2RLIA

Solution structure of cu(i) human sco2
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
170
structure length
170
Chain Sequence
SFTGQGDFHLLDHRGRARCKADFRGQWVLMYFGFTHCPDICPDELEKLVQVVRQLEAEPGLPPVQPVFITVDPERDDVEAMARYVQDFHPRLLGLTGSTKQVAQASHSYRVYYNAGPKDEDQDYIVDHSIAIYLLNPDGLFTDYYGRSRSAEQISDSVRRHMAAFRSVLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SCO2 protein homolog, mitochondrial
publication title A Structural Characterization of Human SCO2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal transport
total genus 44
structure length 170
sequence length 170
ec nomenclature
pdb deposition date 2007-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02630 SCO1-SenC SCO1/SenC
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2rliA00
2VLTA 1CQGA 2C1YA 1SJIA 1GSEA 1XBSA 4I6XA 2FUG2 5KN1A 2LJAA 1XW9A 3F6DA 3VI5A 4HOJA 4V1Ag 4MCUA 2JU5A 1TRUA 3VWUA 1PKZA 18GSA 2IWTA 5CP1A 5D9VA 1U3AA 4LL1B 1OC3A 2F9SA 2P5RA 5ECIB 4G10A 5ECHB 1ZYQB 3F4TA 5CRHA 2FD3A 2P31A 1E2YA 3VPTA 3DMLA 5JWQB 4EXJA 3DVXA 2VCZA 2H8LA 3WT1A 1X5DA 4PGTA 1AUCA 2MMZA 5A5KA 3VLNA 2GQKA 3L9SA 5CO3A 1JZOA 2DJ0A 2FWHA 2VO4A 4AF2A 2VL3A 2TRCP 1SU9A 3DXBA 1TI1A 4TOPA 1HNAA 3KCMA 3QCPA 5F8BA 2H70A 1R26A 2RM6A 2NVLA 4XS4A 1X9MB 5JCUA 1FOVA 3GURA 3I69A 4ID0A 3WGEA 2VAFA 4ZL8A 1OAZA 2KUCA 2DMLA 3G7IA 2H19A 4KW6A 3IXRA 3Q74A 5LNKe 1ERWA 3TB2A 3HVXA 3GH9A 3CSIA 5C00A 4KNDA 2CX4A 2RUEA 5JWOB 1USBA 3C1RA 4V2LA 3GSTA 2ON5A 4NV5A 4JRRA 2N5AA 4HU7A 5F07A 4WETA 2YWMA 1KBNA 1YY7A 4IHUA 4IGJA 2L6DA 2LQOA 4MF6A 3VI7A 1XWKA 5IM9A 2YV9A 1T7PB 4HJ2A 3TRQA 3CTFA 4ECIA 4EL1A 5KN3A 3A2XA 1SK2A 5IMAA 1SK0A 4TKYA 3VK9A 1X0RA 3E3EA 4JR6A 5CNWA 3V1WA 1TRWA 3BBYA 1PSQA 5B6MA 2GSQA 2PVOC 4EDZA 1SD8A 1O8XA 3L4NA 2DLXA 5H5QA 3CRTA 3PINA 2HLSA 3EU4A 1A2MA 3UBKA 5COHA 5ENUA 5F05A 1S3AA 2BMXA 2KP1A 3UAPA 1EGOA 1GLQA 2O7KA 4MH2A 4IVFA 4FH8A 3ZRDA 3HJOA 2FA8A 2OBKA 1PQNA 3RHBA 5CAXA 3QOUA 3GUSA 3IAM2 3DEXA 3J7Yb 4YAPA 3TKQA 3RHCA 2CV4A 4E8EA 2WZ9A 3TKSC 1EGRA 2O87A 3Q18A 3MNGA 3ZZXA 2BJXA 1GRXA 4O7HA 3HJMA 3ZVJA 1SL1B 4WF4A 4EUYA 2GS3A 4QQ7A 4Q5FA 4HEA2 3UEMA 13GSA 2JZRA 1SD9A 1AXDA 4WR5A 4JU5A 1K3LA 1K0DA 1DUGA 1G7OA 3TJKA 4PX1A 5D96A 2VL2C 5KEJA 5EPFA 2X8HA 3DVWA 1PD21 3VWXA 2I9HA 2LEGA 3BCIA 2LJRA 2X64A 2JACA 3ZVJD 1GUMA 2GSTA 4L8EA 3TJBA 4N0ZA 1O85A 2YWIA 3LYKA 1QQ2A 1XW6A 4OCFA 2LRTA 3GTUB 4POKA 3VURA 3WGDA 1YQ1A 2IMIA 2JZTA 1SK1A 1GSDA 3UMAA 3SWLA 1SJZA 1GL8A 3MWHA 1RQMA 4L5OA 3UBLA 1EEMA 4HDEA 12GSA 3BD2A 1XFLA 3F4RA 2VCQA 4TRXA 4I2UA 1PMTA 3IRAA 4XCSA 3F9UA 3TGZA 2ALBA 3UARA 2DIYA 2H6XA 1B4PA 2LKUA 4FO5A 5DALB 3C8EA 4JBBA 3HXSA 4WBRD 3EE2A 1K0MA 2V41A 3H8QA 2A2SA 2I3YA 1XWAA 1OC9A 2CAIA 2I4AA 2HSHA 6GSVA 5IOWA 2HZFA 3KMNA 1K0BA 4ECBA 1OC8A 1WMJA 2LQQA 3DD3A 2VM1A 3GN3A 4HQZA 4KCAA 2F8AA 2OADA 3L9UA 4NHZA 4HU9A 4N10A 4PUAA 5HR3A 5JCWA 3CTGA 1WWJA 2OACA 3IR4A 1M9BA 1ON4A 4TR1B 5LD0A 1FG4A 2FWGA 3EMPA 3N5OA 2MBTA 1Z5YE 3APOA 3GRXA 3HYPA 2YWOA 3E0UA 1YF0A 3SBCA 1XOBA 3EWLA 2KHPA 5IPHA 2E7PA 2IPAA 3TRPA 1VF1A 2YZUA 4OFTA 2B5XA 1A24A 4Q5RA 3KH7A 5ECKB 1M0UA 3HZ8A 3TJJA 2K6VA 4G2EA 5J9CA 4PNGA 1QFNA 2HZEB 3F6FA 4IBPA 1N2AA 2QC7A 5J41A 2H1DA 2JADA 3ERWA 1QMVA 3BCKA 3HZ4A 14GSA 2L59A 3HHVA 5B8AA 2H0IA 5HFKA 3KEBA 4KH7A 1ZL9A 3CXGA 4KA0A 3VFIA 2B5YA 3GNJA 2B1LA 2H73A 4TR0A 1X5CA 4GF0A 1O81A 2C8UA 3TRXA 4GSTA 3GFKA 5EVOA 3KH9A 4AJ6A 5KN2A 3LXZA 1AC1A 3GX8A 4ULXA 4H86A 4YQVA 2L57A 2A4VA 1SYXA 2V6OA 1LU4A 4IP1A 1G6YA 5AN1A 4WBJA 1GUKA 1TK5B 4GQCA 3TKRA 1AQWA 3GA4A 1TKDB 2V6KA 5HR1A 3HVSA 2X8GA 3RAZA 2AJQB 5J3RA 5IIZA 3M1GA 4KSMA 5J9BA 4V2MA 3L78A 2CA8A 3AY8A 3CSHA 4YQMA 3HCZA 4ZXGA 2VOCA 4LA1A 3APSA 3KIJA 4JE1A 3G7JA 4WXTA 4BWQA 2D2ZA 1C72A 4JEDA 2C3TA 1CQHA 5A4VA 3FZ5A 3LEFA 4EDYA 2GTUA 1V9WA 4TXOA 2V1MA 1J08A 1JZDA 5IO2A 3KTBA 4ZL7A 2IFQA 1Y6EA 1K0AA 2HSYA 1HNCA 2NBSA 4OO4A 1A2JA 1FW1A 1QGVA 3JCML 4K6XA 2VCXA 3KZQA 5ECLB 2E2MA 2HFDA 2VL9A 1SKSB 5DDLA 3ME7A 1GSSA 2J23A 2JZSA 4ZILA 2CVDA 4EC0A 4Z7XA 1DE2A 2EIOA 2H76A 4ACSA 1PL1A 5DAKA 1WRYA 4PQHA 4LL4B 3CSJA 4NWYA 3DKSA 5KN0A 5D9XA 2NTOA 3QD9A 4XRAA 3TCOA 2X8CA 5ECNB 4BWSA 1Z7RA 5IMDA 3FZ9A 2WCIA 1M9AA 1Z6MA 3OR5A 4IKHA 3ZMLA 4L5LA 5J4UA 4PQIA 2HYXA 2B3SA 1WPIA 2RLIA 3ED3A 4ILFA 2G0FA 2PN8A 3ZITA 1T3BA 4N0VA 3O6TA 4FYUA 3GL3A 5IQYA 2ZNMA 1A8LA 1OE7A 3KGKA 2XPDA 3HA9A 3HKRA 2H1AA 4X0XA 1TRSA 3H1NA 5GZZB 1GLPA 1TI3A 1I5GA 5B6NA 4IELA 4MDCA 2FGXA 3LXTA 2VCTA 1SYRA 1F3BA 5B8BA 3D4MA 3M8NA 1N8JA 4Q5QA 1V2AA 2DJ1A 3IV4A 3WGXA 4KDXA 1FAAA 1A23A 3LQ7A 3ZIJA 3W6GA 1A0FA 1F2EA 2R37A 2ZCTA 4MPFA 1B48A 2H30A 4F9ZA 1GNWA 1U87A 2HE3A 4MMMA 5IMFA 2J9HA 4RI6A 1VF3A 1PGTA 5AIVA 2OE1A 4N11A 3ME8A 5G1LA 4MZCA 5IOXA 2GZZA 6GSUA 5IMZA 5CREA 1O73A 3I6AA 4WEYA 1YDKA 1OKTA 2IMKA 1TOFA 1QUWA 2DIZA 2GSSA 2JSYA 1JZRA 2YWNA 3UJ1A 3KP8A 3BOAA 4OO5A 1JLVA 1U6TA 4I8BA 3D4TA 1J9BA 2CZ2A 3GKMA 4F03A 4IQAA 2P0GA 1T4ZA 2YP6A 3Q6OA 2V32A 2H0HA 2H72A 2YANA 2C3NA 2RUFA 3EU3A 2NPBA 4MK3A 5G5FA 4EO3A 3FW2A 2H1BA 1XPVA 5ELGA 1UN2A 1F6MC 3QFAC 4D73A 1TK8B 2LV3A 2RM5A 2L4CA 3ZLPA 4ZBDA 2K8SA 5DJLA 3A3TA 4ZBAA 2ON7A 3K8NA 2YV7A 4ZIJA 4EF0A 2QSIA 4HZ4A 4RUVA 3NIVA 3QDNA 3MDKA 2I81A 3QMXA 22GSA 2WGRA 1O8WA 4KDYA 3FR3A 3VWVA 1XWBA 1AAZA 4PQ1A 4J56E 1K3OA 3IA1A 4RQRA 1OVNA 4GSNA 1VRSD 4OFNA 3P90A 4FYCA 2FLSA 3GHAA 4V2NA 2C0GA 4GSSA 2VL2A 4KX4A 1OE8A 4IW9A 1PA3A 3HJPA 1BG5A 3Q19A 4YQUA 1XOAA 2C80A 3O3TA 4O32A 1BX9A 1OC9B 1A0RP 5G31A 1FB6A 4X43A 3FZ4A 2FY6A 2HRFA 4KCEA 1Z9HA 2R2JA 5G2ZA 1JZWA 2H1GA 1LBKA 4K7IA 3ERGA 5JCGA 4DVCA 2EC4A 3EVIA 1TTZA 5CYYA 2HI7A 2MBSA 4EVMA 1HYUA 4P3YB 4GWRA 1Q98A 4K1FA 4NXIA 3LWAA 1B4QA 2IN3A 4HQSA 3IK7A 2WFCA 2LSTA 2AYTA 1SL2B 4MA9A 5D9WA 4CDOA 3O76A 3UVTA 1PX6A 1H75A 2WRTA 1Y25A 5H5RA 1TXXA 4WF5A 4HI7A 5A4UA 4WKWA 1KNGA 2H6YA 3I9V2 1UA5A 2MZCA 4ZB6A 1G7EA 6GSSA 1GTAA 1V58A 4HJMA 2K18A 1GWCA 2XBIA 2GQMA 3TJGA 1XZOA 4BVYA 4BVXA 1BYEA 1Z6NA 1EV9A 4QL7A 4IS0A 1M99A 1YKCA 3GIXA 1B9YC 3NOFA 1MDJA 2LS5A 3GTUA 5FWGA 5DCGA 2RIIA 1XVQA 1V57A 1T1VA 1ZMAA 4J57E 2C0EA 1W4VA 3GH6A 4NPBA 4PURA 4RI7A 3DWVA 1ERUA 1R7HA 2LNSA 2OA7A 2H0GA 3IOSA 2OE0A 3KM6A 4KDUA 1XIYA 1NSWA 1GSUA 5JWRB 3C1SA 4YH2A 2OBIA 2MYGA 1BQ7A 2CT6A 4IP6A 4XS6A 1RW1A 2FNOA 2LRCA 4OMVA 4LMWA 4KAEA 1PRXA 5CRDA 2E0QA 2OE3A 1DBYA 4MLYA 3PGTA 2JL4A 4MZWA 1ACVA 2DJKA 4HZ2A 3QAWA 5HR2A 1XCCA 5ID2A 3M9KA 1OYJA 2PERA 1ML6A 1X5EA 3C7MA 2YZHA 1F9MA 1QXHA 1GH2A 4K8MA 1TDIA 4NAXA 4POMA 1X9WB 1IYHA 3GSSA 4MJEA 4MF5A 3DIEA 5E59A 4ZB9A 3ZYWA 2DJ2A 2XBQA 2IIYA 3U6VA 3KXOA 5B7CA 1BJXA 1EOGA 4DSRA 4ZB8A 1M2AA 1ST9A 4I97A 2IL3A 3F8UA 4TXOB 3IBHA 2VIMA 4DSQA 2IFQB 3RDWA 3ZIVA 5D9TA 2O89A 1KTEA 2M46A 5G30A 4BL7A 1SJ6A 2REMA 3ERFA 1FO5A 3D21A 2YNXA 3EC3A 3MSZA 5LCZA 3EURA 2VM2A 2FA4A 1LJRA 4XHMA 5DAKB 3QAVA 1EV4A 5D73A 3QAGA 5HFIA 1YEXA 3GX0A 6GSTA 3D5JA 1TW9A 4AJ8A 2DMMA 1GSQA 3UIWA 4DSSA 3GKKA 5C04A 1NHYA 4I5QA 2F51A 3RPPA 4XTSA 2LRNA 3KD0A 1M2DA 2LTKA 4F2IA 3RBTA 3QPMA 3W8SA 4AGSA 5HR0A 1PX7A 3IHQA 4XS4B 4DEJA 5AIXA 3HDCA 4Q5NA 2GT5A 4NHWA 4G9HA 3TKPA 3P7XA 3CBUA 2B7KA 4MP4A 4YAVA 3KTLA 3LJRA 2C0FA 1XVWA 3DRNA 3WD6A 2IMEA 3ZFLA 3FRCA 3FYGA 1B8XA 3H93A 6GSXA 9GSSA 3WT2A 3IK9A 3M3MA 2AAWA 2TIRA 4J2FA 2MMOA 5H5SA 5CRGA 5F0GA 2LUSA 3GV1A 1AQVA 1V98A 8GSSA 1ILOA 5DQYA 1E6BA 1SENA 3U5RE 1K0CA 1EP7A 1JHBA 1XXUA 3TJFA 2DSAA 5DJMA 3G7YA 2PU9C 1Z7PA 1DE1A 1BAYA 5GSSA 1MD3A 1F3AA 1T8EB 2N5FA 3HD5A 4OCEA 4GRFA 1SKRB 4K0NA 4O5RA 2F3MA 4TW5A 1ZCPA 1YZXA 3FZAA 1M2BA 4IQ1A 4F82A 3KMOA 3FK8A 4EKZA 2VLVA 1S3DA 1MD4A 1JFUA 1FVKA 4KUNA 1J0FA 4EE0A 1GTBA 2WULA 1PL2A 4LLRA 1SL0B 2YPMA 3FY7A 4HUAA 2LNTA 2R6KA 2B1KA 4TXVA 1GNEA 4TVEA 2VLUA 1ZGNA 4OFMA 5IMCA 2AV4A 1VF2A 3IC4A 1GULA 1MEKA 1T00A 1H4OA 5EL8A 1KEBA 3GKNA 1XWCA 5GAND 1ERTA 1EZKA 4D73B 2M80A 5ECQB 1WE0A 2CX3A 3L9VA 2GQLA 2PWJA 2YN1A 1EP8A 3C73A 2XPEA 2YJHA 2HNLA 3M0FA 1GUHA 3TUEA 3DYRA 4I2TA 1THOA 4GLTA 2HT9A 2FHEA 4NMUA 4FIWA 4F0BA 3UVHA 3ZL5A 2VD1A 3UL3A 2HRNA 4ML6A 4OD7A 3WYWA 3LFLA 1HQOA 4GQFA 5ECOB 1THXA 2DJJA 2QGVA 3FR6A 19GSA 5GAPD 1K0NA 3KJYA 16GSA 2PBJA 2K9FA 3EMXA 3LORA 1ZYEA 2WDUA 4KB3A 1U3IA 2EIRA 1WIKA 2GSRA 2IMDA 3F3RA 1PN9A 2VD0A 1FVJA 3EINA 2FCHA 5E4WA 3TKSA 1AW9A 2N5BA 2H74A 3H4KA 5DBQA 4IJ3A 4LMVA 3GL5A 2ZUPA 5HFGA 2OKAA 3PR8A 1ABAA 2GVPA 3HVVA 1WP0A 2PUKC 5ECMB 1URMA 1HNBA 2IMFA 2VCWA 5ELAA 4MJAA 1PKWA 3W8JA 2C0DA 10GSA 4E8HA 4ISDA 3F3QA 4G19A 4TR4A 5HQPA 5INYA 1Z3EA 3P2AA 4QL9A 1UC7A 5D8IA 2K8VA 2R4VA 4HS1A 1YEPA 2CVKA 3ZFBA 3GMFA 3FEUA 1GSYA 1G6WA 2FWFA 2DJ3A 1IYIA 2H71A 4KE3A 4K0GA 3LSZA 2H66A 1ZOFA 4GTUA 3CYNA 2WS2A 2YJ7A 4ECCA 4NV2A 2AUVA 1GP1A 4TN8A 1ZZYA 2PMTA 4BA7A 3J7Yk 2GDRA 3C71A 4V1Ap 2Z9SA 3IE3A 2GZPA 3BJ5A 1TJDA 3QFBC 3HY2A 3EYTA 4ZBBA 4KSOA 4K9ZA 3LYPA 2GT6A 2VUPA 5AISA 5ABRA 3APQA 5ECRB 4ECJA 3QR6A 4JR4A 1TRVA 4K7OA 2L5LA 1VF4A 3R2QA 1AIUA 1A8YA 2C3QA 4CHSA 4MJCA 2YCDA 2FWEA 5FT3A 4IN0A 3FHKA 5L71A 3TOUA 1BEDA 1G0TA 4PNFA 4BPYA 4AJ7A 5AGYA 2V2GA 4K7NA 3VWWA 4POLA 4MPGA 2MMNA 2R3XA 1HD2A 4KGIA 2E2GA 1MDKA 1T4YA 17GSA 1XW5A 2PVQA 2R5GA 1W89A 3D0ZA 2B5EA 2CQ9A 4X1UA 1WOUA 1F37A 5ECSA 1R5AA 1OKDA 5ID2B 2B7JA 5A4WA 3DGQA 3D6IA 1FHEA 2CAQA 3MAKA 2OJLA 3GYKA 2C4JA 1NW2A 2B6MA 2GGTA 3F63A 4RQXA 3FKFA 2X99A 1S3CA 5J5NA 2NDOA 3IDVA 4ZL9A 7GSSA 3UOMA 4WR4A 2P5QA 2TRXA 2O8VB 2L4QA 5DALA 1YJ6A 3M9JA 3E9JB 5IO0A 1AQXA 2QKEA 1V40A 4L0WA 4F0CA 3A5WA 2O85A 3TKSE 2L5OA 5DVBA 20GSA 1EWXA 3IPZA 2M72A 3CRUA 3US3A 5FHIA 2IJYA 1VGLA 4MH3A 3TOTA 3LGCA 4MF7A 1TU7A 3CMIA 4OWYA 1QK8A 1I9DA 2F8FA 1U88A 2H01A 1Q4JA 3D22A 5DQSA 3A2VA 3S9FA 1TK0B 2KOKA 1FB0A 3LG6A 2KP2A 5IPGA 1NHOA 6GSWA 4GCIA 1RK4A 2DBCA 4TR1A 3GKXA 3VPQA 5EY6A 4XIHA 2LJKA 3P8WA 1R4WA 4JZQA 4MABA 2WJUA 2L6CA 4XS1A 1M7TA 3IAS2 1TU8A 2EIQA 4L0UA 2HXKA 4O92A 1MDIA 4K2DA 4POBA 2PPTA 5CRWA 3NZNA 1X9SB 1GTIA 1A2LA 4IJIA 1WJKA 4FYBA 1R5PA 5G5EA 1O7UA 3ZMKA 4DSSB 2ES7A 4MJBA 1YKAA 2WB9A 1YF1A 3G9BA 5DCHA 1GTUA 3ZREA 2HZEA 1NM3A 2MMAA 6GSYA 1XWGA 2XHFA 3KP9A 1UVZA 1EOHA 3L0HA 4XRDA 2H75A 2KLXA 3ZTLA 2CVBA 2I1UA 2PGTA 1DSBA 1B9XC 4N30A 2GLRA 1K3YA 1EEJA 2VCVA 2BTOT 4ML1A 1JLWA 1K0OA 2DC5A 4PUFC 2JSZA 5F06A 2H6ZA 4PXOA 3A2WA 3F0IA 3I43A 4MZBA 5G1KA 5GSTA 2AHEA 5ECPB 2A2RA 5IMVA 3N9JA 11GSA 3F4SA 1ERVA 2AB6A 3TDGA 3FR9A 2YOIA 2G2QA 3ISOA 1SKWB 3H79A 1TP9A 2CZ3A 3PH9A 5D93A 1MTCA 2GZYA 1O6JA 3RPNA 1GSFA 4TR3A 2XC2A 4CW9A 4GXZA
