3GHAA

Crystal structure of etda-treated bdbd (reduced)
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
186
structure length
186
Chain Sequence
NDAVSGQPSIKGQPVLGKDDAPVTVVEFGDYKCPSCKVFNSDIFPKIQKDFIDKGDVKFSFVNVMFHGKGSRLAALASEEVWKEDPDSFWDFHEKLFEKQPDTEQEWVTPGLLGDLAKSTTKIKPETLKENLDKETFASQVEKDSDLNQKMNIQATPTIYVNDKVIKNFADYDEIKETIEKELKGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Disulfide bond formation protein D
publication title Crystal Structure and Biophysical Properties of Bacillus subtilis BdbD: AN OXIDIZING THIOL:DISULFIDE OXIDOREDUCTASE CONTAINING A NOVEL METAL SITE
pubmed doi rcsb
source organism Bacillus subtilis
total genus 73
structure length 186
sequence length 186
ec nomenclature
pdb deposition date 2009-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13462 Thioredoxin_4 Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3ghaA00
2C3QA 3HJMA 4MP4A 1A8LA 5H5SA 5ENUA 2ZUPA 2XBQA 3QD9A 2FGXA 6GSSA 1ABAA 4WBRD 2VCQA 1VGLA 2D2ZA 2FY6A 5ECHB 4ECJA 4EDZA 5FT3A 2OE3A 2E2GA 4IW9A 1YKAA 1PRXA 1MD4A 3BOAA 2YV7A 5CRGA 3RPPA 2V41A 4TR0A 1SYRA 2YWMA 3WGXA 5IM9A 3D0ZA 1VF3A 1H4OA 1O6JA 2LQOA 5JWRB 1NSWA 2H75A 2HLSA 9GSSA 2CVBA 2KUCA 2H6XA 2H71A 1AQVA 3EMPA 5FWGA 2IN3A 3QDNA 1FO5A 1R26A 5B7CA 3ED3A 3G7IA 5CP1A 1PKZA 2YP6A 1ML6A 3IDVA 1TK8B 1EV9A 2V2GA 2ES7A 3H1NA 4WR4A 1OKTA 4XS1A 2XPDA 2N5AA 1UN2A 2IJYA 1B48A 4ZBDA 4RUVA 1FG4A 4TVEA 3A2WA 2C1YA 4KUNA 2KP1A 2AB6A 3GKNA 4XTSA 2E7PA 1K0BA 3MAKA 1SL1B 3ZITA 5A4WA 1PX6A 2DJ3A 3KMNA 4DVCA 3DGQA 3GX8A 4PNGA 3ERGA 2YJ7A 1GH2A 5G5EA 2F8AA 1EEMA 4IP6A 3FR9A 4JBBA 1O7UA 2P0GA 4GRFA 4LMWA 4YQMA 4MH2A 3N5OA 2CAQA 5DALA 3D6IA 2ON5A 2K8VA 2H0IA 4MK3A 5ID2B 4ZB9A 3TJBA 1FVKA 4V1Ap 1R7HA 4OCEA 1X0RA 4TW5A 1FVJA 1WPIA 3UAPA 3LGCA 1X9WB 1EOGA 3ME8A 2GZPA 2VL2A 2IFQA 3LXTA 4PQ1A 1T8EB 4IJIA 2IMIA 5KN3A 3TJJA 3M9KA 5B8AA 1G6WA 2OE1A 4WEYA 1VF2A 2L4CA 3F3RA 3TOTA 4WF5A 5D9TA 3L4NA 5GSSA 4GWRA 1B4QA 2AJQB 1YF0A 5ECIB 3FEUA 1A0FA 2YCDA 4IELA 3VPTA 1AQXA 2YWIA 1K0AA 3DVWA 2VLTA 1M99A 3ZIJA 4ECCA 3Q18A 2BJXA 4BA7A 2YWNA 4MZWA 5D9VA 2CZ3A 1MEKA 5COHA 2I3YA 1THOA 2MBSA 1R4WA 4POLA 3CTGA 1GSSA 1YEXA 2HT9A 4JEDA 4MA9A 2IMEA 3ZRDA 4O5RA 1HNCA 14GSA 2A4VA 3VWXA 1PL1A 5B8BA 1Z6NA 1TP9A 4Q5NA 2VD0A 3IE3A 3TJFA 3KP9A 2C3TA 3IPZA 3VWVA 1BX9A 2WGRA 1YJ6A 3C73A 3GSSA 3ZIVA 1HD2A 2E2MA 4D73B 1WMJA 1TJDA 1TU8A 2O8VB 3GYKA 2O89A 3UVTA 3PH9A 3VI5A 1SKSB 3IXRA 2HZEA 11GSA 2H0GA 18GSA 1Z9HA 1FB0A 2GTUA 4DSSA 2CX4A 3O6TA 1THXA 1GTBA 3VLNA 4NPBA 6GSTA 1RQMA 2LRCA 5KEJA 4MABA 2CVKA 6GSUA 4TXVA 3TKSC 3CRTA 4FO5A 4POKA 4IHUA 4MPGA 12GSA 1TKDB 1I5GA 2H1DA 2KP2A 3G7JA 4IN0A 2L5LA 5HR0A 3A3TA 4GLTA 2OKAA 2VL9A 2P5RA 22GSA 3F8UA 4NHWA 2AHEA 1TW9A 2CZ2A 2C8UA 3IHQA 3WD6A 3CXGA 3MWHA 2QKEA 4HU7A 3CSHA 1ZYQB 3LYPA 4K6XA 1V98A 1EGOA 1ACVA 3ZMKA 4QL9A 2EC4A 4BWSA 3LWAA 5HR2A 1YF1A 3FZ4A 3WGEA 3KTBA 3KJYA 5ECQB 2B7JA 2WS2A 1GSFA 3HJOA 1XPVA 4I2TA 1X5DA 1QXHA 1M2BA 3QR6A 2GSQA 4KSOA 2LSTA 2JSZA 2PUKC 2CQ9A 4GSNA 3GX0A 2AAWA 2M46A 3RHCA 2OACA 2GSSA 4MZBA 2H19A 2MYGA 2N5FA 4LL1B 4L5OA 1K0NA 2B1LA 5DALB 5ECRB 2MMZA 4MLYA 5DAKA 6GSVA 3GKMA 3UIWA 2J9HA 3US3A 2F3MA 5ELAA 1PKWA 1T1VA 2GT6A 2VCTA 2C4JA 2EIQA 2WZ9A 1TK5B 5JCUA 2PVOC 2XBIA 4FYCA 5IMCA 3UL3A 3KEBA 1M9BA 3F6FA 5IMVA 1NHYA 2IFQB 4TKYA 5ECKB 4DSQA 1UA5A 1O8WA 1F9MA 1N8JA 2HYXA 3WYWA 5HFKA 1XWCA 2H66A 4WR5A 2YWOA 3J7Yk 5J3RA 3CYNA 1FB6A 4TOPA 2H6ZA 2J23A 2VM2A 3E3EA 1B9XC 2RM6A 1JZWA 1PX7A 2H1GA 5D73A 1WWJA 2VCVA 1AW9A 1HQOA 1C72A 3ZFLA 3LORA 2NPBA 2L59A 4GTUA 1UVZA 4KH7A 3FW2A 1Q4JA 2G2QA 3IAS2 1DSBA 3TGZA 1XW9A 3TJGA 4N30A 1A8YA 4HI7A 3HHVA 1PQNA 1IYHA 2OBKA 4WKWA 5DJLA 3L9VA 4ECBA 2MMAA 5IOWA 5KN2A 2GQMA 4K2DA 1AAZA 1WOUA 1XXUA 5L71A 3FR6A 3TKRA 2VAFA 2PMTA 2O85A 1R5PA 1T7PB 5G31A 2R3XA 4I97A 2Z9SA 3FY7A 2AUVA 3F9UA 4HQSA 5CRHA 1S3AA 4G9HA 2HZEB 3D4TA 2H72A 3KMOA 3RPNA 4ULXA 4WETA 4DSSB 3EU3A 1SKRB 5J41A 5G1KA 1XVQA 3TDGA 3IR4A 1SENA 3GSTA 1YQ1A 4ZB6A 4K0NA 2DC5A 3D4MA 2HXKA 4IP1A 3GMFA 4ILFA 1WJKA 3L0HA 1TTZA 1JLWA 2VO4A 1BEDA 4O7HA 1PMTA 3F4SA 1GNWA 3HVVA 5A4VA 2GLRA 4L5LA 4X43A 4X1UA 20GSA 3SWLA 4K8MA 3GFKA 7GSSA 4I6XA 4ZB8A 3DWVA 1SK2A 1SD9A 2L57A 5DQSA 5LNKe 4JR6A 2LQQA 2LUSA 2YOIA 3BJ5A 2WCIA 2IMFA 5EY6A 2X8GA 4MZCA 1NW2A 5HR1A 2DJ2A 4JE1A 10GSA 4PQHA 2OJLA 2VUPA 3VFIA 4KCEA 2VD1A 2B1KA 2A2RA 3PINA 4ZBAA 4F2IA 4XRAA 3J7Yb 2XC2A 3GKXA 4ZL9A 1K0MA 3C8EA 3ZL5A 4MF6A 1OC8A 5ECLB 3A2XA 4XCSA 1YKCA 5INYA 3ZMLA 1N2AA 2LJAA 2MMOA 3LG6A 4OFMA 1XIYA 2LS5A 3W8JA 1DE2A 1X9SB 2DJJA 13GSA 2XHFA 4KDUA 3GL5A 5DAKB 3FK8A 3GRXA 4YQUA 2C3NA 1AC1A 1ON4A 1PGTA 5F07A 3N9JA 5J5NA 1X9MB 3H79A 1ZZYA 3IK7A 3HD5A 1XFLA 3CMIA 1B8XA 2FWEA 3ZFBA 3DIEA 4CDOA 2GGTA 4IKHA 4HUAA 4JU5A 1TRUA 3GV1A 3DYRA 2KOKA 4E8HA 4YAPA 3WGDA 2V1MA 4IQ1A 2LEGA 4WBJA 1QFNA 1G0TA 5JCGA 4K7NA 3WT1A 3LEFA 4POMA 3A2VA 2FA4A 4F9ZA 16GSA 4DEJA 2B3SA 2E0QA 1EP8A 3HVSA 4G10A 1XWKA 2CA8A 2QSIA 3QAVA 4PUAA 1Y6EA 4ML6A 2VIMA 2H0HA 2H1BA 3GKKA 3TKPA 3ZZXA 4F0BA 2HE3A 3TKSE 1GL8A 1LBKA 4F0CA 3NZNA 1FOVA 1ERWA 2QC7A 4PXOA 4XRDA 4NV5A 1XWGA 3GHAA 2HRNA 3GN3A 5JWQB 3L78A 3U5RE 1F3BA 4J2FA 4K0GA 3GTUA 1SL0B 4BPYA 2PGTA 3TJKA 2F9SA 1BJXA 1A2JA 2DIZA 2HFDA 2X8CA 4KDYA 4POBA 2R37A 3F0IA 1Q98A 3HXSA 4NV2A 2VLUA 4LL4B 2JU5A 1F6MC 4KB3A 4BL7A 5H5RA 2KLXA 4HOJA 4KNDA 4NAXA 5JCWA 2ZNMA 1SK0A 6GSXA 2TIRA 2X99A 4V2LA 1F37A 3L9UA 4YQVA 4MJCA 5HR3A 2H01A 1VRSD 3HA9A 4IQAA 4MDCA 5G1LA 1O8XA 1SJ6A 1O73A 5G2ZA 2GQKA 1AIUA 1E2YA 1U6TA 5ABRA 2YN1A 1A23A 1PD21 3TRQA 3UBKA 2GT5A 1E6BA 2H70A 3EINA 5LD0A 5D8IA 2NVLA 2FNOA 3ZVJD 1OE7A 3EC3A 4KCAA 4OWYA 1GSUA 2YNXA 4OMVA 2TRCP 5GSTA 4O32A 3HZ8A 3LJRA 4MJEA 3UVHA 2PN8A 4X0XA 1J9BA 4KX4A 1HNBA 1KTEA 1ZYEA 1FHEA 5IMFA 1LU4A 4YH2A 2DMMA 3GH9A 3C71A 1BQ7A 1EZKA 1V9WA 3Q74A 4GSTA 3IK9A 2LJKA 2I1UA 2JZSA 1TDIA 1ZMAA 1VF1A 3P8WA 1AQWA 2O87A 5ECMB 1W4VA 4MF7A 2YZHA 2LNTA 2FCHA 3M9JA 4GQFA 4PURA 1GSDA 4FH8A 2BMXA 4AJ8A 4O92A 2GQLA 3DVXA 1JFUA 3AY8A 5F0GA 5GAPD 4NHZA 5AISA 3CBUA 3HVXA 1S3CA 4IVFA 17GSA 2YPMA 2C80A 4MH3A 2GS3A 1EWXA 1UC7A 3DEXA 3D22A 1FW1A 1TRSA 3I69A 3RHBA 3MNGA 1K0OA 3UARA 1AXDA 1FAAA 4AJ7A 1GUKA 1RK4A 3PR8A 1SYXA 2PU9C 4I2UA 4TR4A 3CRUA 4HU9A 4AJ6A 1EP7A 3LXZA 1OE8A 3F6DA 4ZXGA 2I81A 2L6DA 2FHEA 2V32A 3LQ7A 4JR4A 4QL7A 4F82A 5IIZA 4PX1A 1EEJA 2WJUA 1GSEA 1DUGA 2WFCA 3RBTA 3H4KA 4KE3A 3O3TA 3Q6OA 5AGYA 2YJHA 3I43A 1GLQA 1XVWA 2FWGA 2G0FA 1NHOA 2JACA 2GSTA 1K0CA 1TU7A 4KDXA 3W8SA 3GL3A 1YEPA 3TKSA 2KHPA 4YAVA 4N0VA 2H73A 5ELGA 2A2SA 2VCXA 2DJ1A 2L6CA 4N10A 3H8QA 5G30A 4ZBBA 1Z6MA 1Z5YE 1PN9A 3FZAA 4ZILA 4FYUA 5J9BA 1B4PA 3NIVA 4K9ZA 3D5JA 4WXTA 2LRTA 4XS4B 1DE1A 3EVIA 2H30A 5IPGA 4TR1A 2DSAA 2ON7A 1TRWA 4GXZA 3KIJA 1HNAA 1EV4A 3EYTA 1TK0B 4LLRA 1QGVA 1G6YA 1M0UA 2WDUA 3GTUB 1MDJA 1XW6A 2H76A 3GH6A 4CW9A 3E9JB 1A2LA 3HCZA 5DQYA 1GSYA 1VF4A 4P3YB 4FYBA 3FRCA 1SJIA 3HYPA 3CTFA 1T4YA 4EE0A 1Y25A 3IOSA 4BVXA 3LSZA 4XS6A 5ECSA 2V6KA 3QMXA 3ZTLA 3M3MA 1GTUA 1KEBA 4KA0A 5IOXA 3MSZA 3GURA 1S3DA 1DBYA 2NBSA 2JADA 1OC3A 2H8LA 3TUEA 2B5YA 1MDKA 1MDIA 2R2JA 2AV4A 4EKZA 1GRXA 4ZIJA 3QFAC 1XZOA 4PGTA 4KAEA 2IL3A 2HRFA 4EUYA 3TRPA 3M8NA 2H1AA 3ERFA 4TRXA 1WRYA 4ML1A 1R5AA 5KN1A 1JZDA 2YV9A 4FIWA 1LJRA 4I5QA 5G5FA 4AGSA 1GTAA 3APSA 5IQYA 1GWCA 2P5QA 4RQRA 2R5GA 2EIRA 3KM6A 2PWJA 2FA8A 1U3IA 3U6VA 1U88A 1Z7PA 2OA7A 3QCPA 1GLPA 2IMKA 2L4QA 2K6VA 2GZYA 5D9WA 3VI7A 1MTCA 3C1RA 5E59A 2OE0A 2LRNA 2WB9A 4H86A 1JHBA 2CVDA 4NMUA 2MMNA 3FZ9A 1M2AA 1OC9A 1YY7A 4OO4A 4RI7A 5A4UA 1A2MA 5DDLA 1T00A 4N0ZA 5DCHA 2HSYA 1PSQA 4GCIA 5JWOB 3VWWA 5F06A 4ACSA 5LCZA 1X5CA 3KXOA 1EGRA 1IYIA 3KTLA 1XOAA 5IPHA 1SJZA 5D96A 5EPFA 3DKSA 3VURA 1QUWA 3EWLA 1YZXA 4G19A 1GULA 5GZZB 1SD8A 3UMAA 4ZL8A 2JZTA 3I6AA 4J57E 1ERUA 5C04A 3G7YA 1GSQA 2JL4A 4BVYA 1HYUA 2C0EA 2LKUA 2IPAA 1MD3A 1GP1A 3KP8A 4EO3A 4HZ2A 5D93A 1XCCA 5CO3A 1V57A 3F4RA 2B5XA 1XBSA 1JZRA 3IA1A 2PPTA 1G7OA 3WT2A 2DJKA 4OO5A 3IC4A 3P7XA 6GSYA 19GSA 4OFTA 2L5OA 1K3LA 2NDOA 2TRXA 3FYGA 5CREA 3GIXA 1M7TA 2EIOA 3F63A 3UOMA 3QFBC 4QQ7A 2B7KA 1QK8A 5DVBA 2MZCA 1NM3A 2N5BA 4MMMA 5KN0A 4OFNA 5AN1A 2GVPA 3VPQA 3ZREA 4GQCA 2DLXA 3ZYWA 4HEA2 3TCOA 1TI3A 1Z3EA 1ST9A 4DSRA 1G7EA 5A5KA 2PERA 2GSRA 4HJ2A 1TI1A 2VCWA 2IMDA 1CQHA 3TKQA 1WIKA 3P90A 2DMLA 2WRTA 4LA1A 5IMDA 5ECPB 3BCIA 2MBTA 2ALBA 1JZOA 4TR1B 5J4UA 2RM5A 3FHKA 1ZCPA 1ZGNA 1U3AA 1H75A 5E4WA 3TB2A 4Z7XA 3BBYA 3H93A 5CRDA 1Z7RA 4XS4A 3HZ4A 4BWQA 5IO0A 3ISOA 3SBCA 3C7MA 4KGIA 4E8EA 2GDRA 2PBJA 2CAIA 4J56E 1GUMA 3APOA 2HNLA 5B6NA 1QMVA 2FUG2 2CX3A 3L9SA 3RAZA 4XIHA 3TOUA 2K18A 2CT6A 1ERTA 3C1SA 5B6MA 2XPEA 4MCUA 2YZUA 5HFGA 2HSHA 3UEMA 2P31A 4KSMA 2NTOA 1RW1A 2X8HA 4TXOA 2OBIA 3CSJA 1AUCA 2HZFA 4G2EA 3W6GA 3K8NA 2IIYA 4EVMA 1O85A 5CNWA 2I4AA 4K7OA 4HJMA 1A24A 4ISDA 4JRRA 1ERVA 2FWHA 3R2QA 2FD3A 1K0DA 1KBNA 3IAM2 5DCGA 4F03A 4L0UA 4L8EA 1XW5A 4PQIA 1XWAA 3APQA 3HY2A 1GNEA 1WE0A 1V58A 4V1Ag 1M9AA 2CV4A 5J9CA 3BCKA 3HJPA 3RDWA 1OC9B 2K9FA 3EU4A 4Q5FA 3S9FA 2H6YA 1X5EA 4EL1A 4GF0A 2VOCA 5AIXA 4ZL7A 1TRVA 3BD2A 1BYEA 5IMAA 2ZCTA 1XOBA 5CRWA 5D9XA 1OKDA 4HS1A 4EXJA 3QAWA 3HDCA 1I9DA 3D21A 4Q5QA 2DIYA 4ID0A 2DBCA 1F3AA 2RIIA 2VM1A 2M72A 3QOUA 3UBLA 3E0UA 1USBA 3DMLA 2FWFA 2LNSA 4RI6A 1T3BA 4WF4A 4MPFA 4TN8A 2REMA 4NWYA 4MJBA 4V2NA 5CAXA 5EL8A 2B5EA 4IS0A 1JLVA 1KNGA 3Q19A 1ZOFA 3VK9A 3DXBA 3FZ5A 3GA4A 4NXIA 2R6KA 3FKFA 4EC0A 2C0FA 3OR5A 3MDKA 2BTOT 2O7KA 2JZRA 3DD3A 2H74A 2I9HA 3ZVJA 4PNFA 5AIVA 5F05A 1GUHA 3KZQA 5C00A 4ECIA 4Q5RA 5HQPA 2FLSA 2IWTA 2F51A 1EOHA 4K7IA 1XWBA 2OADA 2M80A 2QGVA 1K3OA 3IV4A 3LFLA 3KH9A 1B9YC 5FHIA 4IJ3A 4RQXA 3KGKA 5ID2A 1SU9A 2DJ0A 5ECNB 1OAZA 3IBHA 5HFIA 5DBQA 2VCZA 3EMXA 3GNJA 3FR3A 4OCFA 3ZLPA 4GSSA 2VLVA 1V2AA 2PVQA 5GAND 1PL2A 1T4ZA 3A5WA 3DRNA 3VWUA 5ECOB 1SL2B 4HQZA 1OYJA 1TXXA 2VL3A 3QAGA 3LYKA 4XHMA 1ZL9A 8GSSA 4KW6A 4CHSA 4MF5A 4JZQA 3M0FA 4N11A 1OVNA 2RLIA 4IBPA 2X64A 3M1GA 3CSIA 1O81A 1J0FA 1TOFA 3ME7A 3IRAA 2B6MA 4EDYA 1QQ2A 4HZ4A 5EVOA 1W89A 1GTIA 4TR3A 2LJRA 5H5QA 4MJAA 3NOFA 3V1WA 3JCML 4TXOB 2LV3A 3KH7A 1F2EA 3F4TA 4I8BA 5DJMA 3UJ1A 3F3QA 3QPMA 1WP0A 1YDKA 1V40A 3O76A 4K1FA 3PGTA 3I9V2 2C0DA 2JSYA 4AF2A 3HKRA 1K3YA 2LTKA 3G9BA 2RUFA 2C0GA 5F8BA 2YANA 4PUFC 4OD7A 2V6OA 2GZZA 4LMVA 4HDEA 2RUEA 1CQGA 4V2MA 4D73A 1U87A 2WULA 1M2DA 5IO2A 1SK1A 2AYTA 4IGJA 2F8FA 1A0RP 3TRXA 1BG5A 2K8SA 6GSWA 1SKWB 1ILOA 3KCMA 2HI7A 3EE2A 1J08A 1BAYA 5CYYA 2VL2C 3EURA 3ERWA 3KD0A 3GUSA 3P2AA 4L0WA 1PA3A 2R4VA 1URMA 5IMZA 4EF0A
