2RLIA

Solution structure of cu(i) human sco2
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
170
structure length
170
Chain Sequence
SFTGQGDFHLLDHRGRARCKADFRGQWVLMYFGFTHCPDICPDELEKLVQVVRQLEAEPGLPPVQPVFITVDPERDDVEAMARYVQDFHPRLLGLTGSTKQVAQASHSYRVYYNAGPKDEDQDYIVDHSIAIYLLNPDGLFTDYYGRSRSAEQISDSVRRHMAAFRSVLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal transport
molecule keywords SCO2 protein homolog, mitochondrial
publication title A Structural Characterization of Human SCO2
pubmed doi rcsb
source organism Homo sapiens
total genus 44
structure length 170
sequence length 170
ec nomenclature
pdb deposition date 2007-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02630 SCO1-SenC SCO1/SenC
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2rliA00
2K9FA 5A4VA 2DC5A 4TOPA 3TJBA 1K0BA 5JCWA 4BPYA 3M0FA 1VF3A 2IPAA 1SL0B 3H4KA 2R3XA 3FR3A 1YJ6A 3BBYA 4YAPA 5HFKA 3EINA 2YCDA 2X64A 4ZL9A 2FHEA 2EIQA 2H1GA 4XRAA 3IV4A 3CBUA 2C3TA 1O6JA 1B48A 1SJZA 5IMFA 1ZCPA 3PGTA 2B6MA 5B6NA 1SJIA 1THOA 1TRSA 2YZHA 1OC9A 2LTKA 1SYRA 1M2BA 1QMVA 3KEBA 4YH2A 2LRCA 1TRUA 3TOTA 2H6YA 5A4WA 2HSYA 5LCZA 2C4JA 3Q19A 1TU8A 1EEJA 1HNCA 3KGKA 1VF4A 4NHZA 1IYHA 5IOWA 2PERA 1ERWA 4V1Ag 2JZTA 4O7HA 3OR5A 3ZFBA 5B8BA 1HNBA 4I6XA 4KE3A 2WULA 4NWYA 4H86A 5D9WA 2B5EA 1K3OA 3TCOA 2VLTA 3BOAA 1V58A 4Z7XA 4TW5A 1S3CA 13GSA 1USBA 1YEXA 3UIWA 2REMA 4MK3A 2WZ9A 1G7EA 3JCML 1T4YA 2XC2A 4XS4B 5C04A 1O8XA 4O92A 3TJJA 4D73B 3A2XA 4FYCA 5G30A 3C73A 1EP8A 4ILFA 2KOKA 1V98A 3RPPA 4HQSA 4X0XA 3QPMA 1G0TA 3ZLPA 1YKCA 3FYGA 1T7PB 4K7OA 4RI7A 3LSZA 4IKHA 2GZZA 2I9HA 1JZOA 4KDXA 2H72A 3US3A 3KP9A 3O3TA 5ECIB 3C1SA 1TK0B 1A8YA 1NW2A 4DSRA 2DMMA 4MZWA 4ZB9A 2EIOA 5EL8A 2YPMA 2R37A 1AQVA 1OC3A 1M99A 2FGXA 1GUKA 1PA3A 2IMKA 2A2SA 4POMA 1F37A 3KXOA 4RI6A 4F9ZA 4RQXA 2C80A 2B5XA 3HA9A 1MEKA 1YEPA 4LMWA 2WDUA 5EPFA 3UL3A 4JR6A 1SJ6A 4MP4A 4GQFA 4WETA 3DWVA 4ECJA 3L4NA 5A4UA 5AIVA 2LV3A 5CAXA 2H76A 4LA1A 4N0ZA 1C72A 4BWQA 2VCXA 1XVWA 1XPVA 3EE2A 4IN0A 2MBTA 3J7Yb 3VWVA 1VF2A 2XBIA 2IJYA 2RIIA 4MA9A 5D96A 4TXOB 1I9DA 2ZCTA 1HQOA 3UJ1A 4RQRA 3NOFA 2NBSA 2VCTA 2GSTA 3I43A 3EMPA 4JBBA 4PUAA 3VK9A 1F3AA 3GSTA 1PKZA 1N2AA 3ZITA 5E4WA 4Q5RA 1U3AA 2KUCA 1N8JA 3LEFA 2MMZA 2YWMA 4KGIA 5ECOB 2O89A 1XFLA 4CHSA 2LQOA 3F6DA 5ABRA 4IVFA 4EUYA 1E2YA 3E3EA 3F0IA 1T4ZA 2XBQA 4OFTA 4MLYA 2X8HA 2JZSA 3D4TA 3F6FA 3VPQA 5ELGA 3L9SA 1BAYA 3KM6A 3KMOA 1MD3A 2BJXA 2PU9C 4AJ6A 1ERTA 4I8BA 4X1UA 4OO4A 2AUVA 3EVIA 2GSRA 4ZBAA 3HVVA 3HDCA 4F03A 5GSSA 1HNAA 4KSOA 2Z9SA 5COHA 5CP1A 2G2QA 1TXXA 2A2RA 5D73A 4K0GA 2DLXA 4X43A 3ERFA 2KLXA 4DSSA 1ILOA 1E6BA 1JZWA 1PRXA 2VCVA 1WOUA 2GZYA 1M2DA 3ZZXA 4ZB6A 5JCGA 9GSSA 2V2GA 1FB0A 2PBJA 2L59A 2ES7A 2OJLA 2DIYA 4QL7A 1EGOA 5AN1A 1EGRA 3ZMLA 2C0DA 2N5FA 4KX4A 3TJFA 5KEJA 1GRXA 2RLIA 5H5QA 4AJ7A 5F07A 5D9VA 5F05A 4HEA2 2N5AA 4XHMA 3WD6A 4MF5A 1T00A 4KAEA 4IW9A 3FZ5A 3QAVA 1LJRA 3ERGA 4MABA 1OAZA 4PQ1A 3UVHA 6GSYA 2FD3A 5G5FA 3ZFLA 2LRTA 3RHCA 2OACA 2LRNA 1R7HA 4IP1A 1EV4A 1PKWA 3CSHA 5H5RA 2FUG2 1B9YC 4MH3A 1AW9A 1SKWB 2KHPA 1O73A 2OBKA 4F0CA 1OE7A 1NHOA 5IQYA 1ZL9A 4PX1A 2H0GA 4QQ7A 4L0WA 2GT5A 1KNGA 1XOBA 4V2MA 3P90A 2PN8A 1Z6MA 4EDZA 3LYPA 2LS5A 3UBLA 1GUMA 1Z3EA 3DGQA 3O6TA 1K0MA 1MD4A 2IIYA 2CVKA 4LL1B 3HJPA 3GFKA 2F8AA 20GSA 1JZRA 1XXUA 3UOMA 2GSQA 2MMOA 8GSSA 2R5GA 3APSA 1PQNA 3V1WA 1T1VA 3KZQA 1MDIA 2J9HA 2HZEA 2RM6A 5GZZB 5IMZA 3K8NA 1M0UA 5JWQB 2YN1A 4ML6A 2HNLA 1DE1A 1TI3A 1BJXA 1V57A 5LNKe 2P5QA 2LSTA 3NZNA 1VGLA 1XW9A 1YF0A 3GA4A 3HCZA 4YAVA 2HI7A 2L6CA 5IPGA 4FYBA 1K0DA 2P31A 4TR1B 1WMJA 5DJLA 3FY7A 3ZIVA 4FH8A 1GP1A 4EKZA 3TB2A 2TRCP 1TK5B 1B9XC 4WF4A 1GSYA 3CRTA 2NPBA 3GIXA 1R5AA 3KMNA 3P8WA 1CQHA 4KW6A 3IRAA 1MTCA 1A2LA 6GSSA 2QKEA 3KH7A 2I4AA 1GTBA 3SBCA 4POKA 4WR4A 2LJKA 1TDIA 2FCHA 1M9AA 1ST9A 3LYKA 3I6AA 4OFMA 4N11A 12GSA 2YWIA 3BCIA 5ECLB 1OYJA 3LXZA 4I2UA 2GGTA 2H30A 3VI7A 3N5OA 4KB3A 3HKRA 2FA4A 4MPGA 4ID0A 2B5YA 1QGVA 2EIRA 5KN1A 5FT3A 2IMIA 3GX8A 2HE3A 3R2QA 3SWLA 4ZXGA 4XCSA 3EWLA 4HUAA 4J56E 1V2AA 1BX9A 3CSIA 2KP1A 4K2DA 2VL9A 3DKSA 1DSBA 4XS1A 4MJCA 3G7JA 3M8NA 1A0RP 3VURA 4L8EA 1V40A 1FW1A 2EC4A 4HZ4A 4EL1A 4PXOA 4F2IA 1ZMAA 4N0VA 3RAZA 5IO2A 4TVEA 5KN3A 1RK4A 1K0NA 4I97A 4OWYA 5DAKB 3QDNA 2BMXA 1SKRB 3WT2A 2L4CA 2YWNA 4HI7A 2H6ZA 3DMLA 1UN2A 10GSA 4HU7A 3GH6A 2OE3A 3ZMKA 1BEDA 4KDUA 2FA8A 2IFQA 1X5DA 4IS0A 2E0QA 4Q5FA 1AQXA 2VL3A 3F9UA 3PH9A 3QAWA 4KCEA 3N9JA 2VLVA 1K3LA 4JRRA 4NAXA 2BTOT 3E9JB 2M72A 4IELA 1GTAA 4GSSA 1U6TA 1GSDA 2VD1A 4PQHA 1ZOFA 5G5EA 3HXSA 3MDKA 1WP0A 1FOVA 4K0NA 2PMTA 2H6XA 1A2JA 1G6YA 2H70A 5IMCA 4ECIA 4OCFA 1M7TA 5D9TA 3CXGA 1PL2A 1OC9B 3GH9A 3HVXA 5DALA 4EDYA 2H71A 5F06A 4AJ8A 2I81A 3IBHA 4V1Ap 4ZIJA 2F3MA 1GLQA 3TUEA 1JZDA 2K8SA 5J3RA 4QL9A 4PQIA 4F0BA 6GSUA 1PN9A 5HR2A 4TRXA 3KTBA 1SL2B 1S3AA 1CQGA 2DMLA 4FYUA 2B1KA 1VRSD 1EOGA 2GQKA 3RDWA 4K7IA 4MJEA 4GXZA 2C8UA 3GKMA 4BVYA 1ABAA 3FEUA 4EVMA 3WYWA 5J4UA 2IN3A 2GQLA 3W8JA 2WB9A 3IPZA 2M46A 1A2MA 1R4WA 4OMVA 1I5GA 2OA7A 4WR5A 1PX6A 2RUFA 4J57E 1WPIA 1TU7A 1AC1A 2LUSA 4ML1A 5ECSA 3LJRA 2F51A 2B7KA 4ACSA 1GULA 2ZUPA 5HR0A 1ML6A 3IDVA 4NXIA 2MZCA 3KH9A 1YQ1A 3S9FA 1ACVA 3M3MA 4NV2A 1JLWA 1EEMA 3J7Yk 2NDOA 2YP6A 4WBJA 2CX3A 4KA0A 4AGSA 4BL7A 14GSA 2H19A 3GKNA 4K8MA 5DCGA 1J0FA 2DJ3A 3G7IA 1WWJA 1K0CA 5H5SA 4OD7A 5IOXA 3W6GA 1EOHA 4MMMA 1WRYA 2HRNA 2L4QA 1FO5A 3QAGA 4PUFC 4BA7A 1ERUA 3TKSA 2C1YA 3F4SA 3IK7A 3IE3A 1XIYA 1GL8A 1RW1A 3EC3A 3FRCA 1JFUA 2FWHA 2ON5A 2XPDA 2J23A 1KEBA 2F8FA 4EE0A 2MMNA 1BYEA 1B4PA 1XVQA 2GT6A 1Y6EA 2H8LA 3MAKA 1Z5YE 5D8IA 3D6IA 3IHQA 4TR0A 5CREA 3TKRA 4CW9A 2HSHA 2I3YA 4RUVA 3D22A 5IO0A 2IWTA 5DDLA 1QFNA 4DVCA 5CNWA 4KCAA 4K9ZA 2H0HA 1OE8A 3EU4A 2QC7A 5G31A 5DQSA 2VOCA 3GL3A 5DCHA 4O32A 3HJMA 1H75A 1GNEA 2CT6A 3QD9A 4K1FA 2I1UA 5ELAA 1QUWA 4G10A 3GSSA 2H73A 19GSA 1QK8A 2YZUA 3WT1A 4Q5NA 2H1AA 2X8CA 4POLA 1JLVA 4MCUA 1OVNA 2RM5A 1WE0A 3FR9A 2WJUA 4YQVA 3D0ZA 4GRFA 3UARA 2A4VA 3HJOA 4GSTA 1BG5A 3APQA 2VLUA 1WJKA 2PVOC 1R5PA 3GTUA 2JSYA 1KTEA 1GSFA 3LG6A 1ZYEA 2B1LA 3TDGA 2CVBA 3F3RA 3TOUA 3ME8A 2E7PA 17GSA 2VD0A 4E8HA 6GSWA 1OKTA 3HZ8A 2H66A 4NHWA 5JWOB 1GTUA 2MYGA 1A0FA 4DSSB 3UEMA 3DD3A 4DSQA 3LWAA 2H0IA 4N30A 2HXKA 1SD9A 3Q18A 4ISDA 2VO4A 4ECCA 4WF5A 5F0GA 2B7JA 2CQ9A 1YF1A 2MMAA 2FNOA 3GL5A 3FK8A 4HQZA 5AIXA 3GYKA 3I69A 2VM2A 5FHIA 1FAAA 4NPBA 4KNDA 3F4TA 3WGXA 1AQWA 2LKUA 3QFBC 2DJ0A 2ON7A 3LGCA 3GRXA 3FHKA 2F9SA 3TGZA 1F6MC 3L78A 4N10A 4IGJA 5IM9A 1PMTA 3QFAC 1Z6NA 2GZPA 2H74A 1YKAA 4LLRA 4TR3A 5JWRB 4IQ1A 1GSSA 1XWAA 1UVZA 2HRFA 3AY8A 2GSSA 1XWGA 4FO5A 4V2LA 3WGDA 2C0GA 3A3TA 3IAS2 2FWGA 6GSVA 5IMAA 2XHFA 4XS6A 4MH2A 4V2NA 4XTSA 1DBYA 5IMDA 3DRNA 1HYUA 4GSNA 5DQYA 2TIRA 3L9VA 5HR1A 5ECHB 4YQMA 4Q5QA 1Q98A 5CRGA 1J08A 5HQPA 1TP9A 2IL3A 3GKXA 3CSJA 4O5RA 4HS1A 2CX4A 1Z7RA 1ON4A 3GNJA 1O8WA 1X9SB 3U5RE 4XS4A 2R6KA 2XPEA 3VWWA 1LU4A 1GUHA 5ID2A 3GV1A 4MZCA 2LJAA 1XOAA 2K8VA 3C7MA 4YQUA 1PGTA 4D73A 3EYTA 5J9CA 1F2EA 3DVWA 2HZEB 1A24A 4EC0A 4HJ2A 3UAPA 3MWHA 5DJMA 5B7CA 3LQ7A 4MJAA 5CRHA 2H1BA 4ZBDA 1UA5A 1K0AA 2L57A 3TJKA 4PNFA 3F8UA 1AAZA 1DUGA 2GVPA 2AJQB 3CYNA 4WXTA 2WCIA 1SENA 2X8GA 3PINA 4MF6A 1S3DA 3O76A 5ECNB 3IR4A 4HDEA 2LNSA 1GH2A 1Q4JA 2DJ2A 2JACA 2AHEA 2YV7A 3G7YA 4ZBBA 3L9UA 3ED3A 4LL4B 1Y25A 4I2TA 5IMVA 16GSA 1XCCA 4ZB8A 2VUPA 3ZL5A 1U88A 1TW9A 3ZVJD 5HR3A 1TJDA 4JU5A 4KUNA 1XWKA 2CA8A 2DJ1A 4I5QA 4WKWA 1U87A 3VPTA 7GSSA 3EMXA 5C00A 1FVJA 1XWBA 3UMAA 2WFCA 5G1LA 5GAPD 2DJKA 2DIZA 3CRUA 3NIVA 2H75A 5G1KA 1TI1A 3BJ5A 2V1MA 5D93A 1PX7A 2GDRA 4MZBA 2CVDA 4XIHA 3ERWA 2HT9A 2V6OA 1JHBA 2VCWA 1TRVA 3TRXA 5DVBA 3W8SA 1AXDA 1GNWA 3MNGA 1XWCA 5ID2B 4IHUA 3VWXA 2H1DA 2QGVA 2CAQA 5HFGA 2FLSA 3ZREA 3RHBA 3P7XA 1OC8A 1X5CA 1FB6A 4G2EA 3F63A 2VM1A 3KCMA 5J41A 4TXOA 1J9BA 3DYRA 4AF2A 3VFIA 1K3YA 2OKAA 2O87A 2YWOA 3VI5A 5EY6A 2VL2C 1XW5A 2MBSA 2CV4A 1M2AA 4JR4A 1YY7A 1TOFA 2YOIA 1UC7A 1ZZYA 4MPFA 1F9MA 3I9V2 1X9WB 4K6XA 3A5WA 4GCIA 1O85A 3A2WA 3DIEA 2GTUA 5INYA 4P3YB 4GWRA 3CTGA 4IJ3A 4TR4A 3BD2A 3IXRA 1NHYA 2L5LA 4IJIA 4TN8A 2YV9A 2AB6A 4JE1A 3FKFA 2FWFA 3KP8A 3A2VA 3TKSE 3Q74A 1F3BA 3F3QA 2WRTA 3GN3A 1SK0A 5G2ZA 5DBQA 1MDKA 3C1RA 4ULXA 3GHAA 1B4QA 1GTIA 3L0HA 2R4VA 1FHEA 1URMA 4IQAA 4EO3A 2VAFA 1O81A 3ZIJA 4CDOA 3KIJA 4K7NA 5ENUA 4E8EA 3FZAA 1HD2A 2PPTA 2IFQB 3FR6A 2P0GA 1EV9A 1QXHA 3DEXA 2X99A 4KDYA 5D9XA 3H1NA 2IMDA 3PR8A 2FWEA 5HFIA 2PVQA 5AISA 1BQ7A 2JU5A 2VCZA 2B3SA 2CZ2A 4LMVA 1A8LA 3GUSA 5L71A 3RBTA 1WIKA 1T3BA 2C0FA 1AUCA 1RQMA 2C3QA 2GLRA 1Z7PA 4F82A 1DE2A 2LEGA 4OO5A 2D2ZA 2JL4A 1GSUA 4TKYA 3KD0A 4J2FA 4IBPA 1ERVA 4HJMA 5ECMB 5DALB 3C8EA 1TRWA 3TRQA 4TXVA 2VIMA 4ZILA 3UBKA 2OADA 3CMIA 1XBSA 2CAIA 2HFDA 2M80A 2V32A 5KN0A 3FZ9A 1PSQA 2PUKC 1M9BA 2AV4A 2LQQA 4KSMA 2OE0A 3TRPA 2O8VB 1G7OA 2YANA 2AYTA 1X5EA 3HZ4A 1H4OA 3HVSA 2OBIA 4EF0A 3HD5A 4OCEA 2O85A 1GLPA 1MDJA 4L5OA 4XRDA 2OE1A 1EP7A 3ZTLA 2K6VA 4G9HA 4L5LA 3EURA 1SK2A 3LXTA 1EZKA 3M9JA 2DJJA 3H8QA 3IK9A 4HOJA 4WEYA 18GSA 3VLNA 3TKQA 11GSA 2G0FA 4BWSA 4EXJA 2GS3A 3HHVA 3D5JA 3KTLA 3GX0A 1X9MB 1A23A 5CYYA 5J9BA 6GSXA 2K18A 5ECKB 5LD0A 4BVXA 4L0UA 1W89A 4MF7A 5B8AA 1T8EB 3D21A 1U3IA 2JSZA 1O7UA 3BCKA 3G9BA 1NSWA 1ZGNA 1SL1B 3APOA 5AGYA 2NTOA 3MSZA 5CRDA 2HLSA 3FZ4A 1NM3A 5J5NA 6GSTA 1PL1A 2HZFA 2PWJA 2LJRA 3C71A 5GAND 4IP6A 2AAWA 3DXBA 2DSAA 4NMUA 1W4VA 2GQMA 4GTUA 2TRXA 3KJYA 2JZRA 2CZ3A 3LORA 2FY6A 3HYPA 4NV5A 4WBRD 3QCPA 4POBA 2O7KA 1SU9A 1FG4A 2P5RA 5GSTA 2E2GA 4PGTA 3Q6OA 1V9WA 3M1GA 2V6KA 1SYXA 4TR1A 1KBNA 2KP2A 5CRWA 5ECQB 3GMFA 3E0UA 4FIWA 1TK8B 2QSIA 1GSEA 3H93A 1B8XA 1XZOA 3U6VA 1K0OA 4DEJA 3P2AA 4HZ2A 1TKDB 1SK1A 5IPHA 5JCUA 3M9KA 1EWXA 3IC4A 3D4MA 4PNGA 4G19A 3WGEA 2L6DA 3VWUA 1X0RA 22GSA 2DBCA 4JEDA 2H01A 3UVTA 3TKPA 4JZQA 3IOSA 1LBKA 2L5OA 5E59A 4GF0A 5A5KA 2ALBA 3ME7A 3IA1A 2N5BA 2C3NA 1G6WA 3ZRDA 1SKSB 3QR6A 5F8BA 2R2JA 2HYXA 3GURA 1YDKA 5IIZA 2IMFA 3IAM2 5ECPB 1GWCA 4ZL8A 1YZXA 3GKKA 2PGTA 2YNXA 1TTZA 2LNTA 1Z9HA 4GLTA 1R26A 3RPNA 4PURA 3ZVJA 3CTFA 5B6MA 2ZNMA 5KN2A 3TKSC 5CO3A 4HU9A 1OKDA 3QMXA 2RUEA 1GSQA 1FVKA 3QOUA 2E2MA 2WS2A 4KH7A 1THXA 4ZL7A 1SD8A 3H79A 5EVOA 1IYIA 3DVXA 3EU3A 3ISOA 3GTUB 2IMEA 3FW2A 1VF1A 3ZYWA 2VL2A 2V41A 2YJHA 4MDCA 2JADA 2C0EA 1AIUA 3HY2A 2YJ7A 1PD21 1XW6A 3LFLA 4OFNA 5DAKA 4ECBA 1QQ2A 4MJBA 2VCQA 3TJGA 1ZYQB 5FWGA 2WGRA 3F4RA 4GQCA 2NVLA 5ECRB
