1T00A

The structure of thioredoxin from s. coelicolor
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
112
structure length
112
Chain Sequence
SHMAGTLKHVTDDSFEQDVLKNDKPVLVDFWAAWCGPCRQIAPSLEAIAAEYGDKIEIVKLNIDENPGTAAKYGVMSIPTLNVYQGGEVAKTIVGAKPKAAIVRDLEDFIAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thioredoxin
publication title Expression, purification and X-ray crystallographic analysis of thioredoxin from Streptomyces coelicolor.
pubmed doi rcsb
source organism Streptomyces coelicolor
molecule tags Electron transport
total genus 30
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2004-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1t00A00
1XCCA 1ZL9A 1PN9A 2H75A 2N5BA 2YJ7A 2IMDA 3IPZA 3LXZA 1J0FA 2KP2A 4DSSB 3HD5A 4Q5QA 1EGRA 1K3YA 4IQ1A 4MH2A 2P5RA 1ZMAA 2F3MA 4G10A 1WE0A 3HA9A 1TKDB 4HDEA 4N10A 1GNWA 3KP9A 4XHMA 5ID2B 2KHPA 4EL1A 4EXJA 4KAEA 1IYIA 1VF3A 2QKEA 1FHEA 3FZ4A 4RI7A 5IMCA 7GSSA 5B6MA 4L0UA 3VWXA 4HS1A 1AQXA 2IMFA 2R6KA 3GTUB 2DSAA 1SL1B 2P5QA 1SK0A 5JWOB 5G1LA 3GL3A 4OD7A 1GTIA 3H93A 2VLUA 3MWHA 3VWVA 4FYUA 3ZIVA 4OWYA 1TK0B 3FZAA 5ENUA 2BJXA 2E7PA 3CTGA 4PUAA 4I6XA 1K0MA 1QMVA 4E8HA 4K7NA 1O73A 4RUVA 1PKZA 1MTCA 3HCZA 3NOFA 3ZLPA 3QAGA 1EGOA 2MMOA 1SD9A 3FKFA 3Q74A 1SKRB 1A2MA 5HR1A 4POLA 3N9JA 2DJKA 1OKTA 4RI6A 2DC5A 2OBKA 5ABRA 3GX8A 5KN3A 1O85A 4BA7A 1X9SB 4IHUA 4Q5FA 1JZDA 2WS2A 2VIMA 16GSA 5ELAA 5CREA 4J2FA 3TJGA 2CT6A 2K18A 1NW2A 2MYGA 2H74A 2WDUA 2TRXA 4AGSA 5INYA 3C73A 4ZB9A 2YOIA 5AIVA 4F9ZA 2OKAA 1ML6A 3GRXA 3UVHA 13GSA 1F3BA 3A2XA 2IWTA 3AY8A 3U5RE 4GF0A 5F06A 3G7IA 4CDOA 4O7HA 4IELA 5FWGA 2PPTA 1DUGA 3N5OA 2CA8A 2C0EA 3MAKA 3HYPA 4KDXA 2QC7A 1F37A 3PGTA 4KA0A 1WP0A 5A4VA 3A5WA 2CAIA 4CHSA 4WF5A 12GSA 3UEMA 4MK3A 1JZOA 3LORA 3SWLA 2ON5A 5GAPD 3EWLA 1B48A 3O76A 5KN0A 4OFTA 2JZTA 5C00A 3ZITA 1T4YA 11GSA 2I3YA 1DBYA 2YWIA 3OR5A 1WRYA 3DKSA 3H4KA 4K0GA 1K0NA 2FD3A 2PUKC 1M2BA 4MZCA 1EEJA 1HNAA 3HZ8A 4FYBA 2FWHA 3VI7A 2BMXA 2VLTA 1BJXA 2A2SA 2RM6A 5FHIA 3GKXA 2YANA 5ECHB 3ZFLA 2H1DA 1ACVA 2CX3A 1FOVA 5AGYA 2F51A 5GSTA 4JZQA 1GTBA 1MDJA 3TJKA 4WKWA 1EOGA 4OFNA 1SYXA 3IRAA 1TI3A 3CMIA 3GUSA 1ZZYA 2JU5A 3O3TA 1O8XA 5C04A 3LYKA 4X43A 3FK8A 5GAND 2L4CA 4MF7A 4TR1B 2GZPA 3RBTA 1I5GA 3QAVA 2KOKA 5ECMB 1UN2A 4IS0A 3CRUA 1TRUA 4RQXA 2IJYA 3DRNA 3D0ZA 3A2WA 4XIHA 3VWUA 5AIXA 5ID2A 2YWMA 3M1GA 2GQKA 4OCFA 5ECPB 3VURA 5AISA 1YF1A 2EIRA 3WT1A 2K9FA 1FB6A 2NPBA 2IFQA 4NWYA 5CO3A 1A24A 5ECNB 3GX0A 4JE1A 3DIEA 1Z9HA 4ZL9A 5ECIB 5HFKA 3GTUA 3PH9A 2EIQA 1GLQA 2HI7A 2AV4A 4XRDA 4ZL8A 3IAM2 3MDKA 3QAWA 1GUKA 1GSSA 3ZTLA 4GTUA 4AJ8A 2O8VB 5E59A 1X5EA 2YNXA 1HNCA 2R37A 3QDNA 1B8XA 2E0QA 2Z9SA 4NHWA 2FCHA 4YAPA 5EVOA 2P0GA 2O85A 3SBCA 4I2TA 3UAPA 4IN0A 4EF0A 4GQFA 3GH6A 5HFGA 1BEDA 5DAKA 1EP7A 4J56E 1QUWA 3DMLA 2DJ2A 3IHQA 1WWJA 4KGIA 1AQWA 4G9HA 2MMAA 5JWQB 1TI1A 3KXOA 3QR6A 4TVEA 5A5KA 1JLVA 2F8FA 4HQZA 4PQ1A 3P90A 5CP1A 1JZWA 5H5SA 5F8BA 2VCZA 5IMVA 4JRRA 1TRWA 1RW1A 1SKSB 2VCVA 2CX4A 3EU4A 1EEMA 2XHFA 3VFIA 3HDCA 1QQ2A 3GSTA 1M0UA 3C1RA 4OO4A 2DMMA 1YJ6A 5D9WA 5A4UA 2O89A 3JCML 5DQYA 3TKQA 2IN3A 1ZCPA 3ZRDA 4XRAA 1TK5B 2X8CA 2PERA 2K6VA 3HJMA 3P7XA 4TR0A 1XOAA 2HRNA 2PGTA 1M7TA 1GUHA 4F2IA 5F07A 1YY7A 2ZCTA 4O32A 4IBPA 3RHBA 1PA3A 1LU4A 1A2LA 2XPDA 3LQ7A 3RDWA 1X9MB 3GYKA 3TJJA 4CW9A 3NZNA 2HLSA 5CRDA 3WGXA 2IMEA 4I2UA 1TU8A 3DXBA 5IO0A 1A8LA 4ISDA 2FA8A 2H01A 4N30A 2L59A 2GQMA 4TR3A 1V98A 4L0WA 2AJQB 1BX9A 4ZBBA 3BCIA 5D9VA 20GSA 3FW2A 1R5PA 3UIWA 4NPBA 1Q98A 3HVSA 4TN8A 3D4TA 1PKWA 2JSYA 5ECSA 4G2EA 4NV2A 5F0GA 2VCWA 2M72A 3APQA 4Q5NA 1R5AA 1YKCA 2LRNA 3EURA 2L5OA 4HU9A 1I9DA 2N5FA 4MH3A 4AJ7A 3IA1A 4KSMA 1A0FA 5IMDA 1UC7A 2GSSA 3EINA 5J5NA 1XWGA 4PNGA 1NHOA 2G0FA 1GSYA 5CYYA 1KBNA 4ZB6A 2LUSA 6GSVA 4HEA2 4ZL7A 3QFBC 4HOJA 5IQYA 3H79A 1G7OA 3GMFA 4PUFC 1KNGA 1QXHA 1HNBA 5D73A 4ML6A 1MDIA 2DIYA 3CRTA 3FZ5A 1UVZA 4H86A 1Z6NA 1U6TA 1T3BA 4F0BA 1FG4A 3C7MA 3C8EA 4GQCA 3DVWA 3W8SA 3ZIJA 6GSYA 2OA7A 2HYXA 3ME7A 3TDGA 1TP9A 6GSUA 1XXUA 4GXZA 1DSBA 3CBUA 5EL8A 2H66A 1NHYA 2PWJA 3D4MA 3KZQA 2VLVA 4TRXA 1GSQA 4NV5A 2P31A 5DBQA 3FRCA 1SL0B 1TU7A 3APOA 1EV4A 2C0GA 1CQHA 2LV3A 1V58A 2IFQB 4EVMA 2GT5A 5B8BA 4I8BA 2RUFA 2PBJA 1WPIA 4MF6A 2VCTA 3IOSA 4OO5A 4JEDA 1X0RA 2B6MA 3NIVA 2QSIA 3APSA 5EPFA 3UOMA 2H6YA 5J9CA 1Y25A 2LS5A 4IJ3A 4NMUA 2GS3A 1O7UA 3F8UA 5G5EA 3UMAA 2VL9A 3GHAA 3Q6OA 1FO5A 4MABA 3F63A 4AJ6A 4EUYA 5HFIA 4V1Ag 1YZXA 2FA4A 3I69A 1PRXA 2CV4A 4YQVA 4Z7XA 2B5YA 4YH2A 5COHA 5E4WA 1K3LA 3K8NA 5DAKB 1SYRA 1A23A 5IMAA 2ZNMA 4YAVA 2AUVA 4YQUA 1OKDA 1VGLA 3VI5A 3GKKA 4WXTA 10GSA 1FVKA 1OE7A 4L5OA 1VF2A 3ZMKA 3KMNA 1G0TA 3TOUA 2CVKA 5DJLA 5ELGA 4XS1A 3MNGA 2I81A 2GSQA 2MBTA 4I97A 4ACSA 3L9UA 2DJ3A 4MJCA 5H5QA 2DIZA 1EZKA 4K8MA 1E6BA 1FB0A 1OC3A 2NVLA 3P2AA 4MCUA 1QGVA 4KCEA 2REMA 5LCZA 3KH9A 2ALBA 1K0BA 2WRTA 2OE0A 1V2AA 2R3XA 1Z7RA 4YQMA 2H0IA 1YF0A 2CZ3A 2JACA 5DCHA 3KEBA 3LGCA 2LQQA 4MF5A 3DWVA 1X5CA 4ECJA 3G7JA 4X1UA 5KEJA 2KLXA 3VPQA 3CXGA 4MP4A 1Z6MA 5G31A 3US3A 3VWWA 1Z5YE 3G9BA 4TXVA 2LKUA 3L9VA 3IC4A 3LXTA 3UVTA 3V1WA 1KEBA 3Q19A 2IMKA 3BCKA 3ZZXA 2NDOA 3TJFA 2H19A 3HVVA 3VPTA 3ZFBA 3PINA 3WGDA 4FH8A 2VL2C 1AAZA 2LJAA 3KH7A 4TOPA 1PL2A 4V2NA 1FVJA 4EKZA 4PURA 3IE3A 4BWSA 4ZIJA 2OE1A 1F3AA 3EE2A 4ZILA 4KDYA 3L4NA 2J23A 4EO3A 2EC4A 2F9SA 1SL2B 2ES7A 1AQVA 5IOWA 18GSA 5G2ZA 1RK4A 1R7HA 4LMWA 3MSZA 1MDKA 2B5EA 5DCGA 1DE1A 3G7YA 5JCUA 3QMXA 2X99A 2DJJA 2YCDA 1M9BA 3FZ9A 2H70A 2C1YA 3EMXA 5D93A 3HJPA 1MD4A 1R26A 2C4JA 4IP6A 1J9BA 3ZREA 3TB2A 2C3NA 1J08A 1GLPA 2GSRA 3CTFA 5H5RA 1EV9A 2VL2A 1TK8B 1WIKA 3DVXA 4ECBA 2YZHA 1U87A 1X5DA 3F6DA 3HJOA 3ME8A 4DEJA 2L5LA 5HR3A 3GKNA 3UARA 4PQIA 3KTLA 5J41A 2FHEA 4K1FA 3I9V2 1JHBA 2VOCA 4BL7A 1S3AA 1WMJA 4PGTA 1N2AA 2PMTA 2WZ9A 2K8SA 3IBHA 5JCGA 4IVFA 2PN8A 4MMMA 1BYEA 2V1MA 4F03A 3E9JB 1HYUA 4KSOA 1GSEA 1VF4A 2MMZA 2YZUA 1SJIA 3J7Yk 3DGQA 3A2VA 2H76A 5HR0A 4DSQA 1GTAA 3QFAC 1NM3A 4BVYA 2C80A 2F8AA 5A4WA 4LL4B 1PGTA 4P3YB 3DYRA 4MPFA 3GV1A 3U6VA 17GSA 2HNLA 1OC8A 2L6CA 5LD0A 3GIXA 4FIWA 1OAZA 4HQSA 1PSQA 4N0ZA 3TKSC 2IL3A 1K3OA 1XWCA 1XIYA 2IPAA 4ZB8A 5CNWA 4NAXA 3BOAA 2HFDA 2R2JA 2JSZA 2LRTA 4PX1A 1T00A 1SU9A 4GSTA 3H1NA 3KIJA 3M3MA 5IO2A 3GN3A 2DBCA 4K7IA 2YV9A 3L0HA 1E2YA 1ST9A 3VLNA 3CSHA 2YP6A 4HJMA 3I43A 2WFCA 1ERVA 1BQ7A 1K0AA 2AAWA 2H0HA 2H6ZA 2HSHA 2B7JA 2EIOA 4RQRA 2HRFA 4FYCA 1A0RP 4GSSA 1ZYEA 4BPYA 2V32A 2GTUA 2CAQA 2LRCA 2PVQA 2N5AA 14GSA 4KNDA 2VD0A 3TKSE 4KB3A 3TKSA 1ZOFA 4MJAA 5CRHA 2OBIA 1GTUA 2JL4A 1TOFA 2J9HA 1M9AA 3F4RA 1M99A 3FY7A 3S9FA 4XS4A 4TXOB 1XWAA 3ISOA 8GSSA 2OJLA 3KD0A 2GZZA 2HXKA 4PXOA 5J4UA 3EYTA 2A4VA 2PVOC 3H8QA 3RPNA 4XCSA 3F9UA 2X64A 1BAYA 1KTEA 1XWKA 2XPEA 3GKMA 1W4VA 1ABAA 1XW9A 3M0FA 1TJDA 5DDLA 2A2RA 1XPVA 5EY6A 2E2GA 1V40A 4JU5A 1PX7A 3LYPA 5F05A 1U3AA 2H71A 3HVXA 1HQOA 2CVDA 3HHVA 2LSTA 1H4OA 2AB6A 4MZBA 3A3TA 3TKRA 2VCQA 4HJ2A 3RAZA 2LTKA 4K7OA 4WBJA 9GSSA 3TRXA 1W89A 1AW9A 4ULXA 5DALA 3GH9A 5ECOB 5ECRB 4GCIA 2BTOT 3BD2A 1GH2A 4EDZA 5GSSA 2ON7A 3BBYA 3ZL5A 2H1BA 4GRFA 2L6DA 4L5LA 4N11A 1G6WA 3WD6A 3RPPA 2RLIA 4J57E 2RM5A 1B9XC 2VL3A 1SKWB 3ED3A 1T7PB 4ML1A 2YV7A 4ZXGA 1B9YC 3IAS2 2O7KA 2WB9A 3VK9A 2H1AA 1HD2A 5AN1A 1URMA 2RIIA 2OACA 5J3RA 4TW5A 2E2MA 3LJRA 5D9TA 3F0IA 4F82A 2H6XA 1GSDA 5IMZA 4V2MA 5DVBA 4JBBA 2VUPA 4IQAA 1VF1A 1SJZA 1TDIA 22GSA 5ECLB 4JR6A 2DMLA 5G30A 1G6YA 3FR3A 3KGKA 2LNSA 4WBRD 2C8UA 5IPGA 2JZRA 5IPHA 3M9KA 3IK9A 1EP8A 4MJBA 1U88A 4KW6A 3UJ1A 2K8VA 2FWGA 1K0OA 3O6TA 4N0VA 4ZBDA 1GL8A 4KH7A 2VM2A 2I1UA 3UBLA 2LEGA 3I6AA 4IJIA 1YDKA 3E0UA 3ZYWA 4E8EA 5GZZB 1XBSA 1YEPA 2X8GA 3M8NA 3DD3A 2HZEA 2CQ9A 1T1VA 2KP1A 4X0XA 3R2QA 3GURA 2X8HA 2LQOA 2H30A 3ZVJA 4O92A 2CZ2A 1OC9A 4O5RA 1X9WB 1ZGNA 2JZSA 4MPGA 2YWOA 2OE3A 3EVIA 2L4QA 2VAFA 2L57A 4KDUA 1IYHA 2DLXA 3IR4A 3EMPA 1A2JA 2WULA 4K9ZA 2JADA 1Q4JA 4HU7A 3ZVJD 2HE3A 3WGEA 4LMVA 2FLSA 1PL1A 1SK2A 1ERWA 2PU9C 5IIZA 4TKYA 3TUEA 3ZMLA 1Z7PA 5B7CA 3ERGA 1O6JA 1SJ6A 2HZFA 4D73A 2B7KA 4XTSA 2MBSA 2C3QA 2M80A 1XVQA 3GA4A 5HQPA 3IDVA 4KCAA 4TXOA 4HI7A 1U3IA 3LG6A 4ECCA 1S3CA 4LLRA 1K0DA 4KX4A 4KE3A 4IKHA 2NBSA 1YEXA 1SK1A 2V6OA 3F3RA 1JFUA 2MMNA 1THOA 2H8LA 1LJRA 1FAAA 3UBKA 3KCMA 1QK8A 3GL5A 1XVWA 2IIYA 4HZ2A 3HZ4A 2R5GA 4PQHA 3D22A 2XBIA 3QOUA 1WOUA 5ECKB 4POBA 4Q5RA 2GZYA 4ID0A 4XS4B 3DEXA 1F6MC 2I9HA 3KTBA 2GVPA 3IV4A 3CSJA 1ON4A 1FW1A 3PR8A 2LNTA 5IOXA 3F4SA 4WETA 2B1KA 1SD8A 4TR4A 1C72A 1AUCA 1V9WA 2GGTA 3F4TA 1OVNA 1TXXA 2FWFA 1O81A 1GRXA 1CQGA 3F6FA 1TRSA 4WEYA 1JZRA 3KMOA 1BG5A 1H75A 3D5JA 3C1SA 5JCWA 2AHEA 1GULA 1OYJA 5G1KA 4KUNA 1K0CA 1ERUA 3ERFA 4DSSA 2YWNA 1PQNA 2NTOA 2AYTA 5IMFA 2GT6A 3KM6A 3FYGA 2VO4A 4AF2A 3RHCA 5DALB 3WYWA 4EC0A 5FT3A 1XFLA 3LFLA 1GWCA 1MEKA 3HXSA 2DJ0A 6GSSA 1EOHA 1A8YA 4L8EA 3GNJA 4MZWA 2H73A 1B4PA 4MA9A 5KN1A 1VRSD 5D9XA 1ZYQB 4BWQA 2FWEA 1AXDA 1WJKA 2YJHA 4WF4A 3WT2A 2B1LA 4MLYA 1XW5A 1YQ1A 3ERWA 3TRPA 5J9BA 1JLWA 4DSRA 1GSFA 2CVBA 2V6KA 2ZUPA 2XBQA 2B5XA 4WR4A 3TRQA 2V2GA 2OADA 5JWRB 2VM1A 5IM9A 5G5FA 5LNKe 3QCPA 4WR5A 1AC1A 3TOTA 5HR2A 2H0GA 2O87A 2IMIA 3M9JA 19GSA 3BJ5A 1XOBA 1USBA 1TW9A 1SENA 2FY6A 2R4VA 4OCEA 2RUEA 4OFMA 5D8IA 5B8AA 3L78A 3L9SA 4OMVA 3FHKA 1F9MA 1PMTA 2FUG2 2LJRA 4ECIA 2C0FA 1GNEA 2TIRA 2DJ1A 3FEUA 4V2LA 4IW9A 4K6XA 1T8EB 2YN1A 1ERTA 4MJEA 2HSYA 4GSNA 4JR4A 1QFNA 1THXA 1GSUA 1XZOA 4K2DA 4DVCA 2C0DA 2C3TA 2QGVA 1OE8A 4POMA 2HZEB 4ZBAA 3CSIA 3P8WA 5L71A 4QL9A 2WJUA 2FGXA 3IXRA 1MD3A 3QD9A 1O8WA 2M46A 3GSSA 1OC9B 6GSWA 2LJKA 5ECQB 2I4AA 4FO5A 1RQMA 1M2AA 3FR9A 4I5QA 1PD21 3Q18A 4GWRA 2B3SA 4IGJA 2HT9A 5DJMA 3D6IA 1N8JA 1UA5A 4HZ4A 2H72A 4NHZA 5D96A 2VCXA 3E3EA 4QL7A 1GUMA 4LL1B 1TTZA 4PNFA 3W8JA 3CYNA 1ILOA 3EU3A 5KN2A 5CRGA 4D73B 1XWBA 2TRCP 1R4WA 3GFKA 3FR6A 5DQSA 3TJBA 3QPMA 3LWAA 4POKA 4LA1A 3KJYA 1F2EA 1V57A 4MDCA 1G7EA 2VD1A 4XS6A 1S3DA 4ILFA 1XW6A 1M2DA 3HY2A 2GDRA 2G2QA 4NXIA 3HKRA 2MZCA 5CRWA 1TRVA 1LBKA 1Z3EA 3UL3A 5CAXA 1AIUA 4HUAA 2D2ZA 4EE0A 2FNOA 2GQLA 2WCIA 3EC3A 2H1GA 6GSTA 1YKAA 2GSTA 3LEFA 4K0NA 3IK7A 1EWXA 3C71A 4V1Ap 4QQ7A 6GSXA 3D21A 1DE2A 2GLRA 3TCOA 2YPMA 3TKPA 4IP1A 5B6NA 3J7Yb 3LSZA 3KP8A 1B4QA 2KUCA 1T4ZA 3TGZA 4BVXA 3F3QA 2WGRA 4G19A 1GP1A 1NSWA 4F0CA 2XC2A 4TR1A 3W6GA 2V41A 4GLTA 1PX6A 4EDYA 1Y6EA
