4I6XA

Crystal structure of non-catalyic domain of protein disulfide isomerase-related (pdir) protein
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
117
structure length
117
Chain Sequence
MLIERISDPKDLKKLLRTRNNVLVLYSKSEVAAENHLRLLSTVAQAVKGQGTICWVDCGDAESRKLCKKMKVDLSPKDKKVELFHYQDGAFHTEYNRAVTFKSIVAFLKDPKGPPLW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein disulfide-isomerase A5
publication title Structure of the Non-Catalytic Domain of the Protein Disulfide Isomerase-Related Protein (PDIR) Reveals Function in Protein Binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 37
structure length 117
sequence length 117
ec nomenclature ec 5.3.4.1: Protein disulfide-isomerase.
pdb deposition date 2012-11-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4i6xA00
3QCPA 5ECKB 4HZ4A 4GSTA 3TKPA 1U3IA 2BJXA 3TJJA 5IIZA 2O85A 4MA9A 2C1YA 2J23A 1SK2A 2DJ1A 5COHA 3KMNA 2TIRA 4KX4A 2XBIA 5J9BA 1XOAA 3C71A 4KSMA 3DRNA 2B6MA 2MMZA 3KXOA 2FWFA 4NPBA 5KEJA 4EDYA 5J9CA 1AUCA 1OAZA 3CTGA 1BQ7A 3GKMA 4JR6A 3W6GA 4ILFA 2WJUA 2HT9A 1R5PA 3N9JA 2LQQA 3FR6A 1TW9A 4PQ1A 4PQHA 3KGKA 1V2AA 2FHEA 3ZRDA 1F3BA 4XRAA 3EMPA 3ME8A 3GH6A 3KMOA 4KGIA 2FA8A 3TJGA 2DJJA 4V1Ap 3QAWA 1KTEA 1PL2A 5DALA 1THOA 3LFLA 1XWBA 3FZ4A 4IS0A 3KCMA 5EY6A 5GAND 1WOUA 1TK8B 4KDYA 3H8QA 1TRUA 2MBTA 4JZQA 2XC2A 4Q5FA 5J4UA 3G9BA 2N5BA 1K0AA 2CV4A 4K0GA 1FVJA 1Z6NA 3NIVA 3I43A 4TXVA 1XWGA 3KP8A 4MPGA 3LGCA 1M2AA 4YQUA 3IAS2 5ECOB 5G5FA 2NPBA 3WT2A 1PX6A 2O89A 1TRVA 4PGTA 7GSSA 4ZL8A 1YKCA 3GKXA 1GTAA 4TRXA 2PERA 1BG5A 1XWAA 2VCXA 1SL2B 2IIYA 1S3CA 1G6YA 3UL3A 3FW2A 4BWSA 3C7MA 2V6OA 5H5QA 4TR1A 5F05A 2IFQA 1AQVA 4ZB9A 1FAAA 1DBYA 3D22A 1W4VA 4KDUA 1DSBA 2PU9C 3HYPA 5E4WA 4TXOB 3GHAA 4Q5NA 4HZ2A 4HS1A 4MF6A 1A8YA 2JZRA 2C3NA 1KNGA 2H75A 3MWHA 4MF5A 4N11A 1SU9A 1EZKA 2H6ZA 4L0UA 4PUFC 1V57A 2CVKA 5ECQB 2CAQA 1A0RP 4NXIA 3IK7A 3GH9A 1GTUA 2O87A 1K0DA 3Q74A 2I81A 4PX1A 4I97A 2E0QA 3WGEA 4EXJA 4KCEA 4FO5A 4MZBA 2LRNA 1ON4A 1PQNA 5D96A 2GQMA 2HYXA 1VF2A 1K0NA 4EE0A 3ZVJA 2F8FA 3HVVA 4GSSA 3GMFA 5ID2A 4KAEA 4K7IA 4IJIA 1O8WA 3QOUA 1Z9HA 3DGQA 4ML6A 1E2YA 1DE1A 2XHFA 2CA8A 2R37A 1Z7RA 2HLSA 2DIYA 3RHBA 4EVMA 5F0GA 4O5RA 4HJ2A 3J7Yk 3F4SA 2LRTA 1TK5B 3NZNA 5CAXA 2CQ9A 1LJRA 1OKDA 1YEPA 3FZ9A 3GV1A 1O85A 2C4JA 3UEMA 1GUKA 3O76A 3APQA 1YQ1A 4I8BA 5HQPA 1AXDA 2CT6A 5ECLB 3TJKA 1JZWA 2H19A 1F37A 4J2FA 3E9JB 4DSQA 2AHEA 3US3A 1PL1A 2IMEA 3HKRA 3FEUA 5B8BA 4NHZA 1U6TA 1T7PB 3PR8A 1YDKA 3WT1A 3V1WA 2A2RA 4OCEA 3TCOA 4ZIJA 1GUMA 1MDJA 2HSYA 4N0VA 3A5WA 5A5KA 2VIMA 4FYUA 1SD9A 5J5NA 1G6WA 4P3YB 1SYRA 4WBRD 4HU9A 4IQAA 1GP1A 4K0NA 3QMXA 2EIRA 1HNCA 4WBJA 5E59A 3ZIVA 5G1KA 3FZAA 3TKSA 2HZFA 1M7TA 3EE2A 3FZ5A 3C8EA 2CZ2A 1GLQA 3EYTA 4L5LA 5HR1A 2IWTA 5F8BA 3EWLA 5ECMB 1K0OA 1FB0A 2QGVA 4TKYA 3ERGA 2EIOA 3HZ4A 4E8HA 1BX9A 2R3XA 2OKAA 2YWOA 3ZITA 1EGRA 1FB6A 1XZOA 5INYA 1SJZA 3BCIA 3W8JA 2VL2A 1Q4JA 2HNLA 4MK3A 5AIVA 2LNTA 1Z7PA 2MMAA 2L59A 4MPFA 1KEBA 1MDIA 4RI6A 1MDKA 4I2TA 4WR5A 3U5RE 2XPDA 4MF7A 2F3MA 2FWEA 3CBUA 3FR9A 6GSVA 2AV4A 3Q18A 3RDWA 1G0TA 3TOUA 2FUG2 2VLUA 1XVWA 2TRCP 3D4MA 4XS4B 2N5AA 3PH9A 1JLWA 4RQXA 4YAVA 4LA1A 1YEXA 3P7XA 3UVTA 1OC9B 3F8UA 2GZYA 4F9ZA 2V41A 5DCGA 1NSWA 5IO2A 4L0WA 2P5RA 5A4VA 2R6KA 1JLVA 4G19A 4DEJA 3IC4A 4XIHA 3FY7A 4HI7A 3PINA 3M8NA 3VK9A 1Z6MA 2X99A 4EUYA 1ACVA 3ZIJA 2B1KA 1V40A 4KNDA 4JRRA 3ZREA 4ZBAA 5HFIA 4O32A 3A2XA 4MLYA 3GX8A 4WR4A 1PGTA 2GZZA 2VM2A 4BWQA 4FYBA 4Z7XA 2VD1A 5ECSA 1SK0A 3W8SA 1TU7A 2A4VA 2VL9A 1MEKA 2HRFA 2OE1A 2WRTA 2OA7A 5JCUA 3ISOA 4LL1B 2CVBA 4GF0A 3D21A 4K7NA 1R4WA 2HI7A 1YZXA 3VI7A 2D2ZA 3GRXA 3ZZXA 1U87A 1K3YA 4MJBA 1E6BA 3KEBA 1JHBA 3C1RA 4K2DA 4NHWA 4E8EA 3EC3A 4BL7A 1FOVA 1B8XA 1HNAA 1PKZA 1B9YC 4YAPA 2HSHA 4NAXA 1GSFA 2JZTA 20GSA 2VO4A 2LS5A 3RAZA 4EKZA 2I4AA 5IMFA 4TR0A 3FYGA 3VWUA 5IOWA 2DLXA 2IMFA 4AJ7A 1TDIA 1T8EB 2JACA 1YJ6A 1GSDA 1NHOA 4EL1A 1Q98A 4D73A 5AIXA 3GUSA 4JE1A 3VWXA 5J3RA 3ZYWA 3BBYA 4IP1A 2L6DA 3G7JA 5KN3A 1PRXA 1ZCPA 4F2IA 3A3TA 3C73A 1ERTA 13GSA 4G9HA 4EO3A 3RHCA 1GSSA 2H1DA 2H8LA 5IPHA 4WF5A 3E3EA 1JZOA 1OVNA 3KM6A 6GSYA 1GSEA 3EURA 3F4RA 3J7Yb 1F6MC 2RIIA 3UVHA 2OBIA 1V98A 2GLRA 2LQOA 1GNWA 2FNOA 5L71A 2FA4A 2PVQA 1MD4A 3O3TA 4X0XA 1X9MB 3F3QA 2H74A 1CQHA 4NWYA 5ENUA 3S9FA 2OJLA 4CDOA 2VLVA 1GTBA 4NV5A 1UN2A 4EC0A 4OFTA 5G1LA 3ZFBA 4AGSA 1PN9A 4DSSA 1G7OA 3TJFA 4LLRA 3BD2A 4HQZA 2K8SA 2C3QA 3TUEA 1EGOA 1T00A 4F0BA 1K3LA 2RLIA 4OFMA 5DAKB 3VPTA 2C0GA 2QC7A 3GTUB 2LSTA 1T1VA 1NM3A 4QL7A 2LV3A 1YY7A 2YPMA 1AC1A 4ZBBA 2L6CA 4KB3A 1OE7A 3FHKA 3SWLA 4K1FA 2O8VB 4K9ZA 4K8MA 1K0BA 6GSTA 3LEFA 4MCUA 2IMDA 2I9HA 3BJ5A 2JSYA 2H30A 4PNFA 4IHUA 4L5OA 1WIKA 3LYPA 4IELA 5CO3A 1TP9A 5DQSA 2JZSA 2GVPA 1ST9A 3VWVA 1SJ6A 3TKSE 5CYYA 1A2MA 2PBJA 3D5JA 1GUHA 2HFDA 5F06A 2WGRA 3AY8A 2GS3A 2REMA 3LJRA 2HZEB 3VLNA 2YCDA 2TRXA 3LG6A 4GCIA 4YQMA 2H71A 5ECNB 2B7JA 1X5DA 1XPVA 5ECIB 2E7PA 2O7KA 1SJIA 3ZMLA 1HYUA 2P0GA 4XCSA 4POLA 1YKAA 3HZ8A 3TRXA 3VURA 4ZL7A 5HR0A 1YF1A 3EINA 4RUVA 3UARA 18GSA 3F0IA 2PN8A 4G2EA 3EVIA 1M0UA 3HDCA 4IP6A 3IE3A 1BJXA 5D9WA 3HJPA 4NMUA 3ZMKA 1J0FA 4IKHA 2QKEA 3L78A 1THXA 4J56E 1EP8A 4ECIA 2FCHA 3DXBA 3M9JA 1WPIA 2CZ3A 1B4QA 1X0RA 2ZUPA 2Z9SA 4HOJA 1WJKA 3F63A 1C72A 1SL0B 1CQGA 2WULA 3MNGA 2AB6A 5EL8A 5GZZB 3E0UA 3VFIA 2OBKA 1GSQA 3WGXA 5B7CA 4FH8A 1SENA 1PMTA 3DWVA 4V1Ag 4WXTA 1IYIA 3IV4A 3KTLA 2C80A 5FHIA 5AGYA 4GSNA 1K3OA 1O8XA 1T4ZA 3CSIA 4FYCA 4V2NA 2H1GA 1TU8A 3IXRA 1M9AA 3GSTA 4ML1A 4PNGA 2GQKA 3NOFA 5CRHA 2IJYA 3D6IA 4LMVA 5G31A 4HJMA 2IN3A 1VRSD 4V2LA 4I5QA 3DMLA 2VCVA 4NV2A 1SK1A 3ZLPA 2G2QA 4KE3A 4TXOA 1TRWA 3KZQA 1JZRA 1T4YA 2FLSA 4FIWA 2A2SA 3GKNA 1B4PA 2I1UA 1M2DA 3ME7A 3GL3A 2PMTA 1ZYQB 3C1SA 2LTKA 1B9XC 3UBLA 4ZILA 16GSA 1XCCA 4KUNA 1ERVA 1UVZA 2MBSA 4G10A 2NBSA 5HR2A 1EEMA 3ZFLA 4MABA 3UOMA 3N5OA 2VCQA 3BCKA 3HJOA 3DKSA 3UAPA 1VGLA 5GSSA 3KH9A 3RPPA 1M2BA 2PVOC 3DVXA 2VCWA 2ALBA 5LD0A 5KN0A 4TR3A 2X8GA 3K8NA 2X8CA 3CSJA 3IRAA 4GQCA 4LMWA 1N8JA 3APOA 3GKKA 1EWXA 1WWJA 5IMDA 1VF4A 3F4TA 2K18A 1O81A 2M80A 3FRCA 4PURA 4WKWA 1TI3A 2H0HA 2YV9A 1GRXA 5ECRB 2HRNA 4ECCA 5IMVA 3R2QA 5GSTA 2RM5A 3KP9A 2C0EA 1SKWB 5G5EA 2M72A 4OMVA 2NTOA 5DJMA 2YZHA 3HHVA 2DIZA 2J9HA 1ZMAA 3QAVA 1A2JA 3DVWA 2DJ3A 3TJBA 3HVXA 2KP2A 5KN1A 2DJ0A 4MJCA 4L8EA 1UC7A 4GLTA 1URMA 1BEDA 5IQYA 2C0FA 4HDEA 1ZOFA 5CRWA 2GSSA 1T3BA 1H75A 5DQYA 2IMIA 2P5QA 4DVCA 4MZWA 4BVYA 2F51A 1A0FA 2M46A 4TVEA 1TI1A 4ZB8A 1XW9A 5IPGA 4ACSA 1HQOA 1G7EA 4IN0A 4OCFA 2KUCA 2MMOA 2KHPA 2G0FA 5FWGA 1ZZYA 1R5AA 1QK8A 1QUWA 2YOIA 4XS6A 5EVOA 1GSYA 3QPMA 2GDRA 2YANA 1J08A 3ZTLA 3VWWA 2V32A 1QQ2A 2JADA 3LSZA 4RI7A 2C0DA 1WP0A 2JL4A 4CHSA 3OR5A 4YH2A 3IHQA 3L0HA 2P31A 2K9FA 5D9VA 5IMAA 2GQLA 4GRFA 3O6TA 4GXZA 3P2AA 1WE0A 3GFKA 3QFBC 4MDCA 1JFUA 2PGTA 3ED3A 2DSAA 5AN1A 1R26A 3F6DA 1RW1A 2FY6A 2PPTA 1F3AA 1V58A 2H66A 1VF1A 1RK4A 1XWKA 3KH7A 3LQ7A 3GURA 4EF0A 5GAPD 5HFGA 5D8IA 4HQSA 3L9VA 3H1NA 4KDXA 3IAM2 2L5OA 4OO5A 1DUGA 4XS4A 2ZNMA 2PUKC 1MD3A 4ECBA 2DMLA 3ERWA 4HEA2 4I2UA 3IPZA 1OC9A 1PKWA 3RBTA 2JU5A 4EDZA 2AJQB 1O7UA 1F2EA 5DALB 3GNJA 2LUSA 1OE8A 1XW6A 5HR3A 4HU7A 1X5CA 4PXOA 2NVLA 1U88A 4POBA 3VPQA 1F9MA 3HD5A 3QAGA 2IL3A 3DEXA 1V9WA 1XWCA 2NDOA 3G7IA 2C8UA 2OACA 4ZXGA 4PQIA 4IGJA 1OKTA 5ABRA 2B7KA 3HXSA 1BYEA 2WZ9A 2VL3A 2H72A 5ELAA 3A2VA 2DJ2A 1TXXA 2GSTA 3CSHA 1TJDA 2YJHA 3BOAA 9GSSA 1U3AA 1X5EA 2B5XA 3QR6A 4F0CA 1NW2A 2CX4A 2I3YA 1GSUA 4BVXA 2LNSA 2F8AA 4DSRA 4JBBA 1EEJA 3HVSA 1FHEA 5JWQB 4MJEA 4MP4A 3IK9A 2OE0A 5C04A 5HFKA 2GSRA 2VOCA 5JWOB 2YJ7A 4JU5A 2DJKA 4TN8A 4ULXA 3D0ZA 3LWAA 2H73A 1LBKA 4TR1B 3L4NA 5CRGA 3F9UA 2IFQB 4O92A 3I9V2 5ELGA 4IVFA 3GA4A 1R7HA 1GLPA 1EV4A 1X9SB 2DC5A 2EIQA 2L57A 5IM9A 17GSA 3EU3A 1EV9A 2H1AA 2RM6A 1Z5YE 2WDUA 5JCGA 4JEDA 4TW5A 1SKSB 2FD3A 3H79A 4O7HA 2YWIA 3L9SA 1MTCA 3APSA 3TKQA 5CP1A 2KLXA 2YN1A 3TRQA 4KA0A 2LKUA 2LJKA 5J41A 1ZL9A 1TOFA 4H86A 1RQMA 1FO5A 5C00A 2K6VA 4AJ6A 1H4OA 2MMNA 2X64A 2YV7A 3Q19A 4JR4A 2RUEA 3EMXA 2B1LA 3F6FA 3HCZA 4POKA 4TR4A 5ID2B 2XBQA 4N30A 4POMA 1FG4A 3HJMA 4XRDA 2R4VA 1K0CA 2H76A 2H6YA 1ILOA 3A2WA 2WS2A 4AF2A 4QL9A 3FKFA 4RQRA 4X1UA 5A4UA 5LNKe 2FWHA 4F03A 4KW6A 5IMZA 3TOTA 5AISA 3IDVA 4WF4A 1EP7A 1HD2A 4IBPA 3D4TA 2GT5A 2LJAA 3MDKA 6GSWA 4Q5RA 4X43A 3HA9A 4KSOA 1O6JA 1SL1B 3WGDA 2DBCA 3KD0A 1GH2A 1PSQA 2IMKA 2V6KA 2H01A 1ZYEA 22GSA 5H5SA 1YF0A 3DYRA 3GIXA 5LCZA 2V1MA 1K0MA 4IJ3A 1XW5A 4ISDA 3P90A 1XBSA 2GSQA 1TK0B 3F3RA 4ID0A 2E2MA 5DAKA 4HUAA 2B3SA 3G7YA 2VD0A 3GTUA 4GTUA 1QMVA 1TTZA 2H0IA 3GL5A 5DVBA 2ZCTA 1QGVA 2CVDA 3CRUA 3ERFA 1AQXA 5G2ZA 1XVQA 4WETA 1OC3A 3IR4A 1KBNA 1X9WB 3TRPA 4LL4B 3H93A 1QFNA 1OC8A 2VUPA 5F07A 1FW1A 2OE3A 2ES7A 2QSIA 1M99A 3HY2A 1SKRB 1I5GA 2OADA 5IMCA 2GZPA 3TKSC 3GN3A 1PD21 6GSSA 1ERUA 4PUAA 4IW9A 3IBHA 5DBQA 3LXTA 3ZVJD 1UA5A 3JCML 3CRTA 3PGTA 5CREA 2CX3A 4ZL9A 2L4QA 4ZB6A 2DMMA 1Y6EA 1IYHA 2B5EA 2N5FA 2HZEA 1WRYA 4MJAA 4K6XA 1ERWA 3LORA 2EC4A 1TKDB 1J9BA 3Q6OA 5D73A 4I6XA 4BPYA 3VI5A 3SBCA 3QDNA 2VL2C 4MH3A 4TOPA 1EOHA 1A8LA 1M9BA 5JCWA 3RPNA 1FVKA 5IOXA 2L5LA 6GSXA 1OYJA 4WEYA 6GSUA 4QQ7A 5CNWA 3KJYA 3UIWA 2GTUA 2VCTA 3TGZA 1USBA 3KTBA 3UBKA 3I69A 4OWYA 1I9DA 1PA3A 1VF3A 3CMIA 2VAFA 2XPEA 2H70A 4AJ8A 1WMJA 5DCHA 3QD9A 4GWRA 2R2JA 1GTIA 5DJLA 3UJ1A 5JWRB 3M3MA 1GL8A 3CYNA 3ZL5A 4K7OA 1NHYA 1XOBA 1DE2A 4J57E 2YZUA 2HXKA 5B8AA 4MZCA 1W89A 3UMAA 5KN2A 2HE3A 3H4KA 3GYKA 5EPFA 3GSSA 1AW9A 3WD6A 5A4WA 5B6MA 1QXHA 2MYGA 4YQVA 1XXUA 4OO4A 2X8HA 2BTOT 2V2GA 1Y25A 2YNXA 2F9SA 2IPAA 2YWMA 3MAKA 1ABAA 8GSSA 2VCZA 5FT3A 12GSA 1SD8A 3LYKA 3KIJA 4XHMA 5D93A 1A2LA 1A24A 4GQFA 10GSA 2GT6A 3DIEA 1JZDA 3U6VA 1AIUA 1PX7A 3GX0A 1S3AA 2L4CA 2B5YA 2AAWA 3WYWA 1HNBA 2KP1A 2FWGA 1GULA 4OFNA 11GSA 2H1BA 3CTFA 1XIYA 2YP6A 5D9XA 2FGXA 1AAZA 3M0FA 1S3DA 4ECJA 1EOGA 4XS1A 1A23A 4D73B 4MMMA 4N10A 2WFCA 4CW9A 2KOKA 3QFAC 19GSA 1XFLA 5G30A 3LXZA 3IOSA 1ML6A 2E2GA 2PWJA 1BAYA 4N0ZA 4XTSA 4KCAA 5D9TA 1GWCA 2LJRA 3TKRA 2VM1A 3M9KA 4KH7A 1SYXA 3TB2A 2CAIA 4ZBDA 1O73A 2BMXA 2WB9A 5DDLA 2H0GA 3IA1A 1Z3EA 4V2MA 2GGTA 3I6AA 1LU4A 3FR3A 3EU4A 2R5GA 1B48A 2AUVA 5H5RA 14GSA 5IO0A 2YWNA 2RUFA 1ZGNA 5B6NA 1TRSA 4IQ1A 3P8WA 5ECHB 1AQWA 3L9UA 2JSZA 2K8VA 2H6XA 5ECPB 2C3TA 2ON7A 3DD3A 1N2AA 2WCIA 4BA7A 3FK8A 2AYTA 3MSZA 3CXGA 4OD7A 2ON5A 4DSSB 4Q5QA 2LEGA 3M1GA 4MH2A 5CRDA 2LRCA 2MZCA 4F82A 1GNEA 3TDGA 2VLTA
