2WFCA

Crystal structure of peroxiredoxin 5 from arenicola marina
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
159
structure length
159
Chain Sequence
PIKEGDKLPAVTVFGATPNDKVNMAELFAGKKGVLFAVPGAFTPGSSKTHLPGYVEQAAAIHGKGVDIIACMAVNDSFVMDAWGKAHGADDKVQMLADPGGAFTKAVDMELDLSAVLGNVRSKRYSLVIEDGVVTKVNVEPDGKGLTCSLAPNILSQLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords PEROXIREDOXIN 5
publication title Crystal Structure of Peroxiredoxin 5 from Arenicola Marina
rcsb
source organism Arenicola marina
total genus 43
structure length 159
sequence length 159
chains with identical sequence B, C, D
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2009-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08534 Redoxin Redoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2wfcA00
3H1NA 3KTLA 4KDXA 2VD1A 1UC7A 3ZZXA 2LS5A 4XCSA 1TK8B 2YV9A 4JEDA 4IELA 1OC8A 1JZDA 1ZCPA 3LFLA 5HR2A 4ZB6A 1EV9A 2GZYA 3TKPA 2V2GA 4K1FA 1OKDA 2ON5A 2VOCA 2CAQA 1Q98A 3TRQA 3FEUA 5IO2A 3S9FA 4EO3A 4PNGA 1A8YA 5IMZA 3ZL5A 1OAZA 4YAPA 1V58A 2PVOC 2I4AA 4DVCA 3G7IA 9GSSA 1AW9A 1X5EA 3I43A 2C3QA 2O89A 5EY6A 1HYUA 3FZ9A 4NV5A 3TKRA 4E8EA 2LJKA 1X0RA 3DRNA 2R3XA 2H6ZA 2LEGA 5ECIB 5ECOB 1XVQA 4RI6A 1Y25A 17GSA 4O7HA 4EDYA 4TRXA 1MD3A 3RDWA 1GUHA 4ECBA 3RPPA 1URMA 5INYA 2H73A 1B48A 4BVXA 1ZL9A 2LUSA 3EYTA 4ILFA 1A24A 4IW9A 2RUEA 5H5SA 2PWJA 5JCUA 4ULXA 5B6MA 1WP0A 2OA7A 1QK8A 4ECIA 3ME8A 1PGTA 4LMWA 3KTBA 3MSZA 4N10A 1TRUA 2PGTA 1S3AA 6GSUA 2NTOA 2H19A 4BPYA 5FHIA 4DSSB 1ZYEA 1EZKA 6GSSA 1YEXA 5E4WA 4JU5A 3TJKA 1WPIA 3VPTA 1GTUA 5LCZA 2M72A 2HNLA 1XOAA 2TRCP 4ML1A 4K2DA 1V2AA 1SENA 2OE0A 5B7CA 4ACSA 1MDIA 3W6GA 4HS1A 3TKSC 1YDKA 2DBCA 4MDCA 2P5RA 4MH3A 5G2ZA 1GTAA 2KP1A 3FR6A 2L6DA 3F4TA 5F05A 3LEFA 3GSTA 3F63A 4KH7A 4AJ8A 1TOFA 2H1GA 3IHQA 1GWCA 1K0MA 2VCTA 3IRAA 3M9KA 1WJKA 4AGSA 1UVZA 1TKDB 3L9VA 2H0IA 2GSTA 3ZVJD 2RM6A 1Z7PA 4MCUA 4KSOA 3IV4A 3HZ4A 3TB2A 2IFQB 1SD9A 1XWGA 2MZCA 4EL1A 5DAKA 3LYKA 5ABRA 1Z3EA 1XW6A 4FYUA 2QC7A 2H1AA 2PU9C 1J08A 4JBBA 4I2TA 3M0FA 4FYBA 2JZSA 4HU9A 2FHEA 3J7Yk 1Z6NA 1GTBA 1DBYA 4I5QA 2BJXA 2JSYA 4CHSA 3WGXA 2AHEA 3QOUA 1ML6A 2F9SA 3C73A 4D73A 3HYPA 5JWOB 3NOFA 3L9SA 3QDNA 3C71A 3HJPA 2C1YA 3D22A 1NHYA 1B8XA 3UVTA 1KNGA 3RHCA 3CSHA 3KM6A 1X5DA 4IVFA 3G7JA 4ZBBA 5HR1A 1EGOA 1TJDA 2FLSA 1AQWA 1GTIA 4AF2A 2R4VA 5J3RA 3CSIA 5ID2A 2MBSA 3QD9A 4NWYA 1OKTA 5JCGA 1G7EA 4RQRA 5A4WA 1N8JA 1CQHA 2ON7A 2D2ZA 2H66A 4XS4B 4J57E 3O76A 3TKSE 1GSQA 4H86A 4EE0A 6GSWA 3A3TA 1PD21 3CSJA 5DJLA 2C4JA 2QSIA 3Q19A 4I97A 5DCHA 2CZ3A 1PX6A 2BMXA 4LMVA 1GUMA 4Q5NA 2VCXA 3CMIA 5A5KA 2ZUPA 4MK3A 1O73A 2ES7A 2H76A 3APSA 5AGYA 3GH6A 3PH9A 3RAZA 4HJMA 2FWFA 3E9JB 4O92A 2C0FA 1H75A 2VCZA 3ISOA 3QR6A 5HQPA 2PMTA 4OO4A 1OC3A 4XHMA 5F06A 4GSSA 1EV4A 2HI7A 4TR3A 2VL9A 5G1KA 2FWGA 2B1KA 4V1Ap 2B5YA 2FY6A 3UEMA 1AXDA 3CBUA 6GSYA 1XPVA 3FRCA 4V1Ag 4L5LA 4POBA 3H8QA 4JZQA 2LQOA 1SK2A 5H5RA 1AQXA 3DKSA 2LTKA 3VLNA 5B8BA 5ENUA 5AISA 4KNDA 2IN3A 1M2AA 4XS1A 1VF4A 3E0UA 4X1UA 2VLVA 4PX1A 4WXTA 2YN1A 2AJQB 3GKMA 4MPFA 3GA4A 2X64A 2RIIA 4HQSA 1AUCA 1TK0B 1Z6MA 4TOPA 2O8VB 2JACA 2CVBA 1TI1A 2YP6A 3KCMA 4XTSA 1R5PA 2F8FA 5CP1A 2H70A 2IIYA 1XOBA 2HT9A 13GSA 1V57A 5ECRB 1PA3A 1G6WA 2V41A 2KLXA 3TRPA 3LWAA 