chains in the Genus database with same CATH superfamily
1XCCA 1ZL9A 1PN9A 2H75A 2N5BA 2YJ7A 2IMDA 3IPZA 3LXZA 1J0FA 2KP2A 4YKGA 4KF9A 4DSSB 3HD5A 4Q5QA 1EGRA 1K3YA 4IQ1A 4MH2A 2P5RA 1ZMAA 2F3MA 4G10A 1WE0A 3HA9A 1TKDB 4HDEA 4N10A 1GNWA 3KP9A 4XHMA 5ID2B 2KHPA 4EL1A 4EXJA 5KOWA 4KAEA 1IYIA 1VF3A 2QKEA 1FHEA 3FZ4A 4RI7A 5IMCA 7GSSA 5B6MA 4L0UA 3VWXA 4HS1A 1AQXA 2IMFA 2R6KA 3GTUB 2DSAA 1SL1B 2P5QA 1SK0A 5JWOB 1PN0A 4G0IA 5G1LA 3GL3A 4OD7A 1GTIA 3H93A 2VLUA 3MWHA 3VWVA 4FYUA 3ZIVA 4OWYA 1TK0B 3FZAA 5ENUA 2BJXA 2E7PA 3CTGA 3FMWA 4PUAA 4I6XA 1K0MA 1QMVA 4E8HA 4K7NA 1O73A 4RUVA 1PKZA 5BRTA 1MTCA 3HCZA 3NOFA 3ZLPA 3QAGA 1EGOA 2MMOA 1SD9A 1ZYNA 3FKFA 3Q74A 1SKRB 1A2MA 5HR1A 4POLA 3N9JA 2DJKA 1OKTA 4RI6A 2DC5A 3IC8A 2OBKA 5ABRA 3GX8A 5KN3A 1O85A 4BA7A 1X9SB 4IHUA 4Q5FA 1JZDA 2WS2A 2VIMA 16GSA 5CREA 5ELAA 4J2FA 3TJGA 2CT6A 2K18A 1NW2A 2MYGA 2H74A 2A4HA 2WDUA 2TRXA 4AGSA 5INYA 3C73A 4O5UA 4ZB9A 2YOIA 5AIVA 4F9ZA 2OKAA 1ML6A 4Z2RA 3GRXA 3UVHA 13GSA 1F3BA 3A2XA 2IWTA 3AY8A 3U5RE 4GF0A 5F06A 3G7IA 4CDOA 4O7HA 4IELA 5FWGA 2PPTA 1DUGA 3N5OA 2CA8A 2C0EA 3MAKA 3HYPA 4KDXA 2QC7A 1F37A 3PGTA 4KA0A 1WP0A 5A4VA 3A5WA 2CAIA 4CHSA 4WF5A 12GSA 3UEMA 4MK3A 1JZOA 3LORA 4YKFA 3SWLA 2ON5A 5GAPD 3EWLA 1B48A 3O76A 5KN0A 4OFTA 2JZTA 5C00A 3ZITA 1T4YA 11GSA 2I3YA 1DBYA 2YWIA 3OR5A 1WRYA 3DKSA 3H4KA 4K0GA 4Z2TA 1K0NA 2FD3A 2PUKC 1M2BA 4MZCA 1EEJA 1HNAA 3HZ8A 4FYBA 2FWHA 3VI7A 2BMXA 2VLTA 1BJXA 2A2SA 2RM6A 5FHIA 3GKXA 2YANA 5ECHB 3ZFLA 2H1DA 1ACVA 2CX3A 1FOVA 5AGYA 2F51A 5GSTA 4JZQA 1GTBA 1MDJA 3TJKA 4WKWA 1EOGA 4OFNA 1SYXA 3IRAA 1TI3A 3CMIA 3GUSA 1ZZYA 2JU5A 3O3TA 1O8XA 4BVXB 1M3JA 5C04A 3LYKA 4X43A 3FK8A 5GAND 2L4CA 4MF7A 4TR1B 2GZPA 3RBTA 1I5GA 3QAVA 2KOKA 5ECMB 1UN2A 4EIPA 4IS0A 3CRUA 1TRUA 4RQXA 2IJYA 3DRNA 3D0ZA 3A2WA 4XIHA 3VWUA 5AIXA 5ID2A 2YWMA 3M1GA 2GQKA 4OCFA 5ECPB 3VURA 5AISA 1YF1A 2EIRA 3WT1A 2K9FA 1FB6A 2NPBA 2IFQA 4NWYA 5CO3A 1A24A 5ECNB 3GX0A 4JE1A 3DIEA 1Z9HA 4ZL9A 5ECIB 5HFKA 3GTUA 3PH9A 2EIQA 1GLQA 2HI7A 2AV4A 4XRDA 4ZL8A 3IAM2 3MDKA 3QAWA 1GUKA 1GSSA 3ZTLA 4GTUA 4AJ8A 2O8VB 5E59A 1X5EA 2YNXA 1HNCA 2R37A 3QDNA 1B8XA 2E0QA 2Z9SA 4NHWA 2FCHA 4YAPA 5EVOA 2P0GA 2O85A 3SBCA 4I2TA 3UAPA 4IN0A 4EF0A 4GQFA 3GH6A 5HFGA 1BEDA 5DAKA 1EP7A 4J56E 1QUWA 3DMLA 2DJ2A 3IHQA 1WWJA 4KGIA 1AQWA 4G9HA 2MMAA 4MNNA 5JWQB 1TI1A 3KXOA 3QR6A 4TVEA 5A5KA 1JLVA 2F8FA 4HQZA 4PQ1A 3P90A 5CP1A 1JZWA 5H5SA 3EPTA 5F8BA 2VCZA 4G0LA 5IMVA 4JRRA 1TRWA 1RW1A 1SKSB 2VCVA 2CX4A 3EU4A 1EEMA 2XHFA 3VFIA 3HDCA 1QQ2A 3GSTA 1M0UA 3C1RA 4OO4A 2DMMA 1YJ6A 5D9WA 5A4UA 2O89A 3JCML 5DQYA 3TKQA 2IN3A 1ZCPA 3ZRDA 4XRAA 1TK5B 2X8CA 2PERA 2K6VA 3HJMA 3P7XA 4TR0A 1XOAA 2HRNA 2PGTA 1M7TA 1GUHA 4F2IA 4EIQA 5F07A 1YY7A 2ZCTA 4O32A 4IBPA 3RHBA 1PA3A 1LU4A 1A2LA 2XPDA 4K5SA 3LQ7A 3RDWA 1X9MB 3GYKA 3TJJA 4CW9A 3NZNA 2HLSA 5CRDA 3WGXA 2IMEA 4I2UA 1TU8A 3DXBA 1PFOA 5IO0A 1A8LA 2HRAA 4ISDA 2FA8A 2H01A 4N30A 2L59A 2GQMA 4TR3A 1V98A 4L0WA 2AJQB 1BX9A 4ZBBA 3BCIA 5D9VA 20GSA 3FW2A 1R5PA 4G0KA 3UIWA 4NPBA 1Q98A 3HVSA 4TN8A 3D4TA 1PKWA 2JSYA 5ECSA 1FOHA 4G2EA 4NV2A 5F0GA 2VCWA 4USSA 2M72A 3APQA 4Q5NA 1R5AA 4K5RA 1YKCA 2LRNA 3EURA 2L5OA 4HU9A 1I9DA 2N5FA 4MH3A 4AJ7A 3IA1A 4KSMA 1A0FA 5IMDA 1UC7A 2GSSA 3EINA 5J5NA 1XWGA 4PNGA 1NHOA 2G0FA 1GSYA 4O5QA 1KBNA 5CYYA 3IHGA 4ZB6A 2LUSA 6GSVA 4HEA2 4ZL7A 3QFBC 4HOJA 5IQYA 3H79A 1G7OA 3GMFA 4PUFC 1KNGA 1QXHA 1HNBA 5D73A 4ML6A 1MDIA 2DIYA 3CRTA 3FZ5A 1UVZA 4H86A 1Z6NA 1U6TA 1T3BA 4F0BA 1FG4A 3C7MA 3C8EA 4GQCA 3DVWA 3W8SA 3ZIJA 6GSYA 2OA7A 5KOXA 2HYXA 3ME7A 3TDGA 1TP9A 6GSUA 1XXUA 4GXZA 1DSBA 3CBUA 5EL8A 2H66A 2X49A 1NHYA 2PWJA 3D4MA 3KZQA 2VLVA 4TRXA 1GSQA 4NV5A 2P31A 5DBQA 3FRCA 1SL0B 1TU7A 3APOA 1EV4A 2C0GA 1CQHA 2LV3A 1V58A 2IFQB 4EVMA 2GT5A 5B8BA 4I8BA 2RUFA 2PBJA 1WPIA 4MF6A 2VCTA 4K2XA 4BL7B 3IOSA 4OO5A 4JEDA 1X0RA 2B6MA 3NIVA 2QSIA 3APSA 5EPFA 3UOMA 2H6YA 2HSMA 5J9CA 1Y25A 2LS5A 4IJ3A 4NMUA 2GS3A 1O7UA 3F8UA 5G5EA 3UMAA 2VL9A 3GHAA 3Q6OA 1FO5A 4MABA 3F63A 4AJ6A 4EUYA 5HFIA 4V1Ag 1YZXA 2FA4A 3I69A 1PRXA 2CV4A 4YQVA 4Z7XA 2B5YA 4YH2A 5COHA 5E4WA 1K3LA 3K8NA 4BVYB 5DAKB 1SYRA 1A23A 5IMAA 2ZNMA 4YAVA 2AUVA 4YQUA 1OKDA 1VGLA 3VI5A 3GKKA 4WXTA 10GSA 1FVKA 1OE7A 4L5OA 1VF2A 3ZMKA 3KMNA 1G0TA 3TOUA 2CVKA 5DJLA 5ELGA 4XS1A 3MNGA 3MYDA 2I81A 2GSQA 2MBTA 4I97A 4ACSA 3L9UA 2DJ3A 4MJCA 5H5QA 2DIZA 1EZKA 4K8MA 1E6BA 1FB0A 1OC3A 2NVLA 3P2AA 4MCUA 1QGVA 4KCEA 2REMA 1M3IA 5LCZA 3KH9A 2ALBA 1K0BA 2WRTA 2OE0A 1V2AA 2R3XA 1Z7RA 4YQMA 2H0IA 1YF0A 2CZ3A 2JACA 5DCHA 3KEBA 3LGCA 2LQQA 4MF5A 3DWVA 1X5CA 4ECJA 3G7JA 4X1UA 5KEJA 2KLXA 3VPQA 3CXGA 3PPUA 4MP4A 1Z6MA 5G31A 3US3A 3VWWA 1Z5YE 3G9BA 4TXVA 2LKUA 3L9VA 3IC4A 3LXTA 3UVTA 3V1WA 1KEBA 3Q19A 2IMKA 3BCKA 3ZZXA 2NDOA 3TJFA 2H19A 3HVVA 3VPTA 3ZFBA 3PINA 3WGDA 4FH8A 2VL2C 1AAZA 2LJAA 3KH7A 4TOPA 1PL2A 4V2NA 1FVJA 4EKZA 4PURA 3IE3A 4BWSA 4ZIJA 2OE1A 1F3AA 3EE2A 4ZILA 4KDYA 2QA1A 3L4NA 2J23A 4EO3A 2EC4A 2F9SA 1SL2B 2ES7A 1AQVA 5IOWA 18GSA 5G2ZA 1RK4A 1R7HA 4LMWA 3MSZA 1XG8A 1MDKA 2B5EA 5DCGA 1DE1A 3G7YA 5JCUA 3QMXA 2X99A 2DJJA 2YCDA 1M9BA 3FZ9A 2H70A 2C1YA 3EMXA 5D93A 3HJPA 1MD4A 1R26A 2C4JA 4IP6A 1J9BA 3HVNA 3ZREA 3TB2A 2C3NA 1J08A 1GLPA 2GSRA 3CTFA 5H5RA 1EV9A 2VL2A 1TK8B 1WIKA 3DVXA 4ECBA 2YZHA 1U87A 1X5DA 3F6DA 3HJOA 3ME8A 4DEJA 2L5LA 5HR3A 3GKNA 3UARA 4PQIA 3KTLA 5J41A 2FHEA 4K1FA 3I9V2 1JHBA 2VOCA 4BL7A 1S3AA 1WMJA 4PGTA 1N2AA 2PMTA 2WZ9A 2K8SA 3IBHA 5JCGA 4IVFA 2PN8A 2A2PA 4MMMA 1BYEA 2V1MA 4F03A 3E9JB 1HYUA 4KSOA 1GSEA 1VF4A 2MMZA 2YZUA 1SJIA 3J7Yk 3DGQA 3A2VA 2H76A 5HR0A 4DSQA 1GTAA 3QFAC 1NM3A 4BVYA 2C80A 2F8AA 5A4WA 4LL4B 4Z2UA 1PGTA 4P3YB 3DYRA 4MPFA 3GV1A 3U6VA 17GSA 2HNLA 1OC8A 2L6CA 5LD0A 3GIXA 4FIWA 1OAZA 4HQSA 1PSQA 4N0ZA 3TKSC 2IL3A 1K3OA 1XWCA 1XIYA 2IPAA 3R3EA 4ZB8A 5CNWA 4NAXA 3BOAA 4CY6A 2HFDA 2R2JA 2JSZA 2LRTA 4PX1A 1T00A 1SU9A 4GSTA 3H1NA 3KIJA 3M3MA 5IO2A 3GN3A 2DBCA 4K7IA 2YV9A 3L0HA 1E2YA 1ST9A 3VLNA 3CSHA 2YP6A 4HJMA 3I43A 2WFCA 1ERVA 2DKIA 1BQ7A 1K0AA 2AAWA 2H0HA 2H6ZA 2HSHA 2B7JA 2EIOA 4RQRA 2HRFA 4FYCA 1A0RP 4GSSA 1ZYEA 4BPYA 2V32A 2GTUA 2CAQA 2LRCA 2PVQA 2N5AA 14GSA 4KNDA 2VD0A 3TKSE 4KB3A 3TKSA 1ZOFA 4MJAA 5CRHA 2OBIA 1GTUA 2JL4A 1TOFA 2J9HA 1M9AA 3F4RA 1M99A 3FY7A 3S9FA 4XS4A 4TXOB 1XWAA 3ISOA 8GSSA 2OJLA 3KD0A 2GZZA 2HXKA 4PXOA 5J4UA 3EYTA 2A4VA 2PVOC 3H8QA 3RPNA 4XCSA 3F9UA 2X64A 1BAYA 1KTEA 1XWKA 2XPEA 3GKMA 1W4VA 1ABAA 1XW9A 3M0FA 1TJDA 5DDLA 2A2RA 1XPVA 5EY6A 2E2GA 1V40A 4JU5A 1PX7A 3LYPA 5F05A 1U3AA 2H71A 3HVXA 1HQOA 2CVDA 3HHVA 2LSTA 1H4OA 2AB6A 4MZBA 3A3TA 3TKRA 2VCQA 4HJ2A 3RAZA 2LTKA 4K7OA 4WBJA 9GSSA 3TRXA 1W89A 1AW9A 4ULXA 5DALA 3GH9A 5ECOB 5ECRB 2DKHA 4GCIA 2BTOT 3BD2A 1GH2A 4EDZA 5GSSA 2ON7A 3BBYA 3ZL5A 2H1BA 4GRFA 2L6DA 4L5LA 4N11A 1G6WA 3WD6A 3RPPA 2RLIA 4J57E 2RM5A 1B9XC 2VL3A 1SKWB 3ED3A 1T7PB 4ML1A 2YV7A 4ZXGA 1B9YC 3IAS2 4HSCX 2O7KA 2WB9A 3VK9A 2H1AA 1HD2A 1S3RA 5AN1A 1URMA 2RIIA 2OACA 5J3RA 4TW5A 2E2MA 3LJRA 5D9TA 3F0IA 4F82A 2H6XA 1GSDA 5IMZA 4CY8A 4V2MA 5DVBA 4JBBA 2VUPA 4IQAA 1VF1A 1SJZA 1TDIA 22GSA 5ECLB 4JR6A 2DMLA 5G30A 1G6YA 3FR3A 3KGKA 2LNSA 4WBRD 4A5PA 2C8UA 5IPGA 2JZRA 5IPHA 3M9KA 3IK9A 1EP8A 4MJBA 1U88A 4KW6A 3UJ1A 2K8VA 2FWGA 1K0OA 3O6TA 4N0VA 4ZBDA 1GL8A 4KH7A 2VM2A 2I1UA 3UBLA 2LEGA 3I6AA 4IJIA 1YDKA 3E0UA 3ZYWA 4E8EA 5GZZB 1XBSA 1YEPA 2X8GA 3M8NA 3DD3A 2HZEA 2CQ9A 1T1VA 2KP1A 4X0XA 3R2QA 3GURA 2X8HA 2LQOA 2H30A 3ZVJA 4O92A 2CZ2A 1OC9A 4O5RA 1X9WB 1ZGNA 2JZSA 4MPGA 2YWOA 2OE3A 3EVIA 2L4QA 2VAFA 2L57A 4KDUA 1IYHA 2DLXA 3IR4A 3EMPA 1A2JA 2WULA 4K9ZA 2JADA 1Q4JA 4HU7A 3ZVJD 2HE3A 3WGEA 4LMVA 2FLSA 1PL1A 1SK2A 1ERWA 2PU9C 5IIZA 4TKYA 3TUEA 3ZMLA 1Z7PA 5B7CA 3ERGA 1O6JA 1SJ6A 2HZFA 4D73A 2B7KA 4XTSA 2MBSA 2C3QA 2M80A 1XVQA 3GA4A 5HQPA 3IDVA 4KCAA 4TXOA 2UZ8A 4HI7A 1U3IA 3LG6A 4ECCA 1S3CA 4LLRA 1K0DA 4KX4A 4KE3A 4IKHA 2NBSA 1YEXA 1SK1A 2V6OA 3F3RA 1JFUA 2MMNA 1THOA 2H8LA 1LJRA 1FAAA 3UBKA 4ICYA 3KCMA 1QK8A 3GL5A 1XVWA 2IIYA 4HZ2A 3HZ4A 2R5GA 4PQHA 3D22A 2XBIA 3QOUA 1WOUA 5ECKB 4POBA 4Q5RA 2GZYA 4ID0A 4XS4B 3DEXA 1F6MC 2I9HA 3KTBA 2GVPA 3IV4A 3CSJA 1ON4A 1FW1A 3PR8A 2LNTA 5IOXA 3F4SA 4WETA 2B1KA 1SD8A 4TR4A 1C72A 1AUCA 1V9WA 2GGTA 3F4TA 1OVNA 1TXXA 2FWFA 1O81A 1GRXA 1CQGA 3F6FA 1TRSA 4WEYA 2QA2A 1JZRA 3KMOA 1BG5A 1H75A 3D5JA 3C1SA 5JCWA 2AHEA 1GULA 1OYJA 5G1KA 4KUNA 1K0CA 1ERUA 3ERFA 4DSSA 2YWNA 1PQNA 2NTOA 2AYTA 5IMFA 2GT6A 3KM6A 3FYGA 2VO4A 4AF2A 3RHCA 5DALB 3WYWA 4EC0A 5FT3A 1XFLA 