1T00A

The structure of thioredoxin from s. coelicolor
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
112
structure length
112
Chain Sequence
SHMAGTLKHVTDDSFEQDVLKNDKPVLVDFWAAWCGPCRQIAPSLEAIAAEYGDKIEIVKLNIDENPGTAAKYGVMSIPTLNVYQGGEVAKTIVGAKPKAAIVRDLEDFIAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Thioredoxin
publication title Expression, purification and X-ray crystallographic analysis of thioredoxin from Streptomyces coelicolor.
pubmed doi rcsb
source organism Streptomyces coelicolor
total genus 30
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2004-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1t00A00
2A2RA 3C8EA 1FAAA 3QFAC 4NV2A 4MF7A 1S3DA 4GXZA 4YAPA 1TDIA 4KGIA 3PINA 1GTBA 3LQ7A 1V98A 3ERFA 2LNSA 2IJYA 5B7CA 3L4NA 3V1WA 1ERWA 1R26A 4GQCA 1F6MC 1OC3A 4DSSA 5HQPA 2DC5A 5HR1A 1TXXA 4L8EA 2V2GA 5HR3A 4I2UA 5DJLA 1EV4A 3NIVA 2KOKA 2GT5A 1O8WA 2DMLA 2YOIA 1OAZA 3CTGA 4ZIJA 1Z5YE 3GFKA 1UA5A 2KLXA 1V2AA 1SL2B 5DJMA 3F3QA 4YQUA 1EEJA 1K3YA 1GSQA 1KBNA 1M9AA 4ZL7A 1JZDA 1G0TA 3BD2A 2PU9C 2DJ1A 5CO3A 2YWNA 5F07A 4NXIA 5DDLA 4WR4A 3FRCA 3FKFA 1TI3A 4EDYA 1FVKA 2J9HA 1WMJA 2CX4A 4BA7A 3ZZXA 3JCML 1NM3A 3CSHA 2Z9SA 1USBA 3UAPA 3D22A 4DSRA 2LRCA 3M8NA 2LS5A 4FYUA 1MEKA 1XBSA 2I9HA 1B4PA 3QAGA 5G2ZA 3CMIA 5ECNB 3KIJA 3U5RE 2LQOA 4O92A 2C0FA 3ED3A 1HQOA 5DVBA 3FR3A 1WP0A 5D9VA 2FCHA 2YZUA 1SL0B 1EV9A 5HR2A 4RQRA 4Q5NA 5EPFA 2HZFA 2RM6A 2RUFA 3LGCA 4ZBAA 4V1Ap 1TK0B 1GSFA 3EMPA 4PQHA 4WETA 1EWXA 2VD0A 2AJQB 3SWLA 5IMZA 1ZYQB 3FW2A 1SD9A 2WULA 1FOVA 1JZOA 4PXOA 4BVXA 2AAWA 4OFMA 2H0IA 4BVYA 2HLSA 4PQ1A 4KNDA 2ON5A 5D73A 3DRNA 1QFNA 1T8EB 1GRXA 2BMXA 1M99A 3BCIA 3Q74A 1AXDA 3FY7A 1WRYA 5G1KA 4POKA 3W6GA 1BG5A 3DYRA 2EIQA 3LXZA 2PUKC 10GSA 1S3AA 1HNCA 3N9JA 2HXKA 2VM1A 5IMCA 4EE0A 1YEPA 2M72A 1Y6EA 5J3RA 2AV4A 3WGEA 2WCIA 4MMMA 3DGQA 2C3QA 5J4UA 4JZQA 1JHBA 12GSA 16GSA 3WT1A 2CAQA 4YQVA 3L9VA 3ZVJD 3VPTA 5CRGA 2K6VA 3HVSA 5G31A 2XHFA 2GZYA 1XW6A 3MDKA 1XWKA 1WJKA 2YANA 3KJYA 2MYGA 3KEBA 1XVQA 2IPAA 1VF2A 4TKYA 4EVMA 1B9YC 4PURA 1GSDA 2O7KA 2ZCTA 1SKSB 1WIKA 3LYKA 4ECJA 3D21A 2F3MA 1OC9A 3MWHA 3APSA 1QXHA 3A2WA 3M9JA 2C0GA 2QSIA 1Q98A 4D73A 1XXUA 1MTCA 2H1GA 1XVWA 4GSNA 1O73A 3I6AA 2FUG2 3M0FA 4K7NA 4ID0A 1F2EA 3PH9A 1EZKA 5GSTA 4JE1A 1EP7A 4ZBBA 1O81A 4O32A 1U6TA 2HYXA 4ECBA 1XW5A 3Q18A 5ECPB 3TOTA 3IAS2 4KE3A 4FIWA 3WGXA 5CRDA 1OYJA 2B7KA 4AJ8A 3MNGA 1ERUA 1U87A 1MDJA 2O89A 4LMWA 1Z6NA 5DCHA 1O6JA 2F51A 2DJ3A 2LKUA 1PX7A 2GQKA 4PNFA 4WEYA 2LRNA 4IBPA 1DE1A 4GRFA 2CZ2A 2NTOA 5HFKA 2X64A 3QPMA 18GSA 1UVZA 1A0RP 5DAKA 1Q4JA 3UBKA 3UOMA 3IC4A 5DALB 4MJCA 3KCMA 2NVLA 2VL2C 1N8JA 2H74A 3GTUB 1NHYA 5JCGA 4TR1A 2GS3A 1SYRA 5DBQA 3QD9A 3ZMKA 2ZNMA 3ZL5A 3L78A 3U6VA 2LJAA 1B9XC 1A2JA 1QMVA 5GSSA 1J9BA 4L5OA 1A2LA 3H4KA 2X99A 2OA7A 6GSWA 2PPTA 3C7MA 1Z7RA 1XOAA 2DJKA 5ECRB 2XBIA 5H5RA 4MP4A 4EKZA 4PUAA 2LQQA 4ULXA 2OJLA 2IMKA 4L5LA 4QL9A 1XCCA 3ME7A 2MZCA 4WBRD 4MJAA 3I9V2 2JSYA 4N0ZA 1B4QA 1A0FA 2BJXA 3IK7A 2RM5A 4PQIA 3F8UA 4EDZA 4IGJA 4CHSA 2O87A 4CDOA 3UVTA 2H01A 1SU9A 2B3SA 5KN2A 3RDWA 5ID2A 2QC7A 2FWGA 3TDGA 3QOUA 1GSSA 3RPNA 5ECOB 3KH7A 5ECHB 4KH7A 5F05A 4NMUA 1J0FA 3UVHA 6GSYA 3I43A 2C3TA 3TRPA 5L71A 2PWJA 4IQ1A 5ECLB 1PX6A 2L5LA 3ERWA 3FHKA 1OVNA 2DJ0A 3LFLA 4MPFA 4CW9A 2CVDA 2RIIA 5INYA 2LNTA 1GUHA 2IIYA 3IXRA 1YKCA 5A5KA 2PVQA 1GSUA 1DUGA 1F9MA 3TRXA 2JZRA 5AGYA 3CSJA 3M3MA 5GZZB 5HFGA 4RI7A 3IV4A 3LYPA 2WZ9A 1SYXA 3GV1A 5DQSA 3HZ8A 5GAND 4HI7A 4TN8A 2ALBA 1PKZA 3R2QA 1X5DA 3HYPA 2IMDA 2DBCA 1YJ6A 5FHIA 3UMAA 5LD0A 4MH2A 2FD3A 4TOPA 1KTEA 3TKSA 5IMDA 4Q5QA 2F8AA 1ZL9A 3H8QA 2VM2A 4K9ZA 2CT6A 2MMOA 4JR6A 4WR5A 1JZRA 4EXJA 5E4WA 3GH9A 3HDCA 3GRXA 5AIVA 5KN0A 4QL7A 4MPGA 4POBA 1O85A 4GLTA 5H5SA 4IKHA 2EIRA 3S9FA 1ZGNA 4G19A 1SK1A 1JFUA 4TXOB 1GP1A 5DCGA 3TJKA 3WGDA 3KP9A 4IP6A 5F06A 5CRWA 3WD6A 2PGTA 3L0HA 1BEDA 2GLRA 2YCDA 3FZ5A 4KUNA 1CQHA 4IN0A 2GZPA 2F9SA 3IR4A 1G6WA 5IPGA 2AB6A 2K18A 2VAFA 4KSMA 1K0DA 3CRUA 4L0WA 3EC3A 1Z3EA 4KA0A 2FA8A 3C1RA 5A4WA 2KHPA 1T7PB 3DVXA 2H66A 1AW9A 4MF5A 1F3BA 1AAZA 1GUMA 2OKAA 3IPZA 1VGLA 5J41A 1N2AA 4K0NA 2VUPA 3GL5A 2VCWA 1NSWA 2C8UA 3QDNA 17GSA 3DMLA 4MABA 1FB0A 4NV5A 1Z6MA 1PD21 1A24A 3Q6OA 2L4CA 2H70A 4V2MA 2LEGA 2D2ZA 3G7JA 4HUAA 3IK9A 3VURA 3NZNA 1H4OA 4N0VA 2VL3A 2H6ZA 4FYBA 4XRDA 3P7XA 4I6XA 3UBLA 4AF2A 1AC1A 3TUEA 1DSBA 1KEBA 2H71A 3TKQA 1X9SB 5JWRB 1K0CA 2V32A 2YJHA 4OWYA 4XRAA 3FR6A 2DSAA 4IS0A 4N11A 4DVCA 3VWWA 3ZITA 2WS2A 4BWSA 1S3CA 2FWEA 3SBCA 3D4MA 2JACA 1SK0A 3EWLA 3F4RA 5ABRA 3QMXA 5D93A 3HKRA 2HI7A 2P5RA 2TRXA 3AY8A 2XPDA 2LRTA 4OD7A 3DWVA 2N5AA 4KX4A 1ACVA 2HT9A 5HR0A 2WB9A 4BL7A 4XTSA 1LJRA 5IPHA 4KB3A 1U3IA 2B5EA 1BX9A 2H0HA 4ZB8A 5D8IA 4POMA 2VCVA 3D0ZA 4RQXA 4OCEA 3F9UA 3F3RA 4TR0A 1FO5A 3GKKA 4MJBA 4EL1A 4IQAA 4DEJA 4F0BA 2R4VA 2F8FA 3RAZA 1NHOA 2DJJA 3EVIA 3F4TA 1BJXA 3C73A 5JCWA 4OO5A 1YF0A 5AISA 2H76A 2FWFA 3EU4A 3KXOA 4HZ2A 2GDRA 2MMZA 3PR8A 4MA9A 3EE2A 3DVWA 1XWAA 1PQNA 2ZUPA 5IO2A 1X9MB 4V2NA 1GULA 3IDVA 3G9BA 1PL1A 1EOHA 4K2DA 1XWCA 2E2GA 3VWXA 1EOGA 4EO3A 5EL8A 4ECCA 1K0OA 3IBHA 3HY2A 4PX1A 3HJPA 3EMXA 4HJ2A 1OC8A 2YV9A 3DD3A 1AIUA 4J2FA 5LCZA 4WXTA 4HZ4A 3ZIVA 4QQ7A 1EP8A 5DALA 3ME8A 4HDEA 4BWQA 2GQMA 3KMOA 4TVEA 3GTUA 2LTKA 2OBKA 2X8GA 4GWRA 1XIYA 2FHEA 4V2LA 4XCSA 2H8LA 3GSTA 2H30A 2FA4A 1BAYA 2IFQB 2H75A 1XWGA 1SJZA 3ZREA 3GKMA 3QCPA 5CYYA 4KW6A 4J56E 3K8NA 4LL1B 2K8VA 4MF6A 2VOCA 3BBYA 1BYEA 3GN3A 4PUFC 2YWIA 4K8MA 4OMVA 2VCZA 2WDUA 11GSA 2HFDA 1G7EA 4Z7XA 1JLVA 2B1KA 2FGXA 2JSZA 2GT6A 5A4VA 5C00A 1FB6A 4POLA 2MMAA 1R5PA 3MSZA 2H1AA 3WYWA 5J9CA 2YN1A 4MH3A 3KM6A 4XS4B 4AGSA 1THOA 5B8BA 3P90A 1MD4A 3D5JA 4ZBDA 3QAWA 4MZBA 3HXSA 3BCKA 3Q19A 4FO5A 5B6NA 2OBIA 1V40A 2J23A 3APOA 3TJFA 2DIYA 5DQYA 3FZ9A 3BOAA 2G2QA 5D9WA 2YP6A 2CV4A 5ENUA 2FLSA 5JWOB 2B1LA 4TR3A 4MK3A 2HRNA 1ZOFA 2CVKA 2R3XA 3F6FA 4OCFA 5CAXA 5GAPD 3ZTLA 2L59A 1LBKA 5FT3A 3E9JB 1K3OA 1PMTA 2PBJA 1MD3A 5E59A 5G5EA 4WKWA 2GSSA 4ML1A 1ON4A 5IIZA 1AQXA 3GNJA 1YY7A 3KMNA 3C71A 2WRTA 1TJDA 1F37A 4EUYA 2AYTA 1A2MA 4KDUA 2HZEB 3DIEA 3LSZA 1JLWA 4N30A 2R2JA 1YQ1A 1I5GA 1QUWA 1ST9A 2X8CA 1M0UA 5A4UA 4PGTA 14GSA 4NHZA 1IYIA 4AJ7A 3P2AA 4OO4A 5KEJA 4K0GA 1GWCA 4ZB6A 4GTUA 1PGTA 2CVBA 5D9TA 4O7HA 1X5EA 3HJOA 3O3TA 5ECMB 2A4VA 3LWAA 4G2EA 3L9SA 2KP1A 1ZCPA 2V6OA 1K0NA 3BJ5A 2XPEA 2VCXA 1GL8A 2LV3A 5J9BA 3M1GA 1TRSA 1F3AA 4TXOA 3DEXA 3FK8A 1TK5B 1GH2A 4LL4B 1WE0A 1A8LA 4O5RA 2P0GA 3VK9A 5ECKB 5B8AA 4IJ3A 1U88A 1ERVA 4JRRA 3IAM2 2N5FA 1PN9A 2VIMA 4EF0A 2HSYA 22GSA 1EGOA 3KTBA 3QAVA 2V1MA 3A2VA 5ECIB 4IELA 2YJ7A 1GSYA 4F9ZA 1GLPA 2HNLA 4MCUA 1TW9A 5B6MA 4OFTA 3LXTA 2C1YA 4WF5A 2VCQA 4IHUA 2I81A 3A3TA 2R6KA 3G7IA 3N5OA 1HNAA 2IL3A 1OE7A 2OADA 4DSQA 3G7YA 3PGTA 3ZIJA 3RHCA 3CXGA 3DKSA 2AUVA 5JWQB 2CZ3A 4X1UA 1CQGA 1XOBA 2C80A 2PMTA 1MDIA 2YWMA 2H1BA 1EEMA 3RBTA 6GSXA 5IO0A 5CP1A 2VLUA 2HRFA 4ACSA 1W4VA 4YQMA 2OE0A 2VLTA 4Q5RA 4TXVA 4K1FA 4ILFA 2LSTA 1AQVA 1G7OA 2JZSA 1SL1B 3FZ4A 3A5WA 2P31A 1HYUA 1TP9A 2RUEA 1SKWB 4IP1A 3LORA 4K7OA 3FEUA 5AN1A 2H6XA 5G5FA 3D6IA 4G10A 4EC0A 3F0IA 3HVVA 3NOFA 3H79A 1TKDB 2L6DA 3FYGA 3QFBC 1PRXA 1HD2A 3W8SA 1X5CA 2I4AA 1TTZA 1PSQA 8GSSA 3QR6A 4MDCA 1TU7A 2JZTA 2VL2A 3HHVA 3F4SA 4FH8A 4G9HA 1A23A 1UC7A 2I3YA 4KAEA 3GIXA 3LG6A 4YAVA 1TRUA 3ERGA 1QGVA 3O76A 2BTOT 3OR5A 1E6BA 5CREA 1ABAA 2B5YA 1GNEA 3KP8A 4HQSA 1R7HA 2R37A 1T00A 2AHEA 2X8HA 2CAIA 3GMFA 1O8XA 2H0GA 2HSHA 1G6YA 1PL2A 1T4ZA 1TU8A 5KN1A 1HNBA 4DSSB 3UIWA 3MAKA 2N5BA 4TR4A 3ZMLA 4JR4A 3TOUA 2C4JA 2IMEA 5ELAA 1DE2A 2E7PA 1XPVA 4HEA2 2LJKA 3I69A 5H5QA 1VRSD 4GSTA 2IMIA 2M46A 1DBYA 3GURA 6GSSA 5G1LA 4ZL8A 2EC4A 3LEFA 3VI7A 5C04A 1YEXA 4F0CA 3EYTA 3VPQA 5F8BA 2GSTA 1URMA 2GGTA 1V58A 3TKSE 4I2TA 3ZYWA 1AUCA 2V41A 2IMFA 3HCZA 1OE8A 1FHEA 3KGKA 5IOXA 3VWVA 3CYNA 1THXA 3KZQA 2YPMA 3EU3A 2CA8A 3VI5A 1SK2A 4TRXA 1LU4A 4F03A 1R4WA 20GSA 2KUCA 3CRTA 2L6CA 2L57A 6GSUA 1QQ2A 3F63A 5J5NA 1QK8A 2XBQA 3ZFBA 4LMVA 1XFLA 2FWHA 2K9FA 3DXBA 5IQYA 3UEMA 3ZLPA 1TK8B 1WPIA 1RK4A 6GSVA 4RI6A 5IM9A 4JEDA 3TKPA 1YF1A 4GSSA 2JL4A 1PKWA 2IFQA 3HJMA 2NDOA 7GSSA 5IMFA 3UL3A 19GSA 3UJ1A 2OE3A 2O8VB 2I1UA 1J08A 13GSA 1GTIA 1TRVA 3CTFA 4K6XA 5ECSA 4E8HA 1SKRB 5D96A 4FYCA 1SENA 3A2XA 1GTUA 3KD0A 3EURA 2XC2A 3LJRA 1K0BA 3TKRA 3HZ4A 1SJIA 2VL9A 2R5GA 1B48A 4X0XA 1K0MA 4NPBA 2MMNA 2VO4A 3RPPA 2PERA 1H75A 4F82A 2GZZA 3TKSC 2MBTA 3KTLA 4RUVA 1ILOA 3M9KA 4NHWA 3IOSA 4ML6A 2E0QA 4WBJA 5CNWA 1ZZYA 2PN8A 4XS4A 4IW9A 4K7IA 3IRAA 2H1DA 2E2MA 2DMMA 2WFCA 3FR9A 2A2SA 4MLYA 1T3BA 1KNGA 4HJMA 3TB2A 3CBUA 4JU5A 4V1Ag 9GSSA 3J7Yb 4KDXA 3GYKA 2FNOA 5G30A 1FG4A 1M2DA 4F2IA 2MBSA 4HU9A 2WJUA 3GA4A 4GQFA 2H72A 1YDKA 5F0GA 5IOWA 3GSSA 1SD8A 3KH9A 2QGVA 3TJBA 1T4YA 3GUSA 4MZWA 5LNKe 4AJ6A 2LUSA 1R5AA 4YH2A 3GH6A 1K3LA 3WT2A 1FW1A 4XHMA 4I5QA 3O6TA 2M80A 2OE1A 2KP2A 2C0EA 3US3A 3GL3A 1I9DA 1W89A 3HA9A 4I8BA 1B8XA 4LA1A 3TGZA 3GKXA 2RLIA 5IMVA 2IN3A 4GF0A 1XZOA 2ES7A 4ZILA 5EVOA 3CSIA 1ZYEA 1VF1A 3TJGA 4N10A 2GSQA 1K0AA 1A8YA 2B6MA 1GNWA 2HZEA 4E8EA 2C0DA 2CX3A 1OC9B 4XIHA 4ZB9A 4JBBA 3GKNA 3FZAA 2C3NA 1UN2A 1AQWA 3GHAA 4D73B 4L0UA 3ZVJA 3TCOA 4Q5FA 1VF3A 5AIXA 5D9XA 4MZCA 2VD1A 2G0FA 1Y25A 2NBSA 3VWUA 1X9WB 3IE3A 2VCTA 1GTAA 1FVJA 2HE3A 2GVPA 2FY6A 3L9UA 5IMAA 2CQ9A 1IYHA 3GX8A 3J7Yk 4ZL9A 3IA1A 2VLVA 4HQZA 4NAXA 4TW5A 2B7JA 2IWTA 4GCIA 1EGRA 1ERTA 2QKEA 1TRWA 3F6DA 3H93A 5KN3A 3HD5A 2DIZA 1Z9HA 3HVXA 5HFIA 1GUKA 4P3YB 4H86A 1GSEA 3GX0A 4HS1A 3D4TA 6GSTA 2H73A 1V9WA 2H19A 2REMA 5DAKB 1VF4A 2OACA 1ZMAA 2YWOA 4BPYA 4TR1B 1X0RA 4ZXGA 4ISDA 5COHA 2LJRA 1T1VA 4MJEA 4IVFA 4NWYA 2YV7A 2DJ2A 2JADA 2EIOA 4KDYA 3ZRDA 2YNXA 1E2YA 1O7UA 2JU5A 3VFIA 3EINA 1M2AA 1BQ7A 1GLQA 1MDKA 3E3EA 2GQLA 5ELGA 2DLXA 5JCUA 2TRCP 4PNGA 3E0UA 1RW1A 1OKTA 1JZWA 2GTUA 4X43A 2ON7A 1RQMA 4KCEA 2P5QA 5ECQB 4HOJA 1XW9A 2O85A 2WGRA 1WOUA 1YZXA 3TJJA 2TIRA 3UARA 1M7TA 2PVOC 3RHBA 1U3AA 3VLNA 3W8JA 4I97A 1OKDA 1WWJA 2H6YA 2K8SA 5ID2B 3C1SA 4HU7A 4KCAA 4IJIA 4XS6A 2B5XA 4XS1A 1M9BA 2L4QA 2YZHA 4ECIA 2L5OA 2GSRA 4OFNA 1TI1A 1SJ6A 4WF4A 1Z7PA 1ML6A 4KSOA 3TRQA 2V6KA 4LLRA 3H1NA 1M2BA 3APQA 3ZFLA 4J57E 1NW2A 1YKAA 1XWBA 1PA3A 1V57A 1TOFA 2NPBA 1C72A 3ISOA 3P8WA 5FWGA 5EY6A 3IHQA 5CRHA