2OADA 3IE3A 3RBTA 1A0RP 2OKAA 3HJMA 3HXSA 4OFTA 2HRNA 2VO4A 2GQKA 1QFNA 4WR4A 5CREA 2OBKA 4KCAA 5CRHA 3TUEA 5DDLA 3D6IA 1TDIA 3UMAA 2G0FA 2TIRA 2GS3A 3OR5A 1PSQA 4GSNA 3GKKA 3V1WA 5E59A 2L6CA 1XZOA 3PINA 4ZXGA 1T7PB 1NM3A 3QCPA 2R6KA 3ZRDA 4ID0A 3VWWA 2TRXA 2NBSA 4G10A 2B5XA 2G2QA 2L4QA 1PN9A 3MNGA 3ZIVA 1SJIA 3KEBA 2YWOA 2JZTA 1RK4A 3FK8A 4GSTA 4IBPA 1M7TA 3QMXA 3DYRA 4TR0A 3KIJA 1EEJA 4GCIA 2C3NA 1EP8A 1F37A 1MDJA 1BYEA 3UBLA 3GTUA 3M1GA 4K0NA 2YNXA 2WZ9A 2YJHA 5DJMA 4POLA 5F07A 1WE0A 2IJYA 5LD0A 5GAND 1FW1A 3HVXA 1XCCA 3ZTLA 2WRTA 4MJEA 3FKFA 1T8EB 3LYPA 3F3QA 4PUAA 3WT2A 5ECLB 1K3OA 2LKUA 3ZMLA 4ZB8A 1X5CA 1FOVA 1XVWA 1GNWA 5D9XA 2VCWA 3TJBA 3QAGA 1SK0A 1GP1A 2GT6A 2L4CA 3PR8A 1U87A 4N30A 1OC9B 2WULA 1I9DA 4Q5RA 3FZAA 4O5RA 5G1LA 4K9ZA 3IK7A 1YF1A 1O8WA 2A4VA 3VFIA 3F8UA 2XPDA 4KDUA 3QPMA 3DGQA 4EF0A 1TK5B 3C1RA 1LBKA 3GH9A 3WGDA 2PBJA 2VM2A 2QGVA 2EIRA 5D93A 4P3YB 5IMDA 5DALB 4GQCA 5JWRB 3GIXA 2HZEB 1ZOFA 1MDKA 2F8AA 2DLXA 1UA5A 4POKA 4XS6A 3I9V2 2J9HA 1SKWB 2X8GA 3KZQA 2DIZA 1S3DA 3CRTA 4PURA 3C7MA 2H74A 3KP9A 2BTOT 1ERTA 1TRVA 2IMFA 4XIHA 1X9MB 4MF6A 2DIYA 3HJOA 2V6KA 4IP6A 3IDVA 3GN3A 3RHBA 3DD3A 1LU4A 1R4WA 4OCEA 2LNSA 1AAZA 4KX4A 3VWXA 4Q5FA 1XWCA 3F0IA 2RUFA 5KN3A 2YANA 4ZL7A 2PN8A 4TR1B 1A2LA 2CA8A 4BWQA 1TU7A 3TGZA 1XIYA 1RW1A 3WYWA 2H72A 4ZL9A 2A2RA 3F3RA 3DWVA 1B4QA 2K6VA 5IQYA 4NXIA 3I6AA 2VM1A 3O3TA 2HYXA 2N5BA 1HD2A 2IMEA 4NHZA 5IMVA 2L57A 3IAM2 3UARA 3HA9A 4IKHA 4OFNA 3BOAA 3L78A 1JZOA 1TI3A 2HE3A 1S3CA 1T1VA 3F4RA 2H30A 2ZNMA 2DJKA 2M80A 3UIWA 1I5GA 2E2GA 2B7KA 1T00A 2VIMA 1K0OA 5J4UA 3Q18A 2AB6A 3EMPA 1EP7A 5CRDA 3EURA 1QQ2A 2O85A 2OE1A 1SKRB 2WJUA 2YZHA 4KDYA 1THXA 3VWUA 1THOA 3FR3A 1JLVA 3R2QA 3ZMKA 3IA1A 3EINA 2LV3A 4NAXA 2MMNA 1A0FA 1H4OA 3KXOA 2RM5A 2GDRA 3FW2A 1BX9A 1A2JA 1TXXA 2CT6A 2H6YA 4IJIA 3UJ1A 5G5FA 5DBQA 4RI7A 1GL8A 2C0EA 4K7NA 2DC5A 1WRYA 1G7OA 2KP2A 3ZREA 5ELGA 2YWNA 4TKYA 3DVWA 1F2EA 10GSA 4G2EA 3MDKA 2VUPA 3P90A 2DSAA 1DSBA 3VPQA 4PGTA 1GSEA 4L5OA 2I9HA 1JZRA 5CO3A 1TRWA 5GZZB 1GUKA 3DIEA 1JHBA 4HZ2A 4FH8A 1E2YA 4YH2A 2LRTA 3TRXA 5CYYA 3MWHA 2HLSA 2P31A 2OE3A 4K0GA 1V9WA 1B9XC 1SU9A 3K8NA 1O81A 2CAIA 3GSSA 2LRCA 4J56E 1FHEA 4JR6A 3GV1A 5G30A 4GXZA 4L0WA 4TXOA 5B6NA 1GNEA 3CTGA 1ZZYA 3NIVA 4G9HA 4ISDA 2YV7A 5IM9A 1Z9HA 2MBTA 3O6TA 1R26A 1IYIA 2DJ1A 1JFUA 1WOUA 5HFKA 2IPAA 2R2JA 2B5EA 2KUCA 3GUSA 4CW9A 2MYGA 2LSTA 5ECKB 2DJJA 3VK9A 3QAWA 1Q4JA 2AV4A 1X9SB 1Y6EA 4N0ZA 4Q5QA 1E6BA 3HZ8A 1K0BA 4MZBA 4OCFA 3HD5A 5KEJA 3LG6A 4G19A 1K0NA 4BA7A 1YQ1A 5G31A 3GX0A 5IOXA 1QGVA 2R37A 3HHVA 5KN0A 5D73A 4JRRA 4IHUA 1WIKA 4EUYA 4IQ1A 3N5OA 3GL3A 1W4VA 1XWKA 5COHA 1GRXA 4MJBA 22GSA 2WS2A 3VI5A 4YQVA 3HDCA 5JCWA 3D4TA 5CNWA 19GSA 3RPNA 2HSHA 2LQQA 2OACA 3IC4A 2FWHA 2IWTA 4NV2A 4GWRA 2C3TA 3H79A 3DMLA 1WWJA 4GTUA 1M9AA 1PKWA 5ECMB 4TR4A 1FAAA 4FO5A 6GSVA 5D8IA 2H1DA 5DAKB 6GSXA 4Z7XA 3FZ5A 2CQ9A 2NDOA 3UBKA 3EVIA 2H75A 3CYNA 1QUWA 2VD0A 2I1UA 4F0CA 3D5JA 5HR3A 2KHPA 2JSZA 4GQFA 4MZWA 4IJ3A 3ZVJA 1Z5YE 1GULA 5GSTA 1T3BA 1A8LA 2PUKC 3C8EA 2X8HA 14GSA 1ERUA 1VRSD 4MP4A 2ZCTA 5AIVA 4F82A 2RLIA 3DVXA 3EE2A 5IOWA 4D73B 4OMVA 1K3YA 1MEKA 4TW5A 2EIOA 4HUAA 1PL1A 1NSWA 4MZCA 2VCQA 1GH2A 2FCHA 1OVNA 2YWIA 4ZIJA 2H6XA 2P5QA 4QQ7A 1V40A 1T4YA 