chains in the Genus database with same CATH superfamily
2X49A 2C3QA 3HJMA 4MP4A 1A8LA 5H5SA 5ENUA 2ZUPA 2XBQA 3QD9A 2FGXA 6GSSA 1ABAA 4WBRD 2VCQA 1VGLA 2D2ZA 2FY6A 3FMWA 5ECHB 4ECJA 4EDZA 4K2XA 5FT3A 2OE3A 4BIKA 2E2GA 4IW9A 1YKAA 1PRXA 1MD4A 3BOAA 2YV7A 5CRGA 3RPPA 2V41A 4TR0A 1SYRA 2YWMA 3WGXA 5IM9A 3D0ZA 1VF3A 1H4OA 1O6JA 2LQOA 5JWRB 1NSWA 2H75A 2HLSA 9GSSA 2CVBA 2KUCA 2H6XA 2H71A 1AQVA 3EMPA 5FWGA 2IN3A 3QDNA 1FO5A 1R26A 5B7CA 3ED3A 3G7IA 5CP1A 1PKZA 2YP6A 1ML6A 3IDVA 1TK8B 1EV9A 2V2GA 2ES7A 3H1NA 4WR4A 1OKTA 4XS1A 2XPDA 2N5AA 1UN2A 2IJYA 1B48A 4ZBDA 4RUVA 1FG4A 1M3JA 2HRAA 4TVEA 3A2WA 2C1YA 4KUNA 2KP1A 2AB6A 3GKNA 4XTSA 2E7PA 1K0BA 3MAKA 1SL1B 3ZITA 5A4WA 1PX6A 2DJ3A 3KMNA 4DVCA 3DGQA 3GX8A 4PNGA 3ERGA 2YJ7A 1GH2A 5G5EA 2F8AA 1EEMA 4IP6A 3FR9A 4JBBA 1O7UA 2P0GA 4GRFA 4LMWA 4YQMA 4MH2A 3N5OA 2CAQA 5DALA 3D6IA 2ON5A 2K8VA 2H0IA 4MK3A 5ID2B 4ZB9A 3TJBA 1FVKA 4V1Ap 1R7HA 4OCEA 1X0RA 4TW5A 1FVJA 1WPIA 3UAPA 1M3IA 3LGCA 1X9WB 1EOGA 3ME8A 2GZPA 2VL2A 2IFQA 3LXTA 4PQ1A 1T8EB 4IJIA 2IMIA 5KN3A 3TJJA 3M9KA 5B8AA 1G6WA 2OE1A 4WEYA 1VF2A 2L4CA 3F3RA 3TOTA 4WF5A 5D9TA 3L4NA 5GSSA 4GWRA 1B4QA 2R0PA 2AJQB 1YF0A 5ECIB 3FEUA 1A0FA 2YCDA 4IELA 3VPTA 1AQXA 2YWIA 1K0AA 3DVWA 2VLTA 1M99A 3ZIJA 4ECCA 3Q18A 2BJXA 4BA7A 2YWNA 4MZWA 5D9VA 2CZ3A 1MEKA 5COHA 2I3YA 1THOA 2MBSA 1R4WA 4POLA 3CTGA 1GSSA 1YEXA 2HT9A 4JEDA 4MA9A 2IMEA 3ZRDA 4O5RA 1HNCA 14GSA 2A4VA 3VWXA 1PL1A 5B8BA 1Z6NA 1TP9A 4Q5NA 2VD0A 3IE3A 3TJFA 3KP9A 2C3TA 3IPZA 3VWVA 1BX9A 2WGRA 1YJ6A 3C73A 3GSSA 4A5PA 3ZIVA 1HD2A 2E2MA 4D73B 1WMJA 1TJDA 1TU8A 2O8VB 3GYKA 4CY6A 2O89A 3UVTA 3PH9A 3VI5A 1SKSB 3IXRA 2HZEA 11GSA 2H0GA 18GSA 1Z9HA 1FB0A 2GTUA 4PTSA 4DSSA 2CX4A 3MIXA 4G0IA 3O6TA 1THXA 1GTBA 3VLNA 4NPBA 6GSTA 1RQMA 4YKGA 2LRCA 5KEJA 4MABA 2CVKA 6GSUA 4TXVA 3TKSC 3CRTA 4FO5A 4POKA 4IHUA 4MPGA 12GSA 1TKDB 1I5GA 2H1DA 2KP2A 3G7JA 4IN0A 2L5LA 5HR0A 3A3TA 4GLTA 2OKAA 2VL9A 2P5RA 22GSA 3F8UA 4NHWA 2AHEA 1TW9A 2CZ2A 2C8UA 3IHQA 3WD6A 3CXGA 3MWHA 2QKEA 4HU7A 3CSHA 1ZYQB 4Z2RA 3LYPA 4K6XA 1V98A 1EGOA 1ACVA 3ZMKA 4QL9A 2EC4A 4BWSA 3LWAA 5HR2A 1YF1A 3FZ4A 3WGEA 3KTBA 3KJYA 5ECQB 2B7JA 2WS2A 2UZ8A 1GSFA 3HJOA 1XPVA 4I2TA 1X5DA 1QXHA 2DKHA 1M2BA 3QR6A 3PPUA 2GSQA 4KSOA 2LSTA 2JSZA 2PUKC 2CQ9A 4GSNA 3GX0A 2AAWA 2M46A 3RHCA 2OACA 2GSSA 4MZBA 2H19A 2MYGA 2N5FA 4LL1B 4L5OA 1K0NA 2B1LA 5DALB 5ECRB 2MMZA 4MLYA 5DAKA 6GSVA 3GKMA 3UIWA 2J9HA 3US3A 2F3MA 5ELAA 1PKWA 1T1VA 2GT6A 2VCTA 2C4JA 2EIQA 2WZ9A 1TK5B 5JCUA 2PVOC 2XBIA 4FYCA 5IMCA 3UL3A 3KEBA 1M9BA 3F6FA 5IMVA 1NHYA 2IFQB 4TKYA 3IC8A 5ECKB 4DSQA 1UA5A 1O8WA 1F9MA 1N8JA 2HYXA 3WYWA 5HFKA 1XWCA 2H66A 4WR5A 2YWOA 3J7Yk 5J3RA 3CYNA 1FB6A 4TOPA 2H6ZA 2J23A 2VM2A 3E3EA 1B9XC 2RM6A 1JZWA 1PX7A 2H1GA 5D73A 1WWJA 2VCVA 1AW9A 1HQOA 1C72A 2QA2A 3ZFLA 3LORA 2NPBA 2L59A 4GTUA 1UVZA 4KH7A 3FW2A 1Q4JA 2G2QA 3IAS2 1DSBA 3TGZA 1XW9A 3TJGA 3LW9A 4N30A 1A8YA 4HI7A 3HHVA 1PQNA 1IYHA 2OBKA 4WKWA 5DJLA 3L9VA 4ECBA 2MMAA 5IOWA 5KN2A 2GQMA 4K2DA 1AAZA 1WOUA 4BL7B 1XXUA 5L71A 3FR6A 3TKRA 2VAFA 2PMTA 2O85A 1R5PA 1T7PB 5G31A 2R3XA 4I97A 2Z9SA 3FY7A 2AUVA 3F9UA 4HQSA 5CRHA 1S3AA 4G9HA 2HZEB 3D4TA 2H72A 3KMOA 4EIPA 3RPNA 4ULXA 4WETA 4DSSB 3EU3A 1SKRB 5J41A 5G1KA 1XVQA 3TDGA 3IR4A 1SENA 4HSCX 3GSTA 1YQ1A 4ZB6A 4K0NA 2DC5A 3D4MA 2HXKA 4IP1A 3GMFA 4ILFA 1WJKA 3L0HA 1TTZA 1JLWA 2VO4A 1BEDA 4O7HA 1PMTA 3F4SA 1GNWA 3HVVA 5A4VA 4EIQA 2GLRA 4L5LA 4X43A 4X1UA 20GSA 3SWLA 4K8MA 3GFKA 7GSSA 4I6XA 4ZB8A 3DWVA 1SK2A 1SD9A 2L57A 5DQSA 5LNKe 4JR6A 2LQQA 2LUSA 2YOIA 3BJ5A 2WCIA 2IMFA 5EY6A 2X8GA 4MZCA 1NW2A 5HR1A 2DJ2A 4JE1A 10GSA 4PQHA 2OJLA 2VUPA 3VFIA 4KCEA 2VD1A 2B1KA 2A2RA 3PINA 4ZBAA 4F2IA 4XRAA 3J7Yb 2XC2A 3GKXA 4ZL9A 1K0MA 2X4AA 3C8EA 3ZL5A 4MF6A 1OC8A 5ECLB 3A2XA 4XCSA 1YKCA 5INYA 3ZMLA 1N2AA 2LJAA 2MMOA 3LG6A 4OFMA 1XIYA 2LS5A 3W8JA 1DE2A 1X9SB 2DJJA 13GSA 2XHFA 4KDUA 3GL5A 5DAKB 3FK8A 3GRXA 4YQUA 2C3NA 1AC1A 1ON4A 1PGTA 5F07A 3N9JA 5J5NA 1X9MB 3H79A 1ZZYA 3IK7A 3HD5A 1XFLA 3CMIA 1B8XA 2FWEA 3ZFBA 3DIEA 5KOXA 2HSMA 4CDOA 2GGTA 4IKHA 4HUAA 4JU5A 1TRUA 3GV1A 3DYRA 2KOKA 4E8HA 4YAPA 3WGDA 4X4JA 2V1MA 4IQ1A 2LEGA 4WBJA 1QFNA 1G0TA 5JCGA 4K7NA 3WT1A 3LEFA 4POMA 3A2VA 2FA4A 4F9ZA 16GSA 4DEJA 2B3SA 2E0QA 1EP8A 3HVSA 4G10A 1XWKA 2CA8A 2QSIA 3QAVA 4PUAA 1Y6EA 4ML6A 2VIMA 2H0HA 2H1BA 3GKKA 3TKPA 3ZZXA 4F0BA 2HE3A 3TKSE 1GL8A 1LBKA 4F0CA 3NZNA 1FOVA 1ERWA 2QC7A 4PXOA 4XRDA 4NV5A 1XWGA 3GHAA 2HRNA 3GN3A 5JWQB 3L78A 3U5RE 1F3BA 4J2FA 4K0GA 3GTUA 1SL0B 4BPYA 2PGTA 3TJKA 2F9SA 1BJXA 1A2JA 2DIZA 2HFDA 4KDYA 2X8CA 4POBA 2R37A 3F0IA 1Q98A 3HXSA 4NV2A 2VLUA 4LL4B 2JU5A 1F6MC 4KB3A 4BL7A 5H5RA 2KLXA 4HOJA 4KNDA 4NAXA 5JCWA 2ZNMA 1SK0A 6GSXA 2TIRA 2X99A 4V2LA 1F37A 3L9UA 4YQVA 4MJCA 5HR3A 2H01A 1VRSD 3HA9A 4IQAA 4MDCA 5G1LA 1O8XA 1SJ6A 1O73A 5G2ZA 2GQKA 1AIUA 1E2YA 1U6TA 5ABRA 2YN1A 1A23A 1PD21 3TRQA 3UBKA 2GT5A 1E6BA 2H70A 3EINA 5LD0A 5D8IA 2NVLA 2FNOA 3ZVJD 1OE7A 3EC3A 4KCAA 4OWYA 1GSUA 2YNXA 4OMVA 2TRCP 5GSTA 4O32A 3HZ8A 3LJRA 4MJEA 3UVHA 2PN8A 4X0XA 1J9BA 4KX4A 1HNBA 1KTEA 1ZYEA 1FHEA 5IMFA 1LU4A 4YH2A 2DMMA 3GH9A 3C71A 1BQ7A 1EZKA 1V9WA 3Q74A 4GSTA 3IK9A 2LJKA 2I1UA 2JZSA 1TDIA 1ZMAA 1VF1A 3P8WA 1AQWA 2O87A 5ECMB 1W4VA 4MF7A 2YZHA 2LNTA 2FCHA 3M9JA 4GQFA 4PURA 1GSDA 4FH8A 2BMXA 4AJ8A 4O92A 2GQLA 3DVXA 1JFUA 3AY8A 5F0GA 5GAPD 4NHZA 5AISA 3CBUA 3HVXA 1S3CA 4IVFA 17GSA 2YPMA 2C80A 4MH3A 4USSA 2GS3A 1EWXA 1UC7A 3DEXA 3D22A 1FW1A 1TRSA 3I69A 3RHBA 3MNGA 1K0OA 3UARA 1AXDA 1FAAA 4AJ7A 1GUKA 1RK4A 3PR8A 1XG8A 1SYXA 2PU9C 4I2UA 4TR4A 3CRUA 4HU9A 4AJ6A 1EP7A 3LXZA 1PFOA 1OE8A 3F6DA 4ZXGA 2I81A 2L6DA 3EPTA 2FHEA 2V32A 3LQ7A 4JR4A 4QL7A 4F82A 5IIZA 4PX1A 1EEJA 4ICYA 2WJUA 1GSEA 1DUGA 2WFCA 3RBTA 3H4KA 4KE3A 3O3TA 3Q6OA 5AGYA 2YJHA 3I43A 1GLQA 1XVWA 2FWGA 2G0FA 1NHOA 2JACA 2GSTA 1K0CA 1TU7A 4KDXA 2R0GA 3W8SA 3GL3A 1YEPA 3TKSA 2KHPA 4YAVA 4N0VA 2H73A 5ELGA 2A2SA 2VCXA 2DJ1A 2L6CA 4N10A 3H8QA 5G30A 4ZBBA 1Z6MA 1Z5YE 1PN9A 3FZAA 4ZILA 4FYUA 5J9BA 1B4PA 3NIVA 4K9ZA 3D5JA 4WXTA 2LRTA 4XS4B 1DE1A 3EVIA 2H30A 5IPGA 4TR1A 2DSAA 2ON7A 1TRWA 4GXZA 3KIJA 1HNAA 1EV4A 3EYTA 1TK0B 4LLRA 1QGVA 1G6YA 1M0UA 2WDUA 3GTUB 1MDJA 1XW6A 2H76A 3GH6A 4CW9A 3E9JB 1A2LA 3HCZA 5DQYA 1GSYA 1VF4A 4P3YB 4FYBA 3FRCA 1SJIA 3HYPA 3CTFA 1T4YA 4EE0A 1Y25A 3IOSA 4BVXA 3LSZA 4XS6A 5ECSA 2V6KA 3QMXA 3ZTLA 3M3MA 1GTUA 1KEBA 4KA0A 5IOXA 3MSZA 2HRKA 1S3DA 3GURA 1DBYA 2NBSA 2JADA 1OC3A 2H8LA 3TUEA 2B5YA 2QA1A 1MDKA 1MDIA 2R2JA 2AV4A 4EKZA 1GRXA 4ZIJA 3QFAC 1XZOA 4PGTA 4KAEA 2IL3A 2HRFA 4EUYA 3TRPA 3M8NA 2H1AA 3ERFA 4TRXA 1WRYA 4ML1A 1R5AA 5KN1A 1JZDA 2YV9A 4FIWA 1LJRA 4I5QA 5G5FA 4AGSA 4CY8A 1GTAA 3APSA 5IQYA 1GWCA 2P5QA 4RQRA 2R5GA 2EIRA 4G0KA 3KM6A 2PWJA 2FA8A 1U3IA 3U6VA 1U88A 1Z7PA 2OA7A 3QCPA 1GLPA 2IMKA 2L4QA 2K6VA 2GZYA 5D9WA 3HVNA 3VI7A 1MTCA 3C1RA 5E59A 2OE0A 2LRNA 2WB9A 4H86A 5KOWA 1JHBA 2CVDA 4NMUA 2MMNA 3FZ9A 1M2AA 1OC9A 1YY7A 4OO4A 4RI7A 5A4UA 1A2MA 5DDLA 1T00A 4N0ZA 4Z2UA 5DCHA 2HSYA 1PSQA 4GCIA 5JWOB 3VWWA 5F06A 4ACSA 5LCZA 1X5CA 3KXOA 1EGRA 1IYIA 3KTLA 1XOAA 5IPHA 1SJZA 5D96A 5EPFA 3DKSA 3VURA 1QUWA 3EWLA 4KF9A 1YZXA 4G19A 1GULA 5GZZB 1SD8A 3UMAA 4ZL8A 2JZTA 3I6AA 4J57E 1ERUA 5C04A 3G7YA 1GSQA 2JL4A 4BVYA 1HYUA 2C0EA 2LKUA 2IPAA 1MD3A 1GP1A 3KP8A 4EO3A 4HZ2A 5D93A 1XCCA 5CO3A 1V57A 3F4RA 2B5XA 1XBSA 1JZRA 3IA1A 2PPTA 1G7OA 3WT2A 2DJKA 4OO5A 3IC4A 3P7XA 6GSYA 19GSA 4OFTA 2L5OA 1K3LA 2NDOA 2TRXA 3FYGA 5CREA 3GIXA 1M7TA 2EIOA 3F63A 3UOMA 3QFBC 4QQ7A 2B7KA 1QK8A 4O5UA 5DVBA 2MZCA 1NM3A 2N5BA 4MMMA 5KN0A 4OFNA 5AN1A 2GVPA 3VPQA 3ZREA 4YKFA 4GQCA 2DLXA 3ZYWA 4HEA2 3TCOA 1TI3A 1Z3EA 1ST9A 4DSRA 1G7EA 5A5KA 2PERA 2GSRA 4HJ2A 1TI1A 2VCWA 2IMDA 1CQHA 3TKQA 1WIKA 3P90A 2DMLA 2WRTA 4LA1A 5IMDA 5ECPB 3BCIA 2MBTA 2ALBA 1JZOA 4TR1B 5J4UA 2RM5A 3FHKA 1ZCPA 1ZGNA 1U3AA 1H75A 5E4WA 3TB2A 4Z7XA 3BBYA 3H93A 5CRDA 1Z7RA 4XS4A 3HZ4A 4BWQA 5IO0A 3ISOA 3SBCA 3C7MA 4KGIA 4Z2TA 4E8EA 2GDRA 2PBJA 2CAIA 4J56E 1GUMA 4BVXB 3APOA 2HNLA 5B6NA 1QMVA 2FUG2 2CX3A 3L9SA 3RAZA 4XIHA 3TOUA 2K18A 2CT6A 1ERTA 4G0LA 3C1SA 5B6MA 1PN0A 2XPEA 4MCUA 2YZUA 5HFGA 2HSHA 3UEMA 2P31A 4KSMA 2NTOA 1RW1A 2X8HA 4TXOA 2OBIA 3CSJA 1AUCA 2HZFA 4G2EA 3W6GA 3K8NA 2IIYA 4EVMA 1O85A 5CNWA 2I4AA 4K7OA 4HJMA 1A24A 4ISDA 4JRRA 1ERVA 2FWHA 3R2QA 2FD3A 1K0DA 1KBNA 3IAM2 