chains in the Genus database with same CATH superfamily
2A2RA 3C8EA 1FAAA 3FMWA 3QFAC 4NV2A 4MF7A 1S3DA 4GXZA 4YAPA 1TDIA 4KGIA 3PINA 1GTBA 3LQ7A 1V98A 3ERFA 2LNSA 2IJYA 5B7CA 3L4NA 3V1WA 1ERWA 1R26A 4GQCA 2UZ8A 2X49A 1F6MC 1OC3A 4DSSA 5HQPA 2DC5A 5HR1A 1TXXA 4L8EA 2V2GA 5HR3A 4I2UA 5DJLA 1EV4A 3NIVA 2KOKA 2GT5A 1O8WA 2DMLA 2YOIA 1OAZA 3CTGA 4ZIJA 1Z5YE 3GFKA 1UA5A 2KLXA 2X4AA 1V2AA 1SL2B 5DJMA 3F3QA 4YQUA 1EEJA 1PFOA 1K3YA 1GSQA 1KBNA 1M9AA 4ZL7A 1JZDA 1G0TA 3BD2A 2PU9C 2DJ1A 5CO3A 2YWNA 5F07A 4NXIA 5DDLA 4WR4A 3FRCA 3FKFA 1TI3A 4EDYA 1FVKA 2J9HA 1WMJA 2CX4A 4BA7A 3ZZXA 3JCML 1NM3A 3CSHA 2Z9SA 1USBA 3UAPA 3D22A 4DSRA 2LRCA 3M8NA 4Z2UA 2LS5A 4FYUA 1MEKA 1XBSA 2I9HA 1B4PA 3QAGA 5G2ZA 3CMIA 5ECNB 3KIJA 3U5RE 2LQOA 4O92A 2C0FA 3ED3A 3R3EA 1HQOA 5DVBA 3FR3A 1WP0A 5D9VA 2FCHA 2YZUA 1SL0B 1EV9A 5HR2A 4RQRA 4Q5NA 5EPFA 2HZFA 2RM6A 2RUFA 3LGCA 4ZBAA 4V1Ap 1TK0B 1GSFA 4KF9A 3EMPA 4PQHA 4WETA 1EWXA 2VD0A 2AJQB 3SWLA 5IMZA 1ZYQB 3FW2A 1SD9A 2WULA 1FOVA 1JZOA 4PXOA 4BVXA 2AAWA 4OFMA 2H0IA 4BVYA 2HLSA 4PQ1A 4KNDA 2ON5A 5D73A 3DRNA 1QFNA 1T8EB 1GRXA 2BMXA 1M99A 3BCIA 3Q74A 1AXDA 3FY7A 1WRYA 5G1KA 4POKA 3W6GA 1BG5A 3DYRA 2EIQA 3LXZA 2PUKC 10GSA 1S3AA 1HNCA 3N9JA 2HXKA 2VM1A 5IMCA 4EE0A 1YEPA 2M72A 1Y6EA 5J3RA 1ZYPA 2AV4A 3WGEA 4HSCX 2WCIA 4MMMA 3DGQA 2C3QA 5J4UA 4JZQA 1JHBA 12GSA 16GSA 3WT1A 2CAQA 4K2XA 4YQVA 3L9VA 1XG8A 3ZVJD 3VPTA 5CRGA 2K6VA 3HVSA 5G31A 2XHFA 2GZYA 1XW6A 3MDKA 1XWKA 1WJKA 2YANA 3KJYA 4PTSA 2MYGA 3KEBA 1XVQA 2HRKA 2IPAA 1VF2A 4TKYA 4EVMA 1B9YC 4PURA 1GSDA 2O7KA 2ZCTA 1SKSB 1WIKA 3LYKA 4ECJA 3D21A 2F3MA 1OC9A 3MWHA 3APSA 1QXHA 3A2WA 3M9JA 2C0GA 2QSIA 1Q98A 4D73A 1XXUA 1MTCA 2H1GA 1XVWA 4GSNA 3MIXA 1O73A 3I6AA 2FUG2 3M0FA 4K7NA 4ID0A 1F2EA 3PH9A 1EZKA 5GSTA 4JE1A 1EP7A 4ZBBA 1O81A 4O32A 1U6TA 2HYXA 4ECBA 1XW5A 3Q18A 5ECPB 3TOTA 3IAS2 4KE3A 4FIWA 3WGXA 5CRDA 1OYJA 2B7KA 4AJ8A 3MNGA 1ERUA 1U87A 1MDJA 2O89A 4LMWA 1Z6NA 5DCHA 1O6JA 2F51A 2DJ3A 2LKUA 1PX7A 2GQKA 4PNFA 4WEYA 2LRNA 4IBPA 1DE1A 4GRFA 2CZ2A 2NTOA 5HFKA 2X64A 3QPMA 18GSA 1UVZA 1A0RP 5DAKA 1Q4JA 3UBKA 3UOMA 3IC4A 5DALB 4MJCA 3KCMA 2NVLA 2VL2C 1N8JA 2H74A 3GTUB 1NHYA 5JCGA 4TR1A 2GS3A 1SYRA 5DBQA 3QD9A 3ZMKA 2ZNMA 3ZL5A 3L78A 3U6VA 2LJAA 1B9XC 1A2JA 1QMVA 5GSSA 1J9BA 4L5OA 1A2LA 3H4KA 2X99A 2OA7A 6GSWA 2PPTA 3C7MA 1Z7RA 1XOAA 2DJKA 5ECRB 2XBIA 5H5RA 4MP4A 4EKZA 4PUAA 2LQQA 4ULXA 2OJLA 2IMKA 4L5LA 4QL9A 1XCCA 3ME7A 2MZCA 4WBRD 4MJAA 3I9V2 4CY8A 2JSYA 4N0ZA 1B4QA 1A0FA 2BJXA 3IK7A 2RM5A 4PQIA 3F8UA 4EDZA 4IGJA 4CHSA 2O87A 4CDOA 3UVTA 2H01A 1SU9A 2B3SA 5KN2A 3RDWA 5ID2A 2QC7A 2FWGA 3TDGA 3QOUA 1GSSA 3RPNA 5ECOB 3KH7A 5ECHB 4KH7A 5F05A 4NMUA 1J0FA 3UVHA 6GSYA 3I43A 2C3TA 3TRPA 5L71A 2PWJA 4IQ1A 5ECLB 1PX6A 2L5LA 3ERWA 3FHKA 1OVNA 4K5SA 2DJ0A 2QA1A 3LFLA 4MPFA 4CW9A 2CVDA 2RIIA 5INYA 2LNTA 1GUHA 2IIYA 3IXRA 1YKCA 5A5KA 5KOWA 2PVQA 1GSUA 1DUGA 1F9MA 3TRXA 2JZRA 5AGYA 3CSJA 3M3MA 5GZZB 5HFGA 4RI7A 3IV4A 3LYPA 2WZ9A 1SYXA 3GV1A 5DQSA 3HZ8A 5GAND 4HI7A 4TN8A 2ALBA 1PKZA 3R2QA 1X5DA 3HYPA 2IMDA 2DBCA 1YJ6A 5FHIA 3UMAA 5LD0A 4MH2A 2FD3A 4TOPA 1KTEA 3TKSA 5IMDA 4Q5QA 2F8AA 1ZL9A 3H8QA 2VM2A 4K9ZA 2CT6A 2MMOA 4JR6A 4WR5A 1JZRA 4EXJA 5E4WA 3GH9A 2R0GA 3HDCA 3GRXA 5AIVA 5KN0A 4QL7A 4MPGA 4POBA 1O85A 4GLTA 5H5SA 4IKHA 2EIRA 3S9FA 1ZGNA 1S3RA 4G19A 1SK1A 1JFUA 4TXOB 1GP1A 5DCGA 3TJKA 3WGDA 3KP9A 4A5PA 4IP6A 5F06A 5CRWA 3WD6A 2PGTA 3L0HA 1BEDA 2GLRA 2YCDA 3FZ5A 4KUNA 1CQHA 4IN0A 2GZPA 2F9SA 3IR4A 1G6WA 5IPGA 2AB6A 2K18A 2VAFA 4KSMA 1K0DA 3CRUA 4L0WA 3EC3A 1Z3EA 4KA0A 2DKIA 2FA8A 3C1RA 5A4WA 2KHPA 1T7PB 3DVXA 3IHGA 2H66A 1AW9A 4MF5A 1F3BA 1AAZA 1GUMA 2OKAA 3IPZA 1VGLA 5J41A 1N2AA 4K0NA 2VUPA 3GL5A 2VCWA 1NSWA 2C8UA 3QDNA 17GSA 3DMLA 4MABA 1FB0A 4NV5A 1Z6MA 1PD21 1A24A 3Q6OA 2L4CA 2H70A 4V2MA 2LEGA 2D2ZA 3G7JA 4HUAA 3IK9A 3VURA 3NZNA 1H4OA 4N0VA 2VL3A 2H6ZA 4FYBA 4XRDA 3P7XA 4I6XA 2DKHA 3UBLA 1AC1A 4AF2A 3TUEA 1DSBA 1KEBA 2H71A 3TKQA 1X9SB 5JWRB 1K0CA 2V32A 2YJHA 4OWYA 4XRAA 3FR6A 2DSAA 4IS0A 4N11A 4O5UA 4DVCA 3VWWA 3ZITA 2WS2A 4BWSA 1S3CA 2FWEA 4MNNA 3SBCA 3D4MA 5BMUA 2JACA 1SK0A 3EWLA 3F4RA 4G0LA 5ABRA 3QMXA 5D93A 3HKRA 2HI7A 2P5RA 2TRXA 3AY8A 2XPDA 2LRTA 4OD7A 3DWVA 2N5AA 4KX4A 1ACVA 2HT9A 5HR0A 2WB9A 4BL7A 4XTSA 1LJRA 3IC8A 5IPHA 4KB3A 1U3IA 2B5EA 1BX9A 2H0HA 4ZB8A 5D8IA 4POMA 2VCVA 3D0ZA 4RQXA 4OCEA 3F9UA 3F3RA 4TR0A 1FO5A 3GKKA 4MJBA 4EL1A 4IQAA 4DEJA 4F0BA 2R4VA 2F8FA 3RAZA 1NHOA 2DJJA 3EVIA 3F4TA 1BJXA 3C73A 5JCWA 4OO5A 1YF0A 5AISA 2H76A 2FWFA 3EU4A 3KXOA 4HZ2A 2GDRA 2MMZA 3PR8A 4MA9A 3EE2A 3DVWA 1XWAA 1PQNA 2ZUPA 4G0IA 5IO2A 1X9MB 5KOXA 4V2NA 1GULA 3IDVA 3G9BA 1PL1A 1EOHA 4K2DA 1XWCA 2E2GA 3VWXA 1EOGA 4EO3A 5EL8A 4ECCA 1K0OA 3IBHA 3HY2A 4PX1A 3HJPA 3EMXA 4HJ2A 1OC8A 2YV9A 3DD3A 1AIUA 4J2FA 5LCZA 4WXTA 4HZ4A 3ZIVA 4QQ7A 1EP8A 5DALA 3ME8A 4HDEA 4BWQA 2GQMA 3KMOA 4TVEA 3GTUA 2LTKA 2OBKA 2X8GA 4GWRA 1XIYA 2FHEA 4V2LA 4XCSA 2H8LA 3GSTA 2H30A 2FA4A 1BAYA 2IFQB 2H75A 1XWGA 1SJZA 3ZREA 3GKMA 3QCPA 5CYYA 1M3IA 4KW6A 4J56E 3K8NA 4LL1B 2K8VA 4MF6A 2VOCA 3BBYA 1BYEA 3GN3A 3MYDA 4PUFC 2HRAA 2YWIA 4K8MA 4OMVA 2VCZA 2WDUA 11GSA 2HFDA 1G7EA 4Z7XA 1JLVA 2B1KA 2FGXA 2JSZA 2GT6A 5A4VA 5C00A 1FB6A 4POLA 2MMAA 1R5PA 3MSZA 2H1AA 3WYWA 5J9CA 2YN1A 4MH3A 3KM6A 4XS4B 4AGSA 1THOA 5B8BA 3P90A 3HVNA 1MD4A 2R0CA 3D5JA 4ZBDA 3QAWA 4MZBA 3HXSA 3BCKA 3Q19A 4FO5A 5B6NA 2OBIA 1V40A 2J23A 3APOA 3TJFA 2DIYA 5DQYA 3FZ9A 3BOAA 2G2QA 5D9WA 2YP6A 2CV4A 5ENUA 2FLSA 5JWOB 2B1LA 4TR3A 4MK3A 2HRNA 1ZOFA 2CVKA 2R3XA 3F6FA 4OCFA 5CAXA 5GAPD 3ZTLA 2L59A 1LBKA 5FT3A 3E9JB 1K3OA 1PMTA 2PBJA 1MD3A 5E59A 5G5EA 4WKWA 2GSSA 4ML1A 1ON4A 5IIZA 1AQXA 3GNJA 1YY7A 3KMNA 3C71A 2WRTA 1TJDA 1F37A 4EUYA 2AYTA 1A2MA 4KDUA 2HZEB 3DIEA 3LSZA 1JLWA 4N30A 2R2JA 1YQ1A 1I5GA 1QUWA 1ST9A 2X8CA 1M0UA 5A4UA 4PGTA 14GSA 4NHZA 1IYIA 4AJ7A 3P2AA 4OO4A 5KEJA 4K0GA 1GWCA 4ZB6A 4GTUA 1PGTA 2CVBA 5D9TA 4O7HA 1X5EA 2QA2A 3HJOA 3O3TA 5ECMB 2A4VA 3LWAA 4G2EA 3L9SA 2A4HA 2KP1A 1ZCPA 2V6OA 1K0NA 3BJ5A 2XPEA 2VCXA 1GL8A 2LV3A 5J9BA 3M1GA 1TRSA 1F3AA 4TXOA 3DEXA 3FK8A 1TK5B 1GH2A 4LL4B 4EIPA 1WE0A 1A8LA 4O5RA 2P0GA 3VK9A 5ECKB 5B8AA 4IJ3A 1U88A 1ERVA 4JRRA 3IAM2 2N5FA 1FOHA 1PN9A 2VIMA 4EF0A 2HSYA 22GSA 1EGOA 3KTBA 3QAVA 2V1MA 3A2VA 5ECIB 4YKFA 4IELA 2YJ7A 1GSYA 4F9ZA 1GLPA 2HNLA 4MCUA 1TW9A 5B6MA 4OFTA 3LXTA 2C1YA 4WF5A 2A2PA 2VCQA 4IHUA 2I81A 3A3TA 2R6KA 3G7IA 3N5OA 1HNAA 2IL3A 1OE7A 2OADA 4O5QA 4DSQA 4Z2TA 3G7YA 3PGTA 3ZIJA 3RHCA 3CXGA 3DKSA 2AUVA 5JWQB 2CZ3A 4X1UA 4ICYA 1CQGA 1XOBA 2C80A 2PMTA 1MDIA 2YWMA 2H1BA 1EEMA 3RBTA 6GSXA 5IO0A 5CP1A 2VLUA 2HRFA 4ACSA 1W4VA 4YQMA 2OE0A 2VLTA 4Q5RA 4TXVA 4K1FA 4ILFA 2LSTA 1AQVA 1G7OA 2JZSA 1SL1B 3FZ4A 3A5WA 2P31A 1HYUA 1TP9A 2RUEA 1SKWB 4IP1A 3LORA 4K7OA 4X4JA 3FEUA 5AN1A 2H6XA 5G5FA 3D6IA 4G10A 4EC0A 3F0IA 3HVVA 3NOFA 3H79A 1TKDB 2L6DA 3FYGA 3QFBC 1PRXA 1HD2A 3W8SA 1X5CA 2I4AA 1TTZA 1PSQA 2R0PA 8GSSA 3QR6A 4MDCA 1TU7A 2JZTA 2VL2A 3HHVA 3F4SA 4FH8A 4G9HA 1A23A 1UC7A 2I3YA 4KAEA 3GIXA 3LG6A 4YAVA 1TRUA 3ERGA 1QGVA 3O76A 5BRTA 2BTOT 3OR5A 1E6BA 5CREA 1ABAA 2B5YA 1GNEA 3KP8A 4HQSA 1R7HA 2R37A 1T00A 2AHEA 2X8HA 2CAIA 3GMFA 1O8XA 3LW9A 2H0GA 2HSHA 1G6YA 1PL2A 1T4ZA 1TU8A 5KN1A 1HNBA 1PN0A 4DSSB 3UIWA 3MAKA 2N5BA 4TR4A 3ZMLA 4JR4A 4CY6A 3TOUA 2C4JA 2IMEA 5ELAA 1DE2A 2E7PA 1XPVA 4HEA2 2LJKA 3I69A 5H5QA 1VRSD 4GSTA 2IMIA 2M46A 1DBYA 3GURA 6GSSA 5G1LA 4ZL8A 2EC4A 3LEFA 3VI7A 5C04A 1YEXA 1ZYNA 4F0CA 3EYTA 3VPQA 5F8BA 2GSTA 1URMA 2GGTA 1V58A 3TKSE 4I2TA 3ZYWA 1AUCA 2V41A 2IMFA 3HCZA 1OE8A 1FHEA 3KGKA 5IOXA 3VWVA 3CYNA 1THXA 3KZQA 2YPMA 3EU3A 2CA8A 3VI5A 1SK2A 4TRXA 1LU4A 4F03A 1R4WA 20GSA 2KUCA 3CRTA 2L6CA 2L57A 6GSUA 1QQ2A 3F63A 5J5NA 1QK8A 2XBQA 3ZFBA 4LMVA 1XFLA 2FWHA 2K9FA 3DXBA 5IQYA 3UEMA 3ZLPA 1TK8B 1WPIA 1RK4A 6GSVA 4Z2RA 4RI6A 5IM9A 4JEDA 3TKPA 1YF1A 4GSSA 2JL4A 1PKWA 2IFQA 3HJMA 2NDOA 7GSSA 5IMFA 3UL3A 19GSA 3UJ1A 2OE3A 2O8VB 2I1UA 1J08A 13GSA 1GTIA 1TRVA 3CTFA 4K6XA 5ECSA 4E8HA 1SKRB 5D96A 4FYCA 1SENA 3A2XA 1GTUA 3KD0A 3EURA 2XC2A 3LJRA 1K0BA 3TKRA 3HZ4A 1SJIA 2VL9A 2R5GA 1B48A 4X0XA 1K0MA 4NPBA 2MMNA 2VO4A 3RPPA 2PERA 4BL7B 1H75A 4F82A 2GZZA 3TKSC 2MBTA 3KTLA 4RUVA 1ILOA 3M9KA 4NHWA 4BVXB 3IOSA 4ML6A 4BVYB 2E0QA 4WBJA 5CNWA 4YKGA 2HSMA 1ZZYA 2PN8A 4XS4A 4IW9A 4K7IA 3IRAA 2H1DA 2E2MA 2DMMA 2WFCA 3FR9A 2A2SA 4MLYA 1T3BA 1KNGA 4HJMA 3PPUA 3TB2A 3CBUA 4JU5A 4V1Ag 9GSSA 3J7Yb 4KDXA 3GYKA 2FNOA 5G30A 1FG4A 1M2DA 4F2IA 3A5IA 2MBSA 4HU9A 2WJUA 3GA4A 4GQFA 