chains in the Genus database with same CATH superfamily
2VLTA 1CQGA 2C1YA 1SJIA 3FMWA 4BIKA 1GSEA 1XBSA 4I6XA 2FUG2 5KN1A 2LJAA 1XW9A 3F6DA 3VI5A 4HOJA 4V1Ag 4MCUA 2JU5A 1TRUA 3VWUA 1PKZA 18GSA 2IWTA 5CP1A 4PTSA 5D9VA 1U3AA 4LL1B 1OC3A 2F9SA 2P5RA 5ECIB 4G10A 5ECHB 1ZYQB 3F4TA 5CRHA 2FD3A 2P31A 1E2YA 3VPTA 3DMLA 5JWQB 4EXJA 3DVXA 2VCZA 2H8LA 3WT1A 1X5DA 4O5QA 4PGTA 1AUCA 2MMZA 5A5KA 3VLNA 2GQKA 2UZ8A 3L9SA 5CO3A 1JZOA 2DJ0A 2FWHA 2VO4A 4AF2A 2VL3A 2TRCP 1SU9A 3DXBA 1TI1A 4TOPA 1HNAA 3KCMA 3QCPA 5F8BA 2H70A 1R26A 2RM6A 2NVLA 4XS4A 1X9MB 5JCUA 1FOVA 3GURA 3I69A 4ID0A 3WGEA 2VAFA 4ZL8A 1OAZA 2R0PA 2KUCA 2DMLA 3G7IA 2H19A 4KW6A 3IXRA 3Q74A 5LNKe 1ERWA 3TB2A 3HVXA 3GH9A 3CSIA 5C00A 4KNDA 2CX4A 2RUEA 5JWOB 1USBA 3C1RA 1M3IA 4V2LA 3GSTA 2ON5A 4NV5A 4JRRA 2N5AA 4HU7A 5F07A 4WETA 2YWMA 1KBNA 1YY7A 4G0LA 4IHUA 4IGJA 2L6DA 2LQOA 4MF6A 3VI7A 1XWKA 5IM9A 2YV9A 1T7PB 4HJ2A 3TRQA 3CTFA 4ECIA 4EL1A 5KN3A 3A2XA 1SK2A 5IMAA 1SK0A 4TKYA 3VK9A 1X0RA 3E3EA 4JR6A 5CNWA 3V1WA 1TRWA 3BBYA 1PSQA 5B6MA 2GSQA 2PVOC 4EDZA 1SD8A 1O8XA 3L4NA 2DLXA 5H5QA 3CRTA 3PINA 2HLSA 3EU4A 1A2MA 3UBKA 5COHA 5ENUA 5F05A 1S3AA 2BMXA 2KP1A 3UAPA 1EGOA 1GLQA 2O7KA 4MH2A 4IVFA 4FH8A 3ZRDA 3HJOA 2FA8A 2OBKA 1PQNA 3RHBA 5CAXA 3QOUA 3GUSA 3IAM2 3DEXA 3J7Yb 4YAPA 3TKQA 3RHCA 3PPUA 2CV4A 4E8EA 2WZ9A 3TKSC 1EGRA 2O87A 3Q18A 3MNGA 3ZZXA 2BJXA 1GRXA 4O7HA 3HJMA 3ZVJA 1SL1B 4WF4A 4EUYA 2GS3A 4QQ7A 4Q5FA 4YKFA 4HEA2 3UEMA 13GSA 2JZRA 1SD9A 1AXDA 4WR5A 4JU5A 1K3LA 1K0DA 1DUGA 1G7OA 3TJKA 4PX1A 5D96A 2VL2C 5KEJA 5EPFA 2X8HA 3DVWA 1PD21 3VWXA 2I9HA 2LEGA 3BCIA 2LJRA 2X64A 2JACA 3ZVJD 1GUMA 2GSTA 4L8EA 3TJBA 4N0ZA 1O85A 2YWIA 3LYKA 1QQ2A 1XW6A 4OCFA 2LRTA 3GTUB 4POKA 3VURA 3WGDA 1YQ1A 2IMIA 2JZTA 1SK1A 1GSDA 3UMAA 3SWLA 4X4JA 1SJZA 1GL8A 3MWHA 1RQMA 4L5OA 3UBLA 1EEMA 4HDEA 12GSA 3BD2A 1XFLA 3F4RA 2VCQA 4TRXA 4I2UA 1PMTA 3IRAA 4XCSA 3F9UA 3TGZA 2ALBA 3UARA 2DIYA 2H6XA 1B4PA 2LKUA 4FO5A 5DALB 3C8EA 4JBBA 3HXSA 4WBRD 3EE2A 1K0MA 4CY6A 2V41A 3H8QA 2A2SA 2I3YA 1XWAA 1OC9A 4YKGA 2CAIA 2I4AA 3LW9A 2HSHA 6GSVA 5IOWA 2HZFA 3KMNA 1K0BA 4ECBA 1OC8A 1WMJA 2LQQA 3DD3A 2VM1A 3GN3A 4HQZA 4KCAA 2F8AA 2OADA 3L9UA 4NHZA 4HU9A 4N10A 4PUAA 5HR3A 5JCWA 3CTGA 4O5UA 1WWJA 2OACA 3IR4A 1M9BA 4Z2TA 1ON4A 4TR1B 5LD0A 1FG4A 2FWGA 3EMPA 3N5OA 2MBTA 1Z5YE 3APOA 3GRXA 3HYPA 2YWOA 3E0UA 1YF0A 3SBCA 1XOBA 3EWLA 2KHPA 5IPHA 2E7PA 1PN0A 2IPAA 3TRPA 1VF1A 2YZUA 4OFTA 2B5XA 1A24A 4Q5RA 3KH7A 5ECKB 1M0UA 3HZ8A 3TJJA 2K6VA 1PFOA 4G2EA 4PNGA 5J9CA 1QFNA 2HZEB 3F6FA 4IBPA 1N2AA 2QC7A 5J41A 2H1DA 4BL7B 2JADA 3ERWA 1QMVA 3BCKA 3HZ4A 14GSA 2L59A 3HHVA 5B8AA 2H0IA 5HFKA 3KEBA 4KH7A 1ZL9A 3CXGA 4KA0A 3VFIA 2B5YA 3GNJA 2B1LA 2H73A 4TR0A 4CY8A 4USSA 1X5CA 4GF0A 1O81A 2C8UA 3TRXA 4GSTA 3GFKA 3R3EA 5EVOA 3KH9A 4AJ6A 5KN2A 3LXZA 1AC1A 3GX8A 4ULXA 4H86A 4YQVA 2L57A 2A4VA 1SYXA 2V6OA 1LU4A 4IP1A 1G6YA 4ICYA 5AN1A 4WBJA 1GUKA 1TK5B 4GQCA 3TKRA 1AQWA 3GA4A 1TKDB 2V6KA 5HR1A 3HVSA 2X8GA 3RAZA 2AJQB 5J3RA 5IIZA 3M1GA 4KSMA 5J9BA 4V2MA 4EIPA 3L78A 2CA8A 3AY8A 3CSHA 4YQMA 3HCZA 4ZXGA 2HRAA 2VOCA 4LA1A 3APSA 3KIJA 4JE1A 3G7JA 4WXTA 4BWQA 2D2ZA 1C72A 4JEDA 2C3TA 1CQHA 5A4VA 3FZ5A 3LEFA 4EDYA 2GTUA 1V9WA 4TXOA 2V1MA 1J08A 1JZDA 5IO2A 3KTBA 4ZL7A 2IFQA 1Y6EA 1K0AA 2HSYA 1HNCA 2NBSA 4OO4A 1A2JA 1FW1A 1QGVA 3JCML 4K6XA 2VCXA 3KZQA 5ECLB 2E2MA 2HFDA 2VL9A 1SKSB 5DDLA 3ME7A 1GSSA 2J23A 2JZSA 4ZILA 2CVDA 4EC0A 4Z7XA 1DE2A 2EIOA 2H76A 4ACSA 1PL1A 5DAKA 1WRYA 4PQHA 4LL4B 3CSJA 4NWYA 3DKSA 5KN0A 5D9XA 2NTOA 3QD9A 4XRAA 3TCOA 2X8CA 5ECNB 4BWSA 1Z7RA 5IMDA 3FZ9A 2WCIA 1M9AA 1Z6MA 3OR5A 4IKHA 3ZMLA 4L5LA 5J4UA 4PQIA 2HYXA 2B3SA 1WPIA 2RLIA 3ED3A 4ILFA 2G0FA 2PN8A 3ZITA 1T3BA 4N0VA 3O6TA 4K2XA 4FYUA 3GL3A 5IQYA 2ZNMA 1A8LA 1OE7A 3KGKA 2XPDA 3HA9A 4MNNA 3HKRA 2H1AA 4X0XA 1TRSA 3H1NA 5GZZB 1GLPA 1TI3A 1I5GA 5B6NA 4IELA 4MDCA 2FGXA 3LXTA 2VCTA 1SYRA 1F3BA 5B8BA 3D4MA 3M8NA 1N8JA 4Q5QA 1V2AA 2DJ1A 2DKIA 3IV4A 3WGXA 4KDXA 1FAAA 1A23A 3LQ7A 3ZIJA 3W6GA 1A0FA 1F2EA 2R37A 2ZCTA 4MPFA 1B48A 2H30A 4F9ZA 1GNWA 1U87A 2HE3A 4MMMA 5IMFA 2J9HA 4RI6A 1VF3A 1PGTA 5AIVA 2OE1A 4N11A 3ME8A 5G1LA 4MZCA 5IOXA 2GZZA 6GSUA 5IMZA 5CREA 1O73A 3I6AA 4WEYA 1YDKA 1OKTA 2IMKA 1TOFA 1QUWA 2DIZA 2GSSA 2JSYA 1JZRA 2YWNA 3UJ1A 3KP8A 3BOAA 4OO5A 1JLVA 1U6TA 4I8BA 3D4TA 1J9BA 2CZ2A 3GKMA 4F03A 4IQAA 2P0GA 1T4ZA 2YP6A 3Q6OA 2V32A 2H0HA 2H72A 2YANA 2C3NA 2RUFA 3EU3A 2NPBA 4MK3A 5G5FA 4EO3A 3FW2A 2H1BA 1XPVA 5ELGA 1UN2A 1F6MC 3QFAC 4D73A 1TK8B 2LV3A 2RM5A 2L4CA 3ZLPA 4ZBDA 2K8SA 5DJLA 3A3TA 4ZBAA 2ON7A 3K8NA 2YV7A 4ZIJA 4EF0A 2QSIA 4HZ4A 4RUVA 3NIVA 3QDNA 3MDKA 2I81A 3QMXA 22GSA 2WGRA 1O8WA 4KDYA 3FR3A 3VWVA 1XWBA 1AAZA 4PQ1A 4J56E 4FQUA 1K3OA 3IA1A 4RQRA 1OVNA 4GSNA 1VRSD 4OFNA 3P90A 4FYCA 2FLSA 3GHAA 4V2NA 2C0GA 4GSSA 2VL2A 4KX4A 1OE8A 4IW9A 1PA3A 3HJPA 1BG5A 4Z2RA 1XG8A 3Q19A 4YQUA 1XOAA 2C80A 3O3TA 4O32A 2R0GA 1BX9A 1OC9B 1A0RP 5G31A 1FB6A 4X43A 3FZ4A 2FY6A 2HRFA 4KCEA 1Z9HA 2R2JA 5G2ZA 1JZWA 2H1GA 1LBKA 4K7IA 3ERGA 5JCGA 4K5RA 4DVCA 2EC4A 3EVIA 1TTZA 5CYYA 2HI7A 2MBSA 4EVMA 1HYUA 4P3YB 4GWRA 1Q98A 4K1FA 4NXIA 3LWAA 1B4QA 2IN3A 4HQSA 3IK7A 2WFCA 2LSTA 2AYTA 1SL2B 4MA9A 5D9WA 4CDOA 3O76A 3UVTA 1PX6A 5KOXA 1H75A 2WRTA 1Y25A 5H5RA 2A2PA 1TXXA 4WF5A 4HI7A 5A4UA 4WKWA 1KNGA 2H6YA 4K5SA 3I9V2 1UA5A 2MZCA 4ZB6A 1G7EA 6GSSA 1GTAA 1V58A 4HJMA 2K18A 1GWCA 2XBIA 2GQMA 3TJGA 1XZOA 4BVYA 4BVXA 3EPTA 1BYEA 1Z6NA 1EV9A 4QL7A 4IS0A 1M99A 1YKCA 3GIXA 1B9YC 3NOFA 1MDJA 2LS5A 3GTUA 5FWGA 5DCGA 2RIIA 1XVQA 1V57A 1T1VA 1ZMAA 4J57E 2C0EA 2X49A 1W4VA 3GH6A 4NPBA 4PURA 4RI7A 3DWVA 1ERUA 1R7HA 2LNSA 2OA7A 2H0GA 3IOSA 2OE0A 3KM6A 4KDUA 1XIYA 1NSWA 1GSUA 5JWRB 3A5IA 3C1SA 4YH2A 2OBIA 2MYGA 1BQ7A 2CT6A 4IP6A 4XS6A 1RW1A 2FNOA 2LRCA 4OMVA 4LMWA 4G0KA 4KAEA 1PRXA 5CRDA 2E0QA 2OE3A 1DBYA 4MLYA 3PGTA 2JL4A 4MZWA 1ACVA 2DJKA 4HZ2A 3QAWA 5HR2A 1XCCA 5ID2A 3M9KA 1OYJA 2PERA 1ML6A 1X5EA 3IHGA 3C7MA 2YZHA 1F9MA 1QXHA 1GH2A 4K8MA 1TDIA 4NAXA 4POMA 1X9WB 1IYHA 4A5PA 3GSSA 4MJEA 4MF5A 3DIEA 5E59A 4ZB9A 3ZYWA 2DJ2A 2XBQA 2IIYA 3U6VA 3KXOA 5B7CA 1BJXA 1EOGA 4DSRA 4ZB8A 1M2AA 1ST9A 4I97A 2IL3A 3F8UA 4TXOB 3IBHA 2VIMA 4DSQA 2IFQB 3RDWA 3ZIVA 5D9TA 2O89A 1KTEA 2M46A 5G30A 4BL7A 1SJ6A 2REMA 3ERFA 1FO5A 3D21A 2YNXA 3EC3A 3MSZA 5LCZA 3EURA 2VM2A 2FA4A 1LJRA 4XHMA 5DAKB 3QAVA 1EV4A 5D73A 3QAGA 5HFIA 1YEXA 3MIXA 3GX0A 6GSTA 3D5JA 1TW9A 4AJ8A 2DMMA 1GSQA 3UIWA 4DSSA 3GKKA 5C04A 1NHYA 4I5QA 2F51A 3RPPA 4XTSA 2LRNA 3KD0A 1M2DA 2LTKA 4F2IA 4Z2UA 3RBTA 3QPMA 3W8SA 4AGSA 5HR0A 1PX7A 3IHQA 4XS4B 4DEJA 5AIXA 3HDCA 4Q5NA 2GT5A 4NHWA 4G9HA 3TKPA 2QA1A 3P7XA 3CBUA 2B7KA 4MP4A 4YAVA 3KTLA 3LJRA 2C0FA 1XVWA 3DRNA 3WD6A 2IMEA 3ZFLA 3FRCA 3FYGA 1B8XA 3H93A 6GSXA 2A4HA 3WT2A 9GSSA 3IK9A 3M3MA 2AAWA 2TIRA 4J2FA 2MMOA 5H5SA 4EIQA 5CRGA 5F0GA 2LUSA 3GV1A 1AQVA 1V98A 8GSSA 1ILOA 5DQYA 1E6BA 1SENA 3U5RE 1K0CA 1EP7A 1JHBA 1XXUA 3TJFA 2DSAA 5DJMA 3G7YA 2PU9C 1Z7PA 1DE1A 1BAYA 5GSSA 1MD3A 1F3AA 1T8EB 2N5FA 3HD5A 4OCEA 1ZYPA 4GRFA 1SKRB 4K0NA 5BRTA 4O5RA 3IC8A 2F3MA 4TW5A 1ZCPA 1YZXA 3FZAA 1M2BA 4IQ1A 4F82A 3KMOA 3FK8A 4EKZA 2VLVA 1S3DA 1MD4A 1JFUA 1FVKA 4KUNA 1J0FA 4EE0A 1GTBA 2WULA 1PL2A 4LLRA 1SL0B 2YPMA 3FY7A 4HUAA 2LNTA 2R6KA 2B1KA 4TXVA 1GNEA 4TVEA 2VLUA 1ZGNA 4OFMA 5IMCA 2AV4A 1VF2A 3IC4A 1GULA 1MEKA 1T00A 1H4OA 5EL8A 1KEBA 3GKNA 1XWCA 5GAND 1ERTA 1EZKA 2QA2A 4D73B 2M80A 5ECQB 1WE0A 2CX3A 3L9VA 2GQLA 2PWJA 2YN1A 1EP8A 3C73A 2XPEA 2YJHA 2HNLA 3M0FA 1GUHA 3TUEA 3DYRA 4I2TA 1THOA 4GLTA 2HT9A 2FHEA 4NMUA 4FIWA 4F0BA 3UVHA 3ZL5A 2VD1A 4G0IA 3UL3A 2HRNA 4ML6A 4OD7A 3WYWA 3LFLA 1HQOA 4GQFA 5ECOB 1THXA 2DJJA 2QGVA 3FR6A 19GSA 5GAPD 1K0NA 3KJYA 16GSA 2PBJA 2K9FA 3EMXA 3LORA 1ZYEA 2WDUA 4KB3A 1U3IA 2EIRA 1WIKA 2GSRA 2IMDA 3F3RA 1PN9A 2VD0A 1FVJA 3EINA 2FCHA 5E4WA 1FOHA 3TKSA 1AW9A 2N5BA 2H74A 3H4KA 5DBQA 4IJ3A 4LMVA 3GL5A 2ZUPA 5HFGA 2OKAA 3PR8A 1ABAA 2GVPA 3HVVA 1WP0A 2PUKC 5ECMB 1URMA 1HNBA 2IMFA 2VCWA 5ELAA 4MJAA 1PKWA 3W8JA 2C0DA 10GSA 4E8HA 4ISDA 3F3QA 4G19A 4TR4A 5HQPA 5INYA 1Z3EA 3P2AA 4QL9A 1UC7A 5D8IA 2K8VA 2R4VA 4HS1A 1YEPA 2CVKA 3ZFBA 3GMFA 3FEUA 1GSYA 1G6WA 2FWFA 2DJ3A 1IYIA 2H71A 4KE3A 1ZYNA 4K0GA 3LSZA 2H66A 1ZOFA 4GTUA 3CYNA 2WS2A 2YJ7A 4ECCA 4NV2A 2AUVA 1GP1A 4TN8A 1ZZYA 2PMTA 4BA7A 3J7Yk 2GDRA 3C71A 4V1Ap 4BVYB 2Z9SA 4BVXB 3IE3A 2GZPA 3BJ5A 1TJDA 3QFBC 3HY2A 3EYTA 4ZBBA 4KSOA 4K9ZA 3LYPA 2GT6A 