chains in the Genus database with same CATH superfamily
2K9FA 5A4VA 2DC5A 4TOPA 3TJBA 1K0BA 5JCWA 4BPYA 3M0FA 1VF3A 2IPAA 1SL0B 3H4KA 2R3XA 3FR3A 1YJ6A 3BBYA 4YAPA 5HFKA 3EINA 2YCDA 2X64A 4ZL9A 2FHEA 2EIQA 2H1GA 4XRAA 3IV4A 3CBUA 2C3TA 1O6JA 1B48A 1SJZA 5IMFA 1ZCPA 3PGTA 2B6MA 5B6NA 1SJIA 1THOA 4Z2UA 1TRSA 2YZHA 1OC9A 2LTKA 1SYRA 1M2BA 1QMVA 3KEBA 4YH2A 2LRCA 1TRUA 3TOTA 2H6YA 4MNNA 5A4WA 2HSYA 5LCZA 2C4JA 3Q19A 1TU8A 1EEJA 1HNCA 3KGKA 1VF4A 4NHZA 1IYHA 5IOWA 2PERA 1ERWA 4V1Ag 2JZTA 4O7HA 3OR5A 4CY6A 3ZFBA 5B8BA 1HNBA 4I6XA 4KE3A 2WULA 4NWYA 4H86A 5D9WA 2B5EA 1K3OA 3TCOA 2VLTA 3BOAA 1V58A 4Z7XA 4TW5A 1S3CA 13GSA 1USBA 1YEXA 3UIWA 2REMA 4MK3A 2WZ9A 1G7EA 3JCML 1T4YA 2XC2A 4XS4B 4K5SA 2R0CA 3PPUA 5C04A 1O8XA 4O92A 3TJJA 4D73B 3A2XA 4FYCA 5G30A 3C73A 1EP8A 4ILFA 2KOKA 1V98A 3RPPA 4HQSA 4X0XA 3QPMA 1G0TA 3ZLPA 1YKCA 3FYGA 1T7PB 4K7OA 4RI7A 3LSZA 4IKHA 2GZZA 2I9HA 1JZOA 4KDXA 2H72A 3US3A 3KP9A 3O3TA 4PTSA 5ECIB 3C1SA 1TK0B 1A8YA 1NW2A 4DSRA 2DMMA 4MZWA 4ZB9A 2EIOA 5EL8A 1S3RA 2YPMA 2R37A 1AQVA 1OC3A 1M99A 2FGXA 1GUKA 1PA3A 2IMKA 2A2SA 4POMA 1F37A 3KXOA 4RI6A 4F9ZA 4RQXA 2C80A 2B5XA 3HA9A 1MEKA 1YEPA 4LMWA 2WDUA 5EPFA 3UL3A 4JR6A 1SJ6A 4MP4A 4GQFA 4WETA 3EPTA 3DWVA 4ECJA 3L4NA 5A4UA 5AIVA 4KF9A 2LV3A 5CAXA 2H76A 4LA1A 4N0ZA 1C72A 4BWQA 2VCXA 4X4JA 1XVWA 1XPVA 3EE2A 4IN0A 2MBTA 3J7Yb 3VWVA 1VF2A 2XBIA 2IJYA 2RIIA 4MA9A 5D96A 4TXOB 1I9DA 2ZCTA 1HQOA 3UJ1A 4RQRA 3NOFA 2NBSA 2VCTA 2GSTA 3I43A 3EMPA 4JBBA 4PUAA 3VK9A 1F3AA 3GSTA 1PKZA 1N2AA 3ZITA 4Q5RA 5E4WA 1U3AA 2KUCA 1N8JA 3LEFA 2MMZA 2YWMA 4KGIA 2QA2A 5ECOB 2O89A 1XFLA 4CHSA 3HVNA 2LQOA 3F6DA 5ABRA 4IVFA 4EUYA 1E2YA 3E3EA 3F0IA 1T4ZA 2XBQA 4OFTA 4MLYA 2X8HA 2JZSA 3D4TA 3F6FA 3VPQA 5ELGA 3L9SA 1BAYA 3KM6A 3KMOA 1MD3A 2BJXA 2PU9C 4AJ6A 1ERTA 4I8BA 4X1UA 4OO4A 2AUVA 3EVIA 2GSRA 4ZBAA 3HVVA 3HDCA 4F03A 5GSSA 1HNAA 4KSOA 2Z9SA 5COHA 5CP1A 2G2QA 1TXXA 2A2RA 5D73A 4K0GA 2DLXA 4X43A 3ERFA 2KLXA 5KOWA 4DSSA 1ILOA 1E6BA 1JZWA 1PRXA 2VCVA 1WOUA 2GZYA 1M2DA 3ZZXA 4ZB6A 5JCGA 9GSSA 2V2GA 1FB0A 2PBJA 2L59A 2ES7A 2OJLA 2DIYA 3IHGA 4QL7A 1EGOA 5AN1A 1EGRA 3ZMLA 2C0DA 2N5FA 4KX4A 3TJFA 5KEJA 1GRXA 2RLIA 5H5QA 4AJ7A 5D9VA 5F07A 5F05A 4HEA2 2N5AA 4XHMA 3WD6A 4MF5A 1T00A 4KAEA 4IW9A 5BMUA 3FZ5A 3QAVA 1LJRA 3ERGA 4MABA 1OAZA 4PQ1A 3UVHA 6GSYA 2FD3A 5G5FA 3ZFLA 2HRKA 2LRTA 3RHCA 2OACA 2LRNA 1R7HA 4IP1A 1EV4A 1PKWA 3CSHA 5H5RA 2FUG2 1B9YC 4MH3A 1AW9A 1SKWB 2KHPA 1O73A 2OBKA 4F0CA 1OE7A 1NHOA 5IQYA 1ZL9A 4PX1A 2H0GA 4QQ7A 4L0WA 2GT5A 1KNGA 1XOBA 4V2MA 3P90A 2PN8A 4EIQA 1Z6MA 4EDZA 3LYPA 2LS5A 3UBLA 1GUMA 1Z3EA 3DGQA 2QA1A 3O6TA 1K0MA 1MD4A 2IIYA 2CVKA 4LL1B 3HJPA 3GFKA 2F8AA 20GSA 1JZRA 1XXUA 3UOMA 2GSQA 2MMOA 8GSSA 2R5GA 3APSA 1PQNA 3V1WA 1T1VA 3KZQA 1MDIA 2J9HA 2HZEA 2RM6A 5GZZB 5IMZA 4EIPA 3K8NA 1M0UA 5JWQB 2YN1A 4ML6A 2HNLA 1DE1A 1TI3A 1BJXA 1V57A 5LNKe 2P5QA 2LSTA 3NZNA 1VGLA 1XW9A 1YF0A 3GA4A 3HCZA 4YAVA 2HI7A 2L6CA 5IPGA 4FYBA 1K0DA 2P31A 4YKGA 4TR1B 1WMJA 5DJLA 3FY7A 3ZIVA 4FH8A 1GP1A 2A2PA 4EKZA 3TB2A 2TRCP 1TK5B 1B9XC 4WF4A 1GSYA 3CRTA 2NPBA 3GIXA 1R5AA 3KMNA 3P8WA 1CQHA 4KW6A 3IRAA 1MTCA 1A2LA 6GSSA 2QKEA 3KH7A 2I4AA 1GTBA 3SBCA 4POKA 4WR4A 2LJKA 1TDIA 2FCHA 1M9AA 1ST9A 3LYKA 3I6AA 4OFMA 4N11A 12GSA 2YWIA 3BCIA 5ECLB 1OYJA 2DKHA 1ZYPA 3LXZA 4I2UA 2GGTA 2H30A 3VI7A 4K2XA 3N5OA 1ZYNA 4KB3A 3HKRA 2FA4A 4MPGA 4ID0A 2B5YA 1QGVA 2EIRA 5KN1A 5FT3A 2IMIA 3GX8A 2HE3A 3R2QA 3SWLA 4ZXGA 4XCSA 3EWLA 4HUAA 4J56E 1V2AA 1BX9A 3CSIA 2KP1A 4K2DA 2VL9A 3DKSA 3IC8A 1DSBA 4XS1A 4MJCA 3G7JA 3M8NA 1A0RP 3VURA 4L8EA 1V40A 1FW1A 2EC4A 4HZ4A 4EL1A 4PXOA 4F2IA 1ZMAA 4N0VA 3RAZA 5IO2A 4TVEA 5KN3A 1RK4A 1K0NA 4I97A 4OWYA 5DAKB 4USSA 3QDNA 4Z2TA 2BMXA 1SKRB 3WT2A 2L4CA 2YWNA 4HI7A 2H6ZA 3DMLA 1UN2A 10GSA 4HU7A 3GH6A 2OE3A 3ZMKA 2A4HA 1BEDA 4KDUA 2FA8A 4FQUA 2IFQA 1X5DA 4IS0A 1PFOA 2E0QA 3FMWA 4Q5FA 1AQXA 2VL3A 3F9UA 3PH9A 3QAWA 4KCEA 3N9JA 2VLVA 1K3LA 4JRRA 4NAXA 2BTOT 3E9JB 2M72A 4IELA 1GTAA 4GSSA 1U6TA 1GSDA 2VD1A 4PQHA 1ZOFA 5G5EA 3HXSA 3MDKA 1WP0A 1FOVA 4K0NA 2PMTA 2H6XA 1A2JA 1G6YA 2H70A 5IMCA 4ECIA 4OCFA 1M7TA 5D9TA 3CXGA 1PL2A 1OC9B 3GH9A 3HVXA 5DALA 4EDYA 2H71A 5F06A 4AJ8A 2I81A 3IBHA 4V1Ap 4ZIJA 2F3MA 1GLQA 3TUEA 1JZDA 2K8SA 5J3RA 4QL9A 4PQIA 4F0BA 6GSUA 1PN9A 5HR2A 4TRXA 3KTBA 1SL2B 1S3AA 1CQGA 2DMLA 4FYUA 2B1KA 1VRSD 1EOGA 2GQKA 3RDWA 4K7IA 4MJEA 4GXZA 2C8UA 3GKMA 4BVYA 1ABAA 3FEUA 4EVMA 4HSCX 3WYWA 5J4UA 2IN3A 2GQLA 3W8JA 2WB9A 4Z2RA 3IPZA 2M46A 1A2MA 1R4WA 4OMVA 1I5GA 2OA7A 4WR5A 1PX6A 2RUFA 4J57E 1WPIA 2R0GA 1TU7A 1AC1A 2LUSA 4ML1A 5ECSA 3LJRA 2F51A 2B7KA 4ACSA 1GULA 2ZUPA 5HR0A 1ML6A 3IDVA 4NXIA 2MZCA 3KH9A 1YQ1A 3S9FA 1ACVA 3M3MA 4NV2A 1JLWA 1EEMA 3J7Yk 2NDOA 2YP6A 4WBJA 2CX3A 4KA0A 4AGSA 4BL7A 14GSA 2H19A 3GKNA 4K8MA 5DCGA 1J0FA 2DJ3A 3G7IA 1WWJA 1K0CA 5H5SA 4OD7A 5IOXA 3W6GA 1EOHA 4MMMA 1WRYA 2HRNA 2L4QA 1FO5A 3QAGA 4PUFC 4BA7A 1ERUA 3TKSA 2C1YA 3F4SA 3IK7A 3IE3A 1XIYA 1GL8A 1RW1A 3EC3A 3FRCA 1JFUA 3CQFA 2X4AA 2FWHA 2ON5A 2XPDA 2J23A 1KEBA 2F8FA 4EE0A 2MMNA 1BYEA 1B4PA 1XVQA 2GT6A 1Y6EA 2H8LA 3MAKA 1Z5YE 5D8IA 3D6IA 3IHQA 4TR0A 4G0LA 5CREA 3TKRA 4CW9A 2HSHA 2I3YA 4RUVA 3D22A 5IO0A 2IWTA 5DDLA 1QFNA 4DVCA 5CNWA 4KCAA 4K9ZA 2H0HA 1OE8A 3EU4A 2QC7A 5G31A 5DQSA 2VOCA 3GL3A 5DCHA 4O32A 3HJMA 1H75A 1GNEA 2CT6A 3QD9A 4K1FA 2I1UA 5ELAA 1QUWA 4G10A 3GSSA 2H73A 19GSA 1QK8A 2YZUA 3WT1A 4Q5NA 2H1AA 2X8CA 4POLA 1JLVA 4MCUA 1OVNA 4BL7B 2RM5A 1WE0A 3FR9A 2WJUA 4YQVA 3D0ZA 4GRFA 3UARA 2A4VA 3HJOA 4GSTA 1BG5A 3APQA 2VLUA 1WJKA 2PVOC 1R5PA 3GTUA 2JSYA 1KTEA 1GSFA 3LG6A 1ZYEA 2B1LA 3TDGA 2CVBA 3F3RA 3TOUA 3ME8A 2E7PA 17GSA 2VD0A 4E8HA 6GSWA 1OKTA 3HZ8A 2H66A 4NHWA 5JWOB 1GTUA 2MYGA 1A0FA 4DSSB 3UEMA 4YKFA 3DD3A 4DSQA 3LWAA 2H0IA 4N30A 4ICYA 2HXKA 1SD9A 3Q18A 4ISDA 2VO4A 4ECCA 4WF5A 5F0GA 2B7JA 2CQ9A 1YF1A 2MMAA 2FNOA 3GL5A 3FK8A 4HQZA 5AIXA 3GYKA 3I69A 2VM2A 5FHIA 1FAAA 4NPBA 4KNDA 3F4TA 3WGXA 1AQWA 2LKUA 3QFBC 2DJ0A 2ON7A 3LGCA 3GRXA 3FHKA 2F9SA 3TGZA 1F6MC 3L78A 4N10A 4IGJA 5IM9A 1PMTA 3QFAC 1Z6NA 2GZPA 2H74A 1YKAA 4LLRA 4TR3A 5JWRB 4IQ1A 1GSSA 1XWAA 1UVZA 2HRFA 3AY8A 2GSSA 1XWGA 4FO5A 4V2LA 5KOXA 3WGDA 2C0GA 3A3TA 3IAS2 2FWGA 6GSVA 5IMAA 2XHFA 4XS6A 4MH2A 4V2NA 4XTSA 1DBYA 5IMDA 3DRNA 1HYUA 4GSNA 5DQYA 2TIRA 3L9VA 5HR1A 5ECHB 4YQMA 4Q5QA 1Q98A 5CRGA 1J08A 5HQPA 1TP9A 2IL3A 3GKXA 3CSJA 4O5RA 2X49A 4HS1A 2CX4A 1Z7RA 1ON4A 3GNJA 1O8WA 1X9SB 3U5RE 4XS4A 2R6KA 2XPEA 3VWWA 1LU4A 1GUHA 5ID2A 3GV1A 4MZCA 2LJAA 1XOAA 2K8VA 3C7MA 4YQUA 1PGTA 4D73A 3EYTA 5J9CA 1F2EA 3DVWA 2HZEB 1A24A 4EC0A 4HJ2A 3A5IA 3UAPA 3MWHA 5DJMA 5B7CA 3LQ7A 4MJAA 4K5RA 5CRHA 2H1BA 2R0PA 4ZBDA 1UA5A 1K0AA 2L57A 3TJKA 4PNFA 3F8UA 1AAZA 1DUGA 2GVPA 2AJQB 3CYNA 4WXTA 2WCIA 1SENA 2X8GA 3PINA 4MF6A 1S3DA 3O76A 5ECNB 3IR4A 4HDEA 2LNSA 1GH2A 1Q4JA 2DJ2A 2JACA 2AHEA 2YV7A 3G7YA 4ZBBA 3L9UA 3ED3A 4LL4B 1Y25A 4I2TA 5IMVA 16GSA 1XCCA 4ZB8A 2VUPA 3ZL5A 1U88A 1TW9A 3ZVJD 5HR3A 1TJDA 4JU5A 4KUNA 1XWKA 2CA8A 2DJ1A 4I5QA 4WKWA 1U87A 3VPTA 7GSSA 3EMXA 5C00A 1FVJA 1XWBA 3UMAA 2WFCA 5G1LA 5GAPD 2DJKA 2DIZA 3CRUA 3NIVA 2H75A 5G1KA 1TI1A 3BJ5A 2V1MA 5D93A 1PX7A 2GDRA 4MZBA 2CVDA 4XIHA 3ERWA 2HT9A 2V6OA 1JHBA 2VCWA 1TRVA 3TRXA 5DVBA 1XG8A 3W8SA 1AXDA 1GNWA 3MNGA 1XWCA 5ID2B 4IHUA 3VWXA 2H1DA 2QGVA 2CAQA 5HFGA 2FLSA 3ZREA 3RHBA 3P7XA 1OC8A 1X5CA 1FB6A 4G2EA 3F63A 2VM1A 3KCMA 3LW9A 5J41A 4TXOA 1J9BA 3DYRA 4AF2A 3VFIA 1K3YA 2OKAA 2O87A 2YWOA 3VI5A 5EY6A 2VL2C 1XW5A 2MBSA 2CV4A 1M2AA 4JR4A 1YY7A 1TOFA 2YOIA 1UC7A 1ZZYA 4MPFA 1F9MA 3I9V2 1X9WB 4O5QA 4K6XA 3A5WA 4GCIA 1O85A 3A2WA 3DIEA 2GTUA 5INYA 4P3YB 4GWRA 3CTGA 4IJ3A 4TR4A 3BD2A 3IXRA 1NHYA 2L5LA 4IJIA 4TN8A 2YV9A 2AB6A 4JE1A 3FKFA 2FWFA 3KP8A 3A2VA 3TKSE 3Q74A 1F3BA 3F3QA 2WRTA 3R3EA 3GN3A 1SK0A 5G2ZA 5DBQA 2DKIA 4G0IA 1MDKA 3C1RA 4ULXA 3GHAA 1B4QA 1GTIA 3L0HA 2R4VA 1FHEA 1URMA 4IQAA 4EO3A 2VAFA 1O81A 3ZIJA 4CDOA 3KIJA 4K7NA 5ENUA 4G0KA 4E8EA 3FZAA 1HD2A 2PPTA 2IFQB 3FR6A 2P0GA 1EV9A 1QXHA 3DEXA 2X99A 4KDYA 5D9XA 3H1NA 2IMDA 3PR8A 2FWEA 5HFIA 2PVQA 5AISA 1BQ7A 2JU5A 3MYDA 2VCZA 2B3SA 2CZ2A 4LMVA 1A8LA 3GUSA 5L71A 3RBTA 1WIKA 1T3BA 2C0FA 1AUCA 1RQMA 2C3QA 2GLRA 1Z7PA 4F82A 1DE2A 2LEGA 4OO5A 2D2ZA 2JL4A 1GSUA 4TKYA 4BIKA 3KD0A 4J2FA 4IBPA 1ERVA 4HJMA 5ECMB 5DALB 3C8EA 1TRWA 3TRQA 4TXVA 2VIMA 4ZILA 3UBKA 2OADA 4O5UA 3CMIA 1XBSA 2CAIA 2HFDA 2M80A 2V32A 5KN0A 3FZ9A 1PSQA 