chains in the Genus database with same CATH superfamily
3QCPA 5ECKB 4HZ4A 4GSTA 3TKPA 1U3IA 2BJXA 3TJJA 5IIZA 2O85A 3MYDA 2C1YA 4MA9A 2J23A 1SK2A 2DJ1A 5COHA 4EIQA 3KMNA 2TIRA 4KX4A 2XBIA 5J9BA 1XOAA 3C71A 4KSMA 3DRNA 2B6MA 2MMZA 3KXOA 2FWFA 4NPBA 5KEJA 4EDYA 5J9CA 1AUCA 1OAZA 3CTGA 1FOHA 1BQ7A 3GKMA 4JR6A 3W6GA 4ILFA 2WJUA 2HT9A 1R5PA 3N9JA 2LQQA 5BRTA 3FR6A 1TW9A 4PQ1A 4PQHA 3KGKA 1V2AA 2FHEA 3ZRDA 1F3BA 4XRAA 3EMPA 3ME8A 3GH6A 3KMOA 4KGIA 2FA8A 3TJGA 2DJJA 4V1Ap 3QAWA 1KTEA 1PL2A 5DALA 1THOA 3LFLA 1XWBA 3FZ4A 4IS0A 3KCMA 5EY6A 5GAND 1WOUA 1TK8B 4KDYA 3H8QA 1TRUA 2MBTA 4JZQA 2XC2A 4Q5FA 5J4UA 3G9BA 2N5BA 1K0AA 2CV4A 4K0GA 1FVJA 1Z6NA 3NIVA 3I43A 4TXVA 1XWGA 5KOWA 3KP8A 4MPGA 3LGCA 1M2AA 4YQUA 3IAS2 5ECOB 5G5FA 2NPBA 3WT2A 1PX6A 2O89A 1TRVA 4PGTA 7GSSA 4ZL8A 1YKCA 3GKXA 1GTAA 4TRXA 2PERA 1BG5A 1XWAA 2VCXA 1SL2B 2IIYA 1S3CA 1G6YA 3UL3A 3FW2A 4BWSA 3C7MA 2V6OA 5H5QA 4TR1A 5F05A 2IFQA 1AQVA 4ZB9A 1FAAA 1DBYA 3D22A 1W4VA 4KDUA 1DSBA 2PU9C 3HYPA 5E4WA 4TXOB 3GHAA 4Q5NA 4HZ2A 4HS1A 4MF6A 1A8YA 2JZRA 2C3NA 1KNGA 2H75A 3MWHA 4MF5A 4N11A 1SU9A 1EZKA 2H6ZA 5KOXA 4L0UA 4PUFC 1V57A 2CVKA 4YKGA 5ECQB 2CAQA 1A0RP 4NXIA 3IK7A 3GH9A 1GTUA 2O87A 1K0DA 3Q74A 2I81A 4PX1A 4I97A 2E0QA 3WGEA 4EXJA 4KCEA 4FO5A 4MZBA 2LRNA 1ON4A 1PQNA 5D96A 2GQMA 2HYXA 1VF2A 1K0NA 4EE0A 3ZVJA 2F8FA 3HVVA 4GSSA 3GMFA 5ID2A 4ICYA 4KAEA 4K7IA 4IJIA 1O8WA 3QOUA 1Z9HA 3DGQA 4ML6A 1E2YA 1DE1A 2XHFA 2CA8A 2R37A 1Z7RA 4FQUA 2HLSA 2DIYA 3RHBA 4BIKA 4EVMA 5F0GA 4O5RA 4HJ2A 3J7Yk 3F4SA 2LRTA 1TK5B 3NZNA 5CAXA 2CQ9A 1LJRA 1OKDA 1YEPA 3FZ9A 3GV1A 1O85A 2C4JA 3UEMA 1GUKA 3O76A 3APQA 1YQ1A 4I8BA 5HQPA 1AXDA 2CT6A 5ECLB 3TJKA 1JZWA 2H19A 1F37A 4J2FA 3E9JB 4DSQA 2AHEA 3US3A 1PL1A 2HRKA 2IMEA 3HKRA 3FEUA 5B8BA 4NHZA 1U6TA 1T7PB 3PR8A 1YDKA 3WT1A 3V1WA 2A2RA 4OCEA 3TCOA 4ZIJA 4BVYB 1GUMA 1MDJA 2HSYA 4N0VA 3A5WA 5A5KA 2VIMA 4FYUA 1SD9A 5J5NA 1G6WA 4P3YB 1SYRA 4WBRD 4HU9A 4IQAA 1GP1A 4K0NA 3QMXA 2EIRA 1HNCA 4WBJA 5E59A 3ZIVA 5G1KA 3FZAA 3TKSA 2HZFA 1M7TA 3EE2A 3FZ5A 3C8EA 2CZ2A 1GLQA 3EYTA 4L5LA 5HR1A 2IWTA 5F8BA 4G0KA 3EWLA 5ECMB 1K0OA 1FB0A 2QGVA 4TKYA 3ERGA 2EIOA 3HZ4A 4E8HA 1BX9A 2R3XA 2OKAA 2YWOA 3ZITA 1EGRA 1FB6A 1XZOA 5INYA 1SJZA 3BCIA 3W8JA 2VL2A 1Q4JA 2HNLA 4MK3A 5AIVA 2LNTA 1Z7PA 3MIXA 2MMAA 2L59A 4MPFA 1KEBA 1MDIA 4RI6A 1MDKA 4I2TA 4WR5A 3U5RE 2XPDA 4MF7A 2F3MA 2FWEA 3CBUA 3FR9A 6GSVA 2AV4A 3Q18A 3RDWA 1G0TA 3TOUA 2FUG2 2QA1A 2VLUA 1XVWA 2TRCP 3D4MA 4XS4B 2N5AA 3PH9A 1JLWA 4RQXA 4YAVA 4LA1A 1YEXA 3P7XA 3UVTA 1OC9B 3F8UA 2GZYA 4F9ZA 2V41A 5DCGA 1NSWA 5IO2A 4L0WA 2UZ8A 2P5RA 5A4VA 2R6KA 1JLVA 4G19A 4DEJA 3IC4A 4XIHA 3FY7A 4HI7A 3PINA 3M8NA 3VK9A 1Z6MA 2X99A 4EUYA 1ACVA 3ZIJA 2B1KA 1V40A 4KNDA 4JRRA 3ZREA 4ZBAA 5HFIA 4O32A 4G0LA 3A2XA 4MLYA 3GX8A 4WR4A 1PGTA 2GZZA 2VM2A 4BWQA 4FYBA 4Z7XA 2VD1A 5ECSA 3LW9A 1SK0A 3W8SA 1TU7A 2A4VA 2VL9A 1MEKA 2HRFA 2OE1A 2WRTA 2OA7A 5JCUA 4BVXB 3ISOA 4LL1B 2CVBA 4GF0A 3D21A 4K7NA 1R4WA 2HI7A 1YZXA 3VI7A 2D2ZA 3GRXA 3ZZXA 1U87A 1K3YA 4MJBA 1E6BA 3KEBA 1JHBA 3C1RA 4K2DA 4NHWA 4E8EA 3EC3A 4BL7A 1FOVA 1B8XA 1HNAA 1PKZA 1B9YC 4YAPA 2HSHA 4NAXA 1GSFA 2JZTA 20GSA 2VO4A 2LS5A 3RAZA 4EKZA 2I4AA 5IMFA 4TR0A 3FYGA 3VWUA 5IOWA 2DLXA 2IMFA 4AJ7A 1TDIA 1T8EB 2JACA 1YJ6A 1GSDA 1NHOA 4EL1A 1Q98A 4D73A 5AIXA 3GUSA 4JE1A 3VWXA 5J3RA 3ZYWA 3BBYA 4IP1A 2L6DA 3G7JA 5KN3A 1PRXA 1ZCPA 4F2IA 3A3TA 3C73A 1S3RA 1ERTA 13GSA 4G9HA 4EO3A 3RHCA 1GSSA 2H1DA 2H8LA 5IPHA 4WF5A 3E3EA 1JZOA 1OVNA 3KM6A 6GSYA 2HSMA 1GSEA 3EURA 3F4RA 3J7Yb 1F6MC 2RIIA 3UVHA 2OBIA 1V98A 2GLRA 2LQOA 1GNWA 2FNOA 5L71A 2FA4A 2PVQA 1MD4A 3O3TA 4X0XA 1X9MB 3F3QA 2H74A 1CQHA 4NWYA 5ENUA 3S9FA 2OJLA 4CDOA 2VLVA 1GTBA 4NV5A 1UN2A 4EC0A 4OFTA 5G1LA 3ZFBA 4AGSA 1PN9A 4DSSA 1G7OA 3TJFA 4LLRA 1ZYNA 3BD2A 4HQZA 2K8SA 2C3QA 3TUEA 1EGOA 1T00A 4F0BA 1K3LA 2RLIA 4OFMA 5DAKB 3VPTA 1ZYPA 2C0GA 2QC7A 3GTUB 2LSTA 1T1VA 1NM3A 4QL7A 2LV3A 1YY7A 2YPMA 1AC1A 4ZBBA 2L6CA 4KB3A 1OE7A 3FHKA 3SWLA 4K1FA 2O8VB 4K9ZA 4K8MA 1K0BA 6GSTA 3LEFA 4MCUA 2IMDA 2I9HA 3BJ5A 2JSYA 2H30A 4PNFA 4IHUA 4L5OA 1WIKA 3LYPA 4IELA 5CO3A 1TP9A 5DQSA 2JZSA 2GVPA 1ST9A 3VWVA 1SJ6A 3TKSE 5CYYA 1A2MA 2PBJA 3D5JA 4CY6A 1GUHA 2HFDA 5F06A 2WGRA 3AY8A 2GS3A 2REMA 3LJRA 2HZEB 3VLNA 2YCDA 2TRXA 3LG6A 4GCIA 4YQMA 2H71A 5ECNB 2B7JA 1XG8A 1X5DA 1XPVA 5ECIB 2E7PA 2O7KA 1SJIA 3ZMLA 1HYUA 2P0GA 4XCSA 4POLA 1YKAA 3HZ8A 3TRXA 3VURA 4ZL7A 5HR0A 1YF1A 3EINA 4RUVA 3UARA 18GSA 3F0IA 2PN8A 4G2EA 3EVIA 1M0UA 3HDCA 4IP6A 3IE3A 1BJXA 5D9WA 3IC8A 3HJPA 4NMUA 3ZMKA 1J0FA 4IKHA 2QKEA 3L78A 1THXA 4J56E 1EP8A 4ECIA 2FCHA 3DXBA 3PPUA 3M9JA 1WPIA 2CZ3A 1B4QA 1X0RA 2ZUPA 2Z9SA 4HOJA 1WJKA 3F63A 1C72A 1SL0B 1CQGA 2WULA 3MNGA 2AB6A 5EL8A 5GZZB 3E0UA 3VFIA 2X49A 2OBKA 1GSQA 3WGXA 5B7CA 4FH8A 1SENA 1PMTA 3DWVA 4O5UA 4V1Ag 4WXTA 1IYIA 3IV4A 3KTLA 2C80A 5FHIA 5AGYA 4GSNA 4CY8A 1K3OA 1O8XA 4KF9A 1T4ZA 3CSIA 4FYCA 4V2NA 2H1GA 1TU8A 3IXRA 1M9AA 3GSTA 4ML1A 4PNGA 2GQKA 3NOFA 5CRHA 2IJYA 3D6IA 4LMVA 5G31A 4HJMA 2IN3A 1VRSD 4V2LA 4I5QA 3DMLA 2VCVA 4NV2A 1SK1A 3ZLPA 2G2QA 4KE3A 4TXOA 2R0PA 1TRWA 3KZQA 1JZRA 1T4YA 2FLSA 4FIWA 2A2SA 2R0CA 3GKNA 1B4PA 2I1UA 1M2DA 3ME7A 3GL3A 2PMTA 1ZYQB 3C1SA 2LTKA 1B9XC 3UBLA 4ZILA 16GSA 1PFOA 1XCCA 4KUNA 1ERVA 1UVZA 2MBSA 4G10A 2NBSA 5HR2A 2DKHA 1EEMA 3ZFLA 4MABA 3UOMA 3N5OA 2VCQA 3BCKA 3HJOA 3DKSA 3UAPA 1VGLA 5GSSA 3KH9A 3RPPA 1M2BA 2PVOC 3DVXA 2VCWA 2ALBA 5LD0A 5KN0A 4TR3A 2X8GA 3K8NA 2X8CA 3CSJA 3IRAA 4GQCA 4LMWA 1N8JA 3APOA 3GKKA 1EWXA 1WWJA 5IMDA 1VF4A 3F4TA 2K18A 1O81A 2M80A 3FRCA 4PURA 4WKWA 1TI3A 2H0HA 2YV9A 1GRXA 5ECRB 2HRNA 4ECCA 5IMVA 3R2QA 5GSTA 2RM5A 3KP9A 2C0EA 3R3EA 1SKWB 5G5EA 2M72A 4OMVA 2NTOA 5DJMA 2YZHA 3HHVA 2DIZA 2J9HA 1ZMAA 3QAVA 1A2JA 3DVWA 2DJ3A 3TJBA 3HVXA 2KP2A 5KN1A 2DJ0A 4MJCA 4L8EA 1UC7A 4GLTA 1URMA 1BEDA 5IQYA 2C0FA 4HDEA 1ZOFA 5CRWA 2GSSA 1T3BA 1H75A 5DQYA 2IMIA 2P5QA 4DVCA 4MZWA 4BVYA 2F51A 4USSA 1A0FA 2M46A 4TVEA 1TI1A 4ZB8A 1XW9A 5IPGA 4ACSA 1HQOA 4BL7B 1G7EA 4IN0A 4K2XA 4OCFA 2KUCA 2MMOA 2KHPA 2G0FA 5FWGA 1ZZYA 1R5AA 1QK8A 1QUWA 2YOIA 4XS6A 5EVOA 1GSYA 3QPMA 2GDRA 2YANA 4Z2TA 1J08A 3ZTLA 3VWWA 2V32A 4HSCX 4K5SA 1QQ2A 2JADA 3LSZA 4RI7A 2C0DA 1WP0A 2JL4A 4CHSA 3OR5A 4YH2A 3IHQA 3L0HA 2P31A 2K9FA 4MNNA 5D9VA 5IMAA 2GQLA 4GRFA 4X4JA 3O6TA 4GXZA 3P2AA 1WE0A 3GFKA 3QFBC 4MDCA 1JFUA 2PGTA 3ED3A 2DSAA 5AN1A 1R26A 3F6DA 1RW1A 2FY6A 2PPTA 1F3AA 1V58A 2H66A 1VF1A 1RK4A 1XWKA 3KH7A 3LQ7A 3GURA 4EF0A 5GAPD 5HFGA 5D8IA 4HQSA 3L9VA 3H1NA 4KDXA 3IAM2 2L5OA 4OO5A 1DUGA 4XS4A 2ZNMA 2PUKC 1MD3A 4ECBA 2DMLA 3ERWA 4HEA2 4I2UA 3IPZA 1OC9A 1PKWA 3RBTA 2JU5A 4EDZA 2AJQB 1O7UA 1F2EA 5DALB 2R0GA 3GNJA 2LUSA 1OE8A 3HVNA 4A5PA 1XW6A 5HR3A 4HU7A 1X5CA 4PXOA 4EIPA 2NVLA 1U88A 4POBA 3VPQA 1F9MA 3HD5A 3QAGA 2IL3A 3DEXA 1V9WA 1XWCA 2NDOA 3G7IA 2C8UA 2OACA 4O5QA 4ZXGA 4PQIA 4IGJA 1OKTA 5ABRA 2B7KA 4Z2UA 3HXSA 1BYEA 2WZ9A 2VL3A 2H72A 5ELAA 3A2VA 2DJ2A 1TXXA 2GSTA 3CSHA 1TJDA 2YJHA 3BOAA 9GSSA 1U3AA 1X5EA 2B5XA 3QR6A 4F0CA 1NW2A 2CX4A 2I3YA 1GSUA 4BVXA 2LNSA 2F8AA 4DSRA 4JBBA 1EEJA 3HVSA 1FHEA 5JWQB 4MJEA 4MP4A 3IK9A 2OE0A 5C04A 5HFKA 2GSRA 2VOCA 5JWOB 2YJ7A 4Z2RA 4JU5A 2DJKA 4TN8A 4ULXA 3D0ZA 3LWAA 2H73A 1LBKA 4TR1B 3L4NA 5CRGA 3F9UA 2IFQB 4O92A 3I9V2 5ELGA 4IVFA 3GA4A 1R7HA 1GLPA 1EV4A 1X9SB 2DC5A 2EIQA 2L57A 5IM9A 17GSA 3EU3A 1EV9A 2H1AA 2RM6A 1Z5YE 2WDUA 5JCGA 4JEDA 4K5RA 4TW5A 1SKSB 2FD3A 3H79A 4O7HA 2YWIA 3L9SA 1MTCA 3APSA 3TKQA 5CP1A 2KLXA 2YN1A 3TRQA 4KA0A 2LKUA 2LJKA 5J41A 1ZL9A 1TOFA 4H86A 1RQMA 1FO5A 5C00A 2K6VA 4AJ6A 1H4OA 2MMNA 2X64A 2YV7A 3Q19A 4JR4A 2RUEA 3EMXA 2B1LA 3F6FA 3HCZA 4POKA 4TR4A 5ID2B 2XBQA 4N30A 4POMA 1FG4A 3HJMA 4XRDA 2R4VA 1K0CA 2H76A 2H6YA 1ILOA 3A2WA 2WS2A 4AF2A 4QL9A 3FKFA 4RQRA 4X1UA 5A4UA 5LNKe 2FWHA 4F03A 4KW6A 5IMZA 3TOTA 5AISA 3IDVA 4WF4A 1EP7A 1HD2A 4IBPA 3D4TA 4PTSA 2GT5A 2DKIA 2LJAA 3MDKA 6GSWA 4Q5RA 4X43A 3HA9A 4KSOA 1O6JA 1SL1B 3WGDA 2DBCA 3KD0A 1GH2A 1PSQA 2IMKA 2V6KA 2H01A 1ZYEA 22GSA 5H5SA 1YF0A 3DYRA 3GIXA 5LCZA 2V1MA 1K0MA 4IJ3A 1XW5A 4ISDA 3P90A 1XBSA 2GSQA 1TK0B 3F3RA 4ID0A 2E2MA 5DAKA 4HUAA 2B3SA 3G7YA 2VD0A 3GTUA 4GTUA 1QMVA 1TTZA 2H0IA 3GL5A 5DVBA 2ZCTA 1QGVA 2CVDA 3CRUA 3ERFA 1AQXA 5G2ZA 1XVQA 1M3JA 4WETA 1OC3A 3IR4A 1KBNA 1X9WB 3TRPA 4LL4B 3H93A 1QFNA 1OC8A 2VUPA 5F07A 1FW1A 2OE3A 2ES7A 2QSIA 1M99A 3HY2A 1SKRB 1I5GA 2OADA 5IMCA 2GZPA 3TKSC 