3EU3A 5C04A 3TKSA 1U88A 1XWAA 5IPHA 2OBIA 4WETA 3UAPA 3GURA 3WT1A 1XBSA 4N11A 2H0GA 3D21A 5IPGA 2F3MA 3APOA 5CRWA 5ID2B 20GSA 3CXGA 4F03A 3FR9A 4X0XA 2XPEA 5AN1A 2AAWA 4ECCA 2Z9SA 1FG4A 4V2LA 1YY7A 4LA1A 4AJ6A 2CVDA 4DSSA 2YOIA 2E2MA 5IMAA 4QL9A 4DSRA 1ST9A 2H71A 4ZL8A 5EPFA 3IPZA 2PERA 2K8SA 4ML6A 2X99A 4DEJA 2QKEA 3TOTA 1G0TA 3A2XA 3FHKA 1TRSA 4OWYA 1VF1A 2X8CA 1CQGA 1IYHA 2L5LA 4PNFA 2XC2A 2CV4A 2B6MA 3HVSA 3I69A 1DE2A 1K0DA 4QL7A 4RUVA 2H1BA 4LL4B 3GKNA 5LNKe 4HEA2 1SYRA 1K0AA 2VAFA 1ACVA 3FZ4A 3LORA 1VGLA 4YQUA 3M8NA 1GSDA 4F9ZA 1C72A 2CZ2A 1LJRA 5ECPB 5JWQB 3LXZA 5FWGA 1OE7A 1MD4A 4F2IA 3TCOA 3HVVA 1O8XA 2IFQA 3ERFA 4DSQA 3HY2A 1ZGNA 5FT3A 4K7IA 5ELAA 4MJCA 3NZNA 2C0GA 4WEYA 4ECJA 4PUFC 2GQMA 2DMLA 2WB9A 3ZIJA 1J9BA 1TP9A 3C1SA 3F9UA 2V1MA 2K18A 3DXBA 4TXVA 1XW5A 1ILOA 1BQ7A 2DMMA 4F0BA 3CRUA 3TJFA 1FB6A 4KGIA 2LRNA 2VL3A 2AUVA 3JCML 4FYCA 3ZFLA 2CX4A 1AC1A 4KE3A 3BD2A 3AY8A 4KW6A 1SJZA 3GFKA 2KOKA 1DUGA 5D96A 2VL2A 1HNBA 4X43A 2NPBA 3TJJA 4MMMA 4HZ4A 4MJAA 2DJ0A 2VLTA 4HQZA 2DJ3A 4TN8A 1M9BA 3IXRA 2FA8A 3F6FA 2B7JA 4IP1A 3G7YA 3F4SA 3IBHA 2K8VA 1YJ6A 4XS4A 1GSSA 2LJRA 3J7Yb 1RQMA 4WBJA 1OE8A 4YAVA 3D4MA 3LXTA 3W8JA 4ZBDA 5DVBA 4V2NA 2IMDA 1JZWA 3LQ7A 1SL2B 2YWMA 4KA0A 3ZFBA 3EMXA 2B1LA 2V6OA 3KH7A 3BCIA 3GKXA 3EC3A 4POMA 16GSA 1KEBA 1F3AA 1PX7A 1EGRA 1R7HA 1SJ6A 1YF0A 3L4NA 4L0UA 4EXJA 4TVEA 5J9BA 1SYXA 4HDEA 1HNAA 2E0QA 3GTUB 1GSUA 3IK9A 4IGJA 3H93A 4ZBAA 2EIQA 3HKRA 3UL3A 1M0UA 3APQA 3ERGA 5D9VA 2HSYA 1FB0A 4IN0A 3KH9A 2GSRA 1WMJA 4MABA 3KMNA 1ERVA 1QXHA 3ZYWA 1B9YC 5AIXA 3QFBC 1SKSB 2M46A 3IOSA 2WDUA 3P2AA 2GTUA 2LJAA 2EC4A 3GMFA 1SL0B 1BG5A 3ED3A 2VCVA 4V2MA 3KMOA 2HRFA 2O7KA 1YZXA 4NHWA 1O85A 5F8BA 1K0CA 1XW9A 3Q6OA 3SWLA 5IMCA 2L5OA 1SK1A 2WFCA 5G5EA 3EWLA 3U5RE 2H0HA 4L8EA 5ECSA 5CAXA 2N5FA 1KBNA 1A2MA 4K7OA 4MLYA 3DEXA 1ABAA 4IS0A 2C0DA 4NPBA 3VURA 2J23A 1U6TA 1USBA 2PPTA 4PQIA 3KP8A 4HJ2A 1TW9A 3MAKA 2JL4A 5HFGA 2C80A 3W8SA 1M2DA 1A23A 2FWEA 4LLRA 1PKZA 2GT5A 3US3A 1EOGA 1ZYQB 3WD6A 1KTEA 1XFLA 4EDZA 3D0ZA 3EU4A 1PQNA 4K6XA 1YKAA 3LGCA 3UOMA 2YZUA 4PQ1A 1PRXA 4EVMA 3VI7A 5ECQB 2GGTA 4WF5A 1HNCA 5J5NA 1R5AA 2FUG2 2JU5A 4PQHA 1O6JA 1N2AA 3QAVA 4I6XA 1EEMA 1NHOA 1U3AA 3SBCA 2JZRA 5HR0A 1JLWA 3A2VA 1HQOA 2FNOA 2VL2C 4GRFA 4MPGA 3ME7A 2H01A 1XXUA 4N0VA 5H5QA 1VF2A 1GLPA 2GQLA 2F51A 5J41A 3ZITA 5A4VA 2L59A 2WGRA 1M99A 1FVJA 3IR4A 1Z7RA 4J2FA 1BEDA 5CRGA 1BAYA 1W89A 5DQSA 3KGKA 2FGXA 2MMAA 3PGTA 3FY7A 2E7PA 3G9BA 4MF5A 2PVQA 5D9TA 2K9FA 1MTCA 5ECNB 5L71A 5IMFA 1ZMAA 1F3BA 4KAEA 3TKQA 2IMKA 1GSFA 5J9CA 2HXKA 3TJGA 2A2SA 1YEPA 1UN2A 4MH2A 4WBRD 3GHAA 4O32A 1OC9A 1DE1A 3GYKA 4ZILA 4OFMA 5EVOA 4HU7A 4K8MA 3GX8A 4KB3A 8GSSA 5EL8A 2IL3A 2V32A 2JADA 2WCIA 2GZPA 2AYTA 1QMVA 2NVLA 1SD8A 3BJ5A 2I3YA 2LNTA 2YCDA 2VLUA 4HI7A 4HOJA 1M2BA 4I2UA 5IO0A 5KN1A 1ON4A 4MA9A 3CTFA 3GRXA 5DALA 4BVYA 1NW2A 5D9WA 4E8HA 4MF7A 2MMZA 1T4ZA 4EKZA 1XWBA 3P8WA 2GSSA 2IMIA 2HZEA 4XRAA 3Q74A 3A5WA 3KD0A 4WR5A 4KUNA 4KSMA 4GLTA 4YQMA 5A4UA 2HZFA 4BWSA 4CDOA 2FD3A 5ECHB 5GAPD 2R5GA 4OO5A 2XBIA 2CX3A 4ZB9A 3UVHA 1BJXA 3U6VA 4RQXA 5GSSA 3HCZA 1OYJA 2FA4A 3BBYA 4AJ7A 3H4KA 1FO5A 3A2WA 1K3LA 5DQYA 4PXOA 5B8AA 4FIWA 4I8BA 1ERWA 2C8UA 4BL7A 4GF0A 1PL2A 2XBQA 4TR1A 2ALBA 3P7XA 1TU8A 4KCEA 