3LFLA 1GWCA 1MEKA 3HXSA 2DJ0A 4FQUA 6GSSA 1EOHA 1A8YA 4L8EA 3GNJA 4MZWA 2H73A 1B4PA 4MA9A 5KN1A 1VRSD 5D9XA 1ZYQB 4BWQA 2FWEA 1AXDA 1WJKA 2YJHA 4WF4A 3WT2A 2B1LA 4MLYA 1XW5A 1YQ1A 3ERWA 5BMUA 3TRPA 5J9BA 1JLWA 4DSRA 1GSFA 2CVBA 4PTSA 2V6KA 3A5IA 2R0GA 2XBQA 2B5XA 2ZUPA 4WR4A 3TRQA 2V2GA 2OADA 5JWRB 2VM1A 5IM9A 5G5FA 5LNKe 3QCPA 4WR5A 1AC1A 3TOTA 5HR2A 2H0GA 2O87A 2IMIA 3M9JA 19GSA 3BJ5A 1XOBA 1USBA 1TW9A 1SENA 2FY6A 4BIKA 2R4VA 2R0CA 4OCEA 2RUEA 4OFMA 5D8IA 5B8AA 3L78A 3L9SA 4OMVA 3FHKA 1F9MA 1PMTA 2FUG2 2LJRA 4ECIA 2C0FA 1GNEA 2TIRA 2DJ1A 3FEUA 4V2LA 4IW9A 4K6XA 1T8EB 2YN1A 1ERTA 4MJEA 2HSYA 4GSNA 4JR4A 1QFNA 1THXA 1GSUA 1XZOA 4K2DA 4DVCA 3LW9A 2C0DA 2C3TA 2QGVA 1OE8A 4POMA 2HZEB 4ZBAA 3CSIA 3P8WA 5L71A 4QL9A 2WJUA 2FGXA 3IXRA 1MD3A 3QD9A 1O8WA 1ZYPA 2M46A 3GSSA 1OC9B 6GSWA 2LJKA 5ECQB 2I4AA 4FO5A 1RQMA 1M2AA 3FR9A 4I5QA 1PD21 3Q18A 4GWRA 2B3SA 4IGJA 2HT9A 5DJMA 3D6IA 1N8JA 1UA5A 4HZ4A 2H72A 4NHZA 5D96A 2VCXA 3E3EA 4QL7A 1GUMA 4LL1B 1TTZA 4PNFA 3W8JA 3CYNA 1ILOA 3EU3A 5KN2A 5CRGA 4D73B 1XWBA 2TRCP 1R4WA 3GFKA 3FR6A 5DQSA 2R0PA 3TJBA 3QPMA 3LWAA 4POKA 4LA1A 3KJYA 1F2EA 1V57A 4MDCA 1G7EA 2VD1A 4XS6A 1S3DA 3CQFA 4ILFA 1XW6A 1M2DA 3HY2A 2GDRA 2G2QA 4NXIA 3HKRA 2MZCA 5CRWA 1TRVA 1LBKA 2HRKA 1Z3EA 3UL3A 5CAXA 1AIUA 4HUAA 2D2ZA 4EE0A 2FNOA 2GQLA 2WCIA 3EC3A 2X4AA 2H1GA 6GSTA 1YKAA 2GSTA 3LEFA 4K0NA 3IK7A 1EWXA 3C71A 4V1Ap 4QQ7A 6GSXA 3D21A 1DE2A 2GLRA 3TCOA 2YPMA 3TKPA 4IP1A 5B6NA 4X4JA 3J7Yb 3LSZA 3KP8A 1B4QA 2KUCA 1T4ZA 3TGZA 4BVXA 3F3QA 2WGRA 4G19A 1GP1A 1NSWA 4F0CA 2XC2A 3MIXA 4TR1A 3W6GA 2V41A 4GLTA 1PX6A 4EDYA 1Y6EA
chains in the Genus database with same CATH topology
1XCCA 1ZL9A 1PN9A 2H75A 2N5BA 2YJ7A 2IMDA 3IPZA 3LXZA 1J0FA 2KP2A 4YKGA 4KF9A 4DSSB 3HD5A 4Q5QA 1EGRA 1K3YA 4IQ1A 4MH2A 2P5RA 1ZMAA 2F3MA 4G10A 1WE0A 3HA9A 1TKDB 4HDEA 4N10A 1GNWA 3KP9A 4XHMA 5ID2B 2KHPA 4EL1A 4EXJA 5KOWA 4KAEA 1IYIA 1VF3A 2QKEA 1FHEA 3FZ4A 4RI7A 5IMCA 7GSSA 5B6MA 4L0UA 3VWXA 4HS1A 1AQXA 2IMFA 2R6KA 3GTUB 2DSAA 1SL1B 2P5QA 1SK0A 5JWOB 1PN0A 4G0IA 5G1LA 3GL3A 4OD7A 1GTIA 3H93A 2VLUA 3MWHA 3VWVA 4FYUA 3ZIVA 4OWYA 1TK0B 3FZAA 5ENUA 2BJXA 2E7PA 3CTGA 3FMWA 4PUAA 4I6XA 1K0MA 1QMVA 4E8HA 4K7NA 1O73A 4RUVA 1PKZA 5BRTA 1MTCA 3HCZA 3NOFA 3ZLPA 3QAGA 1EGOA 2MMOA 1SD9A 1ZYNA 3FKFA 3Q74A 1SKRB 1A2MA 5HR1A 4POLA 3N9JA 2DJKA 1OKTA 4RI6A 2DC5A 3IC8A 2OBKA 5ABRA 3GX8A 5KN3A 1O85A 4BA7A 1X9SB 4IHUA 4Q5FA 1JZDA 2WS2A 2VIMA 16GSA 5CREA 5ELAA 4J2FA 3TJGA 2CT6A 2K18A 1NW2A 2MYGA 2H74A 2A4HA 2WDUA 2TRXA 4AGSA 5INYA 3C73A 4O5UA 4ZB9A 2YOIA 5AIVA 4F9ZA 2OKAA 1ML6A 4Z2RA 3GRXA 3UVHA 13GSA 1F3BA 3A2XA 2IWTA 3AY8A 3U5RE 4GF0A 5F06A 3G7IA 4CDOA 4O7HA 4IELA 5FWGA 2PPTA 1DUGA 3N5OA 2CA8A 2C0EA 3MAKA 3HYPA 4KDXA 2QC7A 1F37A 3PGTA 4KA0A 1WP0A 5A4VA 3A5WA 2CAIA 4CHSA 4WF5A 12GSA 3UEMA 4MK3A 1JZOA 3LORA 4YKFA 3SWLA 2ON5A 5GAPD 3EWLA 1B48A 3O76A 5KN0A 4OFTA 2JZTA 5C00A 3ZITA 1T4YA 11GSA 2I3YA 1DBYA 2YWIA 3OR5A 1WRYA 3DKSA 3H4KA 4K0GA 4Z2TA 1K0NA 2FD3A 2PUKC 1M2BA 4MZCA 1EEJA 1HNAA 3HZ8A 4FYBA 2FWHA 3VI7A 2BMXA 2VLTA 1BJXA 2A2SA 2RM6A 5FHIA 3GKXA 2YANA 5ECHB 3ZFLA 2H1DA 1ACVA 2CX3A 1FOVA 5AGYA 2F51A 5GSTA 4JZQA 1GTBA 1MDJA 3TJKA 4WKWA 1EOGA 4OFNA 1SYXA 3IRAA 1TI3A 3CMIA 3GUSA 1ZZYA 2JU5A 3O3TA 1O8XA 4BVXB 5C04A 3LYKA 4X43A 3FK8A 5GAND 2L4CA 4MF7A 4TR1B 2GZPA 3RBTA 1I5GA 3QAVA 2KOKA 5ECMB 1UN2A 4EIPA 4IS0A 3CRUA 1TRUA 4RQXA 2IJYA 3DRNA 3D0ZA 3A2WA 4XIHA 3VWUA 5AIXA 5ID2A 2YWMA 3M1GA 2GQKA 4OCFA 5ECPB 3VURA 5AISA 1YF1A 2EIRA 3WT1A 2K9FA 1FB6A 2NPBA 2IFQA 4NWYA 5CO3A 1A24A 5ECNB 3GX0A 4JE1A 3DIEA 1Z9HA 4ZL9A 5ECIB 5HFKA 3GTUA 3PH9A 2EIQA 1GLQA 2HI7A 2AV4A 4XRDA 4ZL8A 3IAM2 3MDKA 3QAWA 1GUKA 1GSSA 3ZTLA 4GTUA 4AJ8A 2O8VB 5E59A 1X5EA 2YNXA 1HNCA 2R37A 3QDNA 1B8XA 2E0QA 2Z9SA 4NHWA 2FCHA 4YAPA 5EVOA 2P0GA 2O85A 3SBCA 4I2TA 3UAPA 4IN0A 4EF0A 4GQFA 3GH6A 5HFGA 1BEDA 5DAKA 1EP7A 4J56E 1QUWA 3DMLA 2DJ2A 3IHQA 1WWJA 4KGIA 1AQWA 4G9HA 2MMAA 4MNNA 5JWQB 1TI1A 3KXOA 3QR6A 4TVEA 5A5KA 1JLVA 2F8FA 4HQZA 4PQ1A 3P90A 5CP1A 1JZWA 5H5SA 3EPTA 5F8BA 2VCZA 4G0LA 5IMVA 4JRRA 1TRWA 1RW1A 1SKSB 2VCVA 2CX4A 3EU4A 1EEMA 2XHFA 3VFIA 3HDCA 1QQ2A 3GSTA 1M0UA 3C1RA 4OO4A 2DMMA 1YJ6A 5D9WA 5A4UA 2O89A 3JCML 5DQYA 3TKQA 2IN3A 1ZCPA 3ZRDA 4XRAA 1TK5B 2X8CA 2PERA 2K6VA 3HJMA 3P7XA 4TR0A 1XOAA 2HRNA 2PGTA 1M7TA 1GUHA 4F2IA 4EIQA 5F07A 1YY7A 2ZCTA 4O32A 4IBPA 3RHBA 1PA3A 1LU4A 1A2LA 2XPDA 4K5SA 3LQ7A 3RDWA 1X9MB 3GYKA 3TJJA 4CW9A 3NZNA 2HLSA 5CRDA 3WGXA 2IMEA 4I2UA 1TU8A 3DXBA 5IO0A 1A8LA 2HRAA 4ISDA 2FA8A 2H01A 4N30A 2L59A 2GQMA 4TR3A 1V98A 4L0WA 2AJQB 1BX9A 4ZBBA 3BCIA 5D9VA 20GSA 3FW2A 1R5PA 4G0KA 3UIWA 4NPBA 1Q98A 3HVSA 4TN8A 3D4TA 1PKWA 2JSYA 5ECSA 1FOHA 4G2EA 4NV2A 5F0GA 2VCWA 4USSA 2M72A 3APQA 4Q5NA 1R5AA 4K5RA 1YKCA 2LRNA 3EURA 2L5OA 4HU9A 1I9DA 2N5FA 4MH3A 4AJ7A 3IA1A 4KSMA 1A0FA 5IMDA 1UC7A 2GSSA 3EINA 5J5NA 1XWGA 4PNGA 1NHOA 2G0FA 1GSYA 4O5QA 1KBNA 5CYYA 3IHGA 4ZB6A 2LUSA 6GSVA 4HEA2 4ZL7A 3QFBC 4HOJA 5IQYA 3H79A 1G7OA 3GMFA 4PUFC 1KNGA 1QXHA 1HNBA 5D73A 4ML6A 1MDIA 2DIYA 3CRTA 3FZ5A 1UVZA 4H86A 1Z6NA 1U6TA 1T3BA 4F0BA 1FG4A 3C7MA 3C8EA 4GQCA 3DVWA 3W8SA 3ZIJA 6GSYA 2OA7A 5KOXA 2HYXA 3ME7A 3TDGA 1TP9A 6GSUA 1XXUA 4GXZA 1DSBA 3CBUA 5EL8A 2H66A 2X49A 1NHYA 2PWJA 3D4MA 3KZQA 2VLVA 4TRXA 1GSQA 4NV5A 2P31A 5DBQA 3FRCA 1SL0B 1TU7A 3APOA 1EV4A 2C0GA 1CQHA 2LV3A 1V58A 2IFQB 4EVMA 2GT5A 5B8BA 4I8BA 2RUFA 2PBJA 1WPIA 4MF6A 2VCTA 4K2XA 4BL7B 3IOSA 4OO5A 4JEDA 1X0RA 2B6MA 3NIVA 2QSIA 3APSA 5EPFA 3UOMA 2H6YA 2HSMA 5J9CA 1Y25A 2LS5A 4IJ3A 4NMUA 2GS3A 1O7UA 3F8UA 5G5EA 3UMAA 2VL9A 3GHAA 3Q6OA 1FO5A 4MABA 3F63A 4AJ6A 4EUYA 5HFIA 4V1Ag 1YZXA 2FA4A 3I69A 1PRXA 2CV4A 4YQVA 4Z7XA 2B5YA 4YH2A 5COHA 5E4WA 1K3LA 3K8NA 4BVYB 5DAKB 1SYRA 1A23A 5IMAA 2ZNMA 4YAVA 2AUVA 4YQUA 1OKDA 1VGLA 3VI5A 3GKKA 4WXTA 10GSA 1FVKA 1OE7A 4L5OA 1VF2A 3ZMKA 3KMNA 1G0TA 3TOUA 2CVKA 5DJLA 5ELGA 4XS1A 3MNGA 3MYDA 2I81A 2GSQA 2MBTA 4I97A 4ACSA 3L9UA 2DJ3A 4MJCA 5H5QA 2DIZA 1EZKA 4K8MA 1E6BA 1FB0A 1OC3A 2NVLA 3P2AA 4MCUA 1QGVA 4KCEA 2REMA 5LCZA 3KH9A 2ALBA 1K0BA 2WRTA 2OE0A 1V2AA 2R3XA 1Z7RA 4YQMA 2H0IA 1YF0A 2CZ3A 2JACA 5DCHA 3KEBA 3LGCA 2LQQA 4MF5A 3DWVA 1X5CA 4ECJA 3G7JA 4X1UA 5KEJA 2KLXA 3VPQA 3CXGA 3PPUA 4MP4A 1Z6MA 5G31A 3US3A 3VWWA 1Z5YE 3G9BA 4TXVA 2LKUA 3L9VA 3IC4A 3LXTA 3UVTA 3V1WA 1KEBA 3Q19A 2IMKA 3BCKA 3ZZXA 2NDOA 3TJFA 2H19A 3HVVA 3VPTA 3ZFBA 3PINA 3WGDA 4FH8A 2VL2C 1AAZA 2LJAA 3KH7A 4TOPA 1PL2A 4V2NA 1FVJA 4EKZA 4PURA 3IE3A 4BWSA 4ZIJA 2OE1A 1F3AA 3EE2A 4ZILA 4KDYA 2QA1A 3L4NA 2J23A 4EO3A 2EC4A 2F9SA 1SL2B 2ES7A 1AQVA 5IOWA 18GSA 5G2ZA 1RK4A 1R7HA 4LMWA 3MSZA 1MDKA 2B5EA 5DCGA 1DE1A 3G7YA 5JCUA 3QMXA 2X99A 2DJJA 2YCDA 1M9BA 3FZ9A 2H70A 2C1YA 3EMXA 5D93A 3HJPA 1MD4A 1R26A 2C4JA 4IP6A 1J9BA 3ZREA 3TB2A 2C3NA 1J08A 1GLPA 2GSRA 3CTFA 5H5RA 1EV9A 2VL2A 1TK8B 1WIKA 3DVXA 4ECBA 2YZHA 1U87A 1X5DA 3F6DA 3HJOA 3ME8A 4DEJA 2L5LA 5HR3A 3GKNA 3UARA 4PQIA 3KTLA 5J41A 2FHEA 4K1FA 3I9V2 1JHBA 2VOCA 4BL7A 1S3AA 1WMJA 4PGTA 1N2AA 2PMTA 2WZ9A 2K8SA 3IBHA 5JCGA 4IVFA 2PN8A 2A2PA 4MMMA 1BYEA 2V1MA 4F03A 3E9JB 1HYUA 4KSOA 1GSEA 1VF4A 2MMZA 2YZUA 1SJIA 3J7Yk 3DGQA 3A2VA 2H76A 5HR0A 4DSQA 1GTAA 3QFAC 1NM3A 4BVYA 2C80A 2F8AA 5A4WA 4LL4B 4Z2UA 1PGTA 4P3YB 3DYRA 4MPFA 3GV1A 3U6VA 17GSA 2HNLA 1OC8A 2L6CA 5LD0A 3GIXA 4FIWA 1OAZA 4HQSA 1PSQA 4N0ZA 3TKSC 2IL3A 1K3OA 1XWCA 1XIYA 2IPAA 3R3EA 4ZB8A 5CNWA 4NAXA 3BOAA 4CY6A 2HFDA 2R2JA 2JSZA 2LRTA 4PX1A 1T00A 1SU9A 4GSTA 3H1NA 3KIJA 3M3MA 5IO2A 3GN3A 2DBCA 4K7IA 2YV9A 3L0HA 1E2YA 1ST9A 3VLNA 3CSHA 2YP6A 4HJMA 3I43A 2WFCA 1ERVA 2DKIA 1BQ7A 1K0AA 2AAWA 2H0HA 2H6ZA 2HSHA 2B7JA 2EIOA 4RQRA 2HRFA 4FYCA 1A0RP 4GSSA 1ZYEA 4BPYA 2V32A 2GTUA 2CAQA 2LRCA 2PVQA 2N5AA 14GSA 4KNDA 2VD0A 3TKSE 4KB3A 3TKSA 1ZOFA 4MJAA 5CRHA 2OBIA 1GTUA 2JL4A 1TOFA 2J9HA 1M9AA 3F4RA 1M99A 3FY7A 3S9FA 4XS4A 4TXOB 1XWAA 3ISOA 8GSSA 2OJLA 3KD0A 2GZZA 2HXKA 4PXOA 5J4UA 3EYTA 2A4VA 2PVOC 3H8QA 3RPNA 4XCSA 3F9UA 2X64A 1BAYA 1KTEA 1XWKA 2XPEA 3GKMA 1W4VA 1ABAA 1XW9A 3M0FA 1TJDA 5DDLA 2A2RA 1XPVA 5EY6A 2E2GA 1V40A 4JU5A 1PX7A 3LYPA 5F05A 1U3AA 2H71A 3HVXA 1HQOA 2CVDA 3HHVA 2LSTA 1H4OA 2AB6A 4MZBA 3A3TA 3TKRA 2VCQA 4HJ2A 3RAZA 2LTKA 4K7OA 4WBJA 9GSSA 3TRXA 1W89A 1AW9A 4ULXA 5DALA 3GH9A 5ECOB 5ECRB 2DKHA 4GCIA 2BTOT 3BD2A 1GH2A 4EDZA 5GSSA 2ON7A 3BBYA 3ZL5A 2H1BA 4GRFA 2L6DA 4L5LA 4N11A 1G6WA 3WD6A 3RPPA 2RLIA 4J57E 2RM5A 1B9XC 2VL3A 1SKWB 3ED3A 1T7PB 4ML1A 2YV7A 4ZXGA 1B9YC 3IAS2 2O7KA 2WB9A 3VK9A 2H1AA 1HD2A 5AN1A 1URMA 2RIIA 2OACA 5J3RA 4TW5A 2E2MA 3LJRA 5D9TA 3F0IA 4F82A 2H6XA 1GSDA 5IMZA 4CY8A 4V2MA 5DVBA 4JBBA 2VUPA 4IQAA 1VF1A 1SJZA 1TDIA 22GSA 5ECLB 4JR6A 2DMLA 5G30A 1G6YA 3FR3A 3KGKA 2LNSA 4WBRD 4A5PA 2C8UA 5IPGA 2JZRA 5IPHA 3M9KA 3IK9A 1EP8A 4MJBA 1U88A 4KW6A 3UJ1A 2K8VA 2FWGA 1K0OA 3O6TA 4N0VA 4ZBDA 1GL8A 4KH7A 2VM2A 2I1UA 3UBLA 2LEGA 3I6AA 4IJIA 1YDKA 3E0UA 3ZYWA 4E8EA 5GZZB 1XBSA 1YEPA 2X8GA 3M8NA 3DD3A 2HZEA 2CQ9A 1T1VA 2KP1A 4X0XA 3R2QA 3GURA 2X8HA 2LQOA 2H30A 3ZVJA 4O92A 2CZ2A 1OC9A 4O5RA 1X9WB 1ZGNA 2JZSA 4MPGA 2YWOA 2OE3A 3EVIA 2L4QA 2VAFA 2L57A 4KDUA 1IYHA 2DLXA 3IR4A 3EMPA 1A2JA 2WULA 4K9ZA 2JADA 1Q4JA 4HU7A 3ZVJD 2HE3A 3WGEA 4LMVA 2FLSA 1PL1A 1SK2A 1ERWA 2PU9C 5IIZA 4TKYA 3TUEA 3ZMLA 1Z7PA 5B7CA 3ERGA 1O6JA 1SJ6A 2HZFA 4D73A 2B7KA 4XTSA 2MBSA 2C3QA 2M80A 1XVQA 3GA4A 5HQPA 3IDVA 4KCAA 4TXOA 2UZ8A 4HI7A 1U3IA 