2VUPA 5AISA 5ABRA 3APQA 5ECRB 4ECJA 3QR6A 4JR4A 4HSCX 1TRVA 4K7OA 2L5LA 1VF4A 3R2QA 1AIUA 2HSMA 1A8YA 2C3QA 4CHSA 4MJCA 2YCDA 2FWEA 5FT3A 4IN0A 3FHKA 5L71A 3TOUA 1BEDA 1G0TA 4PNFA 4BPYA 4AJ7A 5AGYA 2V2GA 4K7NA 3VWWA 4POLA 4MPGA 2MMNA 2R3XA 1HD2A 2DKHA 4KGIA 2E2GA 1MDKA 1T4YA 17GSA 1XW5A 2PVQA 2R5GA 1W89A 3D0ZA 2B5EA 2CQ9A 4X1UA 1WOUA 1F37A 5ECSA 1R5AA 1OKDA 5ID2B 2B7JA 5A4WA 3DGQA 3D6IA 1FHEA 2CAQA 1S3RA 3MAKA 2OJLA 3GYKA 2C4JA 1NW2A 2B6MA 2GGTA 3F63A 4RQXA 3FKFA 2X99A 1S3CA 5J5NA 2NDOA 3IDVA 4ZL9A 7GSSA 3UOMA 4WR4A 2P5QA 2TRXA 2O8VB 2L4QA 3CQFA 5DALA 1YJ6A 3M9JA 3E9JB 5IO0A 1AQXA 2QKEA 1V40A 4L0WA 4F0CA 3A5WA 2O85A 3TKSE 2L5OA 5DVBA 20GSA 1EWXA 3IPZA 2M72A 3CRUA 3US3A 3MYDA 5FHIA 2IJYA 1VGLA 4MH3A 3TOTA 3LGCA 4MF7A 1TU7A 3CMIA 4OWYA 1QK8A 1I9DA 2F8FA 1U88A 2H01A 1Q4JA 3D22A 5DQSA 3A2VA 2R0CA 3S9FA 1TK0B 2KOKA 1FB0A 3LG6A 2KP2A 5IPGA 1NHOA 6GSWA 4GCIA 1RK4A 2DBCA 4TR1A 3GKXA 3VPQA 5EY6A 4XIHA 2LJKA 3P8WA 1R4WA 4JZQA 4MABA 2WJUA 2L6CA 4XS1A 1M7TA 3IAS2 5BMUA 1TU8A 2EIQA 4L0UA 2HXKA 4O92A 1MDIA 4K2DA 4POBA 2PPTA 5CRWA 2HRKA 3NZNA 1X9SB 1GTIA 1A2LA 4IJIA 1WJKA 4FYBA 1R5PA 5G5EA 1O7UA 3ZMKA 4DSSB 2ES7A 4MJBA 1YKAA 2WB9A 1YF1A 3G9BA 5DCHA 1GTUA 3ZREA 2HZEA 1NM3A 2MMAA 6GSYA 1XWGA 2XHFA 3KP9A 1UVZA 1EOHA 3L0HA 4XRDA 2H75A 1M3JA 2KLXA 3ZTLA 3HVNA 2CVBA 2I1UA 2PGTA 1DSBA 1B9XC 4N30A 2GLRA 1K3YA 1EEJA 2VCVA 2BTOT 4ML1A 1JLWA 1K0OA 2DC5A 4PUFC 2JSZA 5F06A 5KOWA 2H6ZA 4PXOA 3A2WA 3F0IA 3I43A 4MZBA 5G1KA 5GSTA 2AHEA 5ECPB 2A2RA 5IMVA 3N9JA 11GSA 3F4SA 1ERVA 2AB6A 3TDGA 3FR9A 2YOIA 2G2QA 3ISOA 1SKWB 3H79A 1TP9A 2CZ3A 3PH9A 2X4AA 5D93A 1MTCA 2GZYA 1O6JA 3RPNA 1GSFA 4TR3A 2XC2A 4CW9A 4GXZA 4KF9A
chains in the Genus database with same CATH topology
2VLTA 1CQGA 2C1YA 1SJIA 3FMWA 1GSEA 1XBSA 4I6XA 2FUG2 5KN1A 2LJAA 1XW9A 3F6DA 3VI5A 4HOJA 4V1Ag 4MCUA 2JU5A 1TRUA 3VWUA 1PKZA 18GSA 2IWTA 5CP1A 4PTSA 5D9VA 1U3AA 4LL1B 1OC3A 2F9SA 2P5RA 5ECIB 4G10A 5ECHB 1ZYQB 3F4TA 5CRHA 2FD3A 2P31A 1E2YA 3VPTA 3DMLA 5JWQB 4EXJA 3DVXA 2VCZA 2H8LA 3WT1A 1X5DA 4O5QA 4PGTA 1AUCA 2MMZA 5A5KA 3VLNA 2GQKA 2UZ8A 3L9SA 5CO3A 1JZOA 2DJ0A 2FWHA 2VO4A 4AF2A 2VL3A 2TRCP 1SU9A 3DXBA 1TI1A 4TOPA 1HNAA 3KCMA 3QCPA 5F8BA 2H70A 1R26A 2RM6A 2NVLA 4XS4A 1X9MB 5JCUA 1FOVA 3GURA 3I69A 4ID0A 3WGEA 2VAFA 4ZL8A 1OAZA 2R0PA 2KUCA 2DMLA 3G7IA 2H19A 4KW6A 3IXRA 3Q74A 5LNKe 1ERWA 3TB2A 3HVXA 3GH9A 3CSIA 5C00A 4KNDA 2CX4A 2RUEA 5JWOB 1USBA 3C1RA 4V2LA 3GSTA 2ON5A 4NV5A 4JRRA 2N5AA 4HU7A 5F07A 4WETA 2YWMA 1KBNA 1YY7A 4G0LA 4IHUA 4IGJA 2L6DA 2LQOA 4MF6A 3VI7A 1XWKA 5IM9A 2YV9A 1T7PB 4HJ2A 3TRQA 3CTFA 4ECIA 4EL1A 5KN3A 3A2XA 1SK2A 5IMAA 1SK0A 4TKYA 3VK9A 1X0RA 3E3EA 4JR6A 5CNWA 3V1WA 1TRWA 3BBYA 1PSQA 5B6MA 2GSQA 2PVOC 4EDZA 1SD8A 1O8XA 3L4NA 2DLXA 5H5QA 3CRTA 3PINA 2HLSA 3EU4A 1A2MA 3UBKA 5COHA 5ENUA 5F05A 1S3AA 2BMXA 2KP1A 3UAPA 1EGOA 1GLQA 2O7KA 4MH2A 4IVFA 4FH8A 3ZRDA 3HJOA 2FA8A 2OBKA 1PQNA 3RHBA 5CAXA 3QOUA 3GUSA 3IAM2 3DEXA 3J7Yb 4YAPA 3TKQA 3RHCA 3PPUA 2CV4A 4E8EA 2WZ9A 3TKSC 1EGRA 2O87A 3Q18A 3MNGA 3ZZXA 2BJXA 1GRXA 4O7HA 3HJMA 3ZVJA 1SL1B 4WF4A 4EUYA 2GS3A 4QQ7A 4Q5FA 4YKFA 4HEA2 3UEMA 13GSA 2JZRA 1SD9A 1AXDA 4WR5A 4JU5A 1K3LA 1K0DA 1DUGA 1G7OA 3TJKA 4PX1A 5D96A 2VL2C 5KEJA 5EPFA 2X8HA 3DVWA 1PD21 3VWXA 2I9HA 2LEGA 3BCIA 2LJRA 2X64A 2JACA 3ZVJD 1GUMA 2GSTA 4L8EA 3TJBA 4N0ZA 1O85A 2YWIA 3LYKA 1QQ2A 1XW6A 4OCFA 2LRTA 3GTUB 4POKA 3VURA 3WGDA 1YQ1A 2IMIA 2JZTA 1SK1A 1GSDA 3UMAA 3SWLA 4X4JA 1SJZA 1GL8A 3MWHA 1RQMA 4L5OA 3UBLA 1EEMA 4HDEA 12GSA 3BD2A 1XFLA 3F4RA 2VCQA 4TRXA 4I2UA 1PMTA 3IRAA 4XCSA 3F9UA 3TGZA 2ALBA 3UARA 2DIYA 2H6XA 1B4PA 2LKUA 4FO5A 5DALB 3C8EA 4JBBA 3HXSA 4WBRD 3EE2A 1K0MA 4CY6A 2V41A 3H8QA 2A2SA 2I3YA 1XWAA 1OC9A 4YKGA 2CAIA 2I4AA 3LW9A 2HSHA 6GSVA 5IOWA 2HZFA 3KMNA 1K0BA 4ECBA 1OC8A 1WMJA 2LQQA 3DD3A 2VM1A 3GN3A 4HQZA 4KCAA 2F8AA 2OADA 3L9UA 4NHZA 4HU9A 4N10A 4PUAA 5HR3A 5JCWA 3CTGA 4O5UA 1WWJA 2OACA 3IR4A 1M9BA 4Z2TA 1ON4A 4TR1B 5LD0A 1FG4A 2FWGA 3EMPA 3N5OA 2MBTA 1Z5YE 3APOA 3GRXA 3HYPA 2YWOA 3E0UA 1YF0A 3SBCA 1XOBA 3EWLA 2KHPA 5IPHA 2E7PA 1PN0A 2IPAA 3TRPA 1VF1A 2YZUA 4OFTA 2B5XA 1A24A 4Q5RA 3KH7A 5ECKB 1M0UA 3HZ8A 3TJJA 2K6VA 4G2EA 5J9CA 4PNGA 1QFNA 2HZEB 3F6FA 4IBPA 1N2AA 2QC7A 5J41A 2H1DA 4BL7B 2JADA 3ERWA 1QMVA 3BCKA 3HZ4A 14GSA 2L59A 3HHVA 5B8AA 2H0IA 5HFKA 3KEBA 4KH7A 1ZL9A 3CXGA 4KA0A 3VFIA 2B5YA 3GNJA 2B1LA 2H73A 4TR0A 4CY8A 4USSA 1X5CA 4GF0A 1O81A 2C8UA 3TRXA 4GSTA 3GFKA 3R3EA 5EVOA 3KH9A 4AJ6A 5KN2A 3LXZA 1AC1A 3GX8A 4ULXA 4H86A 4YQVA 2L57A 2A4VA 1SYXA 2V6OA 1LU4A 4IP1A 1G6YA 4ICYA 5AN1A 4WBJA 1GUKA 1TK5B 4GQCA 3TKRA 1AQWA 3GA4A 1TKDB 2V6KA 5HR1A 3HVSA 2X8GA 3RAZA 2AJQB 5J3RA 5IIZA 3M1GA 4KSMA 5J9BA 4V2MA 4EIPA 3L78A 2CA8A 3AY8A 3CSHA 4YQMA 3HCZA 4ZXGA 2HRAA 2VOCA 4LA1A 3APSA 3KIJA 4JE1A 3G7JA 4WXTA 4BWQA 2D2ZA 1C72A 4JEDA 2C3TA 1CQHA 5A4VA 3FZ5A 3LEFA 4EDYA 2GTUA 1V9WA 4TXOA 2V1MA 1J08A 1JZDA 5IO2A 3KTBA 4ZL7A 2IFQA 1Y6EA 1K0AA 2HSYA 1HNCA 2NBSA 4OO4A 1A2JA 1FW1A 1QGVA 3JCML 4K6XA 2VCXA 3KZQA 5ECLB 2E2MA 2HFDA 2VL9A 1SKSB 5DDLA 3ME7A 1GSSA 2J23A 2JZSA 4ZILA 2CVDA 4EC0A 4Z7XA 1DE2A 2EIOA 2H76A 4ACSA 1PL1A 5DAKA 1WRYA 4PQHA 4LL4B 3CSJA 4NWYA 3DKSA 5KN0A 5D9XA 2NTOA 3QD9A 4XRAA 3TCOA 2X8CA 5ECNB 4BWSA 1Z7RA 5IMDA 3FZ9A 2WCIA 1M9AA 1Z6MA 3OR5A 4IKHA 3ZMLA 4L5LA 5J4UA 4PQIA 2HYXA 2B3SA 1WPIA 2RLIA 3ED3A 4ILFA 2G0FA 2PN8A 3ZITA 1T3BA 4N0VA 3O6TA 4K2XA 4FYUA 3GL3A 5IQYA 2ZNMA 1A8LA 1OE7A 3KGKA 2XPDA 3HA9A 4MNNA 3HKRA 2H1AA 4X0XA 1TRSA 3H1NA 5GZZB 1GLPA 1TI3A 1I5GA 5B6NA 4IELA 4MDCA 2FGXA 3LXTA 2VCTA 1SYRA 1F3BA 5B8BA 3D4MA 3M8NA 1N8JA 4Q5QA 1V2AA 2DJ1A 2DKIA 3IV4A 3WGXA 4KDXA 1FAAA 1A23A 3LQ7A 3ZIJA 3W6GA 1A0FA 1F2EA 2R37A 2ZCTA 4MPFA 1B48A 2H30A 4F9ZA 1GNWA 1U87A 2HE3A 4MMMA 5IMFA 2J9HA 4RI6A 1VF3A 1PGTA 5AIVA 2OE1A 4N11A 3ME8A 5G1LA 4MZCA 5IOXA 2GZZA 6GSUA 5IMZA 5CREA 1O73A 3I6AA 4WEYA 1YDKA 1OKTA 2IMKA 1TOFA 1QUWA 2DIZA 2GSSA 2JSYA 1JZRA 2YWNA 3UJ1A 3KP8A 3BOAA 4OO5A 1JLVA 1U6TA 4I8BA 3D4TA 1J9BA 2CZ2A 3GKMA 4F03A 4IQAA 2P0GA 1T4ZA 2YP6A 3Q6OA 2V32A 2H0HA 2H72A 2YANA 2C3NA 2RUFA 3EU3A 2NPBA 4MK3A 5G5FA 4EO3A 3FW2A 2H1BA 1XPVA 5ELGA 1UN2A 1F6MC 3QFAC 4D73A 1TK8B 2LV3A 2RM5A 2L4CA 3ZLPA 4ZBDA 2K8SA 5DJLA 3A3TA 4ZBAA 2ON7A 3K8NA 2YV7A 4ZIJA 4EF0A 2QSIA 4HZ4A 4RUVA 3NIVA 3QDNA 3MDKA 2I81A 3QMXA 22GSA 2WGRA 1O8WA 4KDYA 3FR3A 3VWVA 1XWBA 1AAZA 4PQ1A 4J56E 4FQUA 1K3OA 3IA1A 4RQRA 1OVNA 4GSNA 1VRSD 4OFNA 3P90A 4FYCA 2FLSA 3GHAA 4V2NA 2C0GA 4GSSA 2VL2A 4KX4A 1OE8A 4IW9A 1PA3A 3HJPA 1BG5A 4Z2RA 3Q19A 4YQUA 1XOAA 2C80A 3O3TA 4O32A 2R0GA 1BX9A 1OC9B 1A0RP 5G31A 1FB6A 4X43A 3FZ4A 2FY6A 2HRFA 4KCEA 1Z9HA 2R2JA 5G2ZA 1JZWA 2H1GA 1LBKA 4K7IA 3ERGA 5JCGA 4K5RA 4DVCA 2EC4A 3EVIA 1TTZA 5CYYA 2HI7A 2MBSA 4EVMA 1HYUA 4P3YB 4GWRA 1Q98A 4K1FA 4NXIA 3LWAA 1B4QA 2IN3A 4HQSA 3IK7A 2WFCA 2LSTA 2AYTA 1SL2B 4MA9A 5D9WA 4CDOA 3O76A 3UVTA 1PX6A 5KOXA 1H75A 2WRTA 1Y25A 5H5RA 2A2PA 1TXXA 4WF5A 4HI7A 5A4UA 4WKWA 1KNGA 2H6YA 4K5SA 3I9V2 1UA5A 2MZCA 4ZB6A 1G7EA 6GSSA 1GTAA 1V58A 4HJMA 2K18A 1GWCA 2XBIA 2GQMA 3TJGA 1XZOA 4BVYA 4BVXA 3EPTA 1BYEA 1Z6NA 1EV9A 4QL7A 4IS0A 1M99A 1YKCA 3GIXA 1B9YC 3NOFA 1MDJA 2LS5A 3GTUA 5FWGA 5DCGA 2RIIA 1XVQA 1V57A 1T1VA 1ZMAA 4J57E 2C0EA 2X49A 1W4VA 3GH6A 4NPBA 4PURA 4RI7A 3DWVA 1ERUA 1R7HA 2LNSA 2OA7A 2H0GA 3IOSA 2OE0A 3KM6A 4KDUA 1XIYA 1NSWA 1GSUA 5JWRB 3A5IA 3C1SA 4YH2A 2OBIA 2MYGA 1BQ7A 2CT6A 4IP6A 4XS6A 1RW1A 2FNOA 2LRCA 4OMVA 4LMWA 4G0KA 4KAEA 1PRXA 5CRDA 2E0QA 2OE3A 1DBYA 4MLYA 3PGTA 2JL4A 4MZWA 1ACVA 2DJKA 4HZ2A 3QAWA 5HR2A 1XCCA 5ID2A 3M9KA 1OYJA 2PERA 1ML6A 1X5EA 3IHGA 3C7MA 2YZHA 1F9MA 1QXHA 1GH2A 4K8MA 1TDIA 4NAXA 4POMA 1X9WB 1IYHA 4A5PA 3GSSA 4MJEA 4MF5A 3DIEA 5E59A 4ZB9A 3ZYWA 2DJ2A 2XBQA 2IIYA 3U6VA 3KXOA 5B7CA 1BJXA 1EOGA 4DSRA 4ZB8A 1M2AA 1ST9A 4I97A 2IL3A 3F8UA 4TXOB 3IBHA 2VIMA 4DSQA 2IFQB 3RDWA 3ZIVA 5D9TA 2O89A 1KTEA 2M46A 5G30A 4BL7A 1SJ6A 2REMA 3ERFA 1FO5A 3D21A 2YNXA 3EC3A 3MSZA 5LCZA 3EURA 2VM2A 2FA4A 1LJRA 4XHMA 5DAKB 3QAVA 1EV4A 5D73A 3QAGA 5HFIA 1YEXA 3MIXA 3GX0A 6GSTA 3D5JA 1TW9A 4AJ8A 2DMMA 1GSQA 3UIWA 4DSSA 3GKKA 5C04A 1NHYA 4I5QA 2F51A 3RPPA 4XTSA 2LRNA 3KD0A 1M2DA 2LTKA 4F2IA 4Z2UA 3RBTA 3QPMA 3W8SA 4AGSA 5HR0A 1PX7A 3IHQA 4XS4B 4DEJA 5AIXA 3HDCA 4Q5NA 2GT5A 4NHWA 4G9HA 3TKPA 2QA1A 3P7XA 3CBUA 2B7KA 4MP4A 4YAVA 3KTLA 3LJRA 2C0FA 1XVWA 3DRNA 3WD6A 2IMEA 3ZFLA 3FRCA 3FYGA 1B8XA 3H93A 6GSXA 2A4HA 3WT2A 9GSSA 3IK9A 3M3MA 2AAWA 2TIRA 4J2FA 2MMOA 5H5SA 4EIQA 5CRGA 5F0GA 2LUSA 3GV1A 1AQVA 1V98A 8GSSA 1ILOA 5DQYA 1E6BA 1SENA 3U5RE 1K0CA 1EP7A 1JHBA 1XXUA 3TJFA 2DSAA 5DJMA 3G7YA 2PU9C 1Z7PA 1DE1A 1BAYA 5GSSA 1MD3A 1F3AA 1T8EB 2N5FA 3HD5A 4OCEA 1ZYPA 4GRFA 1SKRB 4K0NA 5BRTA 4O5RA 3IC8A 2F3MA 4TW5A 1ZCPA 1YZXA 3FZAA 1M2BA 4IQ1A 4F82A 3KMOA 3FK8A 4EKZA 2VLVA 1S3DA 1MD4A 1JFUA 1FVKA 4KUNA 1J0FA 4EE0A 1GTBA 2WULA 1PL2A 4LLRA 1SL0B 2YPMA 3FY7A 4HUAA 2LNTA 2R6KA 2B1KA 4TXVA 1GNEA 4TVEA 2VLUA 1ZGNA 4OFMA 5IMCA 2AV4A 1VF2A 3IC4A 1GULA 1MEKA 1T00A 1H4OA 5EL8A 1KEBA 3GKNA 1XWCA 5GAND 1ERTA 1EZKA 2QA2A 4D73B 2M80A 5ECQB 1WE0A 2CX3A 3L9VA 2GQLA 2PWJA 2YN1A 1EP8A 3C73A 2XPEA 2YJHA 2HNLA 3M0FA 1GUHA 3TUEA 3DYRA 4I2TA 1THOA 4GLTA 2HT9A 2FHEA 4NMUA 4FIWA 4F0BA 3UVHA 3ZL5A 2VD1A 4G0IA 3UL3A 2HRNA 4ML6A 4OD7A 3WYWA 3LFLA 1HQOA 4GQFA 5ECOB 1THXA 2DJJA 2QGVA 3FR6A 19GSA 5GAPD 1K0NA 3KJYA 16GSA 2PBJA 2K9FA 3EMXA 3LORA 1ZYEA 2WDUA 4KB3A 