2PUKC 1M9BA 2AV4A 2LQQA 4KSMA 2OE0A 3TRPA 2O8VB 1G7OA 2YANA 2AYTA 1X5EA 3HZ4A 1H4OA 3HVSA 2OBIA 4EF0A 3HD5A 4OCEA 2O85A 1GLPA 1MDJA 4L5OA 4XRDA 2OE1A 1EP7A 3ZTLA 1M3IA 2K6VA 4G9HA 4L5LA 3EURA 1SK2A 3LXTA 1EZKA 3M9JA 2DJJA 3H8QA 3IK9A 4HOJA 4BVYB 4WEYA 18GSA 3VLNA 3TKQA 11GSA 2G0FA 4BWSA 4EXJA 2GS3A 3HHVA 3D5JA 3KTLA 3GX0A 1X9MB 1A23A 5CYYA 5J9BA 6GSXA 2K18A 5ECKB 5LD0A 4BVXA 4L0UA 1W89A 4MF7A 1FOHA 5B8AA 1T8EB 3D21A 1U3IA 2JSZA 1O7UA 3BCKA 3G9BA 1NSWA 1ZGNA 1SL1B 3APOA 5AGYA 2NTOA 3MSZA 5CRDA 2HLSA 3FZ4A 1NM3A 5J5NA 6GSTA 1PL1A 2HZFA 2PWJA 2LJRA 3C71A 5GAND 4IP6A 2AAWA 3DXBA 2DSAA 4NMUA 1W4VA 2GQMA 4GTUA 2TRXA 3KJYA 2JZRA 2CZ3A 3LORA 2FY6A 3HYPA 4NV5A 4WBRD 3QCPA 4POBA 2O7KA 1SU9A 1FG4A 2P5RA 5GSTA 4A5PA 2E2GA 4PGTA 3Q6OA 1V9WA 3M1GA 2V6KA 1SYXA 4TR1A 1KBNA 2KP2A 5CRWA 5ECQB 3GMFA 3E0UA 4FIWA 1TK8B 2QSIA 1GSEA 3H93A 1B8XA 1XZOA 3U6VA 1K0OA 4CY8A 4DEJA 3P2AA 4HZ2A 1TKDB 1SK1A 5IPHA 5JCUA 3M9KA 1EWXA 3IC4A 3D4MA 4PNGA 4G19A 3WGEA 2L6DA 3VWUA 1X0RA 22GSA 2DBCA 4JEDA 2H01A 3UVTA 3TKPA 4JZQA 4BVXB 3IOSA 1LBKA 2L5OA 4GF0A 5E59A 5A5KA 2ALBA 3ME7A 3IA1A 2N5BA 3MIXA 2C3NA 1G6WA 3ZRDA 1SKSB 3QR6A 5F8BA 2R2JA 2HYXA 3GURA 1YDKA 5IIZA 2IMFA 3IAM2 5ECPB 1GWCA 2HSMA 4ZL8A 1YZXA 3GKKA 2PGTA 2YNXA 1PN0A 1TTZA 2LNTA 1Z9HA 4GLTA 1R26A 2HRAA 3RPNA 2UZ8A 4PURA 3ZVJA 3CTFA 5B6MA 2ZNMA 5KN2A 3TKSC 5CO3A 4HU9A 1OKDA 3QMXA 2RUEA 1GSQA 1M3JA 1FVKA 3QOUA 2E2MA 2WS2A 4KH7A 1THXA 4ZL7A 1SD8A 3H79A 5EVOA 1IYIA 3DVXA 3EU3A 3ISOA 3GTUB 2IMEA 3FW2A 1VF1A 3ZYWA 2VL2A 2V41A 2YJHA 4MDCA 2JADA 2C0EA 1AIUA 3HY2A 2YJ7A 1PD21 1XW6A 3LFLA 4OFNA 5DAKA 4ECBA 1QQ2A 4MJBA 2VCQA 3TJGA 1ZYQB 5FWGA 2WGRA 5BRTA 3F4RA 4GQCA 2NVLA 5ECRB
chains in the Genus database with same CATH topology
2K9FA 5A4VA 2DC5A 4TOPA 3TJBA 1K0BA 5JCWA 4BPYA 3M0FA 1VF3A 2IPAA 1SL0B 3H4KA 2R3XA 3FR3A 1YJ6A 3BBYA 4YAPA 5HFKA 3EINA 2YCDA 2X64A 4ZL9A 2FHEA 2EIQA 2H1GA 4XRAA 3IV4A 3CBUA 2C3TA 1O6JA 1B48A 1SJZA 5IMFA 1ZCPA 3PGTA 2B6MA 5B6NA 1SJIA 1THOA 4Z2UA 1TRSA 2YZHA 1OC9A 2LTKA 1SYRA 1M2BA 1QMVA 3KEBA 4YH2A 2LRCA 1TRUA 3TOTA 2H6YA 4MNNA 5A4WA 2HSYA 5LCZA 2C4JA 3Q19A 1TU8A 1EEJA 1HNCA 3KGKA 1VF4A 4NHZA 1IYHA 5IOWA 2PERA 1ERWA 4V1Ag 2JZTA 4O7HA 3OR5A 4CY6A 3ZFBA 5B8BA 1HNBA 4I6XA 4KE3A 2WULA 4NWYA 4H86A 5D9WA 2B5EA 1K3OA 3TCOA 2VLTA 3BOAA 1V58A 4Z7XA 4TW5A 1S3CA 13GSA 1USBA 1YEXA 3UIWA 2REMA 4MK3A 2WZ9A 1G7EA 3JCML 1T4YA 2XC2A 4XS4B 4K5SA 2R0CA 3PPUA 5C04A 1O8XA 4O92A 3TJJA 4D73B 3A2XA 4FYCA 5G30A 3C73A 1EP8A 4ILFA 2KOKA 1V98A 3RPPA 4HQSA 4X0XA 3QPMA 1G0TA 3ZLPA 1YKCA 3FYGA 1T7PB 4K7OA 4RI7A 3LSZA 4IKHA 2GZZA 2I9HA 1JZOA 4KDXA 2H72A 3US3A 3KP9A 3O3TA 4PTSA 5ECIB 3C1SA 1TK0B 1A8YA 1NW2A 4DSRA 2DMMA 4MZWA 4ZB9A 2EIOA 5EL8A 2YPMA 2R37A 1AQVA 1OC3A 1M99A 2FGXA 1GUKA 1PA3A 2IMKA 2A2SA 4POMA 1F37A 3KXOA 4RI6A 4F9ZA 4RQXA 2C80A 2B5XA 3HA9A 1MEKA 1YEPA 4LMWA 2WDUA 5EPFA 3UL3A 4JR6A 1SJ6A 4MP4A 4GQFA 4WETA 3EPTA 3DWVA 4ECJA 3L4NA 5A4UA 5AIVA 4KF9A 2LV3A 5CAXA 2H76A 4LA1A 4N0ZA 1C72A 4BWQA 2VCXA 4X4JA 1XVWA 1XPVA 3EE2A 4IN0A 2MBTA 3J7Yb 3VWVA 1VF2A 2XBIA 2IJYA 2RIIA 4MA9A 5D96A 4TXOB 1I9DA 2ZCTA 1HQOA 3UJ1A 4RQRA 3NOFA 2NBSA 2VCTA 2GSTA 3I43A 3EMPA 4JBBA 4PUAA 3VK9A 1F3AA 3GSTA 1PKZA 1N2AA 3ZITA 4Q5RA 5E4WA 1U3AA 2KUCA 1N8JA 3LEFA 2MMZA 2YWMA 4KGIA 2QA2A 5ECOB 2O89A 1XFLA 4CHSA 2LQOA 3F6DA 5ABRA 4IVFA 4EUYA 1E2YA 3E3EA 3F0IA 1T4ZA 2XBQA 4OFTA 4MLYA 2X8HA 2JZSA 3D4TA 3F6FA 3VPQA 5ELGA 3L9SA 1BAYA 3KM6A 3KMOA 1MD3A 2BJXA 2PU9C 4AJ6A 1ERTA 4I8BA 4X1UA 4OO4A 2AUVA 3EVIA 2GSRA 4ZBAA 3HVVA 3HDCA 4F03A 5GSSA 1HNAA 4KSOA 2Z9SA 5COHA 5CP1A 2G2QA 1TXXA 2A2RA 5D73A 4K0GA 2DLXA 4X43A 3ERFA 2KLXA 5KOWA 4DSSA 1ILOA 1E6BA 1JZWA 1PRXA 2VCVA 1WOUA 2GZYA 1M2DA 3ZZXA 4ZB6A 5JCGA 9GSSA 2V2GA 1FB0A 2PBJA 2L59A 2ES7A 2OJLA 2DIYA 3IHGA 4QL7A 1EGOA 5AN1A 1EGRA 3ZMLA 2C0DA 2N5FA 4KX4A 3TJFA 5KEJA 1GRXA 2RLIA 5H5QA 4AJ7A 5D9VA 5F07A 5F05A 4HEA2 2N5AA 4XHMA 3WD6A 4MF5A 1T00A 4KAEA 4IW9A 5BMUA 3FZ5A 3QAVA 1LJRA 3ERGA 4MABA 1OAZA 4PQ1A 3UVHA 6GSYA 2FD3A 5G5FA 3ZFLA 2HRKA 2LRTA 3RHCA 2OACA 2LRNA 1R7HA 4IP1A 1EV4A 1PKWA 3CSHA 5H5RA 2FUG2 1B9YC 4MH3A 1AW9A 1SKWB 2KHPA 1O73A 2OBKA 4F0CA 1OE7A 1NHOA 5IQYA 1ZL9A 4PX1A 2H0GA 4QQ7A 4L0WA 2GT5A 1KNGA 1XOBA 4V2MA 3P90A 2PN8A 4EIQA 1Z6MA 4EDZA 3LYPA 2LS5A 3UBLA 1GUMA 1Z3EA 3DGQA 2QA1A 3O6TA 1K0MA 1MD4A 2IIYA 2CVKA 4LL1B 3HJPA 3GFKA 2F8AA 20GSA 1JZRA 1XXUA 3UOMA 2GSQA 2MMOA 8GSSA 2R5GA 3APSA 1PQNA 3V1WA 1T1VA 3KZQA 1MDIA 2J9HA 2HZEA 2RM6A 5GZZB 5IMZA 4EIPA 3K8NA 1M0UA 5JWQB 2YN1A 4ML6A 2HNLA 1DE1A 1TI3A 1BJXA 1V57A 5LNKe 2P5QA 2LSTA 3NZNA 1VGLA 1XW9A 1YF0A 3GA4A 3HCZA 4YAVA 2HI7A 2L6CA 5IPGA 4FYBA 1K0DA 2P31A 4YKGA 4TR1B 1WMJA 5DJLA 3FY7A 3ZIVA 4FH8A 1GP1A 2A2PA 4EKZA 3TB2A 2TRCP 1TK5B 1B9XC 4WF4A 1GSYA 3CRTA 2NPBA 3GIXA 1R5AA 3KMNA 3P8WA 1CQHA 4KW6A 3IRAA 1MTCA 1A2LA 6GSSA 2QKEA 3KH7A 2I4AA 1GTBA 3SBCA 4POKA 4WR4A 2LJKA 1TDIA 2FCHA 1M9AA 1ST9A 3LYKA 3I6AA 4OFMA 4N11A 12GSA 2YWIA 3BCIA 5ECLB 1OYJA 2DKHA 1ZYPA 3LXZA 4I2UA 2GGTA 2H30A 3VI7A 4K2XA 3N5OA 1ZYNA 4KB3A 3HKRA 2FA4A 4MPGA 4ID0A 2B5YA 1QGVA 2EIRA 5KN1A 5FT3A 2IMIA 3GX8A 2HE3A 3R2QA 3SWLA 4ZXGA 4XCSA 3EWLA 4HUAA 4J56E 1V2AA 1BX9A 3CSIA 2KP1A 4K2DA 2VL9A 3DKSA 3IC8A 1DSBA 4XS1A 4MJCA 3G7JA 3M8NA 1A0RP 3VURA 4L8EA 1V40A 1FW1A 2EC4A 4HZ4A 4EL1A 4PXOA 4F2IA 1ZMAA 4N0VA 3RAZA 5IO2A 4TVEA 5KN3A 1RK4A 1K0NA 4I97A 4OWYA 5DAKB 4USSA 3QDNA 4Z2TA 2BMXA 1SKRB 3WT2A 2L4CA 2YWNA 4HI7A 2H6ZA 3DMLA 1UN2A 10GSA 4HU7A 3GH6A 2OE3A 3ZMKA 2A4HA 1BEDA 4KDUA 2FA8A 4FQUA 2IFQA 1X5DA 4IS0A 2E0QA 3FMWA 4Q5FA 1AQXA 2VL3A 3F9UA 3PH9A 3QAWA 4KCEA 3N9JA 2VLVA 1K3LA 4JRRA 4NAXA 2BTOT 3E9JB 2M72A 4IELA 1GTAA 4GSSA 1U6TA 1GSDA 2VD1A 4PQHA 1ZOFA 5G5EA 3HXSA 3MDKA 1WP0A 1FOVA 4K0NA 2PMTA 2H6XA 1A2JA 1G6YA 2H70A 5IMCA 4ECIA 4OCFA 1M7TA 5D9TA 3CXGA 1PL2A 1OC9B 3GH9A 3HVXA 5DALA 4EDYA 2H71A 5F06A 4AJ8A 2I81A 3IBHA 4V1Ap 4ZIJA 2F3MA 1GLQA 3TUEA 1JZDA 2K8SA 5J3RA 4QL9A 4PQIA 4F0BA 6GSUA 1PN9A 5HR2A 4TRXA 3KTBA 1SL2B 1S3AA 1CQGA 2DMLA 4FYUA 2B1KA 1VRSD 1EOGA 2GQKA 3RDWA 4K7IA 4MJEA 4GXZA 2C8UA 3GKMA 4BVYA 1ABAA 3FEUA 4EVMA 3WYWA 5J4UA 2IN3A 2GQLA 3W8JA 2WB9A 4Z2RA 3IPZA 2M46A 1A2MA 1R4WA 4OMVA 1I5GA 2OA7A 4WR5A 1PX6A 2RUFA 4J57E 1WPIA 2R0GA 1TU7A 1AC1A 2LUSA 4ML1A 5ECSA 3LJRA 2F51A 2B7KA 4ACSA 1GULA 2ZUPA 5HR0A 1ML6A 3IDVA 4NXIA 2MZCA 3KH9A 1YQ1A 3S9FA 1ACVA 3M3MA 4NV2A 1JLWA 1EEMA 3J7Yk 2NDOA 2YP6A 4WBJA 2CX3A 4KA0A 4AGSA 4BL7A 14GSA 2H19A 3GKNA 4K8MA 5DCGA 1J0FA 2DJ3A 3G7IA 1WWJA 1K0CA 5H5SA 4OD7A 5IOXA 3W6GA 1EOHA 4MMMA 1WRYA 2HRNA 2L4QA 1FO5A 3QAGA 4PUFC 4BA7A 1ERUA 3TKSA 2C1YA 3F4SA 3IK7A 3IE3A 1XIYA 1GL8A 1RW1A 3EC3A 3FRCA 1JFUA 2X4AA 2FWHA 2ON5A 2XPDA 2J23A 1KEBA 2F8FA 4EE0A 2MMNA 1BYEA 1B4PA 1XVQA 2GT6A 1Y6EA 2H8LA 3MAKA 1Z5YE 5D8IA 3D6IA 3IHQA 4TR0A 4G0LA 5CREA 3TKRA 4CW9A 2HSHA 2I3YA 4RUVA 3D22A 5IO0A 2IWTA 5DDLA 1QFNA 4DVCA 5CNWA 4KCAA 4K9ZA 2H0HA 1OE8A 3EU4A 2QC7A 5G31A 5DQSA 2VOCA 3GL3A 5DCHA 4O32A 3HJMA 1H75A 1GNEA 2CT6A 3QD9A 4K1FA 2I1UA 5ELAA 1QUWA 4G10A 3GSSA 2H73A 19GSA 1QK8A 2YZUA 3WT1A 4Q5NA 2H1AA 2X8CA 4POLA 1JLVA 4MCUA 1OVNA 4BL7B 2RM5A 1WE0A 3FR9A 2WJUA 4YQVA 3D0ZA 4GRFA 3UARA 2A4VA 3HJOA 4GSTA 1BG5A 3APQA 2VLUA 1WJKA 2PVOC 1R5PA 3GTUA 2JSYA 1KTEA 1GSFA 3LG6A 1ZYEA 2B1LA 3TDGA 2CVBA 3F3RA 3TOUA 3ME8A 2E7PA 17GSA 2VD0A 4E8HA 6GSWA 1OKTA 3HZ8A 2H66A 4NHWA 5JWOB 1GTUA 2MYGA 1A0FA 4DSSB 3UEMA 4YKFA 3DD3A 4DSQA 3LWAA 2H0IA 4N30A 4ICYA 2HXKA 1SD9A 3Q18A 4ISDA 2VO4A 4ECCA 4WF5A 5F0GA 2B7JA 2CQ9A 1YF1A 2MMAA 2FNOA 3GL5A 3FK8A 4HQZA 5AIXA 3GYKA 3I69A 2VM2A 5FHIA 1FAAA 4NPBA 4KNDA 3F4TA 3WGXA 1AQWA 2LKUA 3QFBC 2DJ0A 2ON7A 3LGCA 3GRXA 3FHKA 2F9SA 3TGZA 1F6MC 3L78A 4N10A 4IGJA 5IM9A 1PMTA 3QFAC 1Z6NA 2GZPA 2H74A 1YKAA 4LLRA 4TR3A 5JWRB 4IQ1A 1GSSA 1XWAA 1UVZA 2HRFA 3AY8A 2GSSA 1XWGA 4FO5A 4V2LA 5KOXA 3WGDA 2C0GA 3A3TA 3IAS2 2FWGA 6GSVA 5IMAA 2XHFA 4XS6A 4MH2A 4V2NA 4XTSA 1DBYA 5IMDA 3DRNA 1HYUA 4GSNA 5DQYA 2TIRA 3L9VA 5HR1A 5ECHB 4YQMA 4Q5QA 1Q98A 5CRGA 1J08A 5HQPA 1TP9A 2IL3A 3GKXA 3CSJA 4O5RA 2X49A 4HS1A 2CX4A 1Z7RA 1ON4A 3GNJA 1O8WA 1X9SB 3U5RE 4XS4A 2R6KA 2XPEA 3VWWA 1LU4A 1GUHA 5ID2A 3GV1A 4MZCA 2LJAA 1XOAA 2K8VA 3C7MA 4YQUA 1PGTA 4D73A 3EYTA 5J9CA 1F2EA 3DVWA 2HZEB 1A24A 4EC0A 4HJ2A 3A5IA 3UAPA 3MWHA 5DJMA 5B7CA 3LQ7A 4MJAA 4K5RA 5CRHA 2H1BA 2R0PA 4ZBDA 1UA5A 1K0AA 2L57A 3TJKA 4PNFA 3F8UA 1AAZA 1DUGA 2GVPA 2AJQB 3CYNA 4WXTA 2WCIA 1SENA 2X8GA 3PINA 4MF6A 1S3DA 3O76A 5ECNB 3IR4A 4HDEA 2LNSA 1GH2A 1Q4JA 2DJ2A 2JACA 2AHEA 2YV7A 3G7YA 4ZBBA 3L9UA 3ED3A 4LL4B 1Y25A 4I2TA 5IMVA 16GSA 1XCCA 4ZB8A 2VUPA 3ZL5A 1U88A 1TW9A 3ZVJD 5HR3A 1TJDA 4JU5A 4KUNA 1XWKA 2CA8A 2DJ1A 4I5QA 4WKWA 1U87A 3VPTA 7GSSA 3EMXA 5C00A 1FVJA 1XWBA 3UMAA 2WFCA 5G1LA 5GAPD 2DJKA 2DIZA 3CRUA 3NIVA 2H75A 5G1KA 1TI1A 3BJ5A 2V1MA 5D93A 1PX7A 2GDRA 4MZBA 2CVDA 4XIHA 3ERWA 2HT9A 2V6OA 1JHBA 2VCWA 1TRVA 3TRXA 5DVBA 3W8SA 1AXDA 1GNWA 3MNGA 1XWCA 5ID2B 4IHUA 3VWXA 2H1DA 2QGVA 2CAQA 5HFGA 2FLSA 3ZREA 3RHBA 3P7XA 1OC8A 1X5CA 1FB6A 4G2EA 3F63A 2VM1A 3KCMA 3LW9A 5J41A 4TXOA 1J9BA 3DYRA 4AF2A 3VFIA 1K3YA 2OKAA 2O87A 2YWOA 3VI5A 5EY6A 2VL2C 1XW5A 2MBSA 2CV4A 1M2AA 4JR4A 1YY7A 1TOFA 2YOIA 1UC7A 1ZZYA 4MPFA 1F9MA 3I9V2 1X9WB 4O5QA 4K6XA 3A5WA 4GCIA 1O85A 3A2WA 3DIEA 2GTUA 5INYA 4P3YB 4GWRA 3CTGA 4IJ3A 4TR4A 3BD2A 3IXRA 1NHYA 2L5LA 4IJIA 4TN8A 2YV9A 2AB6A 4JE1A 3FKFA 2FWFA 3KP8A 3A2VA 3TKSE 3Q74A 