2H72A 1YDKA 5F0GA 5IOWA 3GSSA 3CQFA 1SD8A 3KH9A 2QGVA 3TJBA 1T4YA 3GUSA 4MZWA 5LNKe 4AJ6A 2LUSA 1R5AA 4YH2A 3GH6A 4EIQA 1K3LA 3WT2A 1FW1A 4XHMA 4I5QA 3O6TA 2M80A 2OE1A 2KP2A 2C0EA 3US3A 3GL3A 1I9DA 1W89A 3HA9A 4I8BA 1B8XA 4LA1A 3TGZA 3GKXA 2RLIA 5IMVA 2IN3A 4GF0A 1XZOA 2ES7A 4ZILA 5EVOA 3CSIA 1ZYEA 1VF1A 3TJGA 4N10A 2GSQA 1K0AA 1A8YA 2B6MA 1GNWA 2HZEA 4E8EA 2C0DA 2CX3A 1OC9B 4XIHA 4ZB9A 4JBBA 3GKNA 3FZAA 2C3NA 1UN2A 1AQWA 3GHAA 4D73B 4L0UA 3ZVJA 3TCOA 4Q5FA 1VF3A 5AIXA 5D9XA 4MZCA 2VD1A 2G0FA 1Y25A 2NBSA 3VWUA 1X9WB 3IE3A 2VCTA 1GTAA 1FVJA 2HE3A 2GVPA 2FY6A 3L9UA 5IMAA 2CQ9A 1IYHA 3GX8A 3J7Yk 4ZL9A 3IA1A 2VLVA 4HQZA 4NAXA 1M3JA 4TW5A 2B7JA 2IWTA 4GCIA 1EGRA 1ERTA 2QKEA 1TRWA 3F6DA 3H93A 5KN3A 3HD5A 2DIZA 1Z9HA 3HVXA 5HFIA 1GUKA 4P3YB 4H86A 1GSEA 3GX0A 4HS1A 3D4TA 6GSTA 2H73A 1V9WA 2H19A 2REMA 5DAKB 1VF4A 2OACA 1ZMAA 2YWOA 4BPYA 4TR1B 1X0RA 4ZXGA 4ISDA 5COHA 2LJRA 1T1VA 4K5RA 4MJEA 4IVFA 4NWYA 2YV7A 2DJ2A 2JADA 2EIOA 4KDYA 3ZRDA 2YNXA 1E2YA 1O7UA 2JU5A 3VFIA 3EINA 1M2AA 1BQ7A 1GLQA 1MDKA 3E3EA 4G0KA 2GQLA 5ELGA 2DLXA 5JCUA 2TRCP 4PNGA 3E0UA 1RW1A 1OKTA 1JZWA 2GTUA 4X43A 2ON7A 1RQMA 4KCEA 2P5QA 4FQUA 5ECQB 4HOJA 1XW9A 2O85A 2WGRA 1WOUA 1YZXA 3TJJA 2TIRA 3UARA 1M7TA 2PVOC 3RHBA 1U3AA 3VLNA 3W8JA 4I97A 1OKDA 1WWJA 2H6YA 2K8SA 5ID2B 3C1SA 4HU7A 4KCAA 4IJIA 4BIKA 4XS6A 2B5XA 4XS1A 1M9BA 2L4QA 2YZHA 4ECIA 2L5OA 2GSRA 4OFNA 1TI1A 1SJ6A 4WF4A 1Z7PA 1ML6A 4KSOA 3TRQA 2V6KA 4LLRA 3H1NA 1M2BA 3APQA 3ZFLA 3EPTA 4J57E 1NW2A 1YKAA 1XWBA 1PA3A 1V57A 1TOFA 2NPBA 1C72A 3ISOA 3P8WA 5FWGA 5EY6A 3IHQA 4USSA 5CRHA
chains in the Genus database with same CATH topology
2A2RA 3C8EA 1FAAA 3FMWA 3QFAC 4NV2A 4MF7A 1S3DA 4GXZA 4YAPA 1TDIA 4KGIA 3PINA 1GTBA 3LQ7A 1V98A 3ERFA 2LNSA 2IJYA 5B7CA 3L4NA 3V1WA 1ERWA 1R26A 4GQCA 2UZ8A 2X49A 1F6MC 1OC3A 4DSSA 5HQPA 2DC5A 5HR1A 1TXXA 4L8EA 2V2GA 5HR3A 4I2UA 5DJLA 1EV4A 3NIVA 2KOKA 2GT5A 1O8WA 2DMLA 2YOIA 1OAZA 3CTGA 4ZIJA 1Z5YE 3GFKA 1UA5A 2KLXA 2X4AA 1V2AA 1SL2B 5DJMA 3F3QA 4YQUA 1EEJA 1K3YA 1GSQA 1KBNA 1M9AA 4ZL7A 1JZDA 1G0TA 3BD2A 2PU9C 2DJ1A 5CO3A 2YWNA 5F07A 4NXIA 5DDLA 4WR4A 3FRCA 3FKFA 1TI3A 4EDYA 1FVKA 2J9HA 1WMJA 2CX4A 4BA7A 3ZZXA 3JCML 1NM3A 3CSHA 2Z9SA 1USBA 3UAPA 3D22A 4DSRA 2LRCA 3M8NA 4Z2UA 2LS5A 4FYUA 1MEKA 1XBSA 2I9HA 1B4PA 3QAGA 5G2ZA 3CMIA 5ECNB 3KIJA 3U5RE 2LQOA 4O92A 2C0FA 3ED3A 3R3EA 1HQOA 5DVBA 3FR3A 1WP0A 5D9VA 2FCHA 2YZUA 1SL0B 1EV9A 5HR2A 4RQRA 4Q5NA 5EPFA 2HZFA 2RM6A 2RUFA 3LGCA 4ZBAA 4V1Ap 1TK0B 1GSFA 4KF9A 3EMPA 4PQHA 4WETA 1EWXA 2VD0A 2AJQB 3SWLA 5IMZA 1ZYQB 3FW2A 1SD9A 2WULA 1FOVA 1JZOA 4PXOA 4BVXA 2AAWA 4OFMA 2H0IA 4BVYA 2HLSA 4PQ1A 4KNDA 2ON5A 5D73A 3DRNA 1QFNA 1T8EB 1GRXA 2BMXA 1M99A 3BCIA 3Q74A 1AXDA 3FY7A 1WRYA 5G1KA 4POKA 3W6GA 1BG5A 3DYRA 2EIQA 3LXZA 2PUKC 10GSA 1S3AA 1HNCA 3N9JA 2HXKA 2VM1A 5IMCA 4EE0A 1YEPA 2M72A 1Y6EA 5J3RA 1ZYPA 2AV4A 3WGEA 2WCIA 4MMMA 3DGQA 2C3QA 5J4UA 4JZQA 1JHBA 12GSA 16GSA 3WT1A 2CAQA 4K2XA 4YQVA 3L9VA 3ZVJD 3VPTA 5CRGA 2K6VA 3HVSA 5G31A 2XHFA 2GZYA 1XW6A 3MDKA 1XWKA 1WJKA 2YANA 3KJYA 4PTSA 2MYGA 3KEBA 1XVQA 2HRKA 2IPAA 1VF2A 4TKYA 4EVMA 1B9YC 4PURA 1GSDA 2O7KA 2ZCTA 1SKSB 1WIKA 3LYKA 4ECJA 3D21A 2F3MA 1OC9A 3MWHA 3APSA 1QXHA 3A2WA 3M9JA 2C0GA 2QSIA 1Q98A 4D73A 1XXUA 1MTCA 2H1GA 1XVWA 4GSNA 3MIXA 1O73A 3I6AA 2FUG2 3M0FA 4K7NA 4ID0A 1F2EA 3PH9A 1EZKA 5GSTA 4JE1A 1EP7A 4ZBBA 1O81A 4O32A 1U6TA 2HYXA 4ECBA 1XW5A 3Q18A 5ECPB 3TOTA 3IAS2 4KE3A 4FIWA 3WGXA 5CRDA 1OYJA 2B7KA 4AJ8A 3MNGA 1ERUA 1U87A 1MDJA 2O89A 4LMWA 1Z6NA 5DCHA 1O6JA 2F51A 2DJ3A 2LKUA 1PX7A 2GQKA 4PNFA 4WEYA 2LRNA 4IBPA 1DE1A 4GRFA 2CZ2A 2NTOA 5HFKA 2X64A 3QPMA 18GSA 1UVZA 1A0RP 5DAKA 1Q4JA 3UBKA 3UOMA 3IC4A 5DALB 4MJCA 3KCMA 2NVLA 2VL2C 1N8JA 2H74A 3GTUB 1NHYA 5JCGA 4TR1A 2GS3A 1SYRA 5DBQA 3QD9A 3ZMKA 2ZNMA 3ZL5A 3L78A 3U6VA 2LJAA 1B9XC 1A2JA 1QMVA 5GSSA 1J9BA 4L5OA 1A2LA 3H4KA 2X99A 2OA7A 6GSWA 2PPTA 3C7MA 1Z7RA 1XOAA 2DJKA 5ECRB 2XBIA 5H5RA 4MP4A 4EKZA 4PUAA 2LQQA 4ULXA 2OJLA 2IMKA 4L5LA 4QL9A 1XCCA 3ME7A 2MZCA 4WBRD 4MJAA 3I9V2 4CY8A 2JSYA 4N0ZA 1B4QA 1A0FA 2BJXA 3IK7A 2RM5A 4PQIA 3F8UA 4EDZA 4IGJA 4CHSA 2O87A 4CDOA 3UVTA 2H01A 1SU9A 2B3SA 5KN2A 3RDWA 5ID2A 2QC7A 2FWGA 3TDGA 3QOUA 1GSSA 3RPNA 5ECOB 3KH7A 5ECHB 4KH7A 5F05A 4NMUA 1J0FA 3UVHA 6GSYA 3I43A 2C3TA 3TRPA 5L71A 2PWJA 4IQ1A 5ECLB 1PX6A 2L5LA 3ERWA 3FHKA 1OVNA 4K5SA 2DJ0A 2QA1A 3LFLA 4MPFA 4CW9A 2CVDA 2RIIA 5INYA 2LNTA 1GUHA 2IIYA 3IXRA 1YKCA 5A5KA 5KOWA 2PVQA 1GSUA 1DUGA 1F9MA 3TRXA 2JZRA 5AGYA 3CSJA 3M3MA 5GZZB 5HFGA 4RI7A 3IV4A 3LYPA 2WZ9A 1SYXA 3GV1A 5DQSA 3HZ8A 5GAND 4HI7A 4TN8A 2ALBA 1PKZA 3R2QA 1X5DA 3HYPA 2IMDA 2DBCA 1YJ6A 5FHIA 3UMAA 5LD0A 4MH2A 2FD3A 4TOPA 1KTEA 3TKSA 5IMDA 4Q5QA 2F8AA 1ZL9A 3H8QA 2VM2A 4K9ZA 2CT6A 2MMOA 4JR6A 4WR5A 1JZRA 4EXJA 5E4WA 3GH9A 2R0GA 3HDCA 3GRXA 5AIVA 5KN0A 4QL7A 4MPGA 4POBA 1O85A 4GLTA 5H5SA 4IKHA 2EIRA 3S9FA 1ZGNA 4G19A 1SK1A 1JFUA 4TXOB 1GP1A 5DCGA 3TJKA 3WGDA 3KP9A 4A5PA 4IP6A 5F06A 5CRWA 3WD6A 2PGTA 3L0HA 1BEDA 2GLRA 2YCDA 3FZ5A 4KUNA 1CQHA 4IN0A 2GZPA 2F9SA 3IR4A 1G6WA 5IPGA 2AB6A 2K18A 2VAFA 4KSMA 1K0DA 3CRUA 4L0WA 3EC3A 1Z3EA 4KA0A 2DKIA 2FA8A 3C1RA 5A4WA 2KHPA 1T7PB 3DVXA 3IHGA 2H66A 1AW9A 4MF5A 1F3BA 1AAZA 1GUMA 2OKAA 3IPZA 1VGLA 5J41A 1N2AA 4K0NA 2VUPA 3GL5A 2VCWA 1NSWA 2C8UA 3QDNA 17GSA 3DMLA 4MABA 1FB0A 4NV5A 1Z6MA 1PD21 1A24A 3Q6OA 2L4CA 2H70A 4V2MA 2LEGA 2D2ZA 3G7JA 4HUAA 3IK9A 3VURA 3NZNA 1H4OA 4N0VA 2VL3A 2H6ZA 4FYBA 4XRDA 3P7XA 4I6XA 2DKHA 3UBLA 1AC1A 4AF2A 3TUEA 1DSBA 1KEBA 2H71A 3TKQA 1X9SB 5JWRB 1K0CA 2V32A 2YJHA 4OWYA 4XRAA 3FR6A 2DSAA 4IS0A 4N11A 4O5UA 4DVCA 3VWWA 3ZITA 2WS2A 4BWSA 1S3CA 2FWEA 4MNNA 3SBCA 3D4MA 5BMUA 2JACA 1SK0A 3EWLA 3F4RA 4G0LA 5ABRA 3QMXA 5D93A 3HKRA 2HI7A 2P5RA 2TRXA 3AY8A 2XPDA 2LRTA 4OD7A 3DWVA 2N5AA 4KX4A 1ACVA 2HT9A 5HR0A 2WB9A 4BL7A 4XTSA 1LJRA 3IC8A 5IPHA 4KB3A 1U3IA 2B5EA 1BX9A 2H0HA 4ZB8A 5D8IA 4POMA 2VCVA 3D0ZA 4RQXA 4OCEA 3F9UA 3F3RA 4TR0A 1FO5A 3GKKA 4MJBA 4EL1A 4IQAA 4DEJA 4F0BA 2R4VA 2F8FA 3RAZA 1NHOA 2DJJA 3EVIA 3F4TA 1BJXA 3C73A 5JCWA 4OO5A 1YF0A 5AISA 2H76A 2FWFA 3EU4A 3KXOA 4HZ2A 2GDRA 2MMZA 3PR8A 4MA9A 3EE2A 3DVWA 1XWAA 1PQNA 2ZUPA 4G0IA 5IO2A 1X9MB 5KOXA 4V2NA 1GULA 3IDVA 3G9BA 1PL1A 1EOHA 4K2DA 1XWCA 2E2GA 3VWXA 1EOGA 4EO3A 5EL8A 4ECCA 1K0OA 3IBHA 3HY2A 4PX1A 3HJPA 3EMXA 4HJ2A 1OC8A 2YV9A 3DD3A 1AIUA 4J2FA 5LCZA 4WXTA 4HZ4A 3ZIVA 4QQ7A 1EP8A 5DALA 3ME8A 4HDEA 4BWQA 2GQMA 3KMOA 4TVEA 3GTUA 2LTKA 2OBKA 2X8GA 4GWRA 1XIYA 2FHEA 4V2LA 4XCSA 2H8LA 3GSTA 2H30A 2FA4A 1BAYA 2IFQB 2H75A 1XWGA 1SJZA 3ZREA 3GKMA 3QCPA 5CYYA 4KW6A 4J56E 3K8NA 4LL1B 2K8VA 4MF6A 2VOCA 3BBYA 1BYEA 3GN3A 3MYDA 4PUFC 2HRAA 2YWIA 4K8MA 4OMVA 2VCZA 2WDUA 11GSA 2HFDA 1G7EA 4Z7XA 1JLVA 2B1KA 2FGXA 2JSZA 2GT6A 5A4VA 5C00A 1FB6A 4POLA 2MMAA 1R5PA 3MSZA 2H1AA 3WYWA 5J9CA 2YN1A 4MH3A 3KM6A 4XS4B 4AGSA 1THOA 5B8BA 3P90A 1MD4A 2R0CA 3D5JA 4ZBDA 3QAWA 4MZBA 3HXSA 3BCKA 3Q19A 4FO5A 5B6NA 2OBIA 1V40A 2J23A 3APOA 3TJFA 2DIYA 5DQYA 3FZ9A 3BOAA 2G2QA 5D9WA 2YP6A 2CV4A 5ENUA 2FLSA 5JWOB 2B1LA 4TR3A 4MK3A 2HRNA 1ZOFA 2CVKA 2R3XA 3F6FA 4OCFA 5CAXA 5GAPD 3ZTLA 2L59A 1LBKA 5FT3A 3E9JB 1K3OA 1PMTA 2PBJA 1MD3A 5E59A 5G5EA 4WKWA 2GSSA 4ML1A 1ON4A 5IIZA 1AQXA 3GNJA 1YY7A 3KMNA 3C71A 2WRTA 1TJDA 1F37A 4EUYA 2AYTA 1A2MA 4KDUA 2HZEB 3DIEA 3LSZA 1JLWA 4N30A 2R2JA 1YQ1A 1I5GA 1QUWA 1ST9A 2X8CA 1M0UA 5A4UA 4PGTA 14GSA 4NHZA 1IYIA 4AJ7A 3P2AA 4OO4A 5KEJA 4K0GA 1GWCA 4ZB6A 4GTUA 1PGTA 2CVBA 5D9TA 4O7HA 1X5EA 2QA2A 3HJOA 3O3TA 5ECMB 2A4VA 3LWAA 4G2EA 3L9SA 2A4HA 2KP1A 1ZCPA 2V6OA 1K0NA 3BJ5A 2XPEA 2VCXA 1GL8A 2LV3A 5J9BA 3M1GA 1TRSA 1F3AA 4TXOA 3DEXA 3FK8A 1TK5B 1GH2A 4LL4B 4EIPA 1WE0A 1A8LA 4O5RA 2P0GA 3VK9A 5ECKB 5B8AA 4IJ3A 1U88A 1ERVA 4JRRA 3IAM2 2N5FA 1FOHA 1PN9A 2VIMA 4EF0A 2HSYA 22GSA 1EGOA 3KTBA 3QAVA 2V1MA 3A2VA 5ECIB 4YKFA 4IELA 2YJ7A 1GSYA 4F9ZA 1GLPA 2HNLA 4MCUA 1TW9A 5B6MA 4OFTA 3LXTA 2C1YA 4WF5A 2A2PA 2VCQA 4IHUA 2I81A 3A3TA 2R6KA 3G7IA 3N5OA 1HNAA 2IL3A 1OE7A 2OADA 4O5QA 4DSQA 4Z2TA 3G7YA 3PGTA 3ZIJA 3RHCA 3CXGA 3DKSA 2AUVA 5JWQB 2CZ3A 4X1UA 4ICYA 1CQGA 1XOBA 2C80A 2PMTA 1MDIA 2YWMA 2H1BA 1EEMA 3RBTA 6GSXA 5IO0A 5CP1A 2VLUA 2HRFA 4ACSA 1W4VA 4YQMA 2OE0A 2VLTA 4Q5RA 4TXVA 4K1FA 4ILFA 2LSTA 1AQVA 1G7OA 2JZSA 1SL1B 3FZ4A 3A5WA 2P31A 1HYUA 1TP9A 2RUEA 1SKWB 4IP1A 3LORA 4K7OA 4X4JA 3FEUA 5AN1A 2H6XA 5G5FA 3D6IA 4G10A 4EC0A 3F0IA 3HVVA 3NOFA 3H79A 1TKDB 2L6DA 3FYGA 3QFBC 1PRXA 1HD2A 3W8SA 1X5CA 2I4AA 1TTZA 1PSQA 2R0PA 8GSSA 3QR6A 4MDCA 1TU7A 2JZTA 2VL2A 3HHVA 3F4SA 4FH8A 4G9HA 1A23A 1UC7A 2I3YA 4KAEA 3GIXA 3LG6A 4YAVA 1TRUA 3ERGA 1QGVA 3O76A 5BRTA 2BTOT 3OR5A 1E6BA 5CREA 1ABAA 2B5YA 1GNEA 3KP8A 4HQSA 1R7HA 2R37A 1T00A 2AHEA 2X8HA 2CAIA 3GMFA 1O8XA 3LW9A 2H0GA 2HSHA 1G6YA 1PL2A 1T4ZA 1TU8A 5KN1A 1HNBA 1PN0A 4DSSB 3UIWA 3MAKA 2N5BA 4TR4A 3ZMLA 4JR4A 4CY6A 3TOUA 2C4JA 2IMEA 5ELAA 1DE2A 2E7PA 1XPVA 4HEA2 2LJKA 3I69A 5H5QA 1VRSD 4GSTA 2IMIA 2M46A 1DBYA 3GURA 6GSSA 5G1LA 4ZL8A 2EC4A 3LEFA 3VI7A 5C04A 1YEXA 1ZYNA 4F0CA 3EYTA 3VPQA 5F8BA 2GSTA 1URMA 2GGTA 1V58A 3TKSE 4I2TA 3ZYWA 1AUCA 2V41A 2IMFA 3HCZA 1OE8A 1FHEA 3KGKA 5IOXA 3VWVA 3CYNA 1THXA 3KZQA 2YPMA 3EU3A 2CA8A 3VI5A 1SK2A 4TRXA 1LU4A 4F03A 1R4WA 20GSA 2KUCA 3CRTA 2L6CA 2L57A 6GSUA 1QQ2A 3F63A 5J5NA 1QK8A 2XBQA 3ZFBA 4LMVA 1XFLA 2FWHA 2K9FA 3DXBA 5IQYA 3UEMA 3ZLPA 1TK8B 1WPIA 1RK4A 6GSVA 4Z2RA 4RI6A 