1U3IA 2EIRA 1WIKA 2GSRA 2IMDA 3F3RA 1PN9A 2VD0A 1FVJA 3EINA 2FCHA 5E4WA 1FOHA 3TKSA 1AW9A 2N5BA 2H74A 3H4KA 5DBQA 4IJ3A 4LMVA 3GL5A 2ZUPA 5HFGA 2OKAA 3PR8A 1ABAA 2GVPA 3HVVA 1WP0A 2PUKC 5ECMB 1URMA 1HNBA 2IMFA 2VCWA 5ELAA 4MJAA 1PKWA 3W8JA 2C0DA 10GSA 4E8HA 4ISDA 3F3QA 4G19A 4TR4A 5HQPA 5INYA 1Z3EA 3P2AA 4QL9A 1UC7A 5D8IA 2K8VA 2R4VA 4HS1A 1YEPA 2CVKA 3ZFBA 3GMFA 3FEUA 1GSYA 1G6WA 2FWFA 2DJ3A 1IYIA 2H71A 4KE3A 1ZYNA 4K0GA 3LSZA 2H66A 1ZOFA 4GTUA 3CYNA 2WS2A 2YJ7A 4ECCA 4NV2A 2AUVA 1GP1A 4TN8A 1ZZYA 2PMTA 4BA7A 3J7Yk 2GDRA 3C71A 4V1Ap 4BVYB 2Z9SA 4BVXB 3IE3A 2GZPA 3BJ5A 1TJDA 3QFBC 3HY2A 3EYTA 4ZBBA 4KSOA 4K9ZA 3LYPA 2GT6A 2VUPA 5AISA 5ABRA 3APQA 5ECRB 4ECJA 3QR6A 4JR4A 1TRVA 4K7OA 2L5LA 1VF4A 3R2QA 1AIUA 2HSMA 1A8YA 2C3QA 4CHSA 4MJCA 2YCDA 2FWEA 5FT3A 4IN0A 3FHKA 5L71A 3TOUA 1BEDA 1G0TA 4PNFA 4BPYA 4AJ7A 5AGYA 2V2GA 4K7NA 3VWWA 4POLA 4MPGA 2MMNA 2R3XA 1HD2A 2DKHA 4KGIA 2E2GA 1MDKA 1T4YA 17GSA 1XW5A 2PVQA 2R5GA 1W89A 3D0ZA 2B5EA 2CQ9A 4X1UA 1WOUA 1F37A 5ECSA 1R5AA 1OKDA 5ID2B 2B7JA 5A4WA 3DGQA 3D6IA 1FHEA 2CAQA 3MAKA 2OJLA 3GYKA 2C4JA 1NW2A 2B6MA 2GGTA 3F63A 4RQXA 3FKFA 2X99A 1S3CA 5J5NA 2NDOA 3IDVA 4ZL9A 7GSSA 3UOMA 4WR4A 2P5QA 2TRXA 2O8VB 2L4QA 5DALA 1YJ6A 3M9JA 3E9JB 5IO0A 1AQXA 2QKEA 1V40A 4L0WA 4F0CA 3A5WA 2O85A 3TKSE 2L5OA 5DVBA 20GSA 1EWXA 3IPZA 2M72A 3CRUA 3US3A 3MYDA 5FHIA 2IJYA 1VGLA 4MH3A 3TOTA 3LGCA 4MF7A 1TU7A 3CMIA 4OWYA 1QK8A 1I9DA 2F8FA 1U88A 2H01A 1Q4JA 3D22A 5DQSA 3A2VA 2R0CA 3S9FA 1TK0B 2KOKA 1FB0A 3LG6A 2KP2A 5IPGA 1NHOA 6GSWA 4GCIA 1RK4A 2DBCA 4TR1A 3GKXA 3VPQA 5EY6A 4XIHA 2LJKA 3P8WA 1R4WA 4JZQA 4MABA 2WJUA 2L6CA 4XS1A 1M7TA 3IAS2 5BMUA 1TU8A 2EIQA 4L0UA 2HXKA 4O92A 1MDIA 4K2DA 4POBA 2PPTA 5CRWA 2HRKA 3NZNA 1X9SB 1GTIA 1A2LA 4IJIA 1WJKA 4FYBA 1R5PA 5G5EA 1O7UA 3ZMKA 4DSSB 2ES7A 4MJBA 1YKAA 2WB9A 1YF1A 3G9BA 5DCHA 1GTUA 3ZREA 2HZEA 1NM3A 2MMAA 6GSYA 1XWGA 2XHFA 3KP9A 1UVZA 1EOHA 3L0HA 4XRDA 2H75A 2KLXA 3ZTLA 2CVBA 2I1UA 2PGTA 1DSBA 1B9XC 4N30A 2GLRA 1K3YA 1EEJA 2VCVA 2BTOT 4ML1A 1JLWA 1K0OA 2DC5A 4PUFC 2JSZA 5F06A 5KOWA 2H6ZA 4PXOA 3A2WA 3F0IA 3I43A 4MZBA 5G1KA 5GSTA 2AHEA 5ECPB 2A2RA 5IMVA 3N9JA 11GSA 3F4SA 1ERVA 2AB6A 3TDGA 3FR9A 2YOIA 2G2QA 3ISOA 1SKWB 3H79A 1TP9A 2CZ3A 3PH9A 2X4AA 5D93A 1MTCA 2GZYA 1O6JA 3RPNA 1GSFA 4TR3A 2XC2A 4CW9A 4GXZA 4KF9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VLT A;  1CQG A;  2C1Y A;  1SJI A;  1GSE A;  1XBS A;  4I6X A;  2FUG 2;  5KN1 A;  2LJA A;  1XW9 A;  3F6D A;  3VI5 A;  4HOJ A;  4V1A g;  4MCU A;  2JU5 A;  1TRU A;  3VWU A;  1PKZ A;  18GS A;  2IWT A;  5CP1 A;  5D9V A;  1U3A A;  4LL1 B;  1OC3 A;  2F9S A;  2P5R A;  5ECI B;  4G10 A;  5ECH B;  1ZYQ B;  3F4T A;  5CRH A;  2FD3 A;  2P31 A;  1E2Y A;  3VPT A;  3DML A;  5JWQ B;  4EXJ A;  3DVX A;  2VCZ A;  2H8L A;  3WT1 A;  1X5D A;  4PGT A;  1AUC A;  2MMZ A;  5A5K A;  3VLN A;  2GQK A;  3L9S A;  5CO3 A;  1JZO A;  2DJ0 A;  2FWH A;  2VO4 A;  4AF2 A;  2VL3 A;  2TRC P;  1SU9 A;  3DXB A;  1TI1 A;  4TOP A;  1HNA A;  3KCM A;  3QCP A;  5F8B A;  2H70 A;  1R26 A;  2RM6 A;  2NVL A;  4XS4 A;  1X9M B;  5JCU A;  1FOV A;  3GUR A;  3I69 A;  4ID0 A;  3WGE A;  2VAF A;  4ZL8 A;  1OAZ A;  2KUC A;  2DML A;  3G7I A;  2H19 A;  4KW6 A;  3IXR A;  3Q74 A;  5LNK e;  1ERW A;  3TB2 A;  3HVX A;  3GH9 A;  3CSI A;  5C00 A;  4KND A;  2CX4 A;  2RUE A;  5JWO B;  1USB A;  3C1R A;  4V2L A;  3GST A;  2ON5 A;  4NV5 A;  4JRR A;  2N5A A;  4HU7 A;  5F07 A;  4WET A;  2YWM A;  1KBN A;  1YY7 A;  4IHU A;  4IGJ A;  2L6D A;  2LQO A;  4MF6 A;  3VI7 A;  1XWK A;  5IM9 A;  2YV9 A;  1T7P B;  4HJ2 A;  3TRQ A;  3CTF A;  4ECI A;  4EL1 A;  5KN3 A;  3A2X A;  1SK2 A;  5IMA A;  1SK0 A;  4TKY A;  3VK9 A;  1X0R A;  3E3E A;  4JR6 A;  5CNW A;  3V1W A;  1TRW A;  3BBY A;  1PSQ A;  5B6M A;  2GSQ A;  2PVO C;  4EDZ A;  1SD8 A;  1O8X A;  3L4N A;  2DLX A;  5H5Q A;  3CRT A;  3PIN A;  2HLS A;  3EU4 A;  1A2M A;  3UBK A;  5COH A;  5ENU A;  5F05 A;  1S3A A;  2BMX A;  2KP1 A;  3UAP A;  1EGO A;  1GLQ A;  2O7K A;  4MH2 A;  4IVF A;  4FH8 A;  3ZRD A;  3HJO A;  2FA8 A;  2OBK A;  1PQN A;  3RHB A;  5CAX A;  3QOU A;  3GUS A;  3IAM 2;  3DEX A;  3J7Y b;  4YAP A;  3TKQ A;  3RHC A;  2CV4 A;  4E8E A;  2WZ9 A;  3TKS C;  1EGR A;  2O87 A;  3Q18 A;  3MNG A;  3ZZX A;  2BJX A;  1GRX A;  4O7H A;  3HJM A;  3ZVJ A;  1SL1 B;  4WF4 A;  4EUY A;  2GS3 A;  4QQ7 A;  4Q5F A;  4HEA 2;  3UEM A;  13GS A;  2JZR A;  1SD9 A;  1AXD A;  4WR5 A;  4JU5 A;  1K3L A;  1K0D A;  1DUG A;  1G7O A;  3TJK A;  4PX1 A;  5D96 A;  2VL2 C;  5KEJ A;  5EPF A;  2X8H A;  3DVW A;  1PD2 1;  3VWX A;  2I9H A;  2LEG A;  3BCI A;  2LJR A;  2X64 A;  2JAC A;  3ZVJ D;  1GUM A;  2GST A;  4L8E A;  3TJB A;  4N0Z A;  1O85 A;  2YWI A;  3LYK A;  1QQ2 A;  1XW6 A;  4OCF A;  2LRT A;  3GTU B;  4POK A;  3VUR A;  3WGD A;  1YQ1 A;  2IMI A;  2JZT A;  1SK1 A;  1GSD A;  3UMA A;  3SWL A;  1SJZ A;  1GL8 A;  3MWH A;  1RQM A;  4L5O A;  3UBL A;  1EEM A;  4HDE A;  12GS A;  3BD2 A;  1XFL A;  3F4R A;  2VCQ A;  4TRX A;  4I2U A;  1PMT A;  3IRA A;  4XCS A;  3F9U A;  3TGZ A;  2ALB A;  3UAR A;  2DIY A;  2H6X A;  1B4P A;  2LKU A;  4FO5 A;  5DAL B;  3C8E A;  4JBB A;  3HXS A;  4WBR D;  3EE2 A;  1K0M A;  2V41 A;  3H8Q A;  2A2S A;  2I3Y A;  1XWA A;  1OC9 A;  2CAI A;  2I4A A;  2HSH A;  6GSV A;  5IOW A;  2HZF A;  3KMN A;  1K0B A;  4ECB A;  1OC8 A;  1WMJ A;  2LQQ A;  3DD3 A;  2VM1 A;  3GN3 A;  4HQZ A;  4KCA A;  2F8A A;  2OAD A;  3L9U A;  4NHZ A;  4HU9 A;  4N10 A;  4PUA A;  5HR3 A;  5JCW A;  3CTG A;  1WWJ A;  2OAC A;  3IR4 A;  1M9B A;  1ON4 A;  4TR1 B;  5LD0 A;  1FG4 A;  2FWG A;  3EMP A;  3N5O A;  2MBT A;  1Z5Y E;  3APO A;  3GRX A;  3HYP A;  2YWO A;  3E0U A;  1YF0 A;  3SBC A;  1XOB A;  3EWL A;  2KHP A;  5IPH A;  2E7P A;  2IPA A;  3TRP A;  1VF1 A;  2YZU A;  4OFT A;  2B5X A;  1A24 A;  4Q5R A;  3KH7 A;  5ECK B;  1M0U A;  3HZ8 A;  3TJJ A;  2K6V A;  4G2E A;  5J9C A;  4PNG A;  1QFN A;  2HZE B;  3F6F A;  4IBP A;  1N2A A;  2QC7 A;  5J41 A;  2H1D A;  2JAD A;  3ERW A;  1QMV A;  3BCK A;  3HZ4 A;  14GS A;  2L59 A;  3HHV A;  5B8A A;  2H0I A;  5HFK A;  3KEB A;  4KH7 A;  1ZL9 A;  3CXG A;  4KA0 A;  3VFI A;  2B5Y A;  3GNJ A;  2B1L A;  2H73 A;  4TR0 A;  1X5C A;  4GF0 A;  1O81 A;  2C8U A;  3TRX A;  4GST A;  3GFK A;  5EVO A;  3KH9 A;  4AJ6 A;  5KN2 A;  3LXZ A;  1AC1 A;  3GX8 A;  4ULX A;  4H86 A;  4YQV A;  2L57 A;  2A4V A;  1SYX A;  2V6O A;  1LU4 A;  4IP1 A;  1G6Y A;  5AN1 A;  4WBJ A;  1GUK A;  1TK5 B;  4GQC A;  3TKR A;  1AQW A;  3GA4 A;  1TKD B;  2V6K A;  5HR1 A;  3HVS A;  2X8G A;  3RAZ A;  2AJQ B;  5J3R A;  5IIZ A;  3M1G A;  4KSM A;  5J9B A;  4V2M A;  3L78 A;  2CA8 A;  3AY8 A;  3CSH A;  4YQM A;  3HCZ A;  4ZXG A;  2VOC A;  4LA1 A;  3APS A;  3KIJ A;  4JE1 A;  3G7J A;  4WXT A;  4BWQ A;  2D2Z A;  1C72 A;  4JED A;  2C3T A;  1CQH A;  5A4V A;  3FZ5 A;  3LEF A;  4EDY A;  2GTU A;  1V9W A;  4TXO A;  2V1M A;  1J08 A;  1JZD A;  5IO2 A;  3KTB A;  4ZL7 A;  2IFQ A;  1Y6E A;  1K0A A;  2HSY A;  1HNC A;  2NBS A;  4OO4 A;  1A2J A;  1FW1 A;  1QGV A;  3JCM L;  4K6X A;  2VCX A;  3KZQ A;  5ECL B;  2E2M A;  2HFD A;  2VL9 A;  1SKS B;  5DDL A;  3ME7 A;  1GSS A;  2J23 A;  2JZS A;  4ZIL A;  2CVD A;  4EC0 A;  4Z7X A;  1DE2 A;  2EIO A;  2H76 A;  4ACS A;  1PL1 A;  5DAK A;  1WRY A;  4PQH A;  4LL4 B;  3CSJ A;  4NWY A;  3DKS A;  5KN0 A;  5D9X A;  2NTO A;  3QD9 A;  4XRA A;  3TCO A;  2X8C A;  5ECN B;  4BWS A;  1Z7R A;  5IMD A;  3FZ9 A;  2WCI A;  1M9A A;  1Z6M A;  3OR5 A;  4IKH A;  3ZML A;  4L5L A;  5J4U A;  4PQI A;  2HYX A;  2B3S A;  1WPI A;  2RLI A;  3ED3 A;  4ILF A;  2G0F A;  2PN8 A;  3ZIT A;  1T3B A;  4N0V A;  3O6T A;  4FYU A;  3GL3 A;  5IQY A;  2ZNM A;  1A8L A;  1OE7 A;  3KGK A;  2XPD A;  3HA9 A;  3HKR A;  2H1A A;  4X0X A;  1TRS A;  3H1N A;  5GZZ B;  1GLP A;  1TI3 A;  1I5G A;  5B6N A;  4IEL A;  4MDC A;  2FGX A;  3LXT A;  2VCT A;  1SYR A;  1F3B A;  5B8B A;  3D4M A;  3M8N A;  1N8J A;  4Q5Q A;  1V2A A;  2DJ1 A;  3IV4 A;  3WGX A;  4KDX A;  1FAA A;  1A23 A;  3LQ7 A;  3ZIJ A;  3W6G A;  1A0F A;  1F2E A;  2R37 A;  2ZCT A;  4MPF A;  1B48 A;  2H30 A;  4F9Z A;  1GNW A;  1U87 A;  2HE3 A;  4MMM A;  5IMF A;  2J9H A;  4RI6 A;  1VF3 A;  1PGT A;  5AIV A;  2OE1 A;  4N11 A;  3ME8 A;  5G1L A;  4MZC A;  5IOX A;  2GZZ A;  6GSU A;  5IMZ A;  5CRE A;  1O73 A;  3I6A A;  4WEY A;  1YDK A;  1OKT A;  2IMK A;  1TOF A;  1QUW A;  2DIZ A;  2GSS A;  2JSY A;  1JZR A;  2YWN A;  3UJ1 A;  3KP8 A;  3BOA A;  4OO5 A;  1JLV A;  1U6T A;  4I8B A;  3D4T A;  1J9B A;  2CZ2 A;  3GKM A;  4F03 A;  4IQA A;  2P0G A;  1T4Z A;  2YP6 A;  3Q6O A;  2V32 A;  2H0H A;  2H72 A;  2YAN A;  2C3N A;  2RUF A;  3EU3 A;  2NPB A;  4MK3 A;  5G5F A;  4EO3 A;  3FW2 A;  2H1B A;  1XPV A;  5ELG A;  1UN2 A;  1F6M C;  3QFA C;  4D73 A;  1TK8 B;  2LV3 A;  2RM5 A;  2L4C A;  3ZLP A;  4ZBD A;  2K8S A;  5DJL A;  3A3T A;  4ZBA A;  2ON7 A;  3K8N A;  2YV7 A;  4ZIJ A;  4EF0 A;  2QSI A;  4HZ4 A;  4RUV A;  3NIV A;  3QDN A;  3MDK A;  2I81 A;  3QMX A;  22GS A;  2WGR A;  1O8W A;  4KDY A;  3FR3 A;  3VWV A;  1XWB A;  1AAZ A;  4PQ1 A;  4J56 E;  1K3O A;  3IA1 A;  4RQR A;  1OVN A;  4GSN A;  1VRS D;  4OFN A;  3P90 A;  4FYC A;  2FLS A;  3GHA A;  4V2N A;  2C0G A;  4GSS A;  2VL2 A;  4KX4 A;  1OE8 A;  4IW9 A;  1PA3 A;  3HJP A;  1BG5 A;  3Q19 A;  4YQU A;  1XOA A;  2C80 A;  3O3T A;  4O32 A;  1BX9 A;  1OC9 B;  1A0R P;  5G31 