2DJ2A 1AIUA 2GVPA 2REMA 2N5AA 3F6DA 4TXOB 3L9UA 5HFIA 18GSA 3M9JA 1U3IA 2O87A 2P0GA 6GSTA 1SL1B 1F9MA 11GSA 1O7UA 3WGEA 3L0HA 5DCGA 4NMUA 1F6MC 3TDGA 1G6YA 5F0GA 2YPMA 1GLQA 3KJYA 3TOUA 2OJLA 3LSZA 3GL5A 5C00A 3N9JA 1AQVA 4OD7A 2MMOA 3E3EA 1B4PA 4IQAA 4WKWA 3IAS2 1EWXA 2HFDA 5IIZA 3VWVA 2GLRA 2CVKA 1EOHA 3QFAC 2GZZA 3ZLPA 3ERWA 3BCKA 2YJ7A 3GNJA 1GSYA 4LL1B 1TTZA 2GSQA 1FVKA 4JR4A 1J0FA 2XHFA 2B3SA 5KN2A 3FYGA 2I81A 1V98A 1VF3A 7GSSA 4WF4A 4EC0A 3LJRA 2H8LA 4JE1A 1PMTA 1X9WB 3M3MA 1YKCA 12GSA 4XRDA
chains in the Genus database with same CATH superfamily
3H1NA 3KTLA 4KDXA 2VD1A 1UC7A 3ZZXA 2LS5A 4XCSA 1TK8B 2YV9A 4JEDA 4IELA 1OC8A 1JZDA 1ZCPA 3LFLA 5HR2A 4ZB6A 1EV9A 5KOWA 2GZYA 3TKPA 1FOHA 2R0GA 2V2GA 4K1FA 1OKDA 2ON5A 2VOCA 2CAQA 1Q98A 3TRQA 3FEUA 5IO2A 3S9FA 4EO3A 4PNGA 1A8YA 4ICYA 5IMZA 3ZL5A 1OAZA 4YAPA 1V58A 2PVOC 2I4AA 4DVCA 3G7IA 9GSSA 1AW9A 1X5EA 3I43A 2C3QA 2O89A 5EY6A 1HYUA 3FZ9A 4NV5A 3TKRA 4E8EA 2LJKA 1X0RA 3DRNA 2R3XA 2H6ZA 2LEGA 5ECIB 5ECOB 1XVQA 2R0CA 4RI6A 1Y25A 17GSA 4O7HA 4EDYA 4TRXA 1MD3A 3RDWA 1GUHA 4ECBA 3RPPA 1URMA 5INYA 2H73A 1B48A 4BVXA 1ZL9A 2LUSA 3EYTA 4ILFA 1A24A 4IW9A 2RUEA 5H5SA 2PWJA 5JCUA 4ULXA 5B6MA 1WP0A 2OA7A 1QK8A 4ECIA 3ME8A 1PGTA 4LMWA 3IHGA 3KTBA 3MSZA 4N10A 1TRUA 2PGTA 1S3AA 6GSUA 2NTOA 2H19A 4BPYA 5FHIA 4DSSB 1ZYEA 1EZKA 6GSSA 1YEXA 5E4WA 4JU5A 3TJKA 1WPIA 3IC8A 3VPTA 1GTUA 5LCZA 2M72A 2HNLA 1XOAA 2TRCP 4ML1A 4K2DA 1V2AA 1SENA 2OE0A 5B7CA 4ACSA 1MDIA 3W6GA 4HS1A 3TKSC 1YDKA 2DBCA 2HRKA 4MDCA 2P5RA 4MH3A 5G2ZA 1GTAA 2KP1A 3FR6A 2L6DA 3F4TA 5F05A 3LEFA 2HSMA 3GSTA 3F63A 4KH7A 4AJ8A 1TOFA 1XG8A 2H1GA 3IHQA 1GWCA 1K0MA 2VCTA 3IRAA 3M9KA 1WJKA 4AGSA 1UVZA 1TKDB 3L9VA 2H0IA 2GSTA 3ZVJD 2RM6A 1Z7PA 4MCUA 4KSOA 3IV4A 3HZ4A 3TB2A 2IFQB 1SD9A 1XWGA 2MZCA 4EL1A 5DAKA 3LYKA 5ABRA 1Z3EA 1XW6A 4FYUA 2QC7A 2H1AA 2PU9C 1J08A 4JBBA 4I2TA 3M0FA 4FYBA 2JZSA 4HU9A 2FHEA 3J7Yk 1Z6NA 1GTBA 1DBYA 4I5QA 2BJXA 2JSYA 4CHSA 3WGXA 2AHEA 3QOUA 1ML6A 2F9SA 3C73A 4D73A 3HYPA 5JWOB 3NOFA 3L9SA 3QDNA 3C71A 3HJPA 2C1YA 3D22A 1NHYA 1B8XA 3UVTA 1KNGA 3RHCA 3CSHA 3KM6A 1X5DA 4IVFA 3G7JA 4ZBBA 5HR1A 1EGOA 1TJDA 2FLSA 1AQWA 1S3RA 1GTIA 4AF2A 2R4VA 5J3RA 3CSIA 5ID2A 2MBSA 3QD9A 4NWYA 1OKTA 5JCGA 1G7EA 4RQRA 5A4WA 1N8JA 1CQHA 2ON7A 2D2ZA 2H66A 4XS4B 4J57E 3O76A 3TKSE 1GSQA 4H86A 4EE0A 6GSWA 3A3TA 1PD21 3CSJA 5DJLA 2C4JA 2QSIA 3Q19A 4I97A 5DCHA 2CZ3A 1PX6A 2BMXA 4LMVA 1GUMA 4Q5NA 2VCXA 3CMIA 5A5KA 4BIKA 2ZUPA 4MK3A 1O73A 2ES7A 2H76A 3APSA 5AGYA 3PPUA 3GH6A 3PH9A 3RAZA 4HJMA 2FWFA 3E9JB 2HRAA 4O92A 2C0FA 4K5RA 1H75A 2VCZA 3ISOA 3QR6A 5HQPA 2PMTA 4OO4A 1OC3A 4XHMA 5F06A 4GSSA 1EV4A 2HI7A 4TR3A 2VL9A 5G1KA 2FWGA 2B1KA 4V1Ap 2B5YA 2FY6A 3UEMA 1AXDA 3CBUA 6GSYA 1XPVA 3FRCA 4V1Ag 4L5LA 4POBA 3H8QA 4JZQA 2LQOA 1SK2A 4FQUA 5H5RA 1AQXA 3DKSA 2LTKA 3VLNA 5B8BA 5ENUA 5AISA 4KNDA 2IN3A 1M2AA 4XS1A 1VF4A 3E0UA 2QA1A 4X1UA 2VLVA 4PX1A 4WXTA 2YN1A 2AJQB 3GKMA 4MPFA 3GA4A 2X64A 2RIIA 4HQSA 1AUCA 1TK0B 1Z6MA 4TOPA 2O8VB 2JACA 2CVBA 1TI1A 2YP6A 3KCMA 3R3EA 4XTSA 1R5PA 2F8FA 5CP1A 2H70A 2IIYA 1XOBA 2HT9A 13GSA 1V57A 5ECRB 1PA3A 1G6WA 2V41A 2KLXA 3TRPA 3LWAA 2OADA 1M3IA 3IE3A 3RBTA 1A0RP 2OKAA 3HJMA 3HXSA 4OFTA 2HRNA 2VO4A 2GQKA 1QFNA 4WR4A 5CREA 2OBKA 4KCAA 5CRHA 3TUEA 5DDLA 