1F3BA 3F3QA 2WRTA 3R3EA 3GN3A 1SK0A 5G2ZA 5DBQA 2DKIA 4G0IA 1MDKA 3C1RA 4ULXA 3GHAA 1B4QA 1GTIA 3L0HA 2R4VA 1FHEA 1URMA 4IQAA 4EO3A 2VAFA 1O81A 3ZIJA 4CDOA 3KIJA 4K7NA 5ENUA 4G0KA 4E8EA 3FZAA 1HD2A 2PPTA 2IFQB 3FR6A 2P0GA 1EV9A 1QXHA 3DEXA 2X99A 4KDYA 5D9XA 3H1NA 2IMDA 3PR8A 2FWEA 5HFIA 2PVQA 5AISA 1BQ7A 2JU5A 3MYDA 2VCZA 2B3SA 2CZ2A 4LMVA 1A8LA 3GUSA 5L71A 3RBTA 1WIKA 1T3BA 2C0FA 1AUCA 1RQMA 2C3QA 2GLRA 1Z7PA 4F82A 1DE2A 2LEGA 4OO5A 2D2ZA 2JL4A 1GSUA 4TKYA 3KD0A 4J2FA 4IBPA 1ERVA 4HJMA 5ECMB 5DALB 3C8EA 1TRWA 3TRQA 4TXVA 2VIMA 4ZILA 3UBKA 2OADA 4O5UA 3CMIA 1XBSA 2CAIA 2HFDA 2M80A 2V32A 5KN0A 3FZ9A 1PSQA 2PUKC 1M9BA 2AV4A 2LQQA 4KSMA 2OE0A 3TRPA 2O8VB 1G7OA 2YANA 2AYTA 1X5EA 3HZ4A 1H4OA 3HVSA 2OBIA 4EF0A 3HD5A 4OCEA 2O85A 1GLPA 1MDJA 4L5OA 4XRDA 2OE1A 1EP7A 3ZTLA 2K6VA 4G9HA 4L5LA 3EURA 1SK2A 3LXTA 1EZKA 3M9JA 2DJJA 3H8QA 3IK9A 4HOJA 4BVYB 4WEYA 18GSA 3VLNA 3TKQA 11GSA 2G0FA 4BWSA 4EXJA 2GS3A 3HHVA 3D5JA 3KTLA 3GX0A 1X9MB 1A23A 5CYYA 5J9BA 6GSXA 2K18A 5ECKB 5LD0A 4BVXA 4L0UA 1W89A 4MF7A 1FOHA 5B8AA 1T8EB 3D21A 1U3IA 2JSZA 1O7UA 3BCKA 3G9BA 1NSWA 1ZGNA 1SL1B 3APOA 5AGYA 2NTOA 3MSZA 5CRDA 2HLSA 3FZ4A 1NM3A 5J5NA 6GSTA 1PL1A 2HZFA 2PWJA 2LJRA 3C71A 5GAND 4IP6A 2AAWA 3DXBA 2DSAA 4NMUA 1W4VA 2GQMA 4GTUA 2TRXA 3KJYA 2JZRA 2CZ3A 3LORA 2FY6A 3HYPA 4NV5A 4WBRD 3QCPA 4POBA 2O7KA 1SU9A 1FG4A 2P5RA 5GSTA 4A5PA 2E2GA 4PGTA 3Q6OA 1V9WA 3M1GA 2V6KA 1SYXA 4TR1A 1KBNA 2KP2A 5CRWA 5ECQB 3GMFA 3E0UA 4FIWA 1TK8B 2QSIA 1GSEA 3H93A 1B8XA 1XZOA 3U6VA 1K0OA 4CY8A 4DEJA 3P2AA 4HZ2A 1TKDB 1SK1A 5IPHA 5JCUA 3M9KA 1EWXA 3IC4A 3D4MA 4PNGA 4G19A 3WGEA 2L6DA 3VWUA 1X0RA 22GSA 2DBCA 4JEDA 2H01A 3UVTA 3TKPA 4JZQA 4BVXB 3IOSA 1LBKA 2L5OA 4GF0A 5E59A 5A5KA 2ALBA 3ME7A 3IA1A 2N5BA 3MIXA 2C3NA 1G6WA 3ZRDA 1SKSB 3QR6A 5F8BA 2R2JA 2HYXA 3GURA 1YDKA 5IIZA 2IMFA 3IAM2 5ECPB 1GWCA 2HSMA 4ZL8A 1YZXA 3GKKA 2PGTA 2YNXA 1PN0A 1TTZA 2LNTA 1Z9HA 4GLTA 1R26A 2HRAA 3RPNA 2UZ8A 4PURA 3ZVJA 3CTFA 5B6MA 2ZNMA 5KN2A 3TKSC 5CO3A 4HU9A 1OKDA 3QMXA 2RUEA 1GSQA 1FVKA 3QOUA 2E2MA 2WS2A 4KH7A 1THXA 4ZL7A 1SD8A 3H79A 5EVOA 1IYIA 3DVXA 3EU3A 3ISOA 3GTUB 2IMEA 3FW2A 1VF1A 3ZYWA 2VL2A 2V41A 2YJHA 4MDCA 2JADA 2C0EA 1AIUA 3HY2A 2YJ7A 1PD21 1XW6A 3LFLA 4OFNA 5DAKA 4ECBA 1QQ2A 4MJBA 2VCQA 3TJGA 1ZYQB 5FWGA 2WGRA 5BRTA 3F4RA 4GQCA 2NVLA 5ECRB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K9F A;  5A4V A;  2DC5 A;  4TOP A;  3TJB A;  1K0B A;  5JCW A;  4BPY A;  3M0F A;  1VF3 A;  2IPA A;  1SL0 B;  3H4K A;  2R3X A;  3FR3 A;  1YJ6 A;  3BBY A;  4YAP A;  5HFK A;  3EIN A;  2YCD A;  2X64 A;  4ZL9 A;  2FHE A;  2EIQ A;  2H1G A;  4XRA A;  3IV4 A;  3CBU A;  2C3T A;  1O6J A;  1B48 A;  1SJZ A;  5IMF A;  1ZCP A;  3PGT A;  2B6M A;  5B6N A;  1SJI A;  1THO A;  1TRS A;  2YZH A;  1OC9 A;  2LTK A;  1SYR A;  1M2B A;  1QMV A;  3KEB A;  4YH2 A;  2LRC A;  1TRU A;  3TOT A;  2H6Y A;  5A4W A;  2HSY A;  5LCZ A;  2C4J A;  3Q19 A;  1TU8 A;  1EEJ A;  1HNC A;  3KGK A;  1VF4 A;  4NHZ A;  1IYH A;  5IOW A;  2PER A;  1ERW A;  4V1A g;  2JZT A;  4O7H A;  3OR5 A;  3ZFB A;  5B8B A;  1HNB A;  4I6X A;  4KE3 A;  2WUL A;  4NWY A;  4H86 A;  5D9W A;  2B5E A;  1K3O A;  3TCO A;  2VLT A;  3BOA A;  1V58 A;  4Z7X A;  4TW5 A;  1S3C A;  13GS A;  1USB A;  1YEX A;  3UIW A;  2REM A;  4MK3 A;  2WZ9 A;  1G7E A;  3JCM L;  1T4Y A;  2XC2 A;  4XS4 B;  5C04 A;  1O8X A;  4O92 A;  3TJJ A;  4D73 B;  3A2X A;  4FYC A;  5G30 A;  3C73 A;  1EP8 A;  4ILF A;  2KOK A;  1V98 A;  3RPP A;  4HQS A;  4X0X A;  3QPM A;  1G0T A;  3ZLP A;  1YKC A;  3FYG A;  1T7P B;  4K7O A;  4RI7 A;  3LSZ A;  4IKH A;  2GZZ A;  2I9H A;  1JZO A;  4KDX A;  2H72 A;  3US3 A;  3KP9 A;  3O3T A;  5ECI B;  3C1S A;  1TK0 B;  1A8Y A;  1NW2 A;  4DSR A;  2DMM A;  4MZW A;  4ZB9 A;  2EIO A;  5EL8 A;  2YPM A;  2R37 A;  1AQV A;  1OC3 A;  1M99 A;  2FGX A;  1GUK A;  1PA3 A;  2IMK A;  2A2S A;  4POM A;  1F37 A;  3KXO A;  4RI6 A;  4F9Z A;  4RQX A;  2C80 A;  2B5X A;  3HA9 A;  1MEK A;  1YEP A;  4LMW A;  2WDU A;  5EPF A;  3UL3 A;  4JR6 A;  1SJ6 A;  4MP4 A;  4GQF A;  4WET A;  3DWV A;  4ECJ A;  3L4N A;  5A4U A;  5AIV A;  2LV3 A;  5CAX A;  2H76 A;  4LA1 A;  4N0Z A;  1C72 A;  4BWQ A;  2VCX A;  1XVW A;  1XPV A;  3EE2 A;  4IN0 A;  2MBT A;  3J7Y b;  3VWV A;  1VF2 A;  2XBI A;  2IJY A;  2RII A;  4MA9 A;  5D96 A;  4TXO B;  1I9D A;  2ZCT A;  1HQO A;  3UJ1 A;  4RQR A;  3NOF A;  2NBS A;  2VCT A;  2GST A;  3I43 A;  3EMP A;  4JBB A;  4PUA A;  3VK9 A;  1F3A A;  3GST A;  1PKZ A;  1N2A A;  3ZIT A;  5E4W A;  4Q5R A;  1U3A A;  2KUC A;  1N8J A;  3LEF A;  2MMZ A;  2YWM A;  4KGI A;  5ECO B;  2O89 A;  1XFL A;  4CHS A;  2LQO A;  3F6D A;  5ABR A;  4IVF A;  4EUY A;  1E2Y A;  3E3E A;  3F0I A;  1T4Z A;  2XBQ A;  4OFT A;  4MLY A;  2X8H A;  2JZS A;  3D4T A;  3F6F A;  3VPQ A;  5ELG A;  3L9S A;  1BAY A;  3KM6 A;  3KMO A;  1MD3 A;  2BJX A;  2PU9 C;  4AJ6 A;  1ERT A;  4I8B A;  4X1U A;  4OO4 A;  2AUV A;  3EVI A;  2GSR A;  4ZBA A;  3HVV A;  3HDC A;  4F03 A;  5GSS A;  1HNA A;  4KSO A;  2Z9S A;  5COH A;  5CP1 A;  2G2Q A;  1TXX A;  2A2R A;  5D73 A;  4K0G A;  2DLX A;  4X43 A;  3ERF A;  2KLX A;  4DSS A;  1ILO A;  1E6B A;  1JZW A;  1PRX A;  2VCV A;  1WOU A;  2GZY A;  1M2D A;  3ZZX A;  4ZB6 A;  5JCG A;  9GSS A;  2V2G A;  1FB0 A;  2PBJ A;  2L59 A;  2ES7 A;  2OJL A;  2DIY A;  4QL7 A;  1EGO A;  5AN1 A;  1EGR A;  3ZML A;  2C0D A;  2N5F A;  4KX4 A;  3TJF A;  5KEJ A;  1GRX A;  2RLI A;  5H5Q A;  4AJ7 A;  5F07 A;  5D9V A;  5F05 A;  4HEA 2;  2N5A A;  4XHM A;  3WD6 A;  4MF5 A;  1T00 A;  4KAE A;  4IW9 A;  3FZ5 A;  3QAV A;  1LJR A;  3ERG A;  4MAB A;  1OAZ A;  4PQ1 A;  3UVH A;  6GSY A;  2FD3 A;  5G5F A;  3ZFL A;  2LRT A;  3RHC A;  2OAC A;  2LRN A;  1R7H A;  4IP1 A;  1EV4 A;  1PKW A;  3CSH A;  5H5R A;  2FUG 2;  1B9Y C;  4MH3 A;  1AW9 A;  1SKW B;  2KHP A;  1O73 A;  2OBK A;  4F0C A;  1OE7 A;  1NHO A;  5IQY A;  1ZL9 A;  4PX1 A;  2H0G A;  4QQ7 A;  4L0W A;  2GT5 A;  1KNG A;  1XOB A;  4V2M A;  3P90 A;  2PN8 A;  1Z6M A;  4EDZ A;  3LYP A;  2LS5 A;  3UBL A;  1GUM A;  1Z3E A;  3DGQ A;  3O6T A;  1K0M A;  1MD4 A;  2IIY A;  2CVK A;  4LL1 B;  3HJP A;  3GFK A;  2F8A A;  20GS A;  1JZR A;  1XXU A;  3UOM A;  2GSQ A;  2MMO A;  8GSS A;  2R5G A;  3APS A;  1PQN A;  3V1W A;  1T1V A;  3KZQ A;  1MDI A;  2J9H A;  2HZE A;  2RM6 A;  5GZZ B;  5IMZ A;  3K8N A;  1M0U A;  5JWQ B;  2YN1 A;  4ML6 A;  2HNL A;  1DE1 A;  1TI3 A;  1BJX A;  1V57 A;  5LNK e;  2P5Q A;  2LST A;  3NZN A;  1VGL A;  1XW9 A;  1YF0 A;  3GA4 A;  3HCZ A;  4YAV A;  2HI7 A;  2L6C A;  5IPG A;  4FYB A;  1K0D A;  2P31 A;  4TR1 B;  1WMJ A;  5DJL A;  3FY7 A;  3ZIV A;  4FH8 A;  1GP1 A;  4EKZ A;  3TB2 A;  2TRC P;  1TK5 B;  1B9X C;  4WF4 A;  1GSY A;  3CRT A;  2NPB A;  3GIX A;  1R5A A;  3KMN A;  3P8W A;  1CQH A;  4KW6 A;  3IRA A;  1MTC A;  1A2L A;  6GSS A;  2QKE A;  3KH7 A;  2I4A A;  1GTB A;  3SBC A;  4POK A;  4WR4 A;  2LJK A;  1TDI A;  2FCH A;  1M9A A;  1ST9 A;  3LYK A;  3I6A A;  4OFM A;  4N11 A;  12GS A;  2YWI A;  3BCI A;  5ECL B;  1OYJ A;  3LXZ A;  4I2U A;  2GGT A;  2H30 A;  3VI7 A;  3N5O A;  4KB3 A;  3HKR A;  2FA4 A;  4MPG A;  4ID0 A;  2B5Y A;  1QGV A;  2EIR A;  5KN1 A;  5FT3 A;  2IMI A;  3GX8 A;  2HE3 A;  3R2Q A;  3SWL A;  4ZXG A;  4XCS A;  3EWL A;  4HUA A;  4J56 E;  1V2A A;  1BX9 A;  3CSI A;  2KP1 A;  4K2D A;  2VL9 A;  3DKS A;  1DSB A;  4XS1 A;  4MJC A;  3G7J A;  3M8N A;  1A0R P;  3VUR A;  4L8E A;  1V40 A;  1FW1 A;  2EC4 A;  4HZ4 A;  4EL1 A;  4PXO A;  4F2I A;  1ZMA A;  4N0V A;  3RAZ A;  5IO2 A;  4TVE A;  5KN3 A;  1RK4 A;  1K0N A;  4I97 A;  4OWY A;  5DAK B;  3QDN A;  2BMX A;  1SKR B;  3WT2 A;  2L4C A;  2YWN A;  4HI7 A;  2H6Z A;  3DML A;  1UN2 A;  10GS A;  4HU7 A;  3GH6 A;  2OE3 A;  3ZMK A;  1BED A;  4KDU A;  2FA8 A;  2IFQ A;  1X5D A;  4IS0 A;  2E0Q A;  4Q5F A;  1AQX A;  2VL3 A;  3F9U A;  3PH9 A;  3QAW A;  4KCE A;  3N9J A;  2VLV A;  1K3L A;  4JRR A;  4NAX A;  2BTO T;  3E9J B;  2M72 A;  4IEL A;  1GTA A;  4GSS A;  1U6T A;  1GSD A;  2VD1 A;  4PQH A;  1ZOF A;  5G5E A;  3HXS A;  3MDK A;  1WP0 A;  1FOV A;  4K0N A;  2PMT A;  2H6X A;  1A2J A;  1G6Y A;  2H70 A;  5IMC A;  4ECI A;  4OCF A;  1M7T A;  5D9T A;  3CXG A;  1PL2 A;  1OC9 B;  3GH9 A;  3HVX A;  5DAL A;  4EDY A;  2H71 A;  5F06 A;  4AJ8 A;  2I81 A;  3IBH A;  4V1A p;  4ZIJ A;  2F3M A;  1GLQ A;  3TUE A;  1JZD A;  2K8S A;  5J3R A;  4QL9 A;  4PQI A;  4F0B A;  6GSU A;  1PN9 A;  5HR2 A;  4TRX A;  3KTB A;  1SL2 B;  1S3A A;  1CQG A;  2DML A;  4FYU A;  2B1K A;  1VRS D;  1EOG A;  2GQK A;  3RDW A;  4K7I A;  4MJE A;  4GXZ A;  2C8U A;  3GKM A;  4BVY A;  1ABA A;  3FEU A;  4EVM A;  3WYW A;  5J4U A;  2IN3 A;  2GQL A;  3W8J A;  2WB9 A;  3IPZ A;  2M46 A;  1A2M A;  1R4W A;  4OMV A;  1I5G A;  2OA7 A;  4WR5 A;  1PX6 A;  2RUF A;  4J57 E;  1WPI A;  1TU7 A;  1AC1 A;  2LUS A;  4ML1 A;  5ECS A;  3LJR A;  2F51 A;  2B7K A;  4ACS A;  1GUL A;  2ZUP A;  5HR0 A;  1ML6 A;  3IDV A;  4NXI A;  2MZC A;  3KH9 A;  1YQ1 A;  3S9F A;  1ACV A;  3M3M A;  4NV2 A;  1JLW A;  1EEM A;  3J7Y k;  2NDO A;  2YP6 A;  4WBJ A;  2CX3 A;  4KA0 A;  4AGS A;  4BL7 A;  14GS A;  2H19 A;  3GKN A;  4K8M A;  5DCG A;  1J0F A;  2DJ3 A;  3G7I A;  1WWJ A;  1K0C A;  5H5S A;  4OD7 A;  5IOX A;  3W6G A;  1EOH A;  4MMM A;  1WRY A;  2HRN A;  2L4Q A;  1FO5 A;  3QAG A;  4PUF C;  4BA7 A;  1ERU A;  3TKS A;  2C1Y A;  3F4S A;  3IK7 A;  3IE3 A;  