5DCGA 4F03A 4L0UA 4L8EA 1XW5A 4PQIA 1XWAA 3APQA 3HY2A 1GNEA 1WE0A 1V58A 5BMUA 4V1Ag 1M9AA 2CV4A 2R0CA 5J9CA 3BCKA 3HJPA 3A5IA 3RDWA 1OC9B 2K9FA 3EU4A 4Q5FA 5BRTA 3S9FA 2H6YA 4K5SA 1X5EA 4EL1A 3MYDA 4GF0A 2VOCA 5AIXA 4ZL7A 1TRVA 3BD2A 1BYEA 3CQFA 5IMAA 2ZCTA 1XOBA 5CRWA 5D9XA 1OKDA 4HS1A 4EXJA 3QAWA 3HDCA 1I9DA 4BVYB 3D21A 4Q5QA 2DIYA 4ID0A 2A4HA 2DBCA 4FQUA 1F3AA 2RIIA 2VM1A 2M72A 3QOUA 3UBLA 3E0UA 1USBA 3DMLA 2FWFA 2LNSA 3IHGA 4RI6A 1T3BA 1ZYNA 4WF4A 4MPFA 4TN8A 2REMA 1FOHA 4NWYA 4MJBA 4V2NA 5CAXA 5EL8A 2B5EA 4IS0A 1JLVA 1KNGA 3Q19A 1ZOFA 3VK9A 3DXBA 3FZ5A 3GA4A 4NXIA 2R6KA 3FKFA 4EC0A 2C0FA 3OR5A 3MDKA 2BTOT 2O7KA 2A2PA 2JZRA 3DD3A 2H74A 2I9HA 3ZVJA 4PNFA 5AIVA 5F05A 1GUHA 3KZQA 5C00A 4ECIA 4Q5RA 5HQPA 2FLSA 2IWTA 2F51A 1EOHA 4K7IA 1XWBA 2DKIA 3R3EA 2OADA 2M80A 2QGVA 4O5QA 1K3OA 3IV4A 3LFLA 3KH9A 1B9YC 5FHIA 4IJ3A 4RQXA 3KGKA 5ID2A 1SU9A 2DJ0A 5ECNB 1OAZA 3IBHA 5HFIA 5DBQA 2VCZA 3EMXA 3GNJA 3FR3A 4OCFA 3ZLPA 4GSSA 2VLVA 1V2AA 2PVQA 5GAND 1PL2A 1T4ZA 3A5WA 3DRNA 3VWUA 5ECOB 1SL2B 4HQZA 1OYJA 1TXXA 2VL3A 3QAGA 3LYKA 4XHMA 1ZL9A 8GSSA 4KW6A 4CHSA 4MF5A 4JZQA 3M0FA 4N11A 1OVNA 2RLIA 4IBPA 2X64A 3M1GA 3CSIA 1O81A 1J0FA 1TOFA 3ME7A 3IRAA 2B6MA 4EDYA 1QQ2A 4HZ4A 5EVOA 1W89A 1GTIA 4TR3A 2LJRA 5H5QA 4MJAA 3NOFA 3V1WA 3JCML 4TXOB 2LV3A 3KH7A 1F2EA 3F4TA 4I8BA 5DJMA 3UJ1A 3F3QA 3QPMA 1WP0A 1YDKA 1V40A 3O76A 4K1FA 3PGTA 3I9V2 2C0DA 2JSYA 4AF2A 3HKRA 1K3YA 2LTKA 3G9BA 2RUFA 4K5RA 2C0GA 5F8BA 2YANA 4PUFC 4OD7A 2V6OA 2GZZA 4LMVA 4HDEA 2RUEA 1CQGA 4V2MA 4D73A 1U87A 2WULA 1M2DA 5IO2A 1SK1A 2AYTA 4IGJA 2F8FA 1A0RP 3TRXA 1BG5A 2K8SA 6GSWA 1ZYPA 1SKWB 1ILOA 3KCMA 2HI7A 3EE2A 1J08A 1BAYA 5CYYA 4MNNA 2VL2C 3EURA 3ERWA 3KD0A 3GUSA 3P2AA 4L0WA 1PA3A 2R4VA 1S3RA 1URMA 5IMZA 4EF0A
chains in the Genus database with same CATH topology
2X49A 2C3QA 3HJMA 4MP4A 1A8LA 5H5SA 5ENUA 2ZUPA 2XBQA 3QD9A 2FGXA 6GSSA 1ABAA 4WBRD 2VCQA 1VGLA 2D2ZA 2FY6A 3FMWA 5ECHB 4ECJA 4EDZA 4K2XA 5FT3A 2OE3A 2E2GA 4IW9A 1YKAA 1PRXA 1MD4A 3BOAA 2YV7A 5CRGA 3RPPA 2V41A 4TR0A 1SYRA 2YWMA 3WGXA 5IM9A 3D0ZA 1VF3A 1H4OA 1O6JA 2LQOA 5JWRB 1NSWA 2H75A 2HLSA 9GSSA 2CVBA 2KUCA 2H6XA 2H71A 1AQVA 3EMPA 5FWGA 2IN3A 3QDNA 1FO5A 1R26A 5B7CA 3ED3A 3G7IA 5CP1A 1PKZA 2YP6A 1ML6A 3IDVA 1TK8B 1EV9A 2V2GA 2ES7A 3H1NA 4WR4A 1OKTA 4XS1A 2XPDA 2N5AA 1UN2A 2IJYA 1B48A 4ZBDA 4RUVA 1FG4A 2HRAA 4TVEA 3A2WA 2C1YA 4KUNA 2KP1A 2AB6A 3GKNA 4XTSA 2E7PA 1K0BA 3MAKA 1SL1B 3ZITA 5A4WA 1PX6A 2DJ3A 3KMNA 4DVCA 3DGQA 3GX8A 4PNGA 3ERGA 2YJ7A 1GH2A 5G5EA 2F8AA 1EEMA 4IP6A 3FR9A 4JBBA 1O7UA 2P0GA 4GRFA 4LMWA 4YQMA 4MH2A 3N5OA 2CAQA 5DALA 3D6IA 2ON5A 2K8VA 2H0IA 4MK3A 5ID2B 4ZB9A 3TJBA 1FVKA 4V1Ap 1R7HA 4OCEA 1X0RA 4TW5A 1FVJA 1WPIA 3UAPA 3LGCA 1X9WB 1EOGA 3ME8A 2GZPA 2VL2A 2IFQA 3LXTA 4PQ1A 1T8EB 4IJIA 2IMIA 5KN3A 3TJJA 3M9KA 5B8AA 1G6WA 2OE1A 4WEYA 1VF2A 2L4CA 3F3RA 3TOTA 4WF5A 5D9TA 3L4NA 5GSSA 4GWRA 1B4QA 2R0PA 2AJQB 1YF0A 5ECIB 3FEUA 1A0FA 2YCDA 4IELA 3VPTA 1AQXA 2YWIA 1K0AA 3DVWA 2VLTA 1M99A 3ZIJA 4ECCA 3Q18A 2BJXA 4BA7A 2YWNA 4MZWA 5D9VA 2CZ3A 1MEKA 5COHA 2I3YA 1THOA 2MBSA 1R4WA 4POLA 3CTGA 1GSSA 1YEXA 2HT9A 4JEDA 4MA9A 2IMEA 3ZRDA 4O5RA 1HNCA 14GSA 2A4VA 3VWXA 1PL1A 5B8BA 1Z6NA 1TP9A 4Q5NA 2VD0A 3IE3A 3TJFA 3KP9A 2C3TA 3IPZA 3VWVA 1BX9A 2WGRA 1YJ6A 3C73A 3GSSA 4A5PA 3ZIVA 1HD2A 2E2MA 4D73B 1WMJA 1TJDA 1TU8A 2O8VB 3GYKA 4CY6A 2O89A 3UVTA 3PH9A 3VI5A 1SKSB 3IXRA 2HZEA 11GSA 2H0GA 18GSA 1Z9HA 1FB0A 2GTUA 4PTSA 4DSSA 2CX4A 3MIXA 4G0IA 3O6TA 1THXA 1GTBA 3VLNA 4NPBA 6GSTA 1RQMA 4YKGA 2LRCA 5KEJA 4MABA 2CVKA 6GSUA 4TXVA 3TKSC 3CRTA 4FO5A 4POKA 4IHUA 4MPGA 12GSA 1TKDB 1I5GA 2H1DA 2KP2A 3G7JA 4IN0A 2L5LA 5HR0A 3A3TA 4GLTA 2OKAA 2VL9A 2P5RA 22GSA 3F8UA 4NHWA 2AHEA 1TW9A 2CZ2A 2C8UA 3IHQA 3WD6A 3CXGA 3MWHA 2QKEA 4HU7A 3CSHA 1ZYQB 4Z2RA 3LYPA 4K6XA 1V98A 1EGOA 1ACVA 3ZMKA 4QL9A 2EC4A 4BWSA 3LWAA 5HR2A 1YF1A 3FZ4A 3WGEA 3KTBA 3KJYA 5ECQB 2B7JA 2WS2A 2UZ8A 1GSFA 3HJOA 1XPVA 4I2TA 1X5DA 1QXHA 2DKHA 1M2BA 3QR6A 3PPUA 2GSQA 4KSOA 2LSTA 2JSZA 2PUKC 2CQ9A 4GSNA 3GX0A 2AAWA 2M46A 3RHCA 2OACA 2GSSA 4MZBA 2H19A 2MYGA 2N5FA 4LL1B 4L5OA 1K0NA 2B1LA 5DALB 5ECRB 2MMZA 4MLYA 5DAKA 6GSVA 3GKMA 3UIWA 2J9HA 3US3A 2F3MA 5ELAA 1PKWA 1T1VA 2GT6A 2VCTA 2C4JA 2EIQA 2WZ9A 1TK5B 5JCUA 2PVOC 2XBIA 4FYCA 5IMCA 3UL3A 3KEBA 1M9BA 3F6FA 5IMVA 1NHYA 2IFQB 4TKYA 3IC8A 5ECKB 4DSQA 1UA5A 1O8WA 1F9MA 1N8JA 2HYXA 3WYWA 5HFKA 1XWCA 2H66A 4WR5A 2YWOA 3J7Yk 5J3RA 3CYNA 1FB6A 4TOPA 2H6ZA 2J23A 2VM2A 3E3EA 1B9XC 2RM6A 1JZWA 1PX7A 2H1GA 5D73A 1WWJA 2VCVA 1AW9A 1HQOA 1C72A 2QA2A 3ZFLA 3LORA 2NPBA 2L59A 4GTUA 1UVZA 4KH7A 3FW2A 1Q4JA 2G2QA 3IAS2 1DSBA 3TGZA 1XW9A 3TJGA 3LW9A 4N30A 1A8YA 4HI7A 3HHVA 1PQNA 1IYHA 2OBKA 4WKWA 5DJLA 3L9VA 4ECBA 2MMAA 5IOWA 5KN2A 2GQMA 4K2DA 1AAZA 1WOUA 4BL7B 1XXUA 5L71A 3FR6A 3TKRA 2VAFA 2PMTA 2O85A 1R5PA 1T7PB 5G31A 2R3XA 4I97A 2Z9SA 3FY7A 2AUVA 3F9UA 4HQSA 5CRHA 1S3AA 4G9HA 2HZEB 3D4TA 2H72A 3KMOA 4EIPA 3RPNA 4ULXA 4WETA 4DSSB 3EU3A 1SKRB 5J41A 5G1KA 1XVQA 3TDGA 3IR4A 1SENA 3GSTA 1YQ1A 4ZB6A 4K0NA 2DC5A 3D4MA 2HXKA 4IP1A 3GMFA 4ILFA 1WJKA 3L0HA 1TTZA 1JLWA 2VO4A 1BEDA 4O7HA 1PMTA 3F4SA 1GNWA 3HVVA 5A4VA 4EIQA 2GLRA 4L5LA 4X43A 4X1UA 20GSA 3SWLA 4K8MA 3GFKA 7GSSA 4I6XA 4ZB8A 3DWVA 1SK2A 1SD9A 2L57A 5DQSA 5LNKe 4JR6A 2LQQA 2LUSA 2YOIA 3BJ5A 2WCIA 2IMFA 5EY6A 2X8GA 4MZCA 1NW2A 5HR1A 2DJ2A 4JE1A 10GSA 4PQHA 2OJLA 2VUPA 3VFIA 4KCEA 2VD1A 2B1KA 2A2RA 3PINA 4ZBAA 4F2IA 4XRAA 3J7Yb 2XC2A 3GKXA 4ZL9A 1K0MA 2X4AA 3C8EA 3ZL5A 4MF6A 1OC8A 5ECLB 3A2XA 4XCSA 1YKCA 5INYA 3ZMLA 1N2AA 2LJAA 2MMOA 3LG6A 4OFMA 1XIYA 2LS5A 3W8JA 1DE2A 1X9SB 2DJJA 13GSA 2XHFA 4KDUA 3GL5A 5DAKB 3FK8A 3GRXA 4YQUA 2C3NA 1AC1A 1ON4A 1PGTA 5F07A 3N9JA 5J5NA 1X9MB 3H79A 1ZZYA 3IK7A 3HD5A 1XFLA 3CMIA 1B8XA 2FWEA 3ZFBA 3DIEA 5KOXA 2HSMA 4CDOA 2GGTA 4IKHA 4HUAA 4JU5A 1TRUA 3GV1A 3DYRA 2KOKA 4E8HA 4YAPA 3WGDA 4X4JA 2V1MA 4IQ1A 2LEGA 4WBJA 1QFNA 1G0TA 5JCGA 4K7NA 3WT1A 3LEFA 4POMA 3A2VA 2FA4A 4F9ZA 16GSA 4DEJA 2B3SA 2E0QA 1EP8A 3HVSA 4G10A 1XWKA 2CA8A 2QSIA 3QAVA 4PUAA 1Y6EA 4ML6A 2VIMA 2H0HA 2H1BA 3GKKA 3TKPA 3ZZXA 4F0BA 2HE3A 3TKSE 1GL8A 1LBKA 4F0CA 3NZNA 1FOVA 1ERWA 2QC7A 4PXOA 4XRDA 4NV5A 1XWGA 3GHAA 2HRNA 3GN3A 5JWQB 3L78A 3U5RE 1F3BA 4J2FA 4K0GA 3GTUA 1SL0B 4BPYA 2PGTA 3TJKA 2F9SA 1BJXA 1A2JA 2DIZA 2HFDA 4KDYA 2X8CA 4POBA 2R37A 3F0IA 1Q98A 3HXSA 4NV2A 2VLUA 4LL4B 2JU5A 1F6MC 4KB3A 4BL7A 5H5RA 2KLXA 4HOJA 4KNDA 4NAXA 5JCWA 2ZNMA 1SK0A 6GSXA 2TIRA 2X99A 4V2LA 1F37A 3L9UA 4YQVA 4MJCA 5HR3A 2H01A 1VRSD 3HA9A 4IQAA 4MDCA 5G1LA 1O8XA 1SJ6A 1O73A 5G2ZA 2GQKA 1AIUA 1E2YA 1U6TA 5ABRA 2YN1A 1A23A 1PD21 3TRQA 3UBKA 2GT5A 1E6BA 2H70A 3EINA 5LD0A 5D8IA 2NVLA 2FNOA 3ZVJD 1OE7A 3EC3A 4KCAA 4OWYA 1GSUA 2YNXA 4OMVA 2TRCP 5GSTA 4O32A 3HZ8A 3LJRA 4MJEA 3UVHA 2PN8A 4X0XA 1J9BA 4KX4A 1HNBA 1KTEA 1ZYEA 1FHEA 5IMFA 1LU4A 4YH2A 2DMMA 3GH9A 3C71A 1BQ7A 1EZKA 1V9WA 3Q74A 4GSTA 3IK9A 2LJKA 2I1UA 2JZSA 1TDIA 1ZMAA 1VF1A 3P8WA 1AQWA 2O87A 5ECMB 1W4VA 4MF7A 2YZHA 2LNTA 2FCHA 3M9JA 4GQFA 4PURA 1GSDA 4FH8A 2BMXA 4AJ8A 4O92A 2GQLA 3DVXA 1JFUA 3AY8A 5F0GA 5GAPD 4NHZA 5AISA 3CBUA 3HVXA 1S3CA 4IVFA 17GSA 2YPMA 2C80A 4MH3A 4USSA 2GS3A 1EWXA 1UC7A 3DEXA 3D22A 1FW1A 1TRSA 3I69A 3RHBA 3MNGA 1K0OA 3UARA 1AXDA 1FAAA 4AJ7A 1GUKA 1RK4A 3PR8A 1SYXA 2PU9C 4I2UA 4TR4A 3CRUA 4HU9A 4AJ6A 1EP7A 3LXZA 1OE8A 3F6DA 4ZXGA 2I81A 2L6DA 3EPTA 2FHEA 2V32A 3LQ7A 4JR4A 4QL7A 4F82A 5IIZA 4PX1A 1EEJA 4ICYA 2WJUA 1GSEA 1DUGA 2WFCA 3RBTA 3H4KA 4KE3A 3O3TA 3Q6OA 5AGYA 2YJHA 3I43A 1GLQA 1XVWA 2FWGA 2G0FA 1NHOA 2JACA 2GSTA 1K0CA 1TU7A 4KDXA 2R0GA 3W8SA 3GL3A 1YEPA 3TKSA 2KHPA 4YAVA 4N0VA 2H73A 5ELGA 2A2SA 2VCXA 2DJ1A 2L6CA 4N10A 3H8QA 5G30A 4ZBBA 1Z6MA 1Z5YE 1PN9A 3FZAA 4ZILA 4FYUA 5J9BA 1B4PA 3NIVA 4K9ZA 3D5JA 4WXTA 2LRTA 4XS4B 1DE1A 3EVIA 2H30A 5IPGA 4TR1A 2DSAA 2ON7A 1TRWA 4GXZA 3KIJA 1HNAA 1EV4A 3EYTA 1TK0B 4LLRA 1QGVA 1G6YA 1M0UA 2WDUA 3GTUB 1MDJA 1XW6A 2H76A 3GH6A 4CW9A 3E9JB 1A2LA 3HCZA 5DQYA 1GSYA 1VF4A 4P3YB 4FYBA 3FRCA 1SJIA 3HYPA 3CTFA 1T4YA 4EE0A 1Y25A 3IOSA 4BVXA 3LSZA 4XS6A 5ECSA 2V6KA 3QMXA 3ZTLA 3M3MA 1GTUA 1KEBA 4KA0A 5IOXA 3MSZA 2HRKA 1S3DA 3GURA 1DBYA 2NBSA 2JADA 1OC3A 2H8LA 3TUEA 2B5YA 2QA1A 1MDKA 1MDIA 2R2JA 2AV4A 4EKZA 1GRXA 4ZIJA 3QFAC 1XZOA 4PGTA 4KAEA 2IL3A 2HRFA 4EUYA 3TRPA 3M8NA 2H1AA 3ERFA 4TRXA 1WRYA 4ML1A 1R5AA 5KN1A 1JZDA 2YV9A 4FIWA 1LJRA 4I5QA 5G5FA 4AGSA 4CY8A 1GTAA 3APSA 5IQYA 1GWCA 2P5QA 4RQRA 2R5GA 2EIRA 4G0KA 3KM6A 2PWJA 2FA8A 1U3IA 3U6VA 1U88A 1Z7PA 2OA7A 3QCPA 1GLPA 2IMKA 2L4QA 2K6VA 2GZYA 5D9WA 3VI7A 1MTCA 3C1RA 5E59A 2OE0A 2LRNA 2WB9A 4H86A 5KOWA 1JHBA 2CVDA 4NMUA 2MMNA 3FZ9A 1M2AA 1OC9A 1YY7A 4OO4A 4RI7A 5A4UA 1A2MA 5DDLA 1T00A 4N0ZA 4Z2UA 5DCHA 2HSYA 1PSQA 4GCIA 5JWOB 3VWWA 5F06A 4ACSA 5LCZA 1X5CA 3KXOA 1EGRA 1IYIA 3KTLA 1XOAA 5IPHA 1SJZA 5D96A 5EPFA 3DKSA 3VURA 1QUWA 3EWLA 4KF9A 1YZXA 4G19A 1GULA 5GZZB 1SD8A 3UMAA 4ZL8A 2JZTA 3I6AA 4J57E 1ERUA 5C04A 3G7YA 1GSQA 2JL4A 4BVYA 1HYUA 2C0EA 2LKUA 2IPAA 1MD3A 1GP1A 3KP8A 4EO3A 4HZ2A 5D93A 1XCCA 5CO3A 1V57A 3F4RA 2B5XA 1XBSA 1JZRA 3IA1A 2PPTA 1G7OA 3WT2A 2DJKA 4OO5A 3IC4A 3P7XA 6GSYA 19GSA 4OFTA 2L5OA 1K3LA 2NDOA 2TRXA 3FYGA 5CREA 3GIXA 1M7TA 2EIOA 3F63A 3UOMA 3QFBC 4QQ7A 2B7KA 1QK8A 4O5UA 5DVBA 2MZCA 1NM3A 2N5BA 4MMMA 5KN0A 4OFNA 5AN1A 2GVPA 3VPQA 3ZREA 4YKFA 4GQCA 2DLXA 3ZYWA 4HEA2 3TCOA 1TI3A 1Z3EA 1ST9A 4DSRA 1G7EA 5A5KA 2PERA 2GSRA 