  2I4A A;  3F4S A;  5C00 A;  4CDO A;  5D9T A;  1R4W A;  2GZY A;  4MPF A;  4BWS A;  1YQ1 A;  2HRF A;  2H0H A;  4AJ7 A;  3FHK A;  4TW5 A;  5IMF A;  2DLX A;  5ECR B;  1TRU A;  1FOV A;  5G31 A;  5KN1 A;  2CZ3 A;  2CA8 A;  4EF0 A;  4MDC A;  1OAZ A;  3ED3 A;  4MJC A;  4FIW A;  1X9M B;  3F9U A;  5J3R A;  5ID2 B;  5J9B A;  3H93 A;  3F3Q A;  3ZFB A;  4WR5 A;  3IV4 A;  3QAV A;  3TKR A;  1UN2 A;  1Z6N A;  5KEJ A;  2RLI A;  1XW5 A;  2WB9 A;  4L0U A;  4ML6 A;  2FWF A;  4OCF A;  1G6W A;  3ZLP A;  2HI7 A;  10GS A;  4CHS A;  3VWX A;  1GSQ A;  1YF0 A;  2GSQ A;  3G7J A;  2MMO A;  1SYR A;  2J23 A;  1XWK A;  1RW1 A;  2H1B A;  1GUH A;  18GS A;  1S3D A;  4LL4 B;  4D73 A;  1V58 A;  4X1U A;  2REM A;  1NHO A;  3WYW A;  3PH9 A;  4G9H A;  4N0V A;  1K0C A;  2K8S A;  5HR3 A;  16GS A;  1PX7 A;  3I6A A;  1XWG A;  2H71 A;  4ZB6 A;  1QK8 A;  3ZIJ A;  2GT6 A;  2HYX A;  1SD8 A;  1TK0 B;  2C8U A;  4IW9 A;  5IMC A;  3G7I A;  4KGI A;  1GNW A;  3TOU A;  2QC7 A;  1XIY A;  3IRA A;  4NWY A;  4K9Z A;  2DC5 A;  2WUL A;  5A4W A;  4PNF A;  4PGT A;  3WT2 A;  1DBY A;  1ON4 A;  4MMM A;  4ZL8 A;  4OFT A;  5D9W A;  3ERW A;  4TR0 A;  3M9K A;  2H6Y A;  4NHZ A;  4TRX A;  3FR9 A;  1B48 A;  1ERW A;  3RPN A;  2CAI A;  2X64 A;  2JAC A;  1PMT A;  1G7E A;  1K0A A;  3KM6 A;  2AAW A;  1XXU A;  4PUF C;  3LWA A;  4EDZ A;  3H79 A;  2GST A;  1G6Y A;  2LQO A;  3F3R A;  3SBC A;  1TRS A;  4POK A;  2PN8 A;  3O6T A;  1MDJ A;  2P5R A;  1ZL9 A;  3M3M A;  2OBI A;  1YDK A;  2XBQ A;  1EEJ A;  2DJ1 A;  2IFQ B;  3DXB A;  2DJ0 A;  5E59 A;  1GTI A;  1JZR A;  1XOB A;  4RI6 A;  2QKE A;  1LBK A;  2VL3 A;  4ECI A;  3C1R A;  4OWY A;  4ULX A;  1X0R A;  1AC1 A;  1C72 A;  3NZN A;  3US3 A;  2N5A A;  3KTB A;  1FO5 A;  1EOH A;  1PKW A;  4EVM A;  4N11 A;  1XVQ A;  2R6K A;  5DAL A;  2V6K A;  4HEA 2;  3L9S A;  2YJH A;  3TKS A;  3HDC A;  2GT5 A;  1UA5 A;  1TRV A;  5CYY A;  2VCV A;  3C71 A;  2CX4 A;  4AJ6 A;  2FGX A;  2VCZ A;  2C0E A;  5KN2 A;  1JZW A;  2B7K A;  4EL1 A;  2YNX A;  3ZVJ D;  2QSI A;  2IJY A;  4JBB A;  1SKW B;  2FWG A;  5AGY A;  1KEB A;  3FZA A;  1XWB A;  4FH8 A;  4DSR A;  1QMV A;  1F2E A;  2PER A;  5D96 A;  3TJK A;  5DCG A;  6GSW A;  3HJM A;  3GX8 A;  4JRR A;  5B8A A;  1FB0 A;  2KUC A;  8GSS A;  4TN8 A;  4KA0 A;  2ZCT A;  1NW2 A;  4KH7 A;  3QMX A;  3P90 A;  2DIY A;  5B7C A;  1YKC A;  1YEP A;  3ZYW A;  1ML6 A;  1ACV A;  2JU5 A;  3BOA A;  2PGT A;  1VF4 A;  1SKS B;  1HQO A;  2CVK A;  4KND A;  4K7N A;  1ZOF A;  1QFN A;  1R26 A;  1I9D A;  1O7U A;  1GSU A;  5F06 A;  5G5F A;  4NMU A;  3PIN A;  3APO A;  4LLR A;  1M9B A;  4PNG A;  3UVH A;  2WRT A;  3L9U A;  1PD2 1;  2ON7 A;  2TRC P;  3A2W A;  1ZMA A;  1U3A A;  1X9S B;  1PL1 A;  12GS A;  1BAY A;  3GST A;  5DJL A;  1TK5 B;  4CW9 A;  3TOT A;  1XVW A;  3JCM L;  3TB2 A;  2PWJ A;  2P0G A;  2TRX A;  4LMV A;  4GLT A;  4NXI A;  2IWT A;  3CBU A;  1SK0 A;  3GKX A;  5D73 A;  2AV4 A;  5DBQ A;  2YV7 A;  1S3A A;  3I69 A;  4ZBA A;  1UC7 A;  3M1G A;  6GSY A;  1TP9 A;  4ZXG A;  4F0B A;  3IOS A;  2B5X A;  3EU3 A;  3CMI A;  4K0G A;  3ZVJ A;  1Z7P A;  3RBT A;  2YWN A;  1DE2 A;  2C3N A;  1B4Q A;  2FA8 A;  4ID0 A;  3BJ5 A;  4XCS A;  4KW6 A;  4PQ1 A;  4YQM A;  2DJ2 A;  1AQW A;  4IBP A;  2MMN A;  4O5R A;  1M2A A;  1OE8 A;  2E0Q A;  3MDK A;  4FO5 A;  3KIJ A;  3DML A;  2RUF A;  4GSS A;  3MSZ A;  4QL7 A;  3FKF A;  3CSH A;  4E8H A;  4DSQ A;  3F63 A;  4WKW A;  4NHW A;  4TXO B;  2VO4 A;  1GH2 A;  3IK7 A;  3VWV A;  4MJE A;  5ID2 A;  1QGV A;  3L4N A;  2IPA A;  2N5F A;  5A5K A;  1TOF A;  1WIK A;  3LQ7 A;  4XS4 A;  2JSY A;  1GNE A;  1M99 A;  3TJB A;  1F3A A;  5CRH A;  9GSS A;  1OC9 B;  1AAZ A;  4IN0 A;  4EE0 A;  2H75 A;  4DVC A;  2EIO A;  5F07 A;  3HA9 A;  4I2T A;  4O92 A;  3VWW A;  3TKS E;  3N9J A;  4WR4 A;  3GRX A;  1ZYE A;  4ISD A;  1YKA A;  1V2A A;  3HVS A;  1FW1 A;  3V1W A;  1FHE A;  2I1U A;  5ECH B;  1EV9 A;  1ILO A;  4WET A;  2IL3 A;  3KMO A;  3IXR A;  3IE3 A;  4ZBD A;  2Z9S A;  3BBY A;  4F82 A;  2GVP A;  4XRD A;  3Q74 A;  2F8F A;  5B6M A;  3GHA A;  4KB3 A;  1DE1 A;  2C0F A;  4I8B A;  5KN3 A;  1EEM A;  5DJM A;  4K6X A;  2M72 A;  5F0G A;  1X9W B;  5IM9 A;  2MBS A;  4YAV A;  1AUC A;  4V1A p;  3LG6 A;  4PQH A;  3QAW A;  1GLQ A;  2CQ9 A;  3DRN A;  1K0N A;  4JR6 A;  5IMA A;  2V32 A;  3E9J B;  2VAF A;  4AJ8 A;  1GUL A;  3GTU B;  3KTL A;  4TOP A;  2RII A;  3LFL A;  3DD3 A;  1PKZ A;  2HE3 A;  1PGT A;  2FWH A;  2NTO A;  5KN0 A;  2R37 A;  4PQI A;  2K8V A;  3QAG A;  5HFG A;  1J0F A;  1THX A;  3EMP A;  3NIV A;  1A8L A;  1N8J A;  1XBS A;  2JZR A;  5A4V A;  3LYP A;  2LEG A;  5FWG A;  5B8B A;  1K3O A;  2MZC A;  3SWL A;  1MD3 A;  2VL2 C;  2KHP A;  1SYX A;  1BYE A;  2IFQ A;  2GQL A;  4JED A;  2LJR A;  4FYC A;  3WT1 A;  3Q6O A;  3KH7 A;  2YWM A;  5JWQ B;  4ML1 A;  2AUV A;  2H1A A;  3WGE A;  4HZ2 A;  2WFC A;  3RPP A;  2FUG 2;  4ZB8 A;  3TKQ A;  3EU4 A;  2CVD A;  2F9S A;  2AB6 A;  4YQV A;  3F6D A;  1FVK A;  3ME7 A;  3FZ4 A;  1EGR A;  4XS4 B;  2DMM A;  4TR3 A;  3P2A A;  2M46 A;  5J4U A;  4GST A;  3UAR A;  1Z9H A;  3ZMK A;  1JLV A;  1URM A;  3VWU A;  4I6X A;  4IQ1 A;  4OO5 A;  4FYB A;  1GUK A;  2FA4 A;  1AIU A;  2F8A A;  3P7X A;  3DWV A;  2IMD A;  6GSU A;  1H4O