1XIY A;  1GL8 A;  1RW1 A;  3EC3 A;  3FRC A;  1JFU A;  2FWH A;  2ON5 A;  2XPD A;  2J23 A;  1KEB A;  2F8F A;  4EE0 A;  2MMN A;  1BYE A;  1B4P A;  1XVQ A;  2GT6 A;  1Y6E A;  2H8L A;  3MAK A;  1Z5Y E;  5D8I A;  3D6I A;  3IHQ A;  4TR0 A;  5CRE A;  3TKR A;  4CW9 A;  2HSH A;  2I3Y A;  4RUV A;  3D22 A;  5IO0 A;  2IWT A;  5DDL A;  1QFN A;  4DVC A;  5CNW A;  4KCA A;  4K9Z A;  2H0H A;  1OE8 A;  3EU4 A;  2QC7 A;  5G31 A;  5DQS A;  2VOC A;  3GL3 A;  5DCH A;  4O32 A;  3HJM A;  1H75 A;  1GNE A;  2CT6 A;  3QD9 A;  4K1F A;  2I1U A;  5ELA A;  1QUW A;  4G10 A;  3GSS A;  2H73 A;  19GS A;  1QK8 A;  2YZU A;  3WT1 A;  4Q5N A;  2H1A A;  2X8C A;  4POL A;  1JLV A;  4MCU A;  1OVN A;  2RM5 A;  1WE0 A;  3FR9 A;  2WJU A;  4YQV A;  3D0Z A;  4GRF A;  3UAR A;  2A4V A;  3HJO A;  4GST A;  1BG5 A;  3APQ A;  2VLU A;  1WJK A;  2PVO C;  1R5P A;  3GTU A;  2JSY A;  1KTE A;  1GSF A;  3LG6 A;  1ZYE A;  2B1L A;  3TDG A;  2CVB A;  3F3R A;  3TOU A;  3ME8 A;  2E7P A;  17GS A;  2VD0 A;  4E8H A;  6GSW A;  1OKT A;  3HZ8 A;  2H66 A;  4NHW A;  5JWO B;  1GTU A;  2MYG A;  1A0F A;  4DSS B;  3UEM A;  3DD3 A;  4DSQ A;  3LWA A;  2H0I A;  4N30 A;  2HXK A;  1SD9 A;  3Q18 A;  4ISD A;  2VO4 A;  4ECC A;  4WF5 A;  5F0G A;  2B7J A;  2CQ9 A;  1YF1 A;  2MMA A;  2FNO A;  3GL5 A;  3FK8 A;  4HQZ A;  5AIX A;  3GYK A;  3I69 A;  2VM2 A;  5FHI A;  1FAA A;  4NPB A;  4KND A;  3F4T A;  3WGX A;  1AQW A;  2LKU A;  3QFB C;  2DJ0 A;  2ON7 A;  3LGC A;  3GRX A;  3FHK A;  2F9S A;  3TGZ A;  1F6M C;  3L78 A;  4N10 A;  4IGJ A;  5IM9 A;  1PMT A;  3QFA C;  1Z6N A;  2GZP A;  2H74 A;  1YKA A;  4LLR A;  4TR3 A;  5JWR B;  4IQ1 A;  1GSS A;  1XWA A;  1UVZ A;  2HRF A;  3AY8 A;  2GSS A;  1XWG A;  4FO5 A;  4V2L A;  3WGD A;  2C0G A;  3A3T A;  3IAS 2;  2FWG A;  6GSV A;  5IMA A;  2XHF A;  4XS6 A;  4MH2 A;  4V2N A;  4XTS A;  1DBY A;  5IMD A;  3DRN A;  1HYU A;  4GSN A;  5DQY A;  2TIR A;  3L9V A;  5HR1 A;  5ECH B;  4YQM A;  4Q5Q A;  1Q98 A;  5CRG A;  1J08 A;  5HQP A;  1TP9 A;  2IL3 A;  3GKX A;  3CSJ A;  4O5R A;  4HS1 A;  2CX4 A;  1Z7R A;  1ON4 A;  3GNJ A;  1O8W A;  1X9S B;  3U5R E;  4XS4 A;  2R6K A;  2XPE A;  3VWW A;  1LU4 A;  1GUH A;  5ID2 A;  3GV1 A;  4MZC A;  2LJA A;  1XOA A;  2K8V A;  3C7M A;  4YQU A;  1PGT A;  4D73 A;  3EYT A;  5J9C A;  1F2E A;  3DVW A;  2HZE B;  1A24 A;  4EC0 A;  4HJ2 A;  3UAP A;  3MWH A;  5DJM A;  5B7C A;  3LQ7 A;  4MJA A;  5CRH A;  2H1B A;  4ZBD A;  1UA5 A;  1K0A A;  2L57 A;  3TJK A;  4PNF A;  3F8U A;  1AAZ A;  1DUG A;  2GVP A;  2AJQ B;  3CYN A;  4WXT A;  2WCI A;  1SEN A;  2X8G A;  3PIN A;  4MF6 A;  1S3D A;  3O76 A;  5ECN B;  3IR4 A;  4HDE A;  2LNS A;  1GH2 A;  1Q4J A;  2DJ2 A;  2JAC A;  2AHE A;  2YV7 A;  3G7Y A;  4ZBB A;  3L9U A;  3ED3 A;  4LL4 B;  1Y25 A;  4I2T A;  5IMV A;  16GS A;  1XCC A;  4ZB8 A;  2VUP A;  3ZL5 A;  1U88 A;  1TW9 A;  3ZVJ D;  5HR3 A;  1TJD A;  4JU5 A;  4KUN A;  1XWK A;  2CA8 A;  2DJ1 A;  4I5Q A;  4WKW A;  1U87 A;  3VPT A;  7GSS A;  3EMX A;  5C00 A;  1FVJ A;  1XWB A;  3UMA A;  2WFC A;  5G1L A;  5GAP D;  2DJK A;  2DIZ A;  3CRU A;  3NIV A;  2H75 A;  5G1K A;  1TI1 A;  3BJ5 A;  2V1M A;  5D93 A;  1PX7 A;  2GDR A;  4MZB A;  2CVD A;  4XIH A;  3ERW A;  2HT9 A;  2V6O A;  1JHB A;  2VCW A;  1TRV A;  3TRX A;  5DVB A;  3W8S A;  1AXD A;  1GNW A;  3MNG A;  1XWC A;  5ID2 B;  4IHU A;  3VWX A;  2H1D A;  2QGV A;  2CAQ A;  5HFG A;  2FLS A;  3ZRE A;  3RHB A;  3P7X A;  1OC8 A;  1X5C A;  1FB6 A;  4G2E A;  3F63 A;  2VM1 A;  3KCM A;  5J41 A;  4TXO A;  1J9B A;  3DYR A;  4AF2 A;  3VFI A;  1K3Y A;  2OKA A;  2O87 A;  2YWO A;  3VI5 A;  5EY6 A;  2VL2 C;  1XW5 A;  2MBS A;  2CV4 A;  1M2A A;  4JR4 A;  1YY7 A;  1TOF A;  2YOI A;  1UC7 A;  1ZZY A;  4MPF A;  1F9M A;  3I9V 2;  1X9W B;  4K6X A;  3A5W A;  4GCI A;  1O85 A;  3A2W A;  3DIE A;  2GTU A;  5INY A;  4P3Y B;  4GWR A;  3CTG A;  4IJ3 A;  4TR4 A;  3BD2 A;  3IXR A;  1NHY A;  2L5L A;  4IJI A;  4TN8 A;  2YV9 A;  2AB6 A;  4JE1 A;  3FKF A;  2FWF A;  3KP8 A;  3A2V A;  3TKS E;  3Q74 A;  1F3B A;  3F3Q A;  2WRT A;  3GN3 A;  1SK0 A;  5G2Z A;  5DBQ A;  1MDK A;  3C1R A;  4ULX A;  3GHA A;  1B4Q A;  1GTI A;  3L0H A;  2R4V A;  1FHE A;  1URM A;  4IQA A;  4EO3 A;  2VAF A;  1O81 A;  3ZIJ A;  4CDO A;  3KIJ A;  4K7N A;  5ENU A;  4E8E A;  3FZA A;  1HD2 A;  2PPT A;  2IFQ B;  3FR6 A;  2P0G A;  1EV9 A;  1QXH A;  3DEX A;  2X99 A;  4KDY A;  5D9X A;  3H1N A;  2IMD A;  3PR8 A;  2FWE A;  5HFI A;  2PVQ A;  5AIS A;  1BQ7 A;  2JU5 A;  2VCZ A;  2B3S A;  2CZ2 A;  4LMV A;  1A8L A;  3GUS A;  5L71 A;  3RBT A;  1WIK A;  1T3B A;  2C0F A;  1AUC A;  1RQM A;  2C3Q A;  2GLR A;  1Z7P A;  4F82 A;  1DE2 A;  2LEG A;  4OO5 A;  2D2Z A;  2JL4 A;  1GSU A;  4TKY A;  3KD0 A;  4J2F A;  4IBP A;  1ERV A;  4HJM A;  5ECM B;  5DAL B;  3C8E A;  1TRW A;  3TRQ A;  4TXV A;  2VIM A;  4ZIL A;  3UBK A;  2OAD A;  3CMI A;  1XBS A;  2CAI A;  2HFD A;  2M80 A;  2V32 A;  5KN0 A;  3FZ9 A;  1PSQ A;  2PUK C;  1M9B A;  2AV4 A;  2LQQ A;  4KSM A;  2OE0 A;  3TRP A;  2O8V B;  1G7O A;  2YAN A;  2AYT A;  1X5E A;  3HZ4 A;  1H4O A;  3HVS A;  2OBI A;  4EF0 A;  3HD5 A;  4OCE A;  2O85 A;  1GLP A;  1MDJ A;  4L5O A;  4XRD A;  2OE1 A;  1EP7 A;  3ZTL A;  2K6V A;  4G9H A;  4L5L A;  3EUR A;  1SK2 A;  3LXT A;  1EZK A;  3M9J A;  2DJJ A;  3H8Q A;  3IK9 A;  4HOJ A;  4WEY A;  18GS A;  3VLN A;  3TKQ A;  11GS A;  2G0F A;  4BWS A;  4EXJ A;  2GS3 A;  3HHV A;  3D5J A;  3KTL A;  3GX0 A;  1X9M B;  1A23 A;  5CYY A;  5J9B A;  6GSX A;  2K18 A;  5ECK B;  5LD0 A;  4BVX A;  4L0U A;  1W89 A;  4MF7 A;  5B8A A;  1T8E B;  3D21 A;  1U3I A;  2JSZ A;  1O7U A;  3BCK A;  3G9B A;  1NSW A;  1ZGN A;  1SL1 B;  3APO A;  5AGY A;  2NTO A;  3MSZ A;  5CRD A;  2HLS A;  3FZ4 A;  1NM3 A;  5J5N A;  6GST A;  1PL1 A;  2HZF A;  2PWJ A;  2LJR A;  3C71 A;  5GAN D;  4IP6 A;  2AAW A;  3DXB A;  2DSA A;  4NMU A;  1W4V A;  2GQM A;  4GTU A;  2TRX A;  3KJY A;  2JZR A;  2CZ3 A;  3LOR A;  2FY6 A;  3HYP A;  4NV5 A;  4WBR D;  3QCP A;  4POB A;  2O7K A;  1SU9 A;  1FG4 A;  2P5R A;  5GST A;  2E2G A;  4PGT A;  3Q6O A;  1V9W A;  3M1G A;  2V6K A;  1SYX A;  4TR1 A;  1KBN A;  2KP2 A;  5CRW A;  5ECQ B;  3GMF A;  3E0U A;  4FIW A;  1TK8 B;  2QSI A;  1GSE A;  3H93 A;  1B8X A;  1XZO A;  3U6V A;  1K0O A;  4DEJ A;  3P2A A;  4HZ2 A;  1TKD B;  1SK1 A;  5IPH A;  5JCU A;  3M9K A;  1EWX A;  3IC4 A;  3D4M A;  4PNG A;  4G19 A;  3WGE A;  2L6D A;  3VWU A;  1X0R A;  22GS A;  2DBC A;  4JED A;  2H01 A;  3UVT A;  3TKP A;  4JZQ A;  3IOS A;  1LBK A;  2L5O A;  5E59 A;  4GF0 A;  5A5K A;  2ALB A;  3ME7 A;  3IA1 A;  2N5B A;  2C3N A;  1G6W A;  3ZRD A;  1SKS B;  3QR6 A;  5F8B A;  2R2J A;  2HYX A;  3GUR A;  1YDK A;  5IIZ A;  2IMF A;  3IAM 2;  5ECP B;  1GWC A;  4ZL8 A;  1YZX A;  3GKK A;  2PGT A;  2YNX A;  1TTZ A;  2LNT A;  1Z9H A;  4GLT A;  1R26 A;  3RPN A;  4PUR A;  3ZVJ A;  3CTF A;  5B6M A;  2ZNM A;  5KN2 A;  3TKS C;  5CO3 A;  4HU9 A;  1OKD A;  3QMX A;  2RUE A;  1GSQ A;  1FVK A;  3QOU A;  2E2M A;  2WS2 A;  4KH7 A;  1THX A;  4ZL7 A;  1SD8 A;  3H79 A;  5EVO A;  1IYI A;  3DVX A;  3EU3 A;  3ISO A;  3GTU B;  2IME A;  3FW2 A;  1VF1 A;  3ZYW A;  2VL2 A;  2V41 A;  2YJH A;  4MDC A;  2JAD A;  2C0E A;  1AIU A;  3HY2 A;  2YJ7 A;  1PD2 1;  1XW6 A;  3LFL A;  4OFN A;  5DAK A;  4ECB A;  1QQ2 A;  4MJB A;  2VCQ A;  3TJG A;  1ZYQ B;  5FWG A;  2WGR A;  3F4R A;  4GQC A;  2NVL A;  5ECR B; 
#chains in the Genus database with same CATH topology
 2K9F A;  5A4V A;  2DC5 A;  4TOP A;  3TJB A;  1K0B A;  5JCW A;  4BPY A;  3M0F A;  1VF3 A;  2IPA A;  1SL0 B;  3H4K A;  2R3X A;  3FR3 A;  1YJ6 A;  3BBY A;  4YAP A;  5HFK A;  3EIN A;  2YCD A;  2X64 A;  4ZL9 A;  2FHE A;  2EIQ A;  2H1G A;  4XRA A;  3IV4 A;  3CBU A;  2C3T A;  1O6J A;  1B48 A;  1SJZ A;  5IMF A;  1ZCP A;  3PGT A;  2B6M A;  5B6N A;  1SJI A;  1THO A;  4Z2U A;  1TRS A;  2YZH A;  1OC9 A;  2LTK A;  1SYR A;  1M2B A;  1QMV A;  3KEB A;  4YH2 A;  2LRC A;  1TRU A;  3TOT A;  2H6Y A;  4MNN A;  5A4W A;  2HSY A;  5LCZ A;  2C4J A;  3Q19 A;  1TU8 A;  1EEJ A;  1HNC A;  3KGK A;  1VF4 A;  4NHZ A;  1IYH A;  5IOW A;  2PER A;  1ERW A;  4V1A g;  2JZT A;  4O7H A;  3OR5 A;  4CY6 A;  3ZFB A;  5B8B A;  1HNB A;  4I6X A;  4KE3 A;  2WUL A;  4NWY A;  4H86 A;  5D9W A;  2B5E A;  1K3O A;  3TCO A;  2VLT A;  3BOA A;  1V58 A;  4Z7X A;  4TW5 A;  1S3C A;  13GS A;  1USB A;  1YEX A;  3UIW A;  2REM A;  4MK3 A;  2WZ9 A;  1G7E A;  3JCM L;  1T4Y A;  2XC2 A;  4XS4 B;  4K5S A;  2R0C A;  3PPU A;  5C04 A;  1O8X A;  4O92 A;  3TJJ A;  4D73 B;  3A2X A;  4FYC A;  5G30 A;  3C73 A;  1EP8 A;  4ILF A;  2KOK A;  1V98 A;  3RPP A;  4HQS A;  4X0X A;  3QPM A;  1G0T A;  3ZLP A;  1YKC A;  3FYG A;  1T7P B;  4K7O A;  4RI7 A;  3LSZ A;  4IKH A;  2GZZ A;  2I9H A;  1JZO A;  4KDX A;  2H72 A;  3US3 A;  3KP9 A;  3O3T A;  4PTS A;  5ECI B;  3C1S A;  1TK0 B;  1A8Y A;  1NW2 A;  4DSR A;  2DMM A;  4MZW A;  4ZB9 A;  2EIO A;  5EL8 A;  1S3R A;  2YPM A;  2R37 A;  1AQV A;  1OC3 A;  1M99 A;  2FGX A;  1GUK A;  1PA3 A;  2IMK A;  2A2S A;  4POM A;  1F37 A;  3KXO A;  4RI6 A;  4F9Z A;  4RQX A;  2C80 A;  2B5X A;  3HA9 A;  1MEK A;  1YEP A;  4LMW A;  2WDU A;  5EPF A;  3UL3 A;  4JR6 A;  1SJ6 A;  4MP4 A;  4GQF A;  4WET A;  3EPT A;  3DWV A;  4ECJ A;  3L4N A;  5A4U A;  5AIV A;  4KF9 A;  2LV3 A;  5CAX A;  2H76 A;  4LA1 A;  4N0Z A;  1C72 A;  4BWQ A;  2VCX A;  4X4J A;  1XVW A;  1XPV A;  3EE2 A;  