2X4AA 3GN3A 1PD21 6GSSA 1ERUA 4G0IA 4PUAA 4IW9A 3IBHA 5DBQA 3LXTA 3ZVJD 1UA5A 3JCML 3CRTA 3PGTA 5CREA 1M3IA 2CX3A 4ZL9A 2L4QA 4ZB6A 2DMMA 1Y6EA 1IYHA 2B5EA 2N5FA 2HZEA 1WRYA 4MJAA 4K6XA 1ERWA 3LORA 2EC4A 1TKDB 1J9BA 3Q6OA 5D73A 4I6XA 4BPYA 3VI5A 3SBCA 3QDNA 2VL2C 4MH3A 4TOPA 1EOHA 1A8LA 1M9BA 5JCWA 3RPNA 1FVKA 5IOXA 2L5LA 6GSXA 1OYJA 4WEYA 6GSUA 4QQ7A 5CNWA 3KJYA 3UIWA 2GTUA 2VCTA 4YKFA 3TGZA 1USBA 3KTBA 3UBKA 3I69A 4OWYA 1I9DA 1PA3A 1VF3A 3CMIA 2VAFA 2XPEA 2H70A 4AJ8A 5BMUA 2A4HA 1WMJA 5DCHA 3QD9A 4GWRA 2R2JA 1GTIA 5DJLA 3UJ1A 5JWRB 3M3MA 1GL8A 3CYNA 2QA2A 3ZL5A 4K7OA 1NHYA 2HRAA 1XOBA 1DE2A 3EPTA 3IHGA 4J57E 2YZUA 2HXKA 5B8AA 4MZCA 1W89A 3UMAA 5KN2A 2HE3A 3H4KA 2A2PA 3GYKA 5EPFA 3GSSA 1AW9A 3WD6A 5A4WA 5B6MA 1QXHA 2MYGA 4YQVA 1XXUA 4OO4A 2X8HA 2BTOT 2V2GA 1Y25A 2YNXA 2F9SA 2IPAA 2YWMA 3MAKA 1ABAA 8GSSA 2VCZA 5FT3A 12GSA 1SD8A 3LYKA 3KIJA 4XHMA 5D93A 1A2LA 1A24A 4GQFA 10GSA 2GT6A 3DIEA 1JZDA 3CQFA 3U6VA 1AIUA 1PX7A 3GX0A 1S3AA 2L4CA 2B5YA 2AAWA 3WYWA 1HNBA 2KP1A 2FWGA 1GULA 4OFNA 11GSA 2H1BA 3CTFA 1XIYA 2YP6A 5D9XA 2FGXA 1AAZA 3M0FA 1S3DA 4ECJA 1EOGA 4XS1A 1A23A 4D73B 3FMWA 4MMMA 4N10A 2WFCA 4CW9A 2KOKA 3QFAC 19GSA 1XFLA 5G30A 3LXZA 3IOSA 1ML6A 2E2GA 2PWJA 1BAYA 4N0ZA 4XTSA 4KCAA 5D9TA 1GWCA 2LJRA 3TKRA 2VM1A 3M9KA 4KH7A 1SYXA 3TB2A 2CAIA 4ZBDA 1O73A 2BMXA 2WB9A 5DDLA 2H0GA 3IA1A 1Z3EA 4V2MA 2GGTA 3I6AA 1LU4A 3FR3A 3EU4A 2R5GA 1B48A 2AUVA 5H5RA 14GSA 5IO0A 2YWNA 2RUFA 1PN0A 1ZGNA 5B6NA 1TRSA 4IQ1A 3P8WA 5ECHB 1AQWA 3L9UA 2JSZA 2K8VA 2H6XA 5ECPB 2C3TA 2ON7A 3DD3A 1N2AA 2WCIA 4BA7A 3FK8A 2AYTA 3MSZA 3CXGA 4OD7A 2ON5A 4DSSB 4Q5QA 2LEGA 3M1GA 4MH2A 5CRDA 2LRCA 2MZCA 4F82A 3A5IA 1GNEA 3TDGA 2VLTA
chains in the Genus database with same CATH topology
3QCPA 5ECKB 4HZ4A 4GSTA 3TKPA 1U3IA 2BJXA 3TJJA 5IIZA 2O85A 3MYDA 2C1YA 4MA9A 2J23A 1SK2A 2DJ1A 5COHA 4EIQA 3KMNA 2TIRA 4KX4A 2XBIA 5J9BA 1XOAA 3C71A 4KSMA 3DRNA 2B6MA 2MMZA 3KXOA 2FWFA 4NPBA 5KEJA 4EDYA 5J9CA 1AUCA 1OAZA 3CTGA 1FOHA 1BQ7A 3GKMA 4JR6A 3W6GA 4ILFA 2WJUA 2HT9A 1R5PA 3N9JA 2LQQA 5BRTA 3FR6A 1TW9A 4PQ1A 4PQHA 3KGKA 1V2AA 2FHEA 3ZRDA 1F3BA 4XRAA 3EMPA 3ME8A 3GH6A 3KMOA 4KGIA 2FA8A 3TJGA 2DJJA 4V1Ap 3QAWA 1KTEA 1PL2A 5DALA 1THOA 3LFLA 1XWBA 3FZ4A 4IS0A 3KCMA 5EY6A 5GAND 1WOUA 1TK8B 4KDYA 3H8QA 1TRUA 2MBTA 4JZQA 2XC2A 4Q5FA 5J4UA 3G9BA 2N5BA 1K0AA 2CV4A 4K0GA 1FVJA 1Z6NA 3NIVA 3I43A 4TXVA 1XWGA 5KOWA 3KP8A 4MPGA 3LGCA 1M2AA 4YQUA 3IAS2 5ECOB 5G5FA 2NPBA 3WT2A 1PX6A 2O89A 1TRVA 4PGTA 7GSSA 4ZL8A 1YKCA 3GKXA 1GTAA 4TRXA 2PERA 1BG5A 1XWAA 2VCXA 1SL2B 2IIYA 1S3CA 1G6YA 3UL3A 3FW2A 4BWSA 3C7MA 2V6OA 5H5QA 4TR1A 5F05A 2IFQA 1AQVA 4ZB9A 1FAAA 1DBYA 3D22A 1W4VA 4KDUA 1DSBA 2PU9C 3HYPA 5E4WA 4TXOB 3GHAA 4Q5NA 4HZ2A 4HS1A 4MF6A 1A8YA 2JZRA 2C3NA 1KNGA 2H75A 3MWHA 4MF5A 4N11A 1SU9A 1EZKA 2H6ZA 5KOXA 4L0UA 4PUFC 1V57A 2CVKA 4YKGA 5ECQB 2CAQA 1A0RP 4NXIA 3IK7A 3GH9A 1GTUA 2O87A 1K0DA 3Q74A 2I81A 4PX1A 4I97A 2E0QA 3WGEA 4EXJA 4KCEA 4FO5A 4MZBA 2LRNA 1ON4A 1PQNA 5D96A 2GQMA 2HYXA 1VF2A 1K0NA 4EE0A 3ZVJA 2F8FA 3HVVA 4GSSA 3GMFA 5ID2A 4ICYA 4KAEA 4K7IA 4IJIA 1O8WA 3QOUA 1Z9HA 3DGQA 4ML6A 1E2YA 1DE1A 2XHFA 2CA8A 2R37A 1Z7RA 4FQUA 2HLSA 2DIYA 3RHBA 4EVMA 5F0GA 4O5RA 4HJ2A 3J7Yk 3F4SA 2LRTA 1TK5B 3NZNA 5CAXA 2CQ9A 1LJRA 1OKDA 1YEPA 3FZ9A 3GV1A 1O85A 2C4JA 3UEMA 1GUKA 3O76A 3APQA 1YQ1A 4I8BA 5HQPA 1AXDA 2CT6A 5ECLB 3TJKA 1JZWA 2H19A 1F37A 4J2FA 3E9JB 4DSQA 2AHEA 3US3A 1PL1A 2HRKA 2IMEA 3HKRA 3FEUA 5B8BA 4NHZA 1U6TA 1T7PB 3PR8A 1YDKA 3WT1A 3V1WA 2A2RA 4OCEA 3TCOA 4ZIJA 4BVYB 1GUMA 1MDJA 2HSYA 4N0VA 3A5WA 5A5KA 2VIMA 4FYUA 1SD9A 5J5NA 1G6WA 4P3YB 1SYRA 4WBRD 4HU9A 4IQAA 1GP1A 4K0NA 3QMXA 2EIRA 1HNCA 4WBJA 5E59A 3ZIVA 5G1KA 3FZAA 3TKSA 2HZFA 1M7TA 3EE2A 3FZ5A 3C8EA 2CZ2A 1GLQA 3EYTA 4L5LA 5HR1A 2IWTA 5F8BA 4G0KA 3EWLA 5ECMB 1K0OA 1FB0A 2QGVA 4TKYA 3ERGA 2EIOA 3HZ4A 4E8HA 1BX9A 2R3XA 2OKAA 2YWOA 3ZITA 1EGRA 1FB6A 1XZOA 5INYA 1SJZA 3BCIA 3W8JA 2VL2A 1Q4JA 2HNLA 4MK3A 5AIVA 2LNTA 1Z7PA 3MIXA 2MMAA 2L59A 4MPFA 1KEBA 1MDIA 4RI6A 1MDKA 4I2TA 4WR5A 3U5RE 2XPDA 4MF7A 2F3MA 2FWEA 3CBUA 3FR9A 6GSVA 2AV4A 3Q18A 3RDWA 1G0TA 3TOUA 2FUG2 2QA1A 2VLUA 1XVWA 2TRCP 3D4MA 4XS4B 2N5AA 3PH9A 1JLWA 4RQXA 4YAVA 4LA1A 1YEXA 3P7XA 3UVTA 1OC9B 3F8UA 2GZYA 4F9ZA 2V41A 5DCGA 1NSWA 5IO2A 4L0WA 2UZ8A 2P5RA 5A4VA 2R6KA 1JLVA 4G19A 4DEJA 3IC4A 4XIHA 3FY7A 4HI7A 3PINA 3M8NA 3VK9A 1Z6MA 2X99A 4EUYA 1ACVA 3ZIJA 2B1KA 1V40A 4KNDA 4JRRA 3ZREA 4ZBAA 5HFIA 4O32A 4G0LA 3A2XA 4MLYA 3GX8A 4WR4A 1PGTA 2GZZA 2VM2A 4BWQA 4FYBA 4Z7XA 2VD1A 5ECSA 3LW9A 1SK0A 3W8SA 1TU7A 2A4VA 2VL9A 1MEKA 2HRFA 2OE1A 2WRTA 2OA7A 5JCUA 4BVXB 3ISOA 4LL1B 2CVBA 4GF0A 3D21A 4K7NA 1R4WA 2HI7A 1YZXA 3VI7A 2D2ZA 3GRXA 3ZZXA 1U87A 1K3YA 4MJBA 1E6BA 3KEBA 1JHBA 3C1RA 4K2DA 4NHWA 4E8EA 3EC3A 4BL7A 1FOVA 1B8XA 1HNAA 1PKZA 1B9YC 4YAPA 2HSHA 4NAXA 1GSFA 2JZTA 20GSA 2VO4A 2LS5A 3RAZA 4EKZA 2I4AA 5IMFA 4TR0A 3FYGA 3VWUA 5IOWA 2DLXA 2IMFA 4AJ7A 1TDIA 1T8EB 2JACA 1YJ6A 1GSDA 1NHOA 4EL1A 1Q98A 4D73A 5AIXA 3GUSA 4JE1A 3VWXA 5J3RA 3ZYWA 3BBYA 4IP1A 2L6DA 3G7JA 5KN3A 1PRXA 1ZCPA 4F2IA 3A3TA 3C73A 1ERTA 13GSA 4G9HA 4EO3A 3RHCA 1GSSA 2H1DA 2H8LA 5IPHA 4WF5A 3E3EA 1JZOA 1OVNA 3KM6A 6GSYA 2HSMA 1GSEA 3EURA 3F4RA 3J7Yb 1F6MC 2RIIA 3UVHA 2OBIA 1V98A 2GLRA 2LQOA 1GNWA 2FNOA 5L71A 2FA4A 2PVQA 1MD4A 3O3TA 4X0XA 1X9MB 3F3QA 2H74A 1CQHA 4NWYA 5ENUA 3S9FA 2OJLA 4CDOA 2VLVA 1GTBA 4NV5A 1UN2A 4EC0A 4OFTA 5G1LA 3ZFBA 4AGSA 1PN9A 4DSSA 1G7OA 3TJFA 4LLRA 1ZYNA 3BD2A 4HQZA 2K8SA 2C3QA 3TUEA 1EGOA 1T00A 4F0BA 1K3LA 2RLIA 4OFMA 5DAKB 3VPTA 1ZYPA 2C0GA 2QC7A 3GTUB 2LSTA 1T1VA 1NM3A 4QL7A 2LV3A 1YY7A 2YPMA 1AC1A 4ZBBA 2L6CA 4KB3A 1OE7A 3FHKA 3SWLA 4K1FA 2O8VB 4K9ZA 4K8MA 1K0BA 6GSTA 3LEFA 4MCUA 2IMDA 2I9HA 3BJ5A 2JSYA 2H30A 4PNFA 4IHUA 4L5OA 1WIKA 3LYPA 4IELA 5CO3A 1TP9A 5DQSA 2JZSA 2GVPA 1ST9A 3VWVA 1SJ6A 3TKSE 5CYYA 1A2MA 2PBJA 3D5JA 4CY6A 1GUHA 2HFDA 5F06A 2WGRA 3AY8A 2GS3A 2REMA 3LJRA 2HZEB 3VLNA 2YCDA 2TRXA 3LG6A 4GCIA 4YQMA 2H71A 5ECNB 2B7JA 1X5DA 1XPVA 5ECIB 2E7PA 2O7KA 1SJIA 3ZMLA 1HYUA 2P0GA 4XCSA 4POLA 1YKAA 3HZ8A 3TRXA 3VURA 4ZL7A 5HR0A 1YF1A 3EINA 4RUVA 3UARA 18GSA 3F0IA 2PN8A 4G2EA 3EVIA 1M0UA 3HDCA 4IP6A 3IE3A 1BJXA 5D9WA 3IC8A 3HJPA 4NMUA 3ZMKA 1J0FA 4IKHA 2QKEA 3L78A 1THXA 4J56E 1EP8A 4ECIA 2FCHA 3DXBA 3PPUA 3M9JA 1WPIA 2CZ3A 1B4QA 1X0RA 2ZUPA 2Z9SA 4HOJA 1WJKA 3F63A 1C72A 1SL0B 1CQGA 2WULA 3MNGA 2AB6A 5EL8A 5GZZB 3E0UA 3VFIA 2X49A 2OBKA 1GSQA 3WGXA 5B7CA 4FH8A 1SENA 1PMTA 3DWVA 4O5UA 4V1Ag 4WXTA 1IYIA 3IV4A 3KTLA 2C80A 5FHIA 5AGYA 4GSNA 4CY8A 1K3OA 1O8XA 4KF9A 1T4ZA 3CSIA 4FYCA 4V2NA 2H1GA 1TU8A 3IXRA 1M9AA 3GSTA 4ML1A 4PNGA 2GQKA 3NOFA 5CRHA 2IJYA 3D6IA 4LMVA 5G31A 4HJMA 2IN3A 1VRSD 4V2LA 4I5QA 3DMLA 2VCVA 4NV2A 1SK1A 3ZLPA 2G2QA 4KE3A 4TXOA 2R0PA 1TRWA 3KZQA 1JZRA 1T4YA 2FLSA 4FIWA 2A2SA 2R0CA 3GKNA 1B4PA 2I1UA 1M2DA 3ME7A 3GL3A 2PMTA 1ZYQB 3C1SA 2LTKA 1B9XC 3UBLA 4ZILA 16GSA 1XCCA 4KUNA 1ERVA 1UVZA 2MBSA 4G10A 2NBSA 5HR2A 2DKHA 1EEMA 3ZFLA 4MABA 3UOMA 3N5OA 2VCQA 3BCKA 3HJOA 3DKSA 3UAPA 1VGLA 5GSSA 3KH9A 3RPPA 1M2BA 2PVOC 3DVXA 2VCWA 2ALBA 5LD0A 5KN0A 4TR3A 2X8GA 3K8NA 2X8CA 3CSJA 3IRAA 4GQCA 4LMWA 1N8JA 3APOA 3GKKA 1EWXA 1WWJA 5IMDA 1VF4A 3F4TA 2K18A 1O81A 2M80A 3FRCA 4PURA 4WKWA 1TI3A 2H0HA 2YV9A 1GRXA 5ECRB 2HRNA 4ECCA 5IMVA 3R2QA 5GSTA 2RM5A 3KP9A 2C0EA 3R3EA 1SKWB 5G5EA 2M72A 4OMVA 2NTOA 5DJMA 2YZHA 3HHVA 2DIZA 2J9HA 1ZMAA 3QAVA 1A2JA 3DVWA 2DJ3A 3TJBA 3HVXA 2KP2A 5KN1A 2DJ0A 4MJCA 4L8EA 1UC7A 4GLTA 1URMA 1BEDA 5IQYA 2C0FA 4HDEA 1ZOFA 5CRWA 2GSSA 1T3BA 1H75A 5DQYA 2IMIA 2P5QA 4DVCA 4MZWA 4BVYA 2F51A 4USSA 1A0FA 2M46A 4TVEA 1TI1A 4ZB8A 1XW9A 5IPGA 4ACSA 1HQOA 4BL7B 1G7EA 4IN0A 4K2XA 4OCFA 2KUCA 2MMOA 2KHPA 2G0FA 5FWGA 1ZZYA 1R5AA 1QK8A 1QUWA 2YOIA 4XS6A 5EVOA 1GSYA 3QPMA 2GDRA 2YANA 4Z2TA 1J08A 3ZTLA 3VWWA 2V32A 4K5SA 1QQ2A 2JADA 3LSZA 4RI7A 2C0DA 1WP0A 2JL4A 4CHSA 3OR5A 4YH2A 3IHQA 3L0HA 2P31A 2K9FA 4MNNA 5D9VA 5IMAA 2GQLA 4GRFA 4X4JA 3O6TA 4GXZA 3P2AA 1WE0A 3GFKA 3QFBC 4MDCA 1JFUA 2PGTA 3ED3A 2DSAA 5AN1A 1R26A 3F6DA 1RW1A 2FY6A 2PPTA 1F3AA 1V58A 2H66A 1VF1A 1RK4A 1XWKA 3KH7A 3LQ7A 3GURA 4EF0A 5GAPD 5HFGA 5D8IA 4HQSA 3L9VA 3H1NA 4KDXA 3IAM2 2L5OA 4OO5A 1DUGA 4XS4A 2ZNMA 2PUKC 1MD3A 4ECBA 2DMLA 3ERWA 4HEA2 4I2UA 3IPZA 1OC9A 1PKWA 3RBTA 2JU5A 4EDZA 2AJQB 1O7UA 1F2EA 5DALB 2R0GA 3GNJA 2LUSA 1OE8A 4A5PA 1XW6A 5HR3A 4HU7A 1X5CA 4PXOA 4EIPA 2NVLA 1U88A 4POBA 3VPQA 1F9MA 3HD5A 3QAGA 2IL3A 3DEXA 1V9WA 1XWCA 2NDOA 3G7IA 2C8UA 2OACA 4O5QA 4ZXGA 4PQIA 4IGJA 1OKTA 5ABRA 2B7KA 4Z2UA 3HXSA 1BYEA 2WZ9A 2VL3A 2H72A 5ELAA 3A2VA 2DJ2A 1TXXA 2GSTA 3CSHA 1TJDA 2YJHA 3BOAA 9GSSA 1U3AA 1X5EA 2B5XA 3QR6A 4F0CA 1NW2A 2CX4A 2I3YA 1GSUA 4BVXA 2LNSA 2F8AA 4DSRA 4JBBA 1EEJA 3HVSA 1FHEA 5JWQB 4MJEA 4MP4A 3IK9A 2OE0A 5C04A 5HFKA 2GSRA 2VOCA 5JWOB 2YJ7A 4Z2RA 4JU5A 2DJKA 4TN8A 4ULXA 3D0ZA 3LWAA 2H73A 1LBKA 4TR1B 3L4NA 5CRGA 3F9UA 2IFQB 4O92A 3I9V2 5ELGA 4IVFA 3GA4A 1R7HA 1GLPA 1EV4A 1X9SB 2DC5A 2EIQA 2L57A 5IM9A 17GSA 3EU3A 1EV9A 2H1AA 2RM6A 1Z5YE 2WDUA 5JCGA 4JEDA 4K5RA 4TW5A 1SKSB 2FD3A 3H79A 4O7HA 2YWIA 3L9SA 1MTCA 3APSA 3TKQA 5CP1A 2KLXA 2YN1A 3TRQA 4KA0A 2LKUA 2LJKA 5J41A 1ZL9A 1TOFA 4H86A 1RQMA 1FO5A 5C00A 2K6VA 4AJ6A 1H4OA 2MMNA 2X64A 2YV7A 3Q19A 4JR4A 2RUEA 3EMXA 2B1LA 3F6FA 3HCZA 4POKA 4TR4A 5ID2B 2XBQA 4N30A 4POMA 1FG4A 3HJMA 4XRDA 2R4VA 1K0CA 2H76A 2H6YA 1ILOA 3A2WA 