4HJ2A 1TI1A 2VCWA 2IMDA 1CQHA 3TKQA 1WIKA 3P90A 2DMLA 2WRTA 4LA1A 5IMDA 5ECPB 3BCIA 2MBTA 2ALBA 1JZOA 4TR1B 5J4UA 2RM5A 3FHKA 1ZCPA 1ZGNA 1U3AA 1H75A 5E4WA 3TB2A 4Z7XA 3BBYA 3H93A 5CRDA 1Z7RA 4XS4A 3HZ4A 4BWQA 5IO0A 3ISOA 3SBCA 3C7MA 4KGIA 4Z2TA 4E8EA 2GDRA 2PBJA 2CAIA 4J56E 1GUMA 4BVXB 3APOA 2HNLA 5B6NA 1QMVA 2FUG2 2CX3A 3L9SA 3RAZA 4XIHA 3TOUA 2K18A 2CT6A 1ERTA 4G0LA 3C1SA 5B6MA 1PN0A 2XPEA 4MCUA 2YZUA 5HFGA 2HSHA 3UEMA 2P31A 4KSMA 2NTOA 1RW1A 2X8HA 4TXOA 2OBIA 3CSJA 1AUCA 2HZFA 4G2EA 3W6GA 3K8NA 2IIYA 4EVMA 1O85A 5CNWA 2I4AA 4K7OA 4HJMA 1A24A 4ISDA 4JRRA 1ERVA 2FWHA 3R2QA 2FD3A 1K0DA 1KBNA 3IAM2 5DCGA 4F03A 4L0UA 4L8EA 1XW5A 4PQIA 1XWAA 3APQA 3HY2A 1GNEA 1WE0A 1V58A 5BMUA 4V1Ag 1M9AA 2CV4A 2R0CA 5J9CA 3BCKA 3HJPA 3A5IA 3RDWA 1OC9B 2K9FA 3EU4A 4Q5FA 5BRTA 3S9FA 2H6YA 4K5SA 1X5EA 4EL1A 3MYDA 4GF0A 2VOCA 5AIXA 4ZL7A 1TRVA 3BD2A 1BYEA 5IMAA 2ZCTA 1XOBA 5CRWA 5D9XA 1OKDA 4HS1A 4EXJA 3QAWA 3HDCA 1I9DA 4BVYB 3D21A 4Q5QA 2DIYA 4ID0A 2A4HA 2DBCA 4FQUA 1F3AA 2RIIA 2VM1A 2M72A 3QOUA 3UBLA 3E0UA 1USBA 3DMLA 2FWFA 2LNSA 3IHGA 4RI6A 1T3BA 1ZYNA 4WF4A 4MPFA 4TN8A 2REMA 1FOHA 4NWYA 4MJBA 4V2NA 5CAXA 5EL8A 2B5EA 4IS0A 1JLVA 1KNGA 3Q19A 1ZOFA 3VK9A 3DXBA 3FZ5A 3GA4A 4NXIA 2R6KA 3FKFA 4EC0A 2C0FA 3OR5A 3MDKA 2BTOT 2O7KA 2A2PA 2JZRA 3DD3A 2H74A 2I9HA 3ZVJA 4PNFA 5AIVA 5F05A 1GUHA 3KZQA 5C00A 4ECIA 4Q5RA 5HQPA 2FLSA 2IWTA 2F51A 1EOHA 4K7IA 1XWBA 2DKIA 3R3EA 2OADA 2M80A 2QGVA 4O5QA 1K3OA 3IV4A 3LFLA 3KH9A 1B9YC 5FHIA 4IJ3A 4RQXA 3KGKA 5ID2A 1SU9A 2DJ0A 5ECNB 1OAZA 3IBHA 5HFIA 5DBQA 2VCZA 3EMXA 3GNJA 3FR3A 4OCFA 3ZLPA 4GSSA 2VLVA 1V2AA 2PVQA 5GAND 1PL2A 1T4ZA 3A5WA 3DRNA 3VWUA 5ECOB 1SL2B 4HQZA 1OYJA 1TXXA 2VL3A 3QAGA 3LYKA 4XHMA 1ZL9A 8GSSA 4KW6A 4CHSA 4MF5A 4JZQA 3M0FA 4N11A 1OVNA 2RLIA 4IBPA 2X64A 3M1GA 3CSIA 1O81A 1J0FA 1TOFA 3ME7A 3IRAA 2B6MA 4EDYA 1QQ2A 4HZ4A 5EVOA 1W89A 1GTIA 4TR3A 2LJRA 5H5QA 4MJAA 3NOFA 3V1WA 3JCML 4TXOB 2LV3A 3KH7A 1F2EA 3F4TA 4I8BA 5DJMA 3UJ1A 3F3QA 3QPMA 1WP0A 1YDKA 1V40A 3O76A 4K1FA 3PGTA 3I9V2 2C0DA 2JSYA 4AF2A 3HKRA 1K3YA 2LTKA 3G9BA 2RUFA 4K5RA 2C0GA 5F8BA 2YANA 4PUFC 4OD7A 2V6OA 2GZZA 4LMVA 4HDEA 2RUEA 1CQGA 4V2MA 4D73A 1U87A 2WULA 1M2DA 5IO2A 1SK1A 2AYTA 4IGJA 2F8FA 1A0RP 3TRXA 1BG5A 2K8SA 6GSWA 1ZYPA 1SKWB 1ILOA 3KCMA 2HI7A 3EE2A 1J08A 1BAYA 5CYYA 4MNNA 2VL2C 3EURA 3ERWA 3KD0A 3GUSA 3P2AA 4L0WA 1PA3A 2R4VA 1URMA 5IMZA 4EF0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C3Q A;  3HJM A;  4MP4 A;  1A8L A;  5H5S A;  5ENU A;  2ZUP A;  2XBQ A;  3QD9 A;  2FGX A;  6GSS A;  1ABA A;  4WBR D;  2VCQ A;  1VGL A;  2D2Z A;  2FY6 A;  5ECH B;  4ECJ A;  4EDZ A;  5FT3 A;  2OE3 A;  2E2G A;  4IW9 A;  1YKA A;  1PRX A;  1MD4 A;  3BOA A;  2YV7 A;  5CRG A;  3RPP A;  2V41 A;  4TR0 A;  1SYR A;  2YWM A;  3WGX A;  5IM9 A;  3D0Z A;  1VF3 A;  1H4O A;  1O6J A;  2LQO A;  5JWR B;  1NSW A;  2H75 A;  2HLS A;  9GSS A;  2CVB A;  2KUC A;  2H6X A;  2H71 A;  1AQV A;  3EMP A;  5FWG A;  2IN3 A;  3QDN A;  1FO5 A;  1R26 A;  5B7C A;  3ED3 A;  3G7I A;  5CP1 A;  1PKZ A;  2YP6 A;  1ML6 A;  3IDV A;  1TK8 B;  1EV9 A;  2V2G A;  2ES7 A;  3H1N A;  4WR4 A;  1OKT A;  4XS1 A;  2XPD A;  2N5A A;  1UN2 A;  2IJY A;  1B48 A;  4ZBD A;  4RUV A;  1FG4 A;  4TVE A;  3A2W A;  2C1Y A;  4KUN A;  2KP1 A;  2AB6 A;  3GKN A;  4XTS A;  2E7P A;  1K0B A;  3MAK A;  1SL1 B;  3ZIT A;  5A4W A;  1PX6 A;  2DJ3 A;  3KMN A;  4DVC A;  3DGQ A;  3GX8 A;  4PNG A;  3ERG A;  2YJ7 A;  1GH2 A;  5G5E A;  2F8A A;  1EEM A;  4IP6 A;  3FR9 A;  4JBB A;  1O7U A;  2P0G A;  4GRF A;  4LMW A;  4YQM A;  4MH2 A;  3N5O A;  2CAQ A;  5DAL A;  3D6I A;  2ON5 A;  2K8V A;  2H0I A;  4MK3 A;  5ID2 B;  4ZB9 A;  3TJB A;  1FVK A;  4V1A p;  1R7H A;  4OCE A;  1X0R A;  4TW5 A;  1FVJ A;  1WPI A;  3UAP A;  3LGC A;  1X9W B;  1EOG A;  3ME8 A;  2GZP A;  2VL2 A;  2IFQ A;  3LXT A;  4PQ1 A;  1T8E B;  4IJI A;  2IMI A;  5KN3 A;  3TJJ A;  3M9K A;  5B8A A;  1G6W A;  2OE1 A;  4WEY A;  1VF2 A;  2L4C A;  3F3R A;  3TOT A;  4WF5 A;  5D9T A;  3L4N A;  5GSS A;  4GWR A;  1B4Q A;  2AJQ B;  1YF0 A;  5ECI B;  3FEU A;  1A0F A;  2YCD A;  4IEL A;  3VPT A;  1AQX A;  2YWI A;  1K0A A;  3DVW A;  2VLT A;  1M99 A;  3ZIJ A;  4ECC A;  3Q18 A;  2BJX A;  4BA7 A;  2YWN A;  4MZW A;  5D9V A;  2CZ3 A;  1MEK A;  5COH A;  2I3Y A;  1THO A;  2MBS A;  1R4W A;  4POL A;  3CTG A;  1GSS A;  1YEX A;  2HT9 A;  4JED A;  4MA9 A;  2IME A;  3ZRD A;  4O5R A;  1HNC A;  14GS A;  2A4V A;  3VWX A;  1PL1 A;  5B8B A;  1Z6N A;  1TP9 A;  4Q5N A;  2VD0 A;  3IE3 A;  3TJF A;  3KP9 A;  2C3T A;  3IPZ A;  3VWV A;  1BX9 A;  2WGR A;  1YJ6 A;  3C73 A;  3GSS A;  3ZIV A;  1HD2 A;  2E2M A;  4D73 B;  1WMJ A;  1TJD A;  1TU8 A;  2O8V B;  3GYK A;  2O89 A;  3UVT A;  3PH9 A;  3VI5 A;  1SKS B;  3IXR A;  2HZE A;  11GS A;  2H0G A;  18GS A;  1Z9H A;  1FB0 A;  2GTU A;  4DSS A;  2CX4 A;  3O6T A;  1THX A;  1GTB A;  3VLN A;  4NPB A;  6GST A;  1RQM A;  2LRC A;  5KEJ A;  4MAB A;  2CVK A;  6GSU A;  4TXV A;  3TKS C;  3CRT A;  4FO5 A;  4POK A;  4IHU A;  4MPG A;  12GS A;  1TKD B;  1I5G A;  2H1D A;  2KP2 A;  3G7J A;  4IN0 A;  2L5L A;  5HR0 A;  3A3T A;  4GLT A;  2OKA A;  2VL9 A;  2P5R A;  22GS A;  3F8U A;  4NHW A;  2AHE A;  1TW9 A;  2CZ2 A;  2C8U A;  3IHQ A;  3WD6 A;  3CXG A;  3MWH A;  2QKE A;  4HU7 A;  3CSH A;  1ZYQ B;  3LYP A;  4K6X A;  1V98 A;  1EGO A;  1ACV A;  3ZMK A;  4QL9 A;  2EC4 A;  4BWS A;  3LWA A;  5HR2 A;  1YF1 A;  3FZ4 A;  3WGE A;  3KTB A;  3KJY A;  5ECQ B;  2B7J A;  2WS2 A;  1GSF A;  3HJO A;  1XPV A;  4I2T A;  1X5D A;  1QXH A;  1M2B A;  3QR6 A;  2GSQ A;  4KSO A;  2LST A;  2JSZ A;  2PUK C;  2CQ9 A;  4GSN A;  3GX0 A;  2AAW A;  2M46 A;  3RHC A;  2OAC A;  2GSS A;  4MZB A;  2H19 A;  2MYG A;  2N5F A;  4LL1 B;  4L5O A;  1K0N A;  2B1L A;  5DAL B;  5ECR B;  2MMZ A;  4MLY A;  5DAK A;  6GSV A;  3GKM A;  3UIW A;  2J9H A;  3US3 A;  2F3M A;  5ELA A;  1PKW A;  1T1V A;  2GT6 A;  2VCT A;  2C4J A;  2EIQ A;  2WZ9 A;  1TK5 B;  5JCU A;  2PVO C;  2XBI A;  4FYC A;  5IMC A;  3UL3 A;  3KEB A;  1M9B A;  3F6F A;  5IMV A;  1NHY A;  2IFQ B;  4TKY A;  5ECK B;  4DSQ A;  1UA5 A;  1O8W A;  1F9M A;  1N8J A;  2HYX A;  3WYW A;  5HFK A;  1XWC A;  2H66 A;  4WR5 A;  2YWO A;  3J7Y k;  5J3R A;  3CYN A;  1FB6 A;  4TOP A;  2H6Z A;  2J23 A;  2VM2 A;  3E3E A;  1B9X C;  2RM6 A;  1JZW A;  1PX7 A;  2H1G A;  5D73 A;  1WWJ A;  2VCV A;  1AW9 A;  1HQO A;  1C72 A;  3ZFL A;  3LOR A;  2NPB A;  2L59 A;  4GTU A;  1UVZ A;  4KH7 A;  3FW2 A;  1Q4J A;  2G2Q A;  3IAS 2;  1DSB A;  3TGZ A;  1XW9 A;  3TJG A;  4N30 A;  1A8Y A;  4HI7 A;  3HHV A;  1PQN A;  1IYH A;  2OBK A;  4WKW A;  5DJL A;  3L9V A;  4ECB A;  2MMA A;  5IOW A;  5KN2 A;  2GQM A;  4K2D A;  1AAZ A;  1WOU A;  1XXU A;  5L71 A;  3FR6 A;  3TKR A;  2VAF A;  2PMT A;  2O85 A;  1R5P A;  1T7P B;  5G31 A;  2R3X A;  4I97 A;  2Z9S A;  3FY7 A;  2AUV A;  3F9U A;  4HQS A;  5CRH A;  1S3A A;  4G9H A;  2HZE B;  3D4T A;  2H72 A;  3KMO A;  3RPN A;  4ULX A;  4WET A;  4DSS B;  3EU3 A;  1SKR B;  5J41 A;  5G1K A;  1XVQ A;  3TDG A;  3IR4 A;  1SEN A;  3GST A;  1YQ1 A;  4ZB6 A;  4K0N A;  2DC5 A;  3D4M A;  2HXK A;  4IP1 A;  3GMF A;  4ILF A;  1WJK A;  3L0H A;  1TTZ A;  1JLW A;  2VO4 A;  1BED A;  4O7H A;  1PMT A;  3F4S A;  1GNW A;  3HVV A;  5A4V A;  2GLR A;  4L5L A;  4X43 A;  4X1U A;  20GS A;  3SWL A;  4K8M A;  3GFK A;  7GSS A;  4I6X A;  4ZB8 A;  3DWV A;  1SK2 A;  1SD9 A;  2L57 A;  5DQS A;  5LNK e;  4JR6 A;  2LQQ A;  2LUS A;  2YOI A;  3BJ5 A;  2WCI A;  2IMF A;  5EY6 A;  2X8G A;  4MZC A;  1NW2 A;  5HR1 A;  2DJ2 A;  4JE1 A;  10GS A;  4PQH A;  2OJL A;  2VUP A;  3VFI A;  4KCE A;  2VD1 A;  2B1K A;  2A2R A;  3PIN A;  4ZBA A;  4F2I A;  4XRA A;  3J7Y b;  2XC2 A;  3GKX A;  4ZL9 A;  1K0M A;  3C8E A;  3ZL5 A;  4MF6 A;  1OC8 A;  5ECL B;  3A2X A;  4XCS A;  1YKC A;  5INY A;  3ZML A;  1N2A A;  2LJA A;  2MMO A;  3LG6 A;  4OFM A;  1XIY A;  2LS5 A;  3W8J A;  1DE2 A;  1X9S B;  2DJJ A;  13GS A;  2XHF A;  4KDU A;  3GL5 A;  5DAK B;  3FK8 A;  3GRX A;  4YQU A;  2C3N A;  1AC1 A;  1ON4 A;  1PGT A;  5F07 A;  3N9J A;  5J5N A;  1X9M B;  3H79 A;  1ZZY A;  3IK7 A;  3HD5 A;  1XFL A;  3CMI A;  1B8X A;  2FWE A;  3ZFB A;  3DIE A;  4CDO A;  2GGT A;  4IKH A;  4HUA A;  4JU5 A;  1TRU A;  3GV1 A;  3DYR A;  2KOK A;  4E8H A;  4YAP A;  3WGD A;  2V1M A;  4IQ1 A;  2LEG A;  4WBJ A;  1QFN A;  1G0T A;  5JCG A;  4K7N A;  3WT1 A;  3LEF A;  4POM A;  3A2V A;  2FA4 A;  4F9Z A;  16GS A;  4DEJ A;  2B3S A;  2E0Q A;  1EP8 A;  3HVS A;  4G10 A;  1XWK A;  2CA8 A;  2QSI A;  3QAV A;  4PUA A;  1Y6E A;  4ML6 A;  2VIM A;  2H0H A;  2H1B A;  3GKK A;  3TKP A;  3ZZX A;  4F0B A;  2HE3 A;  3TKS E;  1GL8 A;  1LBK A;  4F0C A;  3NZN A;  1FOV A;  1ERW A;  2QC7 A;  4PXO A;  4XRD A;  4NV5 A;  1XWG A;  3GHA A;  2HRN A;  3GN3 A;  5JWQ B;  3L78 A;  3U5R E;  1F3B A;  4J2F A;  4K0G A;  3GTU A;  1SL0 B;  4BPY A;  2PGT A;  3TJK A;  2F9S A;  1BJX A;  1A2J A;  2DIZ A;  2HFD A;  2X8C A;  4KDY A;  4POB A;  2R37 A;  3F0I A;  1Q98 A;  3HXS A;  4NV2 A;  2VLU A;  4LL4 B;  2JU5 A;  1F6M C;  4KB3 A;  4BL7 A;  5H5R A;  2KLX A;  4HOJ A;  4KND A;  4NAX A;  5JCW A;  2ZNM A;  1SK0 A;  6GSX A;  2TIR A;  2X99 A;  4V2L A;  1F37 A;  3L9U A;  4YQV A;  4MJC A;  5HR3 A;  2H01 A;  1VRS D;  3HA9 A;  4IQA A;  4MDC A;  5G1L A;  1O8X A;  1SJ6 A;  1O73 A;  5G2Z A;  2GQK A;  1AIU A;  1E2Y A;  1U6T A;  5ABR A;  2YN1 A;  1A23 A;  1PD2 1;  3TRQ A;  3UBK A;  2GT5 A;  1E6B A;  2H70 A;  3EIN A;  5LD0 A;  5D8I A;  2NVL A;  2FNO A;  3ZVJ D;  1OE7 A;  3EC3 A;  4KCA A;  4OWY A;  1GSU A;  2YNX A;  4OMV A;  2TRC P;  5GST A;  4O32 A;  3HZ8 A;  3LJR A;  4MJE A;  3UVH A;  2PN8 A;  4X0X A;  1J9B A;  4KX4 A;  1HNB A;  1KTE A;  1ZYE A;  1FHE A;  5IMF A;  1LU4 A;  4YH2 A;  2DMM A;  3GH9 A;  3C71 A;  1BQ7 A;  1EZK A;  1V9W A;  3Q74 A;  4GST A;  3IK9 A;  2LJK A;  2I1U A;  2JZS A;  1TDI A;  1ZMA A;  1VF1 A;  3P8W A;  1AQW A;  2O87 A;  5ECM B;  1W4V A;  4MF7 A;  2YZH A;  2LNT A;  2FCH A;  3M9J A;  4GQF A;  4PUR A;  1GSD A;  4FH8 A;  2BMX A;  4AJ8 A;  4O92 A;  2GQL A;  3DVX A;  1JFU A;  3AY8 A;  5F0G A;  5GAP D;  4NHZ A;  5AIS A;  3CBU A;  3HVX A;  1S3C A;  4IVF A;  17GS A;  2YPM A;  2C80 A;  4MH3 A;  2GS3 A;  1EWX A;  1UC7 A;  3DEX A;  3D22 A;  1FW1 A;  1TRS A;  3I69 A;  3RHB A;  3MNG A;  1K0O A;  3UAR A;  1AXD A;  1FAA A;  4AJ7 A;  1GUK A;  1RK4 A;  3PR8 A;  1SYX A;  2PU9 C;  4I2U A;  4TR4 A;  3CRU A;  4HU9 A;  4AJ6 A;  1EP7 A;  3LXZ A;  1OE8 A;  3F6D A;  4ZXG A;  2I81 A;  2L6D A;  2FHE A;  2V32 A;  3LQ7 A;  4JR4 A;  4QL7 A;  4F82 A;  5IIZ A;  4PX1 A;  1EEJ A;  2WJU A;  1GSE A;  1DUG A;  2WFC A;  3RBT A;  3H4K A;  4KE3 A;  3O3T A;  3Q6O A;  5AGY A;  2YJH A;  3I43 A;  1GLQ A;  1XVW A;  2FWG A;  2G0F A;  1NHO A;  2JAC A;  2GST A;  1K0C A;  1TU7 A;  4KDX A;  3W8S A;  3GL3 A;  1YEP A;  3TKS A;  2KHP A;  4YAV A;  4N0V A;  2H73 A;  5ELG A;  2A2S A;  2VCX A;  2DJ1 A;  2L6C A;  4N10 A;  3H8Q A;  5G30 A;  4ZBB A;  1Z6M A;  1Z5Y E;  1PN9 A;  3FZA A;  4ZIL A;  4FYU A;  5J9B A;  1B4P A;  3NIV A;  4K9Z A;  3D5J A;  4WXT A;  2LRT A;  4XS4 B;  1DE1 A;  3EVI A;  2H30 A;  5IPG A;  4TR1 A;  2DSA A;  2ON7 A;  1TRW A;  4GXZ A;  3KIJ A;  1HNA A;  1EV4 A;  3EYT A;  1TK0 B;  4LLR A;  1QGV A;  1G6Y A;  1M0U A;  2WDU A;  3GTU B;  1MDJ A;  1XW6 A;  2H76 A;  3GH6 A;  4CW9 A;  3E9J B;  1A2L A;  3HCZ A;  5DQY A;  1GSY A;  1VF4 A;  4P3Y B;  4FYB A;  3FRC A;  1SJI A;  3HYP A;  3CTF A;  1T4Y A;  4EE0 A;  1Y25 A;  3IOS A;  4BVX A;  3LSZ A;  4XS6 A;  5ECS A;  2V6K A;  3QMX A;  3ZTL A;  3M3M A;  1GTU A;  1KEB A;  4KA0 A;  5IOX A;  3MSZ A;  3GUR A;  1S3D A;  1DBY A;  2NBS A;  2JAD A;  1OC3 A;  2H8L A;  3TUE A;  2B5Y A;  1MDK A;  1MDI A;  2R2J A;  2AV4 A;  4EKZ A;  1GRX A;  4ZIJ A;  3QFA C;  1XZO A;  4PGT A;  4KAE A;  2IL3 A;  2HRF A;  4EUY A;  3TRP A;  3M8N A;  2H1A A;  3ERF A;  4TRX A;  1WRY A;  4ML1 A;  1R5A A;  5KN1 A;  1JZD A;  2YV9 A;  4FIW A;  1LJR A;  4I5Q A;  5G5F A;  4AGS A;  1GTA A;  3APS A;  5IQY A;  1GWC A;  2P5Q A;  4RQR A;  2R5G A;  2EIR A;  3KM6 A;  2PWJ A;  2FA8 A;  1U3I A;  3U6V A;  1U88 A;  1Z7P A;  2OA7 A;  3QCP A;  1GLP A;  2IMK A;  2L4Q A;  2K6V A;  2GZY A;  5D9W A;  3VI7 A;  1MTC A;  3C1R A;  5E59 A;  2OE0 A;  2LRN A;  2WB9 A;  4H86 A;  1JHB A;  2CVD A;  4NMU A;  2MMN A;  3FZ9 A;  1M2A A;  1OC9 A;  1YY7 A;  4OO4 A;  4RI7 A;  5A4U A;  1A2M A;  5DDL A;  1T00 A;  4N0Z A;  5DCH A;  2HSY A;  1PSQ A;  4GCI A;  5JWO B;  3VWW A;  5F06 A;  4ACS A;  5LCZ A;  1X5C A;  3KXO A;  1EGR A;  1IYI A;  3KTL A;  1XOA A;  5IPH A;  1SJZ A;  5D96 A;  5EPF A;  3DKS A;  3VUR A;  1QUW A;  3EWL A;  1YZX A;  4G19 A;  1GUL A;  5GZZ B;  1SD8 A;  3UMA A;  4ZL8 A;  2JZT A;  3I6A A;  4J57 E;  1ERU A;  5C04 A;  3G7Y A;  1GSQ A;  2JL4 A;  4BVY A;  1HYU A;  2C0E A;  2LKU A;  2IPA A;  1MD3 A;  1GP1 A;  3KP8 A;  4EO3 A;  4HZ2 A;  5D93 A;  1XCC A;  5CO3 A;  1V57 A;  3F4R A;  2B5X A;  1XBS A;  1JZR A;  3IA1 A;  2PPT A;  1G7O A;  3WT2 A;  2DJK A;  4OO5 A;  3IC4 A;  3P7X A;  6GSY A;  19GS A;  4OFT A;  2L5O A;  1K3L A;  2NDO A;  2TRX A;  3FYG A;  5CRE A;  3GIX A;  1M7T A;  2EIO A;  3F63 A;  3UOM A;  3QFB C;  4QQ7 A;  2B7K A;  1QK8 A;  5DVB A;  2MZC A;  1NM3 A;  2N5B A;  4MMM A;  5KN0 A;  4OFN A;  5AN1 A;  2GVP A;  3VPQ A;  3ZRE A;  4GQC A;  2DLX A;  3ZYW A;  4HEA 2;  3TCO A;  1TI3 A;  1Z3E A;  1ST9 A;  4DSR A;  1G7E A;  5A5K A;  2PER A;  2GSR A;  4HJ2 A;  1TI1 A;  2VCW A;  2IMD A;  1CQH A;  3TKQ A;  1WIK A;  3P90 A;  2DML A;  2WRT A;  4LA1 A;  5IMD A;  5ECP B;  3BCI A;  2MBT A;  2ALB A;  1JZO A;  4TR1 B;  5J4U A;  2RM5 A;  3FHK A;  1ZCP A;  1ZGN A;  1U3A A;  1H75 A;  5E4W A;  3TB2 A;  4Z7X A;  3BBY A;  3H93 A;  5CRD A;  1Z7R A;  4XS4 A;  3HZ4 A;  4BWQ A;  5IO0 A;  3ISO A;  3SBC A;  3C7M A;  4KGI A;  4E8E A;  2GDR A;  2PBJ A;  2CAI A;  4J56 E;  1GUM A;  3APO A;  2HNL A;  5B6N A;  1QMV A;  2FUG 2;  2CX3 A;  3L9S A;  3RAZ A;  4XIH A;  3TOU A;  2K18 A;  2CT6 A;  1ERT A;  3C1S A;  5B6M A;  2XPE A;  4MCU A;  2YZU A;  5HFG A;  2HSH A;  3UEM A;  2P31 A;  4KSM A;  2NTO A;  1RW1 A;  2X8H A;  4TXO A;  2OBI A;  3CSJ A;  1AUC A;  2HZF A;  4G2E A;  3W6G A;  3K8N A;  2IIY A;  4EVM A;  1O85 A;  5CNW A;  2I4A A;  4K7O A;  4HJM A;  1A24 A;  4ISD A;  4JRR A;  1ERV A;  2FWH A;  3R2Q A;  2FD3 A;  1K0D A;  1KBN A;  3IAM 2;  5DCG A;  4F03 A;  4L0U A;  4L8E A;  1XW5 A;  4PQI A;  1XWA A;  3APQ A;  3HY2 A;  1GNE A;  1WE0 A;  1V58 A;  4V1A g;  1M9A A;  2CV4 A;  5J9C A;  3BCK A;  3HJP A;  3RDW A;  1OC9 B;  2K9F A;  3EU4 A;  4Q5F A;  3S9F A;  2H6Y A;  1X5E A;  4EL1 A;  4GF0 A;  2VOC A;  5AIX A;  4ZL7 A;  1TRV A;  3BD2 A;  1BYE A;  5IMA A;  2ZCT A;  1XOB A;  5CRW A;  5D9X A;  1OKD A;  4HS1 A;  4EXJ A;  3QAW A;  3HDC A;  1I9D A;  3D21 A;  4Q5Q A;  2DIY A;  4ID0 A;  2DBC A;  1F3A A;  2RII A;  2VM1 A;  2M72 A;  3QOU A;  3UBL A;  3E0U A;  1USB A;  3DML A;  2FWF A;  2LNS A;  4RI6 A;  1T3B A;  4WF4 A;  4MPF A;  4TN8 A;  2REM A;  4NWY A;  4MJB A;  4V2N A;  5CAX A;  5EL8 A;  2B5E A;  4IS0 A;  1JLV A;  1KNG A;  3Q19 A;  1ZOF A;  3VK9 A;  3DXB A;  3FZ5 A;  3GA4 A;  4NXI A;  2R6K A;  3FKF A;  4EC0 A;  2C0F A;  3OR5 A;  3MDK A;  2BTO T;  2O7K A;  2JZR A;  3DD3 A;  2H74 A;  2I9H A;  3ZVJ A;  4PNF A;  5AIV A;  5F05 A;  1GUH A;  3KZQ A;  5C00 A;  4ECI A;  4Q5R A;  5HQP A;  2FLS A;  2IWT A;  2F51 A;  1EOH A;  4K7I A;  1XWB A;  2OAD A;  2M80 A;  2QGV A;  1K3O A;  3IV4 A;  3LFL A;  3KH9 A;  1B9Y C;  5FHI A;  4IJ3 A;  4RQX A;  3KGK A;  5ID2 A;  1SU9 A;  2DJ0 A;  5ECN B;  1OAZ A;  3IBH A;  5HFI A;  5DBQ A;  2VCZ A;  3EMX A;  3GNJ A;  3FR3 A;  4OCF A;  3ZLP A;  4GSS A;  2VLV A;  1V2A A;  2PVQ A;  5GAN D;  1PL2 A;  1T4Z A;  3A5W A;  3DRN A;  3VWU A;  5ECO B;  1SL2 B;  4HQZ A;  1OYJ A;  1TXX A;  2VL3 A;  3QAG A;  3LYK A;  4XHM A;  1ZL9 A;  8GSS A;  4KW6 A;  4CHS A;  4MF5 A;  4JZQ A;  3M0F A;  4N11 A;  1OVN A;  2RLI A;  4IBP A;  2X64 A;  3M1G A;  3CSI A;  1O81 A;  1J0F A;  1TOF A;  3ME7 A;  3IRA A;  2B6M A;  4EDY A;  1QQ2 A;  4HZ4 A;  5EVO A;  1W89 A;  1GTI A;  4TR3 A;  2LJR A;  5H5Q A;  4MJA A;  3NOF A;  3V1W A;  3JCM L;  4TXO B;  2LV3 A;  3KH7 A;  1F2E A;  3F4T A;  4I8B A;  5DJM A;  3UJ1 A;  3F3Q A;  3QPM A;  1WP0 A;  1YDK A;  1V40 A;  3O76 A;  4K1F A;  3PGT A;  3I9V 2;  2C0D A;  2JSY A;  4AF2 A;  3HKR A;  1K3Y A;  2LTK A;  3G9B A;  2RUF A;  2C0G A;  5F8B A;  2YAN A;  4PUF C;  4OD7 A;  2V6O A;  2GZZ A;  4LMV A;  4HDE A;  2RUE A;  1CQG A;  4V2M A;  4D73 A;  1U87 A;  2WUL A;  1M2D A;  5IO2 A;  1SK1 A;  2AYT A;  4IGJ A;  2F8F A;  1A0R P;  3TRX A;  1BG5 A;  2K8S A;  6GSW A;  1SKW B;  1ILO A;  3KCM A;  2HI7 A;  3EE2 A;  1J08 A;  1BAY A;  5CYY A;  2VL2 C;  3EUR A;  3ERW A;  3KD0 A;  3GUS A;  3P2A A;  4L0W A;  1PA3 A;  2R4V A;  1URM A;  5IMZ A;  4EF0 A; 
#chains in the Genus database with same CATH topology
 2X49 A;  2C3Q A;  3HJM A;  4MP4 A;  1A8L A;  5H5S A;  5ENU A;  2ZUP A;  2XBQ A;  3QD9 A;  2FGX A;  6GSS A;  1ABA A;  4WBR D;  2VCQ A;  1VGL A;  2D2Z A;  2FY6 A;  3FMW A;  5ECH B;  4ECJ A;  4EDZ A;  4K2X A;  5FT3 A;  2OE3 A;  4BIK A;  2E2G A;  4IW9 A;  1YKA A;  1PRX A;  1MD4 A;  3BOA A;  2YV7 A;  5CRG A;  3RPP A;  2V41 A;  4TR0 A;  1SYR A;  2YWM A;  3WGX A;  5IM9 A;  3D0Z A;  1VF3 A;  1H4O A;  1O6J A;  2LQO A;  5JWR B;  1NSW A;  2H75 A;  2HLS A;  9GSS A;  2CVB A;  2KUC A;  2H6X A;  2H71 A;  1AQV A;  3EMP A;  5FWG A;  2IN3 A;  3QDN A;  1FO5 A;  1R26 A;  5B7C A;  3ED3 A;  3G7I A;  5CP1 A;  1PKZ A;  2YP6 A;  1ML6 A;  3IDV A;  1TK8 B;  1EV9 A;  2V2G A;  2ES7 A;  3H1N A;  4WR4 A;  1OKT A;  4XS1 A;  2XPD A;  2N5A A;  1UN2 A;  2IJY A;  1B48 A;  4ZBD A;  4RUV A;  1FG4 A;  1M3J A;  2HRA A;  4TVE A;  3A2W A;  2C1Y A;  4KUN A;  2KP1 A;  2AB6 A;  3GKN A;  4XTS A;  2E7P A;  1K0B A;  3MAK A;  1SL1 B;  3ZIT A;  5A4W A;  1PX6 A;  2DJ3 A;  3KMN A;  4DVC A;  3DGQ A;  3GX8 A;  4PNG A;  3ERG A;  2YJ7 A;  1GH2 A;  5G5E A;  2F8A A;  1EEM A;  4IP6 A;  3FR9 A;  4JBB A;  1O7U A;  2P0G A;  4GRF A;  4LMW A;  4YQM A;  4MH2 A;  3N5O A;  2CAQ A;  5DAL A;  3D6I A;  2ON5 A;  2K8V A;  2H0I A;  4MK3 A;  5ID2 B;  4ZB9 A;  3TJB A;  1FVK A;  4V1A p;  1R7H A;  4OCE A;  1X0R A;  4TW5 A;  1FVJ A;  1WPI A;  3UAP A;  1M3I A;  3LGC A;  1X9W B;  1EOG A;  3ME8 A;  2GZP A;  2VL2 A;  2IFQ A;  3LXT A;  4PQ1 A;  1T8E B;  4IJI A;  2IMI A;  5KN3 A;  3TJJ A;  3M9K A;  5B8A A;  1G6W A;  2OE1 A;  4WEY A;  1VF2 A;  2L4C A;  3F3R A;  3TOT A;  4WF5 A;  5D9T A;  3L4N A;  5GSS A;  4GWR A;  1B4Q A;  2R0P A;  2AJQ B;  1YF0 A;  5ECI B;  3FEU A;  1A0F A;  2YCD A;  4IEL A;  3VPT A;  1AQX A;  2YWI A;  1K0A A;  3DVW A;  2VLT A;  1M99 A;  3ZIJ A;  4ECC A;  3Q18 A;  2BJX A;  4BA7 A;  2YWN A;  4MZW A;  5D9V A;  2CZ3 A;  1MEK A;  5COH A;  