4IN0 A;  2MBT A;  3J7Y b;  3VWV A;  1VF2 A;  2XBI A;  2IJY A;  2RII A;  4MA9 A;  5D96 A;  4TXO B;  1I9D A;  2ZCT A;  1HQO A;  3UJ1 A;  4RQR A;  3NOF A;  2NBS A;  2VCT A;  2GST A;  3I43 A;  3EMP A;  4JBB A;  4PUA A;  3VK9 A;  1F3A A;  3GST A;  1PKZ A;  1N2A A;  3ZIT A;  4Q5R A;  5E4W A;  1U3A A;  2KUC A;  1N8J A;  3LEF A;  2MMZ A;  2YWM A;  4KGI A;  2QA2 A;  5ECO B;  2O89 A;  1XFL A;  4CHS A;  3HVN A;  2LQO A;  3F6D A;  5ABR A;  4IVF A;  4EUY A;  1E2Y A;  3E3E A;  3F0I A;  1T4Z A;  2XBQ A;  4OFT A;  4MLY A;  2X8H A;  2JZS A;  3D4T A;  3F6F A;  3VPQ A;  5ELG A;  3L9S A;  1BAY A;  3KM6 A;  3KMO A;  1MD3 A;  2BJX A;  2PU9 C;  4AJ6 A;  1ERT A;  4I8B A;  4X1U A;  4OO4 A;  2AUV A;  3EVI A;  2GSR A;  4ZBA A;  3HVV A;  3HDC A;  4F03 A;  5GSS A;  1HNA A;  4KSO A;  2Z9S A;  5COH A;  5CP1 A;  2G2Q A;  1TXX A;  2A2R A;  5D73 A;  4K0G A;  2DLX A;  4X43 A;  3ERF A;  2KLX A;  5KOW A;  4DSS A;  1ILO A;  1E6B A;  1JZW A;  1PRX A;  2VCV A;  1WOU A;  2GZY A;  1M2D A;  3ZZX A;  4ZB6 A;  5JCG A;  9GSS A;  2V2G A;  1FB0 A;  2PBJ A;  2L59 A;  2ES7 A;  2OJL A;  2DIY A;  3IHG A;  4QL7 A;  1EGO A;  5AN1 A;  1EGR A;  3ZML A;  2C0D A;  2N5F A;  4KX4 A;  3TJF A;  5KEJ A;  1GRX A;  2RLI A;  5H5Q A;  4AJ7 A;  5D9V A;  5F07 A;  5F05 A;  4HEA 2;  2N5A A;  4XHM A;  3WD6 A;  4MF5 A;  1T00 A;  4KAE A;  4IW9 A;  5BMU A;  3FZ5 A;  3QAV A;  1LJR A;  3ERG A;  4MAB A;  1OAZ A;  4PQ1 A;  3UVH A;  6GSY A;  2FD3 A;  5G5F A;  3ZFL A;  2HRK A;  2LRT A;  3RHC A;  2OAC A;  2LRN A;  1R7H A;  4IP1 A;  1EV4 A;  1PKW A;  3CSH A;  5H5R A;  2FUG 2;  1B9Y C;  4MH3 A;  1AW9 A;  1SKW B;  2KHP A;  1O73 A;  2OBK A;  4F0C A;  1OE7 A;  1NHO A;  5IQY A;  1ZL9 A;  4PX1 A;  2H0G A;  4QQ7 A;  4L0W A;  2GT5 A;  1KNG A;  1XOB A;  4V2M A;  3P90 A;  2PN8 A;  4EIQ A;  1Z6M A;  4EDZ A;  3LYP A;  2LS5 A;  3UBL A;  1GUM A;  1Z3E A;  3DGQ A;  2QA1 A;  3O6T A;  1K0M A;  1MD4 A;  2IIY A;  2CVK A;  4LL1 B;  3HJP A;  3GFK A;  2F8A A;  20GS A;  1JZR A;  1XXU A;  3UOM A;  2GSQ A;  2MMO A;  8GSS A;  2R5G A;  3APS A;  1PQN A;  3V1W A;  1T1V A;  3KZQ A;  1MDI A;  2J9H A;  2HZE A;  2RM6 A;  5GZZ B;  5IMZ A;  4EIP A;  3K8N A;  1M0U A;  5JWQ B;  2YN1 A;  4ML6 A;  2HNL A;  1DE1 A;  1TI3 A;  1BJX A;  1V57 A;  5LNK e;  2P5Q A;  2LST A;  3NZN A;  1VGL A;  1XW9 A;  1YF0 A;  3GA4 A;  3HCZ A;  4YAV A;  2HI7 A;  2L6C A;  5IPG A;  4FYB A;  1K0D A;  2P31 A;  4YKG A;  4TR1 B;  1WMJ A;  5DJL A;  3FY7 A;  3ZIV A;  4FH8 A;  1GP1 A;  2A2P A;  4EKZ A;  3TB2 A;  2TRC P;  1TK5 B;  1B9X C;  4WF4 A;  1GSY A;  3CRT A;  2NPB A;  3GIX A;  1R5A A;  3KMN A;  3P8W A;  1CQH A;  4KW6 A;  3IRA A;  1MTC A;  1A2L A;  6GSS A;  2QKE A;  3KH7 A;  2I4A A;  1GTB A;  3SBC A;  4POK A;  4WR4 A;  2LJK A;  1TDI A;  2FCH A;  1M9A A;  1ST9 A;  3LYK A;  3I6A A;  4OFM A;  4N11 A;  12GS A;  2YWI A;  3BCI A;  5ECL B;  1OYJ A;  2DKH A;  1ZYP A;  3LXZ A;  4I2U A;  2GGT A;  2H30 A;  3VI7 A;  4K2X A;  3N5O A;  1ZYN A;  4KB3 A;  3HKR A;  2FA4 A;  4MPG A;  4ID0 A;  2B5Y A;  1QGV A;  2EIR A;  5KN1 A;  5FT3 A;  2IMI A;  3GX8 A;  2HE3 A;  3R2Q A;  3SWL A;  4ZXG A;  4XCS A;  3EWL A;  4HUA A;  4J56 E;  1V2A A;  1BX9 A;  3CSI A;  2KP1 A;  4K2D A;  2VL9 A;  3DKS A;  3IC8 A;  1DSB A;  4XS1 A;  4MJC A;  3G7J A;  3M8N A;  1A0R P;  3VUR A;  4L8E A;  1V40 A;  1FW1 A;  2EC4 A;  4HZ4 A;  4EL1 A;  4PXO A;  4F2I A;  1ZMA A;  4N0V A;  3RAZ A;  5IO2 A;  4TVE A;  5KN3 A;  1RK4 A;  1K0N A;  4I97 A;  4OWY A;  5DAK B;  4USS A;  3QDN A;  4Z2T A;  2BMX A;  1SKR B;  3WT2 A;  2L4C A;  2YWN A;  4HI7 A;  2H6Z A;  3DML A;  1UN2 A;  10GS A;  4HU7 A;  3GH6 A;  2OE3 A;  3ZMK A;  2A4H A;  1BED A;  4KDU A;  2FA8 A;  4FQU A;  2IFQ A;  1X5D A;  4IS0 A;  1PFO A;  2E0Q A;  3FMW A;  4Q5F A;  1AQX A;  2VL3 A;  3F9U A;  3PH9 A;  3QAW A;  4KCE A;  3N9J A;  2VLV A;  1K3L A;  4JRR A;  4NAX A;  2BTO T;  3E9J B;  2M72 A;  4IEL A;  1GTA A;  4GSS A;  1U6T A;  1GSD A;  2VD1 A;  4PQH A;  1ZOF A;  5G5E A;  3HXS A;  3MDK A;  1WP0 A;  1FOV A;  4K0N A;  2PMT A;  2H6X A;  1A2J A;  1G6Y A;  2H70 A;  5IMC A;  4ECI A;  4OCF A;  1M7T A;  5D9T A;  3CXG A;  1PL2 A;  1OC9 B;  3GH9 A;  3HVX A;  5DAL A;  4EDY A;  2H71 A;  5F06 A;  4AJ8 A;  2I81 A;  3IBH A;  4V1A p;  4ZIJ A;  2F3M A;  1GLQ A;  3TUE A;  1JZD A;  2K8S A;  5J3R A;  4QL9 A;  4PQI A;  4F0B A;  6GSU A;  1PN9 A;  5HR2 A;  4TRX A;  3KTB A;  1SL2 B;  1S3A A;  1CQG A;  2DML A;  4FYU A;  2B1K A;  1VRS D;  1EOG A;  2GQK A;  3RDW A;  4K7I A;  4MJE A;  4GXZ A;  2C8U A;  3GKM A;  4BVY A;  1ABA A;  3FEU A;  4EVM A;  4HSC X;  3WYW A;  5J4U A;  2IN3 A;  2GQL A;  3W8J A;  2WB9 A;  4Z2R A;  3IPZ A;  2M46 A;  1A2M A;  1R4W A;  4OMV A;  1I5G A;  2OA7 A;  4WR5 A;  1PX6 A;  2RUF A;  4J57 E;  1WPI A;  2R0G A;  1TU7 A;  1AC1 A;  2LUS A;  4ML1 A;  5ECS A;  3LJR A;  2F51 A;  2B7K A;  4ACS A;  1GUL A;  2ZUP A;  5HR0 A;  1ML6 A;  3IDV A;  4NXI A;  2MZC A;  3KH9 A;  1YQ1 A;  3S9F A;  1ACV A;  3M3M A;  4NV2 A;  1JLW A;  1EEM A;  3J7Y k;  2NDO A;  2YP6 A;  4WBJ A;  2CX3 A;  4KA0 A;  4AGS A;  4BL7 A;  14GS A;  2H19 A;  3GKN A;  4K8M A;  5DCG A;  1J0F A;  2DJ3 A;  3G7I A;  1WWJ A;  1K0C A;  5H5S A;  4OD7 A;  5IOX A;  3W6G A;  1EOH A;  4MMM A;  1WRY A;  2HRN A;  2L4Q A;  1FO5 A;  3QAG A;  4PUF C;  4BA7 A;  1ERU A;  3TKS A;  2C1Y A;  3F4S A;  3IK7 A;  3IE3 A;  1XIY A;  1GL8 A;  1RW1 A;  3EC3 A;  3FRC A;  1JFU A;  3CQF A;  2X4A A;  2FWH A;  2ON5 A;  2XPD A;  2J23 A;  1KEB A;  2F8F A;  4EE0 A;  2MMN A;  1BYE A;  1B4P A;  1XVQ A;  2GT6 A;  1Y6E A;  2H8L A;  3MAK A;  1Z5Y E;  5D8I A;  3D6I A;  3IHQ A;  4TR0 A;  4G0L A;  5CRE A;  3TKR A;  4CW9 A;  2HSH A;  2I3Y A;  4RUV A;  3D22 A;  5IO0 A;  2IWT A;  5DDL A;  1QFN A;  4DVC A;  5CNW A;  4KCA A;  4K9Z A;  2H0H A;  1OE8 A;  3EU4 A;  2QC7 A;  5G31 A;  5DQS A;  2VOC A;  3GL3 A;  5DCH A;  4O32 A;  3HJM A;  1H75 A;  1GNE A;  2CT6 A;  3QD9 A;  4K1F A;  2I1U A;  5ELA A;  1QUW A;  4G10 A;  3GSS A;  2H73 A;  19GS A;  1QK8 A;  2YZU A;  3WT1 A;  4Q5N A;  2H1A A;  2X8C A;  4POL A;  1JLV A;  4MCU A;  1OVN A;  4BL7 B;  2RM5 A;  1WE0 A;  3FR9 A;  2WJU A;  4YQV A;  3D0Z A;  4GRF A;  3UAR A;  2A4V A;  3HJO A;  4GST A;  1BG5 A;  3APQ A;  2VLU A;  1WJK A;  2PVO C;  1R5P A;  3GTU A;  2JSY A;  1KTE A;  1GSF A;  3LG6 A;  1ZYE A;  2B1L A;  3TDG A;  2CVB A;  3F3R A;  3TOU A;  3ME8 A;  2E7P A;  17GS A;  2VD0 A;  4E8H A;  6GSW A;  1OKT A;  3HZ8 A;  2H66 A;  4NHW A;  5JWO B;  1GTU A;  2MYG A;  1A0F A;  4DSS B;  3UEM A;  4YKF A;  3DD3 A;  4DSQ A;  3LWA A;  2H0I A;  4N30 A;  4ICY A;  2HXK A;  1SD9 A;  3Q18 A;  4ISD A;  2VO4 A;  4ECC A;  4WF5 A;  5F0G A;  2B7J A;  2CQ9 A;  1YF1 A;  2MMA A;  2FNO A;  3GL5 A;  3FK8 A;  4HQZ A;  5AIX A;  3GYK A;  3I69 A;  2VM2 A;  5FHI A;  1FAA A;  4NPB A;  4KND A;  3F4T A;  3WGX A;  1AQW A;  2LKU A;  3QFB C;  2DJ0 A;  2ON7 A;  3LGC A;  3GRX A;  3FHK A;  2F9S A;  3TGZ A;  1F6M C;  3L78 A;  4N10 A;  4IGJ A;  5IM9 A;  1PMT A;  3QFA C;  1Z6N A;  2GZP A;  2H74 A;  1YKA A;  4LLR A;  4TR3 A;  5JWR B;  4IQ1 A;  1GSS A;  1XWA A;  1UVZ A;  2HRF A;  3AY8 A;  2GSS A;  1XWG A;  4FO5 A;  4V2L A;  5KOX A;  3WGD A;  2C0G A;  3A3T A;  3IAS 2;  2FWG A;  6GSV A;  5IMA A;  2XHF A;  4XS6 A;  4MH2 A;  4V2N A;  4XTS A;  1DBY A;  5IMD A;  3DRN A;  1HYU A;  4GSN A;  5DQY A;  2TIR A;  3L9V A;  5HR1 A;  5ECH B;  4YQM A;  4Q5Q A;  1Q98 A;  5CRG A;  1J08 A;  5HQP A;  1TP9 A;  2IL3 A;  3GKX A;  3CSJ A;  4O5R A;  2X49 A;  4HS1 A;  2CX4 A;  1Z7R A;  1ON4 A;  3GNJ A;  1O8W A;  1X9S B;  3U5R E;  4XS4 A;  2R6K A;  2XPE A;  3VWW A;  1LU4 A;  1GUH A;  5ID2 A;  3GV1 A;  4MZC A;  2LJA A;  1XOA A;  2K8V A;  3C7M A;  4YQU A;  1PGT A;  4D73 A;  3EYT A;  5J9C A;  1F2E A;  3DVW A;  2HZE B;  1A24 A;  4EC0 A;  4HJ2 A;  3A5I A;  3UAP A;  3MWH A;  5DJM A;  5B7C A;  3LQ7 A;  4MJA A;  4K5R A;  5CRH A;  2H1B A;  2R0P A;  4ZBD A;  1UA5 A;  1K0A A;  2L57 A;  3TJK A;  4PNF A;  3F8U A;  1AAZ A;  1DUG A;  2GVP A;  2AJQ B;  3CYN A;  4WXT A;  2WCI A;  1SEN A;  2X8G A;  3PIN A;  4MF6 A;  1S3D A;  3O76 A;  5ECN B;  3IR4 A;  4HDE A;  2LNS A;  1GH2 A;  1Q4J A;  2DJ2 A;  2JAC A;  2AHE A;  2YV7 A;  3G7Y A;  4ZBB A;  3L9U A;  3ED3 A;  4LL4 B;  1Y25 A;  4I2T A;  5IMV A;  16GS A;  1XCC A;  4ZB8 A;  2VUP A;  3ZL5 A;  1U88 A;  1TW9 A;  3ZVJ D;  5HR3 A;  1TJD A;  4JU5 A;  4KUN A;  1XWK A;  2CA8 A;  2DJ1 A;  4I5Q A;  4WKW A;  1U87 A;  3VPT A;  7GSS A;  3EMX A;  5C00 A;  1FVJ A;  1XWB A;  3UMA A;  2WFC A;  5G1L A;  5GAP D;  2DJK A;  2DIZ A;  3CRU A;  3NIV A;  2H75 A;  5G1K A;  1TI1 A;  3BJ5 A;  2V1M A;  5D93 A;  1PX7 A;  2GDR A;  4MZB A;  2CVD A;  4XIH A;  3ERW A;  2HT9 A;  2V6O A;  1JHB A;  2VCW A;  1TRV A;  3TRX A;  5DVB A;  1XG8 A;  3W8S A;  1AXD A;  1GNW A;  3MNG A;  1XWC A;  5ID2 B;  4IHU A;  3VWX A;  2H1D A;  2QGV A;  2CAQ A;  5HFG A;  2FLS A;  3ZRE A;  3RHB A;  3P7X A;  1OC8 A;  1X5C A;  1FB6 A;  4G2E A;  3F63 A;  2VM1 A;  3KCM A;  3LW9 A;  5J41 A;  4TXO A;  1J9B A;  3DYR A;  4AF2 A;  3VFI A;  1K3Y A;  2OKA A;  2O87 A;  2YWO A;  3VI5 A;  5EY6 A;  2VL2 C;  1XW5 A;  2MBS A;  2CV4 A;  1M2A A;  4JR4 A;  1YY7 A;  1TOF A;  2YOI A;  1UC7 A;  1ZZY A;  4MPF A;  1F9M A;  3I9V 2;  1X9W B;  4O5Q A;  4K6X A;  3A5W A;  4GCI A;  1O85 A;  3A2W A;  3DIE A;  2GTU A;  5INY A;  4P3Y B;  4GWR A;  3CTG A;  