A;  3QFB C;  5ABR A;  3TJF A;  3TDG A;  4N0Z A;  6GST A;  1YJ6 A;  2A2S A;  1SK2 A;  3FRC A;  4RQR A;  4KCA A;  3OR5 A;  3LXZ A;  4OFM A;  3C7M A;  1ERU A;  4X0X A;  2XPD A;  3TKP A;  4HJ2 A;  1WE0 A;  2GLR A;  1YEX A;  5IMZ A;  2I81 A;  1A2J A;  1T7P B;  2VM1 A;  4PUR A;  3GV1 A;  1A2M A;  1W89 A;  5ECK B;  2GSS A;  1TJD A;  3MWH A;  3EUR A;  4BL7 A;  1B9Y C;  1PRX A;  2H72 A;  2JL4 A;  2L5L A;  4GSN A;  3M8N A;  5LCZ A;  1KTE A;  3GN3 A;  3GSS A;  1Y6E A;  4XTS A;  2AJQ B;  2BMX A;  2PBJ A;  3W6G A;  3EVI A;  5G2Z A;  3GX0 A;  1OYJ A;  2FNO A;  4G2E A;  3CXG A;  1G7O A;  2LKU A;  4I2U A;  2LRN A;  5G30 A;  1Z7R A;  2LNS A;  4PUA A;  2CAQ A;  4OCE A;  3DKS A;  3W8J A;  4GCI A;  3HXS A;  1VRS D;  4FYU A;  1XFL A;  4YQU A;  5H5R A;  2L6C A;  4IP1 A;  1F37 A;  5ELA A;  3HHV A;  1GTA A;  2CZ2 A;  2X8H A;  2L4C A;  2O87 A;  5DQS A;  3RAZ A;  3HJO A;  2O8V B;  4LA1 A;  3IHQ A;  3TRP A;  2H73 A;  5HFI A;  3D0Z A;  4AF2 A;  4MLY A;  1GSD A;  1XOA A;  2G0F A;  1HNA A;  2KP2 A;  3LEF A;  1O81 A;  4Q5Q A;  2C3Q A;  4XIH A;  4HOJ A;  5IOX A;  2XPE A;  4BVX A;  2PPT A;  3U6V A;  3ZTL A;  2ALB A;  4QQ7 A;  3UMA A;  3VI7 A;  1NSW A;  3KP8 A;  2LRT A;  3WGD A;  4X43 A;  3IA1 A;  5ELG A;  5AIS A;  4ZL7 A;  2H1D A;  1GLP A;  5GSS A;  4NAX A;  1EGO A;  1GP1 A;  2AHE A;  4TXO A;  2R3X A;  2CX3 A;  4XHM A;  5GZZ B;  3TRX A;  4DSS B;  3UOM A;  3FYG A;  4ECJ A;  4TR1 B;  1DUG A;  4GTU A;  3HYP A;  4GRF A;  2CV4 A;  3D22 A;  2LJA A;  4KX4 A;  4F0C A;  2A2R A;  1OC9 A;  4WEY A;  2K18 A;  5LD0 A;  5J9C A;  3HZ8 A;  1MDK A;  3GUR A;  4KCE A;  3I43 A;  2WS2 A;  4RQX A;  1NHY A;  3UVT A;  5HFK A;  5DDL A;  5HR1 A;  2LNT A;  3DEX A;  3GFK A;  2D2Z A;  4P3Y B;  1V40 A;  3GIX A;  1YZX A;  3ISO A;  1R7H A;  20GS A;  3D6I A;  2O7K A;  1GSY A;  6GSX A;  5JWR B;  1EP8 A;  2HLS A;  3ERG A;  3UBL A;  1K3Y A;  5GAN D;  3IK9 A;  4K7I A;  2YWI A;  4HU7 A;  2VM2 A;  4HZ4 A;  4BWQ A;  5HR0 A;  4F9Z A;  5AIX A;  3UBK A;  6GSV A;  1SJI A;  4GQF A;  1R5P A;  1XPV A;  1CQH A;  2YWO A;  1SJZ A;  1A8Y A;  3APQ A;  5IMD A;  1Y25 A;  1T4Z A;  1G0T A;  4IJ3 A;  2OBK A;  2GS3 A;  3GTU A;  3KZQ A;  4WF5 A;  3TUE A;  3IAM 2;  5ECL B;  6GSS A;  2OJL A;  2P31 A;  2X99 A;  2GDR A;  3DGQ A;  3GUS A;  3GYK A;  22GS A;  2ZUP A;  2EIQ A;  3CTF A;  2KP1 A;  2NPB A;  4MJB A;  3APS A;  2DML A;  2R2J A;  2H19 A;  3O3T A;  2DJJ A;  3ZFL A;  1O73 A;  2VL2 A;  2YCD A;  1A0F A;  4BVY A;  1GSF A;  3GNJ A;  1VF1 A;  3KH9 A;  2RM6 A;  1RQM A;  2I3Y A;  1Z6M A;  2B3S A;  4Z7X A;  3EWL A;  3GL3 A;  2V41 A;  2OE3 A;  4MK3 A;  3CSI A;  5EVO A;  3KD0 A;  5C04 A;  1XW9 A;  3LGC A;  1OE7 A;  5DAK B;  3Q18 A;  1RK4 A;  2R5G A;  3RDW A;  5IO2 A;  3AY8 A;  3GMF A;  4IHU A;  2MYG A;  3TJJ A;  2O85 A;  3LJR A;  4L8E A;  3ZL5 A;  2OE0 A;  1KNG A;  2LTK A;  1U3I A;  4RUV A;  4OD7 A;  3W8S A;  2PMT A;  3VK9 A;  2L4Q A;  1SU9 A;  2PUK C;  4XRA A;  2GZP A;  4ZL9 A;  3TRQ A;  1Z3E A;  3J7Y k;  3RHC A;  4XS6 A;  17GS A;  5IIZ A;  3UIW A;  3D5J A;  3C1S A;  4I5Q A;  4KSM A;  3FR3 A;  1OKT A;  2XC2 A;  3ZZX A;  2L5O A;  5CO3 A;  3HY2 A;  2ON5 A;  2FY6 A;  3FEU A;  2VCT A;  1E6B A;  3GA4 A;  1SL1 B;  2HSY A;  4N10 A;  2LST A;  2JZS A;  4MA9 A;  4IP6 A;  4O7H A;  3HD5 A;  1K3L A;  2C0G A;  3QR6 A;  2X8C A;  4E8E A;  2C4J A;  1EV4 A;  4ECB A;  3D4M A;  5DCH A;  2NBS A;  3LXT A;  3PR8 A;  13GS A;  4NV2 A;  2JZT A;  4EC0 A;  2JAD A;  3E3E A;  2LS5 A;  1DSB A;  1S3C A;  5E4W A;  1OC8 A;  3ZIT A;  4L5O A;  2MMA A;  1FB6 A;  2V6O A;  1M7T A;  4BA7 A;  19GS A;  2H30 A;  2B5Y A;  4IQA A;  2IME A;  1T8E B;  2HNL A;  1JZD A;  4HI7 A;  3HCZ A;  4EDY A;  5ECN B;  1B8X A;  3KXO A;  3CTG A;  1M2D A;  2JSZ A;  5L71 A;  4J56 E;  3L0H A;  2R4V A;  1Q4J A;  3IC4 A;  1WRY A;  1PA3 A;  3VPQ A;  3MAK A;  1U88 A;  4MZB A;  2H6X A;  5CAX A;  1ZZY A;  4KE3 A;  3F0I A;  3HZ4 A;  1A24 A;  1M9A A;  1TW9 A;  2B5E A;  4BPY A;  4EUY A;  1LJR A;  1EZK A;  1TRW A;  3KEB A;  1XWA A;  2A4V A;  2OAD A;  1K0B A;  5CRW A;  4IVF A;  2YV9 A;  3F6F A;  3H4K A;  3G7Y A;  1FVJ A;  1O6J A;  2IMF A;  2G2Q A;  2E7P A;  3F4T A;  3GKN A;  5D9V A;  5DQY A;  4JZQ A;  3QPM A;  3J7Y b;  1A2L A;  3UL3 A;  3HVX A;  1KBN A;  2P5Q A;  2VD1 A;  2PU9 C;  3Q19 A;  3VFI A;  1JFU A;  2IIY A;  4POB A;  1V57 A;  3G9B A;  3FW2 A;  4MJA A;  4MAB A;  4F03 A;  2VUP A;  4EXJ A;  3NOF A;  5JCW A;  3M0F A;  3S9F A;  2B1L A;  2VCX A;  3PGT A;  2FD3 A;  1H75 A;  1T1V A;  3QFA C;  4HDE A;  2OKA A;  2BTO T;  5IOW A;  2C80 A;  5AN1 A;  3UJ1 A;  1QQ2 A;  2GGT A;  4KDX A;  4ILF A;  4DSS A;  3C8E A;  1XZO A;  4K2D A;  4TR1 A;  3KP9 A;  2YZU A;  3HKR A;  1V9W A;  1TU7 A;  1F3B A;  2HSH A;  1GUM A;  1X5C A;  3LSZ A;  1HD2 A;  1VF3 A;  1AW9 A;  1IYI A;  1GRX A;  1O8X A;  2E2G A;  1K0D A;  2RM5 A;  2KLX A;  5JCG A;  5B6N A;  2MMZ A;  2PVQ A;  4OMV A;  2YP6 A;  4TVE A;  1F9M A;  1PSQ A;  2FHE A;  2XBI A;  1F6M C;  2LQQ A;  3WD6 A;  3GH9 A;  3EYT A;  5HR2 A;  4NPB A;  2LRC A;  2RUE A;  2YN1 A;  1TTZ A;  5FT3 A;  4WXT A;  1MTC A;  1FAA A;  3KJY A;  1XWC A;  2C3T A;  4MH3 A;  1EP7 A;  2WCI A;  5A4U A;  2V2G A;  4V2L A;  1ZYQ B;  1AQV A;  2KOK A;  2B6M