5IM9A 4JEDA 3TKPA 1YF1A 4GSSA 2JL4A 1PKWA 2IFQA 3HJMA 2NDOA 7GSSA 5IMFA 3UL3A 19GSA 3UJ1A 2OE3A 2O8VB 2I1UA 1J08A 13GSA 1GTIA 1TRVA 3CTFA 4K6XA 5ECSA 4E8HA 1SKRB 5D96A 4FYCA 1SENA 3A2XA 1GTUA 3KD0A 3EURA 2XC2A 3LJRA 1K0BA 3TKRA 3HZ4A 1SJIA 2VL9A 2R5GA 1B48A 4X0XA 1K0MA 4NPBA 2MMNA 2VO4A 3RPPA 2PERA 4BL7B 1H75A 4F82A 2GZZA 3TKSC 2MBTA 3KTLA 4RUVA 1ILOA 3M9KA 4NHWA 4BVXB 3IOSA 4ML6A 4BVYB 2E0QA 4WBJA 5CNWA 4YKGA 2HSMA 1ZZYA 2PN8A 4XS4A 4IW9A 4K7IA 3IRAA 2H1DA 2E2MA 2DMMA 2WFCA 3FR9A 2A2SA 4MLYA 1T3BA 1KNGA 4HJMA 3PPUA 3TB2A 3CBUA 4JU5A 4V1Ag 9GSSA 3J7Yb 4KDXA 3GYKA 2FNOA 5G30A 1FG4A 1M2DA 4F2IA 3A5IA 2MBSA 4HU9A 2WJUA 3GA4A 4GQFA 2H72A 1YDKA 5F0GA 5IOWA 3GSSA 1SD8A 3KH9A 2QGVA 3TJBA 1T4YA 3GUSA 4MZWA 5LNKe 4AJ6A 2LUSA 1R5AA 4YH2A 3GH6A 4EIQA 1K3LA 3WT2A 1FW1A 4XHMA 4I5QA 3O6TA 2M80A 2OE1A 2KP2A 2C0EA 3US3A 3GL3A 1I9DA 1W89A 3HA9A 4I8BA 1B8XA 4LA1A 3TGZA 3GKXA 2RLIA 5IMVA 2IN3A 4GF0A 1XZOA 2ES7A 4ZILA 5EVOA 3CSIA 1ZYEA 1VF1A 3TJGA 4N10A 2GSQA 1K0AA 1A8YA 2B6MA 1GNWA 2HZEA 4E8EA 2C0DA 2CX3A 1OC9B 4XIHA 4ZB9A 4JBBA 3GKNA 3FZAA 2C3NA 1UN2A 1AQWA 3GHAA 4D73B 4L0UA 3ZVJA 3TCOA 4Q5FA 1VF3A 5AIXA 5D9XA 4MZCA 2VD1A 2G0FA 1Y25A 2NBSA 3VWUA 1X9WB 3IE3A 2VCTA 1GTAA 1FVJA 2HE3A 2GVPA 2FY6A 3L9UA 5IMAA 2CQ9A 1IYHA 3GX8A 3J7Yk 4ZL9A 3IA1A 2VLVA 4HQZA 4NAXA 4TW5A 2B7JA 2IWTA 4GCIA 1EGRA 1ERTA 2QKEA 1TRWA 3F6DA 3H93A 5KN3A 3HD5A 2DIZA 1Z9HA 3HVXA 5HFIA 1GUKA 4P3YB 4H86A 1GSEA 3GX0A 4HS1A 3D4TA 6GSTA 2H73A 1V9WA 2H19A 2REMA 5DAKB 1VF4A 2OACA 1ZMAA 2YWOA 4BPYA 4TR1B 1X0RA 4ZXGA 4ISDA 5COHA 2LJRA 1T1VA 4K5RA 4MJEA 4IVFA 4NWYA 2YV7A 2DJ2A 2JADA 2EIOA 4KDYA 3ZRDA 2YNXA 1E2YA 1O7UA 2JU5A 3VFIA 3EINA 1M2AA 1BQ7A 1GLQA 1MDKA 3E3EA 4G0KA 2GQLA 5ELGA 2DLXA 5JCUA 2TRCP 4PNGA 3E0UA 1RW1A 1OKTA 1JZWA 2GTUA 4X43A 2ON7A 1RQMA 4KCEA 2P5QA 4FQUA 5ECQB 4HOJA 1XW9A 2O85A 2WGRA 1WOUA 1YZXA 3TJJA 2TIRA 3UARA 1M7TA 2PVOC 3RHBA 1U3AA 3VLNA 3W8JA 4I97A 1OKDA 1WWJA 2H6YA 2K8SA 5ID2B 3C1SA 4HU7A 4KCAA 4IJIA 4XS6A 2B5XA 4XS1A 1M9BA 2L4QA 2YZHA 4ECIA 2L5OA 2GSRA 4OFNA 1TI1A 1SJ6A 4WF4A 1Z7PA 1ML6A 4KSOA 3TRQA 2V6KA 4LLRA 3H1NA 1M2BA 3APQA 3ZFLA 3EPTA 4J57E 1NW2A 1YKAA 1XWBA 1PA3A 1V57A 1TOFA 2NPBA 1C72A 3ISOA 3P8WA 5FWGA 5EY6A 3IHQA 4USSA 5CRHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A2R A;  3C8E A;  1FAA A;  3QFA C;  4NV2 A;  4MF7 A;  1S3D A;  4GXZ A;  4YAP A;  1TDI A;  4KGI A;  3PIN A;  1GTB A;  3LQ7 A;  1V98 A;  3ERF A;  2LNS A;  2IJY A;  5B7C A;  3L4N A;  3V1W A;  1ERW A;  1R26 A;  4GQC A;  1F6M C;  1OC3 A;  4DSS A;  5HQP A;  2DC5 A;  5HR1 A;  1TXX A;  4L8E A;  2V2G A;  5HR3 A;  4I2U A;  5DJL A;  1EV4 A;  3NIV A;  2KOK A;  2GT5 A;  1O8W A;  2DML A;  2YOI A;  1OAZ A;  3CTG A;  4ZIJ A;  1Z5Y E;  3GFK A;  1UA5 A;  2KLX A;  1V2A A;  1SL2 B;  5DJM A;  3F3Q A;  4YQU A;  1EEJ A;  1K3Y A;  1GSQ A;  1KBN A;  1M9A A;  4ZL7 A;  1JZD A;  1G0T A;  3BD2 A;  2PU9 C;  2DJ1 A;  5CO3 A;  2YWN A;  5F07 A;  4NXI A;  5DDL A;  4WR4 A;  3FRC A;  3FKF A;  1TI3 A;  4EDY A;  1FVK A;  2J9H A;  1WMJ A;  2CX4 A;  4BA7 A;  3ZZX A;  3JCM L;  1NM3 A;  3CSH A;  2Z9S A;  1USB A;  3UAP A;  3D22 A;  4DSR A;  2LRC A;  3M8N A;  2LS5 A;  4FYU A;  1MEK A;  1XBS A;  2I9H A;  1B4P A;  3QAG A;  5G2Z A;  3CMI A;  5ECN B;  3KIJ A;  3U5R E;  2LQO A;  4O92 A;  2C0F A;  3ED3 A;  1HQO A;  5DVB A;  3FR3 A;  1WP0 A;  5D9V A;  2FCH A;  2YZU A;  1SL0 B;  1EV9 A;  5HR2 A;  4RQR A;  4Q5N A;  5EPF A;  2HZF A;  2RM6 A;  2RUF A;  3LGC A;  4ZBA A;  4V1A p;  1TK0 B;  1GSF A;  3EMP A;  4PQH A;  4WET A;  1EWX A;  2VD0 A;  2AJQ B;  3SWL A;  5IMZ A;  1ZYQ B;  3FW2 A;  1SD9 A;  2WUL A;  1FOV A;  1JZO A;  4PXO A;  4BVX A;  2AAW A;  4OFM A;  2H0I A;  4BVY A;  2HLS A;  4PQ1 A;  4KND A;  2ON5 A;  5D73 A;  3DRN A;  1QFN A;  1T8E B;  1GRX A;  2BMX A;  1M99 A;  3BCI A;  3Q74 A;  1AXD A;  3FY7 A;  1WRY A;  5G1K A;  4POK A;  3W6G A;  1BG5 A;  3DYR A;  2EIQ A;  3LXZ A;  2PUK C;  10GS A;  1S3A A;  1HNC A;  3N9J A;  2HXK A;  2VM1 A;  5IMC A;  4EE0 A;  1YEP A;  2M72 A;  1Y6E A;  5J3R A;  2AV4 A;  3WGE A;  2WCI A;  4MMM A;  3DGQ A;  2C3Q A;  5J4U A;  4JZQ A;  1JHB A;  12GS A;  16GS A;  3WT1 A;  2CAQ A;  4YQV A;  3L9V A;  3ZVJ D;  3VPT A;  5CRG A;  2K6V A;  3HVS A;  5G31 A;  2XHF A;  2GZY A;  1XW6 A;  3MDK A;  1XWK A;  1WJK A;  2YAN A;  3KJY A;  2MYG A;  3KEB A;  1XVQ A;  2IPA A;  1VF2 A;  4TKY A;  4EVM A;  1B9Y C;  4PUR A;  1GSD A;  2O7K A;  2ZCT A;  1SKS B;  1WIK A;  3LYK A;  4ECJ A;  3D21 A;  2F3M A;  1OC9 A;  3MWH A;  3APS A;  1QXH A;  3A2W A;  3M9J A;  2C0G A;  2QSI A;  1Q98 A;  4D73 A;  1XXU A;  1MTC A;  2H1G A;  1XVW A;  4GSN A;  1O73 A;  3I6A A;  2FUG 2;  3M0F A;  4K7N A;  4ID0 A;  1F2E A;  3PH9 A;  1EZK A;  5GST A;  4JE1 A;  1EP7 A;  4ZBB A;  1O81 A;  4O32 A;  1U6T A;  2HYX A;  4ECB A;  1XW5 A;  3Q18 A;  5ECP B;  3TOT A;  3IAS 2;  4KE3 A;  4FIW A;  3WGX A;  5CRD A;  1OYJ A;  2B7K A;  4AJ8 A;  3MNG A;  1ERU A;  1U87 A;  1MDJ A;  2O89 A;  4LMW A;  1Z6N A;  5DCH A;  1O6J A;  2F51 A;  2DJ3 A;  2LKU A;  1PX7 A;  2GQK A;  4PNF A;  4WEY A;  2LRN A;  4IBP A;  1DE1 A;  4GRF A;  2CZ2 A;  2NTO A;  5HFK A;  2X64 A;  3QPM A;  18GS A;  1UVZ A;  1A0R P;  5DAK A;  1Q4J A;  3UBK A;  3UOM A;  3IC4 A;  5DAL B;  4MJC A;  3KCM A;  2NVL A;  2VL2 C;  1N8J A;  2H74 A;  3GTU B;  1NHY A;  5JCG A;  4TR1 A;  2GS3 A;  1SYR A;  5DBQ A;  3QD9 A;  3ZMK A;  2ZNM A;  3ZL5 A;  3L78 A;  3U6V A;  2LJA A;  1B9X C;  1A2J A;  1QMV A;  5GSS A;  1J9B A;  4L5O A;  1A2L A;  3H4K A;  2X99 A;  2OA7 A;  6GSW A;  2PPT A;  3C7M A;  1Z7R A;  1XOA A;  2DJK A;  5ECR B;  2XBI A;  5H5R A;  4MP4 A;  4EKZ A;  4PUA A;  2LQQ A;  4ULX A;  2OJL A;  2IMK A;  4L5L A;  4QL9 A;  1XCC A;  3ME7 A;  2MZC A;  4WBR D;  4MJA A;  3I9V 2;  2JSY A;  4N0Z A;  1B4Q A;  1A0F A;  2BJX A;  3IK7 A;  2RM5 A;  4PQI A;  3F8U A;  4EDZ A;  4IGJ A;  4CHS A;  2O87 A;  4CDO A;  3UVT A;  2H01 A;  1SU9 A;  2B3S A;  5KN2 A;  3RDW A;  5ID2 A;  2QC7 A;  2FWG A;  3TDG A;  3QOU A;  1GSS A;  3RPN A;  5ECO B;  3KH7 A;  5ECH B;  4KH7 A;  5F05 A;  4NMU A;  1J0F A;  3UVH A;  6GSY A;  3I43 A;  2C3T A;  3TRP A;  5L71 A;  2PWJ A;  4IQ1 A;  5ECL B;  1PX6 A;  2L5L A;  3ERW A;  3FHK A;  1OVN A;  2DJ0 A;  3LFL A;  4MPF A;  4CW9 A;  2CVD A;  2RII A;  5INY A;  2LNT A;  1GUH A;  2IIY A;  3IXR A;  1YKC A;  5A5K A;  2PVQ A;  1GSU A;  1DUG A;  1F9M A;  3TRX A;  2JZR A;  5AGY A;  3CSJ A;  3M3M A;  5GZZ B;  5HFG A;  4RI7 A;  3IV4 A;  3LYP A;  2WZ9 A;  1SYX A;  3GV1 A;  5DQS A;  3HZ8 A;  5GAN D;  4HI7 A;  4TN8 A;  2ALB A;  1PKZ A;  3R2Q A;  1X5D A;  3HYP A;  2IMD A;  2DBC A;  1YJ6 A;  5FHI A;  3UMA A;  5LD0 A;  4MH2 A;  2FD3 A;  4TOP A;  1KTE A;  3TKS A;  5IMD A;  4Q5Q A;  2F8A A;  1ZL9 A;  3H8Q A;  2VM2 A;  4K9Z A;  2CT6 A;  2MMO A;  4JR6 A;  4WR5 A;  1JZR A;  4EXJ A;  5E4W A;  3GH9 A;  3HDC A;  3GRX A;  5AIV A;  5KN0 A;  4QL7 A;  4MPG A;  4POB A;  1O85 A;  4GLT A;  5H5S A;  4IKH A;  2EIR A;  3S9F A;  1ZGN A;  4G19 A;  1SK1 A;  1JFU A;  4TXO B;  1GP1 A;  5DCG A;  3TJK A;  3WGD A;  3KP9 A;  4IP6 A;  5F06 A;  5CRW A;  3WD6 A;  2PGT A;  3L0H A;  1BED A;  2GLR A;  2YCD A;  3FZ5 A;  4KUN A;  1CQH A;  4IN0 A;  2GZP A;  2F9S A;  3IR4 A;  1G6W A;  5IPG A;  2AB6 A;  2K18 A;  2VAF A;  4KSM A;  1K0D A;  3CRU A;  4L0W A;  3EC3 A;  1Z3E A;  4KA0 A;  2FA8 A;  3C1R A;  5A4W A;  2KHP A;  1T7P B;  3DVX A;  2H66 A;  1AW9 A;  4MF5 A;  1F3B A;  1AAZ A;  1GUM A;  2OKA A;  3IPZ A;  1VGL A;  5J41 A;  1N2A A;  4K0N A;  2VUP A;  3GL5 A;  2VCW A;  1NSW A;  2C8U A;  3QDN A;  17GS A;  3DML A;  4MAB A;  1FB0 A;  4NV5 A;  1Z6M A;  1PD2 1;  1A24 A;  3Q6O A;  2L4C A;  2H70 A;  4V2M A;  2LEG A;  2D2Z A;  3G7J A;  4HUA A;  3IK9 A;  3VUR A;  3NZN A;  1H4O A;  4N0V A;  2VL3 A;  2H6Z A;  4FYB A;  4XRD A;  3P7X A;  4I6X A;  3UBL A;  4AF2 A;  1AC1 A;  3TUE A;  1DSB A;  1KEB A;  2H71 A;  3TKQ A;  1X9S B;  5JWR B;  1K0C A;  2V32 A;  2YJH A;  4OWY A;  4XRA A;  3FR6 A;  2DSA A;  4IS0 A;  4N11 A;  4DVC A;  3VWW A;  3ZIT A;  2WS2 A;  4BWS A;  1S3C A;  2FWE A;  3SBC A;  3D4M A;  2JAC A;  1SK0 A;  3EWL A;  3F4R A;  5ABR A;  3QMX A;  5D93 A;  3HKR A;  2HI7 A;  2P5R A;  2TRX A;  3AY8 A;  2XPD A;  2LRT A;  4OD7 A;  3DWV A;  2N5A A;  4KX4 A;  1ACV A;  2HT9 A;  5HR0 A;  2WB9 A;  4BL7 A;  4XTS A;  1LJR A;  5IPH A;  4KB3 A;  1U3I A;  2B5E A;  1BX9 A;  2H0H A;  4ZB8 A;  5D8I A;  4POM A;  2VCV A;  3D0Z A;  4RQX A;  4OCE A;  3F9U A;  3F3R A;  4TR0 A;  1FO5 A;  3GKK A;  4MJB A;  4EL1 A;  4IQA A;  4DEJ A;  4F0B A;  2R4V A;  2F8F A;  3RAZ A;  1NHO A;  2DJJ A;  3EVI A;  3F4T A;  1BJX A;  3C73 A;  5JCW A;  4OO5 A;  1YF0 A;  5AIS A;  2H76 A;  2FWF A;  3EU4 A;  3KXO A;  4HZ2 A;  2GDR A;  2MMZ A;  3PR8 A;  4MA9 A;  3EE2 A;  3DVW A;  1XWA A;  1PQN A;  2ZUP A;  5IO2 A;  1X9M B;  4V2N A;  1GUL A;  3IDV A;  3G9B A;  1PL1 A;  1EOH A;  4K2D A;  1XWC A;  2E2G A;  3VWX A;  1EOG A;  4EO3 A;  5EL8 A;  4ECC A;  1K0O A;  3IBH A;  3HY2 A;  4PX1 A;  3HJP A;  3EMX A;  4HJ2 A;  1OC8 A;  2YV9 A;  3DD3 A;  1AIU A;  4J2F A;  5LCZ A;  4WXT A;  4HZ4 A;  3ZIV A;  4QQ7 A;  1EP8 A;  5DAL A;  3ME8 A;  4HDE A;  4BWQ A;  2GQM A;  3KMO A;  4TVE A;  3GTU A;  2LTK A;  2OBK A;  2X8G A;  4GWR A;  1XIY A;  2FHE A;  4V2L A;  4XCS A;  2H8L A;  3GST A;  2H30 A;  2FA4 A;  1BAY A;  2IFQ B;  2H75 