3LG6A 4ECCA 1S3CA 4LLRA 1K0DA 4KX4A 4KE3A 4IKHA 2NBSA 1YEXA 1SK1A 2V6OA 3F3RA 1JFUA 2MMNA 1THOA 2H8LA 1LJRA 1FAAA 3UBKA 4ICYA 3KCMA 1QK8A 3GL5A 1XVWA 2IIYA 4HZ2A 3HZ4A 2R5GA 4PQHA 3D22A 2XBIA 3QOUA 1WOUA 5ECKB 4POBA 4Q5RA 2GZYA 4ID0A 4XS4B 3DEXA 1F6MC 2I9HA 3KTBA 2GVPA 3IV4A 3CSJA 1ON4A 1FW1A 3PR8A 2LNTA 5IOXA 3F4SA 4WETA 2B1KA 1SD8A 4TR4A 1C72A 1AUCA 1V9WA 2GGTA 3F4TA 1OVNA 1TXXA 2FWFA 1O81A 1GRXA 1CQGA 3F6FA 1TRSA 4WEYA 2QA2A 1JZRA 3KMOA 1BG5A 1H75A 3D5JA 3C1SA 5JCWA 2AHEA 1GULA 1OYJA 5G1KA 4KUNA 1K0CA 1ERUA 3ERFA 4DSSA 2YWNA 1PQNA 2NTOA 2AYTA 5IMFA 2GT6A 3KM6A 3FYGA 2VO4A 4AF2A 3RHCA 5DALB 3WYWA 4EC0A 5FT3A 1XFLA 3LFLA 1GWCA 1MEKA 3HXSA 2DJ0A 4FQUA 6GSSA 1EOHA 1A8YA 4L8EA 3GNJA 4MZWA 2H73A 1B4PA 4MA9A 5KN1A 1VRSD 5D9XA 1ZYQB 4BWQA 2FWEA 1AXDA 1WJKA 2YJHA 4WF4A 3WT2A 2B1LA 4MLYA 1XW5A 1YQ1A 3ERWA 5BMUA 3TRPA 5J9BA 1JLWA 4DSRA 1GSFA 2CVBA 4PTSA 2V6KA 3A5IA 2R0GA 2XBQA 2B5XA 2ZUPA 4WR4A 3TRQA 2V2GA 2OADA 5JWRB 2VM1A 5IM9A 5G5FA 5LNKe 3QCPA 4WR5A 1AC1A 3TOTA 5HR2A 2H0GA 2O87A 2IMIA 3M9JA 19GSA 3BJ5A 1XOBA 1USBA 1TW9A 1SENA 2FY6A 2R4VA 2R0CA 4OCEA 2RUEA 4OFMA 5D8IA 5B8AA 3L78A 3L9SA 4OMVA 3FHKA 1F9MA 1PMTA 2FUG2 2LJRA 4ECIA 2C0FA 1GNEA 2TIRA 2DJ1A 3FEUA 4V2LA 4IW9A 4K6XA 1T8EB 2YN1A 1ERTA 4MJEA 2HSYA 4GSNA 4JR4A 1QFNA 1THXA 1GSUA 1XZOA 4K2DA 4DVCA 3LW9A 2C0DA 2C3TA 2QGVA 1OE8A 4POMA 2HZEB 4ZBAA 3CSIA 3P8WA 5L71A 4QL9A 2WJUA 2FGXA 3IXRA 1MD3A 3QD9A 1O8WA 1ZYPA 2M46A 3GSSA 1OC9B 6GSWA 2LJKA 5ECQB 2I4AA 4FO5A 1RQMA 1M2AA 3FR9A 4I5QA 1PD21 3Q18A 4GWRA 2B3SA 4IGJA 2HT9A 5DJMA 3D6IA 1N8JA 1UA5A 4HZ4A 2H72A 4NHZA 5D96A 2VCXA 3E3EA 4QL7A 1GUMA 4LL1B 1TTZA 4PNFA 3W8JA 3CYNA 1ILOA 3EU3A 5KN2A 5CRGA 4D73B 1XWBA 2TRCP 1R4WA 3GFKA 3FR6A 5DQSA 2R0PA 3TJBA 3QPMA 3LWAA 4POKA 4LA1A 3KJYA 1F2EA 1V57A 4MDCA 1G7EA 2VD1A 4XS6A 1S3DA 4ILFA 1XW6A 1M2DA 3HY2A 2GDRA 2G2QA 4NXIA 3HKRA 2MZCA 5CRWA 1TRVA 1LBKA 2HRKA 1Z3EA 3UL3A 5CAXA 1AIUA 4HUAA 2D2ZA 4EE0A 2FNOA 2GQLA 2WCIA 3EC3A 2X4AA 2H1GA 6GSTA 1YKAA 2GSTA 3LEFA 4K0NA 3IK7A 1EWXA 3C71A 4V1Ap 4QQ7A 6GSXA 3D21A 1DE2A 2GLRA 3TCOA 2YPMA 3TKPA 4IP1A 5B6NA 4X4JA 3J7Yb 3LSZA 3KP8A 1B4QA 2KUCA 1T4ZA 3TGZA 4BVXA 3F3QA 2WGRA 4G19A 1GP1A 1NSWA 4F0CA 2XC2A 3MIXA 4TR1A 3W6GA 2V41A 4GLTA 1PX6A 4EDYA 1Y6EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XCC A;  1ZL9 A;  1PN9 A;  2H75 A;  2N5B A;  2YJ7 A;  2IMD A;  3IPZ A;  3LXZ A;  1J0F A;  2KP2 A;  4DSS B;  3HD5 A;  4Q5Q A;  1EGR A;  1K3Y A;  4IQ1 A;  4MH2 A;  2P5R A;  1ZMA A;  2F3M A;  4G10 A;  1WE0 A;  3HA9 A;  1TKD B;  4HDE A;  4N10 A;  1GNW A;  3KP9 A;  4XHM A;  5ID2 B;  2KHP A;  4EL1 A;  4EXJ A;  4KAE A;  1IYI A;  1VF3 A;  2QKE A;  1FHE A;  3FZ4 A;  4RI7 A;  5IMC A;  7GSS A;  5B6M A;  4L0U A;  3VWX A;  4HS1 A;  1AQX A;  2IMF A;  2R6K A;  3GTU B;  2DSA A;  1SL1 B;  2P5Q A;  1SK0 A;  5JWO B;  5G1L A;  3GL3 A;  4OD7 A;  1GTI A;  3H93 A;  2VLU A;  3MWH A;  3VWV A;  4FYU A;  3ZIV A;  4OWY A;  1TK0 B;  3FZA A;  5ENU A;  2BJX A;  2E7P A;  3CTG A;  4PUA A;  4I6X A;  1K0M A;  1QMV A;  4E8H A;  4K7N A;  1O73 A;  4RUV A;  1PKZ A;  1MTC A;  3HCZ A;  3NOF A;  3ZLP A;  3QAG A;  1EGO A;  2MMO A;  1SD9 A;  3FKF A;  3Q74 A;  1SKR B;  1A2M A;  5HR1 A;  4POL A;  3N9J A;  2DJK A;  1OKT A;  4RI6 A;  2DC5 A;  2OBK A;  5ABR A;  3GX8 A;  5KN3 A;  1O85 A;  4BA7 A;  1X9S B;  4IHU A;  4Q5F A;  1JZD A;  2WS2 A;  2VIM A;  16GS A;  5ELA A;  5CRE A;  4J2F A;  3TJG A;  2CT6 A;  2K18 A;  1NW2 A;  2MYG A;  2H74 A;  2WDU A;  2TRX A;  4AGS A;  5INY A;  3C73 A;  4ZB9 A;  2YOI A;  5AIV A;  4F9Z A;  2OKA A;  1ML6 A;  3GRX A;  3UVH A;  13GS A;  1F3B A;  3A2X A;  2IWT A;  3AY8 A;  3U5R E;  4GF0 A;  5F06 A;  3G7I A;  4CDO A;  4O7H A;  4IEL A;  5FWG A;  2PPT A;  1DUG A;  3N5O A;  2CA8 A;  2C0E A;  3MAK A;  3HYP A;  4KDX A;  2QC7 A;  1F37 A;  3PGT A;  4KA0 A;  1WP0 A;  5A4V A;  3A5W A;  2CAI A;  4CHS A;  4WF5 A;  12GS A;  3UEM A;  4MK3 A;  1JZO A;  3LOR A;  3SWL A;  2ON5 A;  5GAP D;  3EWL A;  1B48 A;  3O76 A;  5KN0 A;  4OFT A;  2JZT A;  5C00 A;  3ZIT A;  1T4Y A;  11GS A;  2I3Y A;  1DBY A;  2YWI A;  3OR5 A;  1WRY A;  3DKS A;  3H4K A;  4K0G A;  1K0N A;  2FD3 A;  2PUK C;  1M2B A;  4MZC A;  1EEJ A;  1HNA A;  3HZ8 A;  4FYB A;  2FWH A;  3VI7 A;  2BMX A;  2VLT A;  1BJX A;  2A2S A;  2RM6 A;  5FHI A;  3GKX A;  2YAN A;  5ECH B;  3ZFL A;  2H1D A;  1ACV A;  2CX3 A;  1FOV A;  5AGY A;  2F51 A;  5GST A;  4JZQ A;  1GTB A;  1MDJ A;  3TJK A;  4WKW A;  1EOG A;  4OFN A;  1SYX A;  3IRA A;  1TI3 A;  3CMI A;  3GUS A;  1ZZY A;  2JU5 A;  3O3T A;  1O8X A;  5C04 A;  3LYK A;  4X43 A;  3FK8 A;  5GAN D;  2L4C A;  4MF7 A;  4TR1 B;  2GZP A;  3RBT A;  1I5G A;  3QAV A;  2KOK A;  5ECM B;  1UN2 A;  4IS0 A;  3CRU A;  1TRU A;  4RQX A;  2IJY A;  3DRN A;  3D0Z A;  3A2W A;  4XIH A;  3VWU A;  5AIX A;  5ID2 A;  2YWM A;  3M1G A;  2GQK A;  4OCF A;  5ECP B;  3VUR A;  5AIS A;  1YF1 A;  2EIR A;  3WT1 A;  2K9F A;  1FB6 A;  2NPB A;  2IFQ A;  4NWY A;  5CO3 A;  1A24 A;  5ECN B;  3GX0 A;  4JE1 A;  3DIE A;  1Z9H A;  4ZL9 A;  5ECI B;  5HFK A;  3GTU A;  3PH9 A;  2EIQ A;  1GLQ A;  2HI7 A;  2AV4 A;  4XRD A;  4ZL8 A;  3IAM 2;  3MDK A;  3QAW A;  1GUK A;  1GSS A;  3ZTL A;  4GTU A;  4AJ8 A;  2O8V B;  5E59 A;  1X5E A;  2YNX A;  1HNC A;  2R37 A;  3QDN A;  1B8X A;  2E0Q A;  2Z9S A;  4NHW A;  2FCH A;  4YAP A;  5EVO A;  2P0G A;  2O85 A;  3SBC A;  4I2T A;  3UAP A;  4IN0 A;  4EF0 A;  4GQF A;  3GH6 A;  5HFG A;  1BED A;  5DAK A;  1EP7 A;  4J56 E;  1QUW A;  3DML A;  2DJ2 A;  3IHQ A;  1WWJ A;  4KGI A;  1AQW A;  4G9H A;  2MMA A;  5JWQ B;  1TI1 A;  3KXO A;  3QR6 A;  4TVE A;  5A5K A;  1JLV A;  2F8F A;  4HQZ A;  4PQ1 A;  3P90 A;  5CP1 A;  1JZW A;  5H5S A;  5F8B A;  2VCZ A;  5IMV A;  4JRR A;  1TRW A;  1RW1 A;  1SKS B;  2VCV A;  2CX4 A;  3EU4 A;  1EEM A;  2XHF A;  3VFI A;  3HDC A;  1QQ2 A;  3GST A;  1M0U A;  3C1R A;  4OO4 A;  2DMM A;  1YJ6 A;  5D9W A;  5A4U A;  2O89 A;  3JCM L;  5DQY A;  3TKQ A;  2IN3 A;  1ZCP A;  3ZRD A;  4XRA A;  1TK5 B;  2X8C A;  2PER A;  2K6V A;  3HJM A;  3P7X A;  4TR0 A;  1XOA A;  2HRN A;  2PGT A;  1M7T A;  1GUH A;  4F2I A;  5F07 A;  1YY7 A;  2ZCT A;  4O32 A;  4IBP A;  3RHB A;  1PA3 A;  1LU4 A;  1A2L A;  2XPD A;  3LQ7 A;  3RDW A;  1X9M B;  3GYK A;  3TJJ A;  4CW9 A;  3NZN A;  2HLS A;  5CRD A;  3WGX A;  2IME A;  4I2U A;  1TU8 A;  3DXB A;  5IO0 A;  1A8L A;  4ISD A;  2FA8 A;  2H01 A;  4N30 A;  2L59 A;  2GQM A;  4TR3 A;  1V98 A;  4L0W A;  2AJQ B;  1BX9 A;  4ZBB A;  3BCI A;  5D9V A;  20GS A;  3FW2 A;  1R5P A;  3UIW A;  4NPB A;  1Q98 A;  3HVS A;  4TN8 A;  3D4T A;  1PKW A;  2JSY A;  5ECS A;  4G2E A;  4NV2 A;  5F0G A;  2VCW A;  2M72 A;  3APQ A;  4Q5N A;  1R5A A;  1YKC A;  2LRN A;  3EUR A;  2L5O A;  4HU9 A;  1I9D A;  2N5F A;  4MH3 A;  4AJ7 A;  3IA1 A;  4KSM A;  1A0F A;  5IMD A;  1UC7 A;  2GSS A;  3EIN A;  5J5N A;  1XWG A;  4PNG A;  1NHO A;  2G0F A;  1GSY A;  5CYY A;  1KBN A;  4ZB6 A;  2LUS A;  6GSV A;  4HEA 2;  4ZL7 A;  3QFB C;  4HOJ A;  5IQY A;  3H79 A;  1G7O A;  3GMF A;  4PUF C;  1KNG A;  1QXH A;  1HNB A;  5D73 A;  4ML6 A;  1MDI A;  2DIY A;  3CRT A;  3FZ5 A;  1UVZ A;  4H86 A;  1Z6N A;  1U6T A;  1T3B A;  4F0B A;  1FG4 A;  3C7M A;  3C8E A;  4GQC A;  3DVW A;  3W8S A;  3ZIJ A;  6GSY A;  2OA7 A;  2HYX A;  3ME7 A;  3TDG A;  1TP9 A;  6GSU A;  1XXU A;  4GXZ A;  1DSB A;  3CBU A;  5EL8 A;  2H66 A;  1NHY A;  2PWJ A;  3D4M A;  3KZQ A;  2VLV A;  4TRX A;  1GSQ A;  4NV5 A;  2P31 A;  5DBQ A;  3FRC A;  1SL0 B;  1TU7 A;  3APO A;  1EV4 A;  2C0G A;  1CQH A;  2LV3 A;  1V58 A;  2IFQ B;  4EVM A;  2GT5 A;  5B8B A;  4I8B A;  2RUF A;  2PBJ A;  1WPI A;  4MF6 A;  2VCT A;  3IOS A;  4OO5 A;  4JED A;  1X0R A;  2B6M A;  3NIV A;  2QSI A;  3APS A;  5EPF A;  3UOM A;  2H6Y A;  5J9C A;  1Y25 A;  2LS5 A;  4IJ3 A;  4NMU A;  2GS3 A;  1O7U A;  3F8U A;  5G5E A;  3UMA A;  2VL9 A;  3GHA A;  3Q6O A;  1FO5 A;  4MAB A;  3F63 A;  4AJ6 A;  4EUY A;  5HFI A;  4V1A g;  1YZX A;  2FA4 A;  3I69 A;  1PRX A;  2CV4 A;  4YQV A;  4Z7X A;  2B5Y A;  4YH2 A;  5COH A;  5E4W A;  1K3L A;  3K8N A;  5DAK B;  1SYR A;  1A23 A;  5IMA A;  2ZNM A;  4YAV A;  2AUV A;  4YQU A;  1OKD A;  1VGL A;  3VI5 A;  3GKK A;  4WXT A;  10GS A;  1FVK A;  1OE7 A;  4L5O A;  1VF2 A;  3ZMK A;  3KMN A;  1G0T A;  3TOU A;  2CVK A;  5DJL A;  5ELG A;  4XS1 A;  3MNG A;  2I81 A;  2GSQ A;  2MBT A;  4I97 A;  4ACS A;  3L9U A;  2DJ3 A;  4MJC A;  5H5Q A;  2DIZ A;  1EZK A;  4K8M A;  1E6B A;  1FB0 A;  1OC3 A;  2NVL A;  3P2A A;  4MCU A;  1QGV A;  4KCE A;  2REM A;  5LCZ A;  3KH9 A;  2ALB A;  1K0B A;  2WRT A;  2OE0 A;  1V2A A;  2R3X A;  1Z7R A;  4YQM A;  2H0I A;  1YF0 A;  2CZ3 A;  2JAC A;  5DCH A;  3KEB A;  3LGC A;  2LQQ A;  4MF5 A;  3DWV A;  1X5C A;  4ECJ A;  3G7J A;  4X1U A;  5KEJ A;  2KLX A;  3VPQ A;  3CXG A;  4MP4 A;  1Z6M A;  5G31 A;  3US3 A;  3VWW A;  1Z5Y E;  3G9B A;  4TXV A;  2LKU A;  3L9V A;  3IC4 A;  3LXT A;  3UVT A;  3V1W A;  1KEB A;  3Q19 A;  2IMK A;  3BCK A;  3ZZX A;  2NDO A;  3TJF A;  2H19 A;  3HVV A;  3VPT A;  3ZFB A;  3PIN A;  3WGD A;  4FH8 A;  2VL2 C;  1AAZ A;  2LJA A;  3KH7 A;  4TOP A;  1PL2 A;  4V2N A;  1FVJ A;  4EKZ A;  4PUR A;  3IE3 A;  4BWS A;  4ZIJ A;  2OE1 A;  1F3A A;  3EE2 A;  4ZIL A;  4KDY A;  3L4N A;  2J23 A;  4EO3 A;  2EC4 A;  2F9S A;  1SL2 B;  2ES7 A;  1AQV A;  5IOW A;  18GS A;  5G2Z A;  1RK4 A;  1R7H