3D6IA 1TDIA 3UMAA 2G0FA 1ZYPA 2TIRA 2GS3A 3OR5A 1PSQA 4GSNA 3GKKA 4G0KA 3V1WA 5E59A 2L6CA 4K5SA 1XZOA 4CY8A 3PINA 4ZXGA 1T7PB 1NM3A 3QCPA 2R6KA 3ZRDA 4ID0A 3VWWA 2TRXA 2NBSA 4G10A 2B5XA 2G2QA 2L4QA 1PN9A 3MNGA 3ZIVA 2A2PA 1SJIA 3KEBA 2YWOA 2JZTA 1RK4A 3FK8A 4GSTA 4IBPA 1M7TA 3QMXA 3DYRA 4TR0A 3KIJA 1EEJA 4GCIA 2C3NA 1EP8A 1F37A 1MDJA 1BYEA 3UBLA 3GTUA 3M1GA 4K0NA 2YNXA 2WZ9A 2YJHA 5DJMA 4POLA 5F07A 1WE0A 2IJYA 5LD0A 5GAND 1FW1A 3HVXA 1XCCA 3ZTLA 2WRTA 4MJEA 3FKFA 1T8EB 3LYPA 3F3QA 4PUAA 3WT2A 5ECLB 1K3OA 2LKUA 3ZMLA 4ZB8A 1X5CA 1FOVA 1XVWA 1GNWA 5D9XA 2VCWA 3TJBA 3QAGA 1SK0A 1GP1A 2GT6A 2L4CA 3PR8A 1U87A 4N30A 1OC9B 2WULA 1I9DA 4Q5RA 3FZAA 4O5RA 5G1LA 4K9ZA 3IK7A 1YF1A 1O8WA 2A4VA 3VFIA 3F8UA 2XPDA 4KDUA 3QPMA 3DGQA 4EF0A 1TK5B 3C1RA 1LBKA 3GH9A 3WGDA 2PBJA 2VM2A 2QGVA 2EIRA 5D93A 4P3YB 5IMDA 5DALB 4BVYB 4GQCA 4X4JA 5JWRB 3GIXA 2HZEB 1ZOFA 1MDKA 2F8AA 2DLXA 1UA5A 4POKA 4XS6A 3I9V2 2J9HA 1SKWB 2X8GA 3KZQA 2DIZA 1S3DA 3CRTA 4PURA 3C7MA 2H74A 3KP9A 2BTOT 1ERTA 1TRVA 2IMFA 4XIHA 1X9MB 4MF6A 2DIYA 3HJOA 2V6KA 4IP6A 3IDVA 1M3JA 3GN3A 3RHBA 3DD3A 1LU4A 4Z2RA 4USSA 1R4WA 4OCEA 2LNSA 1AAZA 4KX4A 3VWXA 4Q5FA 1XWCA 3F0IA 2RUFA 4BL7B 5KN3A 2YANA 4ZL7A 2PN8A 4TR1B 4PTSA 1A2LA 2CA8A 4BWQA 1TU7A 3TGZA 3CQFA 1XIYA 4YKFA 1RW1A 3WYWA 2H72A 4ZL9A 2A2RA 3F3RA 3DWVA 1B4QA 2K6VA 5IQYA 4NXIA 3I6AA 2VM1A 3O3TA 2HYXA 2N5BA 1HD2A 2IMEA 4NHZA 5IMVA 2L57A 3IAM2 3UARA 3HA9A 4IKHA 4OFNA 3BOAA 3L78A 1JZOA 1TI3A 2DKHA 2HE3A 1S3CA 1T1VA 3F4RA 2H30A 2ZNMA 2DJKA 2M80A 3UIWA 1I5GA 2E2GA 2B7KA 1T00A 2VIMA 4G0LA 1K0OA 5J4UA 3Q18A 2AB6A 3EMPA 1EP7A 5CRDA 3EURA 1QQ2A 2O85A 2OE1A 1SKRB 2WJUA 2YZHA 4KDYA 1THXA 3VWUA 1THOA 3FR3A 1JLVA 3R2QA 5KOXA 3ZMKA 3IA1A 3EINA 2LV3A 4NAXA 2MMNA 1A0FA 1H4OA 3KXOA 2RM5A 2GDRA 3FW2A 1BX9A 1A2JA 1TXXA 2CT6A 2H6YA 4IJIA 3UJ1A 5G5FA 5DBQA 4RI7A 1GL8A 2C0EA 4K7NA 2DC5A 1WRYA 1G7OA 2KP2A 3ZREA 5ELGA 2YWNA 4TKYA 3DVWA 1F2EA 10GSA 4G2EA 3MDKA 2VUPA 3P90A 2DSAA 1DSBA 3VPQA 4PGTA 1GSEA 4L5OA 2I9HA 1JZRA 2QA2A 5CO3A 1TRWA 5GZZB 1GUKA 4Z2TA 3DIEA 1JHBA 4HZ2A 4FH8A 1E2YA 4YH2A 2LRTA 3A5IA 4YKGA 3TRXA 5CYYA 3MWHA 2HLSA 2P31A 2OE3A 4K0GA 1V9WA 1B9XC 1SU9A 3K8NA 1O81A 2CAIA 3GSSA 2LRCA 4J56E 1FHEA 4JR6A 3GV1A 5G30A 4GXZA 4L0WA 4TXOA 4BVXB 5B6NA 1GNEA 3CTGA 1ZZYA 3NIVA 4G9HA 4ISDA 2YV7A 5IM9A 1Z9HA 2MBTA 3O6TA 1R26A 1IYIA 2DJ1A 1JFUA 1WOUA 5HFKA 2IPAA 2R2JA 2B5EA 2KUCA 3GUSA 4CW9A 2MYGA 2LSTA 5ECKB 2DJJA 3VK9A 3QAWA 1Q4JA 2AV4A 2R0PA 1X9SB 1Y6EA 4N0ZA 4Q5QA 3EPTA 1E6BA 3HZ8A 1PN0A 1K0BA 4MZBA 4OCFA 3HD5A 5KEJA 3LG6A 4G19A 1K0NA 4BA7A 1YQ1A 5G31A 3GX0A 4MNNA 5IOXA 1QGVA 2R37A 3HHVA 4O5QA 5KN0A 5D73A 4JRRA 4IHUA 1WIKA 4EUYA 4IQ1A 3N5OA 3GL3A 2X49A 1W4VA 1XWKA 5COHA 1GRXA 4MJBA 22GSA 2WS2A 3VI5A 4YQVA 3HDCA 5JCWA 3D4TA 5CNWA 19GSA 3RPNA 2HSHA 2LQQA 2OACA 3IC4A 2FWHA 2IWTA 3LW9A 4NV2A 4GWRA 2C3TA 3H79A 3DMLA 1WWJA 4GTUA 1M9AA 1PKWA 5ECMB 4TR4A 1FAAA 4FO5A 6GSVA 5D8IA 2H1DA 5DAKB 6GSXA 4Z7XA 3FZ5A 2CQ9A 2NDOA 3UBKA 3EVIA 2H75A 3CYNA 1QUWA 2VD0A 2I1UA 4F0CA 3D5JA 5HR3A 2KHPA 2JSZA 4GQFA 4MZWA 5BMUA 4IJ3A 3ZVJA 1Z5YE 1GULA 5GSTA 1T3BA 1A8LA 2PUKC 3C8EA 2X8HA 14GSA 1ERUA 1VRSD 4MP4A 2ZCTA 5AIVA 4F82A 2RLIA 3DVXA 3EE2A 5IOWA 4D73B 4OMVA 1K3YA 1MEKA 4TW5A 2EIOA 4HUAA 1PL1A 1NSWA 4MZCA 2VCQA 