A;  1XWG A;  1SJZ A;  3ZRE A;  3GKM A;  3QCP A;  5CYY A;  4KW6 A;  4J56 E;  3K8N A;  4LL1 B;  2K8V A;  4MF6 A;  2VOC A;  3BBY A;  1BYE A;  3GN3 A;  4PUF C;  2YWI A;  4K8M A;  4OMV A;  2VCZ A;  2WDU A;  11GS A;  2HFD A;  1G7E A;  4Z7X A;  1JLV A;  2B1K A;  2FGX A;  2JSZ A;  2GT6 A;  5A4V A;  5C00 A;  1FB6 A;  4POL A;  2MMA A;  1R5P A;  3MSZ A;  2H1A A;  3WYW A;  5J9C A;  2YN1 A;  4MH3 A;  3KM6 A;  4XS4 B;  4AGS A;  1THO A;  5B8B A;  3P90 A;  1MD4 A;  3D5J A;  4ZBD A;  3QAW A;  4MZB A;  3HXS A;  3BCK A;  3Q19 A;  4FO5 A;  5B6N A;  2OBI A;  1V40 A;  2J23 A;  3APO A;  3TJF A;  2DIY A;  5DQY A;  3FZ9 A;  3BOA A;  2G2Q A;  5D9W A;  2YP6 A;  2CV4 A;  5ENU A;  2FLS A;  5JWO B;  2B1L A;  4TR3 A;  4MK3 A;  2HRN A;  1ZOF A;  2CVK A;  2R3X A;  3F6F A;  4OCF A;  5CAX A;  5GAP D;  3ZTL A;  2L59 A;  1LBK A;  5FT3 A;  3E9J B;  1K3O A;  1PMT A;  2PBJ A;  1MD3 A;  5E59 A;  5G5E A;  4WKW A;  2GSS A;  4ML1 A;  1ON4 A;  5IIZ A;  1AQX A;  3GNJ A;  1YY7 A;  3KMN A;  3C71 A;  2WRT A;  1TJD A;  1F37 A;  4EUY A;  2AYT A;  1A2M A;  4KDU A;  2HZE B;  3DIE A;  3LSZ A;  1JLW A;  4N30 A;  2R2J A;  1YQ1 A;  1I5G A;  1QUW A;  1ST9 A;  2X8C A;  1M0U A;  5A4U A;  4PGT A;  14GS A;  4NHZ A;  1IYI A;  4AJ7 A;  3P2A A;  4OO4 A;  5KEJ A;  4K0G A;  1GWC A;  4ZB6 A;  4GTU A;  1PGT A;  2CVB A;  5D9T A;  4O7H A;  1X5E A;  3HJO A;  3O3T A;  5ECM B;  2A4V A;  3LWA A;  4G2E A;  3L9S A;  2KP1 A;  1ZCP A;  2V6O A;  1K0N A;  3BJ5 A;  2XPE A;  2VCX A;  1GL8 A;  2LV3 A;  5J9B A;  3M1G A;  1TRS A;  1F3A A;  4TXO A;  3DEX A;  3FK8 A;  1TK5 B;  1GH2 A;  4LL4 B;  1WE0 A;  1A8L A;  4O5R A;  2P0G A;  3VK9 A;  5ECK B;  5B8A A;  4IJ3 A;  1U88 A;  1ERV A;  4JRR A;  3IAM 2;  2N5F A;  1PN9 A;  2VIM A;  4EF0 A;  2HSY A;  22GS A;  1EGO A;  3KTB A;  3QAV A;  2V1M A;  3A2V A;  5ECI B;  4IEL A;  2YJ7 A;  1GSY A;  4F9Z A;  1GLP A;  2HNL A;  4MCU A;  1TW9 A;  5B6M A;  4OFT A;  3LXT A;  2C1Y A;  4WF5 A;  2VCQ A;  4IHU A;  2I81 A;  3A3T A;  2R6K A;  3G7I A;  3N5O A;  1HNA A;  2IL3 A;  1OE7 A;  2OAD A;  4DSQ A;  3G7Y A;  3PGT A;  3ZIJ A;  3RHC A;  3CXG A;  3DKS A;  2AUV A;  5JWQ B;  2CZ3 A;  4X1U A;  1CQG A;  1XOB A;  2C80 A;  2PMT A;  1MDI A;  2YWM A;  2H1B A;  1EEM A;  3RBT A;  6GSX A;  5IO0 A;  5CP1 A;  2VLU A;  2HRF A;  4ACS A;  1W4V A;  4YQM A;  2OE0 A;  2VLT A;  4Q5R A;  4TXV A;  4K1F A;  4ILF A;  2LST A;  1AQV A;  1G7O A;  2JZS A;  1SL1 B;  3FZ4 A;  3A5W A;  2P31 A;  1HYU A;  1TP9 A;  2RUE A;  1SKW B;  4IP1 A;  3LOR A;  4K7O A;  3FEU A;  5AN1 A;  2H6X A;  5G5F A;  3D6I A;  4G10 A;  4EC0 A;  3F0I A;  3HVV A;  3NOF A;  3H79 A;  1TKD B;  2L6D A;  3FYG A;  3QFB C;  1PRX A;  1HD2 A;  3W8S A;  1X5C A;  2I4A A;  1TTZ A;  1PSQ A;  8GSS A;  3QR6 A;  4MDC A;  1TU7 A;  2JZT A;  2VL2 A;  3HHV A;  3F4S A;  4FH8 A;  4G9H A;  1A23 A;  1UC7 A;  2I3Y A;  4KAE A;  3GIX A;  3LG6 A;  4YAV A;  1TRU A;  3ERG A;  1QGV A;  3O76 A;  2BTO T;  3OR5 A;  1E6B A;  5CRE A;  1ABA A;  2B5Y A;  1GNE A;  3KP8 A;  4HQS A;  1R7H A;  2R37 A;  1T00 A;  2AHE A;  2X8H A;  2CAI A;  3GMF A;  1O8X A;  2H0G A;  2HSH A;  1G6Y A;  1PL2 A;  1T4Z A;  1TU8 A;  5KN1 A;  1HNB A;  4DSS B;  3UIW A;  3MAK A;  2N5B A;  4TR4 A;  3ZML A;  4JR4 A;  3TOU A;  2C4J A;  2IME A;  5ELA A;  1DE2 A;  2E7P A;  1XPV A;  4HEA 2;  2LJK A;  3I69 A;  5H5Q A;  1VRS D;  4GST A;  2IMI A;  2M46 A;  1DBY A;  3GUR A;  6GSS A;  5G1L A;  4ZL8 A;  2EC4 A;  3LEF A;  3VI7 A;  5C04 A;  1YEX A;  4F0C A;  3EYT A;  3VPQ A;  5F8B A;  2GST A;  1URM A;  2GGT A;  1V58 A;  3TKS E;  4I2T A;  3ZYW A;  1AUC A;  2V41 A;  2IMF A;  3HCZ A;  1OE8 A;  1FHE A;  3KGK A;  5IOX A;  3VWV A;  3CYN A;  1THX A;  3KZQ A;  2YPM A;  3EU3 A;  2CA8 A;  3VI5 A;  1SK2 A;  4TRX A;  1LU4 A;  4F03 A;  1R4W A;  20GS A;  2KUC A;  3CRT A;  2L6C A;  2L57 A;  6GSU A;  1QQ2 A;  3F63 A;  5J5N A;  1QK8 A;  2XBQ A;  3ZFB A;  4LMV A;  1XFL A;  2FWH A;  2K9F A;  3DXB A;  5IQY A;  3UEM A;  3ZLP A;  1TK8 B;  1WPI A;  1RK4 A;  6GSV A;  4RI6 A;  5IM9 A;  4JED A;  3TKP A;  1YF1 A;  4GSS A;  2JL4 A;  1PKW A;  2IFQ A;  3HJM A;  2NDO A;  7GSS A;  5IMF A;  3UL3 A;  19GS A;  3UJ1 A;  2OE3 A;  2O8V B;  2I1U A;  1J08 A;  13GS A;  1GTI A;  1TRV A;  3CTF A;  4K6X A;  5ECS A;  4E8H A;  1SKR B;  5D96 A;  4FYC A;  1SEN A;  3A2X A;  1GTU A;  3KD0 A;  3EUR A;  2XC2 A;  3LJR A;  1K0B A;  3TKR A;  3HZ4 A;  1SJI A;  2VL9 A;  2R5G A;  1B48 A;  4X0X A;  1K0M A;  4NPB A;  2MMN A;  2VO4 A;  3RPP A;  2PER A;  1H75 A;  4F82 A;  2GZZ A;  3TKS C;  2MBT A;  3KTL A;  4RUV A;  1ILO A;  3M9K A;  4NHW A;  3IOS A;  4ML6 A;  2E0Q A;  4WBJ A;  5CNW A;  1ZZY A;  2PN8 A;  4XS4 A;  4IW9 A;  4K7I A;  3IRA A;  2H1D A;  2E2M A;  2DMM A;  2WFC A;  3FR9 A;  2A2S A;  4MLY A;  1T3B A;  1KNG A;  4HJM A;  3TB2 A;  3CBU A;  4JU5 A;  4V1A g;  9GSS A;  3J7Y b;  4KDX A;  3GYK A;  2FNO A;  5G30 A;  1FG4 A;  1M2D A;  4F2I A;  2MBS A;  4HU9 A;  2WJU A;  3GA4 A;  4GQF A;  2H72 A;  1YDK A;  5F0G A;  5IOW A;  3GSS A;  1SD8 A;  3KH9 A;  2QGV A;  3TJB A;  1T4Y A;  3GUS A;  4MZW A;  5LNK e;  4AJ6 A;  2LUS A;  1R5A A;  4YH2 A;  3GH6 A;  1K3L A;  3WT2 A;  1FW1 A;  4XHM A;  4I5Q A;  3O6T A;  2M80 A;  2OE1 A;  2KP2 A;  2C0E A;  3US3 A;  3GL3 A;  1I9D A;  1W89 A;  3HA9 A;  4I8B A;  1B8X A;  4LA1 A;  3TGZ A;  3GKX A;  2RLI A;  5IMV A;  2IN3 A;  4GF0 A;  1XZO A;  2ES7 A;  4ZIL A;  5EVO A;  3CSI A;  1ZYE A;  1VF1 A;  3TJG A;  4N10 A;  2GSQ A;  1K0A A;  1A8Y A;  2B6M A;  1GNW A;  2HZE A;  4E8E A;  2C0D A;  2CX3 A;  1OC9 B;  4XIH A;  4ZB9 A;  4JBB A;  3GKN A;  3FZA A;  2C3N A;  1UN2 A;  1AQW A;  3GHA A;  4D73 B;  4L0U A;  3ZVJ A;  3TCO A;  4Q5F A;  1VF3 A;  5AIX A;  5D9X A;  4MZC A;  2VD1 A;  2G0F A;  1Y25 A;  2NBS A;  3VWU A;  1X9W B;  3IE3 A;  2VCT A;  1GTA A;  1FVJ A;  2HE3 A;  2GVP A;  2FY6 A;  3L9U A;  5IMA A;  2CQ9 A;  1IYH A;  3GX8 A;  3J7Y k;  4ZL9 A;  3IA1 A;  2VLV A;  4HQZ A;  4NAX A;  4TW5 A;  2B7J A;  2IWT A;  4GCI A;  1EGR A;  1ERT A;  2QKE A;  1TRW A;  3F6D A;  3H93 A;  5KN3 A;  3HD5 A;  2DIZ A;  1Z9H A;  3HVX A;  5HFI A;  1GUK A;  4P3Y B;  4H86 A;  1GSE A;  3GX0 A;  4HS1 A;  3D4T A;  6GST A;  2H73 A;  1V9W A;  2H19 A;  2REM A;  5DAK B;  1VF4 A;  2OAC A;  1ZMA A;  2YWO A;  4BPY A;  4TR1 B;  1X0R A;  4ZXG A;  4ISD A;  5COH A;  2LJR A;  1T1V A;  4MJE A;  4IVF A;  4NWY A;  2YV7 A;  2DJ2 A;  2JAD A;  2EIO A;  4KDY A;  3ZRD A;  2YNX A;  1E2Y A;  1O7U A;  2JU5 A;  3VFI A;  3EIN A;  1M2A A;  1BQ7 A;  1GLQ A;  1MDK A;  3E3E A;  2GQL A;  5ELG A;  2DLX A;  5JCU A;  2TRC P;  4PNG A;  3E0U A;  1RW1 A;  1OKT A;  1JZW A;  2GTU A;  4X43 A;  2ON7 A;  1RQM A;  4KCE A;  2P5Q A;  5ECQ B;  4HOJ A;  1XW9 A;  2O85 A;  2WGR A;  1WOU A;  1YZX A;  3TJJ A;  2TIR A;  3UAR A;  1M7T A;  2PVO C;  3RHB A;  1U3A A;  3VLN A;  3W8J A;  4I97 A;  1OKD A;  1WWJ A;  2H6Y A;  2K8S A;  5ID2 B;  3C1S A;  4HU7 A;  4KCA A;  4IJI A;  4XS6 A;  2B5X A;  4XS1 A;  1M9B A;  2L4Q A;  2YZH A;  4ECI A;  2L5O A;  2GSR A;  4OFN A;  1TI1 A;  1SJ6 A;  4WF4 A;  1Z7P A;  1ML6 A;  4KSO A;  3TRQ A;  2V6K A;  4LLR A;  3H1N A;  1M2B A;  3APQ A;  3ZFL A;  4J57 E;  1NW2 A;  1YKA A;  1XWB A;  1PA3 A;  1V57 A;  1TOF A;  2NPB A;  1C72 A;  3ISO A;  3P8W A;  5FWG A;  5EY6 A;  3IHQ A;  5CRH A; 
#chains in the Genus database with same CATH topology
 2A2R A;  3C8E A;  1FAA A;  3FMW A;  3QFA C;  4NV2 A;  4MF7 A;  1S3D A;  4GXZ A;  4YAP A;  1TDI A;  4KGI A;  3PIN A;  1GTB A;  3LQ7 A;  1V98 A;  3ERF A;  2LNS A;  2IJY A;  5B7C A;  3L4N A;  3V1W A;  1ERW A;  1R26 A;  4GQC A;  2UZ8 A;  2X49 A;  1F6M C;  1OC3 A;  4DSS A;  5HQP A;  2DC5 A;  5HR1 A;  1TXX A;  4L8E A;  2V2G A;  5HR3 A;  4I2U A;  5DJL A;  1EV4 A;  3NIV A;  2KOK A;  2GT5 A;  1O8W A;  2DML A;  2YOI A;  1OAZ A;  3CTG A;  4ZIJ A;  1Z5Y E;  3GFK A;  1UA5 A;  2KLX A;  2X4A A;  1V2A A;  1SL2 B;  5DJM A;  3F3Q A;  4YQU A;  1EEJ A;  1PFO A;  1K3Y A;  1GSQ A;  1KBN A;  1M9A A;  4ZL7 A;  1JZD A;  1G0T A;  3BD2 A;  2PU9 C;  2DJ1 A;  5CO3 A;  2YWN A;  5F07 A;  4NXI A;  5DDL A;  4WR4 A;  3FRC A;  3FKF A;  1TI3 A;  4EDY A;  1FVK A;  2J9H A;  1WMJ A;  2CX4 A;  4BA7 A;  3ZZX A;  3JCM L;  1NM3 A;  3CSH A;  2Z9S A;  1USB A;  3UAP A;  3D22 A;  4DSR A;  2LRC A;  3M8N A;  4Z2U A;  2LS5 A;  4FYU A;  1MEK A;  1XBS A;  2I9H A;  1B4P A;  3QAG A;  5G2Z A;  3CMI A;  5ECN B;  3KIJ A;  3U5R E;  2LQO A;  4O92 A;  2C0F A;  3ED3 A;  3R3E A;  1HQO A;  5DVB A;  3FR3 A;  1WP0 A;  5D9V A;  2FCH A;  2YZU A;  1SL0 B;  1EV9 A;  5HR2 A;  4RQR A;  4Q5N A;  5EPF A;  2HZF A;  2RM6 A;  2RUF A;  3LGC A;  4ZBA A;  4V1A p;  1TK0 B;  1GSF A;  4KF9 A;  3EMP A;  4PQH A;  4WET A;  1EWX A;  2VD0 A;  2AJQ B;  3SWL A;  5IMZ A;  1ZYQ B;  3FW2 A;  1SD9 A;  2WUL A;  1FOV A;  1JZO A;  4PXO A;  4BVX A;  2AAW A;  4OFM A;  2H0I A;  4BVY A;  2HLS A;  4PQ1 A;  4KND A;  2ON5 A;  5D73 A;  3DRN A;  1QFN A;  1T8E B;  1GRX A;  2BMX A;  1M99 A;  3BCI A;  3Q74 A;  1AXD A;  3FY7 A;  1WRY A;  5G1K A;  4POK A;  3W6G A;  1BG5 A;  3DYR A;  2EIQ A;  3LXZ A;  2PUK C;  10GS A;  1S3A A;  1HNC A;  3N9J A;  2HXK A;  2VM1 A;  5IMC A;  4EE0 A;  1YEP A;  2M72 A;  1Y6E A;  5J3R A;  1ZYP A;  2AV4 A;  3WGE A;  4HSC X;  2WCI A;  4MMM A;  3DGQ A;  2C3Q A;  5J4U A;  4JZQ A;  1JHB A;  12GS A;  16GS A;  3WT1 A;  2CAQ A;  4K2X A;  4YQV