A;  4LMW A;  3MSZ A;  1MDK A;  2B5E A;  5DCG A;  1DE1 A;  3G7Y A;  5JCU A;  3QMX A;  2X99 A;  2DJJ A;  2YCD A;  1M9B A;  3FZ9 A;  2H70 A;  2C1Y A;  3EMX A;  5D93 A;  3HJP A;  1MD4 A;  1R26 A;  2C4J A;  4IP6 A;  1J9B A;  3ZRE A;  3TB2 A;  2C3N A;  1J08 A;  1GLP A;  2GSR A;  3CTF A;  5H5R A;  1EV9 A;  2VL2 A;  1TK8 B;  1WIK A;  3DVX A;  4ECB A;  2YZH A;  1U87 A;  1X5D A;  3F6D A;  3HJO A;  3ME8 A;  4DEJ A;  2L5L A;  5HR3 A;  3GKN A;  3UAR A;  4PQI A;  3KTL A;  5J41 A;  2FHE A;  4K1F A;  3I9V 2;  1JHB A;  2VOC A;  4BL7 A;  1S3A A;  1WMJ A;  4PGT A;  1N2A A;  2PMT A;  2WZ9 A;  2K8S A;  3IBH A;  5JCG A;  4IVF A;  2PN8 A;  4MMM A;  1BYE A;  2V1M A;  4F03 A;  3E9J B;  1HYU A;  4KSO A;  1GSE A;  1VF4 A;  2MMZ A;  2YZU A;  1SJI A;  3J7Y k;  3DGQ A;  3A2V A;  2H76 A;  5HR0 A;  4DSQ A;  1GTA A;  3QFA C;  1NM3 A;  4BVY A;  2C80 A;  2F8A A;  5A4W A;  4LL4 B;  1PGT A;  4P3Y B;  3DYR A;  4MPF A;  3GV1 A;  3U6V A;  17GS A;  2HNL A;  1OC8 A;  2L6C A;  5LD0 A;  3GIX A;  4FIW A;  1OAZ A;  4HQS A;  1PSQ A;  4N0Z A;  3TKS C;  2IL3 A;  1K3O A;  1XWC A;  1XIY A;  2IPA A;  4ZB8 A;  5CNW A;  4NAX A;  3BOA A;  2HFD A;  2R2J A;  2JSZ A;  2LRT A;  4PX1 A;  1T00 A;  1SU9 A;  4GST A;  3H1N A;  3KIJ A;  3M3M A;  5IO2 A;  3GN3 A;  2DBC A;  4K7I A;  2YV9 A;  3L0H A;  1E2Y A;  1ST9 A;  3VLN A;  3CSH A;  2YP6 A;  4HJM A;  3I43 A;  2WFC A;  1ERV A;  1BQ7 A;  1K0A A;  2AAW A;  2H0H A;  2H6Z A;  2HSH A;  2B7J A;  2EIO A;  4RQR A;  2HRF A;  4FYC A;  1A0R P;  4GSS A;  1ZYE A;  4BPY A;  2V32 A;  2GTU A;  2CAQ A;  2LRC A;  2PVQ A;  2N5A A;  14GS A;  4KND A;  2VD0 A;  3TKS E;  4KB3 A;  3TKS A;  1ZOF A;  4MJA A;  5CRH A;  2OBI A;  1GTU A;  2JL4 A;  1TOF A;  2J9H A;  1M9A A;  3F4R A;  1M99 A;  3FY7 A;  3S9F A;  4XS4 A;  4TXO B;  1XWA A;  3ISO A;  8GSS A;  2OJL A;  3KD0 A;  2GZZ A;  2HXK A;  4PXO A;  5J4U A;  3EYT A;  2A4V A;  2PVO C;  3H8Q A;  3RPN A;  4XCS A;  3F9U A;  2X64 A;  1BAY A;  1KTE A;  1XWK A;  2XPE A;  3GKM A;  1W4V A;  1ABA A;  1XW9 A;  3M0F A;  1TJD A;  5DDL A;  2A2R A;  1XPV A;  5EY6 A;  2E2G A;  1V40 A;  4JU5 A;  1PX7 A;  3LYP A;  5F05 A;  1U3A A;  2H71 A;  3HVX A;  1HQO A;  2CVD A;  3HHV A;  2LST A;  1H4O A;  2AB6 A;  4MZB A;  3A3T A;  3TKR A;  2VCQ A;  4HJ2 A;  3RAZ A;  2LTK A;  4K7O A;  4WBJ A;  9GSS A;  3TRX A;  1W89 A;  1AW9 A;  4ULX A;  5DAL A;  3GH9 A;  5ECO B;  5ECR B;  4GCI A;  2BTO T;  3BD2 A;  1GH2 A;  4EDZ A;  5GSS A;  2ON7 A;  3BBY A;  3ZL5 A;  2H1B A;  4GRF A;  2L6D A;  4L5L A;  4N11 A;  1G6W A;  3WD6 A;  3RPP A;  2RLI A;  4J57 E;  2RM5 A;  1B9X C;  2VL3 A;  1SKW B;  3ED3 A;  1T7P B;  4ML1 A;  2YV7 A;  4ZXG A;  1B9Y C;  3IAS 2;  2O7K A;  2WB9 A;  3VK9 A;  2H1A A;  1HD2 A;  5AN1 A;  1URM A;  2RII A;  2OAC A;  5J3R A;  4TW5 A;  2E2M A;  3LJR A;  5D9T A;  3F0I A;  4F82 A;  2H6X A;  1GSD A;  5IMZ A;  4V2M A;  5DVB A;  4JBB A;  2VUP A;  4IQA A;  1VF1 A;  1SJZ A;  1TDI A;  22GS A;  5ECL B;  4JR6 A;  2DML A;  5G30 A;  1G6Y A;  3FR3 A;  3KGK A;  2LNS A;  4WBR D;  2C8U A;  5IPG A;  2JZR A;  5IPH A;  3M9K A;  3IK9 A;  1EP8 A;  4MJB A;  1U88 A;  4KW6 A;  3UJ1 A;  2K8V A;  2FWG A;  1K0O A;  3O6T A;  4N0V A;  4ZBD A;  1GL8 A;  4KH7 A;  2VM2 A;  2I1U A;  3UBL A;  2LEG A;  3I6A A;  4IJI A;  1YDK A;  3E0U A;  3ZYW A;  4E8E A;  5GZZ B;  1XBS A;  1YEP A;  2X8G A;  3M8N A;  3DD3 A;  2HZE A;  2CQ9 A;  1T1V A;  2KP1 A;  4X0X A;  3R2Q A;  3GUR A;  2X8H A;  2LQO A;  2H30 A;  3ZVJ A;  4O92 A;  2CZ2 A;  1OC9 A;  4O5R A;  1X9W B;  1ZGN A;  2JZS A;  4MPG A;  2YWO A;  2OE3 A;  3EVI A;  2L4Q A;  2VAF A;  2L57 A;  4KDU A;  1IYH A;  2DLX A;  3IR4 A;  3EMP A;  1A2J A;  2WUL A;  4K9Z A;  2JAD A;  1Q4J A;  4HU7 A;  3ZVJ D;  2HE3 A;  3WGE A;  4LMV A;  2FLS A;  1PL1 A;  1SK2 A;  1ERW A;  2PU9 C;  5IIZ A;  4TKY A;  3TUE A;  3ZML A;  1Z7P A;  5B7C A;  3ERG A;  1O6J A;  1SJ6 A;  2HZF A;  4D73 A;  2B7K A;  4XTS A;  2MBS A;  2C3Q A;  2M80 A;  1XVQ A;  3GA4 A;  5HQP A;  3IDV A;  4KCA A;  4TXO A;  4HI7 A;  1U3I A;  3LG6 A;  4ECC A;  1S3C A;  4LLR A;  1K0D A;  4KX4 A;  4KE3 A;  4IKH A;  2NBS A;  1YEX A;  1SK1 A;  2V6O A;  3F3R A;  1JFU A;  2MMN A;  1THO A;  2H8L A;  1LJR A;  1FAA A;  3UBK A;  3KCM A;  1QK8 A;  3GL5 A;  1XVW A;  2IIY A;  4HZ2 A;  3HZ4 A;  2R5G A;  4PQH A;  3D22 A;  2XBI A;  3QOU A;  1WOU A;  5ECK B;  4POB A;  4Q5R A;  2GZY A;  4ID0 A;  4XS4 B;  3DEX A;  1F6M C;  2I9H A;  3KTB A;  2GVP A;  3IV4 A;  3CSJ A;  1ON4 A;  1FW1 A;  3PR8 A;  2LNT A;  5IOX A;  3F4S A;  4WET A;  2B1K A;  1SD8 A;  4TR4 A;  1C72 A;  1AUC A;  1V9W A;  2GGT A;  3F4T A;  1OVN A;  1TXX A;  2FWF A;  1O81 A;  1GRX A;  1CQG A;  3F6F A;  1TRS A;  4WEY A;  1JZR A;  3KMO A;  1BG5 A;  1H75 A;  3D5J A;  3C1S A;  5JCW A;  2AHE A;  1GUL A;  1OYJ A;  5G1K A;  4KUN A;  1K0C A;  1ERU A;  3ERF A;  4DSS A;  2YWN A;  1PQN A;  2NTO A;  2AYT A;  5IMF A;  2GT6 A;  3KM6 A;  3FYG A;  2VO4 A;  4AF2 A;  3RHC A;  5DAL B;  3WYW A;  4EC0 A;  5FT3 A;  1XFL A;  3LFL A;  1GWC A;  1MEK A;  3HXS A;  2DJ0 A;  6GSS A;  1EOH A;  1A8Y A;  4L8E A;  3GNJ A;  4MZW A;  2H73 A;  1B4P A;  4MA9 A;  5KN1 A;  1VRS D;  5D9X A;  1ZYQ B;  4BWQ A;  2FWE A;  1AXD A;  1WJK A;  2YJH A;  4WF4 A;  3WT2 A;  2B1L A;  4MLY A;  1XW5 A;  1YQ1 A;  3ERW A;  3TRP A;  5J9B A;  1JLW A;  4DSR A;  1GSF A;  2CVB A;  2V6K A;  2ZUP A;  2XBQ A;  2B5X A;  4WR4 A;  3TRQ A;  2V2G A;  2OAD A;  5JWR B;  2VM1 A;  5IM9 A;  5G5F A;  5LNK e;  3QCP A;  4WR5 A;  1AC1 A;  3TOT A;  5HR2 A;  2H0G A;  2O87 A;  2IMI A;  3M9J A;  19GS A;  3BJ5 A;  1XOB A;  1USB A;  1TW9 A;  1SEN A;  2FY6 A;  2R4V A;  4OCE A;  2RUE A;  4OFM A;  5D8I A;  5B8A A;  3L78 A;  3L9S A;  4OMV A;  3FHK A;  1F9M A;  1PMT A;  2FUG 2;  2LJR A;  4ECI A;  2C0F A;  1GNE A;  2TIR A;  2DJ1 A;  3FEU A;  4V2L A;  4IW9 A;  4K6X A;  1T8E B;  2YN1 A;  1ERT A;  4MJE A;  2HSY A;  4GSN A;  4JR4 A;  1QFN A;  1THX A;  1GSU A;  1XZO A;  4K2D A;  4DVC A;  2C0D A;  2C3T A;  2QGV A;  1OE8 A;  4POM A;  2HZE B;  4ZBA A;  3CSI A;  3P8W A;  5L71 A;  4QL9 A;  2WJU A;  2FGX A;  3IXR A;  1MD3 A;  3QD9 A;  1O8W A;  2M46 A;  3GSS A;  1OC9 B;  6GSW A;  2LJK A;  5ECQ B;  2I4A A;  4FO5 A;  1RQM A;  1M2A A;  3FR9 A;  4I5Q A;  1PD2 1;  3Q18 A;  4GWR A;  2B3S A;  4IGJ A;  2HT9 A;  5DJM A;  3D6I A;  1N8J A;  1UA5 A;  4HZ4 A;  2H72 A;  4NHZ A;  5D96 A;  2VCX A;  3E3E A;  4QL7 A;  1GUM A;  4LL1 B;  1TTZ A;  4PNF A;  3W8J A;  3CYN A;  1ILO A;  3EU3 A;  5KN2 A;  5CRG A;  4D73 B;  1XWB A;  2TRC P;  1R4W A;  3GFK A;  3FR6 A;  5DQS A;  3TJB A;  3QPM A;  3LWA A;  4POK A;  4LA1 A;  3KJY A;  1F2E A;  1V57 A;  4MDC A;  1G7E A;  2VD1 A;  4XS6 A;  1S3D A;  4ILF A;  1XW6 A;  1M2D A;  3HY2 A;  2GDR A;  2G2Q A;  4NXI A;  3HKR A;  2MZC A;  5CRW A;  1TRV A;  1LBK A;  1Z3E A;  3UL3 A;  5CAX A;  1AIU A;  4HUA A;  2D2Z A;  4EE0 A;  2FNO A;  2GQL A;  2WCI A;  3EC3 A;  2H1G A;  6GST A;  1YKA A;  2GST A;  3LEF A;  4K0N A;  3IK7 A;  1EWX A;  3C71 A;  4V1A p;  4QQ7 A;  6GSX A;  3D21 A;  1DE2 A;  2GLR A;  3TCO A;  2YPM A;  3TKP A;  4IP1 A;  5B6N A;  3J7Y b;  3LSZ A;  3KP8 A;  1B4Q A;  2KUC A;  1T4Z A;  3TGZ A;  4BVX A;  3F3Q A;  2WGR A;  4G19 A;  1GP1 A;  1NSW A;  4F0C A;  2XC2 A;  4TR1 A;  3W6G A;  2V41 A;  4GLT A;  1PX6 A;  4EDY A;  1Y6E A; 
#chains in the Genus database with same CATH topology
 1XCC A;  1ZL9 A;  1PN9 A;  2H75 A;  2N5B A;  2YJ7 A;  2IMD A;  3IPZ A;  3LXZ A;  1J0F A;  2KP2 A;  4YKG A;  4KF9 A;  4DSS B;  3HD5 A;  4Q5Q A;  1EGR A;  1K3Y A;  4IQ1 A;  4MH2 A;  2P5R A;  1ZMA A;  2F3M A;  4G10 A;  1WE0 A;  3HA9 A;  1TKD B;  4HDE A;  4N10 A;  1GNW A;  3KP9 A;  4XHM A;  5ID2 B;  2KHP A;  4EL1 A;  4EXJ A;  5KOW A;  4KAE A;  1IYI A;  1VF3 A;  2QKE A;  1FHE A;  3FZ4 A;  4RI7 A;  5IMC A;  7GSS A;  5B6M A;  4L0U A;  3VWX A;  4HS1 A;  1AQX A;  2IMF A;  2R6K A;  3GTU B;  2DSA A;  1SL1 B;  2P5Q A;  1SK0 A;  5JWO B;  1PN0 A;  4G0I A;  5G1L A;  3GL3 A;  4OD7 A;  1GTI A;  3H93 A;  2VLU A;  3MWH A;  3VWV A;  4FYU A;  3ZIV A;  4OWY A;  1TK0 B;  3FZA A;  5ENU A;  2BJX A;  2E7P A;  3CTG A;  3FMW A;  4PUA A;  4I6X A;  1K0M A;  1QMV A;  4E8H A;  4K7N A;  1O73 A;  4RUV A;  1PKZ A;  5BRT A;  1MTC A;  3HCZ A;  3NOF A;  3ZLP A;  3QAG A;  1EGO A;  2MMO A;  1SD9 A;  1ZYN A;  3FKF A;  3Q74 A;  1SKR B;  1A2M A;  5HR1 A;  4POL A;  3N9J A;  2DJK A;  1OKT A;  4RI6 A;  2DC5 A;  3IC8 A;  2OBK A;  5ABR A;  3GX8 A;  5KN3 A;  1O85 A;  4BA7 A;  1X9S B;  4IHU A;  4Q5F A;  1JZD A;  2WS2 A;  2VIM A;  16GS A;  5CRE A;  5ELA A;  4J2F A;  3TJG A;  2CT6 A;  2K18 A;  1NW2 A;  2MYG A;  2H74 A;  2A4H A;  2WDU A;  2TRX A;  4AGS A;  5INY A;  3C73 A;  4O5U A;  4ZB9 A;  2YOI A;  5AIV A;  4F9Z A;  2OKA A;  1ML6 A;  4Z2R A;  3GRX A;  3UVH A;  13GS A;  1F3B A;  3A2X A;  2IWT A;  3AY8 A;  3U5R E;  4GF0 A;  5F06 A;  3G7I A;  4CDO A;  4O7H A;  4IEL A;  5FWG A;  2PPT A;  1DUG A;  3N5O A;  2CA8 A;  2C0E A;  3MAK A;  3HYP A;  4KDX A;  2QC7 A;  1F37 A;  3PGT A;  4KA0 A;  1WP0 A;  5A4V A;  3A5W A;  2CAI A;  4CHS A;  4WF5 A;  12GS A;  3UEM A;  4MK3 A;  1JZO A;  3LOR A;  4YKF A;  3SWL A;  2ON5 A;  5GAP D;  3EWL A;  1B48 A;  3O76 A;  5KN0 A;  4OFT A;  2JZT A;  5C00 A;  3ZIT A;  1T4Y A;  11GS A;  2I3Y A;  1DBY A;  2YWI A;  3OR5 A;  1WRY A;  3DKS A;  3H4K A;  4K0G A;  4Z2T A;  1K0N A;  