A;  5CP1 A;  3K8N A;  1J08 A;  3GL5 A;  3DIE A;  2VL9 A;  2LV3 A;  4MCU A;  4YH2 A;  5CRG A;  4J57 E;  7GSS A;  1YY7 A;  4MPG A;  2HXK A;  5JWO B;  3FK8 A;  3TCO A;  2H6Z A;  5ECO B;  2DJK A;  3I9V 2;  1X5E A;  4ACS A;  3H8Q A;  3IBH A;  5LNK e;  1W4V A;  5CRD A;  5INY A;  4HQZ A;  4JU5 A;  1JZO A;  4MF6 A;  5F8B A;  4ZB9 A;  2OAC A;  2HZE B;  3O76 A;  4V2N A;  2DIZ A;  2E2M A;  5EL8 A;  2LJK A;  3EIN A;  3HJP A;  3ZRE A;  5GST A;  2C1Y A;  2V1M A;  1PX6 A;  3TGZ A;  1R5A A;  5J41 A;  2EIR A;  4K0N A;  2VCQ A;  3CSJ A;  4DEJ A;  4IS0 A;  1TKD B;  4EKZ A;  4PX1 A;  2YPM A;  2F3M A;  4KDY A;  1CQG A;  1BJX A;  2AYT A;  5G1K A;  5ECM B;  2H01 A;  4EO3 A;  1T3B A;  2TIR A;  1B9X C;  1GL8 A;  5DAK A;  3FR6 A;  3CRT A;  3E0U A;  2K6V A;  2LUS A;  3EC3 A;  2MBT A;  5DVB A;  2H66 A;  1JHB A;  2HZF A;  1THO A;  3KGK A;  3BD2 A;  3F8U A;  4POM A;  3C73 A;  3RHB A;  1BED A;  3IAS 2;  4I97 A;  3FZ5 A;  3UEM A;  4G19 A;  1ZGN A;  3R2Q A;  4AGS A;  4IGJ A;  4D73 B;  2H76 A;  2OE1 A;  2CT6 A;  1IYH A;  4GWR A;  3DVW A;  2H70 A;  3ZML A;  1WJK A;  1XCC A;  1OVN A;  2B1K A;  2WZ9 A;  1PN9 A;  5AIV A;  2OA7 A;  1O8W A;  1UVZ A;  3CRU A;  4TXV A;  1ERT A;  5CRE A;  2GSR A;  3LOR A;  5IPG A;  11GS A;  4RI7 A;  1USB A;  5IO0 A;  2L59 A;  1J9B A;  1SKR B;  1Z5Y E;  5H5Q A;  3BCK A;  2IMI A;  2H74 A;  4HS1 A;  4TKY A; 
#chains in the Genus database with same CATH topology
 1EOG A;  5J5N A;  2VCW A;  2ZNM A;  1QUW A;  2EC4 A;  2O89 A;  4LL1 B;  1GSS A;  1SL2 B;  4KAE A;  5ECS A;  5F05 A;  4USS A;  2IMK A;  1OC3 A;  1HYU A;  1B4P A;  3U5R E;  3UAP A;  1V98 A;  2QGV A;  4N30 A;  3VI5 A;  1A23 A;  2K9F A;  3P8W A;  3M9J A;  3EPT A;  3EE2 A;  4MZC A;  2H0I A;  5ECQ B;  2FCH A;  1QXH A;  3FY7 A;  1YF1 A;  2VIM A;  4KSO A;  2IN3 A;  4HUA A;  3IR4 A;  5IPH A;  4POL A;  3N5O A;  4Q5F A;  2XHF A;  2VLV A;  4F2I A;  1I5G A;  4XS1 A;  4V1A g;  1BG5 A;  5HQP A;  3EMX A;  2YJ7 A;  5JCU A;  2L6D A;  3ERF A;  1PQN A;  3VLN A;  2GTU A;  1XW6 A;  3ZIV A;  1HNB A;  3TJG A;  1BQ7 A;  3A3T A;  4OO4 A;  2VD0 A;  3CYN A;  1X5D A;  2PVO C;  4IKH A;  4V2M A;  1WP0 A;  3A5W A;  2FLS A;  4MF7 A;  3QCP A;  1ZCP A;  5FHI A;  3FZ9 A;  4LMW A;  2N5B A;  3MNG A;  3KMN A;  2GQM A;  1VF2 A;  4PXO A;  5DAL B;  1TI1 A;  1TU8 A;  1HNC A;  4K1F A;  5COH A;  1MDI A;  2HT9 A;  4ZIJ A;  1GTB A;  4KUN A;  2CVB A;  4MZW A;  5D93 A;  1MEK A;  5GAP D;  5ECP B;  1GSE A;  3WGX A;  1GWC A;  4IJI A;  3IDV A;  4ZIL A;  1SEN A;  4K7O A;  4MH2 A;  3TKS C;  1TK8 B;  3GH6 A;  2QA2 A;  4GXZ A;  1SD9 A;  4Q5R A;  3QOU A;  1K0M A;  1TI3 A;  2B7J A;  1VGL A;  4H86 A;  3D21 A;  3DVX A;  2L57 A;  2VOC A;  1GTU A;  4O5U A;  3F4R A;  3QDN A;  3D4T A;  5D8I A;  5EPF A;  2VLT A;  1N2A A;  1U87 A;  2BJX A;  1SK1 A;  4MF5 A;  4G10 A;  4JR4 A;  1E2Y A;  4Q5N A;  3QD9 A;  2NDO A;  3A2X A;  1MD4 A;  1WMJ A;  2DSA A;  4OFN A;  1ERV A;  2FWE A;  1PL2 A;  4FQU A;  4WF4 A;  2YOI A;  4YAP A;  2C0D A;  1EWX A;  2H0G A;  3H1N A;  5H5S A;  14GS A;  4ZBB A;  1Q98 A;  1U6T A;  5ECI B;  1BX9 A;  1SJ6 A;  1PN0 A;  1T00 A;  2HRN A;  1K0O A;  5EY6 A;  3BCI A;  4IEL A;  4NV5 A;  5G1L A;  2WDU A;  2YAN A;  4K8M A;  2ES7 A;  1TDI A;  1WOU A;  2DJ3 A;  3IPZ A;  3ME8 A;  2NVL A;  1NM3 A;  3VPT A;  4KDU A;  3ZRD A;  1PFO A;  2F51 A;  4HQS A;  2J9H A;  1ABA A;  1A0R P;  2VLU A;  4J2F A;  4WBJ A;  4G0K A;  4CY6 A;  2WGR A;  4GF0 A;  2H1G A;  2GQK A;  1T4Y A;  4TR4 A;  5G5E A;  1AQX A;  5CNW A;  4QL9 A;  1WWJ A;  4O32 A;  5D9X A;  3KCM A;  1M2B A;  3GKM A;  3VUR A;  2M80 A;  1WPI A;  2I9H A;  4MNN A;  4MP4 A;  1O85 A;  3L78 A;  3DYR A;  5ENU A;  4GQC A;  4ECC A;  3GKK A;  1M0U A;  1AXD A;  1FG4 A;  1SL0 B;  2GZZ A;  1LU4 A;  2HFD A;  2WJU A;  2DBC A;  4L5L A;  3LYK A;  4JE1 A;  5IQY A;  3A2V A;  1OKD A;  3HVV A;  1ST9 A;  2YZH A;  3L9V A;  4WBR D;  4HU9 A;  1JLW A;  2H8L A;  2X8G A;  4L0W A;  5IMV A;  1TXX A;  2HZE A;  4HJM A;  2I4A A;  3F4S A;  5C00 A;  4CDO A;  5D9T A;  1R4W A;  2GZY A;  4MPF A;  4BWS A;  1YQ1 A;  2HRF A;  2H0H A;  4AJ7 A;  3FHK A;  4TW5 A;  5IMF A;  2DLX A;  5ECR B;  1TRU A;  1FOV A;  5G31 A;  5KN1 A;  2CZ3 A;  2CA8 A;  4EF0 A;  4MDC A;  1OAZ A;  3ED3 A;  4MJC A;  4FIW A;  1X9M B;  3F9U A;  5J3R A;  5ID2 B;  5J9B A;  2QA1 A;  3H93 A;  3F3Q A;  3ZFB A;  4WR5 A;  3IV4 A;  3QAV A;  3TKR A;  1UN2 A;  1Z6N A;  5KEJ A;  2RLI A;  1XW5 A;  2WB9 A;  4L0U A;  4ML6 A;  2FWF A;  4OCF A;  1G6W A;  3ZLP A;  2HI7 A;  10GS A;  4CHS A;  3VWX A;  1GSQ A;  2X4A A;  1YF0 A;  2GSQ A;  3G7J A;  2MMO A;  1SYR A;  2J23 A;  1XWK A;  1RW1 A;  2H1B A;  1GUH A;  18GS A;  1S3D A;  4LL4 B;  4D73 A;  1V58 A;  4X1U A;  2REM A;  1NHO A;  3WYW A;  3PH9 A;  4G9H A;  4N0V A;  1K0C A;  2K8S A;  5KOX A;  5HR3 A;  16GS A;  1PX7 A;  3I6A A;  1XWG A;  2H71 A;  2DKI A;  4ZB6 A;  1QK8 A;  3ZIJ A;  2GT6 A;  4EIQ A;  2HYX A;  1SD8 A;  1TK0 B;  2C8U A;  4IW9 A;  5IMC A;  3G7I A;  4KGI A;  1GNW A;  3TOU A;  2QC7 A;  1XIY A;  3IRA A;  4NWY A;  4K9Z A;  2DC5 A;  2WUL A;  5A4W A;  4PNF A;  4PGT A;  3WT2 A;  1DBY A;  1ON4 A;  4MMM A;  4ZL8 A;  4OFT A;  5D9W A;  4EIP A;  3ERW A;  4TR0 A;  3M9K A;  2H6Y A;  4NHZ A;  4TRX