A;  3L9V A;  1XG8 A;  3ZVJ D;  3VPT A;  5CRG A;  2K6V A;  3HVS A;  5G31 A;  2XHF A;  2GZY A;  1XW6 A;  3MDK A;  1XWK A;  1WJK A;  2YAN A;  3KJY A;  4PTS A;  2MYG A;  3KEB A;  1XVQ A;  2HRK A;  2IPA A;  1VF2 A;  4TKY A;  4EVM A;  1B9Y C;  4PUR A;  1GSD A;  2O7K A;  2ZCT A;  1SKS B;  1WIK A;  3LYK A;  4ECJ A;  3D21 A;  2F3M A;  1OC9 A;  3MWH A;  3APS A;  1QXH A;  3A2W A;  3M9J A;  2C0G A;  2QSI A;  1Q98 A;  4D73 A;  1XXU A;  1MTC A;  2H1G A;  1XVW A;  4GSN A;  3MIX A;  1O73 A;  3I6A A;  2FUG 2;  3M0F A;  4K7N A;  4ID0 A;  1F2E A;  3PH9 A;  1EZK A;  5GST A;  4JE1 A;  1EP7 A;  4ZBB A;  1O81 A;  4O32 A;  1U6T A;  2HYX A;  4ECB A;  1XW5 A;  3Q18 A;  5ECP B;  3TOT A;  3IAS 2;  4KE3 A;  4FIW A;  3WGX A;  5CRD A;  1OYJ A;  2B7K A;  4AJ8 A;  3MNG A;  1ERU A;  1U87 A;  1MDJ A;  2O89 A;  4LMW A;  1Z6N A;  5DCH A;  1O6J A;  2F51 A;  2DJ3 A;  2LKU A;  1PX7 A;  2GQK A;  4PNF A;  4WEY A;  2LRN A;  4IBP A;  1DE1 A;  4GRF A;  2CZ2 A;  2NTO A;  5HFK A;  2X64 A;  3QPM A;  18GS A;  1UVZ A;  1A0R P;  5DAK A;  1Q4J A;  3UBK A;  3UOM A;  3IC4 A;  5DAL B;  4MJC A;  3KCM A;  2NVL A;  2VL2 C;  1N8J A;  2H74 A;  3GTU B;  1NHY A;  5JCG A;  4TR1 A;  2GS3 A;  1SYR A;  5DBQ A;  3QD9 A;  3ZMK A;  2ZNM A;  3ZL5 A;  3L78 A;  3U6V A;  2LJA A;  1B9X C;  1A2J A;  1QMV A;  5GSS A;  1J9B A;  4L5O A;  1A2L A;  3H4K A;  2X99 A;  2OA7 A;  6GSW A;  2PPT A;  3C7M A;  1Z7R A;  1XOA A;  2DJK A;  5ECR B;  2XBI A;  5H5R A;  4MP4 A;  4EKZ A;  4PUA A;  2LQQ A;  4ULX A;  2OJL A;  2IMK A;  4L5L A;  4QL9 A;  1XCC A;  3ME7 A;  2MZC A;  4WBR D;  4MJA A;  3I9V 2;  4CY8 A;  2JSY A;  4N0Z A;  1B4Q A;  1A0F A;  2BJX A;  3IK7 A;  2RM5 A;  4PQI A;  3F8U A;  4EDZ A;  4IGJ A;  4CHS A;  2O87 A;  4CDO A;  3UVT A;  2H01 A;  1SU9 A;  2B3S A;  5KN2 A;  3RDW A;  5ID2 A;  2QC7 A;  2FWG A;  3TDG A;  3QOU A;  1GSS A;  3RPN A;  5ECO B;  3KH7 A;  5ECH B;  4KH7 A;  5F05 A;  4NMU A;  1J0F A;  3UVH A;  6GSY A;  3I43 A;  2C3T A;  3TRP A;  5L71 A;  2PWJ A;  4IQ1 A;  5ECL B;  1PX6 A;  2L5L A;  3ERW A;  3FHK A;  1OVN A;  4K5S A;  2DJ0 A;  2QA1 A;  3LFL A;  4MPF A;  4CW9 A;  2CVD A;  2RII A;  5INY A;  2LNT A;  1GUH A;  2IIY A;  3IXR A;  1YKC A;  5A5K A;  5KOW A;  2PVQ A;  1GSU A;  1DUG A;  1F9M A;  3TRX A;  2JZR A;  5AGY A;  3CSJ A;  3M3M A;  5GZZ B;  5HFG A;  4RI7 A;  3IV4 A;  3LYP A;  2WZ9 A;  1SYX A;  3GV1 A;  5DQS A;  3HZ8 A;  5GAN D;  4HI7 A;  4TN8 A;  2ALB A;  1PKZ A;  3R2Q A;  1X5D A;  3HYP A;  2IMD A;  2DBC A;  1YJ6 A;  5FHI A;  3UMA A;  5LD0 A;  4MH2 A;  2FD3 A;  4TOP A;  1KTE A;  3TKS A;  5IMD A;  4Q5Q A;  2F8A A;  1ZL9 A;  3H8Q A;  2VM2 A;  4K9Z A;  2CT6 A;  2MMO A;  4JR6 A;  4WR5 A;  1JZR A;  4EXJ A;  5E4W A;  3GH9 A;  2R0G A;  3HDC A;  3GRX A;  5AIV A;  5KN0 A;  4QL7 A;  4MPG A;  4POB A;  1O85 A;  4GLT A;  5H5S A;  4IKH A;  2EIR A;  3S9F A;  1ZGN A;  1S3R A;  4G19 A;  1SK1 A;  1JFU A;  4TXO B;  1GP1 A;  5DCG A;  3TJK A;  3WGD A;  3KP9 A;  4A5P A;  4IP6 A;  5F06 A;  5CRW A;  3WD6 A;  2PGT A;  3L0H A;  1BED A;  2GLR A;  2YCD A;  3FZ5 A;  4KUN A;  1CQH A;  4IN0 A;  2GZP A;  2F9S A;  3IR4 A;  1G6W A;  5IPG A;  2AB6 A;  2K18 A;  2VAF A;  4KSM A;  1K0D A;  3CRU A;  4L0W A;  3EC3 A;  1Z3E A;  4KA0 A;  2DKI A;  2FA8 A;  3C1R A;  5A4W A;  2KHP A;  1T7P B;  3DVX A;  3IHG A;  2H66 A;  1AW9 A;  4MF5 A;  1F3B A;  1AAZ A;  1GUM A;  2OKA A;  3IPZ A;  1VGL A;  5J41 A;  1N2A A;  4K0N A;  2VUP A;  3GL5 A;  2VCW A;  1NSW A;  2C8U A;  3QDN A;  17GS A;  3DML A;  4MAB A;  1FB0 A;  4NV5 A;  1Z6M A;  1PD2 1;  1A24 A;  3Q6O A;  2L4C A;  2H70 A;  4V2M A;  2LEG A;  2D2Z A;  3G7J A;  4HUA A;  3IK9 A;  3VUR A;  3NZN A;  1H4O A;  4N0V A;  2VL3 A;  2H6Z A;  4FYB A;  4XRD A;  3P7X A;  4I6X A;  2DKH A;  3UBL A;  1AC1 A;  4AF2 A;  3TUE A;  1DSB A;  1KEB A;  2H71 A;  3TKQ A;  1X9S B;  5JWR B;  1K0C A;  2V32 A;  2YJH A;  4OWY A;  4XRA A;  3FR6 A;  2DSA A;  4IS0 A;  4N11 A;  4O5U A;  4DVC A;  3VWW A;  3ZIT A;  2WS2 A;  4BWS A;  1S3C A;  2FWE A;  4MNN A;  3SBC A;  3D4M A;  5BMU A;  2JAC A;  1SK0 A;  3EWL A;  3F4R A;  4G0L A;  5ABR A;  3QMX A;  5D93 A;  3HKR A;  2HI7 A;  2P5R A;  2TRX A;  3AY8 A;  2XPD A;  2LRT A;  4OD7 A;  3DWV A;  2N5A A;  4KX4 A;  1ACV A;  2HT9 A;  5HR0 A;  2WB9 A;  4BL7 A;  4XTS A;  1LJR A;  3IC8 A;  5IPH A;  4KB3 A;  1U3I A;  2B5E A;  1BX9 A;  2H0H A;  4ZB8 A;  5D8I A;  4POM A;  2VCV A;  3D0Z A;  4RQX A;  4OCE A;  3F9U A;  3F3R A;  4TR0 A;  1FO5 A;  3GKK A;  4MJB A;  4EL1 A;  4IQA A;  4DEJ A;  4F0B A;  2R4V A;  2F8F A;  3RAZ A;  1NHO A;  2DJJ A;  3EVI A;  3F4T A;  1BJX A;  3C73 A;  5JCW A;  4OO5 A;  1YF0 A;  5AIS A;  2H76 A;  2FWF A;  3EU4 A;  3KXO A;  4HZ2 A;  2GDR A;  2MMZ A;  3PR8 A;  4MA9 A;  3EE2 A;  3DVW A;  1XWA A;  1PQN A;  2ZUP A;  4G0I A;  5IO2 A;  1X9M B;  5KOX A;  4V2N A;  1GUL A;  3IDV A;  3G9B A;  1PL1 A;  1EOH A;  4K2D A;  1XWC A;  2E2G A;  3VWX A;  1EOG A;  4EO3 A;  5EL8 A;  4ECC A;  1K0O A;  3IBH A;  3HY2 A;  4PX1 A;  3HJP A;  3EMX A;  4HJ2 A;  1OC8 A;  2YV9 A;  3DD3 A;  1AIU A;  4J2F A;  5LCZ A;  4WXT A;  4HZ4 A;  3ZIV A;  4QQ7 A;  1EP8 A;  5DAL A;  3ME8 A;  4HDE A;  4BWQ A;  2GQM A;  3KMO A;  4TVE A;  3GTU A;  2LTK A;  2OBK A;  2X8G A;  4GWR A;  1XIY A;  2FHE A;  4V2L A;  4XCS A;  2H8L A;  3GST A;  2H30 A;  2FA4 A;  1BAY A;  2IFQ B;  2H75 A;  1XWG A;  1SJZ A;  3ZRE A;  3GKM A;  3QCP A;  5CYY A;  1M3I A;  4KW6 A;  4J56 E;  3K8N A;  4LL1 B;  2K8V A;  4MF6 A;  2VOC A;  3BBY A;  1BYE A;  3GN3 A;  3MYD A;  4PUF C;  2HRA A;  2YWI A;  4K8M A;  4OMV A;  2VCZ A;  2WDU A;  11GS A;  2HFD A;  1G7E A;  4Z7X A;  1JLV A;  2B1K A;  2FGX A;  2JSZ A;  2GT6 A;  5A4V A;  5C00 A;  1FB6 A;  4POL A;  2MMA A;  1R5P A;  3MSZ A;  2H1A A;  3WYW A;  5J9C A;  2YN1 A;  4MH3 A;  3KM6 A;  4XS4 B;  4AGS A;  1THO A;  5B8B A;  3P90 A;  3HVN A;  1MD4 A;  2R0C A;  3D5J A;  4ZBD A;  3QAW A;  4MZB A;  3HXS A;  3BCK A;  3Q19 A;  4FO5 A;  5B6N A;  2OBI A;  1V40 A;  2J23 A;  3APO A;  3TJF A;  2DIY A;  5DQY A;  3FZ9 A;  3BOA A;  2G2Q A;  5D9W A;  2YP6 A;  2CV4 A;  5ENU A;  2FLS A;  5JWO B;  2B1L A;  4TR3 A;  4MK3 A;  2HRN A;  1ZOF A;  2CVK A;  2R3X A;  3F6F A;  4OCF A;  5CAX A;  5GAP D;  3ZTL A;  2L59 A;  1LBK A;  5FT3 A;  3E9J B;  1K3O A;  1PMT A;  2PBJ A;  1MD3 A;  5E59 A;  5G5E A;  4WKW A;  2GSS A;  4ML1 A;  1ON4 A;  5IIZ A;  1AQX A;  3GNJ A;  1YY7 A;  3KMN A;  3C71 A;  2WRT A;  1TJD A;  1F37 A;  4EUY A;  2AYT A;  1A2M A;  4KDU A;  2HZE B;  3DIE A;  3LSZ A;  1JLW A;  4N30 A;  2R2J A;  1YQ1 A;  1I5G A;  1QUW A;  1ST9 A;  2X8C A;  1M0U A;  5A4U A;  4PGT A;  14GS A;  4NHZ A;  1IYI A;  4AJ7 A;  3P2A A;  4OO4 A;  5KEJ A;  4K0G A;  1GWC A;  4ZB6 A;  4GTU A;  1PGT A;  2CVB A;  5D9T A;  4O7H A;  1X5E A;  2QA2 A;  3HJO A;  3O3T A;  5ECM B;  2A4V A;  3LWA A;  4G2E A;  3L9S A;  2A4H A;  2KP1 A;  1ZCP A;  2V6O A;  1K0N A;  3BJ5 A;  2XPE A;  2VCX A;  1GL8 A;  2LV3 A;  5J9B A;  3M1G A;  1TRS A;  1F3A A;  4TXO A;  3DEX A;  3FK8 A;  1TK5 B;  1GH2 A;  4LL4 B;  4EIP A;  1WE0 A;  1A8L A;  4O5R A;  2P0G A;  3VK9 A;  5ECK B;  5B8A A;  4IJ3 A;  1U88 A;  1ERV A;  4JRR A;  3IAM 2;  2N5F A;  1FOH A;  1PN9 A;  2VIM A;  4EF0 A;  2HSY A;  22GS A;  1EGO A;  3KTB A;  3QAV A;  2V1M A;  3A2V A;  5ECI B;  4YKF A;  4IEL A;  2YJ7 A;  1GSY A;  4F9Z A;  1GLP A;  2HNL A;  4MCU A;  1TW9 A;  5B6M A;  4OFT A;  3LXT A;  2C1Y A;  4WF5 A;  2A2P A;  2VCQ A;  4IHU A;  2I81 A;  3A3T A;  2R6K A;  3G7I A;  3N5O A;  1HNA A;  2IL3 A;  1OE7 A;  2OAD A;  4O5Q A;  4DSQ A;  4Z2T A;  3G7Y A;  3PGT A;  3ZIJ A;  3RHC A;  3CXG A;  3DKS A;  2AUV A;  5JWQ B;  2CZ3 A;  4X1U A;  4ICY A;  1CQG A;  1XOB A;  2C80 A;  2PMT A;  1MDI A;  2YWM A;  2H1B A;  1EEM A;  3RBT A;  6GSX A;  5IO0 A;  5CP1 A;  2VLU A;  2HRF A;  4ACS A;  1W4V A;  4YQM A;  2OE0 A;  2VLT A;  4Q5R A;  4TXV A;  4K1F A;  4ILF A;  2LST A;  1AQV A;  1G7O A;  2JZS A;  1SL1 B;  3FZ4 A;  3A5W A;  2P31 A;  1HYU A;  1TP9 A;  2RUE A;  1SKW B;  4IP1 A;  3LOR A;  4K7O A;  4X4J A;  3FEU A;  5AN1 A;  2H6X A;  5G5F A;  3D6I A;  4G10 A;  4EC0 A;  3F0I A;  3HVV A;  3NOF A;  3H79 A;  1TKD B;  2L6D A;  3FYG A;  3QFB C;  1PRX A;  1HD2 A;  3W8S A;  1X5C A;  2I4A A;  1TTZ A;  1PSQ A;  2R0P A;  8GSS A;  3QR6 A;  4MDC A;  1TU7 A;  2JZT A;  2VL2 A;  3HHV A;  3F4S A;  4FH8 A;  4G9H A;  1A23 A;  1UC7 A;  2I3Y A;  4KAE A;  3GIX A;  3LG6 A;  4YAV A;  1TRU A;  3ERG A;  1QGV A;  3O76 A;  5BRT A;  2BTO T;  3OR5 A;  1E6B A;  5CRE A;  1ABA A;  2B5Y A;  1GNE A;  3KP8 A;  4HQS A;  1R7H A;  2R37 A;  1T00 A;  2AHE A;  2X8H A;  2CAI A;  3GMF A;  1O8X A;  3LW9 A;  2H0G A;  2HSH A;  1G6Y A;  1PL2 A;  1T4Z A;  1TU8 A;  5KN1 A;  1HNB A;  1PN0 A;  4DSS B;  3UIW A;  3MAK A;  2N5B A;  4TR4 A;  3ZML A;  4JR4 A;  4CY6 A;  3TOU A;  2C4J A;  2IME A;  5ELA A;  1DE2 A;  2E7P A;  1XPV A;  4HEA 2;  2LJK A;  3I69 A;  5H5Q A;  1VRS D;  4GST A;  2IMI A;  2M46 A;  1DBY A;  3GUR A;  6GSS A;  5G1L A;  4ZL8 A;  2EC4 A;  3LEF A;  3VI7 A;  5C04 A;  1YEX A;  1ZYN A;  4F0C A;  3EYT A;  3VPQ A;  5F8B A;  2GST A;  1URM A;  2GGT A;  1V58 A;  3TKS E;  4I2T A;  3ZYW A;  1AUC A;  2V41 A;  2IMF A;  3HCZ A;  1OE8 A;  1FHE A;  3KGK A;  5IOX A;  3VWV A;  3CYN A;  1THX A;  3KZQ A;  2YPM A;  3EU3 A;  2CA8 A;  3VI5 A;  1SK2 A;  4TRX A;  1LU4 A;  4F03 A;  1R4W