2WS2A 4AF2A 4QL9A 3FKFA 4RQRA 4X1UA 5A4UA 5LNKe 2FWHA 4F03A 4KW6A 5IMZA 3TOTA 5AISA 3IDVA 4WF4A 1EP7A 1HD2A 4IBPA 3D4TA 4PTSA 2GT5A 2DKIA 2LJAA 3MDKA 6GSWA 4Q5RA 4X43A 3HA9A 4KSOA 1O6JA 1SL1B 3WGDA 2DBCA 3KD0A 1GH2A 1PSQA 2IMKA 2V6KA 2H01A 1ZYEA 22GSA 5H5SA 1YF0A 3DYRA 3GIXA 5LCZA 2V1MA 1K0MA 4IJ3A 1XW5A 4ISDA 3P90A 1XBSA 2GSQA 1TK0B 3F3RA 4ID0A 2E2MA 5DAKA 4HUAA 2B3SA 3G7YA 2VD0A 3GTUA 4GTUA 1QMVA 1TTZA 2H0IA 3GL5A 5DVBA 2ZCTA 1QGVA 2CVDA 3CRUA 3ERFA 1AQXA 5G2ZA 1XVQA 4WETA 1OC3A 3IR4A 1KBNA 1X9WB 3TRPA 4LL4B 3H93A 1QFNA 1OC8A 2VUPA 5F07A 1FW1A 2OE3A 2ES7A 2QSIA 1M99A 3HY2A 1SKRB 1I5GA 2OADA 5IMCA 2GZPA 3TKSC 2X4AA 3GN3A 1PD21 6GSSA 1ERUA 4G0IA 4PUAA 4IW9A 3IBHA 5DBQA 3LXTA 3ZVJD 1UA5A 3JCML 3CRTA 3PGTA 5CREA 2CX3A 4ZL9A 2L4QA 4ZB6A 2DMMA 1Y6EA 1IYHA 2B5EA 2N5FA 2HZEA 1WRYA 4MJAA 4K6XA 1ERWA 3LORA 2EC4A 1TKDB 1J9BA 3Q6OA 5D73A 4I6XA 4BPYA 3VI5A 3SBCA 3QDNA 2VL2C 4MH3A 4TOPA 1EOHA 1A8LA 1M9BA 5JCWA 3RPNA 1FVKA 5IOXA 2L5LA 6GSXA 1OYJA 4WEYA 6GSUA 4QQ7A 5CNWA 3KJYA 3UIWA 2GTUA 2VCTA 4YKFA 3TGZA 1USBA 3KTBA 3UBKA 3I69A 4OWYA 1I9DA 1PA3A 1VF3A 3CMIA 2VAFA 2XPEA 2H70A 4AJ8A 5BMUA 2A4HA 1WMJA 5DCHA 3QD9A 4GWRA 2R2JA 1GTIA 5DJLA 3UJ1A 5JWRB 3M3MA 1GL8A 3CYNA 2QA2A 3ZL5A 4K7OA 1NHYA 2HRAA 1XOBA 1DE2A 3EPTA 3IHGA 4J57E 2YZUA 2HXKA 5B8AA 4MZCA 1W89A 3UMAA 5KN2A 2HE3A 3H4KA 2A2PA 3GYKA 5EPFA 3GSSA 1AW9A 3WD6A 5A4WA 5B6MA 1QXHA 2MYGA 4YQVA 1XXUA 4OO4A 2X8HA 2BTOT 2V2GA 1Y25A 2YNXA 2F9SA 2IPAA 2YWMA 3MAKA 1ABAA 8GSSA 2VCZA 5FT3A 12GSA 1SD8A 3LYKA 3KIJA 4XHMA 5D93A 1A2LA 1A24A 4GQFA 10GSA 2GT6A 3DIEA 1JZDA 3U6VA 1AIUA 1PX7A 3GX0A 1S3AA 2L4CA 2B5YA 2AAWA 3WYWA 1HNBA 2KP1A 2FWGA 1GULA 4OFNA 11GSA 2H1BA 3CTFA 1XIYA 2YP6A 5D9XA 2FGXA 1AAZA 3M0FA 1S3DA 4ECJA 1EOGA 4XS1A 1A23A 4D73B 3FMWA 4MMMA 4N10A 2WFCA 4CW9A 2KOKA 3QFAC 19GSA 1XFLA 5G30A 3LXZA 3IOSA 1ML6A 2E2GA 2PWJA 1BAYA 4N0ZA 4XTSA 4KCAA 5D9TA 1GWCA 2LJRA 3TKRA 2VM1A 3M9KA 4KH7A 1SYXA 3TB2A 2CAIA 4ZBDA 1O73A 2BMXA 2WB9A 5DDLA 2H0GA 3IA1A 1Z3EA 4V2MA 2GGTA 3I6AA 1LU4A 3FR3A 3EU4A 2R5GA 1B48A 2AUVA 5H5RA 14GSA 5IO0A 2YWNA 2RUFA 1PN0A 1ZGNA 5B6NA 1TRSA 4IQ1A 3P8WA 5ECHB 1AQWA 3L9UA 2JSZA 2K8VA 2H6XA 5ECPB 2C3TA 2ON7A 3DD3A 1N2AA 2WCIA 4BA7A 3FK8A 2AYTA 3MSZA 3CXGA 4OD7A 2ON5A 4DSSB 4Q5QA 2LEGA 3M1GA 4MH2A 5CRDA 2LRCA 2MZCA 4F82A 3A5IA 1GNEA 3TDGA 2VLTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QCP A;  5ECK B;  4HZ4 A;  4GST A;  3TKP A;  1U3I A;  2BJX A;  3TJJ A;  5IIZ A;  2O85 A;  4MA9 A;  2C1Y A;  2J23 A;  1SK2 A;  2DJ1 A;  5COH A;  3KMN A;  2TIR A;  4KX4 A;  2XBI A;  5J9B A;  1XOA A;  3C71 A;  4KSM A;  3DRN A;  2B6M A;  2MMZ A;  3KXO A;  2FWF A;  4NPB A;  5KEJ A;  4EDY A;  5J9C A;  1AUC A;  1OAZ A;  3CTG A;  1BQ7 A;  3GKM A;  4JR6 A;  3W6G A;  4ILF A;  2WJU A;  2HT9 A;  1R5P A;  3N9J A;  2LQQ A;  3FR6 A;  1TW9 A;  4PQ1 A;  4PQH A;  3KGK A;  1V2A A;  2FHE A;  3ZRD A;  1F3B A;  4XRA A;  3EMP A;  3ME8 A;  3GH6 A;  3KMO A;  4KGI A;  2FA8 A;  3TJG A;  2DJJ A;  4V1A p;  3QAW A;  1KTE A;  1PL2 A;  5DAL A;  1THO A;  3LFL A;  1XWB A;  3FZ4 A;  4IS0 A;  3KCM A;  5EY6 A;  5GAN D;  1WOU A;  1TK8 B;  4KDY A;  3H8Q A;  1TRU A;  2MBT A;  4JZQ A;  2XC2 A;  4Q5F A;  5J4U A;  3G9B A;  2N5B A;  1K0A A;  2CV4 A;  4K0G A;  1FVJ A;  1Z6N A;  3NIV A;  3I43 A;  4TXV A;  1XWG A;  3KP8 A;  4MPG A;  3LGC A;  1M2A A;  4YQU A;  3IAS 2;  5ECO B;  5G5F A;  2NPB A;  3WT2 A;  1PX6 A;  2O89 A;  1TRV A;  4PGT A;  7GSS A;  4ZL8 A;  1YKC A;  3GKX A;  1GTA A;  4TRX A;  2PER A;  1BG5 A;  1XWA A;  2VCX A;  1SL2 B;  2IIY A;  1S3C A;  1G6Y A;  3UL3 A;  3FW2 A;  4BWS A;  3C7M A;  2V6O A;  5H5Q A;  4TR1 A;  5F05 A;  2IFQ A;  1AQV A;  4ZB9 A;  1FAA A;  1DBY A;  3D22 A;  1W4V A;  4KDU A;  1DSB A;  2PU9 C;  3HYP A;  5E4W A;  4TXO B;  3GHA A;  4Q5N A;  4HZ2 A;  4HS1 A;  4MF6 A;  1A8Y A;  2JZR A;  2C3N A;  1KNG A;  2H75 A;  3MWH A;  4MF5 A;  4N11 A;  1SU9 A;  1EZK A;  2H6Z A;  4L0U A;  4PUF C;  1V57 A;  2CVK A;  5ECQ B;  2CAQ A;  1A0R P;  4NXI A;  3IK7 A;  3GH9 A;  1GTU A;  2O87 A;  1K0D A;  3Q74 A;  2I81 A;  4PX1 A;  4I97 A;  2E0Q A;  3WGE A;  4EXJ A;  4KCE A;  4FO5 A;  4MZB A;  2LRN A;  1ON4 A;  1PQN A;  5D96 A;  2GQM A;  2HYX A;  1VF2 A;  1K0N A;  4EE0 A;  3ZVJ A;  2F8F A;  3HVV A;  4GSS A;  3GMF A;  5ID2 A;  4KAE A;  4K7I A;  4IJI A;  1O8W A;  3QOU A;  1Z9H A;  3DGQ A;  4ML6 A;  1E2Y A;  1DE1 A;  2XHF A;  2CA8 A;  2R37 A;  1Z7R A;  2HLS A;  2DIY A;  3RHB A;  4EVM A;  5F0G A;  4O5R A;  4HJ2 A;  3J7Y k;  3F4S A;  2LRT A;  1TK5 B;  3NZN A;  5CAX A;  2CQ9 A;  1LJR A;  1OKD A;  1YEP A;  3FZ9 A;  3GV1 A;  1O85 A;  2C4J A;  3UEM A;  1GUK A;  3O76 A;  3APQ A;  1YQ1 A;  4I8B A;  5HQP A;  1AXD A;  2CT6 A;  5ECL B;  3TJK A;  1JZW A;  2H19 A;  1F37 A;  4J2F A;  3E9J B;  4DSQ A;  2AHE A;  3US3 A;  1PL1 A;  2IME A;  3HKR A;  3FEU A;  5B8B A;  4NHZ A;  1U6T A;  1T7P B;  3PR8 A;  1YDK A;  3WT1 A;  3V1W A;  2A2R A;  4OCE A;  3TCO A;  4ZIJ A;  1GUM A;  1MDJ A;  2HSY A;  4N0V A;  3A5W A;  5A5K A;  2VIM A;  4FYU A;  1SD9 A;  5J5N A;  1G6W A;  4P3Y B;  1SYR A;  4WBR D;  4HU9 A;  4IQA A;  1GP1 A;  4K0N A;  3QMX A;  2EIR A;  1HNC A;  4WBJ A;  5E59 A;  3ZIV A;  5G1K A;  3FZA A;  3TKS A;  2HZF A;  1M7T A;  3EE2 A;  3FZ5 A;  3C8E A;  2CZ2 A;  1GLQ A;  3EYT A;  4L5L A;  5HR1 A;  2IWT A;  5F8B A;  3EWL A;  5ECM B;  1K0O A;  1FB0 A;  2QGV A;  4TKY A;  3ERG A;  2EIO A;  3HZ4 A;  4E8H A;  1BX9 A;  2R3X A;  2OKA A;  2YWO A;  3ZIT A;  1EGR A;  1FB6 A;  1XZO A;  5INY A;  1SJZ A;  3BCI A;  3W8J A;  2VL2 A;  1Q4J A;  2HNL A;  4MK3 A;  5AIV A;  2LNT A;  1Z7P A;  2MMA A;  2L59 A;  4MPF A;  1KEB A;  1MDI A;  4RI6 A;  1MDK A;  4I2T A;  4WR5 A;  3U5R E;  2XPD A;  4MF7 A;  2F3M A;  2FWE A;  3CBU A;  3FR9 A;  6GSV A;  2AV4 A;  3Q18 A;  3RDW A;  1G0T A;  3TOU A;  2FUG 2;  2VLU A;  1XVW A;  2TRC P;  3D4M A;  4XS4 B;  2N5A A;  3PH9 A;  1JLW A;  4RQX A;  4YAV A;  4LA1 A;  1YEX A;  3P7X A;  3UVT A;  1OC9 B;  3F8U A;  2GZY A;  4F9Z A;  2V41 A;  5DCG A;  1NSW A;  5IO2 A;  4L0W A;  2P5R A;  5A4V A;  2R6K A;  1JLV A;  4G19 A;  4DEJ A;  3IC4 A;  4XIH A;  3FY7 A;  4HI7 A;  3PIN A;  3M8N A;  3VK9 A;  1Z6M A;  2X99 A;  4EUY A;  1ACV A;  3ZIJ A;  2B1K A;  1V40 A;  4KND A;  4JRR A;  3ZRE A;  4ZBA A;  5HFI A;  4O32 A;  3A2X A;  4MLY A;  3GX8 A;  4WR4 A;  1PGT A;  2GZZ A;  2VM2 A;  4BWQ A;  4FYB A;  4Z7X A;  2VD1 A;  5ECS A;  1SK0 A;  3W8S A;  1TU7 A;  2A4V A;  2VL9 A;  1MEK A;  2HRF A;  2OE1 A;  2WRT A;  2OA7 A;  5JCU A;  3ISO A;  4LL1 B;  2CVB A;  4GF0 A;  3D21 A;  4K7N A;  1R4W A;  2HI7 A;  1YZX A;  3VI7 A;  2D2Z A;  3GRX A;  3ZZX A;  1U87 A;  1K3Y A;  4MJB A;  1E6B A;  3KEB A;  1JHB A;  3C1R A;  4K2D A;  4NHW A;  4E8E A;  3EC3 A;  4BL7 A;  1FOV A;  1B8X A;  1HNA A;  1PKZ A;  1B9Y C;  4YAP A;  2HSH A;  4NAX A;  1GSF A;  2JZT A;  20GS A;  2VO4 A;  2LS5 A;  3RAZ A;  4EKZ A;  2I4A A;  5IMF A;  4TR0 A;  3FYG A;  3VWU A;  5IOW A;  2DLX A;  2IMF A;  4AJ7 A;  1TDI A;  1T8E B;  2JAC A;  1YJ6 A;  1GSD A;  1NHO A;  4EL1 A;  1Q98 A;  4D73 A;  5AIX A;  3GUS A;  4JE1 A;  3VWX A;  5J3R A;  3ZYW A;  3BBY A;  4IP1 A;  2L6D A;  3G7J A;  5KN3 A;  1PRX A;  1ZCP A;  4F2I A;  3A3T A;  3C73 A;  1ERT A;  13GS A;  4G9H A;  4EO3 A;  3RHC A;  1GSS A;  2H1D A;  2H8L A;  5IPH A;  4WF5 A;  3E3E A;  1JZO A;  1OVN A;  3KM6 A;  6GSY A;  1GSE A;  3EUR A;  3F4R A;  3J7Y b;  1F6M C;  2RII A;  3UVH A;  2OBI A;  1V98 A;  2GLR A;  2LQO A;  1GNW A;  2FNO A;  5L71 A;  2FA4 A;  2PVQ A;  1MD4 A;  3O3T A;  4X0X A;  1X9M B;  3F3Q A;  2H74 A;  1CQH A;  4NWY A;  5ENU A;  3S9F A;  2OJL A;  4CDO A;  2VLV A;  1GTB A;  4NV5 A;  1UN2 A;  4EC0 A;  4OFT A;  5G1L A;  3ZFB A;  4AGS A;  1PN9 A;  4DSS A;  1G7O A;  3TJF A;  4LLR A;  3BD2 A;  4HQZ A;  2K8S A;  2C3Q A;  3TUE A;  1EGO A;  1T00 A;  4F0B A;  1K3L A;  2RLI A;  4OFM A;  5DAK B;  3VPT A;  2C0G A;  2QC7 A;  3GTU B;  2LST A;  1T1V A;  1NM3 A;  4QL7 A;  2LV3 A;  1YY7 A;  2YPM A;  1AC1 A;  4ZBB A;  2L6C A;  4KB3 A;  1OE7 A;  3FHK A;  3SWL A;  4K1F A;  2O8V B;  4K9Z A;  4K8M A;  1K0B A;  6GST A;  3LEF A;  4MCU A;  2IMD A;  2I9H A;  3BJ5 A;  2JSY A;  2H30 A;  4PNF A;  4IHU A;  4L5O A;  1WIK A;  3LYP A;  4IEL A;  5CO3 A;  1TP9 A;  5DQS A;  2JZS A;  2GVP A;  1ST9 A;  3VWV A;  1SJ6 A;  3TKS E;  5CYY A;  1A2M A;  2PBJ A;  3D5J A;  1GUH A;  2HFD A;  5F06 A;  2WGR A;  3AY8 A;  2GS3 A;  2REM A;  3LJR A;  2HZE B;  3VLN A;  2YCD A;  2TRX A;  3LG6 A;  4GCI A;  4YQM A;  2H71 A;  5ECN B;  2B7J A;  1X5D A;  1XPV A;  5ECI B;  2E7P A;  2O7K A;  1SJI A;  3ZML A;  1HYU A;  2P0G A;  4XCS A;  4POL A;  1YKA A;  3HZ8 A;  3TRX A;  3VUR A;  4ZL7 A;  5HR0 A;  1YF1 A;  3EIN A;  4RUV A;  3UAR A;  18GS A;  3F0I A;  2PN8 A;  4G2E A;  3EVI A;  1M0U A;  3HDC A;  4IP6 A;  3IE3 A;  1BJX A;  5D9W A;  3HJP A;  4NMU A;  3ZMK A;  1J0F A;  4IKH A;  2QKE A;  3L78 A;  1THX A;  4J56 E;  1EP8 A;  4ECI A;  2FCH A;  3DXB A;  3M9J A;  1WPI A;  2CZ3 A;  1B4Q A;  1X0R A;  2ZUP A;  2Z9S A;  4HOJ A;  1WJK A;  3F63 A;  1C72 A;  1SL0 B;  1CQG A;  2WUL A;  3MNG A;  2AB6 A;  5EL8 A;  5GZZ B;  3E0U A;  3VFI A;  2OBK A;  1GSQ A;  3WGX A;  5B7C A;  4FH8 A;  1SEN A;  1PMT A;  3DWV A;  4V1A g;  4WXT A;  1IYI A;  3IV4 A;  3KTL A;  2C80 A;  5FHI A;  5AGY A;  4GSN A;  1K3O A;  1O8X A;  1T4Z A;  3CSI A;  4FYC A;  4V2N