4IJ3 A;  4TR4 A;  3BD2 A;  3IXR A;  1NHY A;  2L5L A;  4IJI A;  4TN8 A;  2YV9 A;  2AB6 A;  4JE1 A;  3FKF A;  2FWF A;  3KP8 A;  3A2V A;  3TKS E;  3Q74 A;  1F3B A;  3F3Q A;  2WRT A;  3R3E A;  3GN3 A;  1SK0 A;  5G2Z A;  5DBQ A;  2DKI A;  4G0I A;  1MDK A;  3C1R A;  4ULX A;  3GHA A;  1B4Q A;  1GTI A;  3L0H A;  2R4V A;  1FHE A;  1URM A;  4IQA A;  4EO3 A;  2VAF A;  1O81 A;  3ZIJ A;  4CDO A;  3KIJ A;  4K7N A;  5ENU A;  4G0K A;  4E8E A;  3FZA A;  1HD2 A;  2PPT A;  2IFQ B;  3FR6 A;  2P0G A;  1EV9 A;  1QXH A;  3DEX A;  2X99 A;  4KDY A;  5D9X A;  3H1N A;  2IMD A;  3PR8 A;  2FWE A;  5HFI A;  2PVQ A;  5AIS A;  1BQ7 A;  2JU5 A;  3MYD A;  2VCZ A;  2B3S A;  2CZ2 A;  4LMV A;  1A8L A;  3GUS A;  5L71 A;  3RBT A;  1WIK A;  1T3B A;  2C0F A;  1AUC A;  1RQM A;  2C3Q A;  2GLR A;  1Z7P A;  4F82 A;  1DE2 A;  2LEG A;  4OO5 A;  2D2Z A;  2JL4 A;  1GSU A;  4TKY A;  4BIK A;  3KD0 A;  4J2F A;  4IBP A;  1ERV A;  4HJM A;  5ECM B;  5DAL B;  3C8E A;  1TRW A;  3TRQ A;  4TXV A;  2VIM A;  4ZIL A;  3UBK A;  2OAD A;  4O5U A;  3CMI A;  1XBS A;  2CAI A;  2HFD A;  2M80 A;  2V32 A;  5KN0 A;  3FZ9 A;  1PSQ A;  2PUK C;  1M9B A;  2AV4 A;  2LQQ A;  4KSM A;  2OE0 A;  3TRP A;  2O8V B;  1G7O A;  2YAN A;  2AYT A;  1X5E A;  3HZ4 A;  1H4O A;  3HVS A;  2OBI A;  4EF0 A;  3HD5 A;  4OCE A;  2O85 A;  1GLP A;  1MDJ A;  4L5O A;  4XRD A;  2OE1 A;  1EP7 A;  3ZTL A;  1M3I A;  2K6V A;  4G9H A;  4L5L A;  3EUR A;  1SK2 A;  3LXT A;  1EZK A;  3M9J A;  2DJJ A;  3H8Q A;  3IK9 A;  4HOJ A;  4BVY B;  4WEY A;  18GS A;  3VLN A;  3TKQ A;  11GS A;  2G0F A;  4BWS A;  4EXJ A;  2GS3 A;  3HHV A;  3D5J A;  3KTL A;  3GX0 A;  1X9M B;  1A23 A;  5CYY A;  5J9B A;  6GSX A;  2K18 A;  5ECK B;  5LD0 A;  4BVX A;  4L0U A;  1W89 A;  4MF7 A;  1FOH A;  5B8A A;  1T8E B;  3D21 A;  1U3I A;  2JSZ A;  1O7U A;  3BCK A;  3G9B A;  1NSW A;  1ZGN A;  1SL1 B;  3APO A;  5AGY A;  2NTO A;  3MSZ A;  5CRD A;  2HLS A;  3FZ4 A;  1NM3 A;  5J5N A;  6GST A;  1PL1 A;  2HZF A;  2PWJ A;  2LJR A;  3C71 A;  5GAN D;  4IP6 A;  2AAW A;  3DXB A;  2DSA A;  4NMU A;  1W4V A;  2GQM A;  4GTU A;  2TRX A;  3KJY A;  2JZR A;  2CZ3 A;  3LOR A;  2FY6 A;  3HYP A;  4NV5 A;  4WBR D;  3QCP A;  4POB A;  2O7K A;  1SU9 A;  1FG4 A;  2P5R A;  5GST A;  4A5P A;  2E2G A;  4PGT A;  3Q6O A;  1V9W A;  3M1G A;  2V6K A;  1SYX A;  4TR1 A;  1KBN A;  2KP2 A;  5CRW A;  5ECQ B;  3GMF A;  3E0U A;  4FIW A;  1TK8 B;  2QSI A;  1GSE A;  3H93 A;  1B8X A;  1XZO A;  3U6V A;  1K0O A;  4CY8 A;  4DEJ A;  3P2A A;  4HZ2 A;  1TKD B;  1SK1 A;  5IPH A;  5JCU A;  3M9K A;  1EWX A;  3IC4 A;  3D4M A;  4PNG A;  4G19 A;  3WGE A;  2L6D A;  3VWU A;  1X0R A;  22GS A;  2DBC A;  4JED A;  2H01 A;  3UVT A;  3TKP A;  4JZQ A;  4BVX B;  3IOS A;  1LBK A;  2L5O A;  4GF0 A;  5E59 A;  5A5K A;  2ALB A;  3ME7 A;  3IA1 A;  2N5B A;  3MIX A;  2C3N A;  1G6W A;  3ZRD A;  1SKS B;  3QR6 A;  5F8B A;  2R2J A;  2HYX A;  3GUR A;  1YDK A;  5IIZ A;  2IMF A;  3IAM 2;  5ECP B;  1GWC A;  2HSM A;  4ZL8 A;  1YZX A;  3GKK A;  2PGT A;  2YNX A;  1PN0 A;  1TTZ A;  2LNT A;  1Z9H A;  4GLT A;  1R26 A;  2HRA A;  3RPN A;  2UZ8 A;  4PUR A;  3ZVJ A;  3CTF A;  5B6M A;  2ZNM A;  5KN2 A;  3TKS C;  5CO3 A;  4HU9 A;  1OKD A;  3QMX A;  2RUE A;  1GSQ A;  1M3J A;  1FVK A;  3QOU A;  2E2M A;  2WS2 A;  4KH7 A;  1THX A;  4ZL7 A;  1SD8 A;  3H79 A;  5EVO A;  1IYI A;  3DVX A;  3EU3 A;  3ISO A;  3GTU B;  2IME A;  3FW2 A;  1VF1 A;  3ZYW A;  2VL2 A;  2V41 A;  2YJH A;  4MDC A;  2JAD A;  2C0E A;  1AIU A;  3HY2 A;  2YJ7 A;  1PD2 1;  1XW6 A;  3LFL A;  4OFN A;  5DAK A;  4ECB A;  1QQ2 A;  4MJB A;  2VCQ A;  3TJG A;  1ZYQ B;  5FWG A;  2WGR A;  5BRT A;  3F4R A;  4GQC A;  2NVL A;  5ECR B; 
#chains in the Genus database with same CATH homology
 2K9F A;  5A4V A;  2DC5 A;  4TOP A;  3TJB A;  1K0B A;  5JCW A;  4BPY A;  3M0F A;  1VF3 A;  2IPA A;  1SL0 B;  3H4K A;  2R3X A;  3FR3 A;  1YJ6 A;  3BBY A;  4YAP A;  5HFK A;  3EIN A;  2YCD A;  2X64 A;  4ZL9 A;  2FHE A;  2EIQ A;  2H1G A;  4XRA A;  3IV4 A;  3CBU A;  2C3T A;  1O6J A;  1B48 A;  1SJZ A;  5IMF A;  1ZCP A;  3PGT A;  2B6M A;  5B6N A;  1SJI A;  1THO A;  4Z2U A;  1TRS A;  2YZH A;  1OC9 A;  2LTK A;  1SYR A;  1M2B A;  1QMV A;  3KEB A;  4YH2 A;  2LRC A;  1TRU A;  3TOT A;  2H6Y A;  4MNN A;  5A4W A;  2HSY A;  5LCZ A;  2C4J A;  3Q19 A;  1TU8 A;  1EEJ A;  1HNC A;  3KGK A;  1VF4 A;  4NHZ A;  1IYH A;  5IOW A;  2PER A;  1ERW A;  4V1A g;  2JZT A;  4O7H A;  3OR5 A;  4CY6 A;  3ZFB A;  5B8B A;  1HNB A;  4I6X A;  4KE3 A;  2WUL A;  4NWY A;  4H86 A;  5D9W A;  2B5E A;  1K3O A;  3TCO A;  2VLT A;  3BOA A;  1V58 A;  4Z7X A;  4TW5 A;  1S3C A;  13GS A;  1USB A;  1YEX A;  3UIW A;  2REM A;  4MK3 A;  2WZ9 A;  1G7E A;  3JCM L;  1T4Y A;  2XC2 A;  4XS4 B;  4K5S A;  2R0C A;  3PPU A;  5C04 A;  1O8X A;  4O92 A;  3TJJ A;  4D73 B;  3A2X A;  4FYC A;  5G30 A;  3C73 A;  1EP8 A;  4ILF A;  2KOK A;  1V98 A;  3RPP A;  4HQS A;  4X0X A;  3QPM A;  1G0T A;  3ZLP A;  1YKC A;  3FYG A;  1T7P B;  4K7O A;  4RI7 A;  3LSZ A;  4IKH A;  2GZZ A;  2I9H A;  1JZO A;  4KDX A;  2H72 A;  3US3 A;  3KP9 A;  3O3T A;  4PTS A;  5ECI B;  3C1S A;  1TK0 B;  1A8Y A;  1NW2 A;  4DSR A;  2DMM A;  4MZW A;  4ZB9 A;  2EIO A;  5EL8 A;  2YPM A;  2R37 A;  1AQV A;  1OC3 A;  1M99 A;  2FGX A;  1GUK A;  1PA3 A;  2IMK A;  2A2S A;  4POM A;  1F37 A;  3KXO A;  4RI6 A;  4F9Z A;  4RQX A;  2C80 A;  2B5X A;  3HA9 A;  1MEK A;  1YEP A;  4LMW A;  2WDU A;  5EPF A;  3UL3 A;  4JR6 A;  1SJ6 A;  4MP4 A;  4GQF A;  4WET A;  3EPT A;  3DWV A;  4ECJ A;  3L4N A;  5A4U A;  5AIV A;  4KF9 A;  2LV3 A;  5CAX A;  2H76 A;  4LA1 A;  4N0Z A;  1C72 A;  4BWQ A;  2VCX A;  4X4J A;  1XVW A;  1XPV A;  3EE2 A;  4IN0 A;  2MBT A;  3J7Y b;  3VWV A;  1VF2 A;  2XBI A;  2IJY A;  2RII A;  4MA9 A;  5D96 A;  4TXO B;  1I9D A;  2ZCT A;  1HQO A;  3UJ1 A;  4RQR A;  3NOF A;  2NBS A;  2VCT A;  2GST A;  3I43 A;  3EMP A;  4JBB A;  4PUA A;  3VK9 A;  1F3A A;  3GST A;  1PKZ A;  1N2A A;  3ZIT A;  4Q5R A;  5E4W A;  1U3A A;  2KUC A;  1N8J A;  3LEF A;  2MMZ A;  2YWM A;  4KGI A;  2QA2 A;  5ECO B;  2O89 A;  1XFL A;  4CHS A;  2LQO A;  3F6D A;  5ABR A;  4IVF A;  4EUY A;  1E2Y A;  3E3E A;  3F0I A;  1T4Z A;  2XBQ A;  4OFT A;  4MLY A;  2X8H A;  2JZS A;  3D4T A;  3F6F A;  3VPQ A;  5ELG A;  3L9S A;  1BAY A;  3KM6 A;  3KMO A;  1MD3 A;  2BJX A;  2PU9 C;  4AJ6 A;  1ERT A;  4I8B A;  4X1U A;  4OO4 A;  2AUV A;  3EVI A;  2GSR A;  4ZBA A;  3HVV A;  3HDC A;  4F03 A;  5GSS A;  1HNA A;  4KSO A;  2Z9S A;  5COH A;  5CP1 A;  2G2Q A;  1TXX A;  2A2R A;  5D73 A;  4K0G A;  2DLX A;  4X43 A;  3ERF A;  2KLX A;  5KOW A;  4DSS A;  1ILO A;  1E6B A;  1JZW A;  1PRX A;  2VCV A;  1WOU A;  2GZY A;  1M2D A;  3ZZX A;  4ZB6 A;  5JCG A;  9GSS A;  2V2G A;  1FB0 A;  2PBJ A;  2L59 A;  2ES7 A;  2OJL A;  2DIY A;  3IHG A;  4QL7 A;  1EGO A;  5AN1 A;  1EGR A;  3ZML A;  2C0D A;  2N5F A;  4KX4 A;  3TJF A;  5KEJ A;  1GRX A;  2RLI A;  5H5Q A;  4AJ7 A;  5D9V A;  5F07 A;  5F05 A;  4HEA 2;  2N5A A;  4XHM A;  3WD6 A;  4MF5 A;  1T00 A;  4KAE A;  4IW9 A;  5BMU A;  3FZ5 A;  3QAV A;  1LJR A;  3ERG A;  4MAB A;  1OAZ A;  4PQ1 A;  3UVH A;  6GSY A;  2FD3 A;  5G5F A;  3ZFL A;  2HRK A;  2LRT A;  3RHC A;  2OAC A;  2LRN A;  1R7H A;  4IP1 A;  1EV4 A;  1PKW A;  3CSH A;  5H5R A;  2FUG 2;  1B9Y C;  4MH3 A;  1AW9 A;  1SKW B;  2KHP A;  1O73 A;  2OBK A;  4F0C A;  1OE7 A;  1NHO A;  5IQY A;  1ZL9 A;  4PX1 A;  2H0G A;  4QQ7 A;  4L0W A;  2GT5 A;  1KNG A;  1XOB A;  4V2M A;  3P90 A;  2PN8 A;  4EIQ A;  1Z6M A;  4EDZ A;  3LYP A;  2LS5 A;  3UBL A;  1GUM A;  1Z3E A;  3DGQ A;  2QA1 A;  3O6T A;  1K0M A;  1MD4 A;  2IIY A;  2CVK A;  4LL1 B;  3HJP A;  3GFK A;  2F8A A;  20GS A;  1JZR A;  1XXU A;  3UOM A;  2GSQ A;  2MMO A;  8GSS A;  2R5G A;  3APS A;  1PQN A;  3V1W A;  1T1V A;  3KZQ A;  1MDI A;  2J9H A;  2HZE A;  2RM6 A;  5GZZ B;  5IMZ A;  4EIP A;  3K8N A;  1M0U A;  5JWQ B;  2YN1 A;  4ML6 A;  2HNL A;  1DE1 A;  1TI3 A;  1BJX A;  1V57 A;  5LNK e;  2P5Q A;  2LST A;  3NZN A;  1VGL A;  1XW9 A;  1YF0 A;  3GA4 A;  3HCZ A;  4YAV A;  2HI7 A;  2L6C A;  5IPG A;  4FYB A;  1K0D A;  2P31 A;  4YKG A;  4TR1 B;  1WMJ A;  5DJL A;  3FY7 A;  3ZIV A;  4FH8 A;  1GP1 A;  2A2P A;  4EKZ A;  3TB2 A;  2TRC P;  1TK5 B;  1B9X C;  4WF4 A;  1GSY A;  3CRT A;  2NPB A;  3GIX A;  1R5A A;  3KMN A;  3P8W A;  1CQH A;  4KW6 A;  3IRA A;  1MTC A;  1A2L A;  6GSS A;  2QKE A;  3KH7 A;  2I4A A;  1GTB A;  3SBC A;  4POK A;  4WR4 A;  2LJK A;  1TDI A;  2FCH A;  1M9A A;  1ST9 A;  3LYK A;  3I6A A;  4OFM A;  4N11 A;  12GS A;  2YWI A;  3BCI A;  5ECL B;  1OYJ A;  2DKH A;  1ZYP A;  3LXZ A;  4I2U A;  2GGT A;  2H30 A;  3VI7 A;  4K2X A;  3N5O A;  1ZYN A;  4KB3 A;  3HKR A;  2FA4 A;  4MPG A;  4ID0 A;  2B5Y A;  1QGV A;  2EIR A;  5KN1 A;  5FT3 A;  2IMI A;  3GX8 A;  2HE3 A;  3R2Q A;  3SWL A;  4ZXG A;  4XCS A;  3EWL A;  4HUA A;  4J56 E;  1V2A A;  1BX9 A;  3CSI A;  2KP1 A;  4K2D A;  2VL9 A;  3DKS A;  3IC8 A;  1DSB A;  4XS1 A;  4MJC A;  3G7J A;  3M8N A;  1A0R P;  3VUR A;  4L8E A;  1V40 A;  1FW1 A;  2EC4 A;  4HZ4 A;  4EL1 A;  4PXO A;  4F2I A;  1ZMA A;  4N0V A;  3RAZ A;  5IO2 A;  4TVE A;  5KN3 A;  1RK4 A;  1K0N A;  4I97 A;  4OWY A;  5DAK B;  4USS A;  3QDN A;  4Z2T A;  2BMX A;  1SKR B;  3WT2 A;  2L4C A;  2YWN A;  4HI7 A;  2H6Z A;  3DML A;  1UN2 A;  10GS A;  4HU7 A;  3GH6 A;  2OE3 A;  3ZMK A;  2A4H A;  1BED A;  