A;  1FB6 A;  4X43 A;  3FZ4 A;  2FY6 A;  2HRF A;  4KCE A;  1Z9H A;  2R2J A;  5G2Z A;  1JZW A;  2H1G A;  1LBK A;  4K7I A;  3ERG A;  5JCG A;  4DVC A;  2EC4 A;  3EVI A;  1TTZ A;  5CYY A;  2HI7 A;  2MBS A;  4EVM A;  1HYU A;  4P3Y B;  4GWR A;  1Q98 A;  4K1F A;  4NXI A;  3LWA A;  1B4Q A;  2IN3 A;  4HQS A;  3IK7 A;  2WFC A;  2LST A;  2AYT A;  1SL2 B;  4MA9 A;  5D9W A;  4CDO A;  3O76 A;  3UVT A;  1PX6 A;  1H75 A;  2WRT A;  1Y25 A;  5H5R A;  1TXX A;  4WF5 A;  4HI7 A;  5A4U A;  4WKW A;  1KNG A;  2H6Y A;  3I9V 2;  1UA5 A;  2MZC A;  4ZB6 A;  1G7E A;  6GSS A;  1GTA A;  1V58 A;  4HJM A;  2K18 A;  1GWC A;  2XBI A;  2GQM A;  3TJG A;  1XZO A;  4BVY A;  4BVX A;  1BYE A;  1Z6N A;  1EV9 A;  4QL7 A;  4IS0 A;  1M99 A;  1YKC A;  3GIX A;  1B9Y C;  3NOF A;  1MDJ A;  2LS5 A;  3GTU A;  5FWG A;  5DCG A;  2RII A;  1XVQ A;  1V57 A;  1T1V A;  1ZMA A;  4J57 E;  2C0E A;  1W4V A;  3GH6 A;  4NPB A;  4PUR A;  4RI7 A;  3DWV A;  1ERU A;  1R7H A;  2LNS A;  2OA7 A;  2H0G A;  3IOS A;  2OE0 A;  3KM6 A;  4KDU A;  1XIY A;  1NSW A;  1GSU A;  5JWR B;  3C1S A;  4YH2 A;  2OBI A;  2MYG A;  1BQ7 A;  2CT6 A;  4IP6 A;  4XS6 A;  1RW1 A;  2FNO A;  2LRC A;  4OMV A;  4LMW A;  4KAE A;  1PRX A;  5CRD A;  2E0Q A;  2OE3 A;  1DBY A;  4MLY A;  3PGT A;  2JL4 A;  4MZW A;  1ACV A;  2DJK A;  4HZ2 A;  3QAW A;  5HR2 A;  1XCC A;  5ID2 A;  3M9K A;  1OYJ A;  2PER A;  1ML6 A;  1X5E A;  3C7M A;  2YZH A;  1F9M A;  1QXH A;  1GH2 A;  4K8M A;  1TDI A;  4NAX A;  4POM A;  1X9W B;  1IYH A;  3GSS A;  4MJE A;  4MF5 A;  3DIE A;  5E59 A;  4ZB9 A;  3ZYW A;  2DJ2 A;  2XBQ A;  2IIY A;  3U6V A;  3KXO A;  5B7C A;  1BJX A;  1EOG A;  4DSR A;  4ZB8 A;  1M2A A;  1ST9 A;  4I97 A;  2IL3 A;  3F8U A;  4TXO B;  3IBH A;  2VIM A;  4DSQ A;  2IFQ B;  3RDW A;  3ZIV A;  5D9T A;  2O89 A;  1KTE A;  2M46 A;  5G30 A;  4BL7 A;  1SJ6 A;  2REM A;  3ERF A;  1FO5 A;  3D21 A;  2YNX A;  3EC3 A;  3MSZ A;  5LCZ A;  3EUR A;  2VM2 A;  2FA4 A;  1LJR A;  4XHM A;  5DAK B;  3QAV A;  1EV4 A;  5D73 A;  3QAG A;  5HFI A;  1YEX A;  3GX0 A;  6GST A;  3D5J A;  1TW9 A;  4AJ8 A;  2DMM A;  1GSQ A;  3UIW A;  4DSS A;  3GKK A;  5C04 A;  1NHY A;  4I5Q A;  2F51 A;  3RPP A;  4XTS A;  2LRN A;  3KD0 A;  1M2D A;  2LTK A;  4F2I A;  3RBT A;  3QPM A;  3W8S A;  4AGS A;  5HR0 A;  1PX7 A;  3IHQ A;  4XS4 B;  4DEJ A;  5AIX A;  3HDC A;  4Q5N A;  2GT5 A;  4NHW A;  4G9H A;  3TKP A;  3P7X A;  3CBU A;  2B7K A;  4MP4 A;  4YAV A;  3KTL A;  3LJR A;  2C0F A;  1XVW A;  3DRN A;  3WD6 A;  2IME A;  3ZFL A;  3FRC A;  3FYG A;  1B8X A;  3H93 A;  6GSX A;  9GSS A;  3WT2 A;  3IK9 A;  3M3M A;  2AAW A;  2TIR A;  4J2F A;  2MMO A;  5H5S A;  5CRG A;  5F0G A;  2LUS A;  3GV1 A;  1AQV A;  1V98 A;  8GSS A;  1ILO A;  5DQY A;  1E6B A;  1SEN A;  3U5R E;  1K0C A;  1EP7 A;  1JHB A;  1XXU A;  3TJF A;  2DSA A;  5DJM A;  3G7Y A;  2PU9 C;  1Z7P A;  1DE1 A;  1BAY A;  5GSS A;  1MD3 A;  1F3A A;  1T8E B;  2N5F A;  3HD5 A;  4OCE A;  4GRF A;  1SKR B;  4K0N A;  4O5R A;  2F3M A;  4TW5 A;  1ZCP A;  1YZX A;  3FZA A;  1M2B A;  4IQ1 A;  4F82 A;  3KMO A;  3FK8 A;  4EKZ A;  2VLV A;  1S3D A;  1MD4 A;  1JFU A;  1FVK A;  4KUN A;  1J0F A;  4EE0 A;  1GTB A;  2WUL A;  1PL2 A;  4LLR A;  1SL0 B;  2YPM A;  3FY7 A;  4HUA A;  2LNT A;  2R6K A;  2B1K A;  4TXV A;  1GNE A;  4TVE A;  2VLU A;  1ZGN A;  4OFM A;  5IMC A;  2AV4 A;  1VF2 A;  3IC4 A;  1GUL A;  1MEK A;  1T00 A;  1H4O A;  5EL8 A;  1KEB A;  3GKN A;  1XWC A;  5GAN D;  1ERT A;  1EZK A;  4D73 B;  2M80 A;  5ECQ B;  1WE0 A;  2CX3 A;  3L9V A;  2GQL A;  2PWJ A;  2YN1 A;  1EP8 A;  3C73 A;  2XPE A;  2YJH A;  2HNL A;  3M0F A;  1GUH A;  3TUE A;  3DYR A;  4I2T A;  1THO A;  4GLT A;  2HT9 A;  2FHE A;  4NMU A;  4FIW A;  4F0B A;  3UVH A;  3ZL5 A;  2VD1 A;  3UL3 A;  2HRN A;  4ML6 A;  4OD7 A;  3WYW A;  3LFL A;  1HQO A;  4GQF A;  5ECO B;  1THX A;  2DJJ A;  2QGV A;  3FR6 A;  19GS A;  5GAP D;  1K0N A;  3KJY A;  16GS A;  2PBJ A;  2K9F A;  3EMX A;  3LOR A;  1ZYE A;  2WDU A;  4KB3 A;  1U3I A;  2EIR A;  1WIK A;  2GSR A;  2IMD A;  3F3R A;  1PN9 A;  2VD0 A;  1FVJ A;  3EIN A;  2FCH A;  5E4W A;  3TKS A;  1AW9 A;  2N5B A;  2H74 A;  3H4K A;  5DBQ A;  4IJ3 A;  4LMV A;  3GL5 A;  2ZUP A;  5HFG A;  2OKA A;  3PR8 A;  1ABA A;  2GVP A;  3HVV A;  1WP0 A;  2PUK C;  5ECM B;  1URM A;  1HNB A;  2IMF A;  2VCW A;  5ELA A;  4MJA A;  1PKW A;  3W8J A;  2C0D A;  10GS A;  4E8H A;  4ISD A;  3F3Q A;  4G19 A;  4TR4 A;  5HQP A;  5INY A;  1Z3E A;  3P2A A;  4QL9 A;  1UC7 A;  5D8I A;  2K8V A;  2R4V A;  4HS1 A;  1YEP A;  2CVK A;  3ZFB A;  3GMF A;  3FEU A;  1GSY A;  1G6W A;  2FWF A;  2DJ3 A;  1IYI A;  2H71 A;  4KE3 A;  4K0G A;  3LSZ A;  2H66 A;  1ZOF A;  4GTU A;  3CYN A;  2WS2 A;  2YJ7 A;  4ECC A;  4NV2 A;  2AUV A;  1GP1 A;  4TN8 A;  1ZZY A;  2PMT A;  4BA7 A;  3J7Y k;  2GDR A;  3C71 A;  4V1A p;  2Z9S A;  3IE3 A;  2GZP A;  3BJ5 A;  1TJD A;  3QFB C;  3HY2 A;  3EYT A;  4ZBB A;  4KSO A;  4K9Z A;  3LYP A;  2GT6 A;  2VUP A;  5AIS A;  5ABR A;  3APQ A;  5ECR B;  4ECJ A;  3QR6 A;  4JR4 A;  1TRV A;  4K7O A;  2L5L A;  1VF4 A;  3R2Q A;  1AIU A;  1A8Y A;  2C3Q A;  4CHS A;  4MJC A;  2YCD A;  2FWE A;  5FT3 A;  4IN0 A;  3FHK A;  5L71 A;  3TOU A;  1BED A;  1G0T A;  4PNF A;  4BPY A;  4AJ7 A;  5AGY A;  2V2G A;  4K7N A;  3VWW A;  4POL A;  4MPG A;  2MMN A;  2R3X A;  1HD2 A;  4KGI A;  2E2G A;  1MDK A;  1T4Y A;  17GS A;  1XW5 A;  2PVQ A;  2R5G A;  1W89 A;  3D0Z A;  2B5E A;  2CQ9 A;  4X1U A;  1WOU A;  1F37 A;  5ECS A;  1R5A A;  1OKD A;  5ID2 B;  2B7J A;  5A4W A;  3DGQ A;  3D6I A;  1FHE A;  2CAQ A;  3MAK A;  2OJL A;  3GYK A;  2C4J A;  1NW2 A;  2B6M A;  2GGT A;  3F63 A;  4RQX A;  3FKF A;  2X99 A;  1S3C A;  5J5N A;  2NDO A;  3IDV A;  4ZL9 A;  7GSS A;  3UOM A;  4WR4 A;  2P5Q A;  2TRX A;  2O8V B;  2L4Q A;  5DAL A;  1YJ6 A;  3M9J A;  3E9J B;  5IO0 A;  1AQX A;  2QKE A;  1V40 A;  4L0W A;  4F0C A;  3A5W A;  2O85 A;  3TKS E;  2L5O A;  5DVB A;  20GS A;  1EWX A;  3IPZ A;  2M72 A;  3CRU A;  3US3 A;  5FHI A;  2IJY A;  1VGL A;  4MH3 A;  3TOT A;  3LGC A;  4MF7 A;  1TU7 A;  3CMI A;  4OWY A;  1QK8 A;  1I9D A;  2F8F A;  1U88 A;  2H01 A;  1Q4J A;  3D22 A;  5DQS A;  3A2V A;  3S9F A;  1TK0 B;  2KOK A;  1FB0 A;  3LG6 A;  2KP2 A;  5IPG A;  1NHO A;  6GSW A;  4GCI A;  1RK4 A;  2DBC A;  4TR1 A;  3GKX A;  3VPQ A;  5EY6 A;  4XIH A;  2LJK A;  3P8W A;  1R4W A;  4JZQ A;  4MAB A;  2WJU A;  2L6C A;  4XS1 A;  1M7T A;  3IAS 2;  1TU8 A;  2EIQ A;  4L0U A;  2HXK A;  4O92 A;  1MDI A;  4K2D A;  4POB A;  2PPT A;  5CRW A;  3NZN A;  1X9S B;  1GTI A;  1A2L A;  4IJI A;  1WJK A;  4FYB A;  1R5P A;  5G5E A;  1O7U A;  3ZMK A;  4DSS B;  2ES7 A;  4MJB A;  1YKA A;  2WB9 A;  1YF1 A;  3G9B A;  5DCH A;  1GTU A;  3ZRE A;  2HZE A;  1NM3 A;  2MMA A;  6GSY A;  1XWG A;  2XHF A;  3KP9 A;  1UVZ A;  1EOH A;  3L0H A;  4XRD A;  2H75 A;  2KLX A;  3ZTL A;  2CVB A;  2I1U A;  2PGT A;  1DSB A;  1B9X C;  4N30 A;  2GLR A;  1K3Y A;  1EEJ A;  2VCV A;  2BTO T;  4ML1 A;  1JLW A;  1K0O A;  2DC5 A;  4PUF C;  2JSZ A;  5F06 A;  2H6Z A;  4PXO A;  3A2W A;  3F0I A;  3I43 A;  4MZB A;  5G1K A;  5GST A;  2AHE A;  5ECP B;  2A2R A;  5IMV A;  3N9J A;  11GS A;  3F4S A;  1ERV A;  2AB6 A;  3TDG A;  3FR9 A;  2YOI A;  2G2Q A;  3ISO A;  1SKW B;  3H79 A;  1TP9 A;  2CZ3 A;  3PH9 A;  5D93 A;  1MTC A;  2GZY A;  1O6J A;  3RPN A;  1GSF A;  4TR3 A;  2XC2 A;  4CW9 A;  4GXZ A; 
#chains in the Genus database with same CATH topology
 2VLT A;  1CQG A;  2C1Y A;  1SJI A;  3FMW A;  4BIK A;  1GSE A;  1XBS A;  4I6X A;  2FUG 2;  5KN1 A;  2LJA A;  1XW9 A;  3F6D A;  3VI5 A;  4HOJ A;  4V1A g;  4MCU A;  2JU5 A;  1TRU A;  3VWU A;  1PKZ A;  18GS A;  2IWT A;  5CP1 A;  4PTS A;  5D9V A;  1U3A A;  4LL1 B;  1OC3 A;  2F9S A;  2P5R A;  5ECI B;  4G10 A;  5ECH B;  1ZYQ B;  3F4T A;  5CRH A;  2FD3 A;  2P31 A;  1E2Y A;  3VPT A;  3DML A;  5JWQ B;  4EXJ A;  3DVX A;  2VCZ A;  2H8L A;  3WT1 A;  1X5D A;  4O5Q A;  4PGT A;  1AUC A;  2MMZ A;  5A5K A;  3VLN A;  2GQK A;  2UZ8 A;  3L9S A;  5CO3 A;  1JZO A;  2DJ0 A;  2FWH A;  2VO4 A;  4AF2 A;  2VL3 A;  2TRC P;  1SU9 A;  3DXB A;  1TI1 A;  4TOP A;  1HNA A;  3KCM A;  3QCP A;  5F8B A;  2H70 A;  1R26 A;  2RM6 A;  2NVL A;  4XS4 A;  1X9M B;  5JCU A;  1FOV A;  3GUR A;  3I69 A;  4ID0 A;  3WGE A;  2VAF A;  4ZL8 A;  1OAZ A;  2R0P A;  2KUC A;  2DML A;  3G7I A;  2H19 A;  4KW6 A;  3IXR A;  3Q74 A;  5LNK e;  1ERW A;  3TB2 A;  3HVX A;  3GH9 A;  3CSI A;  5C00 A;  4KND A;  2CX4 A;  2RUE A;  5JWO B;  1USB A;  3C1R A;  1M3I A;  4V2L A;  3GST A;  2ON5 A;  4NV5 A;  4JRR A;  2N5A A;  4HU7 A;  5F07 A;  4WET A;  2YWM A;  1KBN A;  1YY7 A;  4G0L A;  4IHU A;  4IGJ A;  2L6D A;  2LQO A;  4MF6 A;  3VI7 A;  1XWK A;  5IM9 A;  2YV9 A;  1T7P B;  4HJ2 A;  3TRQ A;  3CTF A;  4ECI A;  4EL1 A;  5KN3 A;  3A2X A;  1SK2 A;  5IMA A;  1SK0 A;  4TKY A;  3VK9 A;  1X0R A;  3E3E A;  4JR6 A;  5CNW A;  3V1W A;  1TRW A;  3BBY A;  1PSQ A;  5B6M A;  2GSQ A;  2PVO C;  4EDZ A;  1SD8 A;  1O8X A;  3L4N A;  2DLX A;  5H5Q A;  3CRT A;  3PIN A;  2HLS A;  3EU4 A;  1A2M A;  3UBK A;  5COH A;  5ENU A;  5F05 A;  1S3A A;  2BMX A;  2KP1 A;  3UAP A;  1EGO A;  1GLQ A;  2O7K A;  4MH2 A;  4IVF A;  4FH8 A;  3ZRD A;  3HJO A;  2FA8 A;  2OBK A;  1PQN A;  3RHB A;  5CAX A;  3QOU A;  3GUS A;  3IAM 2;  3DEX A;  3J7Y b;  4YAP A;  3TKQ A;  3RHC A;  3PPU A;  2CV4 A;  4E8E A;  2WZ9 A;  3TKS C;  1EGR A;  2O87 