A;  2H1G A;  1TU8 A;  3IXR A;  1M9A A;  3GST A;  4ML1 A;  4PNG A;  2GQK A;  3NOF A;  5CRH A;  2IJY A;  3D6I A;  4LMV A;  5G31 A;  4HJM A;  2IN3 A;  1VRS D;  4V2L A;  4I5Q A;  3DML A;  2VCV A;  4NV2 A;  1SK1 A;  3ZLP A;  2G2Q A;  4KE3 A;  4TXO A;  1TRW A;  3KZQ A;  1JZR A;  1T4Y A;  2FLS A;  4FIW A;  2A2S A;  3GKN A;  1B4P A;  2I1U A;  1M2D A;  3ME7 A;  3GL3 A;  2PMT A;  1ZYQ B;  3C1S A;  2LTK A;  1B9X C;  3UBL A;  4ZIL A;  16GS A;  1XCC A;  4KUN A;  1ERV A;  1UVZ A;  2MBS A;  4G10 A;  2NBS A;  5HR2 A;  1EEM A;  3ZFL A;  4MAB A;  3UOM A;  3N5O A;  2VCQ A;  3BCK A;  3HJO A;  3DKS A;  3UAP A;  1VGL A;  5GSS A;  3KH9 A;  3RPP A;  1M2B A;  2PVO C;  3DVX A;  2VCW A;  2ALB A;  5LD0 A;  5KN0 A;  4TR3 A;  2X8G A;  3K8N A;  2X8C A;  3CSJ A;  3IRA A;  4GQC A;  4LMW A;  1N8J A;  3APO A;  3GKK A;  1EWX A;  1WWJ A;  5IMD A;  1VF4 A;  3F4T A;  2K18 A;  1O81 A;  2M80 A;  3FRC A;  4PUR A;  4WKW A;  1TI3 A;  2H0H A;  2YV9 A;  1GRX A;  5ECR B;  2HRN A;  4ECC A;  5IMV A;  3R2Q A;  5GST A;  2RM5 A;  3KP9 A;  2C0E A;  1SKW B;  5G5E A;  2M72 A;  4OMV A;  2NTO A;  5DJM A;  2YZH A;  3HHV A;  2DIZ A;  2J9H A;  1ZMA A;  3QAV A;  1A2J A;  3DVW A;  2DJ3 A;  3TJB A;  3HVX A;  2KP2 A;  5KN1 A;  2DJ0 A;  4MJC A;  4L8E A;  1UC7 A;  4GLT A;  1URM A;  1BED A;  5IQY A;  2C0F A;  4HDE A;  1ZOF A;  5CRW A;  2GSS A;  1T3B A;  1H75 A;  5DQY A;  2IMI A;  2P5Q A;  4DVC A;  4MZW A;  4BVY A;  2F51 A;  1A0F A;  2M46 A;  4TVE A;  1TI1 A;  4ZB8 A;  1XW9 A;  5IPG A;  4ACS A;  1HQO A;  1G7E A;  4IN0 A;  4OCF A;  2KUC A;  2MMO A;  2KHP A;  2G0F A;  5FWG A;  1ZZY A;  1R5A A;  1QK8 A;  1QUW A;  2YOI A;  4XS6 A;  5EVO A;  1GSY A;  3QPM A;  2GDR A;  2YAN A;  1J08 A;  3ZTL A;  3VWW A;  2V32 A;  1QQ2 A;  2JAD A;  3LSZ A;  4RI7 A;  2C0D A;  1WP0 A;  2JL4 A;  4CHS A;  3OR5 A;  4YH2 A;  3IHQ A;  3L0H A;  2P31 A;  2K9F A;  5D9V A;  5IMA A;  2GQL A;  4GRF A;  3O6T A;  4GXZ A;  3P2A A;  1WE0 A;  3GFK A;  3QFB C;  4MDC A;  1JFU A;  2PGT A;  3ED3 A;  2DSA A;  5AN1 A;  1R26 A;  3F6D A;  1RW1 A;  2FY6 A;  2PPT A;  1F3A A;  1V58 A;  2H66 A;  1VF1 A;  1RK4 A;  1XWK A;  3KH7 A;  3LQ7 A;  3GUR A;  4EF0 A;  5GAP D;  5HFG A;  5D8I A;  4HQS A;  3L9V A;  3H1N A;  4KDX A;  3IAM 2;  2L5O A;  4OO5 A;  1DUG A;  4XS4 A;  2ZNM A;  2PUK C;  1MD3 A;  4ECB A;  2DML A;  3ERW A;  4HEA 2;  4I2U A;  3IPZ A;  1OC9 A;  1PKW A;  3RBT A;  2JU5 A;  4EDZ A;  2AJQ B;  1O7U A;  1F2E A;  5DAL B;  3GNJ A;  2LUS A;  1OE8 A;  1XW6 A;  5HR3 A;  4HU7 A;  1X5C A;  4PXO A;  2NVL A;  1U88 A;  4POB A;  3VPQ A;  1F9M A;  3HD5 A;  3QAG A;  2IL3 A;  3DEX A;  1V9W A;  1XWC A;  2NDO A;  3G7I A;  2C8U A;  2OAC A;  4ZXG A;  4PQI A;  4IGJ A;  1OKT A;  5ABR A;  2B7K A;  3HXS A;  1BYE A;  2WZ9 A;  2VL3 A;  2H72 A;  5ELA A;  3A2V A;  2DJ2 A;  1TXX A;  2GST A;  3CSH A;  1TJD A;  2YJH A;  3BOA A;  9GSS A;  1U3A A;  1X5E A;  2B5X A;  3QR6 A;  4F0C A;  1NW2 A;  2CX4 A;  2I3Y A;  1GSU A;  4BVX A;  2LNS A;  2F8A A;  4DSR A;  4JBB A;  1EEJ A;  3HVS A;  1FHE A;  5JWQ B;  4MJE A;  4MP4 A;  3IK9 A;  2OE0 A;  5C04 A;  5HFK A;  2GSR A;  2VOC A;  5JWO B;  2YJ7 A;  4JU5 A;  2DJK A;  4TN8 A;  4ULX A;  3D0Z A;  3LWA A;  2H73 A;  1LBK A;  4TR1 B;  3L4N A;  5CRG A;  3F9U A;  2IFQ B;  4O92 A;  3I9V 2;  5ELG A;  4IVF A;  3GA4 A;  1R7H A;  1GLP A;  1EV4 A;  1X9S B;  2DC5 A;  2EIQ A;  2L57 A;  5IM9 A;  17GS A;  3EU3 A;  1EV9 A;  2H1A A;  2RM6 A;  1Z5Y E;  2WDU A;  5JCG A;  4JED A;  4TW5 A;  1SKS B;  2FD3 A;  3H79 A;  4O7H A;  2YWI A;  3L9S A;  1MTC A;  3APS A;  3TKQ A;  5CP1 A;  2KLX A;  2YN1 A;  3TRQ A;  4KA0 A;  2LKU A;  2LJK A;  5J41 A;  1ZL9 A;  1TOF A;  4H86 A;  1RQM A;  1FO5 A;  5C00 A;  2K6V A;  4AJ6 A;  1H4O A;  2MMN A;  2X64 A;  2YV7 A;  3Q19 A;  4JR4 A;  2RUE A;  3EMX A;  2B1L A;  3F6F A;  3HCZ A;  4POK A;  4TR4 A;  5ID2 B;  2XBQ A;  4N30 A;  4POM A;  1FG4 A;  3HJM A;  4XRD A;  2R4V A;  1K0C A;  2H76 A;  2H6Y A;  1ILO A;  3A2W A;  2WS2 A;  4AF2 A;  4QL9 A;  3FKF A;  4RQR A;  4X1U A;  5A4U A;  5LNK e;  2FWH A;  4F03 A;  4KW6 A;  5IMZ A;  3TOT A;  5AIS A;  3IDV A;  4WF4 A;  1EP7 A;  1HD2 A;  4IBP A;  3D4T A;  2GT5 A;  2LJA A;  3MDK A;  6GSW A;  4Q5R A;  4X43 A;  3HA9 A;  4KSO A;  1O6J A;  1SL1 B;  3WGD A;  2DBC A;  3KD0 A;  1GH2 A;  1PSQ A;  2IMK A;  2V6K A;  2H01 A;  1ZYE A;  22GS A;  5H5S A;  1YF0 A;  3DYR A;  3GIX A;  5LCZ A;  2V1M A;  1K0M A;  4IJ3 A;  1XW5 A;  4ISD A;  3P90 A;  1XBS A;  2GSQ A;  1TK0 B;  3F3R A;  4ID0 A;  2E2M A;  5DAK A;  4HUA A;  2B3S A;  3G7Y A;  2VD0 A;  3GTU A;  4GTU A;  1QMV A;  1TTZ A;  2H0I A;  3GL5 A;  5DVB A;  2ZCT A;  1QGV A;  2CVD A;  3CRU A;  3ERF A;  1AQX A;  5G2Z A;  1XVQ A;  4WET A;  1OC3 A;  3IR4 A;  1KBN A;  1X9W B;  3TRP A;  4LL4 B;  3H93 A;  1QFN A;  1OC8 A;  2VUP A;  5F07 A;  1FW1 A;  2OE3 A;  2ES7 A;  2QSI A;  1M99 A;  3HY2 A;  1SKR B;  1I5G A;  2OAD A;  5IMC A;  2GZP A;  3TKS C;  3GN3 A;  1PD2 1;  6GSS A;  1ERU A;  4PUA A;  4IW9 A;  3IBH A;  5DBQ A;  3LXT A;  3ZVJ D;  1UA5 A;  3JCM L;  3CRT A;  3PGT A;  5CRE A;  2CX3 A;  4ZL9 A;  2L4Q A;  4ZB6 A;  2DMM A;  1Y6E A;  1IYH A;  2B5E A;  2N5F A;  2HZE A;  1WRY A;  4MJA A;  4K6X A;  1ERW A;  3LOR A;  2EC4 A;  1TKD B;  1J9B A;  3Q6O A;  5D73 A;  4I6X A;  4BPY A;  3VI5 A;  3SBC A;  3QDN A;  2VL2 C;  4MH3 A;  4TOP A;  1EOH A;  1A8L A;  1M9B A;  5JCW A;  3RPN A;  1FVK A;  5IOX A;  2L5L A;  6GSX A;  1OYJ A;  4WEY A;  6GSU A;  4QQ7 A;  5CNW A;  3KJY A;  3UIW A;  2GTU A;  2VCT A;  3TGZ A;  1USB A;  3KTB A;  3UBK A;  3I69 A;  4OWY A;  1I9D A;  1PA3 A;  1VF3 A;  3CMI A;  2VAF A;  2XPE A;  2H70 A;  4AJ8 A;  1WMJ A;  5DCH A;  3QD9 A;  4GWR A;  2R2J A;  1GTI A;  5DJL A;  3UJ1 A;  5JWR B;  3M3M A;  1GL8 A;  3CYN A;  3ZL5 A;  4K7O A;  1NHY A;  1XOB A;  1DE2 A;  4J57 E;  2YZU A;  2HXK A;  5B8A A;  4MZC A;  1W89 A;  3UMA A;  5KN2 A;  2HE3 A;  3H4K A;  3GYK A;  5EPF A;  3GSS A;  1AW9 A;  3WD6 A;  5A4W A;  5B6M A;  1QXH A;  2MYG A;  4YQV A;  1XXU A;  4OO4 A;  2X8H A;  2BTO T;  2V2G A;  1Y25 A;  2YNX A;  2F9S A;  2IPA A;  2YWM A;  3MAK A;  1ABA A;  8GSS A;  2VCZ A;  5FT3 A;  12GS A;  1SD8 A;  3LYK A;  3KIJ A;  4XHM A;  5D93 A;  1A2L A;  1A24 A;  4GQF A;  10GS A;  2GT6 A;  3DIE A;  1JZD A;  3U6V A;  1AIU A;  1PX7 A;  3GX0 A;  1S3A A;  2L4C A;  2B5Y A;  2AAW A;  3WYW A;  1HNB A;  2KP1 A;  2FWG A;  1GUL A;  4OFN A;  11GS A;  2H1B A;  3CTF A;  1XIY A;  2YP6 A;  5D9X A;  2FGX A;  1AAZ A;  3M0F A;  1S3D A;  4ECJ A;  1EOG A;  4XS1 A;  1A23 A;  4D73 B;  4MMM A;  4N10 A;  2WFC A;  4CW9 A;  2KOK A;  3QFA C;  19GS A;  1XFL A;  5G30 A;  3LXZ A;  3IOS A;  1ML6 A;  2E2G A;  2PWJ A;  1BAY A;  4N0Z A;  4XTS A;  4KCA A;  5D9T A;  1GWC A;  2LJR A;  3TKR A;  2VM1 A;  3M9K A;  4KH7 A;  1SYX A;  3TB2 A;  2CAI A;  4ZBD A;  1O73 A;  2BMX A;  2WB9 A;  5DDL A;  2H0G A;  3IA1 A;  1Z3E A;  4V2M A;  2GGT A;  3I6A A;  1LU4 A;  3FR3 A;  3EU4 A;  2R5G A;  1B48 A;  2AUV A;  5H5R A;  14GS A;  5IO0 A;  2YWN A;  2RUF A;  1ZGN A;  5B6N A;  1TRS A;  4IQ1 A;  3P8W A;  5ECH B;  1AQW A;  3L9U A;  2JSZ A;  2K8V A;  2H6X A;  5ECP B;  2C3T A;  2ON7 A;  3DD3 A;  1N2A A;  2WCI A;  4BA7 A;  3FK8 A;  2AYT A;  3MSZ A;  3CXG A;  4OD7 A;  2ON5 A;  4DSS B;  4Q5Q A;  2LEG A;  3M1G A;  4MH2 A;  5CRD A;  2LRC A;  2MZC A;  4F82 A;  1GNE A;  3TDG A;  2VLT A; 
#chains in the Genus database with same CATH topology
 3QCP A;  5ECK B;  4HZ4 A;  4GST A;  3TKP A;  1U3I A;  2BJX A;  3TJJ A;  5IIZ A;  2O85 A;  3MYD A;  2C1Y A;  4MA9 A;  2J23 A;  1SK2 A;  2DJ1 A;  5COH A;  4EIQ A;  3KMN A;  2TIR A;  4KX4 A;  2XBI A;  5J9B A;  1XOA A;  3C71 A;  4KSM A;  3DRN A;  2B6M A;  2MMZ A;  3KXO A;  2FWF A;  4NPB A;  5KEJ A;  4EDY A;  5J9C A;  1AUC A;  1OAZ A;  3CTG A;  1FOH A;  1BQ7 A;  3GKM A;  4JR6 A;  3W6G A;  4ILF A;  2WJU A;  2HT9 A;  1R5P A;  3N9J A;  2LQQ A;  5BRT A;  3FR6 A;  1TW9 A;  4PQ1 A;  4PQH A;  3KGK A;  1V2A A;  2FHE A;  3ZRD A;  1F3B A;  4XRA A;  3EMP A;  3ME8 A;  3GH6 A;  3KMO A;  4KGI A;  2FA8 A;  3TJG A;  2DJJ A;  4V1A p;  3QAW A;  1KTE A;  1PL2 A;  5DAL A;  1THO A;  3LFL A;  1XWB A;  3FZ4 A;  4IS0 A;  3KCM A;  5EY6 A;  5GAN D;  1WOU A;  1TK8 B;  4KDY A;  3H8Q A;  1TRU A;  2MBT A;  4JZQ A;  2XC2 A;  4Q5F A;  5J4U A;  3G9B A;  2N5B A;  1K0A A;  2CV4 A;  4K0G A;  1FVJ A;  1Z6N A;  3NIV A;  3I43 A;  4TXV A;  1XWG A;  5KOW A;  3KP8 A;  4MPG A;  3LGC A;  1M2A A;  4YQU A;  3IAS 2;  5ECO B;  5G5F A;  2NPB A;  3WT2 A;  1PX6 A;  2O89 A;  1TRV A;  4PGT A;  7GSS A;  4ZL8 A;  1YKC A;  3GKX A;  1GTA A;  4TRX A;  2PER A;  1BG5 A;  1XWA A;  2VCX A;  1SL2 B;  2IIY A;  1S3C A;  1G6Y A;  3UL3 A;  3FW2 A;  4BWS A;  3C7M A;  2V6O A;  5H5Q A;  4TR1 A;  5F05 A;  2IFQ A;  1AQV A;  4ZB9 A;  1FAA A;  1DBY A;  3D22 A;  1W4V A;  4KDU A;  1DSB A;  2PU9 C;  3HYP A;  5E4W A;  4TXO B;  3GHA A;  4Q5N A;  4HZ2 A;  4HS1 A;  4MF6 A;  1A8Y A;  2JZR A;  2C3N A;  1KNG A;  2H75 A;  3MWH A;  4MF5 A;  4N11 A;  1SU9 A;  1EZK A;  2H6Z A;  5KOX A;  4L0U A;  4PUF C;  1V57 A;  2CVK A;  4YKG A;  5ECQ B;  2CAQ A;  1A0R P;  4NXI A;  3IK7 A;  3GH9 A;  1GTU A;  2O87 A;  1K0D A;  3Q74 A;  2I81 A;  4PX1 A;  4I97 A;  2E0Q A;  3WGE A;  4EXJ A;  4KCE A;  4FO5 A;  4MZB A;  2LRN A;  1ON4 A;  1PQN A;  5D96 A;  2GQM A;  2HYX A;  1VF2 A;  1K0N A;  4EE0 A;  3ZVJ A;  2F8F