4KDU A;  2FA8 A;  4FQU A;  2IFQ A;  1X5D A;  4IS0 A;  2E0Q A;  3FMW A;  4Q5F A;  1AQX A;  2VL3 A;  3F9U A;  3PH9 A;  3QAW A;  4KCE A;  3N9J A;  2VLV A;  1K3L A;  4JRR A;  4NAX A;  2BTO T;  3E9J B;  2M72 A;  4IEL A;  1GTA A;  4GSS A;  1U6T A;  1GSD A;  2VD1 A;  4PQH A;  1ZOF A;  5G5E A;  3HXS A;  3MDK A;  1WP0 A;  1FOV A;  4K0N A;  2PMT A;  2H6X A;  1A2J A;  1G6Y A;  2H70 A;  5IMC A;  4ECI A;  4OCF A;  1M7T A;  5D9T A;  3CXG A;  1PL2 A;  1OC9 B;  3GH9 A;  3HVX A;  5DAL A;  4EDY A;  2H71 A;  5F06 A;  4AJ8 A;  2I81 A;  3IBH A;  4V1A p;  4ZIJ A;  2F3M A;  1GLQ A;  3TUE A;  1JZD A;  2K8S A;  5J3R A;  4QL9 A;  4PQI A;  4F0B A;  6GSU A;  1PN9 A;  5HR2 A;  4TRX A;  3KTB A;  1SL2 B;  1S3A A;  1CQG A;  2DML A;  4FYU A;  2B1K A;  1VRS D;  1EOG A;  2GQK A;  3RDW A;  4K7I A;  4MJE A;  4GXZ A;  2C8U A;  3GKM A;  4BVY A;  1ABA A;  3FEU A;  4EVM A;  3WYW A;  5J4U A;  2IN3 A;  2GQL A;  3W8J A;  2WB9 A;  4Z2R A;  3IPZ A;  2M46 A;  1A2M A;  1R4W A;  4OMV A;  1I5G A;  2OA7 A;  4WR5 A;  1PX6 A;  2RUF A;  4J57 E;  1WPI A;  2R0G A;  1TU7 A;  1AC1 A;  2LUS A;  4ML1 A;  5ECS A;  3LJR A;  2F51 A;  2B7K A;  4ACS A;  1GUL A;  2ZUP A;  5HR0 A;  1ML6 A;  3IDV A;  4NXI A;  2MZC A;  3KH9 A;  1YQ1 A;  3S9F A;  1ACV A;  3M3M A;  4NV2 A;  1JLW A;  1EEM A;  3J7Y k;  2NDO A;  2YP6 A;  4WBJ A;  2CX3 A;  4KA0 A;  4AGS A;  4BL7 A;  14GS A;  2H19 A;  3GKN A;  4K8M A;  5DCG A;  1J0F A;  2DJ3 A;  3G7I A;  1WWJ A;  1K0C A;  5H5S A;  4OD7 A;  5IOX A;  3W6G A;  1EOH A;  4MMM A;  1WRY A;  2HRN A;  2L4Q A;  1FO5 A;  3QAG A;  4PUF C;  4BA7 A;  1ERU A;  3TKS A;  2C1Y A;  3F4S A;  3IK7 A;  3IE3 A;  1XIY A;  1GL8 A;  1RW1 A;  3EC3 A;  3FRC A;  1JFU A;  2X4A A;  2FWH A;  2ON5 A;  2XPD A;  2J23 A;  1KEB A;  2F8F A;  4EE0 A;  2MMN A;  1BYE A;  1B4P A;  1XVQ A;  2GT6 A;  1Y6E A;  2H8L A;  3MAK A;  1Z5Y E;  5D8I A;  3D6I A;  3IHQ A;  4TR0 A;  4G0L A;  5CRE A;  3TKR A;  4CW9 A;  2HSH A;  2I3Y A;  4RUV A;  3D22 A;  5IO0 A;  2IWT A;  5DDL A;  1QFN A;  4DVC A;  5CNW A;  4KCA A;  4K9Z A;  2H0H A;  1OE8 A;  3EU4 A;  2QC7 A;  5G31 A;  5DQS A;  2VOC A;  3GL3 A;  5DCH A;  4O32 A;  3HJM A;  1H75 A;  1GNE A;  2CT6 A;  3QD9 A;  4K1F A;  2I1U A;  5ELA A;  1QUW A;  4G10 A;  3GSS A;  2H73 A;  19GS A;  1QK8 A;  2YZU A;  3WT1 A;  4Q5N A;  2H1A A;  2X8C A;  4POL A;  1JLV A;  4MCU A;  1OVN A;  4BL7 B;  2RM5 A;  1WE0 A;  3FR9 A;  2WJU A;  4YQV A;  3D0Z A;  4GRF A;  3UAR A;  2A4V A;  3HJO A;  4GST A;  1BG5 A;  3APQ A;  2VLU A;  1WJK A;  2PVO C;  1R5P A;  3GTU A;  2JSY A;  1KTE A;  1GSF A;  3LG6 A;  1ZYE A;  2B1L A;  3TDG A;  2CVB A;  3F3R A;  3TOU A;  3ME8 A;  2E7P A;  17GS A;  2VD0 A;  4E8H A;  6GSW A;  1OKT A;  3HZ8 A;  2H66 A;  4NHW A;  5JWO B;  1GTU A;  2MYG A;  1A0F A;  4DSS B;  3UEM A;  4YKF A;  3DD3 A;  4DSQ A;  3LWA A;  2H0I A;  4N30 A;  4ICY A;  2HXK A;  1SD9 A;  3Q18 A;  4ISD A;  2VO4 A;  4ECC A;  4WF5 A;  5F0G A;  2B7J A;  2CQ9 A;  1YF1 A;  2MMA A;  2FNO A;  3GL5 A;  3FK8 A;  4HQZ A;  5AIX A;  3GYK A;  3I69 A;  2VM2 A;  5FHI A;  1FAA A;  4NPB A;  4KND A;  3F4T A;  3WGX A;  1AQW A;  2LKU A;  3QFB C;  2DJ0 A;  2ON7 A;  3LGC A;  3GRX A;  3FHK A;  2F9S A;  3TGZ A;  1F6M C;  3L78 A;  4N10 A;  4IGJ A;  5IM9 A;  1PMT A;  3QFA C;  1Z6N A;  2GZP A;  2H74 A;  1YKA A;  4LLR A;  4TR3 A;  5JWR B;  4IQ1 A;  1GSS A;  1XWA A;  1UVZ A;  2HRF A;  3AY8 A;  2GSS A;  1XWG A;  4FO5 A;  4V2L A;  5KOX A;  3WGD A;  2C0G A;  3A3T A;  3IAS 2;  2FWG A;  6GSV A;  5IMA A;  2XHF A;  4XS6 A;  4MH2 A;  4V2N A;  4XTS A;  1DBY A;  5IMD A;  3DRN A;  1HYU A;  4GSN A;  5DQY A;  2TIR A;  3L9V A;  5HR1 A;  5ECH B;  4YQM A;  4Q5Q A;  1Q98 A;  5CRG A;  1J08 A;  5HQP A;  1TP9 A;  2IL3 A;  3GKX A;  3CSJ A;  4O5R A;  2X49 A;  4HS1 A;  2CX4 A;  1Z7R A;  1ON4 A;  3GNJ A;  1O8W A;  1X9S B;  3U5R E;  4XS4 A;  2R6K A;  2XPE A;  3VWW A;  1LU4 A;  1GUH A;  5ID2 A;  3GV1 A;  4MZC A;  2LJA A;  1XOA A;  2K8V A;  3C7M A;  4YQU A;  1PGT A;  4D73 A;  3EYT A;  5J9C A;  1F2E A;  3DVW A;  2HZE B;  1A24 A;  4EC0 A;  4HJ2 A;  3A5I A;  3UAP A;  3MWH A;  5DJM A;  5B7C A;  3LQ7 A;  4MJA A;  4K5R A;  5CRH A;  2H1B A;  2R0P A;  4ZBD A;  1UA5 A;  1K0A A;  2L57 A;  3TJK A;  4PNF A;  3F8U A;  1AAZ A;  1DUG A;  2GVP A;  2AJQ B;  3CYN A;  4WXT A;  2WCI A;  1SEN A;  2X8G A;  3PIN A;  4MF6 A;  1S3D A;  3O76 A;  5ECN B;  3IR4 A;  4HDE A;  2LNS A;  1GH2 A;  1Q4J A;  2DJ2 A;  2JAC A;  2AHE A;  2YV7 A;  3G7Y A;  4ZBB A;  3L9U A;  3ED3 A;  4LL4 B;  1Y25 A;  4I2T A;  5IMV A;  16GS A;  1XCC A;  4ZB8 A;  2VUP A;  3ZL5 A;  1U88 A;  1TW9 A;  3ZVJ D;  5HR3 A;  1TJD A;  4JU5 A;  4KUN A;  1XWK A;  2CA8 A;  2DJ1 A;  4I5Q A;  4WKW A;  1U87 A;  3VPT A;  7GSS A;  3EMX A;  5C00 A;  1FVJ A;  1XWB A;  3UMA A;  2WFC A;  5G1L A;  5GAP D;  2DJK A;  2DIZ A;  3CRU A;  3NIV A;  2H75 A;  5G1K A;  1TI1 A;  3BJ5 A;  2V1M A;  5D93 A;  1PX7 A;  2GDR A;  4MZB A;  2CVD A;  4XIH A;  3ERW A;  2HT9 A;  2V6O A;  1JHB A;  2VCW A;  1TRV A;  3TRX A;  5DVB A;  3W8S A;  1AXD A;  1GNW A;  3MNG A;  1XWC A;  5ID2 B;  4IHU A;  3VWX A;  2H1D A;  2QGV A;  2CAQ A;  5HFG A;  2FLS A;  3ZRE A;  3RHB A;  3P7X A;  1OC8 A;  1X5C A;  1FB6 A;  4G2E A;  3F63 A;  2VM1 A;  3KCM A;  3LW9 A;  5J41 A;  4TXO A;  1J9B A;  3DYR A;  4AF2 A;  3VFI A;  1K3Y A;  2OKA A;  2O87 A;  2YWO A;  3VI5 A;  5EY6 A;  2VL2 C;  1XW5 A;  2MBS A;  2CV4 A;  1M2A A;  4JR4 A;  1YY7 A;  1TOF A;  2YOI A;  1UC7 A;  1ZZY A;  4MPF A;  1F9M A;  3I9V 2;  1X9W B;  4O5Q A;  4K6X A;  3A5W A;  4GCI A;  1O85 A;  3A2W A;  3DIE A;  2GTU A;  5INY A;  4P3Y B;  4GWR A;  3CTG A;  4IJ3 A;  4TR4 A;  3BD2 A;  3IXR A;  1NHY A;  2L5L A;  4IJI A;  4TN8 A;  2YV9 A;  2AB6 A;  4JE1 A;  3FKF A;  2FWF A;  3KP8 A;  3A2V A;  3TKS E;  3Q74 A;  1F3B A;  3F3Q A;  2WRT A;  3R3E A;  3GN3 A;  1SK0 A;  5G2Z A;  5DBQ A;  2DKI A;  4G0I A;  1MDK A;  3C1R A;  4ULX A;  3GHA A;  1B4Q A;  1GTI A;  3L0H A;  2R4V A;  1FHE A;  1URM A;  4IQA A;  4EO3 A;  2VAF A;  1O81 A;  3ZIJ A;  4CDO A;  3KIJ A;  4K7N A;  5ENU A;  4G0K A;  4E8E A;  3FZA A;  1HD2 A;  2PPT A;  2IFQ B;  3FR6 A;  2P0G A;  1EV9 A;  1QXH A;  3DEX A;  2X99 A;  4KDY A;  5D9X A;  3H1N A;  2IMD A;  3PR8 A;  2FWE A;  5HFI A;  2PVQ A;  5AIS A;  1BQ7 A;  2JU5 A;  3MYD A;  2VCZ A;  2B3S A;  2CZ2 A;  4LMV A;  1A8L A;  3GUS A;  5L71 A;  3RBT A;  1WIK A;  1T3B A;  2C0F A;  1AUC A;  1RQM A;  2C3Q A;  2GLR A;  1Z7P A;  4F82 A;  1DE2 A;  2LEG A;  4OO5 A;  2D2Z A;  2JL4 A;  1GSU A;  4TKY A;  3KD0 A;  4J2F A;  4IBP A;  1ERV A;  4HJM A;  5ECM B;  5DAL B;  3C8E A;  1TRW A;  3TRQ A;  4TXV A;  2VIM A;  4ZIL A;  3UBK A;  2OAD A;  4O5U A;  3CMI A;  1XBS A;  2CAI A;  2HFD A;  2M80 A;  2V32 A;  5KN0 A;  3FZ9 A;  1PSQ A;  2PUK C;  1M9B A;  2AV4 A;  2LQQ A;  4KSM A;  2OE0 A;  3TRP A;  2O8V B;  1G7O A;  2YAN A;  2AYT A;  1X5E A;  3HZ4 A;  1H4O A;  3HVS A;  2OBI A;  4EF0 A;  3HD5 A;  4OCE A;  2O85 A;  1GLP A;  1MDJ A;  4L5O A;  4XRD A;  2OE1 A;  1EP7 A;  3ZTL A;  2K6V A;  4G9H A;  4L5L A;  3EUR A;  1SK2 A;  3LXT A;  1EZK A;  3M9J A;  2DJJ A;  3H8Q A;  3IK9 A;  4HOJ A;  4BVY B;  4WEY A;  18GS A;  3VLN A;  3TKQ A;  11GS A;  2G0F A;  4BWS A;  4EXJ A;  2GS3 A;  3HHV A;  3D5J A;  3KTL A;  3GX0 A;  1X9M B;  1A23 A;  5CYY A;  5J9B A;  6GSX A;  2K18 A;  5ECK B;  5LD0 A;  4BVX A;  4L0U A;  1W89 A;  4MF7 A;  1FOH A;  5B8A A;  1T8E B;  3D21 A;  1U3I A;  2JSZ A;  1O7U A;  3BCK A;  3G9B A;  1NSW A;  1ZGN A;  1SL1 B;  3APO A;  5AGY A;  2NTO A;  3MSZ A;  5CRD A;  2HLS A;  3FZ4 A;  1NM3 A;  5J5N A;  6GST A;  1PL1 A;  2HZF A;  2PWJ A;  2LJR A;  3C71 A;  5GAN D;  4IP6 A;  2AAW A;  3DXB A;  2DSA A;  4NMU A;  1W4V A;  2GQM A;  4GTU A;  2TRX A;  3KJY A;  2JZR A;  2CZ3 A;  3LOR A;  2FY6 A;  3HYP A;  4NV5 A;  4WBR D;  3QCP A;  4POB A;  2O7K A;  1SU9 A;  1FG4 A;  2P5R A;  5GST A;  4A5P A;  2E2G A;  4PGT A;  3Q6O A;  1V9W A;  3M1G A;  2V6K A;  1SYX A;  4TR1 A;  1KBN A;  2KP2 A;  5CRW A;  5ECQ B;  3GMF A;  3E0U A;  4FIW A;  1TK8 B;  2QSI A;  1GSE A;  3H93 A;  1B8X A;  1XZO A;  3U6V A;  1K0O A;  4CY8 A;  4DEJ A;  3P2A A;  4HZ2 A;  1TKD B;  1SK1 A;  5IPH A;  5JCU A;  3M9K A;  1EWX A;  3IC4 A;  3D4M A;  4PNG A;  4G19 A;  3WGE A;  2L6D A;  3VWU A;  1X0R A;  22GS A;  2DBC A;  4JED A;  2H01 A;  3UVT A;  3TKP A;  4JZQ A;  4BVX B;  3IOS A;  1LBK A;  2L5O A;  4GF0 A;  5E59 A;  5A5K A;  2ALB A;  3ME7 A;  3IA1 A;  2N5B A;  3MIX A;  2C3N A;  1G6W A;  3ZRD A;  1SKS B;  3QR6 A;  5F8B A;  2R2J A;  2HYX A;  3GUR A;  1YDK A;  5IIZ A;  2IMF A;  3IAM 2;  5ECP B;  1GWC A;  2HSM A;  4ZL8 A;  1YZX A;  3GKK A;  2PGT A;  2YNX A;  1PN0 A;  1TTZ A;  2LNT A;  1Z9H A;  4GLT A;  1R26 A;  2HRA A;  3RPN A;  2UZ8 A;  4PUR A;  3ZVJ A;  3CTF A;  5B6M A;  2ZNM A;  5KN2 A;  3TKS C;  5CO3 A;  4HU9 A;  1OKD A;  3QMX A;  2RUE A;  1GSQ A;  1FVK A;  3QOU A;  2E2M A;  2WS2 A;  4KH7 A;  1THX A;  4ZL7 A;  1SD8 A;  3H79 A;  5EVO A;  1IYI A;  3DVX A;  3EU3 A;  3ISO A;  3GTU B;  2IME A;  3FW2 A;  1VF1 A;  3ZYW A;  2VL2 A;  2V41 A;  2YJH A;  4MDC A;  2JAD A;  2C0E A;  1AIU A;  3HY2 A;  2YJ7 A;  1PD2 1;  1XW6 A;  3LFL A;  4OFN A;  5DAK A;  4ECB A;  1QQ2 A;  4MJB A;  2VCQ A;  3TJG A;  1ZYQ B;  5FWG A;  2WGR A;  5BRT A;  3F4R A;  4GQC A;  2NVL A;  5ECR B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...