2I3Y A;  1THO A;  2MBS A;  1R4W A;  4POL A;  3CTG A;  1GSS A;  1YEX A;  2HT9 A;  4JED A;  4MA9 A;  2IME A;  3ZRD A;  4O5R A;  1HNC A;  14GS A;  2A4V A;  3VWX A;  1PL1 A;  5B8B A;  1Z6N A;  1TP9 A;  4Q5N A;  2VD0 A;  3IE3 A;  3TJF A;  3KP9 A;  2C3T A;  3IPZ A;  3VWV A;  1BX9 A;  2WGR A;  1YJ6 A;  3C73 A;  3GSS A;  4A5P A;  3ZIV A;  1HD2 A;  2E2M A;  4D73 B;  1WMJ A;  1TJD A;  1TU8 A;  2O8V B;  3GYK A;  4CY6 A;  2O89 A;  3UVT A;  3PH9 A;  3VI5 A;  1SKS B;  3IXR A;  2HZE A;  11GS A;  2H0G A;  18GS A;  1Z9H A;  1FB0 A;  2GTU A;  4PTS A;  4DSS A;  2CX4 A;  3MIX A;  4G0I A;  3O6T A;  1THX A;  1GTB A;  3VLN A;  4NPB A;  6GST A;  1RQM A;  4YKG A;  2LRC A;  5KEJ A;  4MAB A;  2CVK A;  6GSU A;  4TXV A;  3TKS C;  3CRT A;  4FO5 A;  4POK A;  4IHU A;  4MPG A;  12GS A;  1TKD B;  1I5G A;  2H1D A;  2KP2 A;  3G7J A;  4IN0 A;  2L5L A;  5HR0 A;  3A3T A;  4GLT A;  2OKA A;  2VL9 A;  2P5R A;  22GS A;  3F8U A;  4NHW A;  2AHE A;  1TW9 A;  2CZ2 A;  2C8U A;  3IHQ A;  3WD6 A;  3CXG A;  3MWH A;  2QKE A;  4HU7 A;  3CSH A;  1ZYQ B;  4Z2R A;  3LYP A;  4K6X A;  1V98 A;  1EGO A;  1ACV A;  3ZMK A;  4QL9 A;  2EC4 A;  4BWS A;  3LWA A;  5HR2 A;  1YF1 A;  3FZ4 A;  3WGE A;  3KTB A;  3KJY A;  5ECQ B;  2B7J A;  2WS2 A;  2UZ8 A;  1GSF A;  3HJO A;  1XPV A;  4I2T A;  1X5D A;  1QXH A;  2DKH A;  1M2B A;  3QR6 A;  3PPU A;  2GSQ A;  4KSO A;  2LST A;  2JSZ A;  2PUK C;  2CQ9 A;  4GSN A;  3GX0 A;  2AAW A;  2M46 A;  3RHC A;  2OAC A;  2GSS A;  4MZB A;  2H19 A;  2MYG A;  2N5F A;  4LL1 B;  4L5O A;  1K0N A;  2B1L A;  5DAL B;  5ECR B;  2MMZ A;  4MLY A;  5DAK A;  6GSV A;  3GKM A;  3UIW A;  2J9H A;  3US3 A;  2F3M A;  5ELA A;  1PKW A;  1T1V A;  2GT6 A;  2VCT A;  2C4J A;  2EIQ A;  2WZ9 A;  1TK5 B;  5JCU A;  2PVO C;  2XBI A;  4FYC A;  5IMC A;  3UL3 A;  3KEB A;  1M9B A;  3F6F A;  5IMV A;  1NHY A;  2IFQ B;  4TKY A;  3IC8 A;  5ECK B;  4DSQ A;  1UA5 A;  1O8W A;  1F9M A;  1N8J A;  2HYX A;  3WYW A;  5HFK A;  1XWC A;  2H66 A;  4WR5 A;  2YWO A;  3J7Y k;  5J3R A;  3CYN A;  1FB6 A;  4TOP A;  2H6Z A;  2J23 A;  2VM2 A;  3E3E A;  1B9X C;  2RM6 A;  1JZW A;  1PX7 A;  2H1G A;  5D73 A;  1WWJ A;  2VCV A;  1AW9 A;  1HQO A;  1C72 A;  2QA2 A;  3ZFL A;  3LOR A;  2NPB A;  2L59 A;  4GTU A;  1UVZ A;  4KH7 A;  3FW2 A;  1Q4J A;  2G2Q A;  3IAS 2;  1DSB A;  3TGZ A;  1XW9 A;  3TJG A;  3LW9 A;  4N30 A;  1A8Y A;  4HI7 A;  3HHV A;  1PQN A;  1IYH A;  2OBK A;  4WKW A;  5DJL A;  3L9V A;  4ECB A;  2MMA A;  5IOW A;  5KN2 A;  2GQM A;  4K2D A;  1AAZ A;  1WOU A;  4BL7 B;  1XXU A;  5L71 A;  3FR6 A;  3TKR A;  2VAF A;  2PMT A;  2O85 A;  1R5P A;  1T7P B;  5G31 A;  2R3X A;  4I97 A;  2Z9S A;  3FY7 A;  2AUV A;  3F9U A;  4HQS A;  5CRH A;  1S3A A;  4G9H A;  2HZE B;  3D4T A;  2H72 A;  3KMO A;  4EIP A;  3RPN A;  4ULX A;  4WET A;  4DSS B;  3EU3 A;  1SKR B;  5J41 A;  5G1K A;  1XVQ A;  3TDG A;  3IR4 A;  1SEN A;  4HSC X;  3GST A;  1YQ1 A;  4ZB6 A;  4K0N A;  2DC5 A;  3D4M A;  2HXK A;  4IP1 A;  3GMF A;  4ILF A;  1WJK A;  3L0H A;  1TTZ A;  1JLW A;  2VO4 A;  1BED A;  4O7H A;  1PMT A;  3F4S A;  1GNW A;  3HVV A;  5A4V A;  4EIQ A;  2GLR A;  4L5L A;  4X43 A;  4X1U A;  20GS A;  3SWL A;  4K8M A;  3GFK A;  7GSS A;  4I6X A;  4ZB8 A;  3DWV A;  1SK2 A;  1SD9 A;  2L57 A;  5DQS A;  5LNK e;  4JR6 A;  2LQQ A;  2LUS A;  2YOI A;  3BJ5 A;  2WCI A;  2IMF A;  5EY6 A;  2X8G A;  4MZC A;  1NW2 A;  5HR1 A;  2DJ2 A;  4JE1 A;  10GS A;  4PQH A;  2OJL A;  2VUP A;  3VFI A;  4KCE A;  2VD1 A;  2B1K A;  2A2R A;  3PIN A;  4ZBA A;  4F2I A;  4XRA A;  3J7Y b;  2XC2 A;  3GKX A;  4ZL9 A;  1K0M A;  2X4A A;  3C8E A;  3ZL5 A;  4MF6 A;  1OC8 A;  5ECL B;  3A2X A;  4XCS A;  1YKC A;  5INY A;  3ZML A;  1N2A A;  2LJA A;  2MMO A;  3LG6 A;  4OFM A;  1XIY A;  2LS5 A;  3W8J A;  1DE2 A;  1X9S B;  2DJJ A;  13GS A;  2XHF A;  4KDU A;  3GL5 A;  5DAK B;  3FK8 A;  3GRX A;  4YQU A;  2C3N A;  1AC1 A;  1ON4 A;  1PGT A;  5F07 A;  3N9J A;  5J5N A;  1X9M B;  3H79 A;  1ZZY A;  3IK7 A;  3HD5 A;  1XFL A;  3CMI A;  1B8X A;  2FWE A;  3ZFB A;  3DIE A;  5KOX A;  2HSM A;  4CDO A;  2GGT A;  4IKH A;  4HUA A;  4JU5 A;  1TRU A;  3GV1 A;  3DYR A;  2KOK A;  4E8H A;  4YAP A;  3WGD A;  4X4J A;  2V1M A;  4IQ1 A;  2LEG A;  4WBJ A;  1QFN A;  1G0T A;  5JCG A;  4K7N A;  3WT1 A;  3LEF A;  4POM A;  3A2V A;  2FA4 A;  4F9Z A;  16GS A;  4DEJ A;  2B3S A;  2E0Q A;  1EP8 A;  3HVS A;  4G10 A;  1XWK A;  2CA8 A;  2QSI A;  3QAV A;  4PUA A;  1Y6E A;  4ML6 A;  2VIM A;  2H0H A;  2H1B A;  3GKK A;  3TKP A;  3ZZX A;  4F0B A;  2HE3 A;  3TKS E;  1GL8 A;  1LBK A;  4F0C A;  3NZN A;  1FOV A;  1ERW A;  2QC7 A;  4PXO A;  4XRD A;  4NV5 A;  1XWG A;  3GHA A;  2HRN A;  3GN3 A;  5JWQ B;  3L78 A;  3U5R E;  1F3B A;  4J2F A;  4K0G A;  3GTU A;  1SL0 B;  4BPY A;  2PGT A;  3TJK A;  2F9S A;  1BJX A;  1A2J A;  2DIZ A;  2HFD A;  4KDY A;  2X8C A;  4POB A;  2R37 A;  3F0I A;  1Q98 A;  3HXS A;  4NV2 A;  2VLU A;  4LL4 B;  2JU5 A;  1F6M C;  4KB3 A;  4BL7 A;  5H5R A;  2KLX A;  4HOJ A;  4KND A;  4NAX A;  5JCW A;  2ZNM A;  1SK0 A;  6GSX A;  2TIR A;  2X99 A;  4V2L A;  1F37 A;  3L9U A;  4YQV A;  4MJC A;  5HR3 A;  2H01 A;  1VRS D;  3HA9 A;  4IQA A;  4MDC A;  5G1L A;  1O8X A;  1SJ6 A;  1O73 A;  5G2Z A;  2GQK A;  1AIU A;  1E2Y A;  1U6T A;  5ABR A;  2YN1 A;  1A23 A;  1PD2 1;  3TRQ A;  3UBK A;  2GT5 A;  1E6B A;  2H70 A;  3EIN A;  5LD0 A;  5D8I A;  2NVL A;  2FNO A;  3ZVJ D;  1OE7 A;  3EC3 A;  4KCA A;  4OWY A;  1GSU A;  2YNX A;  4OMV A;  2TRC P;  5GST A;  4O32 A;  3HZ8 A;  3LJR A;  4MJE A;  3UVH A;  2PN8 A;  4X0X A;  1J9B A;  4KX4 A;  1HNB A;  1KTE A;  1ZYE A;  1FHE A;  5IMF A;  1LU4 A;  4YH2 A;  2DMM A;  3GH9 A;  3C71 A;  1BQ7 A;  1EZK A;  1V9W A;  3Q74 A;  4GST A;  3IK9 A;  2LJK A;  2I1U A;  2JZS A;  1TDI A;  1ZMA A;  1VF1 A;  3P8W A;  1AQW A;  2O87 A;  5ECM B;  1W4V A;  4MF7 A;  2YZH A;  2LNT A;  2FCH A;  3M9J A;  4GQF A;  4PUR A;  1GSD A;  4FH8 A;  2BMX A;  4AJ8 A;  4O92 A;  2GQL A;  3DVX A;  1JFU A;  3AY8 A;  5F0G A;  5GAP D;  4NHZ A;  5AIS A;  3CBU A;  3HVX A;  1S3C A;  4IVF A;  17GS A;  2YPM A;  2C80 A;  4MH3 A;  4USS A;  2GS3 A;  1EWX A;  1UC7 A;  3DEX A;  3D22 A;  1FW1 A;  1TRS A;  3I69 A;  3RHB A;  3MNG A;  1K0O A;  3UAR A;  1AXD A;  1FAA A;  4AJ7 A;  1GUK A;  1RK4 A;  3PR8 A;  1XG8 A;  1SYX A;  2PU9 C;  4I2U A;  4TR4 A;  3CRU A;  4HU9 A;  4AJ6 A;  1EP7 A;  3LXZ A;  1PFO A;  1OE8 A;  3F6D A;  4ZXG A;  2I81 A;  2L6D A;  3EPT A;  2FHE A;  2V32 A;  3LQ7 A;  4JR4 A;  4QL7 A;  4F82 A;  5IIZ A;  4PX1 A;  1EEJ A;  4ICY A;  2WJU A;  1GSE A;  1DUG A;  2WFC A;  3RBT A;  3H4K A;  4KE3 A;  3O3T A;  3Q6O A;  5AGY A;  2YJH A;  3I43 A;  1GLQ A;  1XVW A;  2FWG A;  2G0F A;  1NHO A;  2JAC A;  2GST A;  1K0C A;  1TU7 A;  4KDX A;  2R0G A;  3W8S A;  3GL3 A;  1YEP A;  3TKS A;  2KHP A;  4YAV A;  4N0V A;  2H73 A;  5ELG A;  2A2S A;  2VCX A;  2DJ1 A;  2L6C A;  4N10 A;  3H8Q A;  5G30 A;  4ZBB A;  1Z6M A;  1Z5Y E;  1PN9 A;  3FZA A;  4ZIL A;  4FYU A;  5J9B A;  1B4P A;  3NIV A;  4K9Z A;  3D5J A;  4WXT A;  2LRT A;  4XS4 B;  1DE1 A;  3EVI A;  2H30 A;  5IPG A;  4TR1 A;  2DSA A;  2ON7 A;  1TRW A;  4GXZ A;  3KIJ A;  1HNA A;  1EV4 A;  3EYT A;  1TK0 B;  4LLR A;  1QGV A;  1G6Y A;  1M0U A;  2WDU A;  3GTU B;  1MDJ A;  1XW6 A;  2H76 A;  3GH6 A;  4CW9 A;  3E9J B;  1A2L A;  3HCZ A;  5DQY A;  1GSY A;  1VF4 A;  4P3Y B;  4FYB A;  3FRC A;  1SJI A;  3HYP A;  3CTF A;  1T4Y A;  4EE0 A;  1Y25 A;  3IOS A;  4BVX A;  3LSZ A;  4XS6 A;  5ECS A;  2V6K A;  3QMX A;  3ZTL A;  3M3M A;  1GTU A;  1KEB A;  4KA0 A;  5IOX A;  3MSZ A;  2HRK A;  1S3D A;  3GUR A;  1DBY A;  2NBS A;  2JAD A;  1OC3 A;  2H8L A;  3TUE A;  2B5Y A;  2QA1 A;  1MDK A;  1MDI A;  2R2J A;  2AV4 A;  4EKZ A;  1GRX A;  4ZIJ A;  3QFA C;  1XZO A;  4PGT A;  4KAE A;  2IL3 A;  2HRF A;  4EUY A;  3TRP A;  3M8N A;  2H1A A;  3ERF A;  4TRX A;  1WRY A;  4ML1 A;  1R5A A;  5KN1 A;  1JZD A;  2YV9 A;  4FIW A;  1LJR A;  4I5Q A;  5G5F A;  4AGS A;  4CY8 A;  1GTA A;  3APS A;  5IQY A;  1GWC A;  2P5Q A;  4RQR A;  2R5G A;  2EIR A;  4G0K A;  3KM6 A;  2PWJ A;  2FA8 A;  1U3I A;  3U6V A;  1U88 A;  1Z7P A;  2OA7 A;  3QCP A;  1GLP A;  2IMK A;  2L4Q A;  2K6V A;  2GZY A;  5D9W A;  3HVN A;  3VI7 A;  1MTC A;  3C1R A;  5E59 A;  2OE0 A;  2LRN A;  2WB9 A;  4H86 A;  5KOW A;  1JHB A;  2CVD A;  4NMU A;  2MMN A;  3FZ9 A;  1M2A A;  1OC9 A;  1YY7 A;  4OO4 A;  4RI7 A;  5A4U A;  1A2M A;  5DDL A;  1T00 A;  4N0Z A;  4Z2U A;  5DCH A;  2HSY A;  1PSQ A;  4GCI A;  5JWO B;  3VWW A;  5F06 A;  4ACS A;  5LCZ A;  1X5C A;  3KXO A;  1EGR A;  1IYI A;  3KTL A;  1XOA A;  5IPH A;  1SJZ A;  5D96 A;  5EPF A;  3DKS A;  3VUR A;  1QUW A;  3EWL A;  4KF9 A;  1YZX A;  4G19 A;  1GUL A;  5GZZ B;  1SD8 A;  3UMA A;  4ZL8 A;  2JZT A;  3I6A A;  4J57 E;  1ERU A;  5C04 A;  3G7Y A;  1GSQ A;  2JL4 A;  4BVY A;  1HYU A;  2C0E A;  2LKU A;  2IPA A;  1MD3 A;  1GP1 A;  3KP8 A;  4EO3 A;  4HZ2 A;  5D93 A;  1XCC A;  5CO3 A;  1V57 A;  3F4R A;  2B5X A;  1XBS A;  1JZR A;  3IA1 A;  2PPT A;  1G7O A;  3WT2 A;  2DJK A;  4OO5 A;  3IC4 A;  3P7X A;  6GSY A;  19GS A;  4OFT A;  2L5O A;  1K3L A;  2NDO A;  2TRX A;  3FYG A;  5CRE A;  3GIX A;  1M7T A;  2EIO A;  3F63 A;  3UOM A;  3QFB C;  4QQ7 A;  2B7K A;  1QK8 A;  4O5U A;  5DVB A;  2MZC A;  1NM3 A;  2N5B A;  4MMM A;  5KN0 A;  4OFN A;  5AN1 A;  2GVP A;  3VPQ A;  3ZRE A;  4YKF A;  4GQC A;  2DLX A;  3ZYW A;  