A;  3HVV A;  4GSS A;  3GMF A;  5ID2 A;  4ICY A;  4KAE A;  4K7I A;  4IJI A;  1O8W A;  3QOU A;  1Z9H A;  3DGQ A;  4ML6 A;  1E2Y A;  1DE1 A;  2XHF A;  2CA8 A;  2R37 A;  1Z7R A;  4FQU A;  2HLS A;  2DIY A;  3RHB A;  4BIK A;  4EVM A;  5F0G A;  4O5R A;  4HJ2 A;  3J7Y k;  3F4S A;  2LRT A;  1TK5 B;  3NZN A;  5CAX A;  2CQ9 A;  1LJR A;  1OKD A;  1YEP A;  3FZ9 A;  3GV1 A;  1O85 A;  2C4J A;  3UEM A;  1GUK A;  3O76 A;  3APQ A;  1YQ1 A;  4I8B A;  5HQP A;  1AXD A;  2CT6 A;  5ECL B;  3TJK A;  1JZW A;  2H19 A;  1F37 A;  4J2F A;  3E9J B;  4DSQ A;  2AHE A;  3US3 A;  1PL1 A;  2HRK A;  2IME A;  3HKR A;  3FEU A;  5B8B A;  4NHZ A;  1U6T A;  1T7P B;  3PR8 A;  1YDK A;  3WT1 A;  3V1W A;  2A2R A;  4OCE A;  3TCO A;  4ZIJ A;  4BVY B;  1GUM A;  1MDJ A;  2HSY A;  4N0V A;  3A5W A;  5A5K A;  2VIM A;  4FYU A;  1SD9 A;  5J5N A;  1G6W A;  4P3Y B;  1SYR A;  4WBR D;  4HU9 A;  4IQA A;  1GP1 A;  4K0N A;  3QMX A;  2EIR A;  1HNC A;  4WBJ A;  5E59 A;  3ZIV A;  5G1K A;  3FZA A;  3TKS A;  2HZF A;  1M7T A;  3EE2 A;  3FZ5 A;  3C8E A;  2CZ2 A;  1GLQ A;  3EYT A;  4L5L A;  5HR1 A;  2IWT A;  5F8B A;  4G0K A;  3EWL A;  5ECM B;  1K0O A;  1FB0 A;  2QGV A;  4TKY A;  3ERG A;  2EIO A;  3HZ4 A;  4E8H A;  1BX9 A;  2R3X A;  2OKA A;  2YWO A;  3ZIT A;  1EGR A;  1FB6 A;  1XZO A;  5INY A;  1SJZ A;  3BCI A;  3W8J A;  2VL2 A;  1Q4J A;  2HNL A;  4MK3 A;  5AIV A;  2LNT A;  1Z7P A;  3MIX A;  2MMA A;  2L59 A;  4MPF A;  1KEB A;  1MDI A;  4RI6 A;  1MDK A;  4I2T A;  4WR5 A;  3U5R E;  2XPD A;  4MF7 A;  2F3M A;  2FWE A;  3CBU A;  3FR9 A;  6GSV A;  2AV4 A;  3Q18 A;  3RDW A;  1G0T A;  3TOU A;  2FUG 2;  2QA1 A;  2VLU A;  1XVW A;  2TRC P;  3D4M A;  4XS4 B;  2N5A A;  3PH9 A;  1JLW A;  4RQX A;  4YAV A;  4LA1 A;  1YEX A;  3P7X A;  3UVT A;  1OC9 B;  3F8U A;  2GZY A;  4F9Z A;  2V41 A;  5DCG A;  1NSW A;  5IO2 A;  4L0W A;  2UZ8 A;  2P5R A;  5A4V A;  2R6K A;  1JLV A;  4G19 A;  4DEJ A;  3IC4 A;  4XIH A;  3FY7 A;  4HI7 A;  3PIN A;  3M8N A;  3VK9 A;  1Z6M A;  2X99 A;  4EUY A;  1ACV A;  3ZIJ A;  2B1K A;  1V40 A;  4KND A;  4JRR A;  3ZRE A;  4ZBA A;  5HFI A;  4O32 A;  4G0L A;  3A2X A;  4MLY A;  3GX8 A;  4WR4 A;  1PGT A;  2GZZ A;  2VM2 A;  4BWQ A;  4FYB A;  4Z7X A;  2VD1 A;  5ECS A;  3LW9 A;  1SK0 A;  3W8S A;  1TU7 A;  2A4V A;  2VL9 A;  1MEK A;  2HRF A;  2OE1 A;  2WRT A;  2OA7 A;  5JCU A;  4BVX B;  3ISO A;  4LL1 B;  2CVB A;  4GF0 A;  3D21 A;  4K7N A;  1R4W A;  2HI7 A;  1YZX A;  3VI7 A;  2D2Z A;  3GRX A;  3ZZX A;  1U87 A;  1K3Y A;  4MJB A;  1E6B A;  3KEB A;  1JHB A;  3C1R A;  4K2D A;  4NHW A;  4E8E A;  3EC3 A;  4BL7 A;  1FOV A;  1B8X A;  1HNA A;  1PKZ A;  1B9Y C;  4YAP A;  2HSH A;  4NAX A;  1GSF A;  2JZT A;  20GS A;  2VO4 A;  2LS5 A;  3RAZ A;  4EKZ A;  2I4A A;  5IMF A;  4TR0 A;  3FYG A;  3VWU A;  5IOW A;  2DLX A;  2IMF A;  4AJ7 A;  1TDI A;  1T8E B;  2JAC A;  1YJ6 A;  1GSD A;  1NHO A;  4EL1 A;  1Q98 A;  4D73 A;  5AIX A;  3GUS A;  4JE1 A;  3VWX A;  5J3R A;  3ZYW A;  3BBY A;  4IP1 A;  2L6D A;  3G7J A;  5KN3 A;  1PRX A;  1ZCP A;  4F2I A;  3A3T A;  3C73 A;  1S3R A;  1ERT A;  13GS A;  4G9H A;  4EO3 A;  3RHC A;  1GSS A;  2H1D A;  2H8L A;  5IPH A;  4WF5 A;  3E3E A;  1JZO A;  1OVN A;  3KM6 A;  6GSY A;  2HSM A;  1GSE A;  3EUR A;  3F4R A;  3J7Y b;  1F6M C;  2RII A;  3UVH A;  2OBI A;  1V98 A;  2GLR A;  2LQO A;  1GNW A;  2FNO A;  5L71 A;  2FA4 A;  2PVQ A;  1MD4 A;  3O3T A;  4X0X A;  1X9M B;  3F3Q A;  2H74 A;  1CQH A;  4NWY A;  5ENU A;  3S9F A;  2OJL A;  4CDO A;  2VLV A;  1GTB A;  4NV5 A;  1UN2 A;  4EC0 A;  4OFT A;  5G1L A;  3ZFB A;  4AGS A;  1PN9 A;  4DSS A;  1G7O A;  3TJF A;  4LLR A;  1ZYN A;  3BD2 A;  4HQZ A;  2K8S A;  2C3Q A;  3TUE A;  1EGO A;  1T00 A;  4F0B A;  1K3L A;  2RLI A;  4OFM A;  5DAK B;  3VPT A;  1ZYP A;  2C0G A;  2QC7 A;  3GTU B;  2LST A;  1T1V A;  1NM3 A;  4QL7 A;  2LV3 A;  1YY7 A;  2YPM A;  1AC1 A;  4ZBB A;  2L6C A;  4KB3 A;  1OE7 A;  3FHK A;  3SWL A;  4K1F A;  2O8V B;  4K9Z A;  4K8M A;  1K0B A;  6GST A;  3LEF A;  4MCU A;  2IMD A;  2I9H A;  3BJ5 A;  2JSY A;  2H30 A;  4PNF A;  4IHU A;  4L5O A;  1WIK A;  3LYP A;  4IEL A;  5CO3 A;  1TP9 A;  5DQS A;  2JZS A;  2GVP A;  1ST9 A;  3VWV A;  1SJ6 A;  3TKS E;  5CYY A;  1A2M A;  2PBJ A;  3D5J A;  4CY6 A;  1GUH A;  2HFD A;  5F06 A;  2WGR A;  3AY8 A;  2GS3 A;  2REM A;  3LJR A;  2HZE B;  3VLN A;  2YCD A;  2TRX A;  3LG6 A;  4GCI A;  4YQM A;  2H71 A;  5ECN B;  2B7J A;  1XG8 A;  1X5D A;  1XPV A;  5ECI B;  2E7P A;  2O7K A;  1SJI A;  3ZML A;  1HYU A;  2P0G A;  4XCS A;  4POL A;  1YKA A;  3HZ8 A;  3TRX A;  3VUR A;  4ZL7 A;  5HR0 A;  1YF1 A;  3EIN A;  4RUV A;  3UAR A;  18GS A;  3F0I A;  2PN8 A;  4G2E A;  3EVI A;  1M0U A;  3HDC A;  4IP6 A;  3IE3 A;  1BJX A;  5D9W A;  3IC8 A;  3HJP A;  4NMU A;  3ZMK A;  1J0F A;  4IKH A;  2QKE A;  3L78 A;  1THX A;  4J56 E;  1EP8 A;  4ECI A;  2FCH A;  3DXB A;  3PPU A;  3M9J A;  1WPI A;  2CZ3 A;  1B4Q A;  1X0R A;  2ZUP A;  2Z9S A;  4HOJ A;  1WJK A;  3F63 A;  1C72 A;  1SL0 B;  1CQG A;  2WUL A;  3MNG A;  2AB6 A;  5EL8 A;  5GZZ B;  3E0U A;  3VFI A;  2X49 A;  2OBK A;  1GSQ A;  3WGX A;  5B7C A;  4FH8 A;  1SEN A;  1PMT A;  3DWV A;  4O5U A;  4V1A g;  4WXT A;  1IYI A;  3IV4 A;  3KTL A;  2C80 A;  5FHI A;  5AGY A;  4GSN A;  4CY8 A;  1K3O A;  1O8X A;  4KF9 A;  1T4Z A;  3CSI A;  4FYC A;  4V2N A;  2H1G A;  1TU8 A;  3IXR A;  1M9A A;  3GST A;  4ML1 A;  4PNG A;  2GQK A;  3NOF A;  5CRH A;  2IJY A;  3D6I A;  4LMV A;  5G31 A;  4HJM A;  2IN3 A;  1VRS D;  4V2L A;  4I5Q A;  3DML A;  2VCV A;  4NV2 A;  1SK1 A;  3ZLP A;  2G2Q A;  4KE3 A;  4TXO A;  2R0P A;  1TRW A;  3KZQ A;  1JZR A;  1T4Y A;  2FLS A;  4FIW A;  2A2S A;  2R0C A;  3GKN A;  1B4P A;  2I1U A;  1M2D A;  3ME7 A;  3GL3 A;  2PMT A;  1ZYQ B;  3C1S A;  2LTK A;  1B9X C;  3UBL A;  4ZIL A;  16GS A;  1PFO A;  1XCC A;  4KUN A;  1ERV A;  1UVZ A;  2MBS A;  4G10 A;  2NBS A;  5HR2 A;  2DKH A;  1EEM A;  3ZFL A;  4MAB A;  3UOM A;  3N5O A;  2VCQ A;  3BCK A;  3HJO A;  3DKS A;  3UAP A;  1VGL A;  5GSS A;  3KH9 A;  3RPP A;  1M2B A;  2PVO C;  3DVX A;  2VCW A;  2ALB A;  5LD0 A;  5KN0 A;  4TR3 A;  2X8G A;  3K8N A;  2X8C A;  3CSJ A;  3IRA A;  4GQC A;  4LMW A;  1N8J A;  3APO A;  3GKK A;  1EWX A;  1WWJ A;  5IMD A;  1VF4 A;  3F4T A;  2K18 A;  1O81 A;  2M80 A;  3FRC A;  4PUR A;  4WKW A;  1TI3 A;  2H0H A;  2YV9 A;  1GRX A;  5ECR B;  2HRN A;  4ECC A;  5IMV A;  3R2Q A;  5GST A;  2RM5 A;  3KP9 A;  2C0E A;  3R3E A;  1SKW B;  5G5E A;  2M72 A;  4OMV A;  2NTO A;  5DJM A;  2YZH A;  3HHV A;  2DIZ A;  2J9H A;  1ZMA A;  3QAV A;  1A2J A;  3DVW A;  2DJ3 A;  3TJB A;  3HVX A;  2KP2 A;  5KN1 A;  2DJ0 A;  4MJC A;  4L8E A;  1UC7 A;  4GLT A;  1URM A;  1BED A;  5IQY A;  2C0F A;  4HDE A;  1ZOF A;  5CRW A;  2GSS A;  1T3B A;  1H75 A;  5DQY A;  2IMI A;  2P5Q A;  4DVC A;  4MZW A;  4BVY A;  2F51 A;  4USS A;  1A0F A;  2M46 A;  4TVE A;  1TI1 A;  4ZB8 A;  1XW9 A;  5IPG A;  4ACS A;  1HQO A;  4BL7 B;  1G7E A;  4IN0 A;  4K2X A;  4OCF A;  2KUC A;  2MMO A;  2KHP A;  2G0F A;  5FWG A;  1ZZY A;  1R5A A;  1QK8 A;  1QUW A;  2YOI A;  4XS6 A;  5EVO A;  1GSY A;  3QPM A;  2GDR A;  2YAN A;  4Z2T A;  1J08 A;  3ZTL A;  3VWW A;  2V32 A;  4HSC X;  4K5S A;  1QQ2 A;  2JAD A;  3LSZ A;  4RI7 A;  2C0D A;  1WP0 A;  2JL4 A;  4CHS A;  3OR5 A;  4YH2 A;  3IHQ A;  3L0H A;  2P31 A;  2K9F A;  4MNN A;  5D9V A;  5IMA A;  2GQL A;  4GRF A;  4X4J A;  3O6T A;  4GXZ A;  3P2A A;  1WE0 A;  3GFK A;  3QFB C;  4MDC A;  1JFU A;  2PGT A;  3ED3 A;  2DSA A;  5AN1 A;  1R26 A;  3F6D A;  1RW1 A;  2FY6 A;  2PPT A;  1F3A A;  1V58 A;  2H66 A;  1VF1 A;  1RK4 A;  1XWK A;  3KH7 A;  3LQ7 A;  3GUR A;  4EF0 A;  5GAP D;  5HFG A;  5D8I A;  4HQS A;  3L9V A;  3H1N A;  4KDX A;  3IAM 2;  2L5O A;  4OO5 A;  1DUG A;  4XS4 A;  2ZNM A;  2PUK C;  1MD3 A;  4ECB A;  2DML A;  3ERW A;  4HEA 2;  4I2U A;  3IPZ A;  1OC9 A;  1PKW A;  3RBT A;  2JU5 A;  4EDZ A;  2AJQ B;  1O7U A;  1F2E A;  5DAL B;  2R0G A;  3GNJ A;  2LUS A;  1OE8 A;  3HVN A;  4A5P A;  1XW6 A;  5HR3 A;  4HU7 A;  1X5C A;  4PXO A;  4EIP A;  2NVL A;  1U88 A;  4POB A;  3VPQ A;  1F9M A;  3HD5 A;  3QAG A;  2IL3 A;  3DEX A;  1V9W A;  1XWC A;  2NDO A;  3G7I A;  2C8U A;  2OAC A;  4O5Q A;  4ZXG A;  4PQI A;  4IGJ A;  1OKT A;  5ABR A;  2B7K A;  4Z2U A;  3HXS A;  1BYE A;  2WZ9 A;  2VL3 A;  2H72 A;  5ELA A;  3A2V A;  2DJ2 A;  1TXX A;  2GST A;  3CSH A;  1TJD A;  2YJH A;  3BOA A;  9GSS A;  1U3A A;  1X5E A;  2B5X A;  3QR6 A;  4F0C A;  1NW2 A;  2CX4 A;  2I3Y A;  1GSU A;  4BVX A;  2LNS A;  2F8A A;  4DSR A;  4JBB A;  1EEJ A;  3HVS A;  1FHE A;  5JWQ B;  4MJE A;  4MP4 A;  3IK9 A;  2OE0 A;  5C04 A;  5HFK A;  2GSR A;  2VOC A;  5JWO B;  2YJ7 A;  4Z2R A;  4JU5 A;  2DJK A;  4TN8 A;  4ULX A;  3D0Z A;  3LWA A;  2H73 A;  1LBK A;  4TR1 B;  3L4N A;  5CRG A;  3F9U A;  2IFQ B;  4O92 A;  3I9V 2;  5ELG A;  4IVF A;  3GA4 A;  1R7H A;  1GLP A;  1EV4 A;  1X9S B;  2DC5 A;  2EIQ A;  2L57 A;  5IM9 A;  17GS A;  3EU3 A;  1EV9 A;  2H1A A;  2RM6 A;  1Z5Y E;  2WDU A;  5JCG A;  4JED A;  4K5R A;  4TW5 A;  1SKS B;  2FD3 A;  3H79 A;  4O7H A;  2YWI A;  3L9S A;  1MTC A;  3APS A;  3TKQ A;  5CP1 A;  2KLX A;  2YN1 A;  3TRQ A;  4KA0 A;  2LKU A;  2LJK A;  5J41 A;  1ZL9 A;  1TOF A;  4H86 A;  1RQM A;  1FO5 A;  5C00 A;  2K6V A;  4AJ6 A;  1H4O A;  2MMN A;  2X64 A;  2YV7 A;  3Q19 A;  4JR4 A;  2RUE A;  3EMX A;  2B1L A;  3F6F A;  3HCZ A;  4POK A;  4TR4 A;  5ID2 B;  2XBQ A;  4N30 A;  4POM A;  1FG4 A;  3HJM A;  4XRD A;  2R4V A;  1K0C A;  2H76 A;  2H6Y A;  1ILO A;  3A2W A;  2WS2 A;  4AF2 A;  4QL9 A;  3FKF A;  4RQR A;  4X1U A;  5A4U A;  5LNK e;  2FWH A;  4F03 A;  4KW6 A;  5IMZ A;  3TOT A;  5AIS A;  3IDV A;  4WF4 A;  1EP7 A;  1HD2 A;  4IBP A;  3D4T A;  4PTS A;  2GT5 A;  2DKI A;  2LJA A;  3MDK A;  6GSW A;  4Q5R A;  4X43 A;  3HA9 A;  4KSO A;  1O6J A;  1SL1 B;  3WGD A;  2DBC A;  3KD0 A;  1GH2 A;  1PSQ A;  2IMK A;  2V6K A;  2H01 A;  1ZYE A;  22GS A;  5H5S A;  1YF0 A;  3DYR A;  3GIX A;  5LCZ A;  2V1M A;  1K0M A;  4IJ3 A;  1XW5 A;  4ISD A;  3P90 A;  1XBS A;  2GSQ A;  1TK0 B;  3F3R A;  4ID0 A;  2E2M A;  5DAK A;  4HUA A;  2B3S A;  3G7Y A;  2VD0 A;  3GTU A;  4GTU A;  1QMV A;  1TTZ A;  2H0I A;  3GL5 A;  5DVB A;  2ZCT A;  1QGV A;  2CVD A;  3CRU A;  3ERF A;  1AQX A;  5G2Z A;  1XVQ A;  1M3J A;  4WET A;  1OC3 A;  3IR4 A;  1KBN A;  1X9W B;  3TRP A;  4LL4 B;  3H93 A;  1QFN A;  1OC8 A;  2VUP A;  5F07 A;  1FW1 A;  2OE3 A;  2ES7 A;  2QSI A;  1M99 A;  3HY2 A;  1SKR B;  1I5G A;  2OAD A;  5IMC A;  2GZP A;  3TKS C;  2X4A A;  3GN3 A;  1PD2 1;  6GSS A;  1ERU A;  4G0I A;  4PUA A;  4IW9 A;  3IBH A;  5DBQ A;  3LXT A;  3ZVJ D;  1UA5 A;  3JCM L;  3CRT A;  3PGT A;  5CRE A;  1M3I A;  2CX3 A;  4ZL9 A;  2L4Q A;  4ZB6 A;  2DMM A;  1Y6E A;  1IYH A;  2B5E A;  2N5F A;  2HZE A;  1WRY A;  4MJA A;  4K6X A;  1ERW A;  3LOR A;  2EC4 A;  1TKD B;  1J9B A;  3Q6O A;  5D73 A;  4I6X A;  4BPY A;  3VI5 A;  3SBC A;  3QDN A;  2VL2 C;  4MH3 A;  4TOP A;  1EOH A;  1A8L A;  1M9B A;  5JCW A;  3RPN A;  1FVK A;  5IOX A;  2L5L A;  6GSX A;  1OYJ A;  4WEY A;  6GSU A;  4QQ7 A;  5CNW A;  3KJY A;  3UIW A;  2GTU A;  2VCT A;  4YKF A;  3TGZ A;  1USB A;  3KTB A;  3UBK A;  3I69 A;  4OWY A;  1I9D A;  1PA3 A;  1VF3 A;  3CMI A;  2VAF A;  2XPE A;  2H70 A;  4AJ8 A;  5BMU A;  2A4H A;  1WMJ A;  5DCH A;  3QD9 A;  4GWR A;  2R2J A;  1GTI A;  5DJL A;  3UJ1 A;  5JWR B;  3M3M A;  1GL8 A;  3CYN A;  2QA2 A;  3ZL5 A;  4K7O A;  1NHY A;  2HRA A;  1XOB A;  1DE2 A;  3EPT A;  3IHG A;  4J57 E;  2YZU A;  2HXK A;  5B8A A;  4MZC A;  1W89 A;  3UMA A;  5KN2 A;  2HE3 A;  3H4K A;  2A2P A;  3GYK A;  5EPF A;  3GSS A;  1AW9 A;  3WD6 A;  5A4W A;  5B6M A;  1QXH A;  2MYG A;  4YQV A;  1XXU A;  4OO4 A;  2X8H A;  2BTO T;  2V2G A;  1Y25 A;  2YNX A;  2F9S A;  2IPA A;  2YWM A;  3MAK A;  1ABA A;  8GSS A;  2VCZ A;  5FT3 A;  12GS A;  1SD8 A;  3LYK A;  3KIJ A;  4XHM A;  5D93 A;  1A2L A;  1A24 A;  4GQF A;  10GS A;  2GT6 A;  3DIE A;  1JZD A;  3CQF A;  3U6V A;  1AIU A;  1PX7 A;  3GX0 A;  1S3A A;  2L4C A;  2B5Y A;  2AAW A;  3WYW A;  1HNB A;  2KP1 A;  2FWG A;  1GUL A;  4OFN A;  11GS A;  2H1B A;  3CTF A;  1XIY A;  2YP6 A;  5D9X A;  2FGX A;  1AAZ A;  3M0F A;  1S3D A;  4ECJ A;  1EOG A;  4XS1 A;  1A23 A;  4D73 B;  3FMW A;  4MMM A;  4N10 A;  2WFC A;  4CW9 A;  2KOK A;  3QFA C;  19GS A;  1XFL A;  5G30 A;  3LXZ A;  3IOS A;  1ML6 A;  2E2G A;  2PWJ A;  1BAY A;  4N0Z A;  4XTS A;  4KCA A;  5D9T A;  1GWC A;  2LJR A;  3TKR A;  2VM1 A;  3M9K A;  4KH7 A;  1SYX A;  3TB2 A;  2CAI A;  4ZBD A;  1O73 A;  2BMX A;  2WB9 A;  5DDL A;  2H0G A;  3IA1 A;  1Z3E A;  4V2M A;  2GGT A;  3I6A A;  1LU4 A;  3FR3 A;  3EU4 A;  2R5G A;  1B48 A;  2AUV A;  5H5R A;  14GS A;  5IO0 A;  2YWN A;  2RUF A;  1PN0 A;  1ZGN A;  5B6N A;  1TRS A;  4IQ1 A;  3P8W A;  5ECH B;  1AQW A;  3L9U A;  2JSZ A;  2K8V A;  2H6X A;  5ECP B;  2C3T A;  2ON7 A;  3DD3 A;  1N2A A;  2WCI A;  4BA7 A;  3FK8 A;  2AYT A;  3MSZ A;  3CXG A;  4OD7 A;  2ON5 A;  4DSS B;  4Q5Q A;  2LEG A;  3M1G A;  4MH2 A;  5CRD A;  2LRC A;  2MZC A;  4F82 A;  3A5I A;  1GNE A;  3TDG A;  2VLT A; 
#chains in the Genus database with same CATH homology
 3QCP A;  5ECK B;  4HZ4 A;  4GST A;  3TKP A;  1U3I A;  2BJX A;  3TJJ A;  5IIZ A;  2O85 A;  3MYD A;  2C1Y A;  4MA9 A;  2J23 A;  1SK2 A;  2DJ1 A;  5COH A;  4EIQ A;  3KMN A;  2TIR A;  4KX4 A;  2XBI A;  5J9B A;  1XOA A;  3C71 A;  4KSM A;  3DRN A;  2B6M A;  2MMZ A;  3KXO A;  2FWF A;  4NPB A;  5KEJ A;  4EDY A;  5J9C A;  1AUC A;  1OAZ A;  3CTG A;  1FOH A;  1BQ7 A;  3GKM A;  4JR6 A;  3W6G A;  4ILF A;  2WJU A;  2HT9 A;  1R5P A;  3N9J A;  2LQQ A;  5BRT A;  3FR6 A;  1TW9 A;  4PQ1 A;  4PQH A;  3KGK A;  1V2A A;  2FHE A;  3ZRD A;  1F3B A;  4XRA A;  3EMP A;  3ME8 A;  3GH6 A;  3KMO A;  4KGI A;  2FA8 A;  3TJG A;  2DJJ A;  4V1A p;  3QAW A;  1KTE A;  1PL2 A;  5DAL A;  1THO A;  3LFL A;  1XWB A;  3FZ4 A;  4IS0 A;  3KCM A;  5EY6 A;  5GAN D;  1WOU A;  1TK8 B;  4KDY A;  3H8Q A;  1TRU A;  2MBT A;  4JZQ A;  2XC2 A;  4Q5F A;  5J4U A;  3G9B A;  2N5B A;  1K0A A;  2CV4 A;  4K0G A;  1FVJ A;  1Z6N A;  3NIV A;  3I43 A;  4TXV A;  1XWG A;  5KOW A;  3KP8 A;  4MPG A;  3LGC A;  1M2A A;  4YQU A;  3IAS 2;  5ECO B;  5G5F A;  2NPB A;  3WT2 A;  1PX6 A;  2O89 A;  1TRV A;  4PGT A;  7GSS A;  4ZL8 A;  1YKC A;  3GKX A;  1GTA A;  4TRX A;  2PER A;  1BG5 A;  1XWA A;  2VCX A;  1SL2 B;  2IIY A;  1S3C A;  1G6Y A;  3UL3 A;  3FW2 A;  4BWS A;  3C7M A;  2V6O A;  5H5Q A;  4TR1 A;  5F05 A;  2IFQ A;  1AQV A;  4ZB9 A;  1FAA A;  1DBY A;  3D22 A;  1W4V A;  4KDU A;  1DSB A;  2PU9 C;  3HYP A;  5E4W A;  4TXO B;  3GHA A;  4Q5N A;  4HZ2 A;  4HS1 A;  4MF6 A;  1A8Y A;  2JZR A;  2C3N A;  1KNG A;  2H75 A;  3MWH A;  4MF5 A;  4N11 A;  1SU9 A;  1EZK A;  2H6Z A;  5KOX A;  4L0U A;  4PUF C;  1V57 A;  2CVK A;  4YKG A;  5ECQ B;  2CAQ A;  1A0R P;  4NXI A;  3IK7 A;  3GH9 A;  1GTU A;  2O87 A;  1K0D A;  3Q74 A;  2I81 A;  4PX1 A;  4I97 A;  2E0Q A;  3WGE A;  4EXJ A;  4KCE A;  4FO5 A;  4MZB A;  2LRN A;  1ON4 A;  1PQN A;  5D96 A;  2GQM A;  2HYX A;  1VF2 A;  1K0N A;  4EE0 A;  3ZVJ A;  2F8F A;  3HVV A;  4GSS A;  3GMF A;  5ID2 A;  4ICY A;  4KAE A;  4K7I A;  4IJI A;  1O8W A;  3QOU A;  1Z9H A;  3DGQ A;  4ML6 A;  1E2Y A;  1DE1 A;  2XHF A;  2CA8 A;  2R37 A;  1Z7R A;  4FQU A;  2HLS A;  2DIY A;  3RHB A;  4EVM A;  5F0G A;  4O5R A;  4HJ2 A;  3J7Y k;  3F4S A;  2LRT A;  1TK5 B;  3NZN A;  5CAX A;  2CQ9 A;  1LJR A;  1OKD A;  1YEP A;  3FZ9 A;  3GV1 A;  1O85 A;  2C4J A;  3UEM A;  1GUK A;  3O76 A;  3APQ A;  1YQ1 A;  4I8B A;  5HQP A;  1AXD A;  2CT6 A;  5ECL B;  3TJK A;  1JZW A;  2H19 A;  1F37 A;  4J2F A;  3E9J B;  4DSQ A;  2AHE A;  3US3 A;  1PL1 A;  2HRK A;  2IME A;  3HKR A;  3FEU A;  5B8B A;  4NHZ A;  1U6T A;  1T7P B;  3PR8 A;  1YDK A;  3WT1 A;  3V1W A;  2A2R A;  4OCE A;  3TCO A;  4ZIJ A;  4BVY B;  1GUM A;  1MDJ A;  2HSY A;  4N0V A;  3A5W A;  5A5K A;  2VIM A;  4FYU A;  1SD9 A;  5J5N A;  1G6W A;  4P3Y B;  1SYR A;  4WBR D;  4HU9 A;  4IQA A;  1GP1 A;  4K0N A;  3QMX A;  2EIR A;  1HNC A;  4WBJ A;  5E59 A;  3ZIV A;  5G1K A;  3FZA A;  3TKS A;  2HZF A;  1M7T A;  3EE2 A;  3FZ5 A;  3C8E A;  2CZ2 A;  1GLQ A;  3EYT A;  4L5L A;  5HR1 A;  2IWT A;  5F8B A;  4G0K A;  3EWL A;  5ECM B;  1K0O A;  1FB0 A;  2QGV A;  4TKY A;  3ERG A;  2EIO A;  3HZ4 A;  4E8H A;  1BX9 A;  2R3X A;  2OKA A;  2YWO A;  3ZIT A;  1EGR A;  1FB6 A;  1XZO A;  5INY A;  1SJZ A;  3BCI A;  3W8J A;  2VL2 A;  1Q4J A;  2HNL A;  4MK3 A;  5AIV A;  2LNT A;  1Z7P A;  3MIX A;  2MMA A;  2L59 A;  4MPF A;  1KEB A;  1MDI A;  4RI6 A;  1MDK A;  4I2T A;  4WR5 A;  3U5R E;  2XPD A;  4MF7 A;  2F3M A;  2FWE A;  3CBU A;  3FR9 A;  6GSV A;  2AV4 A;  3Q18 A;  3RDW A;  1G0T A;  3TOU A;  2FUG 2;  2QA1 A;  2VLU A;  1XVW A;  2TRC P;  3D4M A;  4XS4 B;  2N5A A;  3PH9 A;  1JLW A;  4RQX A;  4YAV A;  4LA1 A;  1YEX A;  3P7X A;  3UVT A;  1OC9 B;  3F8U A;  2GZY A;  4F9Z A;  2V41 A;  5DCG A;  1NSW A;  5IO2 A;  4L0W A;  2UZ8 A;  2P5R A;  5A4V A;  2R6K A;  1JLV A;  4G19 A;  4DEJ A;  3IC4 A;  4XIH A;  3FY7 A;  4HI7 A;  3PIN A;  3M8N A;  3VK9 A;  1Z6M A;  2X99 A;  4EUY A;  1ACV A;  3ZIJ A;  2B1K A;  1V40 A;  4KND A;  4JRR A;  3ZRE A;  4ZBA A;  5HFI A;  4O32 A;  4G0L A;  3A2X A;  4MLY A;  3GX8 A;  4WR4 A;  1PGT A;  2GZZ A;  2VM2 A;  4BWQ A;  4FYB A;  4Z7X A;  2VD1 A;  5ECS A;  3LW9 A;  1SK0 A;  3W8S A;  1TU7 A;  2A4V A;  2VL9 A;  1MEK A;  2HRF A;  2OE1 A;  2WRT A;  2OA7 A;  5JCU A;  4BVX B;  3ISO A;  4LL1 B;  2CVB A;  4GF0 A;  3D21 A;  4K7N A;  1R4W A;  2HI7 A;  1YZX A;  3VI7 A;  2D2Z A;  3GRX A;  3ZZX A;  1U87 A;  1K3Y A;  4MJB A;  1E6B A;  3KEB A;  1JHB A;  3C1R A;  4K2D A;  4NHW A;  4E8E A;  3EC3 A;  4BL7 A;  1FOV A;  1B8X A;  1HNA A;  1PKZ A;  1B9Y C;  4YAP A;  2HSH A;  4NAX A;  1GSF A;  2JZT A;  20GS A;  2VO4 A;  2LS5 A;  3RAZ A;  4EKZ A;  2I4A A;  5IMF A;  4TR0 A;  3FYG A;  3VWU A;  5IOW A;  2DLX A;  2IMF A;  4AJ7 A;  1TDI A;  1T8E B;  2JAC A;  1YJ6 A;  1GSD A;  1NHO A;  4EL1 A;  1Q98 A;  4D73 A;  5AIX A;  3GUS A;  4JE1 A;  3VWX A;  5J3R A;  3ZYW A;  3BBY A;  4IP1 A;  2L6D A;  3G7J A;  5KN3 A;  1PRX A;  1ZCP A;  4F2I A;  3A3T A;  3C73 A;  1ERT A;  13GS A;  4G9H A;  4EO3 A;  3RHC A;  1GSS A;  2H1D A;  2H8L A;  5IPH A;  4WF5 A;  3E3E A;  1JZO A;  1OVN A;  3KM6 A;  6GSY A;  2HSM A;  1GSE A;  3EUR A;  3F4R A;  3J7Y b;  1F6M C;  2RII A;  3UVH A;  2OBI A;  1V98 A;  2GLR A;  2LQO A;  1GNW A;  2FNO A;  5L71 A;  2FA4 A;  2PVQ A;  1MD4 A;  3O3T A;  4X0X A;  1X9M B;  3F3Q A;  2H74 A;  1CQH A;  4NWY A;  5ENU A;  3S9F A;  2OJL A;  4CDO A;  2VLV A;  1GTB A;  4NV5 A;  1UN2 A;  4EC0 A;  4OFT A;  5G1L A;  3ZFB A;  4AGS A;  1PN9 A;  4DSS A;  1G7O A;  3TJF A;  4LLR A;  1ZYN A;  3BD2 A;  4HQZ A;  2K8S A;  2C3Q A;  3TUE