A;  3Q18 A;  3MNG A;  3ZZX A;  2BJX A;  1GRX A;  4O7H A;  3HJM A;  3ZVJ A;  1SL1 B;  4WF4 A;  4EUY A;  2GS3 A;  4QQ7 A;  4Q5F A;  4YKF A;  4HEA 2;  3UEM A;  13GS A;  2JZR A;  1SD9 A;  1AXD A;  4WR5 A;  4JU5 A;  1K3L A;  1K0D A;  1DUG A;  1G7O A;  3TJK A;  4PX1 A;  5D96 A;  2VL2 C;  5KEJ A;  5EPF A;  2X8H A;  3DVW A;  1PD2 1;  3VWX A;  2I9H A;  2LEG A;  3BCI A;  2LJR A;  2X64 A;  2JAC A;  3ZVJ D;  1GUM A;  2GST A;  4L8E A;  3TJB A;  4N0Z A;  1O85 A;  2YWI A;  3LYK A;  1QQ2 A;  1XW6 A;  4OCF A;  2LRT A;  3GTU B;  4POK A;  3VUR A;  3WGD A;  1YQ1 A;  2IMI A;  2JZT A;  1SK1 A;  1GSD A;  3UMA A;  3SWL A;  4X4J A;  1SJZ A;  1GL8 A;  3MWH A;  1RQM A;  4L5O A;  3UBL A;  1EEM A;  4HDE A;  12GS A;  3BD2 A;  1XFL A;  3F4R A;  2VCQ A;  4TRX A;  4I2U A;  1PMT A;  3IRA A;  4XCS A;  3F9U A;  3TGZ A;  2ALB A;  3UAR A;  2DIY A;  2H6X A;  1B4P A;  2LKU A;  4FO5 A;  5DAL B;  3C8E A;  4JBB A;  3HXS A;  4WBR D;  3EE2 A;  1K0M A;  4CY6 A;  2V41 A;  3H8Q A;  2A2S A;  2I3Y A;  1XWA A;  1OC9 A;  4YKG A;  2CAI A;  2I4A A;  3LW9 A;  2HSH A;  6GSV A;  5IOW A;  2HZF A;  3KMN A;  1K0B A;  4ECB A;  1OC8 A;  1WMJ A;  2LQQ A;  3DD3 A;  2VM1 A;  3GN3 A;  4HQZ A;  4KCA A;  2F8A A;  2OAD A;  3L9U A;  4NHZ A;  4HU9 A;  4N10 A;  4PUA A;  5HR3 A;  5JCW A;  3CTG A;  4O5U A;  1WWJ A;  2OAC A;  3IR4 A;  1M9B A;  4Z2T A;  1ON4 A;  4TR1 B;  5LD0 A;  1FG4 A;  2FWG A;  3EMP A;  3N5O A;  2MBT A;  1Z5Y E;  3APO A;  3GRX A;  3HYP A;  2YWO A;  3E0U A;  1YF0 A;  3SBC A;  1XOB A;  3EWL A;  2KHP A;  5IPH A;  2E7P A;  1PN0 A;  2IPA A;  3TRP A;  1VF1 A;  2YZU A;  4OFT A;  2B5X A;  1A24 A;  4Q5R A;  3KH7 A;  5ECK B;  1M0U A;  3HZ8 A;  3TJJ A;  2K6V A;  1PFO A;  4G2E A;  4PNG A;  5J9C A;  1QFN A;  2HZE B;  3F6F A;  4IBP A;  1N2A A;  2QC7 A;  5J41 A;  2H1D A;  4BL7 B;  2JAD A;  3ERW A;  1QMV A;  3BCK A;  3HZ4 A;  14GS A;  2L59 A;  3HHV A;  5B8A A;  2H0I A;  5HFK A;  3KEB A;  4KH7 A;  1ZL9 A;  3CXG A;  4KA0 A;  3VFI A;  2B5Y A;  3GNJ A;  2B1L A;  2H73 A;  4TR0 A;  4CY8 A;  4USS A;  1X5C A;  4GF0 A;  1O81 A;  2C8U A;  3TRX A;  4GST A;  3GFK A;  3R3E A;  5EVO A;  3KH9 A;  4AJ6 A;  5KN2 A;  3LXZ A;  1AC1 A;  3GX8 A;  4ULX A;  4H86 A;  4YQV A;  2L57 A;  2A4V A;  1SYX A;  2V6O A;  1LU4 A;  4IP1 A;  1G6Y A;  4ICY A;  5AN1 A;  4WBJ A;  1GUK A;  1TK5 B;  4GQC A;  3TKR A;  1AQW A;  3GA4 A;  1TKD B;  2V6K A;  5HR1 A;  3HVS A;  2X8G A;  3RAZ A;  2AJQ B;  5J3R A;  5IIZ A;  3M1G A;  4KSM A;  5J9B A;  4V2M A;  4EIP A;  3L78 A;  2CA8 A;  3AY8 A;  3CSH A;  4YQM A;  3HCZ A;  4ZXG A;  2HRA A;  2VOC A;  4LA1 A;  3APS A;  3KIJ A;  4JE1 A;  3G7J A;  4WXT A;  4BWQ A;  2D2Z A;  1C72 A;  4JED A;  2C3T A;  1CQH A;  5A4V A;  3FZ5 A;  3LEF A;  4EDY A;  2GTU A;  1V9W A;  4TXO A;  2V1M A;  1J08 A;  1JZD A;  5IO2 A;  3KTB A;  4ZL7 A;  2IFQ A;  1Y6E A;  1K0A A;  2HSY A;  1HNC A;  2NBS A;  4OO4 A;  1A2J A;  1FW1 A;  1QGV A;  3JCM L;  4K6X A;  2VCX A;  3KZQ A;  5ECL B;  2E2M A;  2HFD A;  2VL9 A;  1SKS B;  5DDL A;  3ME7 A;  1GSS A;  2J23 A;  2JZS A;  4ZIL A;  2CVD A;  4EC0 A;  4Z7X A;  1DE2 A;  2EIO A;  2H76 A;  4ACS A;  1PL1 A;  5DAK A;  1WRY A;  4PQH A;  4LL4 B;  3CSJ A;  4NWY A;  3DKS A;  5KN0 A;  5D9X A;  2NTO A;  3QD9 A;  4XRA A;  3TCO A;  2X8C A;  5ECN B;  4BWS A;  1Z7R A;  5IMD A;  3FZ9 A;  2WCI A;  1M9A A;  1Z6M A;  3OR5 A;  4IKH A;  3ZML A;  4L5L A;  5J4U A;  4PQI A;  2HYX A;  2B3S A;  1WPI A;  2RLI A;  3ED3 A;  4ILF A;  2G0F A;  2PN8 A;  3ZIT A;  1T3B A;  4N0V A;  3O6T A;  4K2X A;  4FYU A;  3GL3 A;  5IQY A;  2ZNM A;  1A8L A;  1OE7 A;  3KGK A;  2XPD A;  3HA9 A;  4MNN A;  3HKR A;  2H1A A;  4X0X A;  1TRS A;  3H1N A;  5GZZ B;  1GLP A;  1TI3 A;  1I5G A;  5B6N A;  4IEL A;  4MDC A;  2FGX A;  3LXT A;  2VCT A;  1SYR A;  1F3B A;  5B8B A;  3D4M A;  3M8N A;  1N8J A;  4Q5Q A;  1V2A A;  2DJ1 A;  2DKI A;  3IV4 A;  3WGX A;  4KDX A;  1FAA A;  1A23 A;  3LQ7 A;  3ZIJ A;  3W6G A;  1A0F A;  1F2E A;  2R37 A;  2ZCT A;  4MPF A;  1B48 A;  2H30 A;  4F9Z A;  1GNW A;  1U87 A;  2HE3 A;  4MMM A;  5IMF A;  2J9H A;  4RI6 A;  1VF3 A;  1PGT A;  5AIV A;  2OE1 A;  4N11 A;  3ME8 A;  5G1L A;  4MZC A;  5IOX A;  2GZZ A;  6GSU A;  5IMZ A;  5CRE A;  1O73 A;  3I6A A;  4WEY A;  1YDK A;  1OKT A;  2IMK A;  1TOF A;  1QUW A;  2DIZ A;  2GSS A;  2JSY A;  1JZR A;  2YWN A;  3UJ1 A;  3KP8 A;  3BOA A;  4OO5 A;  1JLV A;  1U6T A;  4I8B A;  3D4T A;  1J9B A;  2CZ2 A;  3GKM A;  4F03 A;  4IQA A;  2P0G A;  1T4Z A;  2YP6 A;  3Q6O A;  2V32 A;  2H0H A;  2H72 A;  2YAN A;  2C3N A;  2RUF A;  3EU3 A;  2NPB A;  4MK3 A;  5G5F A;  4EO3 A;  3FW2 A;  2H1B A;  1XPV A;  5ELG A;  1UN2 A;  1F6M C;  3QFA C;  4D73 A;  1TK8 B;  2LV3 A;  2RM5 A;  2L4C A;  3ZLP A;  4ZBD A;  2K8S A;  5DJL A;  3A3T A;  4ZBA A;  2ON7 A;  3K8N A;  2YV7 A;  4ZIJ A;  4EF0 A;  2QSI A;  4HZ4 A;  4RUV A;  3NIV A;  3QDN A;  3MDK A;  2I81 A;  3QMX A;  22GS A;  2WGR A;  1O8W A;  4KDY A;  3FR3 A;  3VWV A;  1XWB A;  1AAZ A;  4PQ1 A;  4J56 E;  4FQU A;  1K3O A;  3IA1 A;  4RQR A;  1OVN A;  4GSN A;  1VRS D;  4OFN A;  3P90 A;  4FYC A;  2FLS A;  3GHA A;  4V2N A;  2C0G A;  4GSS A;  2VL2 A;  4KX4 A;  1OE8 A;  4IW9 A;  1PA3 A;  3HJP A;  1BG5 A;  4Z2R A;  1XG8 A;  3Q19 A;  4YQU A;  1XOA A;  2C80 A;  3O3T A;  4O32 A;  2R0G A;  1BX9 A;  1OC9 B;  1A0R P;  5G31 A;  1FB6 A;  4X43 A;  3FZ4 A;  2FY6 A;  2HRF A;  4KCE A;  1Z9H A;  2R2J A;  5G2Z A;  1JZW A;  2H1G A;  1LBK A;  4K7I A;  3ERG A;  5JCG A;  4K5R A;  4DVC A;  2EC4 A;  3EVI A;  1TTZ A;  5CYY A;  2HI7 A;  2MBS A;  4EVM A;  1HYU A;  4P3Y B;  4GWR A;  1Q98 A;  4K1F A;  4NXI A;  3LWA A;  1B4Q A;  2IN3 A;  4HQS A;  3IK7 A;  2WFC A;  2LST A;  2AYT A;  1SL2 B;  4MA9 A;  5D9W A;  4CDO A;  3O76 A;  3UVT A;  1PX6 A;  5KOX A;  1H75 A;  2WRT A;  1Y25 A;  5H5R A;  2A2P A;  1TXX A;  4WF5 A;  4HI7 A;  5A4U A;  4WKW A;  1KNG A;  2H6Y A;  4K5S A;  3I9V 2;  1UA5 A;  2MZC A;  4ZB6 A;  1G7E A;  6GSS A;  1GTA A;  1V58 A;  4HJM A;  2K18 A;  1GWC A;  2XBI A;  2GQM A;  3TJG A;  1XZO A;  4BVY A;  4BVX A;  3EPT A;  1BYE A;  1Z6N A;  1EV9 A;  4QL7 A;  4IS0 A;  1M99 A;  1YKC A;  3GIX A;  1B9Y C;  3NOF A;  1MDJ A;  2LS5 A;  3GTU A;  5FWG A;  5DCG A;  2RII A;  1XVQ A;  1V57 A;  1T1V A;  1ZMA A;  4J57 E;  2C0E A;  2X49 A;  1W4V A;  3GH6 A;  4NPB A;  4PUR A;  4RI7 A;  3DWV A;  1ERU A;  1R7H A;  2LNS A;  2OA7 A;  2H0G A;  3IOS A;  2OE0 A;  3KM6 A;  4KDU A;  1XIY A;  1NSW A;  1GSU A;  5JWR B;  3A5I A;  3C1S A;  4YH2 A;  2OBI A;  2MYG A;  1BQ7 A;  2CT6 A;  4IP6 A;  4XS6 A;  1RW1 A;  2FNO A;  2LRC A;  4OMV A;  4LMW A;  4G0K A;  4KAE A;  1PRX A;  5CRD A;  2E0Q A;  2OE3 A;  1DBY A;  4MLY A;  3PGT A;  2JL4 A;  4MZW A;  1ACV A;  2DJK A;  4HZ2 A;  3QAW A;  5HR2 A;  1XCC A;  5ID2 A;  3M9K A;  1OYJ A;  2PER A;  1ML6 A;  1X5E A;  3IHG A;  3C7M A;  2YZH A;  1F9M A;  1QXH A;  1GH2 A;  4K8M A;  1TDI A;  4NAX A;  4POM A;  1X9W B;  1IYH A;  4A5P A;  3GSS A;  4MJE A;  4MF5 A;  3DIE A;  5E59 A;  4ZB9 A;  3ZYW A;  2DJ2 A;  2XBQ A;  2IIY A;  3U6V A;  3KXO A;  5B7C A;  1BJX A;  1EOG A;  4DSR A;  4ZB8 A;  1M2A A;  1ST9 A;  4I97 A;  2IL3 A;  3F8U A;  4TXO B;  3IBH A;  2VIM A;  4DSQ A;  2IFQ B;  3RDW A;  3ZIV A;  5D9T A;  2O89 A;  1KTE A;  2M46 A;  5G30 A;  4BL7 A;  1SJ6 A;  2REM A;  3ERF A;  1FO5 A;  3D21 A;  2YNX A;  3EC3 A;  3MSZ A;  5LCZ A;  3EUR A;  2VM2 A;  2FA4 A;  1LJR A;  4XHM A;  5DAK B;  3QAV A;  1EV4 A;  5D73 A;  3QAG A;  5HFI A;  1YEX A;  3MIX A;  3GX0 A;  6GST A;  3D5J A;  1TW9 A;  4AJ8 A;  2DMM A;  1GSQ A;  3UIW A;  4DSS A;  3GKK A;  5C04 A;  1NHY A;  4I5Q A;  2F51 A;  3RPP A;  4XTS A;  2LRN A;  3KD0 A;  1M2D A;  2LTK A;  4F2I A;  4Z2U A;  3RBT A;  3QPM A;  3W8S A;  4AGS A;  5HR0 A;  1PX7 A;  3IHQ A;  4XS4 B;  4DEJ A;  5AIX A;  3HDC A;  4Q5N A;  2GT5 A;  4NHW A;  4G9H A;  3TKP A;  2QA1 A;  3P7X A;  3CBU A;  2B7K A;  4MP4 A;  4YAV A;  3KTL A;  3LJR A;  2C0F A;  1XVW A;  3DRN A;  3WD6 A;  2IME A;  3ZFL A;  3FRC A;  3FYG A;  1B8X A;  3H93 A;  6GSX A;  2A4H A;  3WT2 A;  9GSS A;  3IK9 A;  3M3M A;  2AAW A;  2TIR A;  4J2F A;  2MMO A;  5H5S A;  4EIQ A;  5CRG A;  5F0G A;  2LUS A;  3GV1 A;  1AQV A;  1V98 A;  8GSS A;  1ILO A;  5DQY A;  1E6B A;  1SEN A;  3U5R E;  1K0C A;  1EP7 A;  1JHB A;  1XXU A;  3TJF A;  2DSA A;  5DJM A;  3G7Y A;  2PU9 C;  1Z7P A;  1DE1 A;  1BAY A;  5GSS A;  1MD3 A;  1F3A A;  1T8E B;  2N5F A;  3HD5 A;  4OCE A;  1ZYP A;  4GRF A;  1SKR B;  4K0N A;  5BRT A;  4O5R A;  3IC8 A;  2F3M A;  4TW5 A;  1ZCP A;  1YZX A;  3FZA A;  1M2B A;  4IQ1 A;  4F82 A;  3KMO A;  3FK8 A;  4EKZ A;  2VLV A;  1S3D A;  1MD4 A;  1JFU A;  1FVK A;  4KUN A;  1J0F A;  4EE0 A;  1GTB A;  2WUL A;  1PL2 A;  4LLR A;  1SL0 B;  2YPM A;  3FY7 A;  4HUA A;  2LNT A;  2R6K A;  2B1K A;  4TXV A;  1GNE A;  4TVE A;  2VLU A;  1ZGN A;  4OFM A;  5IMC A;  2AV4 A;  1VF2 A;  3IC4 A;  1GUL A;  1MEK A;  1T00 A;  1H4O A;  5EL8 A;  1KEB A;  3GKN A;  1XWC A;  5GAN D;  1ERT A;  1EZK A;  2QA2 A;  4D73 B;  2M80 A;  5ECQ B;  1WE0 A;  2CX3 A;  3L9V A;  2GQL A;  2PWJ A;  2YN1 A;  1EP8 A;  3C73 A;  2XPE A;  2YJH A;  2HNL A;  3M0F A;  1GUH A;  3TUE A;  3DYR A;  4I2T A;  1THO A;  4GLT A;  2HT9 A;  2FHE A;  4NMU A;  4FIW A;  4F0B A;  3UVH A;  3ZL5 A;  2VD1 A;  4G0I A;  3UL3 A;  2HRN A;  4ML6 A;  4OD7 A;  3WYW A;  3LFL A;  1HQO A;  4GQF A;  5ECO B;  