A;  20GS A;  2KUC A;  3CRT A;  2L6C A;  2L57 A;  6GSU A;  1QQ2 A;  3F63 A;  5J5N A;  1QK8 A;  2XBQ A;  3ZFB A;  4LMV A;  1XFL A;  2FWH A;  2K9F A;  3DXB A;  5IQY A;  3UEM A;  3ZLP A;  1TK8 B;  1WPI A;  1RK4 A;  6GSV A;  4Z2R A;  4RI6 A;  5IM9 A;  4JED A;  3TKP A;  1YF1 A;  4GSS A;  2JL4 A;  1PKW A;  2IFQ A;  3HJM A;  2NDO A;  7GSS A;  5IMF A;  3UL3 A;  19GS A;  3UJ1 A;  2OE3 A;  2O8V B;  2I1U A;  1J08 A;  13GS A;  1GTI A;  1TRV A;  3CTF A;  4K6X A;  5ECS A;  4E8H A;  1SKR B;  5D96 A;  4FYC A;  1SEN A;  3A2X A;  1GTU A;  3KD0 A;  3EUR A;  2XC2 A;  3LJR A;  1K0B A;  3TKR A;  3HZ4 A;  1SJI A;  2VL9 A;  2R5G A;  1B48 A;  4X0X A;  1K0M A;  4NPB A;  2MMN A;  2VO4 A;  3RPP A;  2PER A;  4BL7 B;  1H75 A;  4F82 A;  2GZZ A;  3TKS C;  2MBT A;  3KTL A;  4RUV A;  1ILO A;  3M9K A;  4NHW A;  4BVX B;  3IOS A;  4ML6 A;  4BVY B;  2E0Q A;  4WBJ A;  5CNW A;  4YKG A;  2HSM A;  1ZZY A;  2PN8 A;  4XS4 A;  4IW9 A;  4K7I A;  3IRA A;  2H1D A;  2E2M A;  2DMM A;  2WFC A;  3FR9 A;  2A2S A;  4MLY A;  1T3B A;  1KNG A;  4HJM A;  3PPU A;  3TB2 A;  3CBU A;  4JU5 A;  4V1A g;  9GSS A;  3J7Y b;  4KDX A;  3GYK A;  2FNO A;  5G30 A;  1FG4 A;  1M2D A;  4F2I A;  3A5I A;  2MBS A;  4HU9 A;  2WJU A;  3GA4 A;  4GQF A;  2H72 A;  1YDK A;  5F0G A;  5IOW A;  3GSS A;  3CQF A;  1SD8 A;  3KH9 A;  2QGV A;  3TJB A;  1T4Y A;  3GUS A;  4MZW A;  5LNK e;  4AJ6 A;  2LUS A;  1R5A A;  4YH2 A;  3GH6 A;  4EIQ A;  1K3L A;  3WT2 A;  1FW1 A;  4XHM A;  4I5Q A;  3O6T A;  2M80 A;  2OE1 A;  2KP2 A;  2C0E A;  3US3 A;  3GL3 A;  1I9D A;  1W89 A;  3HA9 A;  4I8B A;  1B8X A;  4LA1 A;  3TGZ A;  3GKX A;  2RLI A;  5IMV A;  2IN3 A;  4GF0 A;  1XZO A;  2ES7 A;  4ZIL A;  5EVO A;  3CSI A;  1ZYE A;  1VF1 A;  3TJG A;  4N10 A;  2GSQ A;  1K0A A;  1A8Y A;  2B6M A;  1GNW A;  2HZE A;  4E8E A;  2C0D A;  2CX3 A;  1OC9 B;  4XIH A;  4ZB9 A;  4JBB A;  3GKN A;  3FZA A;  2C3N A;  1UN2 A;  1AQW A;  3GHA A;  4D73 B;  4L0U A;  3ZVJ A;  3TCO A;  4Q5F A;  1VF3 A;  5AIX A;  5D9X A;  4MZC A;  2VD1 A;  2G0F A;  1Y25 A;  2NBS A;  3VWU A;  1X9W B;  3IE3 A;  2VCT A;  1GTA A;  1FVJ A;  2HE3 A;  2GVP A;  2FY6 A;  3L9U A;  5IMA A;  2CQ9 A;  1IYH A;  3GX8 A;  3J7Y k;  4ZL9 A;  3IA1 A;  2VLV A;  4HQZ A;  4NAX A;  1M3J A;  4TW5 A;  2B7J A;  2IWT A;  4GCI A;  1EGR A;  1ERT A;  2QKE A;  1TRW A;  3F6D A;  3H93 A;  5KN3 A;  3HD5 A;  2DIZ A;  1Z9H A;  3HVX A;  5HFI A;  1GUK A;  4P3Y B;  4H86 A;  1GSE A;  3GX0 A;  4HS1 A;  3D4T A;  6GST A;  2H73 A;  1V9W A;  2H19 A;  2REM A;  5DAK B;  1VF4 A;  2OAC A;  1ZMA A;  2YWO A;  4BPY A;  4TR1 B;  1X0R A;  4ZXG A;  4ISD A;  5COH A;  2LJR A;  1T1V A;  4K5R A;  4MJE A;  4IVF A;  4NWY A;  2YV7 A;  2DJ2 A;  2JAD A;  2EIO A;  4KDY A;  3ZRD A;  2YNX A;  1E2Y A;  1O7U A;  2JU5 A;  3VFI A;  3EIN A;  1M2A A;  1BQ7 A;  1GLQ A;  1MDK A;  3E3E A;  4G0K A;  2GQL A;  5ELG A;  2DLX A;  5JCU A;  2TRC P;  4PNG A;  3E0U A;  1RW1 A;  1OKT A;  1JZW A;  2GTU A;  4X43 A;  2ON7 A;  1RQM A;  4KCE A;  2P5Q A;  4FQU A;  5ECQ B;  4HOJ A;  1XW9 A;  2O85 A;  2WGR A;  1WOU A;  1YZX A;  3TJJ A;  2TIR A;  3UAR A;  1M7T A;  2PVO C;  3RHB A;  1U3A A;  3VLN A;  3W8J A;  4I97 A;  1OKD A;  1WWJ A;  2H6Y A;  2K8S A;  5ID2 B;  3C1S A;  4HU7 A;  4KCA A;  4IJI A;  4BIK A;  4XS6 A;  2B5X A;  4XS1 A;  1M9B A;  2L4Q A;  2YZH A;  4ECI A;  2L5O A;  2GSR A;  4OFN A;  1TI1 A;  1SJ6 A;  4WF4 A;  1Z7P A;  1ML6 A;  4KSO A;  3TRQ A;  2V6K A;  4LLR A;  3H1N A;  1M2B A;  3APQ A;  3ZFL A;  3EPT A;  4J57 E;  1NW2 A;  1YKA A;  1XWB A;  1PA3 A;  1V57 A;  1TOF A;  2NPB A;  1C72 A;  3ISO A;  3P8W A;  5FWG A;  5EY6 A;  3IHQ A;  4USS A;  5CRH A; 
#chains in the Genus database with same CATH homology
 2A2R A;  3C8E A;  1FAA A;  3FMW A;  3QFA C;  4NV2 A;  4MF7 A;  1S3D A;  4GXZ A;  4YAP A;  1TDI A;  4KGI A;  3PIN A;  1GTB A;  3LQ7 A;  1V98 A;  3ERF A;  2LNS A;  2IJY A;  5B7C A;  3L4N A;  3V1W A;  1ERW A;  1R26 A;  4GQC A;  2UZ8 A;  2X49 A;  1F6M C;  1OC3 A;  4DSS A;  5HQP A;  2DC5 A;  5HR1 A;  1TXX A;  4L8E A;  2V2G A;  5HR3 A;  4I2U A;  5DJL A;  1EV4 A;  3NIV A;  2KOK A;  2GT5 A;  1O8W A;  2DML A;  2YOI A;  1OAZ A;  3CTG A;  4ZIJ A;  1Z5Y E;  3GFK A;  1UA5 A;  2KLX A;  2X4A A;  1V2A A;  1SL2 B;  5DJM A;  3F3Q A;  4YQU A;  1EEJ A;  1K3Y A;  1GSQ A;  1KBN A;  1M9A A;  4ZL7 A;  1JZD A;  1G0T A;  3BD2 A;  2PU9 C;  2DJ1 A;  5CO3 A;  2YWN A;  5F07 A;  4NXI A;  5DDL A;  4WR4 A;  3FRC A;  3FKF A;  1TI3 A;  4EDY A;  1FVK A;  2J9H A;  1WMJ A;  2CX4 A;  4BA7 A;  3ZZX A;  3JCM L;  1NM3 A;  3CSH A;  2Z9S A;  1USB A;  3UAP A;  3D22 A;  4DSR A;  2LRC A;  3M8N A;  4Z2U A;  2LS5 A;  4FYU A;  1MEK A;  1XBS A;  2I9H A;  1B4P A;  3QAG A;  5G2Z A;  3CMI A;  5ECN B;  3KIJ A;  3U5R E;  2LQO A;  4O92 A;  2C0F A;  3ED3 A;  3R3E A;  1HQO A;  5DVB A;  3FR3 A;  1WP0 A;  5D9V A;  2FCH A;  2YZU A;  1SL0 B;  1EV9 A;  5HR2 A;  4RQR A;  4Q5N A;  5EPF A;  2HZF A;  2RM6 A;  2RUF A;  3LGC A;  4ZBA A;  4V1A p;  1TK0 B;  1GSF A;  4KF9 A;  3EMP A;  4PQH A;  4WET A;  1EWX A;  2VD0 A;  2AJQ B;  3SWL A;  5IMZ A;  1ZYQ B;  3FW2 A;  1SD9 A;  2WUL A;  1FOV A;  1JZO A;  4PXO A;  4BVX A;  2AAW A;  4OFM A;  2H0I A;  4BVY A;  2HLS A;  4PQ1 A;  4KND A;  2ON5 A;  5D73 A;  3DRN A;  1QFN A;  1T8E B;  1GRX A;  2BMX A;  1M99 A;  3BCI A;  3Q74 A;  1AXD A;  3FY7 A;  1WRY A;  5G1K A;  4POK A;  3W6G A;  1BG5 A;  3DYR A;  2EIQ A;  3LXZ A;  2PUK C;  10GS A;  1S3A A;  1HNC A;  3N9J A;  2HXK A;  2VM1 A;  5IMC A;  4EE0 A;  1YEP A;  2M72 A;  1Y6E A;  5J3R A;  1ZYP A;  2AV4 A;  3WGE A;  2WCI A;  4MMM A;  3DGQ A;  2C3Q A;  5J4U A;  4JZQ A;  1JHB A;  12GS A;  16GS A;  3WT1 A;  2CAQ A;  4K2X A;  4YQV A;  3L9V A;  3ZVJ D;  3VPT A;  5CRG A;  2K6V A;  3HVS A;  5G31 A;  2XHF A;  2GZY A;  1XW6 A;  3MDK A;  1XWK A;  1WJK A;  2YAN A;  3KJY A;  4PTS A;  2MYG A;  3KEB A;  1XVQ A;  2HRK A;  2IPA A;  1VF2 A;  4TKY A;  4EVM A;  1B9Y C;  4PUR A;  1GSD A;  2O7K A;  2ZCT A;  1SKS B;  1WIK A;  3LYK A;  4ECJ A;  3D21 A;  2F3M A;  1OC9 A;  3MWH A;  3APS A;  1QXH A;  3A2W A;  3M9J A;  2C0G A;  2QSI A;  1Q98 A;  4D73 A;  1XXU A;  1MTC A;  2H1G A;  1XVW A;  4GSN A;  3MIX A;  1O73 A;  3I6A A;  2FUG 2;  3M0F A;  4K7N A;  4ID0 A;  1F2E A;  3PH9 A;  1EZK A;  5GST A;  4JE1 A;  1EP7 A;  4ZBB A;  1O81 A;  4O32 A;  1U6T A;  2HYX A;  4ECB A;  1XW5 A;  3Q18 A;  5ECP B;  3TOT A;  3IAS 2;  4KE3 A;  4FIW A;  3WGX A;  5CRD A;  1OYJ A;  2B7K A;  4AJ8 A;  3MNG A;  1ERU A;  1U87 A;  1MDJ A;  2O89 A;  4LMW A;  1Z6N A;  5DCH A;  1O6J A;  2F51 A;  2DJ3 A;  2LKU A;  1PX7 A;  2GQK A;  4PNF A;  4WEY A;  2LRN A;  4IBP A;  1DE1 A;  4GRF A;  2CZ2 A;  2NTO A;  5HFK A;  2X64 A;  3QPM A;  18GS A;  1UVZ A;  1A0R P;  5DAK A;  1Q4J A;  3UBK A;  3UOM A;  3IC4 A;  5DAL B;  4MJC A;  3KCM A;  2NVL A;  2VL2 C;  1N8J A;  2H74 A;  3GTU B;  1NHY A;  5JCG A;  4TR1 A;  2GS3 A;  1SYR A;  5DBQ A;  3QD9 A;  3ZMK A;  2ZNM A;  3ZL5 A;  3L78 A;  3U6V A;  2LJA A;  1B9X C;  1A2J A;  1QMV A;  5GSS A;  1J9B A;  4L5O A;  1A2L A;  3H4K A;  2X99 A;  2OA7 A;  6GSW A;  2PPT A;  3C7M A;  1Z7R A;  1XOA A;  2DJK A;  5ECR B;  2XBI A;  5H5R A;  4MP4 A;  4EKZ A;  4PUA A;  2LQQ A;  4ULX A;  2OJL A;  2IMK A;  4L5L A;  4QL9 A;  1XCC A;  3ME7 A;  2MZC A;  4WBR D;  4MJA A;  3I9V 2;  4CY8 A;  2JSY A;  4N0Z A;  1B4Q A;  1A0F A;  2BJX A;  3IK7 A;  2RM5 A;  4PQI A;  3F8U A;  4EDZ A;  4IGJ A;  4CHS A;  2O87 A;  4CDO A;  3UVT A;  2H01 A;  1SU9 A;  2B3S A;  5KN2 A;  3RDW A;  5ID2 A;  2QC7 A;  2FWG A;  3TDG A;  3QOU A;  1GSS A;  3RPN A;  5ECO B;  3KH7 A;  5ECH B;  4KH7 A;  5F05 A;  4NMU A;  1J0F A;  3UVH A;  6GSY A;  3I43 A;  2C3T A;  3TRP A;  5L71 A;  2PWJ A;  4IQ1 A;  5ECL B;  1PX6 A;  2L5L A;  3ERW A;  3FHK A;  1OVN A;  4K5S A;  2DJ0 A;  2QA1 A;  3LFL A;  4MPF A;  4CW9 A;  2CVD A;  2RII A;  5INY A;  2LNT A;  1GUH A;  2IIY A;  3IXR A;  1YKC A;  5A5K A;  5KOW A;  2PVQ A;  1GSU A;  1DUG A;  1F9M A;  3TRX A;  2JZR A;  5AGY A;  3CSJ A;  3M3M A;  5GZZ B;  5HFG A;  4RI7 A;  3IV4 A;  3LYP A;  2WZ9 A;  1SYX A;  3GV1 A;  5DQS A;  3HZ8 A;  5GAN D;  4HI7 A;  4TN8 A;  2ALB A;  1PKZ A;  3R2Q A;  1X5D A;  3HYP A;  2IMD A;  2DBC A;  1YJ6 A;  5FHI A;  3UMA A;  5LD0 A;  4MH2 A;  2FD3 A;  4TOP A;  1KTE A;  3TKS A;  5IMD A;  4Q5Q A;  2F8A A;  1ZL9 A;  3H8Q A;  2VM2 A;  4K9Z A;  2CT6 A;  2MMO A;  4JR6 A;  4WR5 A;  1JZR A;  4EXJ A;  5E4W A;  3GH9 A;  2R0G A;  3HDC A;  3GRX A;  5AIV A;  5KN0 A;  4QL7 A;  4MPG A;  4POB A;  1O85 A;  4GLT A;  5H5S A;  4IKH A;  2EIR A;  3S9F A;  1ZGN A;  4G19 A;  1SK1 A;  1JFU A;  4TXO B;  1GP1 A;  5DCG A;  3TJK A;  3WGD A;  3KP9 A;  4A5P A;  4IP6 A;  5F06 A;  5CRW A;  3WD6 A;  2PGT A;  3L0H A;  1BED A;  2GLR A;  2YCD A;  3FZ5 A;  4KUN A;  1CQH A;  4IN0 A;  2GZP A;  2F9S A;  3IR4 A;  1G6W A;  5IPG A;  2AB6 A;  2K18 A;  2VAF A;  4KSM A;  1K0D A;  3CRU A;  4L0W A;  3EC3 A;  1Z3E A;  4KA0 A;  2DKI A;  2FA8 A;  3C1R A;  5A4W A;  2KHP A;  1T7P B;  3DVX A;  3IHG A;  2H66 A;  1AW9 A;  4MF5 A;  1F3B A;  1AAZ A;  1GUM A;  2OKA A;  3IPZ A;  1VGL A;  5J41 A;  1N2A A;  4K0N A;  2VUP A;  3GL5 A;  2VCW A;  1NSW A;  2C8U A;  3QDN A;  17GS A;  3DML A;  4MAB A;  1FB0 A;  4NV5 A;  1Z6M A;  1PD2 1;  1A24 A;  3Q6O A;  2L4C A;  2H70 A;  4V2M A;  2LEG A;  2D2Z A;  3G7J A;  4HUA A;  3IK9 A;  3VUR