1GH2A 2FCHA 1OVNA 2YWIA 4ZIJA 2H6XA 2P5QA 4QQ7A 1V40A 1T4YA 3EU3A 5C04A 3TKSA 1U88A 1XWAA 5IPHA 2OBIA 4WETA 3UAPA 3GURA 3WT1A 1XBSA 4N11A 2H0GA 3D21A 5IPGA 2F3MA 3APOA 5CRWA 5ID2B 20GSA 3CXGA 4F03A 3FR9A 4X0XA 2XPEA 5AN1A 2AAWA 4ECCA 2Z9SA 1FG4A 4V2LA 1YY7A 4LA1A 4AJ6A 2CVDA 4DSSA 2YOIA 2E2MA 5IMAA 4QL9A 4DSRA 1ST9A 2H71A 4ZL8A 5EPFA 3IPZA 2PERA 2K8SA 3HVNA 4ML6A 2X99A 4DEJA 2QKEA 3TOTA 1G0TA 3A2XA 3FHKA 1TRSA 4OWYA 1VF1A 2X8CA 1CQGA 1IYHA 2L5LA 4PNFA 2XC2A 2CV4A 2B6MA 3HVSA 3I69A 1DE2A 1K0DA 4QL7A 4RUVA 2H1BA 4LL4B 3GKNA 5LNKe 4HEA2 1SYRA 1K0AA 2VAFA 1ACVA 3FZ4A 3LORA 1VGLA 4YQUA 3M8NA 1GSDA 4F9ZA 1C72A 2CZ2A 1LJRA 5ECPB 5JWQB 3LXZA 5FWGA 4O5UA 1OE7A 1MD4A 4F2IA 3TCOA 3HVVA 1O8XA 2IFQA 3ERFA 4DSQA 3HY2A 1ZGNA 5FT3A 4K7IA 5ELAA 4MJCA 3NZNA 2C0GA 4WEYA 4ECJA 4PUFC 2GQMA 2DMLA 2WB9A 3ZIJA 1J9BA 1TP9A 3C1SA 3F9UA 2V1MA 2K18A 3DXBA 4TXVA 1XW5A 1ILOA 1BQ7A 2DMMA 4F0BA 3CRUA 3TJFA 1FB6A 4KGIA 2LRNA 2VL3A 2AUVA 3JCML 4FYCA 3ZFLA 2DKIA 2CX4A 1AC1A 4KE3A 3BD2A 3AY8A 4KW6A 1SJZA 3GFKA 2KOKA 1DUGA 5D96A 2VL2A 1HNBA 4X43A 2NPBA 3TJJA 4MMMA 4HZ4A 4MJAA 2DJ0A 2VLTA 4HQZA 1PFOA 2DJ3A 4TN8A 1M9BA 3IXRA 2FA8A 3F6FA 2B7JA 4IP1A 3G7YA 3MYDA 3F4SA 3IBHA 2K8VA 1YJ6A 4XS4A 1GSSA 2LJRA 2A4HA 3J7Yb 1RQMA 4WBJA 1OE8A 4YAVA 3D4MA 3LXTA 4Z2UA 3W8JA 4ZBDA 5DVBA 4V2NA 2IMDA 4K2XA 1JZWA 3LQ7A 1SL2B 2YWMA 4KA0A 3ZFBA 3EMXA 2B1LA 2V6OA 3KH7A 3BCIA 3GKXA 3EC3A 4EIPA 4POMA 16GSA 1KEBA 1F3AA 1PX7A 1EGRA 1R7HA 1SJ6A 1YF0A 3L4NA 4L0UA 4EXJA 4TVEA 5J9BA 1SYXA 4HDEA 1HNAA 2E0QA 3GTUB 1GSUA 3IK9A 4IGJA 3H93A 4ZBAA 2EIQA 3HKRA 3UL3A 1M0UA 3APQA 3ERGA 5D9VA 2HSYA 1FB0A 4IN0A 3KH9A 2GSRA 1WMJA 4MABA 3KMNA 1ERVA 1QXHA 3ZYWA 1B9YC 5AIXA 3QFBC 1SKSB 2M46A 3IOSA 2WDUA 3P2AA 2GTUA 2LJAA 2EC4A 3GMFA 1SL0B 1BG5A 3ED3A 2VCVA 2X4AA 4V2MA 3KMOA 2HRFA 2O7KA 1YZXA 4NHWA 1O85A 5F8BA 1K0CA 1XW9A 3Q6OA 3SWLA 5IMCA 2L5OA 1SK1A 2WFCA 5G5EA 3EWLA 3U5RE 2H0HA 4L8EA 5ECSA 5CAXA 2N5FA 1KBNA 1A2MA 4K7OA 4MLYA 2UZ8A 3DEXA 1ABAA 4IS0A 2C0DA 4NPBA 3VURA 2J23A 1U6TA 1USBA 2PPTA 4PQIA 3KP8A 4HJ2A 1TW9A 3MAKA 2JL4A 5HFGA 2C80A 3W8SA 1M2DA 1A23A 2FWEA 4LLRA 1PKZA 2GT5A 3US3A 1EOGA 1ZYQB 3WD6A 1KTEA 1XFLA 4A5PA 4EDZA 3D0ZA 3EU4A 1PQNA 4K6XA 1YKAA 3LGCA 3UOMA 2YZUA 4PQ1A 1PRXA 4EVMA 3VI7A 5ECQB 2GGTA 4WF5A 1HNCA 5J5NA 1R5AA 2FUG2 2JU5A 4PQHA 1O6JA 1N2AA 3QAVA 4I6XA 1EEMA 1NHOA 1U3AA 3SBCA 2JZRA 5HR0A 1JLWA 3A2VA 1HQOA 2FNOA 2VL2C 4GRFA 4MPGA 3ME7A 2H01A 1XXUA 4N0VA 5H5QA 1VF2A 1GLPA 2GQLA 2F51A 5J41A 3ZITA 5A4VA 2L59A 2WGRA 1M99A 1FVJA 3IR4A 1Z7RA 4J2FA 1BEDA 5CRGA 1BAYA 1W89A 5DQSA 3KGKA 2FGXA 2MMAA 3PGTA 3FY7A 2E7PA 3G9BA 4MF5A 2PVQA 5D9TA 2K9FA 1MTCA 5ECNB 5L71A 5IMFA 1ZMAA 1F3BA 4KAEA 3TKQA 2IMKA 1GSFA 5J9CA 2HXKA 3TJGA 3MIXA 2A2SA 1YEPA 1UN2A 4MH2A 4WBRD 3GHAA 4O32A 1OC9A 1DE1A 3GYKA 4ZILA 4OFMA 5EVOA 4HU7A 4K8MA 3GX8A 4KB3A 8GSSA 5EL8A 2IL3A 2V32A 2JADA 2WCIA 2GZPA 2AYTA 1QMVA 2NVLA 1SD8A 3BJ5A 2I3YA 2LNTA 2YCDA 2VLUA 4HI7A 4HOJA 1M2BA 4I2UA 5IO0A 5KN1A 1ON4A 4MA9A 3CTFA 4EIQA 3GRXA 5DALA 4BVYA 1NW2A 5D9WA 4E8HA 4MF7A 2MMZA 1T4ZA 4EKZA 1XWBA 3P8WA 2GSSA 2IMIA 2HZEA 4XRAA 3Q74A 3A5WA 3KD0A 4WR5A 4KUNA 4KSMA 4GLTA 4YQMA 5A4UA 2HZFA 4BWSA 4CDOA 2FD3A 5ECHB 5GAPD 2R5GA 4OO5A 2XBIA 2CX3A 4ZB9A 3UVHA 1BJXA 3U6VA 4RQXA 5GSSA 