A;  3FR9 A;  1B48 A;  1ERW A;  3RPN A;  2CAI A;  2X64 A;  2JAC A;  1PMT A;  1G7E A;  1K0A A;  3KM6 A;  2AAW A;  3R3E A;  1XXU A;  4PUF C;  3LWA A;  4EDZ A;  3H79 A;  2GST A;  1G6Y A;  2LQO A;  3F3R A;  3SBC A;  1TRS A;  4POK A;  2PN8 A;  3O6T A;  1MDJ A;  2P5R A;  1ZL9 A;  3M3M A;  2OBI A;  1YDK A;  2XBQ A;  1EEJ A;  2DJ1 A;  2IFQ B;  3DXB A;  2DJ0 A;  5E59 A;  1GTI A;  1JZR A;  1XOB A;  4RI6 A;  2QKE A;  1LBK A;  2VL3 A;  4ECI A;  3C1R A;  4OWY A;  4ULX A;  1X0R A;  1AC1 A;  1C72 A;  3NZN A;  3US3 A;  2N5A A;  3KTB A;  1FO5 A;  1EOH A;  1PKW A;  4EVM A;  4N11 A;  1XVQ A;  2R6K A;  5DAL A;  2V6K A;  4HEA 2;  3L9S A;  2YJH A;  3TKS A;  3HDC A;  2GT5 A;  1UA5 A;  1TRV A;  3MIX A;  5CYY A;  2VCV A;  3C71 A;  2CX4 A;  4AJ6 A;  2FGX A;  2VCZ A;  3A5I A;  2C0E A;  5KN2 A;  1JZW A;  2B7K A;  4EL1 A;  2YNX A;  3ZVJ D;  2QSI A;  2IJY A;  4JBB A;  1SKW B;  2FWG A;  5AGY A;  1KEB A;  3FZA A;  1XWB A;  4FH8 A;  4DSR A;  1QMV A;  1F2E A;  2PER A;  5D96 A;  3TJK A;  5DCG A;  6GSW A;  3HJM A;  3GX8 A;  4JRR A;  5B8A A;  1FB0 A;  2KUC A;  8GSS A;  4TN8 A;  4KA0 A;  2ZCT A;  1NW2 A;  4KH7 A;  3QMX A;  3P90 A;  2DIY A;  5B7C A;  1YKC A;  1YEP A;  3ZYW A;  1ML6 A;  1ACV A;  2JU5 A;  3BOA A;  2PGT A;  1VF4 A;  1SKS B;  1HQO A;  2HSM A;  2CVK A;  4KND A;  4K7N A;  4BL7 B;  1ZOF A;  1QFN A;  3HVN A;  1FOH A;  1I9D A;  1O7U A;  1R26 A;  1GSU A;  5F06 A;  5G5F A;  4NMU A;  3PIN A;  3APO A;  4LLR A;  1M9B A;  4PNG A;  3UVH A;  2WRT A;  3L9U A;  1PD2 1;  2ON7 A;  2TRC P;  3A2W A;  1ZMA A;  1U3A A;  1X9S B;  1PL1 A;  5KOW A;  12GS A;  1BAY A;  3GST A;  5DJL A;  1TK5 B;  4CW9 A;  3TOT A;  1XVW A;  3JCM L;  3TB2 A;  2PWJ A;  2P0G A;  2TRX A;  4LMV A;  4GLT A;  4NXI A;  2IWT A;  3CBU A;  1SK0 A;  3GKX A;  5D73 A;  2AV4 A;  5DBQ A;  2YV7 A;  1S3A A;  3I69 A;  4ZBA A;  1UC7 A;  3M1G A;  6GSY A;  1TP9 A;  4ZXG A;  4F0B A;  3IOS A;  2B5X A;  3EU3 A;  3CMI A;  4K0G A;  3ZVJ A;  1Z7P A;  3RBT A;  2YWN A;  1DE2 A;  2C3N A;  1B4Q A;  2FA8 A;  4ID0 A;  3BJ5 A;  4XCS A;  4KW6 A;  4PQ1 A;  4YQM A;  3PPU A;  2DJ2 A;  1AQW A;  4IBP A;  2MMN A;  4O5R A;  4BVX B;  1M2A A;  1OE8 A;  2E0Q A;  3MDK A;  4FO5 A;  3KIJ A;  3DML A;  2RUF A;  4GSS A;  3MSZ A;  4QL7 A;  3FKF A;  3CSH A;  4E8H A;  4DSQ A;  3F63 A;  4WKW A;  4NHW A;  4TXO B;  2VO4 A;  1GH2 A;  3IK7 A;  3VWV A;  4MJE A;  5ID2 A;  1QGV A;  3L4N A;  2IPA A;  2N5F A;  5A5K A;  1TOF A;  1WIK A;  3LQ7 A;  4XS4 A;  2JSY A;  1GNE A;  1M99 A;  3TJB A;  1F3A A;  4K5R A;  5CRH A;  9GSS A;  4BIK A;  1OC9 B;  1AAZ A;  4IN0 A;  4EE0 A;  2H75 A;  4DVC A;  1ZYN A;  2EIO A;  5F07 A;  3HA9 A;  4I2T A;  4O92 A;  3VWW A;  3TKS E;  3N9J A;  4WR4 A;  3GRX A;  1ZYE A;  4ISD A;  1YKA A;  1V2A A;  3HVS A;  1FW1 A;  3V1W A;  1FHE A;  2I1U A;  5ECH B;  1EV9 A;  1ILO A;  4WET A;  2IL3 A;  3KMO A;  3IXR A;  3IE3 A;  4ZBD A;  2Z9S A;  3BBY A;  1M3J A;  4F82 A;  2GVP A;  4XRD A;  3Q74 A;  2F8F A;  5B6M A;  3GHA A;  4KB3 A;  1DE1 A;  2C0F A;  4I8B A;  5KN3 A;  1EEM A;  5DJM A;  2A2P A;  4K6X A;  2M72 A;  5F0G A;  1X9W B;  5IM9 A;  2MBS A;  4YAV A;  1AUC A;  4V1A p;  3LG6 A;  4PQH A;  3QAW A;  1GLQ A;  2CQ9 A;  3DRN A;  1K0N A;  4JR6 A;  5IMA A;  2V32 A;  3E9J B;  4A5P A;  2VAF A;  4AJ8 A;  1GUL A;  3GTU B;  3KTL A;  4TOP A;  2RII A;  3LFL A;  3DD3 A;  1PKZ A;  2HE3 A;  1PGT A;  3IC8 A;  2FWH A;  2NTO A;  5KN0 A;  2R37 A;  4PQI A;  2K8V A;  3QAG A;  5HFG A;  1J0F A;  1THX A;  3EMP A;  3NIV A;  1A8L A;  1N8J A;  1XBS A;  2JZR A;  5A4V A;  3LYP A;  2LEG A;  5FWG A;  5B8B A;  4BVY B;  1K3O A;  2MZC A;  3SWL A;  1MD3 A;  2VL2 C;  2KHP A;  1SYX A;  1BYE A;  2IFQ A;  2GQL A;  3LW9 A;  4Z2T A;  4JED A;  2LJR A;  4FYC A;  3WT1 A;  3Q6O A;  3KH7 A;  2YWM A;  5JWQ B;  4ML1 A;  2AUV A;  2H1A A;  3WGE A;  4HZ2 A;  4X4J A;  2WFC A;  3RPP A;  2FUG 2;  4ZB8 A;  3TKQ A;  3EU4 A;  1XG8 A;  2CVD A;  2F9S A;  2AB6 A;  4YQV A;  3F6D A;  1FVK A;  3ME7 A;  3FZ4 A;  1EGR A;  4XS4 B;  2DMM A;  4TR3 A;  3P2A A;  2M46 A;  5J4U A;  4GST A;  3UAR A;  1Z9H A;  3ZMK A;  1JLV A;  1URM A;  3VWU A;  4I6X A;  4IQ1 A;  4OO5 A;  4FYB A;  4K5S A;  1GUK A;  2FA4 A;  1AIU A;  2F8A A;  3P7X A;  3DWV A;  2IMD A;  4CY8 A;  1H4O A;  6GSU A;  3QFB C;  5ABR A;  3TJF A;  3TDG A;  4N0Z A;  6GST A;  1YJ6 A;  2A2S A;  1SK2 A;  3FRC A;  4RQR A;  4KCA A;  2R0G A;  3OR5 A;  3LXZ A;  4OFM A;  3C7M A;  1ERU A;  4X0X A;  2XPD A;  3TKP A;  4HJ2 A;  1WE0 A;  2GLR A;  1YEX A;  5IMZ A;  2I81 A;  1A2J A;  1T7P B;  2VM1 A;  4PUR A;  3GV1 A;  1A2M A;  1W89 A;  5ECK B;  2GSS A;  1TJD A;  3MWH A;  3EUR A;  4BL7 A;  1B9Y C;  1PRX A;  2H72 A;  2JL4 A;  2L5L A;  4GSN A;  3M8N A;  5LCZ A;  1KTE A;  3GN3 A;  3GSS A;  1Y6E A;  4XTS A;  2AJQ B;  2BMX A;  2PBJ A;  3W6G A;  3EVI A;  5G2Z A;  3GX0 A;  1OYJ A;  2FNO A;  4G2E A;  3CXG A;  1G7O A;  2LKU A;  4I2U A;  2LRN A;  5G30 A;  1Z7R A;  2LNS A;  4PUA A;  2CAQ A;  4OCE A;  3DKS A;  3W8J A;  4GCI A;  3HXS A;  1VRS D;  4FYU A;  1XFL A;  4YQU A;  5H5R A;  2L6C A;  4IP1 A;  1F37 A;  5ELA A;  3HHV A;  1GTA A;  2CZ2 A;  2X8H A;  2L4C A;  3IHG A;  2O87 A;  5DQS A;  3RAZ A;  3HJO A;  2O8V B;  3MYD A;  4LA1 A;  3IHQ A;  