1THX A;  2DJJ A;  2QGV A;  3FR6 A;  19GS A;  5GAP D;  1K0N A;  3KJY A;  16GS A;  2PBJ A;  2K9F A;  3EMX A;  3LOR A;  1ZYE A;  2WDU A;  4KB3 A;  1U3I A;  2EIR A;  1WIK A;  2GSR A;  2IMD A;  3F3R A;  1PN9 A;  2VD0 A;  1FVJ A;  3EIN A;  2FCH A;  5E4W A;  1FOH A;  3TKS A;  1AW9 A;  2N5B A;  2H74 A;  3H4K A;  5DBQ A;  4IJ3 A;  4LMV A;  3GL5 A;  2ZUP A;  5HFG A;  2OKA A;  3PR8 A;  1ABA A;  2GVP A;  3HVV A;  1WP0 A;  2PUK C;  5ECM B;  1URM A;  1HNB A;  2IMF A;  2VCW A;  5ELA A;  4MJA A;  1PKW A;  3W8J A;  2C0D A;  10GS A;  4E8H A;  4ISD A;  3F3Q A;  4G19 A;  4TR4 A;  5HQP A;  5INY A;  1Z3E A;  3P2A A;  4QL9 A;  1UC7 A;  5D8I A;  2K8V A;  2R4V A;  4HS1 A;  1YEP A;  2CVK A;  3ZFB A;  3GMF A;  3FEU A;  1GSY A;  1G6W A;  2FWF A;  2DJ3 A;  1IYI A;  2H71 A;  4KE3 A;  1ZYN A;  4K0G A;  3LSZ A;  2H66 A;  1ZOF A;  4GTU A;  3CYN A;  2WS2 A;  2YJ7 A;  4ECC A;  4NV2 A;  2AUV A;  1GP1 A;  4TN8 A;  1ZZY A;  2PMT A;  4BA7 A;  3J7Y k;  2GDR A;  3C71 A;  4V1A p;  4BVY B;  2Z9S A;  4BVX B;  3IE3 A;  2GZP A;  3BJ5 A;  1TJD A;  3QFB C;  3HY2 A;  3EYT A;  4ZBB A;  4KSO A;  4K9Z A;  3LYP A;  2GT6 A;  2VUP A;  5AIS A;  5ABR A;  3APQ A;  5ECR B;  4ECJ A;  3QR6 A;  4JR4 A;  4HSC X;  1TRV A;  4K7O A;  2L5L A;  1VF4 A;  3R2Q A;  1AIU A;  2HSM A;  1A8Y A;  2C3Q A;  4CHS A;  4MJC A;  2YCD A;  2FWE A;  5FT3 A;  4IN0 A;  3FHK A;  5L71 A;  3TOU A;  1BED A;  1G0T A;  4PNF A;  4BPY A;  4AJ7 A;  5AGY A;  2V2G A;  4K7N A;  3VWW A;  4POL A;  4MPG A;  2MMN A;  2R3X A;  1HD2 A;  2DKH A;  4KGI A;  2E2G A;  1MDK A;  1T4Y A;  17GS A;  1XW5 A;  2PVQ A;  2R5G A;  1W89 A;  3D0Z A;  2B5E A;  2CQ9 A;  4X1U A;  1WOU A;  1F37 A;  5ECS A;  1R5A A;  1OKD A;  5ID2 B;  2B7J A;  5A4W A;  3DGQ A;  3D6I A;  1FHE A;  2CAQ A;  1S3R A;  3MAK A;  2OJL A;  3GYK A;  2C4J A;  1NW2 A;  2B6M A;  2GGT A;  3F63 A;  4RQX A;  3FKF A;  2X99 A;  1S3C A;  5J5N A;  2NDO A;  3IDV A;  4ZL9 A;  7GSS A;  3UOM A;  4WR4 A;  2P5Q A;  2TRX A;  2O8V B;  2L4Q A;  3CQF A;  5DAL A;  1YJ6 A;  3M9J A;  3E9J B;  5IO0 A;  1AQX A;  2QKE A;  1V40 A;  4L0W A;  4F0C A;  3A5W A;  2O85 A;  3TKS E;  2L5O A;  5DVB A;  20GS A;  1EWX A;  3IPZ A;  2M72 A;  3CRU A;  3US3 A;  3MYD A;  5FHI A;  2IJY A;  1VGL A;  4MH3 A;  3TOT A;  3LGC A;  4MF7 A;  1TU7 A;  3CMI A;  4OWY A;  1QK8 A;  1I9D A;  2F8F A;  1U88 A;  2H01 A;  1Q4J A;  3D22 A;  5DQS A;  3A2V A;  2R0C A;  3S9F A;  1TK0 B;  2KOK A;  1FB0 A;  3LG6 A;  2KP2 A;  5IPG A;  1NHO A;  6GSW A;  4GCI A;  1RK4 A;  2DBC A;  4TR1 A;  3GKX A;  3VPQ A;  5EY6 A;  4XIH A;  2LJK A;  3P8W A;  1R4W A;  4JZQ A;  4MAB A;  2WJU A;  2L6C A;  4XS1 A;  1M7T A;  3IAS 2;  5BMU A;  1TU8 A;  2EIQ A;  4L0U A;  2HXK A;  4O92 A;  1MDI A;  4K2D A;  4POB A;  2PPT A;  5CRW A;  2HRK A;  3NZN A;  1X9S B;  1GTI A;  1A2L A;  4IJI A;  1WJK A;  4FYB A;  1R5P A;  5G5E A;  1O7U A;  3ZMK A;  4DSS B;  2ES7 A;  4MJB A;  1YKA A;  2WB9 A;  1YF1 A;  3G9B A;  5DCH A;  1GTU A;  3ZRE A;  2HZE A;  1NM3 A;  2MMA A;  6GSY A;  1XWG A;  2XHF A;  3KP9 A;  1UVZ A;  1EOH A;  3L0H A;  4XRD A;  2H75 A;  1M3J A;  2KLX A;  3ZTL A;  3HVN A;  2CVB A;  2I1U A;  2PGT A;  1DSB A;  1B9X C;  4N30 A;  2GLR A;  1K3Y A;  1EEJ A;  2VCV A;  2BTO T;  4ML1 A;  1JLW A;  1K0O A;  2DC5 A;  4PUF C;  2JSZ A;  5F06 A;  5KOW A;  2H6Z A;  4PXO A;  3A2W A;  3F0I A;  3I43 A;  4MZB A;  5G1K A;  5GST A;  2AHE A;  5ECP B;  2A2R A;  5IMV A;  3N9J A;  11GS A;  3F4S A;  1ERV A;  2AB6 A;  3TDG A;  3FR9 A;  2YOI A;  2G2Q A;  3ISO A;  1SKW B;  3H79 A;  1TP9 A;  2CZ3 A;  3PH9 A;  2X4A A;  5D93 A;  1MTC A;  2GZY A;  1O6J A;  3RPN A;  1GSF A;  4TR3 A;  2XC2 A;  4CW9 A;  4GXZ A;  4KF9 A; 
#chains in the Genus database with same CATH homology
 2VLT A;  1CQG A;  2C1Y A;  1SJI A;  3FMW A;  1GSE A;  1XBS A;  4I6X A;  2FUG 2;  5KN1 A;  2LJA A;  1XW9 A;  3F6D A;  3VI5 A;  4HOJ A;  4V1A g;  4MCU A;  2JU5 A;  1TRU A;  3VWU A;  1PKZ A;  18GS A;  2IWT A;  5CP1 A;  4PTS A;  5D9V A;  1U3A A;  4LL1 B;  1OC3 A;  2F9S A;  2P5R A;  5ECI B;  4G10 A;  5ECH B;  1ZYQ B;  3F4T A;  5CRH A;  2FD3 A;  2P31 A;  1E2Y A;  3VPT A;  3DML A;  5JWQ B;  4EXJ A;  3DVX A;  2VCZ A;  2H8L A;  3WT1 A;  1X5D A;  4O5Q A;  4PGT A;  1AUC A;  2MMZ A;  5A5K A;  3VLN A;  2GQK A;  2UZ8 A;  3L9S A;  5CO3 A;  1JZO A;  2DJ0 A;  2FWH A;  2VO4 A;  4AF2 A;  2VL3 A;  2TRC P;  1SU9 A;  3DXB A;  1TI1 A;  4TOP A;  1HNA A;  3KCM A;  3QCP A;  5F8B A;  2H70 A;  1R26 A;  2RM6 A;  2NVL A;  4XS4 A;  1X9M B;  5JCU A;  1FOV A;  3GUR A;  3I69 A;  4ID0 A;  3WGE A;  2VAF A;  4ZL8 A;  1OAZ A;  2R0P A;  2KUC A;  2DML A;  3G7I A;  2H19 A;  4KW6 A;  3IXR A;  3Q74 A;  5LNK e;  1ERW A;  3TB2 A;  3HVX A;  3GH9 A;  3CSI A;  5C00 A;  4KND A;  2CX4 A;  2RUE A;  5JWO B;  1USB A;  3C1R A;  4V2L A;  3GST A;  2ON5 A;  4NV5 A;  4JRR A;  2N5A A;  4HU7 A;  5F07 A;  4WET A;  2YWM A;  1KBN A;  1YY7 A;  4G0L A;  4IHU A;  4IGJ A;  2L6D A;  2LQO A;  4MF6 A;  3VI7 A;  1XWK A;  5IM9 A;  2YV9 A;  1T7P B;  4HJ2 A;  3TRQ A;  3CTF A;  4ECI A;  4EL1 A;  5KN3 A;  3A2X A;  1SK2 A;  5IMA A;  1SK0 A;  4TKY A;  3VK9 A;  1X0R A;  3E3E A;  4JR6 A;  5CNW A;  3V1W A;  1TRW A;  3BBY A;  1PSQ A;  5B6M A;  2GSQ A;  2PVO C;  4EDZ A;  1SD8 A;  1O8X A;  3L4N A;  2DLX A;  5H5Q A;  3CRT A;  3PIN A;  2HLS A;  3EU4 A;  1A2M A;  3UBK A;  5COH A;  5ENU A;  5F05 A;  1S3A A;  2BMX A;  2KP1 A;  3UAP A;  1EGO A;  1GLQ A;  2O7K A;  4MH2 A;  4IVF A;  4FH8 A;  3ZRD A;  3HJO A;  2FA8 A;  2OBK A;  1PQN A;  3RHB A;  5CAX A;  3QOU A;  3GUS A;  3IAM 2;  3DEX A;  3J7Y b;  4YAP A;  3TKQ A;  3RHC A;  3PPU A;  2CV4 A;  4E8E A;  2WZ9 A;  3TKS C;  1EGR A;  2O87 A;  3Q18 A;  3MNG A;  3ZZX A;  2BJX A;  1GRX A;  4O7H A;  3HJM A;  3ZVJ A;  1SL1 B;  4WF4 A;  4EUY A;  2GS3 A;  4QQ7 A;  4Q5F A;  4YKF A;  4HEA 2;  3UEM A;  13GS A;  2JZR A;  1SD9 A;  1AXD A;  4WR5 A;  4JU5 A;  1K3L A;  1K0D A;  1DUG A;  1G7O A;  3TJK A;  4PX1 A;  5D96 A;  2VL2 C;  5KEJ A;  5EPF A;  2X8H A;  3DVW A;  1PD2 1;  3VWX A;  2I9H A;  2LEG A;  3BCI A;  2LJR A;  2X64 A;  2JAC A;  3ZVJ D;  1GUM A;  2GST A;  4L8E A;  3TJB A;  4N0Z A;  1O85 A;  2YWI A;  3LYK A;  1QQ2 A;  1XW6 A;  4OCF A;  2LRT A;  3GTU B;  4POK A;  3VUR A;  3WGD A;  1YQ1 A;  2IMI A;  2JZT A;  1SK1 A;  1GSD A;  3UMA A;  3SWL A;  4X4J A;  1SJZ A;  1GL8 A;  3MWH A;  1RQM A;  4L5O A;  3UBL A;  1EEM A;  4HDE A;  12GS A;  3BD2 A;  1XFL A;  3F4R A;  2VCQ A;  4TRX A;  4I2U A;  1PMT A;  3IRA A;  4XCS A;  3F9U A;  3TGZ A;  2ALB A;  3UAR A;  2DIY A;  2H6X A;  1B4P A;  2LKU A;  4FO5 A;  5DAL B;  3C8E A;  4JBB A;  3HXS A;  4WBR D;  3EE2 A;  1K0M A;  4CY6 A;  2V41 A;  3H8Q A;  2A2S A;  2I3Y A;  1XWA A;  1OC9 A;  4YKG A;  2CAI A;  2I4A A;  3LW9 A;  2HSH A;  6GSV A;  5IOW A;  2HZF A;  3KMN A;  1K0B A;  4ECB A;  1OC8 A;  1WMJ A;  2LQQ A;  3DD3 A;  2VM1 A;  3GN3 A;  4HQZ A;  4KCA A;  2F8A A;  2OAD A;  3L9U A;  4NHZ A;  4HU9 A;  4N10 A;  4PUA A;  5HR3 A;  5JCW A;  3CTG A;  4O5U A;  1WWJ A;  2OAC A;  3IR4 A;  1M9B A;  4Z2T A;  1ON4 A;  4TR1 B;  5LD0 A;  1FG4 A;  2FWG A;  3EMP A;  3N5O A;  2MBT A;  1Z5Y E;  3APO A;  3GRX A;  3HYP A;  2YWO A;  3E0U A;  1YF0 A;  3SBC A;  1XOB A;  3EWL A;  2KHP A;  5IPH A;  2E7P A;  1PN0 A;  2IPA A;  3TRP A;  1VF1 A;  2YZU A;  4OFT A;  2B5X A;  1A24 A;  4Q5R A;  3KH7 A;  5ECK B;  1M0U A;  3HZ8 A;  3TJJ A;  2K6V A;  4G2E A;  5J9C A;  4PNG A;  1QFN A;  2HZE B;  3F6F A;  4IBP A;  1N2A A;  2QC7 A;  5J41 A;  2H1D A;  4BL7 B;  2JAD A;  3ERW A;  1QMV A;  3BCK A;  3HZ4 A;  14GS A;  2L59 A;  3HHV A;  5B8A A;  2H0I A;  5HFK A;  3KEB A;  4KH7 A;  1ZL9 A;  3CXG A;  4KA0 A;  3VFI A;  2B5Y A;  3GNJ A;  2B1L A;  2H73 A;  4TR0 A;  4CY8 A;  4USS A;  1X5C A;  4GF0 A;  1O81 A;  2C8U A;  3TRX A;  4GST A;  3GFK A;  3R3E A;  5EVO A;  3KH9 A;  4AJ6 A;  5KN2 A;  3LXZ A;  1AC1 A;  3GX8 A;  4ULX A;  4H86 A;  4YQV A;  2L57 A;  2A4V A;  1SYX A;  2V6O A;  1LU4 A;  4IP1 A;  1G6Y A;  4ICY A;  5AN1 A;  4WBJ A;  1GUK A;  1TK5 B;  4GQC A;  3TKR A;  1AQW A;  3GA4 A;  1TKD B;  2V6K A;  5HR1 A;  3HVS A;  2X8G A;  3RAZ A;  2AJQ B;  5J3R A;  5IIZ A;  3M1G A;  4KSM A;  5J9B A;  4V2M A;  4EIP A;  3L78 A;  2CA8 A;  3AY8 A;  3CSH A;  4YQM A;  3HCZ A;  4ZXG A;  2HRA A;  2VOC A;  4LA1 A;  3APS A;  3KIJ A;  4JE1 A;  3G7J A;  4WXT A;  4BWQ A;  2D2Z A;  1C72 A;  4JED A;  2C3T A;  1CQH A;  5A4V A;  3FZ5 A;  3LEF A;  4EDY A;  2GTU A;  1V9W A;  4TXO A;  2V1M A;  1J08 A;  1JZD A;  5IO2 A;  3KTB A;  4ZL7 A;  2IFQ A;  1Y6E A;  1K0A A;  2HSY A;  1HNC A;  2NBS A;  4OO4 A;  1A2J A;  1FW1 A;  1QGV A;  3JCM L;  4K6X A;  2VCX A;  3KZQ A;  5ECL B;  2E2M A;  2HFD A;  2VL9 A;  1SKS B;  5DDL A;  3ME7 A;  1GSS A;  2J23 A;  2JZS A;  4ZIL A;  2CVD A;  4EC0 A;  4Z7X A;  1DE2 A;  2EIO A;  2H76 A;  4ACS A;  1PL1 A;  5DAK A;  1WRY A;  4PQH A;  4LL4 B;  3CSJ A;  4NWY A;  3DKS A;  5KN0 A;  5D9X A;  2NTO A;  3QD9 A;  4XRA A;  3TCO A;  2X8C A;  5ECN B;  4BWS A;  1Z7R A;  5IMD A;  3FZ9 A;  2WCI A;  1M9A A;  1Z6M A;  3OR5 A;  4IKH A;  3ZML A;  4L5L A;  5J4U A;  4PQI A;  2HYX A;  2B3S A;  1WPI A;  2RLI A;  3ED3 A;  4ILF A;  2G0F A;  2PN8 A;  3ZIT A;  1T3B A;  4N0V A;  3O6T A;  4K2X A;  4FYU A;  3GL3 A;  5IQY A;  2ZNM A;  1A8L A;  1OE7 A;  3KGK A;  2XPD A;  3HA9 A;  4MNN A;  3HKR A;  2H1A A;  4X0X A;  1TRS A;  3H1N A;  