3HCZA 1OYJA 2FA4A 3BBYA 5BRTA 1ZYNA 4AJ7A 3H4KA 1FO5A 3A2WA 1K3LA 5DQYA 4PXOA 5B8AA 4FIWA 4I8BA 1ERWA 2C8UA 4BL7A 4GF0A 1PL2A 2XBQA 4TR1A 2ALBA 3P7XA 1TU8A 4KCEA 2DJ2A 1AIUA 2GVPA 2REMA 2N5AA 3F6DA 4TXOB 3L9UA 5HFIA 18GSA 3M9JA 1U3IA 2O87A 2P0GA 6GSTA 4HSCX 1SL1B 1F9MA 4G0IA 11GSA 1O7UA 3WGEA 3L0HA 4NMUA 5DCGA 4CY6A 1F6MC 3TDGA 1G6YA 5F0GA 2YPMA 1GLQA 3KJYA 3TOUA 2OJLA 3LSZA 3GL5A 5C00A 3N9JA 1AQVA 4OD7A 2MMOA 3E3EA 1B4PA 4IQAA 4WKWA 3IAS2 4KF9A 1EWXA 2HFDA 5IIZA 3VWVA 2GLRA 2CVKA 1EOHA 3QFAC 2GZZA 3FMWA 3ZLPA 3ERWA 3BCKA 2YJ7A 3GNJA 1GSYA 4LL1B 1TTZA 2GSQA 1FVKA 4JR4A 1J0FA 2XHFA 2B3SA 5KN2A 3FYGA 2I81A 1V98A 1VF3A 7GSSA 4WF4A 4EC0A 3LJRA 2H8LA 4JE1A 1PMTA 1X9WB 3M3MA 1YKCA 12GSA 4XRDA
chains in the Genus database with same CATH topology
3H1NA 3KTLA 4KDXA 2VD1A 1UC7A 3ZZXA 2LS5A 4XCSA 1TK8B 2YV9A 4JEDA 4IELA 1OC8A 1JZDA 1ZCPA 3LFLA 5HR2A 4ZB6A 1EV9A 5KOWA 2GZYA 3TKPA 1FOHA 2R0GA 2V2GA 4K1FA 1OKDA 2ON5A 2VOCA 2CAQA 1Q98A 3TRQA 3FEUA 5IO2A 3S9FA 4EO3A 4PNGA 1A8YA 4ICYA 5IMZA 3ZL5A 1OAZA 4YAPA 1V58A 2PVOC 2I4AA 4DVCA 3G7IA 9GSSA 1AW9A 1X5EA 3I43A 2C3QA 2O89A 5EY6A 1HYUA 3FZ9A 4NV5A 3TKRA 4E8EA 2LJKA 1X0RA 3DRNA 2R3XA 2H6ZA 2LEGA 5ECIB 5ECOB 1XVQA 2R0CA 4RI6A 1Y25A 17GSA 4O7HA 4EDYA 4TRXA 1MD3A 3RDWA 1GUHA 4ECBA 3RPPA 1URMA 5INYA 2H73A 1B48A 4BVXA 1ZL9A 2LUSA 3EYTA 4ILFA 1A24A 4IW9A 2RUEA 5H5SA 2PWJA 5JCUA 4ULXA 5B6MA 1WP0A 2OA7A 1QK8A 4ECIA 3ME8A 1PGTA 4LMWA 3IHGA 3KTBA 3MSZA 4N10A 1TRUA 2PGTA 1S3AA 6GSUA 2NTOA 2H19A 4BPYA 5FHIA 4DSSB 1ZYEA 1EZKA 6GSSA 1YEXA 5E4WA 4JU5A 3TJKA 1WPIA 3IC8A 3VPTA 1GTUA 5LCZA 2M72A 2HNLA 1XOAA 2TRCP 4ML1A 4K2DA 1V2AA 1SENA 2OE0A 5B7CA 4ACSA 1MDIA 3W6GA 4HS1A 3TKSC 1YDKA 2DBCA 2HRKA 4MDCA 2P5RA 4MH3A 5G2ZA 1GTAA 2KP1A 3FR6A 2L6DA 3F4TA 5F05A 3LEFA 2HSMA 3GSTA 3F63A 4KH7A 4AJ8A 1TOFA 2H1GA 3IHQA 1GWCA 1K0MA 2VCTA 3IRAA 3M9KA 1WJKA 4AGSA 1UVZA 1TKDB 3L9VA 2H0IA 2GSTA 3ZVJD 2RM6A 1Z7PA 4MCUA 4KSOA 3IV4A 3HZ4A 3TB2A 2IFQB 1SD9A 1XWGA 2MZCA 4EL1A 5DAKA 3LYKA 5ABRA 1Z3EA 1XW6A 4FYUA 2QC7A 2H1AA 2PU9C 1J08A 4JBBA 4I2TA 3M0FA 4FYBA 2JZSA 4HU9A 2FHEA 3J7Yk 1Z6NA 1GTBA 1DBYA 4I5QA 2BJXA 2JSYA 4CHSA 3WGXA 2AHEA 3QOUA 1ML6A 2F9SA 3C73A 4D73A 3HYPA 5JWOB 3NOFA 3L9SA 3QDNA 3C71A 3HJPA 2C1YA 3D22A 1NHYA 1B8XA 3UVTA 1KNGA 3RHCA 3CSHA 3KM6A 1X5DA 4IVFA 3G7JA 4ZBBA 5HR1A 1EGOA 1TJDA 2FLSA 1AQWA 1GTIA 4AF2A 2R4VA 5J3RA 3CSIA 5ID2A 2MBSA 3QD9A 4NWYA 1OKTA 5JCGA 1G7EA 4RQRA 5A4WA 1N8JA 1CQHA 2ON7A 2D2ZA 2H66A 4XS4B 4J57E 3O76A 3TKSE 1GSQA 4H86A 4EE0A 6GSWA 3A3TA 1PD21 3CSJA 5DJLA 2C4JA 2QSIA 3Q19A 4I97A 5DCHA 2CZ3A 1PX6A 2BMXA 4LMVA 1GUMA 4Q5NA 2VCXA 3CMIA 5A5KA 2ZUPA 4MK3A 1O73A 2ES7A 2H76A 3APSA 5AGYA 3PPUA 3GH6A 3PH9A 3RAZA 4HJMA 2FWFA 3E9JB 2HRAA 4O92A 2C0FA 4K5RA 1H75A 2VCZA 3ISOA 3QR6A 5HQPA 2PMTA 4OO4A 1OC3A 4XHMA 5F06A 4GSSA 1EV4A 2HI7A 4TR3A 2VL9A 5G1KA 2FWGA 2B1KA 4V1Ap 2B5YA 2FY6A 3UEMA 1AXDA 3CBUA 6GSYA 1XPVA 3FRCA 4V1Ag 4L5LA 4POBA 3H8QA 4JZQA 2LQOA 1SK2A 4FQUA 5H5RA 1AQXA 3DKSA 2LTKA 3VLNA 5B8BA 5ENUA 5AISA 4KNDA 2IN3A 1M2AA 4XS1A 1VF4A 3E0UA 2QA1A 4X1UA 2VLVA 4PX1A 4WXTA 2YN1A 2AJQB 3GKMA 4MPFA 3GA4A 2X64A 2RIIA 4HQSA 1AUCA 1TK0B 1Z6MA 4TOPA 2O8VB 2JACA 2CVBA 1TI1A 2YP6A 3KCMA 3R3EA 4XTSA 1R5PA 2F8FA 5CP1A 2H70A 2IIYA 1XOBA 2HT9A 13GSA 