3TRP A;  2H73 A;  5HFI A;  3D0Z A;  4AF2 A;  4MLY A;  1GSD A;  1XOA A;  2G0F A;  1HNA A;  2KP2 A;  3LEF A;  1O81 A;  4Q5Q A;  2C3Q A;  4XIH A;  4HOJ A;  5IOX A;  2XPE A;  4BVX A;  2PPT A;  3U6V A;  3ZTL A;  2ALB A;  4QQ7 A;  3UMA A;  3VI7 A;  1NSW A;  3KP8 A;  2LRT A;  3WGD A;  4X43 A;  3IA1 A;  5ELG A;  5AIS A;  4ZL7 A;  2H1D A;  1GLP A;  5GSS A;  4NAX A;  1EGO A;  1GP1 A;  2AHE A;  4TXO A;  2R3X A;  2CX3 A;  4XHM A;  5GZZ B;  3TRX A;  4DSS B;  3UOM A;  3FYG A;  4ECJ A;  4TR1 B;  1DUG A;  4GTU A;  3HYP A;  4GRF A;  2CV4 A;  3D22 A;  2LJA A;  4KX4 A;  4F0C A;  2A2R A;  1OC9 A;  4WEY A;  2K18 A;  5LD0 A;  5J9C A;  3HZ8 A;  1MDK A;  3GUR A;  4KCE A;  3I43 A;  2WS2 A;  4RQX A;  1NHY A;  3UVT A;  5HFK A;  5DDL A;  5HR1 A;  2LNT A;  3DEX A;  3GFK A;  2D2Z A;  4P3Y B;  1V40 A;  3GIX A;  1YZX A;  3ISO A;  1R7H A;  4YKG A;  1S3R A;  20GS A;  3D6I A;  2O7K A;  1GSY A;  6GSX A;  4G0L A;  5JWR B;  1EP8 A;  2HLS A;  3ERG A;  3UBL A;  1K3Y A;  5GAN D;  3IK9 A;  4K7I A;  2YWI A;  4HU7 A;  2VM2 A;  4HZ4 A;  4BWQ A;  5HR0 A;  4F9Z A;  5AIX A;  3UBK A;  6GSV A;  1SJI A;  4GQF A;  1R5P A;  1XPV A;  1CQH A;  2YWO A;  1SJZ A;  1A8Y A;  3APQ A;  5IMD A;  1Y25 A;  1T4Z A;  1G0T A;  4IJ3 A;  2HRA A;  2OBK A;  2GS3 A;  3GTU A;  3KZQ A;  4WF5 A;  3TUE A;  3IAM 2;  5ECL B;  6GSS A;  2OJL A;  2P31 A;  2X99 A;  2GDR A;  3DGQ A;  3GUS A;  3GYK A;  22GS A;  2ZUP A;  2EIQ A;  3CTF A;  2KP1 A;  2NPB A;  4MJB A;  3APS A;  2DML A;  2R2J A;  2H19 A;  3O3T A;  2DJJ A;  3ZFL A;  1O73 A;  2VL2 A;  4PTS A;  2YCD A;  1A0F A;  4BVY A;  1GSF A;  3GNJ A;  1VF1 A;  3KH9 A;  2RM6 A;  1RQM A;  2I3Y A;  2R0C A;  1Z6M A;  2B3S A;  4Z7X A;  3EWL A;  3GL3 A;  4Z2R A;  3FMW A;  2V41 A;  2OE3 A;  4MK3 A;  3CSI A;  5EVO A;  2HRK A;  3KD0 A;  5C04 A;  1XW9 A;  3LGC A;  1OE7 A;  5DAK B;  3Q18 A;  1RK4 A;  2R5G A;  3RDW A;  5IO2 A;  3AY8 A;  3GMF A;  4IHU A;  2MYG A;  3TJJ A;  2O85 A;  5BRT A;  3LJR A;  4L8E A;  3ZL5 A;  2OE0 A;  1KNG A;  2LTK A;  1U3I A;  4RUV A;  4OD7 A;  3W8S A;  2PMT A;  3VK9 A;  2L4Q A;  1SU9 A;  2PUK C;  4XRA A;  2GZP A;  4ZL9 A;  3TRQ A;  1Z3E A;  3J7Y k;  3RHC A;  4XS6 A;  17GS A;  5IIZ A;  2DKH A;  3UIW A;  3D5J A;  3C1S A;  4I5Q A;  4KSM A;  3FR3 A;  1OKT A;  2XC2 A;  3ZZX A;  2L5O A;  5CO3 A;  1M3I A;  3HY2 A;  2ON5 A;  2FY6 A;  3FEU A;  2VCT A;  1E6B A;  3GA4 A;  1SL1 B;  2HSY A;  4N10 A;  2LST A;  2JZS A;  4MA9 A;  4IP6 A;  4O7H A;  3HD5 A;  1K3L A;  2C0G A;  3QR6 A;  2X8C A;  4E8E A;  2C4J A;  1EV4 A;  4KF9 A;  4ECB A;  3D4M A;  5DCH A;  2NBS A;  3LXT A;  3PR8 A;  13GS A;  4NV2 A;  2JZT A;  4EC0 A;  2JAD A;  3E3E A;  2LS5 A;  1DSB A;  4Z2U A;  1S3C A;  5E4W A;  1OC8 A;  3ZIT A;  1ZYP A;  4L5O A;  2MMA A;  1FB6 A;  2V6O A;  1M7T A;  4BA7 A;  19GS A;  2H30 A;  2B5Y A;  4IQA A;  2A4H A;  2IME A;  1T8E B;  2HNL A;  1JZD A;  4HI7 A;  3HCZ A;  4EDY A;  5ECN B;  1B8X A;  3KXO A;  3CTG A;  1M2D A;  2JSZ A;  5L71 A;  4J56 E;  3L0H A;  2R4V A;  1Q4J A;  3IC4 A;  1WRY A;  1PA3 A;  3VPQ A;  3MAK A;  1U88 A;  4MZB A;  2H6X A;  5CAX A;  1ZZY A;  4KE3 A;  3F0I A;  3HZ4 A;  1A24 A;  1M9A A;  1TW9 A;  2B5E A;  4BPY A;  4EUY A;  1LJR A;  1EZK A;  1TRW A;  3KEB A;  1XWA A;  2A4V A;  2OAD A;  1K0B A;  5CRW A;  4IVF A;  2YV9 A;  3F6F A;  4O5Q A;  3H4K A;  3G7Y A;  1FVJ A;  1O6J A;  2IMF A;  2G2Q A;  2E7P A;  3F4T A;  3GKN A;  5D9V A;  5DQY A;  4JZQ A;  3QPM A;  3J7Y b;  1A2L A;  3UL3 A;  3HVX A;  1KBN A;  2P5Q A;  2VD1 A;  2PU9 C;  3Q19 A;  3VFI A;  1JFU A;  2IIY A;  4POB A;  1V57 A;  3G9B A;  3FW2 A;  4MJA A;  4MAB A;  4F03 A;  2VUP A;  4EXJ A;  3NOF A;  5JCW A;  3M0F A;  3S9F A;  2B1L A;  2VCX A;  3PGT A;  2FD3 A;  1H75 A;  1T1V A;  3QFA C;  4HDE A;  2OKA A;  2BTO T;  5IOW A;  2C80 A;  5AN1 A;  3UJ1 A;  1QQ2 A;  2GGT A;  4KDX A;  4ILF A;  4DSS A;  3C8E A;  1XZO A;  4K2D A;  4TR1 A;  3KP9 A;  2YZU A;  3HKR A;  1V9W A;  1TU7 A;  1F3B A;  2HSH A;  1GUM A;  1X5C A;  3LSZ A;  1HD2 A;  1VF3 A;  1AW9 A;  1IYI A;  1GRX A;  1O8X A;  2E2G A;  1K0D A;  2RM5 A;  2KLX A;  5JCG A;  5B6N A;  2MMZ A;  2PVQ A;  4OMV A;  2YP6 A;  4TVE A;  1F9M A;  1PSQ A;  2FHE A;  2XBI A;  1F6M C;  2LQQ A;  3WD6 A;  3GH9 A;  3EYT A;  5HR2 A;  4NPB A;  2LRC A;  2RUE A;  2YN1 A;  1TTZ A;  5FT3 A;  4WXT A;  1MTC A;  1FAA A;  3KJY A;  1XWC A;  2C3T A;  4MH3 A;  1EP7 A;  2WCI A;  5A4U A;  2V2G A;  4V2L A;  4K2X A;  1ZYQ B;  1AQV A;  2KOK A;  2B6M A;  5CP1 A;  3K8N A;  1J08 A;  3GL5 A;  3DIE A;  2UZ8 A;  2VL9 A;  2LV3 A;  4MCU A;  4YH2 A;  5CRG A;  4J57 E;  7GSS A;  1YY7 A;  4MPG A;  2HXK A;  5JWO B;  3FK8 A;  3TCO A;  2H6Z A;  5ECO B;  2DJK A;  3I9V 2;  1X5E A;  4ACS A;  3H8Q A;  3IBH A;  5LNK e;  1W4V A;  5CRD A;  5INY A;  4HQZ A;  4JU5 A;  1JZO A;  4MF6 A;  5F8B A;  4ZB9 A;  2OAC A;  2HZE B;  3O76 A;  4V2N A;  2DIZ A;  2E2M A;  4ICY A;  5EL8 A;  2LJK A;  3EIN A;  3HJP A;  3ZRE A;  5GST A;  2C1Y A;  2V1M A;  1PX6 A;  3TGZ A;  1R5A A;  5J41 A;  2EIR A;  4K0N A;  2VCQ A;  3CSJ A;  4DEJ A;  4IS0 A;  1TKD B;  4EKZ A;  4PX1 A;  2YPM A;  2F3M A;  4KDY A;  1CQG A;  1BJX A;  2AYT A;  5G1K A;  5ECM B;  2H01 A;  4EO3 A;  1T3B A;  2TIR A;  1B9X C;  1GL8 A;  5DAK A;  3FR6 A;  3CRT A;  3E0U A;  2K6V A;  2LUS A;  3EC3 A;  2MBT A;  5DVB A;  2H66 A;  1JHB A;  2HZF A;  1THO A;  3KGK A;  3BD2 A;  3CQF A;  3F8U A;  2X49 A;  4G0I A;  4POM A;  3C73 A;  3RHB A;  1BED A;  3IAS 2;  4I97 A;  3FZ5 A;  3UEM A;  4G19 A;  1ZGN A;  3R2Q A;  4AGS A;  4IGJ A;  4YKF A;  4D73 B;  2H76 A;  2OE1 A;  2CT6 A;  1IYH A;  4GWR A;  3DVW A;  2H70 A;  3ZML A;  2R0P A;  1WJK A;  1XCC A;  1OVN A;  2B1K A;  4HSC X;  2WZ9 A;  1PN9 A;  5AIV A;  2OA7 A;  1O8W A;  1UVZ A;  3CRU A;  4TXV A;  1ERT A;  5CRE A;  2GSR A;  3LOR A;  5IPG A;  11GS A;  4RI7 A;  5BMU A;  1USB A;  5IO0 A;  2L59 A;  1J9B A;  1SKR B;  1Z5Y E;  5H5Q A;  3BCK A;  2IMI A;  2H74 A;  4HS1 A;  4TKY A; 