4HEA 2;  3TCO A;  1TI3 A;  1Z3E A;  1ST9 A;  4DSR A;  1G7E A;  5A5K A;  2PER A;  2GSR A;  4HJ2 A;  1TI1 A;  2VCW A;  2IMD A;  1CQH A;  3TKQ A;  1WIK A;  3P90 A;  2DML A;  2WRT A;  4LA1 A;  5IMD A;  5ECP B;  3BCI A;  2MBT A;  2ALB A;  1JZO A;  4TR1 B;  5J4U A;  2RM5 A;  3FHK A;  1ZCP A;  1ZGN A;  1U3A A;  1H75 A;  5E4W A;  3TB2 A;  4Z7X A;  3BBY A;  3H93 A;  5CRD A;  1Z7R A;  4XS4 A;  3HZ4 A;  4BWQ A;  5IO0 A;  3ISO A;  3SBC A;  3C7M A;  4KGI A;  4Z2T A;  4E8E A;  2GDR A;  2PBJ A;  2CAI A;  4J56 E;  1GUM A;  4BVX B;  3APO A;  2HNL A;  5B6N A;  1QMV A;  2FUG 2;  2CX3 A;  3L9S A;  3RAZ A;  4XIH A;  3TOU A;  2K18 A;  2CT6 A;  1ERT A;  4G0L A;  3C1S A;  5B6M A;  1PN0 A;  2XPE A;  4MCU A;  2YZU A;  5HFG A;  2HSH A;  3UEM A;  2P31 A;  4KSM A;  2NTO A;  1RW1 A;  2X8H A;  4TXO A;  2OBI A;  3CSJ A;  1AUC A;  2HZF A;  4G2E A;  3W6G A;  3K8N A;  2IIY A;  4EVM A;  1O85 A;  5CNW A;  2I4A A;  4K7O A;  4HJM A;  1A24 A;  4ISD A;  4JRR A;  1ERV A;  2FWH A;  3R2Q A;  2FD3 A;  1K0D A;  1KBN A;  3IAM 2;  5DCG A;  4F03 A;  4L0U A;  4L8E A;  1XW5 A;  4PQI A;  1XWA A;  3APQ A;  3HY2 A;  1GNE A;  1WE0 A;  1V58 A;  5BMU A;  4V1A g;  1M9A A;  2CV4 A;  2R0C A;  5J9C A;  3BCK A;  3HJP A;  3A5I A;  3RDW A;  1OC9 B;  2K9F A;  3EU4 A;  4Q5F A;  5BRT A;  3S9F A;  2H6Y A;  4K5S A;  1X5E A;  4EL1 A;  3MYD A;  4GF0 A;  2VOC A;  5AIX A;  4ZL7 A;  1TRV A;  3BD2 A;  1BYE A;  3CQF A;  5IMA A;  2ZCT A;  1XOB A;  5CRW A;  5D9X A;  1OKD A;  4HS1 A;  4EXJ A;  3QAW A;  3HDC A;  1I9D A;  4BVY B;  3D21 A;  4Q5Q A;  2DIY A;  4ID0 A;  2A4H A;  2DBC A;  4FQU A;  1F3A A;  2RII A;  2VM1 A;  2M72 A;  3QOU A;  3UBL A;  3E0U A;  1USB A;  3DML A;  2FWF A;  2LNS A;  3IHG A;  4RI6 A;  1T3B A;  1ZYN A;  4WF4 A;  4MPF A;  4TN8 A;  2REM A;  1FOH A;  4NWY A;  4MJB A;  4V2N A;  5CAX A;  5EL8 A;  2B5E A;  4IS0 A;  1JLV A;  1KNG A;  3Q19 A;  1ZOF A;  3VK9 A;  3DXB A;  3FZ5 A;  3GA4 A;  4NXI A;  2R6K A;  3FKF A;  4EC0 A;  2C0F A;  3OR5 A;  3MDK A;  2BTO T;  2O7K A;  2A2P A;  2JZR A;  3DD3 A;  2H74 A;  2I9H A;  3ZVJ A;  4PNF A;  5AIV A;  5F05 A;  1GUH A;  3KZQ A;  5C00 A;  4ECI A;  4Q5R A;  5HQP A;  2FLS A;  2IWT A;  2F51 A;  1EOH A;  4K7I A;  1XWB A;  2DKI A;  3R3E A;  2OAD A;  2M80 A;  2QGV A;  4O5Q A;  1K3O A;  3IV4 A;  3LFL A;  3KH9 A;  1B9Y C;  5FHI A;  4IJ3 A;  4RQX A;  3KGK A;  5ID2 A;  1SU9 A;  2DJ0 A;  5ECN B;  1OAZ A;  3IBH A;  5HFI A;  5DBQ A;  2VCZ A;  3EMX A;  3GNJ A;  3FR3 A;  4OCF A;  3ZLP A;  4GSS A;  2VLV A;  1V2A A;  2PVQ A;  5GAN D;  1PL2 A;  1T4Z A;  3A5W A;  3DRN A;  3VWU A;  5ECO B;  1SL2 B;  4HQZ A;  1OYJ A;  1TXX A;  2VL3 A;  3QAG A;  3LYK A;  4XHM A;  1ZL9 A;  8GSS A;  4KW6 A;  4CHS A;  4MF5 A;  4JZQ A;  3M0F A;  4N11 A;  1OVN A;  2RLI A;  4IBP A;  2X64 A;  3M1G A;  3CSI A;  1O81 A;  1J0F A;  1TOF A;  3ME7 A;  3IRA A;  2B6M A;  4EDY A;  1QQ2 A;  4HZ4 A;  5EVO A;  1W89 A;  1GTI A;  4TR3 A;  2LJR A;  5H5Q A;  4MJA A;  3NOF A;  3V1W A;  3JCM L;  4TXO B;  2LV3 A;  3KH7 A;  1F2E A;  3F4T A;  4I8B A;  5DJM A;  3UJ1 A;  3F3Q A;  3QPM A;  1WP0 A;  1YDK A;  1V40 A;  3O76 A;  4K1F A;  3PGT A;  3I9V 2;  2C0D A;  2JSY A;  4AF2 A;  3HKR A;  1K3Y A;  2LTK A;  3G9B A;  2RUF A;  4K5R A;  2C0G A;  5F8B A;  2YAN A;  4PUF C;  4OD7 A;  2V6O A;  2GZZ A;  4LMV A;  4HDE A;  2RUE A;  1CQG A;  4V2M A;  4D73 A;  1U87 A;  2WUL A;  1M2D A;  5IO2 A;  1SK1 A;  2AYT A;  4IGJ A;  2F8F A;  1A0R P;  3TRX A;  1BG5 A;  2K8S A;  6GSW A;  1ZYP A;  1SKW B;  1ILO A;  3KCM A;  2HI7 A;  3EE2 A;  1J08 A;  1BAY A;  5CYY A;  4MNN A;  2VL2 C;  3EUR A;  3ERW A;  3KD0 A;  3GUS A;  3P2A A;  4L0W A;  1PA3 A;  2R4V A;  1S3R A;  1URM A;  5IMZ A;  4EF0 A; 
#chains in the Genus database with same CATH homology
 2X49 A;  2C3Q A;  3HJM A;  4MP4 A;  1A8L A;  5H5S A;  5ENU A;  2ZUP A;  2XBQ A;  3QD9 A;  2FGX A;  6GSS A;  1ABA A;  4WBR D;  2VCQ A;  1VGL A;  2D2Z A;  2FY6 A;  3FMW A;  5ECH B;  4ECJ A;  4EDZ A;  4K2X A;  5FT3 A;  2OE3 A;  2E2G A;  4IW9 A;  1YKA A;  1PRX A;  1MD4 A;  3BOA A;  2YV7 A;  5CRG A;  3RPP A;  2V41 A;  4TR0 A;  1SYR A;  2YWM A;  3WGX A;  5IM9 A;  3D0Z A;  1VF3 A;  1H4O A;  1O6J A;  2LQO A;  5JWR B;  1NSW A;  2H75 A;  2HLS A;  9GSS A;  2CVB A;  2KUC A;  2H6X A;  2H71 A;  1AQV A;  3EMP A;  5FWG A;  2IN3 A;  3QDN A;  1FO5 A;  1R26 A;  5B7C A;  3ED3 A;  3G7I A;  5CP1 A;  1PKZ A;  2YP6 A;  1ML6 A;  3IDV A;  1TK8 B;  1EV9 A;  2V2G A;  2ES7 A;  3H1N A;  4WR4 A;  1OKT A;  4XS1 A;  2XPD A;  2N5A A;  1UN2 A;  2IJY A;  1B48 A;  4ZBD A;  4RUV A;  1FG4 A;  2HRA A;  4TVE A;  3A2W A;  2C1Y A;  4KUN A;  2KP1 A;  2AB6 A;  3GKN A;  4XTS A;  2E7P A;  1K0B A;  3MAK A;  1SL1 B;  3ZIT A;  5A4W A;  1PX6 A;  2DJ3 A;  3KMN A;  4DVC A;  3DGQ A;  3GX8 A;  4PNG A;  3ERG A;  2YJ7 A;  1GH2 A;  5G5E A;  2F8A A;  1EEM A;  4IP6 A;  3FR9 A;  4JBB A;  1O7U A;  2P0G A;  4GRF A;  4LMW A;  4YQM A;  4MH2 A;  3N5O A;  2CAQ A;  5DAL A;  3D6I A;  2ON5 A;  2K8V A;  2H0I A;  4MK3 A;  5ID2 B;  4ZB9 A;  3TJB A;  1FVK A;  4V1A p;  1R7H A;  4OCE A;  1X0R A;  4TW5 A;  1FVJ A;  1WPI A;  3UAP A;  3LGC A;  1X9W B;  1EOG A;  3ME8 A;  2GZP A;  2VL2 A;  2IFQ A;  3LXT A;  4PQ1 A;  1T8E B;  4IJI A;  2IMI A;  5KN3 A;  3TJJ A;  3M9K A;  5B8A A;  1G6W A;  2OE1 A;  4WEY A;  1VF2 A;  2L4C A;  3F3R A;  3TOT A;  4WF5 A;  5D9T A;  3L4N A;  5GSS A;  4GWR A;  1B4Q A;  2R0P A;  2AJQ B;  1YF0 A;  5ECI B;  3FEU A;  1A0F A;  2YCD A;  4IEL A;  3VPT A;  1AQX A;  2YWI A;  1K0A A;  3DVW A;  2VLT A;  1M99 A;  3ZIJ A;  4ECC A;  3Q18 A;  2BJX A;  4BA7 A;  2YWN A;  4MZW A;  5D9V A;  2CZ3 A;  1MEK A;  5COH A;  2I3Y A;  1THO A;  2MBS A;  1R4W A;  4POL A;  3CTG A;  1GSS A;  1YEX A;  2HT9 A;  4JED A;  4MA9 A;  2IME A;  3ZRD A;  4O5R A;  1HNC A;  14GS A;  2A4V A;  3VWX A;  1PL1 A;  5B8B A;  1Z6N A;  1TP9 A;  4Q5N A;  2VD0 A;  3IE3 A;  3TJF A;  3KP9 A;  2C3T A;  3IPZ A;  3VWV A;  1BX9 A;  2WGR A;  1YJ6 A;  3C73 A;  3GSS A;  4A5P A;  3ZIV A;  1HD2 A;  2E2M A;  4D73 B;  1WMJ A;  1TJD A;  1TU8 A;  2O8V B;  3GYK A;  4CY6 A;  2O89 A;  3UVT A;  3PH9 A;  3VI5 A;  1SKS B;  3IXR A;  2HZE A;  11GS A;  2H0G A;  18GS A;  1Z9H A;  1FB0 A;  2GTU A;  4PTS A;  4DSS A;  2CX4 A;  3MIX A;  4G0I A;  3O6T A;  1THX A;  1GTB A;  3VLN A;  4NPB A;  6GST A;  1RQM A;  4YKG A;  2LRC A;  5KEJ A;  4MAB A;  2CVK A;  6GSU A;  4TXV A;  3TKS C;  3CRT A;  4FO5 A;  4POK A;  4IHU A;  4MPG A;  12GS A;  1TKD B;  1I5G A;  2H1D A;  2KP2 A;  3G7J A;  4IN0 A;  2L5L A;  5HR0 A;  3A3T A;  4GLT A;  2OKA A;  2VL9 A;  2P5R A;  22GS A;  3F8U A;  4NHW A;  2AHE A;  1TW9 A;  2CZ2 A;  2C8U A;  3IHQ A;  3WD6 A;  3CXG A;  3MWH A;  2QKE A;  4HU7 A;  3CSH A;  1ZYQ B;  4Z2R A;  3LYP A;  4K6X A;  1V98 A;  1EGO A;  1ACV A;  3ZMK A;  4QL9 A;  2EC4 A;  4BWS A;  3LWA A;  5HR2 A;  1YF1 A;  3FZ4 A;  3WGE A;  3KTB A;  3KJY A;  5ECQ B;  2B7J A;  2WS2 A;  2UZ8 A;  1GSF A;  3HJO A;  1XPV A;  4I2T A;  1X5D A;  1QXH A;  2DKH A;  1M2B A;  3QR6 A;  3PPU A;  2GSQ A;  4KSO A;  2LST A;  2JSZ A;  2PUK C;  2CQ9 A;  4GSN A;  3GX0 A;  2AAW A;  2M46 A;  3RHC A;  2OAC A;  2GSS A;  4MZB A;  2H19 A;  2MYG A;  2N5F A;  4LL1 B;  4L5O A;  1K0N A;  2B1L A;  5DAL B;  5ECR B;  2MMZ A;  4MLY A;  5DAK A;  6GSV A;  3GKM A;  3UIW A;  2J9H A;  3US3 A;  2F3M A;  5ELA A;  1PKW A;  1T1V A;  2GT6 A;  2VCT A;  2C4J A;  2EIQ A;  2WZ9 A;  1TK5 B;  5JCU A;  2PVO C;  2XBI A;  4FYC A;  5IMC A;  3UL3 A;  3KEB A;  1M9B A;  3F6F A;  5IMV A;  1NHY A;  2IFQ B;  4TKY A;  3IC8 A;  5ECK B;  4DSQ A;  1UA5 A;  1O8W A;  1F9M A;  1N8J A;  2HYX A;  3WYW A;  5HFK A;  1XWC A;  2H66 A;  4WR5 A;  2YWO A;  3J7Y k;  5J3R A;  3CYN A;  1FB6 A;  4TOP A;  2H6Z A;  2J23 A;  2VM2 A;  3E3E A;  1B9X C;  2RM6 A;  1JZW A;  1PX7 A;  2H1G A;  5D73 A;  1WWJ A;  2VCV A;  1AW9 A;  1HQO A;  1C72 A;  2QA2 A;  3ZFL A;  3LOR A;  2NPB A;  2L59 A;  4GTU A;  1UVZ A;  4KH7 A;  3FW2 A;  1Q4J A;  2G2Q A;  3IAS 2;  1DSB A;  3TGZ A;  1XW9 A;  3TJG A;  3LW9 A;  4N30 A;  1A8Y A;  4HI7 A;  3HHV A;  1PQN A;  1IYH A;  2OBK A;  4WKW A;  5DJL A;  3L9V A;  4ECB A;  2MMA A;  5IOW A;  5KN2 A;  2GQM A;  4K2D A;  1AAZ A;  1WOU A;  4BL7 B;  1XXU A;  5L71 A;  3FR6 A;  3TKR A;  2VAF A;  2PMT A;  2O85 A;  1R5P A;  1T7P B;  5G31 A;  2R3X A;  4I97 A;  2Z9S A;  3FY7 A;  2AUV A;  3F9U A;  4HQS A;  5CRH A;  1S3A A;  4G9H A;  2HZE B;  3D4T A;  2H72 A;  3KMO A;  4EIP A;  3RPN A;  4ULX A;  4WET A;  4DSS B;  3EU3 A;  1SKR B;  5J41 A;  5G1K A;  1XVQ A;  3TDG A;  3IR4 A;  1SEN A;  3GST A;  1YQ1 A;  4ZB6 A;  4K0N A;  2DC5 A;  3D4M A;  2HXK A;  4IP1 A;  3GMF A;  4ILF A;  1WJK A;  3L0H A;  1TTZ A;  1JLW A;  2VO4 A;  1BED A;  4O7H A;  1PMT A;  3F4S A;  1GNW A;  3HVV A;  5A4V A;  4EIQ A;  2GLR A;  4L5L A;  4X43 A;  4X1U A;  20GS A;  3SWL A;  4K8M A;  3GFK A;  7GSS A;  4I6X A;  4ZB8 A;  3DWV A;  1SK2 A;  1SD9 A;  2L57 A;  5DQS A;  5LNK e;  4JR6 A;  2LQQ A;  2LUS A;  2YOI A;  3BJ5 A;  2WCI A;  2IMF A;  5EY6 A;  2X8G A;  4MZC A;  1NW2 A;  5HR1 A;  2DJ2 A;  4JE1 A;  10GS A;  4PQH A;  2OJL A;  2VUP A;  3VFI A;  4KCE A;  2VD1 A;  2B1K A;  2A2R A;  3PIN A;  4ZBA A;  4F2I A;  4XRA A;  3J7Y b;  2XC2 A;  3GKX A;  4ZL9 A;  1K0M A;  2X4A A;  3C8E A;  3ZL5 A;  4MF6 A;  1OC8 A;  5ECL B;  3A2X A;  4XCS A;  1YKC A;  5INY A;  3ZML A;  1N2A A;  2LJA A;  2MMO A;  3LG6 