A;  1EGO A;  1T00 A;  4F0B A;  1K3L A;  2RLI A;  4OFM A;  5DAK B;  3VPT A;  1ZYP A;  2C0G A;  2QC7 A;  3GTU B;  2LST A;  1T1V A;  1NM3 A;  4QL7 A;  2LV3 A;  1YY7 A;  2YPM A;  1AC1 A;  4ZBB A;  2L6C A;  4KB3 A;  1OE7 A;  3FHK A;  3SWL A;  4K1F A;  2O8V B;  4K9Z A;  4K8M A;  1K0B A;  6GST A;  3LEF A;  4MCU A;  2IMD A;  2I9H A;  3BJ5 A;  2JSY A;  2H30 A;  4PNF A;  4IHU A;  4L5O A;  1WIK A;  3LYP A;  4IEL A;  5CO3 A;  1TP9 A;  5DQS A;  2JZS A;  2GVP A;  1ST9 A;  3VWV A;  1SJ6 A;  3TKS E;  5CYY A;  1A2M A;  2PBJ A;  3D5J A;  4CY6 A;  1GUH A;  2HFD A;  5F06 A;  2WGR A;  3AY8 A;  2GS3 A;  2REM A;  3LJR A;  2HZE B;  3VLN A;  2YCD A;  2TRX A;  3LG6 A;  4GCI A;  4YQM A;  2H71 A;  5ECN B;  2B7J A;  1X5D A;  1XPV A;  5ECI B;  2E7P A;  2O7K A;  1SJI A;  3ZML A;  1HYU A;  2P0G A;  4XCS A;  4POL A;  1YKA A;  3HZ8 A;  3TRX A;  3VUR A;  4ZL7 A;  5HR0 A;  1YF1 A;  3EIN A;  4RUV A;  3UAR A;  18GS A;  3F0I A;  2PN8 A;  4G2E A;  3EVI A;  1M0U A;  3HDC A;  4IP6 A;  3IE3 A;  1BJX A;  5D9W A;  3IC8 A;  3HJP A;  4NMU A;  3ZMK A;  1J0F A;  4IKH A;  2QKE A;  3L78 A;  1THX A;  4J56 E;  1EP8 A;  4ECI A;  2FCH A;  3DXB A;  3PPU A;  3M9J A;  1WPI A;  2CZ3 A;  1B4Q A;  1X0R A;  2ZUP A;  2Z9S A;  4HOJ A;  1WJK A;  3F63 A;  1C72 A;  1SL0 B;  1CQG A;  2WUL A;  3MNG A;  2AB6 A;  5EL8 A;  5GZZ B;  3E0U A;  3VFI A;  2X49 A;  2OBK A;  1GSQ A;  3WGX A;  5B7C A;  4FH8 A;  1SEN A;  1PMT A;  3DWV A;  4O5U A;  4V1A g;  4WXT A;  1IYI A;  3IV4 A;  3KTL A;  2C80 A;  5FHI A;  5AGY A;  4GSN A;  4CY8 A;  1K3O A;  1O8X A;  4KF9 A;  1T4Z A;  3CSI A;  4FYC A;  4V2N A;  2H1G A;  1TU8 A;  3IXR A;  1M9A A;  3GST A;  4ML1 A;  4PNG A;  2GQK A;  3NOF A;  5CRH A;  2IJY A;  3D6I A;  4LMV A;  5G31 A;  4HJM A;  2IN3 A;  1VRS D;  4V2L A;  4I5Q A;  3DML A;  2VCV A;  4NV2 A;  1SK1 A;  3ZLP A;  2G2Q A;  4KE3 A;  4TXO A;  2R0P A;  1TRW A;  3KZQ A;  1JZR A;  1T4Y A;  2FLS A;  4FIW A;  2A2S A;  2R0C A;  3GKN A;  1B4P A;  2I1U A;  1M2D A;  3ME7 A;  3GL3 A;  2PMT A;  1ZYQ B;  3C1S A;  2LTK A;  1B9X C;  3UBL A;  4ZIL A;  16GS A;  1XCC A;  4KUN A;  1ERV A;  1UVZ A;  2MBS A;  4G10 A;  2NBS A;  5HR2 A;  2DKH A;  1EEM A;  3ZFL A;  4MAB A;  3UOM A;  3N5O A;  2VCQ A;  3BCK A;  3HJO A;  3DKS A;  3UAP A;  1VGL A;  5GSS A;  3KH9 A;  3RPP A;  1M2B A;  2PVO C;  3DVX A;  2VCW A;  2ALB A;  5LD0 A;  5KN0 A;  4TR3 A;  2X8G A;  3K8N A;  2X8C A;  3CSJ A;  3IRA A;  4GQC A;  4LMW A;  1N8J A;  3APO A;  3GKK A;  1EWX A;  1WWJ A;  5IMD A;  1VF4 A;  3F4T A;  2K18 A;  1O81 A;  2M80 A;  3FRC A;  4PUR A;  4WKW A;  1TI3 A;  2H0H A;  2YV9 A;  1GRX A;  5ECR B;  2HRN A;  4ECC A;  5IMV A;  3R2Q A;  5GST A;  2RM5 A;  3KP9 A;  2C0E A;  3R3E A;  1SKW B;  5G5E A;  2M72 A;  4OMV A;  2NTO A;  5DJM A;  2YZH A;  3HHV A;  2DIZ A;  2J9H A;  1ZMA A;  3QAV A;  1A2J A;  3DVW A;  2DJ3 A;  3TJB A;  3HVX A;  2KP2 A;  5KN1 A;  2DJ0 A;  4MJC A;  4L8E A;  1UC7 A;  4GLT A;  1URM A;  1BED A;  5IQY A;  2C0F A;  4HDE A;  1ZOF A;  5CRW A;  2GSS A;  1T3B A;  1H75 A;  5DQY A;  2IMI A;  2P5Q A;  4DVC A;  4MZW A;  4BVY A;  2F51 A;  4USS A;  1A0F A;  2M46 A;  4TVE A;  1TI1 A;  4ZB8 A;  1XW9 A;  5IPG A;  4ACS A;  1HQO A;  4BL7 B;  1G7E A;  4IN0 A;  4K2X A;  4OCF A;  2KUC A;  2MMO A;  2KHP A;  2G0F A;  5FWG A;  1ZZY A;  1R5A A;  1QK8 A;  1QUW A;  2YOI A;  4XS6 A;  5EVO A;  1GSY A;  3QPM A;  2GDR A;  2YAN A;  4Z2T A;  1J08 A;  3ZTL A;  3VWW A;  2V32 A;  4K5S A;  1QQ2 A;  2JAD A;  3LSZ A;  4RI7 A;  2C0D A;  1WP0 A;  2JL4 A;  4CHS A;  3OR5 A;  4YH2 A;  3IHQ A;  3L0H A;  2P31 A;  2K9F A;  4MNN A;  5D9V A;  5IMA A;  2GQL A;  4GRF A;  4X4J A;  3O6T A;  4GXZ A;  3P2A A;  1WE0 A;  3GFK A;  3QFB C;  4MDC A;  1JFU A;  2PGT A;  3ED3 A;  2DSA A;  5AN1 A;  1R26 A;  3F6D A;  1RW1 A;  2FY6 A;  2PPT A;  1F3A A;  1V58 A;  2H66 A;  1VF1 A;  1RK4 A;  1XWK A;  3KH7 A;  3LQ7 A;  3GUR A;  4EF0 A;  5GAP D;  5HFG A;  5D8I A;  4HQS A;  3L9V A;  3H1N A;  4KDX A;  3IAM 2;  2L5O A;  4OO5 A;  1DUG A;  4XS4 A;  2ZNM A;  2PUK C;  1MD3 A;  4ECB A;  2DML A;  3ERW A;  4HEA 2;  4I2U A;  3IPZ A;  1OC9 A;  1PKW A;  3RBT A;  2JU5 A;  4EDZ A;  2AJQ B;  1O7U A;  1F2E A;  5DAL B;  2R0G A;  3GNJ A;  2LUS A;  1OE8 A;  4A5P A;  1XW6 A;  5HR3 A;  4HU7 A;  1X5C A;  4PXO A;  4EIP A;  2NVL A;  1U88 A;  4POB A;  3VPQ A;  1F9M A;  3HD5 A;  3QAG A;  2IL3 A;  3DEX A;  1V9W A;  1XWC A;  2NDO A;  3G7I A;  2C8U A;  2OAC A;  4O5Q A;  4ZXG A;  4PQI A;  4IGJ A;  1OKT A;  5ABR A;  2B7K A;  4Z2U A;  3HXS A;  1BYE A;  2WZ9 A;  2VL3 A;  2H72 A;  5ELA A;  3A2V A;  2DJ2 A;  1TXX A;  2GST A;  3CSH A;  1TJD A;  2YJH A;  3BOA A;  9GSS A;  1U3A A;  1X5E A;  2B5X A;  3QR6 A;  4F0C A;  1NW2 A;  2CX4 A;  2I3Y A;  1GSU A;  4BVX A;  2LNS A;  2F8A A;  4DSR A;  4JBB A;  1EEJ A;  3HVS A;  1FHE A;  5JWQ B;  4MJE A;  4MP4 A;  3IK9 A;  2OE0 A;  5C04 A;  5HFK A;  2GSR A;  2VOC A;  5JWO B;  2YJ7 A;  4Z2R A;  4JU5 A;  2DJK A;  4TN8 A;  4ULX A;  3D0Z A;  3LWA A;  2H73 A;  1LBK A;  4TR1 B;  3L4N A;  5CRG A;  3F9U A;  2IFQ B;  4O92 A;  3I9V 2;  5ELG A;  4IVF A;  3GA4 A;  1R7H A;  1GLP A;  1EV4 A;  1X9S B;  2DC5 A;  2EIQ A;  2L57 A;  5IM9 A;  17GS A;  3EU3 A;  1EV9 A;  2H1A A;  2RM6 A;  1Z5Y E;  2WDU A;  5JCG A;  4JED A;  4K5R A;  4TW5 A;  1SKS B;  2FD3 A;  3H79 A;  4O7H A;  2YWI A;  3L9S A;  1MTC A;  3APS A;  3TKQ A;  5CP1 A;  2KLX A;  2YN1 A;  3TRQ A;  4KA0 A;  2LKU A;  2LJK A;  5J41 A;  1ZL9 A;  1TOF A;  4H86 A;  1RQM A;  1FO5 A;  5C00 A;  2K6V A;  4AJ6 A;  1H4O A;  2MMN A;  2X64 A;  2YV7 A;  3Q19 A;  4JR4 A;  2RUE A;  3EMX A;  2B1L A;  3F6F A;  3HCZ A;  4POK A;  4TR4 A;  5ID2 B;  2XBQ A;  4N30 A;  4POM A;  1FG4 A;  3HJM A;  4XRD A;  2R4V A;  1K0C A;  2H76 A;  2H6Y A;  1ILO A;  3A2W A;  2WS2 A;  4AF2 A;  4QL9 A;  3FKF A;  4RQR A;  4X1U A;  5A4U A;  5LNK e;  2FWH A;  4F03 A;  4KW6 A;  5IMZ A;  3TOT A;  5AIS A;  3IDV A;  4WF4 A;  1EP7 A;  1HD2 A;  4IBP A;  3D4T A;  4PTS A;  2GT5 A;  2DKI A;  2LJA A;  3MDK A;  6GSW A;  4Q5R A;  4X43 A;  3HA9 A;  4KSO A;  1O6J A;  1SL1 B;  3WGD A;  2DBC A;  3KD0 A;  1GH2 A;  1PSQ A;  2IMK A;  2V6K A;  2H01 A;  1ZYE A;  22GS A;  5H5S A;  1YF0 A;  3DYR A;  3GIX A;  5LCZ A;  2V1M A;  1K0M A;  4IJ3 A;  1XW5 A;  4ISD A;  3P90 A;  1XBS A;  2GSQ A;  1TK0 B;  3F3R A;  4ID0 A;  2E2M A;  5DAK A;  4HUA A;  2B3S A;  3G7Y A;  2VD0 A;  3GTU A;  4GTU A;  1QMV A;  1TTZ A;  2H0I A;  3GL5 A;  5DVB A;  2ZCT A;  1QGV A;  2CVD A;  3CRU A;  3ERF A;  1AQX A;  5G2Z A;  1XVQ A;  4WET A;  1OC3 A;  3IR4 A;  1KBN A;  1X9W B;  3TRP A;  4LL4 B;  3H93 A;  1QFN A;  1OC8 A;  2VUP A;  5F07 A;  1FW1 A;  2OE3 A;  2ES7 A;  2QSI A;  1M99 A;  3HY2 A;  1SKR B;  1I5G A;  2OAD A;  5IMC A;  2GZP A;  3TKS C;  2X4A A;  3GN3 A;  1PD2 1;  6GSS A;  1ERU A;  4G0I A;  4PUA A;  4IW9 A;  3IBH A;  5DBQ A;  3LXT A;  3ZVJ D;  1UA5 A;  3JCM L;  3CRT A;  3PGT A;  5CRE A;  2CX3 A;  4ZL9 A;  2L4Q A;  4ZB6 A;  2DMM A;  1Y6E A;  1IYH A;  2B5E A;  2N5F A;  2HZE A;  1WRY A;  4MJA A;  4K6X A;  1ERW A;  3LOR A;  2EC4 A;  1TKD B;  1J9B A;  3Q6O A;  5D73 A;  4I6X A;  4BPY A;  3VI5 A;  3SBC A;  3QDN A;  2VL2 C;  4MH3 A;  4TOP A;  1EOH A;  1A8L A;  1M9B A;  5JCW A;  3RPN A;  1FVK A;  5IOX A;  2L5L A;  6GSX A;  1OYJ A;  4WEY A;  6GSU A;  4QQ7 A;  5CNW A;  3KJY A;  3UIW A;  2GTU A;  2VCT A;  4YKF A;  3TGZ A;  1USB A;  3KTB A;  3UBK A;  3I69 A;  4OWY A;  1I9D A;  1PA3 A;  1VF3 A;  3CMI A;  2VAF A;  2XPE A;  2H70 A;  4AJ8 A;  5BMU A;  2A4H A;  1WMJ A;  5DCH A;  3QD9 A;  4GWR A;  2R2J A;  1GTI A;  5DJL A;  3UJ1 A;  5JWR B;  3M3M A;  1GL8 A;  3CYN A;  2QA2 A;  3ZL5 A;  4K7O A;  1NHY A;  2HRA A;  1XOB A;  1DE2 A;  3EPT A;  3IHG A;  4J57 E;  2YZU A;  2HXK A;  5B8A A;  4MZC A;  1W89 A;  3UMA A;  5KN2 A;  2HE3 A;  3H4K A;  2A2P A;  3GYK A;  5EPF A;  3GSS A;  1AW9 A;  3WD6 A;  5A4W A;  5B6M A;  1QXH A;  2MYG A;  4YQV A;  1XXU A;  4OO4 A;  2X8H A;  2BTO T;  2V2G A;  1Y25 A;  2YNX A;  2F9S A;  2IPA A;  2YWM A;  3MAK A;  1ABA A;  8GSS A;  2VCZ A;  5FT3 A;  12GS A;  1SD8 A;  3LYK A;  3KIJ A;  4XHM A;  5D93 A;  1A2L A;  1A24 A;  4GQF A;  10GS A;  2GT6 A;  3DIE A;  1JZD A;  3U6V A;  1AIU A;  1PX7 A;  3GX0 A;  1S3A A;  2L4C A;  2B5Y A;  2AAW A;  3WYW A;  1HNB A;  2KP1 A;  2FWG A;  1GUL A;  4OFN A;  11GS A;  2H1B A;  3CTF A;  1XIY A;  2YP6 A;  5D9X A;  2FGX A;  1AAZ A;  3M0F A;  1S3D A;  4ECJ A;  1EOG A;  4XS1 A;  1A23 A;  4D73 B;  3FMW A;  4MMM A;  4N10 A;  2WFC A;  4CW9 A;  2KOK A;  3QFA C;  19GS A;  1XFL A;  5G30 A;  3LXZ A;  3IOS A;  1ML6 A;  2E2G A;  2PWJ A;  1BAY A;  4N0Z A;  4XTS A;  4KCA A;  5D9T A;  1GWC A;  2LJR A;  3TKR A;  2VM1 A;  3M9K A;  4KH7 A;  1SYX A;  3TB2 A;  2CAI A;  4ZBD A;  1O73 A;  2BMX A;  2WB9 A;  5DDL A;  2H0G A;  3IA1 A;  1Z3E A;  4V2M A;  2GGT A;  3I6A A;  1LU4 A;  3FR3 A;  3EU4 A;  2R5G A;  1B48 A;  2AUV A;  5H5R A;  14GS A;  5IO0 A;  2YWN A;  2RUF A;  1PN0 A;  1ZGN A;  5B6N A;  1TRS A;  4IQ1 A;  3P8W A;  5ECH B;  1AQW A;  3L9U A;  2JSZ A;  2K8V A;  2H6X A;  5ECP B;  2C3T A;  2ON7 A;  3DD3 A;  1N2A A;  2WCI A;  4BA7 A;  3FK8 A;  2AYT A;  3MSZ A;  3CXG A;  4OD7 A;  2ON5 A;  4DSS B;  4Q5Q A;  2LEG A;  3M1G A;  4MH2 A;  5CRD A;  2LRC A;  2MZC A;  4F82 A;  3A5I A;  1GNE A;  3TDG A;  2VLT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...