#chains in the Genus database with same CATH homology
 1EOG A;  5J5N A;  2VCW A;  2ZNM A;  1QUW A;  2EC4 A;  2O89 A;  4LL1 B;  1GSS A;  1SL2 B;  4KAE A;  5ECS A;  5F05 A;  4USS A;  2IMK A;  1OC3 A;  1HYU A;  1B4P A;  3U5R E;  3UAP A;  1V98 A;  2QGV A;  4N30 A;  3VI5 A;  1A23 A;  2K9F A;  3P8W A;  3M9J A;  3EPT A;  3EE2 A;  4MZC A;  2H0I A;  5ECQ B;  2FCH A;  1QXH A;  3FY7 A;  1YF1 A;  2VIM A;  4KSO A;  2IN3 A;  4HUA A;  3IR4 A;  5IPH A;  4POL A;  3N5O A;  4Q5F A;  2XHF A;  2VLV A;  4F2I A;  1I5G A;  4XS1 A;  4V1A g;  1BG5 A;  5HQP A;  3EMX A;  2YJ7 A;  5JCU A;  2L6D A;  3ERF A;  1PQN A;  3VLN A;  2GTU A;  1XW6 A;  3ZIV A;  1HNB A;  3TJG A;  1BQ7 A;  3A3T A;  4OO4 A;  2VD0 A;  3CYN A;  1X5D A;  2PVO C;  4IKH A;  4V2M A;  1WP0 A;  3A5W A;  2FLS A;  4MF7 A;  3QCP A;  1ZCP A;  5FHI A;  3FZ9 A;  4LMW A;  2N5B A;  3MNG A;  3KMN A;  2GQM A;  1VF2 A;  4PXO A;  5DAL B;  1TI1 A;  1TU8 A;  1HNC A;  4K1F A;  5COH A;  1MDI A;  2HT9 A;  4ZIJ A;  1GTB A;  4KUN A;  2CVB A;  4MZW A;  5D93 A;  1MEK A;  5GAP D;  5ECP B;  1GSE A;  3WGX A;  1GWC A;  4IJI A;  3IDV A;  4ZIL A;  1SEN A;  4K7O A;  4MH2 A;  3TKS C;  1TK8 B;  3GH6 A;  2QA2 A;  4GXZ A;  1SD9 A;  4Q5R A;  3QOU A;  1K0M A;  1TI3 A;  2B7J A;  1VGL A;  4H86 A;  3D21 A;  3DVX A;  2L57 A;  2VOC A;  1GTU A;  4O5U A;  3F4R A;  3QDN A;  3D4T A;  5D8I A;  5EPF A;  2VLT A;  1N2A A;  1U87 A;  2BJX A;  1SK1 A;  4MF5 A;  4G10 A;  4JR4 A;  1E2Y A;  4Q5N A;  3QD9 A;  2NDO A;  3A2X A;  1MD4 A;  1WMJ A;  2DSA A;  4OFN A;  1ERV A;  2FWE A;  1PL2 A;  4FQU A;  4WF4 A;  2YOI A;  4YAP A;  2C0D A;  1EWX A;  2H0G A;  3H1N A;  5H5S A;  14GS A;  4ZBB A;  1Q98 A;  1U6T A;  5ECI B;  1BX9 A;  1SJ6 A;  1PN0 A;  1T00 A;  2HRN A;  1K0O A;  5EY6 A;  3BCI A;  4IEL A;  4NV5 A;  5G1L A;  2WDU A;  2YAN A;  4K8M A;  2ES7 A;  1TDI A;  1WOU A;  2DJ3 A;  3IPZ A;  3ME8 A;  2NVL A;  1NM3 A;  3VPT A;  4KDU A;  3ZRD A;  2F51 A;  4HQS A;  2J9H A;  1ABA A;  1A0R P;  2VLU A;  4J2F A;  4WBJ A;  4G0K A;  4CY6 A;  2WGR A;  4GF0 A;  2H1G A;  2GQK A;  1T4Y A;  4TR4 A;  5G5E A;  1AQX A;  5CNW A;  4QL9 A;  1WWJ A;  4O32 A;  5D9X A;  3KCM A;  1M2B A;  3GKM A;  3VUR A;  2M80 A;  1WPI A;  2I9H A;  4MNN A;  4MP4 A;  1O85 A;  3L78 A;  3DYR A;  5ENU A;  4GQC A;  4ECC A;  3GKK A;  1M0U A;  1AXD A;  1FG4 A;  1SL0 B;  2GZZ A;  1LU4 A;  2HFD A;  2WJU A;  2DBC A;  4L5L A;  3LYK A;  4JE1 A;  5IQY A;  3A2V A;  1OKD A;  3HVV A;  1ST9 A;  2YZH A;  3L9V A;  4WBR D;  4HU9 A;  1JLW A;  2H8L A;  2X8G A;  4L0W A;  5IMV A;  1TXX A;  2HZE A;  4HJM A;  2I4A A;  3F4S A;  5C00 A;  4CDO A;  5D9T A;  1R4W A;  2GZY A;  4MPF A;  4BWS A;  1YQ1 A;  2HRF A;  2H0H A;  4AJ7 A;  3FHK A;  4TW5 A;  5IMF A;  2DLX A;  5ECR B;  1TRU A;  1FOV A;  5G31 A;  5KN1 A;  2CZ3 A;  2CA8 A;  4EF0 A;  4MDC A;  1OAZ A;  3ED3 A;  4MJC A;  4FIW A;  1X9M B;  3F9U A;  5J3R A;  5ID2 B;  5J9B A;  2QA1 A;  3H93 A;  3F3Q A;  3ZFB A;  4WR5 A;  3IV4 A;  3QAV A;  3TKR A;  1UN2 A;  1Z6N A;  5KEJ A;  2RLI A;  1XW5 A;  2WB9 A;  4L0U A;  4ML6 A;  2FWF A;  4OCF A;  1G6W A;  3ZLP A;  2HI7 A;  10GS A;  4CHS A;  3VWX A;  1GSQ A;  2X4A A;  1YF0 A;  2GSQ A;  3G7J A;  2MMO A;  1SYR A;  2J23 A;  1XWK A;  1RW1 A;  2H1B A;  1GUH A;  18GS A;  1S3D A;  4LL4 B;  4D73 A;  1V58 A;  4X1U A;  2REM A;  1NHO A;  3WYW A;  3PH9 A;  4G9H A;  4N0V A;  1K0C A;  2K8S A;  5KOX A;  5HR3 A;  16GS A;  1PX7 A;  3I6A A;  1XWG A;  2H71 A;  2DKI A;  4ZB6 A;  1QK8 A;  3ZIJ A;  2GT6 A;  4EIQ A;  2HYX A;  1SD8 A;  1TK0 B;  2C8U A;  4IW9 A;  5IMC A;  3G7I A;  4KGI A;  1GNW A;  3TOU A;  2QC7 A;  1XIY A;  3IRA A;  4NWY A;  4K9Z A;  2DC5 A;  2WUL A;  5A4W A;  4PNF A;  4PGT A;  3WT2 A;  1DBY A;  1ON4 A;  4MMM A;  4ZL8 A;  4OFT A;  5D9W A;  4EIP A;  3ERW A;  4TR0 A;  3M9K A;  2H6Y A;  4NHZ A;  4TRX A;  3FR9 A;  1B48 A;  1ERW A;  3RPN A;  2CAI A;  2X64 A;  2JAC A;  1PMT A;  1G7E A;  1K0A A;  3KM6 A;  2AAW A;  3R3E A;  1XXU A;  4PUF C;  3LWA A;  4EDZ A;  3H79 A;  2GST A;  1G6Y A;  2LQO A;  3F3R A;  3SBC A;  1TRS A;  4POK A;  2PN8 A;  3O6T A;  1MDJ A;  2P5R A;  1ZL9 A;  3M3M A;  2OBI A;  1YDK A;  2XBQ A;  1EEJ A;  2DJ1 A;  2IFQ B;  3DXB A;  2DJ0 A;  5E59 A;  1GTI A;  1JZR A;  1XOB A;  4RI6 A;  2QKE A;  1LBK A;  2VL3 A;  4ECI A;  3C1R A;  4OWY A;  4ULX A;  1X0R A;  1AC1 A;  1C72 A;  3NZN A;  3US3 A;  2N5A A;  3KTB A;  1FO5 A;  1EOH A;  1PKW A;  4EVM A;  4N11 A;  1XVQ A;  2R6K A;  5DAL A;  2V6K A;  4HEA 2;  3L9S A;  2YJH A;  3TKS A;  3HDC A;  