2FD3 A;  2PUK C;  1M2B A;  4MZC A;  1EEJ A;  1HNA A;  3HZ8 A;  4FYB A;  2FWH A;  3VI7 A;  2BMX A;  2VLT A;  1BJX A;  2A2S A;  2RM6 A;  5FHI A;  3GKX A;  2YAN A;  5ECH B;  3ZFL A;  2H1D A;  1ACV A;  2CX3 A;  1FOV A;  5AGY A;  2F51 A;  5GST A;  4JZQ A;  1GTB A;  1MDJ A;  3TJK A;  4WKW A;  1EOG A;  4OFN A;  1SYX A;  3IRA A;  1TI3 A;  3CMI A;  3GUS A;  1ZZY A;  2JU5 A;  3O3T A;  1O8X A;  4BVX B;  1M3J A;  5C04 A;  3LYK A;  4X43 A;  3FK8 A;  5GAN D;  2L4C A;  4MF7 A;  4TR1 B;  2GZP A;  3RBT A;  1I5G A;  3QAV A;  2KOK A;  5ECM B;  1UN2 A;  4EIP A;  4IS0 A;  3CRU A;  1TRU A;  4RQX A;  2IJY A;  3DRN A;  3D0Z A;  3A2W A;  4XIH A;  3VWU A;  5AIX A;  5ID2 A;  2YWM A;  3M1G A;  2GQK A;  4OCF A;  5ECP B;  3VUR A;  5AIS A;  1YF1 A;  2EIR A;  3WT1 A;  2K9F A;  1FB6 A;  2NPB A;  2IFQ A;  4NWY A;  5CO3 A;  1A24 A;  5ECN B;  3GX0 A;  4JE1 A;  3DIE A;  1Z9H A;  4ZL9 A;  5ECI B;  5HFK A;  3GTU A;  3PH9 A;  2EIQ A;  1GLQ A;  2HI7 A;  2AV4 A;  4XRD A;  4ZL8 A;  3IAM 2;  3MDK A;  3QAW A;  1GUK A;  1GSS A;  3ZTL A;  4GTU A;  4AJ8 A;  2O8V B;  5E59 A;  1X5E A;  2YNX A;  1HNC A;  2R37 A;  3QDN A;  1B8X A;  2E0Q A;  2Z9S A;  4NHW A;  2FCH A;  4YAP A;  5EVO A;  2P0G A;  2O85 A;  3SBC A;  4I2T A;  3UAP A;  4IN0 A;  4EF0 A;  4GQF A;  3GH6 A;  5HFG A;  1BED A;  5DAK A;  1EP7 A;  4J56 E;  1QUW A;  3DML A;  2DJ2 A;  3IHQ A;  1WWJ A;  4KGI A;  1AQW A;  4G9H A;  2MMA A;  4MNN A;  5JWQ B;  1TI1 A;  3KXO A;  3QR6 A;  4TVE A;  5A5K A;  1JLV A;  2F8F A;  4HQZ A;  4PQ1 A;  3P90 A;  5CP1 A;  1JZW A;  5H5S A;  3EPT A;  5F8B A;  2VCZ A;  4G0L A;  5IMV A;  4JRR A;  1TRW A;  1RW1 A;  1SKS B;  2VCV A;  2CX4 A;  3EU4 A;  1EEM A;  2XHF A;  3VFI A;  3HDC A;  1QQ2 A;  3GST A;  1M0U A;  3C1R A;  4OO4 A;  2DMM A;  1YJ6 A;  5D9W A;  5A4U A;  2O89 A;  3JCM L;  5DQY A;  3TKQ A;  2IN3 A;  1ZCP A;  3ZRD A;  4XRA A;  1TK5 B;  2X8C A;  2PER A;  2K6V A;  3HJM A;  3P7X A;  4TR0 A;  1XOA A;  2HRN A;  2PGT A;  1M7T A;  1GUH A;  4F2I A;  4EIQ A;  5F07 A;  1YY7 A;  2ZCT A;  4O32 A;  4IBP A;  3RHB A;  1PA3 A;  1LU4 A;  1A2L A;  2XPD A;  4K5S A;  3LQ7 A;  3RDW A;  1X9M B;  3GYK A;  3TJJ A;  4CW9 A;  3NZN A;  2HLS A;  5CRD A;  3WGX A;  2IME A;  4I2U A;  1TU8 A;  3DXB A;  1PFO A;  5IO0 A;  1A8L A;  2HRA A;  4ISD A;  2FA8 A;  2H01 A;  4N30 A;  2L59 A;  2GQM A;  4TR3 A;  1V98 A;  4L0W A;  2AJQ B;  1BX9 A;  4ZBB A;  3BCI A;  5D9V A;  20GS A;  3FW2 A;  1R5P A;  4G0K A;  3UIW A;  4NPB A;  1Q98 A;  3HVS A;  4TN8 A;  3D4T A;  1PKW A;  2JSY A;  5ECS A;  1FOH A;  4G2E A;  4NV2 A;  5F0G A;  2VCW A;  4USS A;  2M72 A;  3APQ A;  4Q5N A;  1R5A A;  4K5R A;  1YKC A;  2LRN A;  3EUR A;  2L5O A;  4HU9 A;  1I9D A;  2N5F A;  4MH3 A;  4AJ7 A;  3IA1 A;  4KSM A;  1A0F A;  5IMD A;  1UC7 A;  2GSS A;  3EIN A;  5J5N A;  1XWG A;  4PNG A;  1NHO A;  2G0F A;  1GSY A;  4O5Q A;  1KBN A;  5CYY A;  3IHG A;  4ZB6 A;  2LUS A;  6GSV A;  4HEA 2;  4ZL7 A;  3QFB C;  4HOJ A;  5IQY A;  3H79 A;  1G7O A;  3GMF A;  4PUF C;  1KNG A;  1QXH A;  1HNB A;  5D73 A;  4ML6 A;  1MDI A;  2DIY A;  3CRT A;  3FZ5 A;  1UVZ A;  4H86 A;  1Z6N A;  1U6T A;  1T3B A;  4F0B A;  1FG4 A;  3C7M A;  3C8E A;  4GQC A;  3DVW A;  3W8S A;  3ZIJ A;  6GSY A;  2OA7 A;  5KOX A;  2HYX A;  3ME7 A;  3TDG A;  1TP9 A;  6GSU A;  1XXU A;  4GXZ A;  1DSB A;  3CBU A;  5EL8 A;  2H66 A;  2X49 A;  1NHY A;  2PWJ A;  3D4M A;  3KZQ A;  2VLV A;  4TRX A;  1GSQ A;  4NV5 A;  2P31 A;  5DBQ A;  3FRC A;  1SL0 B;  1TU7 A;  3APO A;  1EV4 A;  2C0G A;  1CQH A;  2LV3 A;  1V58 A;  2IFQ B;  4EVM A;  2GT5 A;  5B8B A;  4I8B A;  2RUF A;  2PBJ A;  1WPI A;  4MF6 A;  2VCT A;  4K2X A;  4BL7 B;  3IOS A;  4OO5 A;  4JED A;  1X0R A;  2B6M A;  3NIV A;  2QSI A;  3APS A;  5EPF A;  3UOM A;  2H6Y A;  2HSM A;  5J9C A;  1Y25 A;  2LS5 A;  4IJ3 A;  4NMU A;  2GS3 A;  1O7U A;  3F8U A;  5G5E A;  3UMA A;  2VL9 A;  3GHA A;  3Q6O A;  1FO5 A;  4MAB A;  3F63 A;  4AJ6 A;  4EUY A;  5HFI A;  4V1A g;  1YZX A;  2FA4 A;  3I69 A;  1PRX A;  2CV4 A;  4YQV A;  4Z7X A;  2B5Y A;  4YH2 A;  5COH A;  5E4W A;  1K3L A;  3K8N A;  4BVY B;  5DAK B;  1SYR A;  1A23 A;  5IMA A;  2ZNM A;  4YAV A;  2AUV A;  4YQU A;  1OKD A;  1VGL A;  3VI5 A;  3GKK A;  4WXT A;  10GS A;  1FVK A;  1OE7 A;  4L5O A;  1VF2 A;  3ZMK A;  3KMN A;  1G0T A;  3TOU A;  2CVK A;  5DJL A;  5ELG A;  4XS1 A;  3MNG A;  3MYD A;  2I81 A;  2GSQ A;  2MBT A;  4I97 A;  4ACS A;  3L9U A;  2DJ3 A;  4MJC A;  5H5Q A;  2DIZ A;  1EZK A;  4K8M A;  1E6B A;  1FB0 A;  1OC3 A;  2NVL A;  3P2A A;  4MCU A;  1QGV A;  4KCE A;  2REM A;  1M3I A;  5LCZ A;  3KH9 A;  2ALB A;  1K0B A;  2WRT A;  2OE0 A;  1V2A A;  2R3X A;  1Z7R A;  4YQM A;  2H0I A;  1YF0 A;  2CZ3 A;  2JAC A;  5DCH A;  3KEB A;  3LGC A;  2LQQ A;  4MF5 A;  3DWV A;  1X5C A;  4ECJ A;  3G7J A;  4X1U A;  5KEJ A;  2KLX A;  3VPQ A;  3CXG A;  3PPU A;  4MP4 A;  1Z6M A;  5G31 A;  3US3 A;  3VWW A;  1Z5Y E;  3G9B A;  4TXV A;  2LKU A;  3L9V A;  3IC4 A;  3LXT A;  3UVT A;  3V1W A;  1KEB A;  3Q19 A;  2IMK A;  3BCK A;  3ZZX A;  2NDO A;  3TJF A;  2H19 A;  3HVV A;  3VPT A;  3ZFB A;  3PIN A;  3WGD A;  4FH8 A;  2VL2 C;  1AAZ A;  2LJA A;  3KH7 A;  4TOP A;  1PL2 A;  4V2N A;  1FVJ A;  4EKZ A;  4PUR A;  3IE3 A;  4BWS A;  4ZIJ A;  2OE1 A;  1F3A A;  3EE2 A;  4ZIL A;  4KDY A;  2QA1 A;  3L4N A;  2J23 A;  4EO3 A;  2EC4 A;  2F9S A;  1SL2 B;  2ES7 A;  1AQV A;  5IOW A;  18GS A;  5G2Z A;  1RK4 A;  1R7H A;  4LMW A;  3MSZ A;  1XG8 A;  1MDK A;  2B5E A;  5DCG A;  1DE1 A;  3G7Y A;  5JCU A;  3QMX A;  2X99 A;  2DJJ A;  2YCD A;  1M9B A;  3FZ9 A;  2H70 A;  2C1Y A;  3EMX A;  5D93 A;  3HJP A;  1MD4 A;  1R26 A;  2C4J A;  4IP6 A;  1J9B A;  3HVN A;  3ZRE A;  3TB2 A;  2C3N A;  1J08 A;  1GLP A;  2GSR A;  3CTF A;  5H5R A;  1EV9 A;  2VL2 A;  1TK8 B;  1WIK A;  3DVX A;  4ECB A;  2YZH A;  1U87 A;  1X5D A;  3F6D A;  3HJO A;  3ME8 A;  4DEJ A;  2L5L A;  5HR3 A;  3GKN A;  3UAR A;  4PQI A;  3KTL A;  5J41 A;  2FHE A;  4K1F A;  3I9V 2;  1JHB A;  2VOC A;  4BL7 A;  1S3A A;  1WMJ A;  4PGT A;  1N2A A;  2PMT A;  2WZ9 A;  2K8S A;  3IBH A;  5JCG A;  4IVF A;  2PN8 A;  2A2P A;  4MMM A;  1BYE A;  2V1M A;  4F03 A;  3E9J B;  1HYU A;  4KSO A;  1GSE A;  1VF4 A;  2MMZ A;  2YZU A;  1SJI A;  3J7Y k;  3DGQ A;  3A2V A;  2H76 A;  5HR0 A;  4DSQ A;  1GTA A;  3QFA C;  1NM3 A;  4BVY A;  2C80 A;  2F8A A;  5A4W A;  4LL4 B;  4Z2U A;  1PGT A;  4P3Y B;  3DYR A;  4MPF A;  3GV1 A;  3U6V A;  17GS A;  2HNL A;  1OC8 A;  2L6C A;  5LD0 A;  3GIX A;  4FIW A;  1OAZ A;  4HQS A;  1PSQ A;  4N0Z A;  3TKS C;  2IL3 A;  1K3O A;  1XWC A;  1XIY A;  2IPA A;  3R3E A;  4ZB8 A;  5CNW A;  4NAX A;  3BOA A;  4CY6 A;  2HFD A;  2R2J A;  2JSZ A;  2LRT A;  4PX1 A;  1T00 A;  1SU9 A;  4GST A;  3H1N A;  3KIJ A;  3M3M A;  5IO2 A;  3GN3 A;  2DBC A;  4K7I A;  2YV9 A;  3L0H A;  1E2Y A;  1ST9 A;  3VLN A;  3CSH A;  2YP6 A;  4HJM A;  3I43 A;  2WFC A;  1ERV A;  2DKI A;  1BQ7 A;  1K0A A;  2AAW A;  2H0H A;  2H6Z A;  2HSH A;  2B7J A;  2EIO A;  4RQR A;  2HRF A;  4FYC A;  1A0R P;  4GSS A;  1ZYE A;  4BPY A;  2V32 A;  2GTU A;  2CAQ A;  2LRC A;  2PVQ A;  2N5A A;  14GS A;  4KND A;  2VD0 A;  3TKS E;  4KB3 A;  3TKS A;  1ZOF A;  4MJA A;  5CRH A;  2OBI A;  1GTU A;  2JL4 A;  1TOF A;  2J9H A;  1M9A A;  3F4R A;  1M99 A;  3FY7 A;  3S9F A;  4XS4 A;  4TXO B;  1XWA A;  3ISO A;  8GSS A;  2OJL A;  3KD0 A;  2GZZ A;  2HXK A;  4PXO A;  5J4U A;  3EYT A;  2A4V A;  2PVO C;  3H8Q A;  3RPN A;  4XCS A;  3F9U A;  2X64 A;  1BAY A;  1KTE A;  1XWK A;  2XPE A;  3GKM A;  1W4V A;  1ABA A;  1XW9 A;  3M0F A;  1TJD A;  5DDL A;  2A2R A;  1XPV A;  5EY6 A;  2E2G A;  1V40 A;  4JU5 A;  1PX7 A;  3LYP A;  5F05 A;  1U3A A;  2H71 A;  3HVX A;  1HQO A;  2CVD A;  3HHV A;  2LST A;  1H4O A;  2AB6 A;  4MZB A;  3A3T A;  3TKR A;  2VCQ A;  4HJ2 A;  3RAZ A;  2LTK A;  4K7O A;  4WBJ A;  9GSS A;  3TRX A;  1W89 A;  1AW9 A;  4ULX A;  5DAL A;  3GH9 A;  5ECO B;  5ECR B;  2DKH A;  4GCI A;  2BTO T;  3BD2 A;  1GH2 A;  4EDZ A;  5GSS A;  2ON7 A;  3BBY A;  3ZL5 A;  2H1B A;  4GRF A;  2L6D A;  4L5L A;  4N11 A;  1G6W A;  3WD6 A;  3RPP A;  2RLI A;  4J57 E;  2RM5 A;  1B9X C;  2VL3 A;  1SKW B;  3ED3 A;  1T7P B;  4ML1 A;  2YV7 A;  4ZXG A;  1B9Y C;  3IAS 2;  4HSC X;  2O7K A;  2WB9 A;  3VK9 A;  2H1A A;  1HD2 A;  1S3R A;  5AN1 A;  1URM A;  2RII A;  2OAC A;  5J3R A;  4TW5 A;  2E2M A;  3LJR A;  5D9T A;  3F0I A;  4F82 A;  2H6X A;  1GSD A;  5IMZ A;  4CY8 A;  4V2M A;  5DVB A;  4JBB A;  2VUP A;  4IQA A;  1VF1 A;  1SJZ A;  1TDI A;  22GS A;  5ECL B;  4JR6 A;  2DML A;  5G30 A;  1G6Y A;  3FR3 A;  3KGK A;  2LNS A;  4WBR D;  4A5P A;  2C8U A;  5IPG A;  2JZR A;  5IPH A;  3M9K A;  3IK9 A;  1EP8 A;  4MJB A;  1U88 A;  4KW6 A;  3UJ1 A;  2K8V A;  2FWG A;  1K0O A;  3O6T A;  4N0V A;  4ZBD A;  1GL8 A;  4KH7 A;  2VM2 A;  2I1U A;  3UBL A;  2LEG A;  3I6A A;  4IJI A;  1YDK A;  3E0U A;  3ZYW A;  4E8E A;  5GZZ B;  1XBS A;  1YEP A;  2X8G A;  3M8N A;  3DD3 A;  2HZE A;  2CQ9 A;  1T1V A;  2KP1 A;  4X0X A;  3R2Q A;  3GUR A;  2X8H A;  2LQO A;  2H30 A;  3ZVJ A;  4O92 A;  2CZ2 A;  1OC9 A;  4O5R A;  1X9W B;  1ZGN A;  2JZS A;  4MPG A;  2YWO A;  2OE3 A;  3EVI A;  2L4Q A;  2VAF A;  2L57 A;  4KDU A;  1IYH A;  2DLX A;  3IR4 A;  3EMP A;  1A2J A;  2WUL A;  4K9Z A;  2JAD A;  1Q4J A;  4HU7 A;  3ZVJ D;  2HE3 A;  3WGE A;  4LMV A;  2FLS A;  1PL1 A;  1SK2 A;  1ERW A;  2PU9 