5GZZ B;  1GLP A;  1TI3 A;  1I5G A;  5B6N A;  4IEL A;  4MDC A;  2FGX A;  3LXT A;  2VCT A;  1SYR A;  1F3B A;  5B8B A;  3D4M A;  3M8N A;  1N8J A;  4Q5Q A;  1V2A A;  2DJ1 A;  2DKI A;  3IV4 A;  3WGX A;  4KDX A;  1FAA A;  1A23 A;  3LQ7 A;  3ZIJ A;  3W6G A;  1A0F A;  1F2E A;  2R37 A;  2ZCT A;  4MPF A;  1B48 A;  2H30 A;  4F9Z A;  1GNW A;  1U87 A;  2HE3 A;  4MMM A;  5IMF A;  2J9H A;  4RI6 A;  1VF3 A;  1PGT A;  5AIV A;  2OE1 A;  4N11 A;  3ME8 A;  5G1L A;  4MZC A;  5IOX A;  2GZZ A;  6GSU A;  5IMZ A;  5CRE A;  1O73 A;  3I6A A;  4WEY A;  1YDK A;  1OKT A;  2IMK A;  1TOF A;  1QUW A;  2DIZ A;  2GSS A;  2JSY A;  1JZR A;  2YWN A;  3UJ1 A;  3KP8 A;  3BOA A;  4OO5 A;  1JLV A;  1U6T A;  4I8B A;  3D4T A;  1J9B A;  2CZ2 A;  3GKM A;  4F03 A;  4IQA A;  2P0G A;  1T4Z A;  2YP6 A;  3Q6O A;  2V32 A;  2H0H A;  2H72 A;  2YAN A;  2C3N A;  2RUF A;  3EU3 A;  2NPB A;  4MK3 A;  5G5F A;  4EO3 A;  3FW2 A;  2H1B A;  1XPV A;  5ELG A;  1UN2 A;  1F6M C;  3QFA C;  4D73 A;  1TK8 B;  2LV3 A;  2RM5 A;  2L4C A;  3ZLP A;  4ZBD A;  2K8S A;  5DJL A;  3A3T A;  4ZBA A;  2ON7 A;  3K8N A;  2YV7 A;  4ZIJ A;  4EF0 A;  2QSI A;  4HZ4 A;  4RUV A;  3NIV A;  3QDN A;  3MDK A;  2I81 A;  3QMX A;  22GS A;  2WGR A;  1O8W A;  4KDY A;  3FR3 A;  3VWV A;  1XWB A;  1AAZ A;  4PQ1 A;  4J56 E;  4FQU A;  1K3O A;  3IA1 A;  4RQR A;  1OVN A;  4GSN A;  1VRS D;  4OFN A;  3P90 A;  4FYC A;  2FLS A;  3GHA A;  4V2N A;  2C0G A;  4GSS A;  2VL2 A;  4KX4 A;  1OE8 A;  4IW9 A;  1PA3 A;  3HJP A;  1BG5 A;  4Z2R A;  3Q19 A;  4YQU A;  1XOA A;  2C80 A;  3O3T A;  4O32 A;  2R0G A;  1BX9 A;  1OC9 B;  1A0R P;  5G31 A;  1FB6 A;  4X43 A;  3FZ4 A;  2FY6 A;  2HRF A;  4KCE A;  1Z9H A;  2R2J A;  5G2Z A;  1JZW A;  2H1G A;  1LBK A;  4K7I A;  3ERG A;  5JCG A;  4K5R A;  4DVC A;  2EC4 A;  3EVI A;  1TTZ A;  5CYY A;  2HI7 A;  2MBS A;  4EVM A;  1HYU A;  4P3Y B;  4GWR A;  1Q98 A;  4K1F A;  4NXI A;  3LWA A;  1B4Q A;  2IN3 A;  4HQS A;  3IK7 A;  2WFC A;  2LST A;  2AYT A;  1SL2 B;  4MA9 A;  5D9W A;  4CDO A;  3O76 A;  3UVT A;  1PX6 A;  5KOX A;  1H75 A;  2WRT A;  1Y25 A;  5H5R A;  2A2P A;  1TXX A;  4WF5 A;  4HI7 A;  5A4U A;  4WKW A;  1KNG A;  2H6Y A;  4K5S A;  3I9V 2;  1UA5 A;  2MZC A;  4ZB6 A;  1G7E A;  6GSS A;  1GTA A;  1V58 A;  4HJM A;  2K18 A;  1GWC A;  2XBI A;  2GQM A;  3TJG A;  1XZO A;  4BVY A;  4BVX A;  3EPT A;  1BYE A;  1Z6N A;  1EV9 A;  4QL7 A;  4IS0 A;  1M99 A;  1YKC A;  3GIX A;  1B9Y C;  3NOF A;  1MDJ A;  2LS5 A;  3GTU A;  5FWG A;  5DCG A;  2RII A;  1XVQ A;  1V57 A;  1T1V A;  1ZMA A;  4J57 E;  2C0E A;  2X49 A;  1W4V A;  3GH6 A;  4NPB A;  4PUR A;  4RI7 A;  3DWV A;  1ERU A;  1R7H A;  2LNS A;  2OA7 A;  2H0G A;  3IOS A;  2OE0 A;  3KM6 A;  4KDU A;  1XIY A;  1NSW A;  1GSU A;  5JWR B;  3A5I A;  3C1S A;  4YH2 A;  2OBI A;  2MYG A;  1BQ7 A;  2CT6 A;  4IP6 A;  4XS6 A;  1RW1 A;  2FNO A;  2LRC A;  4OMV A;  4LMW A;  4G0K A;  4KAE A;  1PRX A;  5CRD A;  2E0Q A;  2OE3 A;  1DBY A;  4MLY A;  3PGT A;  2JL4 A;  4MZW A;  1ACV A;  2DJK A;  4HZ2 A;  3QAW A;  5HR2 A;  1XCC A;  5ID2 A;  3M9K A;  1OYJ A;  2PER A;  1ML6 A;  1X5E A;  3IHG A;  3C7M A;  2YZH A;  1F9M A;  1QXH A;  1GH2 A;  4K8M A;  1TDI A;  4NAX A;  4POM A;  1X9W B;  1IYH A;  4A5P A;  3GSS A;  4MJE A;  4MF5 A;  3DIE A;  5E59 A;  4ZB9 A;  3ZYW A;  2DJ2 A;  2XBQ A;  2IIY A;  3U6V A;  3KXO A;  5B7C A;  1BJX A;  1EOG A;  4DSR A;  4ZB8 A;  1M2A A;  1ST9 A;  4I97 A;  2IL3 A;  3F8U A;  4TXO B;  3IBH A;  2VIM A;  4DSQ A;  2IFQ B;  3RDW A;  3ZIV A;  5D9T A;  2O89 A;  1KTE A;  2M46 A;  5G30 A;  4BL7 A;  1SJ6 A;  2REM A;  3ERF A;  1FO5 A;  3D21 A;  2YNX A;  3EC3 A;  3MSZ A;  5LCZ A;  3EUR A;  2VM2 A;  2FA4 A;  1LJR A;  4XHM A;  5DAK B;  3QAV A;  1EV4 A;  5D73 A;  3QAG A;  5HFI A;  1YEX A;  3MIX A;  3GX0 A;  6GST A;  3D5J A;  1TW9 A;  4AJ8 A;  2DMM A;  1GSQ A;  3UIW A;  4DSS A;  3GKK A;  5C04 A;  1NHY A;  4I5Q A;  2F51 A;  3RPP A;  4XTS A;  2LRN A;  3KD0 A;  1M2D A;  2LTK A;  4F2I A;  4Z2U A;  3RBT A;  3QPM A;  3W8S A;  4AGS A;  5HR0 A;  1PX7 A;  3IHQ A;  4XS4 B;  4DEJ A;  5AIX A;  3HDC A;  4Q5N A;  2GT5 A;  4NHW A;  4G9H A;  3TKP A;  2QA1 A;  3P7X A;  3CBU A;  2B7K A;  4MP4 A;  4YAV A;  3KTL A;  3LJR A;  2C0F A;  1XVW A;  3DRN A;  3WD6 A;  2IME A;  3ZFL A;  3FRC A;  3FYG A;  1B8X A;  3H93 A;  6GSX A;  2A4H A;  3WT2 A;  9GSS A;  3IK9 A;  3M3M A;  2AAW A;  2TIR A;  4J2F A;  2MMO A;  5H5S A;  4EIQ A;  5CRG A;  5F0G A;  2LUS A;  3GV1 A;  1AQV A;  1V98 A;  8GSS A;  1ILO A;  5DQY A;  1E6B A;  1SEN A;  3U5R E;  1K0C A;  1EP7 A;  1JHB A;  1XXU A;  3TJF A;  2DSA A;  5DJM A;  3G7Y A;  2PU9 C;  1Z7P A;  1DE1 A;  1BAY A;  5GSS A;  1MD3 A;  1F3A A;  1T8E B;  2N5F A;  3HD5 A;  4OCE A;  1ZYP A;  4GRF A;  1SKR B;  4K0N A;  5BRT A;  4O5R A;  3IC8 A;  2F3M A;  4TW5 A;  1ZCP A;  1YZX A;  3FZA A;  1M2B A;  4IQ1 A;  4F82 A;  3KMO A;  3FK8 A;  4EKZ A;  2VLV A;  1S3D A;  1MD4 A;  1JFU A;  1FVK A;  4KUN A;  1J0F A;  4EE0 A;  1GTB A;  2WUL A;  1PL2 A;  4LLR A;  1SL0 B;  2YPM A;  3FY7 A;  4HUA A;  2LNT A;  2R6K A;  2B1K A;  4TXV A;  1GNE A;  4TVE A;  2VLU A;  1ZGN A;  4OFM A;  5IMC A;  2AV4 A;  1VF2 A;  3IC4 A;  1GUL A;  1MEK A;  1T00 A;  1H4O A;  5EL8 A;  1KEB A;  3GKN A;  1XWC A;  5GAN D;  1ERT A;  1EZK A;  2QA2 A;  4D73 B;  2M80 A;  5ECQ B;  1WE0 A;  2CX3 A;  3L9V A;  2GQL A;  2PWJ A;  2YN1 A;  1EP8 A;  3C73 A;  2XPE A;  2YJH A;  2HNL A;  3M0F A;  1GUH A;  3TUE A;  3DYR A;  4I2T A;  1THO A;  4GLT A;  2HT9 A;  2FHE A;  4NMU A;  4FIW A;  4F0B A;  3UVH A;  3ZL5 A;  2VD1 A;  4G0I A;  3UL3 A;  2HRN A;  4ML6 A;  4OD7 A;  3WYW A;  3LFL A;  1HQO A;  4GQF A;  5ECO B;  1THX A;  2DJJ A;  2QGV A;  3FR6 A;  19GS A;  5GAP D;  1K0N A;  3KJY A;  16GS A;  2PBJ A;  2K9F A;  3EMX A;  3LOR A;  1ZYE A;  2WDU A;  4KB3 A;  1U3I A;  2EIR A;  1WIK A;  2GSR A;  2IMD A;  3F3R A;  1PN9 A;  2VD0 A;  1FVJ A;  3EIN A;  2FCH A;  5E4W A;  1FOH A;  3TKS A;  1AW9 A;  2N5B A;  2H74 A;  3H4K A;  5DBQ A;  4IJ3 A;  4LMV A;  3GL5 A;  2ZUP A;  5HFG A;  2OKA A;  3PR8 A;  1ABA A;  2GVP A;  3HVV A;  1WP0 A;  2PUK C;  5ECM B;  1URM A;  1HNB A;  2IMF A;  2VCW A;  5ELA A;  4MJA A;  1PKW A;  3W8J A;  2C0D A;  10GS A;  4E8H A;  4ISD A;  3F3Q A;  4G19 A;  4TR4 A;  5HQP A;  5INY A;  1Z3E A;  3P2A A;  4QL9 A;  1UC7 A;  5D8I A;  2K8V A;  2R4V A;  4HS1 A;  1YEP A;  2CVK A;  3ZFB A;  3GMF A;  3FEU A;  1GSY A;  1G6W A;  2FWF A;  2DJ3 A;  1IYI A;  2H71 A;  4KE3 A;  1ZYN A;  4K0G A;  3LSZ A;  2H66 A;  1ZOF A;  4GTU A;  3CYN A;  2WS2 A;  2YJ7 A;  4ECC A;  4NV2 A;  2AUV A;  1GP1 A;  4TN8 A;  1ZZY A;  2PMT A;  4BA7 A;  3J7Y k;  2GDR A;  3C71 A;  4V1A p;  4BVY B;  2Z9S A;  4BVX B;  3IE3 A;  2GZP A;  3BJ5 A;  1TJD A;  3QFB C;  3HY2 A;  3EYT A;  4ZBB A;  4KSO A;  4K9Z A;  3LYP A;  2GT6 A;  2VUP A;  5AIS A;  5ABR A;  3APQ A;  5ECR B;  4ECJ A;  3QR6 A;  4JR4 A;  1TRV A;  4K7O A;  2L5L A;  1VF4 A;  3R2Q A;  1AIU A;  2HSM A;  1A8Y A;  2C3Q A;  4CHS A;  4MJC A;  2YCD A;  2FWE A;  5FT3 A;  4IN0 A;  3FHK A;  5L71 A;  3TOU A;  1BED A;  1G0T A;  4PNF A;  4BPY A;  4AJ7 A;  5AGY A;  2V2G A;  4K7N A;  3VWW A;  4POL A;  4MPG A;  2MMN A;  2R3X A;  1HD2 A;  2DKH A;  4KGI A;  2E2G A;  1MDK A;  1T4Y A;  17GS A;  1XW5 A;  2PVQ A;  2R5G A;  1W89 A;  3D0Z A;  2B5E A;  2CQ9 A;  4X1U A;  1WOU A;  1F37 A;  5ECS A;  1R5A A;  1OKD A;  5ID2 B;  2B7J A;  5A4W A;  3DGQ A;  3D6I A;  1FHE A;  2CAQ A;  3MAK A;  2OJL A;  3GYK A;  2C4J A;  1NW2 A;  2B6M A;  2GGT A;  3F63 A;  4RQX A;  3FKF A;  2X99 A;  1S3C A;  5J5N A;  2NDO A;  3IDV A;  4ZL9 A;  7GSS A;  3UOM A;  4WR4 A;  2P5Q A;  2TRX A;  2O8V B;  2L4Q A;  5DAL A;  1YJ6 A;  3M9J A;  3E9J B;  5IO0 A;  1AQX A;  2QKE A;  1V40 A;  4L0W A;  4F0C A;  3A5W A;  2O85 A;  3TKS E;  2L5O A;  5DVB A;  20GS A;  1EWX A;  3IPZ A;  2M72 A;  3CRU A;  3US3 A;  3MYD A;  5FHI A;  2IJY A;  1VGL A;  4MH3 A;  3TOT A;  3LGC A;  4MF7 A;  1TU7 A;  3CMI A;  4OWY A;  1QK8 A;  1I9D A;  2F8F A;  1U88 A;  2H01 A;  1Q4J A;  3D22 A;  5DQS A;  3A2V A;  2R0C A;  3S9F A;  1TK0 B;  2KOK A;  1FB0 A;  3LG6 A;  2KP2 A;  5IPG A;  1NHO A;  6GSW A;  4GCI A;  1RK4 A;  2DBC A;  4TR1 A;  3GKX A;  3VPQ A;  5EY6 A;  4XIH A;  2LJK A;  3P8W A;  1R4W A;  4JZQ A;  4MAB A;  2WJU A;  2L6C A;  4XS1 A;  1M7T A;  3IAS 2;  5BMU A;  1TU8 A;  2EIQ A;  4L0U A;  2HXK A;  4O92 A;  1MDI A;  4K2D A;  4POB A;  2PPT A;  5CRW A;  2HRK A;  3NZN A;  1X9S B;  1GTI A;  1A2L A;  4IJI A;  1WJK A;  4FYB A;  1R5P A;  5G5E A;  1O7U A;  3ZMK A;  4DSS B;  2ES7 A;  4MJB A;  1YKA A;  2WB9 A;  1YF1 A;  3G9B A;  5DCH A;  1GTU A;  3ZRE A;  2HZE A;  1NM3 A;  2MMA A;  6GSY A;  1XWG A;  2XHF A;  3KP9 A;  1UVZ A;  1EOH A;  3L0H A;  4XRD A;  2H75 A;  2KLX A;  3ZTL A;  2CVB A;  2I1U A;  2PGT A;  1DSB A;  1B9X C;  4N30 A;  2GLR A;  1K3Y A;  1EEJ A;  2VCV A;  2BTO T;  4ML1 A;  1JLW A;  1K0O A;  2DC5 A;  4PUF C;  2JSZ A;  5F06 A;  5KOW A;  2H6Z A;  4PXO A;  3A2W A;  3F0I A;  3I43 A;  4MZB A;  5G1K A;  5GST A;  2AHE A;  5ECP B;  2A2R A;  5IMV A;  3N9J A;  11GS A;  3F4S A;  1ERV A;  2AB6 A;  3TDG A;  3FR9 A;  2YOI A;  2G2Q A;  3ISO A;  1SKW B;  3H79 A;  1TP9 A;  2CZ3 A;  3PH9 A;  2X4A A;  5D93 A;  1MTC A;  2GZY A;  1O6J A;  3RPN A;  1GSF A;  4TR3 A;  2XC2 A;  4CW9 A;  4GXZ A;  4KF9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...