2GT5 A;  1UA5 A;  1TRV A;  3MIX A;  5CYY A;  2VCV A;  3C71 A;  2CX4 A;  4AJ6 A;  2FGX A;  2VCZ A;  3A5I A;  2C0E A;  5KN2 A;  1JZW A;  2B7K A;  4EL1 A;  2YNX A;  3ZVJ D;  2QSI A;  2IJY A;  4JBB A;  1SKW B;  2FWG A;  5AGY A;  1KEB A;  3FZA A;  1XWB A;  4FH8 A;  4DSR A;  1QMV A;  1F2E A;  2PER A;  5D96 A;  3TJK A;  5DCG A;  6GSW A;  3HJM A;  3GX8 A;  4JRR A;  5B8A A;  1FB0 A;  2KUC A;  8GSS A;  4TN8 A;  4KA0 A;  2ZCT A;  1NW2 A;  4KH7 A;  3QMX A;  3P90 A;  2DIY A;  5B7C A;  1YKC A;  1YEP A;  3ZYW A;  1ML6 A;  1ACV A;  2JU5 A;  3BOA A;  2PGT A;  1VF4 A;  1SKS B;  1HQO A;  2HSM A;  2CVK A;  4KND A;  4K7N A;  4BL7 B;  1ZOF A;  1QFN A;  1FOH A;  1I9D A;  1O7U A;  1R26 A;  1GSU A;  5F06 A;  5G5F A;  4NMU A;  3PIN A;  3APO A;  4LLR A;  1M9B A;  4PNG A;  3UVH A;  2WRT A;  3L9U A;  1PD2 1;  2ON7 A;  2TRC P;  3A2W A;  1ZMA A;  1U3A A;  1X9S B;  1PL1 A;  5KOW A;  12GS A;  1BAY A;  3GST A;  5DJL A;  1TK5 B;  4CW9 A;  3TOT A;  1XVW A;  3JCM L;  3TB2 A;  2PWJ A;  2P0G A;  2TRX A;  4LMV A;  4GLT A;  4NXI A;  2IWT A;  3CBU A;  1SK0 A;  3GKX A;  5D73 A;  2AV4 A;  5DBQ A;  2YV7 A;  1S3A A;  3I69 A;  4ZBA A;  1UC7 A;  3M1G A;  6GSY A;  1TP9 A;  4ZXG A;  4F0B A;  3IOS A;  2B5X A;  3EU3 A;  3CMI A;  4K0G A;  3ZVJ A;  1Z7P A;  3RBT A;  2YWN A;  1DE2 A;  2C3N A;  1B4Q A;  2FA8 A;  4ID0 A;  3BJ5 A;  4XCS A;  4KW6 A;  4PQ1 A;  4YQM A;  3PPU A;  2DJ2 A;  1AQW A;  4IBP A;  2MMN A;  4O5R A;  4BVX B;  1M2A A;  1OE8 A;  2E0Q A;  3MDK A;  4FO5 A;  3KIJ A;  3DML A;  2RUF A;  4GSS A;  3MSZ A;  4QL7 A;  3FKF A;  3CSH A;  4E8H A;  4DSQ A;  3F63 A;  4WKW A;  4NHW A;  4TXO B;  2VO4 A;  1GH2 A;  3IK7 A;  3VWV A;  4MJE A;  5ID2 A;  1QGV A;  3L4N A;  2IPA A;  2N5F A;  5A5K A;  1TOF A;  1WIK A;  3LQ7 A;  4XS4 A;  2JSY A;  1GNE A;  1M99 A;  3TJB A;  1F3A A;  4K5R A;  5CRH A;  9GSS A;  1OC9 B;  1AAZ A;  4IN0 A;  4EE0 A;  2H75 A;  4DVC A;  1ZYN A;  2EIO A;  5F07 A;  3HA9 A;  4I2T A;  4O92 A;  3VWW A;  3TKS E;  3N9J A;  4WR4 A;  3GRX A;  1ZYE A;  4ISD A;  1YKA A;  1V2A A;  3HVS A;  1FW1 A;  3V1W A;  1FHE A;  2I1U A;  5ECH B;  1EV9 A;  1ILO A;  4WET A;  2IL3 A;  3KMO A;  3IXR A;  3IE3 A;  4ZBD A;  2Z9S A;  3BBY A;  4F82 A;  2GVP A;  4XRD A;  3Q74 A;  2F8F A;  5B6M A;  3GHA A;  4KB3 A;  1DE1 A;  2C0F A;  4I8B A;  5KN3 A;  1EEM A;  5DJM A;  2A2P A;  4K6X A;  2M72 A;  5F0G A;  1X9W B;  5IM9 A;  2MBS A;  4YAV A;  1AUC A;  4V1A p;  3LG6 A;  4PQH A;  3QAW A;  1GLQ A;  2CQ9 A;  3DRN A;  1K0N A;  4JR6 A;  5IMA A;  2V32 A;  3E9J B;  4A5P A;  2VAF A;  4AJ8 A;  1GUL A;  3GTU B;  3KTL A;  4TOP A;  2RII A;  3LFL A;  3DD3 A;  1PKZ A;  2HE3 A;  1PGT A;  3IC8 A;  2FWH A;  2NTO A;  5KN0 A;  2R37 A;  4PQI A;  2K8V A;  3QAG A;  5HFG A;  1J0F A;  1THX A;  3EMP A;  3NIV A;  1A8L A;  1N8J A;  1XBS A;  2JZR A;  5A4V A;  3LYP A;  2LEG A;  5FWG A;  5B8B A;  4BVY B;  1K3O A;  2MZC A;  3SWL A;  1MD3 A;  2VL2 C;  2KHP A;  1SYX A;  1BYE A;  2IFQ A;  2GQL A;  3LW9 A;  4Z2T A;  4JED A;  2LJR A;  4FYC A;  3WT1 A;  3Q6O A;  3KH7 A;  2YWM A;  5JWQ B;  4ML1 A;  2AUV A;  2H1A A;  3WGE A;  4HZ2 A;  4X4J A;  2WFC A;  3RPP A;  2FUG 2;  4ZB8 A;  3TKQ A;  3EU4 A;  2CVD A;  2F9S A;  2AB6 A;  4YQV A;  3F6D A;  1FVK A;  3ME7 A;  3FZ4 A;  1EGR A;  4XS4 B;  2DMM A;  4TR3 A;  3P2A A;  2M46 A;  5J4U A;  4GST A;  3UAR A;  1Z9H A;  3ZMK A;  1JLV A;  1URM A;  3VWU A;  4I6X A;  4IQ1 A;  4OO5 A;  4FYB A;  4K5S A;  1GUK A;  2FA4 A;  1AIU A;  2F8A A;  3P7X A;  3DWV A;  2IMD A;  4CY8 A;  1H4O A;  6GSU A;  3QFB C;  5ABR A;  3TJF A;  3TDG A;  4N0Z A;  6GST A;  1YJ6 A;  2A2S A;  1SK2 A;  3FRC A;  4RQR A;  4KCA A;  2R0G A;  3OR5 A;  3LXZ A;  4OFM A;  3C7M A;  1ERU A;  4X0X A;  2XPD A;  3TKP A;  4HJ2 A;  1WE0 A;  2GLR A;  1YEX A;  5IMZ A;  2I81 A;  1A2J A;  1T7P B;  2VM1 A;  4PUR A;  3GV1 A;  1A2M A;  1W89 A;  5ECK B;  2GSS A;  1TJD A;  3MWH A;  3EUR A;  4BL7 A;  1B9Y C;  1PRX A;  2H72 A;  2JL4 A;  2L5L A;  4GSN A;  3M8N A;  5LCZ A;  1KTE A;  3GN3 A;  3GSS A;  1Y6E A;  4XTS A;  2AJQ B;  2BMX A;  2PBJ A;  3W6G A;  3EVI A;  5G2Z A;  3GX0 A;  1OYJ A;  2FNO A;  4G2E A;  3CXG A;  1G7O A;  2LKU A;  4I2U A;  2LRN A;  5G30 A;  1Z7R A;  2LNS A;  4PUA A;  2CAQ A;  4OCE A;  3DKS A;  3W8J A;  4GCI A;  3HXS A;  1VRS D;  4FYU A;  1XFL A;  4YQU A;  5H5R A;  2L6C A;  4IP1 A;  1F37 A;  5ELA A;  3HHV A;  1GTA A;  2CZ2 A;  2X8H A;  2L4C A;  3IHG A;  2O87 A;  5DQS A;  3RAZ A;  3HJO A;  2O8V B;  3MYD A;  4LA1 A;  3IHQ A;  3TRP A;  2H73 A;  5HFI A;  3D0Z A;  4AF2 A;  4MLY A;  1GSD A;  1XOA A;  2G0F A;  1HNA A;  2KP2 A;  3LEF A;  1O81 A;  4Q5Q A;  2C3Q A;  4XIH A;  4HOJ A;  5IOX A;  2XPE A;  4BVX A;  2PPT A;  3U6V A;  3ZTL A;  2ALB A;  4QQ7 A;  3UMA A;  3VI7 A;  1NSW A;  3KP8 A;  2LRT A;  3WGD A;  4X43 A;  3IA1 A;  5ELG A;  5AIS A;  4ZL7 A;  2H1D A;  1GLP A;  5GSS A;  4NAX A;  1EGO A;  1GP1 A;  2AHE A;  4TXO A;  2R3X A;  2CX3 A;  4XHM A;  5GZZ B;  3TRX A;  4DSS B;  3UOM A;  3FYG A;  4ECJ A;  4TR1 B;  1DUG A;  4GTU A;  3HYP A;  4GRF A;  2CV4 A;  3D22 A;  2LJA A;  4KX4 A;  4F0C A;  2A2R A;  1OC9 A;  4WEY A;  2K18 A;  5LD0 A;  5J9C A;  3HZ8 A;  1MDK A;  3GUR A;  4KCE A;  3I43 A;  2WS2 A;  4RQX A;  1NHY