A;  4OFM A;  1XIY A;  2LS5 A;  3W8J A;  1DE2 A;  1X9S B;  2DJJ A;  13GS A;  2XHF A;  4KDU A;  3GL5 A;  5DAK B;  3FK8 A;  3GRX A;  4YQU A;  2C3N A;  1AC1 A;  1ON4 A;  1PGT A;  5F07 A;  3N9J A;  5J5N A;  1X9M B;  3H79 A;  1ZZY A;  3IK7 A;  3HD5 A;  1XFL A;  3CMI A;  1B8X A;  2FWE A;  3ZFB A;  3DIE A;  5KOX A;  2HSM A;  4CDO A;  2GGT A;  4IKH A;  4HUA A;  4JU5 A;  1TRU A;  3GV1 A;  3DYR A;  2KOK A;  4E8H A;  4YAP A;  3WGD A;  4X4J A;  2V1M A;  4IQ1 A;  2LEG A;  4WBJ A;  1QFN A;  1G0T A;  5JCG A;  4K7N A;  3WT1 A;  3LEF A;  4POM A;  3A2V A;  2FA4 A;  4F9Z A;  16GS A;  4DEJ A;  2B3S A;  2E0Q A;  1EP8 A;  3HVS A;  4G10 A;  1XWK A;  2CA8 A;  2QSI A;  3QAV A;  4PUA A;  1Y6E A;  4ML6 A;  2VIM A;  2H0H A;  2H1B A;  3GKK A;  3TKP A;  3ZZX A;  4F0B A;  2HE3 A;  3TKS E;  1GL8 A;  1LBK A;  4F0C A;  3NZN A;  1FOV A;  1ERW A;  2QC7 A;  4PXO A;  4XRD A;  4NV5 A;  1XWG A;  3GHA A;  2HRN A;  3GN3 A;  5JWQ B;  3L78 A;  3U5R E;  1F3B A;  4J2F A;  4K0G A;  3GTU A;  1SL0 B;  4BPY A;  2PGT A;  3TJK A;  2F9S A;  1BJX A;  1A2J A;  2DIZ A;  2HFD A;  4KDY A;  2X8C A;  4POB A;  2R37 A;  3F0I A;  1Q98 A;  3HXS A;  4NV2 A;  2VLU A;  4LL4 B;  2JU5 A;  1F6M C;  4KB3 A;  4BL7 A;  5H5R A;  2KLX A;  4HOJ A;  4KND A;  4NAX A;  5JCW A;  2ZNM A;  1SK0 A;  6GSX A;  2TIR A;  2X99 A;  4V2L A;  1F37 A;  3L9U A;  4YQV A;  4MJC A;  5HR3 A;  2H01 A;  1VRS D;  3HA9 A;  4IQA A;  4MDC A;  5G1L A;  1O8X A;  1SJ6 A;  1O73 A;  5G2Z A;  2GQK A;  1AIU A;  1E2Y A;  1U6T A;  5ABR A;  2YN1 A;  1A23 A;  1PD2 1;  3TRQ A;  3UBK A;  2GT5 A;  1E6B A;  2H70 A;  3EIN A;  5LD0 A;  5D8I A;  2NVL A;  2FNO A;  3ZVJ D;  1OE7 A;  3EC3 A;  4KCA A;  4OWY A;  1GSU A;  2YNX A;  4OMV A;  2TRC P;  5GST A;  4O32 A;  3HZ8 A;  3LJR A;  4MJE A;  3UVH A;  2PN8 A;  4X0X A;  1J9B A;  4KX4 A;  1HNB A;  1KTE A;  1ZYE A;  1FHE A;  5IMF A;  1LU4 A;  4YH2 A;  2DMM A;  3GH9 A;  3C71 A;  1BQ7 A;  1EZK A;  1V9W A;  3Q74 A;  4GST A;  3IK9 A;  2LJK A;  2I1U A;  2JZS A;  1TDI A;  1ZMA A;  1VF1 A;  3P8W A;  1AQW A;  2O87 A;  5ECM B;  1W4V A;  4MF7 A;  2YZH A;  2LNT A;  2FCH A;  3M9J A;  4GQF A;  4PUR A;  1GSD A;  4FH8 A;  2BMX A;  4AJ8 A;  4O92 A;  2GQL A;  3DVX A;  1JFU A;  3AY8 A;  5F0G A;  5GAP D;  4NHZ A;  5AIS A;  3CBU A;  3HVX A;  1S3C A;  4IVF A;  17GS A;  2YPM A;  2C80 A;  4MH3 A;  4USS A;  2GS3 A;  1EWX A;  1UC7 A;  3DEX A;  3D22 A;  1FW1 A;  1TRS A;  3I69 A;  3RHB A;  3MNG A;  1K0O A;  3UAR A;  1AXD A;  1FAA A;  4AJ7 A;  1GUK A;  1RK4 A;  3PR8 A;  1SYX A;  2PU9 C;  4I2U A;  4TR4 A;  3CRU A;  4HU9 A;  4AJ6 A;  1EP7 A;  3LXZ A;  1OE8 A;  3F6D A;  4ZXG A;  2I81 A;  2L6D A;  3EPT A;  2FHE A;  2V32 A;  3LQ7 A;  4JR4 A;  4QL7 A;  4F82 A;  5IIZ A;  4PX1 A;  1EEJ A;  4ICY A;  2WJU A;  1GSE A;  1DUG A;  2WFC A;  3RBT A;  3H4K A;  4KE3 A;  3O3T A;  3Q6O A;  5AGY A;  2YJH A;  3I43 A;  1GLQ A;  1XVW A;  2FWG A;  2G0F A;  1NHO A;  2JAC A;  2GST A;  1K0C A;  1TU7 A;  4KDX A;  2R0G A;  3W8S A;  3GL3 A;  1YEP A;  3TKS A;  2KHP A;  4YAV A;  4N0V A;  2H73 A;  5ELG A;  2A2S A;  2VCX A;  2DJ1 A;  2L6C A;  4N10 A;  3H8Q A;  5G30 A;  4ZBB A;  1Z6M A;  1Z5Y E;  1PN9 A;  3FZA A;  4ZIL A;  4FYU A;  5J9B A;  1B4P A;  3NIV A;  4K9Z A;  3D5J A;  4WXT A;  2LRT A;  4XS4 B;  1DE1 A;  3EVI A;  2H30 A;  5IPG A;  4TR1 A;  2DSA A;  2ON7 A;  1TRW A;  4GXZ A;  3KIJ A;  1HNA A;  1EV4 A;  3EYT A;  1TK0 B;  4LLR A;  1QGV A;  1G6Y A;  1M0U A;  2WDU A;  3GTU B;  1MDJ A;  1XW6 A;  2H76 A;  3GH6 A;  4CW9 A;  3E9J B;  1A2L A;  3HCZ A;  5DQY A;  1GSY A;  1VF4 A;  4P3Y B;  4FYB A;  3FRC A;  1SJI A;  3HYP A;  3CTF A;  1T4Y A;  4EE0 A;  1Y25 A;  3IOS A;  4BVX A;  3LSZ A;  4XS6 A;  5ECS A;  2V6K A;  3QMX A;  3ZTL A;  3M3M A;  1GTU A;  1KEB A;  4KA0 A;  5IOX A;  3MSZ A;  2HRK A;  1S3D A;  3GUR A;  1DBY A;  2NBS A;  2JAD A;  1OC3 A;  2H8L A;  3TUE A;  2B5Y A;  2QA1 A;  1MDK A;  1MDI A;  2R2J A;  2AV4 A;  4EKZ A;  1GRX A;  4ZIJ A;  3QFA C;  1XZO A;  4PGT A;  4KAE A;  2IL3 A;  2HRF A;  4EUY A;  3TRP A;  3M8N A;  2H1A A;  3ERF A;  4TRX A;  1WRY A;  4ML1 A;  1R5A A;  5KN1 A;  1JZD A;  2YV9 A;  4FIW A;  1LJR A;  4I5Q A;  5G5F A;  4AGS A;  4CY8 A;  1GTA A;  3APS A;  5IQY A;  1GWC A;  2P5Q A;  4RQR A;  2R5G A;  2EIR A;  4G0K A;  3KM6 A;  2PWJ A;  2FA8 A;  1U3I A;  3U6V A;  1U88 A;  1Z7P A;  2OA7 A;  3QCP A;  1GLP A;  2IMK A;  2L4Q A;  2K6V A;  2GZY A;  5D9W A;  3VI7 A;  1MTC A;  3C1R A;  5E59 A;  2OE0 A;  2LRN A;  2WB9 A;  4H86 A;  5KOW A;  1JHB A;  2CVD A;  4NMU A;  2MMN A;  3FZ9 A;  1M2A A;  1OC9 A;  1YY7 A;  4OO4 A;  4RI7 A;  5A4U A;  1A2M A;  5DDL A;  1T00 A;  4N0Z A;  4Z2U A;  5DCH A;  2HSY A;  1PSQ A;  4GCI A;  5JWO B;  3VWW A;  5F06 A;  4ACS A;  5LCZ A;  1X5C A;  3KXO A;  1EGR A;  1IYI A;  3KTL A;  1XOA A;  5IPH A;  1SJZ A;  5D96 A;  5EPF A;  3DKS A;  3VUR A;  1QUW A;  3EWL A;  4KF9 A;  1YZX A;  4G19 A;  1GUL A;  5GZZ B;  1SD8 A;  3UMA A;  4ZL8 A;  2JZT A;  3I6A A;  4J57 E;  1ERU A;  5C04 A;  3G7Y A;  1GSQ A;  2JL4 A;  4BVY A;  1HYU A;  2C0E A;  2LKU A;  2IPA A;  1MD3 A;  1GP1 A;  3KP8 A;  4EO3 A;  4HZ2 A;  5D93 A;  1XCC A;  5CO3 A;  1V57 A;  3F4R A;  2B5X A;  1XBS A;  1JZR A;  3IA1 A;  2PPT A;  1G7O A;  3WT2 A;  2DJK A;  4OO5 A;  3IC4 A;  3P7X A;  6GSY A;  19GS A;  4OFT A;  2L5O A;  1K3L A;  2NDO A;  2TRX A;  3FYG A;  5CRE A;  3GIX A;  1M7T A;  2EIO A;  3F63 A;  3UOM A;  3QFB C;  4QQ7 A;  2B7K A;  1QK8 A;  4O5U A;  5DVB A;  2MZC A;  1NM3 A;  2N5B A;  4MMM A;  5KN0 A;  4OFN A;  5AN1 A;  2GVP A;  3VPQ A;  3ZRE A;  4YKF A;  4GQC A;  2DLX A;  3ZYW A;  4HEA 2;  3TCO A;  1TI3 A;  1Z3E A;  1ST9 A;  4DSR A;  1G7E A;  5A5K A;  2PER A;  2GSR A;  4HJ2 A;  1TI1 A;  2VCW A;  2IMD A;  1CQH A;  3TKQ A;  1WIK A;  3P90 A;  2DML A;  2WRT A;  4LA1 A;  5IMD A;  5ECP B;  3BCI A;  2MBT A;  2ALB A;  1JZO A;  4TR1 B;  5J4U A;  2RM5 A;  3FHK A;  1ZCP A;  1ZGN A;  1U3A A;  1H75 A;  5E4W A;  3TB2 A;  4Z7X A;  3BBY A;  3H93 A;  5CRD A;  1Z7R A;  4XS4 A;  3HZ4 A;  4BWQ A;  5IO0 A;  3ISO A;  3SBC A;  3C7M A;  4KGI A;  4Z2T A;  4E8E A;  2GDR A;  2PBJ A;  2CAI A;  4J56 E;  1GUM A;  4BVX B;  3APO A;  2HNL A;  5B6N A;  1QMV A;  2FUG 2;  2CX3 A;  3L9S A;  3RAZ A;  4XIH A;  3TOU A;  2K18 A;  2CT6 A;  1ERT A;  4G0L A;  3C1S A;  5B6M A;  1PN0 A;  2XPE A;  4MCU A;  2YZU A;  5HFG A;  2HSH A;  3UEM A;  2P31 A;  4KSM A;  2NTO A;  1RW1 A;  2X8H A;  4TXO A;  2OBI A;  3CSJ A;  1AUC A;  2HZF A;  4G2E A;  3W6G A;  3K8N A;  2IIY A;  4EVM A;  1O85 A;  5CNW A;  2I4A A;  4K7O A;  4HJM A;  1A24 A;  4ISD A;  4JRR A;  1ERV A;  2FWH A;  3R2Q A;  2FD3 A;  1K0D A;  1KBN A;  3IAM 2;  5DCG A;  4F03 A;  4L0U A;  4L8E A;  1XW5 A;  4PQI A;  1XWA A;  3APQ A;  3HY2 A;  1GNE A;  1WE0 A;  1V58 A;  5BMU A;  4V1A g;  1M9A A;  2CV4 A;  2R0C A;  5J9C A;  3BCK A;  3HJP A;  3A5I A;  3RDW A;  1OC9 B;  2K9F A;  3EU4 A;  4Q5F A;  5BRT A;  3S9F A;  2H6Y A;  4K5S A;  1X5E A;  4EL1 A;  3MYD A;  4GF0 A;  2VOC A;  5AIX A;  4ZL7 A;  1TRV A;  3BD2 A;  1BYE A;  5IMA A;  2ZCT A;  1XOB A;  5CRW A;  5D9X A;  1OKD A;  4HS1 A;  4EXJ A;  3QAW A;  3HDC A;  1I9D A;  4BVY B;  3D21 A;  4Q5Q A;  2DIY A;  4ID0 A;  2A4H A;  2DBC A;  4FQU A;  1F3A A;  2RII A;  2VM1 A;  2M72 A;  3QOU A;  3UBL A;  3E0U A;  1USB A;  3DML A;  2FWF A;  2LNS A;  3IHG A;  4RI6 A;  1T3B A;  1ZYN A;  4WF4 A;  4MPF A;  4TN8 A;  2REM A;  1FOH A;  4NWY A;  4MJB A;  4V2N A;  5CAX A;  5EL8 A;  2B5E A;  4IS0 A;  1JLV A;  1KNG A;  3Q19 A;  1ZOF A;  3VK9 A;  3DXB A;  3FZ5 A;  3GA4 A;  4NXI A;  2R6K A;  3FKF A;  4EC0 A;  2C0F A;  3OR5 A;  3MDK A;  2BTO T;  2O7K A;  2A2P A;  2JZR A;  3DD3 A;  2H74 A;  2I9H A;  3ZVJ A;  4PNF A;  5AIV A;  5F05 A;  1GUH A;  3KZQ A;  5C00 A;  4ECI A;  4Q5R A;  5HQP A;  2FLS A;  2IWT A;  2F51 A;  1EOH A;  4K7I A;  1XWB A;  2DKI A;  3R3E A;  2OAD A;  2M80 A;  2QGV A;  4O5Q A;  1K3O A;  3IV4 A;  3LFL A;  3KH9 A;  1B9Y C;  5FHI A;  4IJ3 A;  4RQX A;  3KGK A;  5ID2 A;  1SU9 A;  2DJ0 A;  5ECN B;  1OAZ A;  3IBH A;  5HFI A;  5DBQ A;  2VCZ A;  3EMX A;  3GNJ A;  3FR3 A;  4OCF A;  3ZLP A;  4GSS A;  2VLV A;  1V2A A;  2PVQ A;  5GAN D;  1PL2 A;  1T4Z A;  3A5W A;  3DRN A;  3VWU A;  5ECO B;  1SL2 B;  4HQZ A;  1OYJ A;  1TXX A;  2VL3 A;  3QAG A;  3LYK A;  4XHM A;  1ZL9 A;  8GSS A;  4KW6 A;  4CHS A;  4MF5 A;  4JZQ A;  3M0F A;  4N11 A;  1OVN A;  2RLI A;  4IBP A;  2X64 A;  3M1G A;  3CSI A;  1O81 A;  1J0F A;  1TOF A;  3ME7 A;  3IRA A;  2B6M A;  4EDY A;  1QQ2 A;  4HZ4 A;  5EVO A;  1W89 A;  1GTI A;  4TR3 A;  2LJR A;  5H5Q A;  4MJA A;  3NOF A;  3V1W A;  3JCM L;  4TXO B;  2LV3 A;  3KH7 A;  1F2E A;  3F4T A;  4I8B A;  5DJM A;  3UJ1 A;  3F3Q A;  3QPM A;  1WP0 A;  1YDK A;  1V40 A;  3O76 A;  4K1F A;  3PGT A;  3I9V 2;  2C0D A;  2JSY A;  4AF2 A;  3HKR A;  1K3Y A;  2LTK A;  3G9B A;  2RUF A;  4K5R A;  2C0G A;  5F8B A;  2YAN A;  4PUF C;  4OD7 A;  2V6O A;  2GZZ A;  4LMV A;  4HDE A;  2RUE A;  1CQG A;  4V2M A;  4D73 A;  1U87 A;  2WUL A;  1M2D A;  5IO2 A;  1SK1 A;  2AYT A;  4IGJ A;  2F8F A;  1A0R P;  3TRX A;  1BG5 A;  2K8S A;  6GSW A;  1ZYP A;  1SKW B;  1ILO A;  3KCM A;  2HI7 A;  3EE2 A;  1J08 A;  1BAY A;  5CYY A;  4MNN A;  2VL2 C;  3EUR A;  3ERW A;  3KD0 A;  3GUS A;  3P2A A;  4L0W A;  1PA3 A;  2R4V A;  1URM A;  5IMZ A;  4EF0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...