C;  5IIZ A;  4TKY A;  3TUE A;  3ZML A;  1Z7P A;  5B7C A;  3ERG A;  1O6J A;  1SJ6 A;  2HZF A;  4D73 A;  2B7K A;  4XTS A;  2MBS A;  2C3Q A;  2M80 A;  1XVQ A;  3GA4 A;  5HQP A;  3IDV A;  4KCA A;  4TXO A;  2UZ8 A;  4HI7 A;  1U3I A;  3LG6 A;  4ECC A;  1S3C A;  4LLR A;  1K0D A;  4KX4 A;  4KE3 A;  4IKH A;  2NBS A;  1YEX A;  1SK1 A;  2V6O A;  3F3R A;  1JFU A;  2MMN A;  1THO A;  2H8L A;  1LJR A;  1FAA A;  3UBK A;  4ICY A;  3KCM A;  1QK8 A;  3GL5 A;  1XVW A;  2IIY A;  4HZ2 A;  3HZ4 A;  2R5G A;  4PQH A;  3D22 A;  2XBI A;  3QOU A;  1WOU A;  5ECK B;  4POB A;  4Q5R A;  2GZY A;  4ID0 A;  4XS4 B;  3DEX A;  1F6M C;  2I9H A;  3KTB A;  2GVP A;  3IV4 A;  3CSJ A;  1ON4 A;  1FW1 A;  3PR8 A;  2LNT A;  5IOX A;  3F4S A;  4WET A;  2B1K A;  1SD8 A;  4TR4 A;  1C72 A;  1AUC A;  1V9W A;  2GGT A;  3F4T A;  1OVN A;  1TXX A;  2FWF A;  1O81 A;  1GRX A;  1CQG A;  3F6F A;  1TRS A;  4WEY A;  2QA2 A;  1JZR A;  3KMO A;  1BG5 A;  1H75 A;  3D5J A;  3C1S A;  5JCW A;  2AHE A;  1GUL A;  1OYJ A;  5G1K A;  4KUN A;  1K0C A;  1ERU A;  3ERF A;  4DSS A;  2YWN A;  1PQN A;  2NTO A;  2AYT A;  5IMF A;  2GT6 A;  3KM6 A;  3FYG A;  2VO4 A;  4AF2 A;  3RHC A;  5DAL B;  3WYW A;  4EC0 A;  5FT3 A;  1XFL A;  3LFL A;  1GWC A;  1MEK A;  3HXS A;  2DJ0 A;  4FQU A;  6GSS A;  1EOH A;  1A8Y A;  4L8E A;  3GNJ A;  4MZW A;  2H73 A;  1B4P A;  4MA9 A;  5KN1 A;  1VRS D;  5D9X A;  1ZYQ B;  4BWQ A;  2FWE A;  1AXD A;  1WJK A;  2YJH A;  4WF4 A;  3WT2 A;  2B1L A;  4MLY A;  1XW5 A;  1YQ1 A;  3ERW A;  5BMU A;  3TRP A;  5J9B A;  1JLW A;  4DSR A;  1GSF A;  2CVB A;  4PTS A;  2V6K A;  3A5I A;  2R0G A;  2XBQ A;  2B5X A;  2ZUP A;  4WR4 A;  3TRQ A;  2V2G A;  2OAD A;  5JWR B;  2VM1 A;  5IM9 A;  5G5F A;  5LNK e;  3QCP A;  4WR5 A;  1AC1 A;  3TOT A;  5HR2 A;  2H0G A;  2O87 A;  2IMI A;  3M9J A;  19GS A;  3BJ5 A;  1XOB A;  1USB A;  1TW9 A;  1SEN A;  2FY6 A;  4BIK A;  2R4V A;  2R0C A;  4OCE A;  2RUE A;  4OFM A;  5D8I A;  5B8A A;  3L78 A;  3L9S A;  4OMV A;  3FHK A;  1F9M A;  1PMT A;  2FUG 2;  2LJR A;  4ECI A;  2C0F A;  1GNE A;  2TIR A;  2DJ1 A;  3FEU A;  4V2L A;  4IW9 A;  4K6X A;  1T8E B;  2YN1 A;  1ERT A;  4MJE A;  2HSY A;  4GSN A;  4JR4 A;  1QFN A;  1THX A;  1GSU A;  1XZO A;  4K2D A;  4DVC A;  3LW9 A;  2C0D A;  2C3T A;  2QGV A;  1OE8 A;  4POM A;  2HZE B;  4ZBA A;  3CSI A;  3P8W A;  5L71 A;  4QL9 A;  2WJU A;  2FGX A;  3IXR A;  1MD3 A;  3QD9 A;  1O8W A;  1ZYP A;  2M46 A;  3GSS A;  1OC9 B;  6GSW A;  2LJK A;  5ECQ B;  2I4A A;  4FO5 A;  1RQM A;  1M2A A;  3FR9 A;  4I5Q A;  1PD2 1;  3Q18 A;  4GWR A;  2B3S A;  4IGJ A;  2HT9 A;  5DJM A;  3D6I A;  1N8J A;  1UA5 A;  4HZ4 A;  2H72 A;  4NHZ A;  5D96 A;  2VCX A;  3E3E A;  4QL7 A;  1GUM A;  4LL1 B;  1TTZ A;  4PNF A;  3W8J A;  3CYN A;  1ILO A;  3EU3 A;  5KN2 A;  5CRG A;  4D73 B;  1XWB A;  2TRC P;  1R4W A;  3GFK A;  3FR6 A;  5DQS A;  2R0P A;  3TJB A;  3QPM A;  3LWA A;  4POK A;  4LA1 A;  3KJY A;  1F2E A;  1V57 A;  4MDC A;  1G7E A;  2VD1 A;  4XS6 A;  1S3D A;  3CQF A;  4ILF A;  1XW6 A;  1M2D A;  3HY2 A;  2GDR A;  2G2Q A;  4NXI A;  3HKR A;  2MZC A;  5CRW A;  1TRV A;  1LBK A;  2HRK A;  1Z3E A;  3UL3 A;  5CAX A;  1AIU A;  4HUA A;  2D2Z A;  4EE0 A;  2FNO A;  2GQL A;  2WCI A;  3EC3 A;  2X4A A;  2H1G A;  6GST A;  1YKA A;  2GST A;  3LEF A;  4K0N A;  3IK7 A;  1EWX A;  3C71 A;  4V1A p;  4QQ7 A;  6GSX A;  3D21 A;  1DE2 A;  2GLR A;  3TCO A;  2YPM A;  3TKP A;  4IP1 A;  5B6N A;  4X4J A;  3J7Y b;  3LSZ A;  3KP8 A;  1B4Q A;  2KUC A;  1T4Z A;  3TGZ A;  4BVX A;  3F3Q A;  2WGR A;  4G19 A;  1GP1 A;  1NSW A;  4F0C A;  2XC2 A;  3MIX A;  4TR1 A;  3W6G A;  2V41 A;  4GLT A;  1PX6 A;  4EDY A;  1Y6E A; 
#chains in the Genus database with same CATH homology
 1XCC A;  1ZL9 A;  1PN9 A;  2H75 A;  2N5B A;  2YJ7 A;  2IMD A;  3IPZ A;  3LXZ A;  1J0F A;  2KP2 A;  4YKG A;  4KF9 A;  4DSS B;  3HD5 A;  4Q5Q A;  1EGR A;  1K3Y A;  4IQ1 A;  4MH2 A;  2P5R A;  1ZMA A;  2F3M A;  4G10 A;  1WE0 A;  3HA9 A;  1TKD B;  4HDE A;  4N10 A;  1GNW A;  3KP9 A;  4XHM A;  5ID2 B;  2KHP A;  4EL1 A;  4EXJ A;  5KOW A;  4KAE A;  1IYI A;  1VF3 A;  2QKE A;  1FHE A;  3FZ4 A;  4RI7 A;  5IMC A;  7GSS A;  5B6M A;  4L0U A;  3VWX A;  4HS1 A;  1AQX A;  2IMF A;  2R6K A;  3GTU B;  2DSA A;  1SL1 B;  2P5Q A;  1SK0 A;  5JWO B;  1PN0 A;  4G0I A;  5G1L A;  3GL3 A;  4OD7 A;  1GTI A;  3H93 A;  2VLU A;  3MWH A;  3VWV A;  4FYU A;  3ZIV A;  4OWY A;  1TK0 B;  3FZA A;  5ENU A;  2BJX A;  2E7P A;  3CTG A;  3FMW A;  4PUA A;  4I6X A;  1K0M A;  1QMV A;  4E8H A;  4K7N A;  1O73 A;  4RUV A;  1PKZ A;  5BRT A;  1MTC A;  3HCZ A;  3NOF A;  3ZLP A;  3QAG A;  1EGO A;  2MMO A;  1SD9 A;  1ZYN A;  3FKF A;  3Q74 A;  1SKR B;  1A2M A;  5HR1 A;  4POL A;  3N9J A;  2DJK A;  1OKT A;  4RI6 A;  2DC5 A;  3IC8 A;  2OBK A;  5ABR A;  3GX8 A;  5KN3 A;  1O85 A;  4BA7 A;  1X9S B;  4IHU A;  4Q5F A;  1JZD A;  2WS2 A;  2VIM A;  16GS A;  5CRE A;  5ELA A;  4J2F A;  3TJG A;  2CT6 A;  2K18 A;  1NW2 A;  2MYG A;  2H74 A;  2A4H A;  2WDU A;  2TRX A;  4AGS A;  5INY A;  3C73 A;  4O5U A;  4ZB9 A;  2YOI A;  5AIV A;  4F9Z A;  2OKA A;  1ML6 A;  4Z2R A;  3GRX A;  3UVH A;  13GS A;  1F3B A;  3A2X A;  2IWT A;  3AY8 A;  3U5R E;  4GF0 A;  5F06 A;  3G7I A;  4CDO A;  4O7H A;  4IEL A;  5FWG A;  2PPT A;  1DUG A;  3N5O A;  2CA8 A;  2C0E A;  3MAK A;  3HYP A;  4KDX A;  2QC7 A;  1F37 A;  3PGT A;  4KA0 A;  1WP0 A;  5A4V A;  3A5W A;  2CAI A;  4CHS A;  4WF5 A;  12GS A;  3UEM A;  4MK3 A;  1JZO A;  3LOR A;  4YKF A;  3SWL A;  2ON5 A;  5GAP D;  3EWL A;  1B48 A;  3O76 A;  5KN0 A;  4OFT A;  2JZT A;  5C00 A;  3ZIT A;  1T4Y A;  11GS A;  2I3Y A;  1DBY A;  2YWI A;  3OR5 A;  1WRY A;  3DKS A;  3H4K A;  4K0G A;  4Z2T A;  1K0N A;  2FD3 A;  2PUK C;  1M2B A;  4MZC A;  1EEJ A;  1HNA A;  3HZ8 A;  4FYB A;  2FWH A;  3VI7 A;  2BMX A;  2VLT A;  1BJX A;  2A2S A;  2RM6 A;  5FHI A;  3GKX A;  2YAN A;  5ECH B;  3ZFL A;  2H1D A;  1ACV A;  2CX3 A;  1FOV A;  5AGY A;  2F51 A;  5GST A;  4JZQ A;  1GTB A;  1MDJ A;  3TJK A;  4WKW A;  1EOG A;  4OFN A;  1SYX A;  3IRA A;  1TI3 A;  3CMI A;  3GUS A;  1ZZY A;  2JU5 A;  3O3T A;  1O8X A;  4BVX B;  5C04 A;  3LYK A;  4X43 A;  3FK8 A;  5GAN D;  2L4C A;  4MF7 A;  4TR1 B;  2GZP A;  3RBT A;  1I5G A;  3QAV A;  2KOK A;  5ECM B;  1UN2 A;  4EIP A;  4IS0 A;  3CRU A;  1TRU A;  4RQX A;  2IJY A;  3DRN A;  3D0Z A;  3A2W A;  4XIH A;  3VWU A;  5AIX A;  5ID2 A;  2YWM A;  3M1G A;  2GQK A;  4OCF A;  5ECP B;  3VUR A;  5AIS A;  1YF1 A;  2EIR A;  3WT1 A;  2K9F A;  1FB6 A;  2NPB A;  2IFQ A;  4NWY A;  5CO3 A;  1A24 A;  5ECN B;  3GX0 A;  4JE1 A;  3DIE A;  1Z9H A;  4ZL9 A;  5ECI B;  5HFK A;  3GTU A;  3PH9 A;  2EIQ A;  1GLQ A;  2HI7 A;  2AV4 A;  4XRD A;  4ZL8 A;  3IAM 2;  3MDK A;  3QAW A;  1GUK A;  1GSS A;  3ZTL A;  4GTU A;  4AJ8 A;  2O8V B;  5E59 A;  1X5E A;  2YNX A;  1HNC A;  2R37 A;  3QDN A;  1B8X A;  2E0Q A;  2Z9S A;  4NHW A;  2FCH A;  4YAP A;  5EVO A;  2P0G A;  2O85 A;  3SBC A;  4I2T A;  3UAP A;  4IN0 A;  4EF0 A;  4GQF A;  3GH6 A;  5HFG A;  1BED A;  5DAK A;  1EP7 A;  4J56 E;  1QUW A;  3DML A;  2DJ2 A;  3IHQ A;  1WWJ A;  4KGI A;  1AQW A;  4G9H A;  2MMA A;  4MNN A;  5JWQ B;  1TI1 A;  3KXO A;  3QR6 A;  4TVE A;  5A5K A;  1JLV A;  2F8F A;  4HQZ A;  4PQ1 A;  3P90 A;  5CP1 A;  1JZW A;  5H5S A;  3EPT A;  5F8B A;  2VCZ A;  4G0L A;  5IMV A;  4JRR A;  1TRW A;  1RW1 A;  1SKS B;  2VCV A;  2CX4 A;  3EU4 A;  1EEM A;  2XHF A;  3VFI A;  3HDC A;  1QQ2 A;  3GST A;  1M0U A;  3C1R A;  4OO4 A;  2DMM A;  1YJ6 A;  5D9W A;  5A4U A;  2O89 A;  3JCM L;  5DQY A;  3TKQ A;  2IN3 A;  1ZCP A;  3ZRD A;  4XRA A;  1TK5 B;  2X8C A;  2PER A;  2K6V A;  3HJM A;  3P7X A;  4TR0 A;  1XOA A;  2HRN A;  2PGT A;  1M7T A;  1GUH A;  4F2I A;  4EIQ A;  5F07 A;  1YY7 A;  2ZCT A;  4O32 A;  4IBP A;  3RHB A;  1PA3 A;  1LU4 A;  1A2L A;  2XPD A;  4K5S A;  3LQ7 A;  3RDW A;  1X9M B;  3GYK A;  3TJJ A;  4CW9 A;  3NZN A;  2HLS A;  5CRD A;  3WGX A;  2IME A;  4I2U A;  1TU8 A;  3DXB A;  5IO0 A;  1A8L A;  2HRA A;  4ISD A;  2FA8 A;  2H01 A;  4N30 A;  2L59 A;  2GQM A;  4TR3 A;  1V98 A;  4L0W A;  2AJQ B;  1BX9 A;  4ZBB A;  3BCI A;  5D9V A;  20GS A;  3FW2 A;  1R5P A;  4G0K A;  3UIW A;  4NPB A;  1Q98 A;  3HVS A;  4TN8 A;  3D4T A;  1PKW A;  2JSY A;  5ECS A;  1FOH A;  4G2E A;  4NV2 A;  5F0G A;  2VCW A;  4USS A;  2M72 A;  3APQ A;  4Q5N A;  1R5A A;  4K5R A;  1YKC A;  2LRN A;  3EUR A;  2L5O A;  4HU9 A;  1I9D A;  2N5F A;  4MH3 A;  4AJ7 A;  3IA1 A;  4KSM A;  1A0F A;  5IMD A;  1UC7 A;  2GSS A;  3EIN A;  5J5N A;  1XWG A;  4PNG A;  1NHO A;  2G0F A;  1GSY A;  4O5Q A;  1KBN A;  5CYY A;  3IHG A;  4ZB6 A;  2LUS A;  6GSV A;  4HEA 2;  4ZL7 A;  3QFB C;  4HOJ A;  5IQY A;  3H79 A;  1G7O A;  3GMF A;  4PUF C;  1KNG A;  1QXH A;  1HNB A;  5D73 A;  4ML6 A;  1MDI A;  2DIY A;  3CRT A;  3FZ5 A;  1UVZ A;  4H86 A;  1Z6N A;  1U6T A;  1T3B A;  4F0B A;  1FG4 A;  3C7M A;  3C8E A;  4GQC A;  3DVW A;  3W8S A;  3ZIJ A;  6GSY A;  2OA7 A;  5KOX A;  2HYX A;  3ME7 A;  3TDG A;  1TP9 A;  6GSU A;  1XXU A;  4GXZ A;  1DSB A;  3CBU A;  5EL8 A;  2H66 A;  2X49 A;  1NHY A;  2PWJ A;  3D4M A;  3KZQ A;  2VLV A;  4TRX A;  1GSQ A;  4NV5 A;  2P31 A;  5DBQ A;  3FRC A;  1SL0 B;  1TU7 A;  3APO A;  1EV4 A;  2C0G A;  1CQH A;  2LV3 A;  1V58 A;  2IFQ B;  4EVM A;  2GT5 A;  5B8B A;  4I8B A;  2RUF A;  2PBJ A;  1WPI A;  4MF6 A;  2VCT A;  4K2X A;  