A;  3UVT A;  5HFK A;  5DDL A;  5HR1 A;  2LNT A;  3DEX A;  3GFK A;  2D2Z A;  4P3Y B;  1V40 A;  3GIX A;  1YZX A;  3ISO A;  1R7H A;  4YKG A;  20GS A;  3D6I A;  2O7K A;  1GSY A;  6GSX A;  4G0L A;  5JWR B;  1EP8 A;  2HLS A;  3ERG A;  3UBL A;  1K3Y A;  5GAN D;  3IK9 A;  4K7I A;  2YWI A;  4HU7 A;  2VM2 A;  4HZ4 A;  4BWQ A;  5HR0 A;  4F9Z A;  5AIX A;  3UBK A;  6GSV A;  1SJI A;  4GQF A;  1R5P A;  1XPV A;  1CQH A;  2YWO A;  1SJZ A;  1A8Y A;  3APQ A;  5IMD A;  1Y25 A;  1T4Z A;  1G0T A;  4IJ3 A;  2HRA A;  2OBK A;  2GS3 A;  3GTU A;  3KZQ A;  4WF5 A;  3TUE A;  3IAM 2;  5ECL B;  6GSS A;  2OJL A;  2P31 A;  2X99 A;  2GDR A;  3DGQ A;  3GUS A;  3GYK A;  22GS A;  2ZUP A;  2EIQ A;  3CTF A;  2KP1 A;  2NPB A;  4MJB A;  3APS A;  2DML A;  2R2J A;  2H19 A;  3O3T A;  2DJJ A;  3ZFL A;  1O73 A;  2VL2 A;  4PTS A;  2YCD A;  1A0F A;  4BVY A;  1GSF A;  3GNJ A;  1VF1 A;  3KH9 A;  2RM6 A;  1RQM A;  2I3Y A;  2R0C A;  1Z6M A;  2B3S A;  4Z7X A;  3EWL A;  3GL3 A;  4Z2R A;  3FMW A;  2V41 A;  2OE3 A;  4MK3 A;  3CSI A;  5EVO A;  2HRK A;  3KD0 A;  5C04 A;  1XW9 A;  3LGC A;  1OE7 A;  5DAK B;  3Q18 A;  1RK4 A;  2R5G A;  3RDW A;  5IO2 A;  3AY8 A;  3GMF A;  4IHU A;  2MYG A;  3TJJ A;  2O85 A;  5BRT A;  3LJR A;  4L8E A;  3ZL5 A;  2OE0 A;  1KNG A;  2LTK A;  1U3I A;  4RUV A;  4OD7 A;  3W8S A;  2PMT A;  3VK9 A;  2L4Q A;  1SU9 A;  2PUK C;  4XRA A;  2GZP A;  4ZL9 A;  3TRQ A;  1Z3E A;  3J7Y k;  3RHC A;  4XS6 A;  17GS A;  5IIZ A;  2DKH A;  3UIW A;  3D5J A;  3C1S A;  4I5Q A;  4KSM A;  3FR3 A;  1OKT A;  2XC2 A;  3ZZX A;  2L5O A;  5CO3 A;  3HY2 A;  2ON5 A;  2FY6 A;  3FEU A;  2VCT A;  1E6B A;  3GA4 A;  1SL1 B;  2HSY A;  4N10 A;  2LST A;  2JZS A;  4MA9 A;  4IP6 A;  4O7H A;  3HD5 A;  1K3L A;  2C0G A;  3QR6 A;  2X8C A;  4E8E A;  2C4J A;  1EV4 A;  4KF9 A;  4ECB A;  3D4M A;  5DCH A;  2NBS A;  3LXT A;  3PR8 A;  13GS A;  4NV2 A;  2JZT A;  4EC0 A;  2JAD A;  3E3E A;  2LS5 A;  1DSB A;  4Z2U A;  1S3C A;  5E4W A;  1OC8 A;  3ZIT A;  1ZYP A;  4L5O A;  2MMA A;  1FB6 A;  2V6O A;  1M7T A;  4BA7 A;  19GS A;  2H30 A;  2B5Y A;  4IQA A;  2A4H A;  2IME A;  1T8E B;  2HNL A;  1JZD A;  4HI7 A;  3HCZ A;  4EDY A;  5ECN B;  1B8X A;  3KXO A;  3CTG A;  1M2D A;  2JSZ A;  5L71 A;  4J56 E;  3L0H A;  2R4V A;  1Q4J A;  3IC4 A;  1WRY A;  1PA3 A;  3VPQ A;  3MAK A;  1U88 A;  4MZB A;  2H6X A;  5CAX A;  1ZZY A;  4KE3 A;  3F0I A;  3HZ4 A;  1A24 A;  1M9A A;  1TW9 A;  2B5E A;  4BPY A;  4EUY A;  1LJR A;  1EZK A;  1TRW A;  3KEB A;  1XWA A;  2A4V A;  2OAD A;  1K0B A;  5CRW A;  4IVF A;  2YV9 A;  3F6F A;  4O5Q A;  3H4K A;  3G7Y A;  1FVJ A;  1O6J A;  2IMF A;  2G2Q A;  2E7P A;  3F4T A;  3GKN A;  5D9V A;  5DQY A;  4JZQ A;  3QPM A;  3J7Y b;  1A2L A;  3UL3 A;  3HVX A;  1KBN A;  2P5Q A;  2VD1 A;  2PU9 C;  3Q19 A;  3VFI A;  1JFU A;  2IIY A;  4POB A;  1V57 A;  3G9B A;  3FW2 A;  4MJA A;  4MAB A;  4F03 A;  2VUP A;  4EXJ A;  3NOF A;  5JCW A;  3M0F A;  3S9F A;  2B1L A;  2VCX A;  3PGT A;  2FD3 A;  1H75 A;  1T1V A;  3QFA C;  4HDE A;  2OKA A;  2BTO T;  5IOW A;  2C80 A;  5AN1 A;  3UJ1 A;  1QQ2 A;  2GGT A;  4KDX A;  4ILF A;  4DSS A;  3C8E A;  1XZO A;  4K2D A;  4TR1 A;  3KP9 A;  2YZU A;  3HKR A;  1V9W A;  1TU7 A;  1F3B A;  2HSH A;  1GUM A;  1X5C A;  3LSZ A;  1HD2 A;  1VF3 A;  1AW9 A;  1IYI A;  1GRX A;  1O8X A;  2E2G A;  1K0D A;  2RM5 A;  2KLX A;  5JCG A;  5B6N A;  2MMZ A;  2PVQ A;  4OMV A;  2YP6 A;  4TVE A;  1F9M A;  1PSQ A;  2FHE A;  2XBI A;  1F6M C;  2LQQ A;  3WD6 A;  3GH9 A;  3EYT A;  5HR2 A;  4NPB A;  2LRC A;  2RUE A;  2YN1 A;  1TTZ A;  5FT3 A;  4WXT A;  1MTC A;  1FAA A;  3KJY A;  1XWC A;  2C3T A;  4MH3 A;  1EP7 A;  2WCI A;  5A4U A;  2V2G A;  4V2L A;  4K2X A;  1ZYQ B;  1AQV A;  2KOK A;  2B6M A;  5CP1 A;  3K8N A;  1J08 A;  3GL5 A;  3DIE A;  2UZ8 A;  2VL9 A;  2LV3 A;  4MCU A;  4YH2 A;  5CRG A;  4J57 E;  7GSS A;  1YY7 A;  4MPG A;  2HXK A;  5JWO B;  3FK8 A;  3TCO A;  2H6Z A;  5ECO B;  2DJK A;  3I9V 2;  1X5E A;  4ACS A;  3H8Q A;  3IBH A;  5LNK e;  1W4V A;  5CRD A;  5INY A;  4HQZ A;  4JU5 A;  1JZO A;  4MF6 A;  5F8B A;  4ZB9 A;  2OAC A;  2HZE B;  3O76 A;  4V2N A;  2DIZ A;  2E2M A;  4ICY A;  5EL8 A;  2LJK A;  3EIN A;  3HJP A;  3ZRE A;  5GST A;  2C1Y A;  2V1M A;  1PX6 A;  3TGZ A;  1R5A A;  5J41 A;  2EIR A;  4K0N A;  2VCQ A;  3CSJ A;  4DEJ A;  4IS0 A;  1TKD B;  4EKZ A;  4PX1 A;  2YPM A;  2F3M A;  4KDY A;  1CQG A;  1BJX A;  2AYT A;  5G1K A;  5ECM B;  2H01 A;  4EO3 A;  1T3B A;  2TIR A;  1B9X C;  1GL8 A;  5DAK A;  3FR6 A;  3CRT A;  3E0U A;  2K6V A;  2LUS A;  3EC3 A;  2MBT A;  5DVB A;  2H66 A;  1JHB A;  2HZF A;  1THO A;  3KGK A;  3BD2 A;  3F8U A;  2X49 A;  4G0I A;  4POM A;  3C73 A;  3RHB A;  1BED A;  3IAS 2;  4I97 A;  3FZ5 A;  3UEM A;  4G19 A;  1ZGN A;  3R2Q A;  4AGS A;  4IGJ A;  4YKF A;  4D73 B;  2H76 A;  2OE1 A;  2CT6 A;  1IYH A;  4GWR A;  3DVW A;  2H70 A;  3ZML A;  2R0P A;  1WJK A;  1XCC A;  1OVN A;  2B1K A;  2WZ9 A;  1PN9 A;  5AIV A;  2OA7 A;  1O8W A;  1UVZ A;  3CRU A;  4TXV A;  1ERT A;  5CRE A;  2GSR A;  3LOR A;  5IPG A;  11GS A;  4RI7 A;  5BMU A;  1USB A;  5IO0 A;  2L59 A;  1J9B A;  1SKR B;  1Z5Y E;  5H5Q A;  3BCK A;  2IMI A;  2H74 A;  4HS1 A;  4TKY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...