A;  3NZN A;  1H4O A;  4N0V A;  2VL3 A;  2H6Z A;  4FYB A;  4XRD A;  3P7X A;  4I6X A;  2DKH A;  3UBL A;  1AC1 A;  4AF2 A;  3TUE A;  1DSB A;  1KEB A;  2H71 A;  3TKQ A;  1X9S B;  5JWR B;  1K0C A;  2V32 A;  2YJH A;  4OWY A;  4XRA A;  3FR6 A;  2DSA A;  4IS0 A;  4N11 A;  4O5U A;  4DVC A;  3VWW A;  3ZIT A;  2WS2 A;  4BWS A;  1S3C A;  2FWE A;  4MNN A;  3SBC A;  3D4M A;  5BMU A;  2JAC A;  1SK0 A;  3EWL A;  3F4R A;  4G0L A;  5ABR A;  3QMX A;  5D93 A;  3HKR A;  2HI7 A;  2P5R A;  2TRX A;  3AY8 A;  2XPD A;  2LRT A;  4OD7 A;  3DWV A;  2N5A A;  4KX4 A;  1ACV A;  2HT9 A;  5HR0 A;  2WB9 A;  4BL7 A;  4XTS A;  1LJR A;  3IC8 A;  5IPH A;  4KB3 A;  1U3I A;  2B5E A;  1BX9 A;  2H0H A;  4ZB8 A;  5D8I A;  4POM A;  2VCV A;  3D0Z A;  4RQX A;  4OCE A;  3F9U A;  3F3R A;  4TR0 A;  1FO5 A;  3GKK A;  4MJB A;  4EL1 A;  4IQA A;  4DEJ A;  4F0B A;  2R4V A;  2F8F A;  3RAZ A;  1NHO A;  2DJJ A;  3EVI A;  3F4T A;  1BJX A;  3C73 A;  5JCW A;  4OO5 A;  1YF0 A;  5AIS A;  2H76 A;  2FWF A;  3EU4 A;  3KXO A;  4HZ2 A;  2GDR A;  2MMZ A;  3PR8 A;  4MA9 A;  3EE2 A;  3DVW A;  1XWA A;  1PQN A;  2ZUP A;  4G0I A;  5IO2 A;  1X9M B;  5KOX A;  4V2N A;  1GUL A;  3IDV A;  3G9B A;  1PL1 A;  1EOH A;  4K2D A;  1XWC A;  2E2G A;  3VWX A;  1EOG A;  4EO3 A;  5EL8 A;  4ECC A;  1K0O A;  3IBH A;  3HY2 A;  4PX1 A;  3HJP A;  3EMX A;  4HJ2 A;  1OC8 A;  2YV9 A;  3DD3 A;  1AIU A;  4J2F A;  5LCZ A;  4WXT A;  4HZ4 A;  3ZIV A;  4QQ7 A;  1EP8 A;  5DAL A;  3ME8 A;  4HDE A;  4BWQ A;  2GQM A;  3KMO A;  4TVE A;  3GTU A;  2LTK A;  2OBK A;  2X8G A;  4GWR A;  1XIY A;  2FHE A;  4V2L A;  4XCS A;  2H8L A;  3GST A;  2H30 A;  2FA4 A;  1BAY A;  2IFQ B;  2H75 A;  1XWG A;  1SJZ A;  3ZRE A;  3GKM A;  3QCP A;  5CYY A;  4KW6 A;  4J56 E;  3K8N A;  4LL1 B;  2K8V A;  4MF6 A;  2VOC A;  3BBY A;  1BYE A;  3GN3 A;  3MYD A;  4PUF C;  2HRA A;  2YWI A;  4K8M A;  4OMV A;  2VCZ A;  2WDU A;  11GS A;  2HFD A;  1G7E A;  4Z7X A;  1JLV A;  2B1K A;  2FGX A;  2JSZ A;  2GT6 A;  5A4V A;  5C00 A;  1FB6 A;  4POL A;  2MMA A;  1R5P A;  3MSZ A;  2H1A A;  3WYW A;  5J9C A;  2YN1 A;  4MH3 A;  3KM6 A;  4XS4 B;  4AGS A;  1THO A;  5B8B A;  3P90 A;  1MD4 A;  2R0C A;  3D5J A;  4ZBD A;  3QAW A;  4MZB A;  3HXS A;  3BCK A;  3Q19 A;  4FO5 A;  5B6N A;  2OBI A;  1V40 A;  2J23 A;  3APO A;  3TJF A;  2DIY A;  5DQY A;  3FZ9 A;  3BOA A;  2G2Q A;  5D9W A;  2YP6 A;  2CV4 A;  5ENU A;  2FLS A;  5JWO B;  2B1L A;  4TR3 A;  4MK3 A;  2HRN A;  1ZOF A;  2CVK A;  2R3X A;  3F6F A;  4OCF A;  5CAX A;  5GAP D;  3ZTL A;  2L59 A;  1LBK A;  5FT3 A;  3E9J B;  1K3O A;  1PMT A;  2PBJ A;  1MD3 A;  5E59 A;  5G5E A;  4WKW A;  2GSS A;  4ML1 A;  1ON4 A;  5IIZ A;  1AQX A;  3GNJ A;  1YY7 A;  3KMN A;  3C71 A;  2WRT A;  1TJD A;  1F37 A;  4EUY A;  2AYT A;  1A2M A;  4KDU A;  2HZE B;  3DIE A;  3LSZ A;  1JLW A;  4N30 A;  2R2J A;  1YQ1 A;  1I5G A;  1QUW A;  1ST9 A;  2X8C A;  1M0U A;  5A4U A;  4PGT A;  14GS A;  4NHZ A;  1IYI A;  4AJ7 A;  3P2A A;  4OO4 A;  5KEJ A;  4K0G A;  1GWC A;  4ZB6 A;  4GTU A;  1PGT A;  2CVB A;  5D9T A;  4O7H A;  1X5E A;  2QA2 A;  3HJO A;  3O3T A;  5ECM B;  2A4V A;  3LWA A;  4G2E A;  3L9S A;  2A4H A;  2KP1 A;  1ZCP A;  2V6O A;  1K0N A;  3BJ5 A;  2XPE A;  2VCX A;  1GL8 A;  2LV3 A;  5J9B A;  3M1G A;  1TRS A;  1F3A A;  4TXO A;  3DEX A;  3FK8 A;  1TK5 B;  1GH2 A;  4LL4 B;  4EIP A;  1WE0 A;  1A8L A;  4O5R A;  2P0G A;  3VK9 A;  5ECK B;  5B8A A;  4IJ3 A;  1U88 A;  1ERV A;  4JRR A;  3IAM 2;  2N5F A;  1FOH A;  1PN9 A;  2VIM A;  4EF0 A;  2HSY A;  22GS A;  1EGO A;  3KTB A;  3QAV A;  2V1M A;  3A2V A;  5ECI B;  4YKF A;  4IEL A;  2YJ7 A;  1GSY A;  4F9Z A;  1GLP A;  2HNL A;  4MCU A;  1TW9 A;  5B6M A;  4OFT A;  3LXT A;  2C1Y A;  4WF5 A;  2A2P A;  2VCQ A;  4IHU A;  2I81 A;  3A3T A;  2R6K A;  3G7I A;  3N5O A;  1HNA A;  2IL3 A;  1OE7 A;  2OAD A;  4O5Q A;  4DSQ A;  4Z2T A;  3G7Y A;  3PGT A;  3ZIJ A;  3RHC A;  3CXG A;  3DKS A;  2AUV A;  5JWQ B;  2CZ3 A;  4X1U A;  4ICY A;  1CQG A;  1XOB A;  2C80 A;  2PMT A;  1MDI A;  2YWM A;  2H1B A;  1EEM A;  3RBT A;  6GSX A;  5IO0 A;  5CP1 A;  2VLU A;  2HRF A;  4ACS A;  1W4V A;  4YQM A;  2OE0 A;  2VLT A;  4Q5R A;  4TXV A;  4K1F A;  4ILF A;  2LST A;  1AQV A;  1G7O A;  2JZS A;  1SL1 B;  3FZ4 A;  3A5W A;  2P31 A;  1HYU A;  1TP9 A;  2RUE A;  1SKW B;  4IP1 A;  3LOR A;  4K7O A;  4X4J A;  3FEU A;  5AN1 A;  2H6X A;  5G5F A;  3D6I A;  4G10 A;  4EC0 A;  3F0I A;  3HVV A;  3NOF A;  3H79 A;  1TKD B;  2L6D A;  3FYG A;  3QFB C;  1PRX A;  1HD2 A;  3W8S A;  1X5C A;  2I4A A;  1TTZ A;  1PSQ A;  2R0P A;  8GSS A;  3QR6 A;  4MDC A;  1TU7 A;  2JZT A;  2VL2 A;  3HHV A;  3F4S A;  4FH8 A;  4G9H A;  1A23 A;  1UC7 A;  2I3Y A;  4KAE A;  3GIX A;  3LG6 A;  4YAV A;  1TRU A;  3ERG A;  1QGV A;  3O76 A;  5BRT A;  2BTO T;  3OR5 A;  1E6B A;  5CRE A;  1ABA A;  2B5Y A;  1GNE A;  3KP8 A;  4HQS A;  1R7H A;  2R37 A;  1T00 A;  2AHE A;  2X8H A;  2CAI A;  3GMF A;  1O8X A;  3LW9 A;  2H0G A;  2HSH A;  1G6Y A;  1PL2 A;  1T4Z A;  1TU8 A;  5KN1 A;  1HNB A;  1PN0 A;  4DSS B;  3UIW A;  3MAK A;  2N5B A;  4TR4 A;  3ZML A;  4JR4 A;  4CY6 A;  3TOU A;  2C4J A;  2IME A;  5ELA A;  1DE2 A;  2E7P A;  1XPV A;  4HEA 2;  2LJK A;  3I69 A;  5H5Q A;  1VRS D;  4GST A;  2IMI A;  2M46 A;  1DBY A;  3GUR A;  6GSS A;  5G1L A;  4ZL8 A;  2EC4 A;  3LEF A;  3VI7 A;  5C04 A;  1YEX A;  1ZYN A;  4F0C A;  3EYT A;  3VPQ A;  5F8B A;  2GST A;  1URM A;  2GGT A;  1V58 A;  3TKS E;  4I2T A;  3ZYW A;  1AUC A;  2V41 A;  2IMF A;  3HCZ A;  1OE8 A;  1FHE A;  3KGK A;  5IOX A;  3VWV A;  3CYN A;  1THX A;  3KZQ A;  2YPM A;  3EU3 A;  2CA8 A;  3VI5 A;  1SK2 A;  4TRX A;  1LU4 A;  4F03 A;  1R4W A;  20GS A;  2KUC A;  3CRT A;  2L6C A;  2L57 A;  6GSU A;  1QQ2 A;  3F63 A;  5J5N A;  1QK8 A;  2XBQ A;  3ZFB A;  4LMV A;  1XFL A;  2FWH A;  2K9F A;  3DXB A;  5IQY A;  3UEM A;  3ZLP A;  1TK8 B;  1WPI A;  1RK4 A;  6GSV A;  4Z2R A;  4RI6 A;  5IM9 A;  4JED A;  3TKP A;  1YF1 A;  4GSS A;  2JL4 A;  1PKW A;  2IFQ A;  3HJM A;  2NDO A;  7GSS A;  5IMF A;  3UL3 A;  19GS A;  3UJ1 A;  2OE3 A;  2O8V B;  2I1U A;  1J08 A;  13GS A;  1GTI A;  1TRV A;  3CTF A;  4K6X A;  5ECS A;  4E8H A;  1SKR B;  5D96 A;  4FYC A;  1SEN A;  3A2X A;  1GTU A;  3KD0 A;  3EUR A;  2XC2 A;  3LJR A;  1K0B A;  3TKR A;  3HZ4 A;  1SJI A;  2VL9 A;  2R5G A;  1B48 A;  4X0X A;  1K0M A;  4NPB A;  2MMN A;  2VO4 A;  3RPP A;  2PER A;  4BL7 B;  1H75 A;  4F82 A;  2GZZ A;  3TKS C;  2MBT A;  3KTL A;  4RUV A;  1ILO A;  3M9K A;  4NHW A;  4BVX B;  3IOS A;  4ML6 A;  4BVY B;  2E0Q A;  4WBJ A;  5CNW A;  4YKG A;  2HSM A;  1ZZY A;  2PN8 A;  4XS4 A;  4IW9 A;  4K7I A;  3IRA A;  2H1D A;  2E2M A;  2DMM A;  2WFC A;  3FR9 A;  2A2S A;  4MLY A;  1T3B A;  1KNG A;  4HJM A;  3PPU A;  3TB2 A;  3CBU A;  4JU5 A;  4V1A g;  9GSS A;  3J7Y b;  4KDX A;  3GYK A;  2FNO A;  5G30 A;  1FG4 A;  1M2D A;  4F2I A;  3A5I A;  2MBS A;  4HU9 A;  2WJU A;  3GA4 A;  4GQF A;  2H72 A;  1YDK A;  5F0G A;  5IOW A;  3GSS A;  1SD8 A;  3KH9 A;  2QGV A;  3TJB A;  1T4Y A;  3GUS A;  4MZW A;  5LNK e;  4AJ6 A;  2LUS A;  1R5A A;  4YH2 A;  3GH6 A;  4EIQ A;  1K3L A;  3WT2 A;  1FW1 A;  4XHM A;  4I5Q A;  3O6T A;  2M80 A;  2OE1 A;  2KP2 A;  2C0E A;  3US3 A;  3GL3 A;  1I9D A;  1W89 A;  3HA9 A;  4I8B A;  1B8X A;  4LA1 A;  3TGZ A;  3GKX A;  2RLI A;  5IMV A;  2IN3 A;  4GF0 A;  1XZO A;  2ES7 A;  4ZIL A;  5EVO A;  3CSI A;  1ZYE A;  1VF1 A;  3TJG A;  4N10 A;  2GSQ A;  1K0A A;  1A8Y A;  2B6M A;  1GNW A;  2HZE A;  4E8E A;  2C0D A;  2CX3 A;  1OC9 B;  4XIH A;  4ZB9 A;  4JBB A;  3GKN A;  3FZA A;  2C3N A;  1UN2 A;  1AQW A;  3GHA A;  4D73 B;  4L0U A;  3ZVJ A;  3TCO A;  4Q5F A;  1VF3 A;  5AIX A;  5D9X A;  4MZC A;  2VD1 A;  2G0F A;  1Y25 A;  2NBS A;  3VWU A;  1X9W B;  3IE3 A;  2VCT A;  1GTA A;  1FVJ A;  2HE3 A;  2GVP A;  2FY6 A;  3L9U A;  5IMA A;  2CQ9 A;  1IYH A;  3GX8 A;  3J7Y k;  4ZL9 A;  3IA1 A;  2VLV A;  4HQZ A;  4NAX A;  4TW5 A;  2B7J A;  2IWT A;  4GCI A;  1EGR A;  1ERT A;  2QKE A;  1TRW A;  3F6D A;  3H93 A;  5KN3 A;  3HD5 A;  2DIZ A;  1Z9H A;  3HVX A;  5HFI A;  1GUK A;  4P3Y B;  4H86 A;  1GSE A;  3GX0 A;  4HS1 A;  3D4T A;  6GST A;  2H73 A;  1V9W A;  2H19 A;  2REM A;  5DAK B;  1VF4 A;  2OAC A;  1ZMA A;  2YWO A;  4BPY A;  4TR1 B;  1X0R A;  4ZXG A;  4ISD A;  5COH A;  2LJR A;  1T1V A;  4K5R A;  4MJE A;  4IVF A;  4NWY A;  2YV7 A;  2DJ2 A;  2JAD A;  2EIO A;  4KDY A;  3ZRD A;  2YNX A;  1E2Y A;  1O7U A;  2JU5 A;  3VFI A;  3EIN A;  1M2A A;  1BQ7 A;  1GLQ A;  1MDK A;  3E3E A;  4G0K A;  2GQL A;  5ELG A;  2DLX A;  5JCU A;  2TRC P;  4PNG A;  3E0U A;  1RW1 A;  1OKT A;  1JZW A;  2GTU A;  4X43 A;  2ON7 A;  1RQM A;  4KCE A;  2P5Q A;  4FQU A;  5ECQ B;  4HOJ A;  1XW9 A;  2O85 A;  2WGR A;  1WOU A;  1YZX A;  3TJJ A;  2TIR A;  3UAR A;  1M7T A;  2PVO C;  3RHB A;  1U3A A;  3VLN A;  3W8J A;  4I97 A;  1OKD A;  1WWJ A;  2H6Y A;  2K8S A;  5ID2 B;  3C1S A;  4HU7 A;  4KCA A;  4IJI A;  4XS6 A;  2B5X A;  4XS1 A;  1M9B A;  2L4Q A;  2YZH A;  4ECI A;  2L5O A;  2GSR A;  4OFN A;  1TI1 A;  1SJ6 A;  4WF4 A;  1Z7P A;  1ML6 A;  4KSO A;  3TRQ A;  2V6K A;  4LLR A;  3H1N A;  1M2B A;  3APQ A;  3ZFL A;  3EPT A;  4J57 E;  1NW2 A;  1YKA A;  1XWB A;  1PA3 A;  1V57 A;  1TOF A;  2NPB A;  1C72 A;  3ISO A;  3P8W A;  5FWG A;  5EY6 A;  3IHQ A;  4USS A;  5CRH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...