4BL7 B;  3IOS A;  4OO5 A;  4JED A;  1X0R A;  2B6M A;  3NIV A;  2QSI A;  3APS A;  5EPF A;  3UOM A;  2H6Y A;  2HSM A;  5J9C A;  1Y25 A;  2LS5 A;  4IJ3 A;  4NMU A;  2GS3 A;  1O7U A;  3F8U A;  5G5E A;  3UMA A;  2VL9 A;  3GHA A;  3Q6O A;  1FO5 A;  4MAB A;  3F63 A;  4AJ6 A;  4EUY A;  5HFI A;  4V1A g;  1YZX A;  2FA4 A;  3I69 A;  1PRX A;  2CV4 A;  4YQV A;  4Z7X A;  2B5Y A;  4YH2 A;  5COH A;  5E4W A;  1K3L A;  3K8N A;  4BVY B;  5DAK B;  1SYR A;  1A23 A;  5IMA A;  2ZNM A;  4YAV A;  2AUV A;  4YQU A;  1OKD A;  1VGL A;  3VI5 A;  3GKK A;  4WXT A;  10GS A;  1FVK A;  1OE7 A;  4L5O A;  1VF2 A;  3ZMK A;  3KMN A;  1G0T A;  3TOU A;  2CVK A;  5DJL A;  5ELG A;  4XS1 A;  3MNG A;  3MYD A;  2I81 A;  2GSQ A;  2MBT A;  4I97 A;  4ACS A;  3L9U A;  2DJ3 A;  4MJC A;  5H5Q A;  2DIZ A;  1EZK A;  4K8M A;  1E6B A;  1FB0 A;  1OC3 A;  2NVL A;  3P2A A;  4MCU A;  1QGV A;  4KCE A;  2REM A;  5LCZ A;  3KH9 A;  2ALB A;  1K0B A;  2WRT A;  2OE0 A;  1V2A A;  2R3X A;  1Z7R A;  4YQM A;  2H0I A;  1YF0 A;  2CZ3 A;  2JAC A;  5DCH A;  3KEB A;  3LGC A;  2LQQ A;  4MF5 A;  3DWV A;  1X5C A;  4ECJ A;  3G7J A;  4X1U A;  5KEJ A;  2KLX A;  3VPQ A;  3CXG A;  3PPU A;  4MP4 A;  1Z6M A;  5G31 A;  3US3 A;  3VWW A;  1Z5Y E;  3G9B A;  4TXV A;  2LKU A;  3L9V A;  3IC4 A;  3LXT A;  3UVT A;  3V1W A;  1KEB A;  3Q19 A;  2IMK A;  3BCK A;  3ZZX A;  2NDO A;  3TJF A;  2H19 A;  3HVV A;  3VPT A;  3ZFB A;  3PIN A;  3WGD A;  4FH8 A;  2VL2 C;  1AAZ A;  2LJA A;  3KH7 A;  4TOP A;  1PL2 A;  4V2N A;  1FVJ A;  4EKZ A;  4PUR A;  3IE3 A;  4BWS A;  4ZIJ A;  2OE1 A;  1F3A A;  3EE2 A;  4ZIL A;  4KDY A;  2QA1 A;  3L4N A;  2J23 A;  4EO3 A;  2EC4 A;  2F9S A;  1SL2 B;  2ES7 A;  1AQV A;  5IOW A;  18GS A;  5G2Z A;  1RK4 A;  1R7H A;  4LMW A;  3MSZ A;  1MDK A;  2B5E A;  5DCG A;  1DE1 A;  3G7Y A;  5JCU A;  3QMX A;  2X99 A;  2DJJ A;  2YCD A;  1M9B A;  3FZ9 A;  2H70 A;  2C1Y A;  3EMX A;  5D93 A;  3HJP A;  1MD4 A;  1R26 A;  2C4J A;  4IP6 A;  1J9B A;  3ZRE A;  3TB2 A;  2C3N A;  1J08 A;  1GLP A;  2GSR A;  3CTF A;  5H5R A;  1EV9 A;  2VL2 A;  1TK8 B;  1WIK A;  3DVX A;  4ECB A;  2YZH A;  1U87 A;  1X5D A;  3F6D A;  3HJO A;  3ME8 A;  4DEJ A;  2L5L A;  5HR3 A;  3GKN A;  3UAR A;  4PQI A;  3KTL A;  5J41 A;  2FHE A;  4K1F A;  3I9V 2;  1JHB A;  2VOC A;  4BL7 A;  1S3A A;  1WMJ A;  4PGT A;  1N2A A;  2PMT A;  2WZ9 A;  2K8S A;  3IBH A;  5JCG A;  4IVF A;  2PN8 A;  2A2P A;  4MMM A;  1BYE A;  2V1M A;  4F03 A;  3E9J B;  1HYU A;  4KSO A;  1GSE A;  1VF4 A;  2MMZ A;  2YZU A;  1SJI A;  3J7Y k;  3DGQ A;  3A2V A;  2H76 A;  5HR0 A;  4DSQ A;  1GTA A;  3QFA C;  1NM3 A;  4BVY A;  2C80 A;  2F8A A;  5A4W A;  4LL4 B;  4Z2U A;  1PGT A;  4P3Y B;  3DYR A;  4MPF A;  3GV1 A;  3U6V A;  17GS A;  2HNL A;  1OC8 A;  2L6C A;  5LD0 A;  3GIX A;  4FIW A;  1OAZ A;  4HQS A;  1PSQ A;  4N0Z A;  3TKS C;  2IL3 A;  1K3O A;  1XWC A;  1XIY A;  2IPA A;  3R3E A;  4ZB8 A;  5CNW A;  4NAX A;  3BOA A;  4CY6 A;  2HFD A;  2R2J A;  2JSZ A;  2LRT A;  4PX1 A;  1T00 A;  1SU9 A;  4GST A;  3H1N A;  3KIJ A;  3M3M A;  5IO2 A;  3GN3 A;  2DBC A;  4K7I A;  2YV9 A;  3L0H A;  1E2Y A;  1ST9 A;  3VLN A;  3CSH A;  2YP6 A;  4HJM A;  3I43 A;  2WFC A;  1ERV A;  2DKI A;  1BQ7 A;  1K0A A;  2AAW A;  2H0H A;  2H6Z A;  2HSH A;  2B7J A;  2EIO A;  4RQR A;  2HRF A;  4FYC A;  1A0R P;  4GSS A;  1ZYE A;  4BPY A;  2V32 A;  2GTU A;  2CAQ A;  2LRC A;  2PVQ A;  2N5A A;  14GS A;  4KND A;  2VD0 A;  3TKS E;  4KB3 A;  3TKS A;  1ZOF A;  4MJA A;  5CRH A;  2OBI A;  1GTU A;  2JL4 A;  1TOF A;  2J9H A;  1M9A A;  3F4R A;  1M99 A;  3FY7 A;  3S9F A;  4XS4 A;  4TXO B;  1XWA A;  3ISO A;  8GSS A;  2OJL A;  3KD0 A;  2GZZ A;  2HXK A;  4PXO A;  5J4U A;  3EYT A;  2A4V A;  2PVO C;  3H8Q A;  3RPN A;  4XCS A;  3F9U A;  2X64 A;  1BAY A;  1KTE A;  1XWK A;  2XPE A;  3GKM A;  1W4V A;  1ABA A;  1XW9 A;  3M0F A;  1TJD A;  5DDL A;  2A2R A;  1XPV A;  5EY6 A;  2E2G A;  1V40 A;  4JU5 A;  1PX7 A;  3LYP A;  5F05 A;  1U3A A;  2H71 A;  3HVX A;  1HQO A;  2CVD A;  3HHV A;  2LST A;  1H4O A;  2AB6 A;  4MZB A;  3A3T A;  3TKR A;  2VCQ A;  4HJ2 A;  3RAZ A;  2LTK A;  4K7O A;  4WBJ A;  9GSS A;  3TRX A;  1W89 A;  1AW9 A;  4ULX A;  5DAL A;  3GH9 A;  5ECO B;  5ECR B;  2DKH A;  4GCI A;  2BTO T;  3BD2 A;  1GH2 A;  4EDZ A;  5GSS A;  2ON7 A;  3BBY A;  3ZL5 A;  2H1B A;  4GRF A;  2L6D A;  4L5L A;  4N11 A;  1G6W A;  3WD6 A;  3RPP A;  2RLI A;  4J57 E;  2RM5 A;  1B9X C;  2VL3 A;  1SKW B;  3ED3 A;  1T7P B;  4ML1 A;  2YV7 A;  4ZXG A;  1B9Y C;  3IAS 2;  2O7K A;  2WB9 A;  3VK9 A;  2H1A A;  1HD2 A;  5AN1 A;  1URM A;  2RII A;  2OAC A;  5J3R A;  4TW5 A;  2E2M A;  3LJR A;  5D9T A;  3F0I A;  4F82 A;  2H6X A;  1GSD A;  5IMZ A;  4CY8 A;  4V2M A;  5DVB A;  4JBB A;  2VUP A;  4IQA A;  1VF1 A;  1SJZ A;  1TDI A;  22GS A;  5ECL B;  4JR6 A;  2DML A;  5G30 A;  1G6Y A;  3FR3 A;  3KGK A;  2LNS A;  4WBR D;  4A5P A;  2C8U A;  5IPG A;  2JZR A;  5IPH A;  3M9K A;  3IK9 A;  1EP8 A;  4MJB A;  1U88 A;  4KW6 A;  3UJ1 A;  2K8V A;  2FWG A;  1K0O A;  3O6T A;  4N0V A;  4ZBD A;  1GL8 A;  4KH7 A;  2VM2 A;  2I1U A;  3UBL A;  2LEG A;  3I6A A;  4IJI A;  1YDK A;  3E0U A;  3ZYW A;  4E8E A;  5GZZ B;  1XBS A;  1YEP A;  2X8G A;  3M8N A;  3DD3 A;  2HZE A;  2CQ9 A;  1T1V A;  2KP1 A;  4X0X A;  3R2Q A;  3GUR A;  2X8H A;  2LQO A;  2H30 A;  3ZVJ A;  4O92 A;  2CZ2 A;  1OC9 A;  4O5R A;  1X9W B;  1ZGN A;  2JZS A;  4MPG A;  2YWO A;  2OE3 A;  3EVI A;  2L4Q A;  2VAF A;  2L57 A;  4KDU A;  1IYH A;  2DLX A;  3IR4 A;  3EMP A;  1A2J A;  2WUL A;  4K9Z A;  2JAD A;  1Q4J A;  4HU7 A;  3ZVJ D;  2HE3 A;  3WGE A;  4LMV A;  2FLS A;  1PL1 A;  1SK2 A;  1ERW A;  2PU9 C;  5IIZ A;  4TKY A;  3TUE A;  3ZML A;  1Z7P A;  5B7C A;  3ERG A;  1O6J A;  1SJ6 A;  2HZF A;  4D73 A;  2B7K A;  4XTS A;  2MBS A;  2C3Q A;  2M80 A;  1XVQ A;  3GA4 A;  5HQP A;  3IDV A;  4KCA A;  4TXO A;  2UZ8 A;  4HI7 A;  1U3I A;  3LG6 A;  4ECC A;  1S3C A;  4LLR A;  1K0D A;  4KX4 A;  4KE3 A;  4IKH A;  2NBS A;  1YEX A;  1SK1 A;  2V6O A;  3F3R A;  1JFU A;  2MMN A;  1THO A;  2H8L A;  1LJR A;  1FAA A;  3UBK A;  4ICY A;  3KCM A;  1QK8 A;  3GL5 A;  1XVW A;  2IIY A;  4HZ2 A;  3HZ4 A;  2R5G A;  4PQH A;  3D22 A;  2XBI A;  3QOU A;  1WOU A;  5ECK B;  4POB A;  4Q5R A;  2GZY A;  4ID0 A;  4XS4 B;  3DEX A;  1F6M C;  2I9H A;  3KTB A;  2GVP A;  3IV4 A;  3CSJ A;  1ON4 A;  1FW1 A;  3PR8 A;  2LNT A;  5IOX A;  3F4S A;  4WET A;  2B1K A;  1SD8 A;  4TR4 A;  1C72 A;  1AUC A;  1V9W A;  2GGT A;  3F4T A;  1OVN A;  1TXX A;  2FWF A;  1O81 A;  1GRX A;  1CQG A;  3F6F A;  1TRS A;  4WEY A;  2QA2 A;  1JZR A;  3KMO A;  1BG5 A;  1H75 A;  3D5J A;  3C1S A;  5JCW A;  2AHE A;  1GUL A;  1OYJ A;  5G1K A;  4KUN A;  1K0C A;  1ERU A;  3ERF A;  4DSS A;  2YWN A;  1PQN A;  2NTO A;  2AYT A;  5IMF A;  2GT6 A;  3KM6 A;  3FYG A;  2VO4 A;  4AF2 A;  3RHC A;  5DAL B;  3WYW A;  4EC0 A;  5FT3 A;  1XFL A;  3LFL A;  1GWC A;  1MEK A;  3HXS A;  2DJ0 A;  4FQU A;  6GSS A;  1EOH A;  1A8Y A;  4L8E A;  3GNJ A;  4MZW A;  2H73 A;  1B4P A;  4MA9 A;  5KN1 A;  1VRS D;  5D9X A;  1ZYQ B;  4BWQ A;  2FWE A;  1AXD A;  1WJK A;  2YJH A;  4WF4 A;  3WT2 A;  2B1L A;  4MLY A;  1XW5 A;  1YQ1 A;  3ERW A;  5BMU A;  3TRP A;  5J9B A;  1JLW A;  4DSR A;  1GSF A;  2CVB A;  4PTS A;  2V6K A;  3A5I A;  2R0G A;  2XBQ A;  2B5X A;  2ZUP A;  4WR4 A;  3TRQ A;  2V2G A;  2OAD A;  5JWR B;  2VM1 A;  5IM9 A;  5G5F A;  5LNK e;  3QCP A;  4WR5 A;  1AC1 A;  3TOT A;  5HR2 A;  2H0G A;  2O87 A;  2IMI A;  3M9J A;  19GS A;  3BJ5 A;  1XOB A;  1USB A;  1TW9 A;  1SEN A;  2FY6 A;  2R4V A;  2R0C A;  4OCE A;  2RUE A;  4OFM A;  5D8I A;  5B8A A;  3L78 A;  3L9S A;  4OMV A;  3FHK A;  1F9M A;  1PMT A;  2FUG 2;  2LJR A;  4ECI A;  2C0F A;  1GNE A;  2TIR A;  2DJ1 A;  3FEU A;  4V2L A;  4IW9 A;  4K6X A;  1T8E B;  2YN1 A;  1ERT A;  4MJE A;  2HSY A;  4GSN A;  4JR4 A;  1QFN A;  1THX A;  1GSU A;  1XZO A;  4K2D A;  4DVC A;  3LW9 A;  2C0D A;  2C3T A;  2QGV A;  1OE8 A;  4POM A;  2HZE B;  4ZBA A;  3CSI A;  3P8W A;  5L71 A;  4QL9 A;  2WJU A;  2FGX A;  3IXR A;  1MD3 A;  3QD9 A;  1O8W A;  1ZYP A;  2M46 A;  3GSS A;  1OC9 B;  6GSW A;  2LJK A;  5ECQ B;  2I4A A;  4FO5 A;  1RQM A;  1M2A A;  3FR9 A;  4I5Q A;  1PD2 1;  3Q18 A;  4GWR A;  2B3S A;  4IGJ A;  2HT9 A;  5DJM A;  3D6I A;  1N8J A;  1UA5 A;  4HZ4 A;  2H72 A;  4NHZ A;  5D96 A;  2VCX A;  3E3E A;  4QL7 A;  1GUM A;  4LL1 B;  1TTZ A;  4PNF A;  3W8J A;  3CYN A;  1ILO A;  3EU3 A;  5KN2 A;  5CRG A;  4D73 B;  1XWB A;  2TRC P;  1R4W A;  3GFK A;  3FR6 A;  5DQS A;  2R0P A;  3TJB A;  3QPM A;  3LWA A;  4POK A;  4LA1 A;  3KJY A;  1F2E A;  1V57 A;  4MDC A;  1G7E A;  2VD1 A;  4XS6 A;  1S3D A;  4ILF A;  1XW6 A;  1M2D A;  3HY2 A;  2GDR A;  2G2Q A;  4NXI A;  3HKR A;  2MZC A;  5CRW A;  1TRV A;  1LBK A;  2HRK A;  1Z3E A;  3UL3 A;  5CAX A;  1AIU A;  4HUA A;  2D2Z A;  4EE0 A;  2FNO A;  2GQL A;  2WCI A;  3EC3 A;  2X4A A;  2H1G A;  6GST A;  1YKA A;  2GST A;  3LEF A;  4K0N A;  3IK7 A;  1EWX A;  3C71 A;  4V1A p;  4QQ7 A;  6GSX A;  3D21 A;  1DE2 A;  2GLR A;  3TCO A;  2YPM A;  3TKP A;  4IP1 A;  5B6N A;  4X4J A;  3J7Y b;  3LSZ A;  3KP8 A;  1B4Q A;  2KUC A;  1T4Z A;  3TGZ A;  4BVX A;  3F3Q A;  2WGR A;  4G19 A;  1GP1 A;  1NSW A;  4F0C A;  2XC2 A;  3MIX A;  4TR1 A;  3W6G A;  2V41 A;  4GLT A;  1PX6 A;  4EDY A;  1Y6E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...