1V57A 5ECRB 1PA3A 1G6WA 2V41A 2KLXA 3TRPA 3LWAA 2OADA 3IE3A 3RBTA 1A0RP 2OKAA 3HJMA 3HXSA 4OFTA 2HRNA 2VO4A 2GQKA 1QFNA 4WR4A 5CREA 2OBKA 4KCAA 5CRHA 3TUEA 5DDLA 3D6IA 1TDIA 3UMAA 2G0FA 1ZYPA 2TIRA 2GS3A 3OR5A 1PSQA 4GSNA 3GKKA 4G0KA 3V1WA 5E59A 2L6CA 4K5SA 1XZOA 4CY8A 3PINA 4ZXGA 1T7PB 1NM3A 3QCPA 2R6KA 3ZRDA 4ID0A 3VWWA 2TRXA 2NBSA 4G10A 2B5XA 2G2QA 2L4QA 1PN9A 3MNGA 3ZIVA 2A2PA 1SJIA 3KEBA 2YWOA 2JZTA 1RK4A 3FK8A 4GSTA 4IBPA 1M7TA 3QMXA 3DYRA 4TR0A 3KIJA 1EEJA 4GCIA 2C3NA 1EP8A 1F37A 1MDJA 1BYEA 3UBLA 3GTUA 3M1GA 4K0NA 2YNXA 2WZ9A 2YJHA 5DJMA 4POLA 5F07A 1WE0A 2IJYA 5LD0A 5GAND 1FW1A 3HVXA 1XCCA 3ZTLA 2WRTA 4MJEA 3FKFA 1T8EB 3LYPA 3F3QA 4PUAA 3WT2A 5ECLB 1K3OA 2LKUA 3ZMLA 4ZB8A 1X5CA 1FOVA 1XVWA 1GNWA 5D9XA 2VCWA 3TJBA 3QAGA 1SK0A 1GP1A 2GT6A 2L4CA 3PR8A 1U87A 4N30A 1OC9B 2WULA 1I9DA 4Q5RA 3FZAA 4O5RA 5G1LA 4K9ZA 3IK7A 1YF1A 1O8WA 2A4VA 3VFIA 3F8UA 2XPDA 4KDUA 3QPMA 3DGQA 4EF0A 1TK5B 3C1RA 1LBKA 3GH9A 3WGDA 2PBJA 2VM2A 2QGVA 2EIRA 5D93A 4P3YB 5IMDA 5DALB 4BVYB 4GQCA 4X4JA 5JWRB 3GIXA 2HZEB 1ZOFA 1MDKA 2F8AA 2DLXA 1UA5A 4POKA 4XS6A 3I9V2 2J9HA 1SKWB 2X8GA 3KZQA 2DIZA 1S3DA 3CRTA 4PURA 3C7MA 2H74A 3KP9A 2BTOT 1ERTA 1TRVA 2IMFA 4XIHA 1X9MB 4MF6A 2DIYA 3HJOA 2V6KA 4IP6A 3IDVA 3GN3A 3RHBA 3DD3A 1LU4A 4Z2RA 4USSA 1R4WA 4OCEA 2LNSA 1AAZA 4KX4A 3VWXA 4Q5FA 1XWCA 3F0IA 2RUFA 4BL7B 5KN3A 2YANA 4ZL7A 2PN8A 4TR1B 4PTSA 1A2LA 2CA8A 4BWQA 1TU7A 3TGZA 1XIYA 4YKFA 1RW1A 3WYWA 2H72A 4ZL9A 2A2RA 3F3RA 3DWVA 1B4QA 2K6VA 5IQYA 4NXIA 3I6AA 2VM1A 3O3TA 2HYXA 2N5BA 1HD2A 2IMEA 4NHZA 5IMVA 2L57A 3IAM2 3UARA 3HA9A 4IKHA 4OFNA 3BOAA 3L78A 1JZOA 1TI3A 2DKHA 2HE3A 1S3CA 1T1VA 3F4RA 2H30A 2ZNMA 2DJKA 2M80A 3UIWA 1I5GA 2E2GA 2B7KA 1T00A 2VIMA 4G0LA 1K0OA 5J4UA 3Q18A 2AB6A 3EMPA 1EP7A 5CRDA 3EURA 1QQ2A 2O85A 2OE1A 1SKRB 2WJUA 2YZHA 4KDYA 1THXA 3VWUA 1THOA 3FR3A 1JLVA 3R2QA 5KOXA 3ZMKA 3IA1A 3EINA 2LV3A 4NAXA 2MMNA 1A0FA 1H4OA 3KXOA 2RM5A 2GDRA 3FW2A 1BX9A 1A2JA 1TXXA 2CT6A 2H6YA 4IJIA 3UJ1A 5G5FA 5DBQA 4RI7A 1GL8A 2C0EA 4K7NA 2DC5A 1WRYA 1G7OA 2KP2A 3ZREA 5ELGA 2YWNA 4TKYA 3DVWA 1F2EA 10GSA 4G2EA 3MDKA 2VUPA 3P90A 2DSAA 1DSBA 3VPQA 4PGTA 1GSEA 4L5OA 2I9HA 1JZRA 2QA2A 5CO3A 1TRWA 5GZZB 1GUKA 4Z2TA 3DIEA 1JHBA 4HZ2A 4FH8A 1E2YA 4YH2A 2LRTA 3A5IA 4YKGA 3TRXA 5CYYA 3MWHA 2HLSA 2P31A 2OE3A 4K0GA 1V9WA 1B9XC 1SU9A 3K8NA 1O81A 2CAIA 3GSSA 2LRCA 4J56E 1FHEA 4JR6A 3GV1A 5G30A 4GXZA 4L0WA 4TXOA 4BVXB 5B6NA 1GNEA 3CTGA 1ZZYA 3NIVA 4G9HA 4ISDA 2YV7A 5IM9A 1Z9HA 2MBTA 3O6TA 1R26A 1IYIA 2DJ1A 1JFUA 1WOUA 5HFKA 2IPAA 2R2JA 2B5EA 2KUCA 3GUSA 4CW9A 2MYGA 2LSTA 5ECKB 2DJJA 3VK9A 3QAWA 1Q4JA 2AV4A 2R0PA 1X9SB 1Y6EA 4N0ZA 4Q5QA 3EPTA 1E6BA 3HZ8A 1PN0A 1K0BA 4MZBA 4OCFA 3HD5A 5KEJA 3LG6A 4G19A 1K0NA 4BA7A 1YQ1A 5G31A 3GX0A 4MNNA 5IOXA 1QGVA 2R37A 3HHVA 4O5QA 5KN0A 5D73A 4JRRA 4IHUA 1WIKA 4EUYA 4IQ1A 3N5OA 3GL3A 2X49A 1W4VA 1XWKA 5COHA 1GRXA 4MJBA 22GSA 2WS2A 3VI5A 4YQVA 3HDCA 5JCWA 3D4TA 5CNWA 19GSA 3RPNA 2HSHA 2LQQA 2OACA 3IC4A 2FWHA 2IWTA 3LW9A 4NV2A 4GWRA 2C3TA 3H79A 3DMLA 1WWJA 4GTUA 1M9AA 1PKWA 5ECMB 4TR4A 1FAAA 4FO5A 6GSVA 5D8IA 2H1DA 5DAKB 6GSXA 4Z7XA 3FZ5A 2CQ9A 2NDOA 3UBKA 3EVIA 2H75A 3CYNA 1QUWA 2VD0A 2I1UA 4F0CA 3D5JA 5HR3A 2KHPA 2JSZA 4GQFA 4MZWA 5BMUA 4IJ3A 3ZVJA 1Z5YE 1GULA 5GSTA 1T3BA 1A8LA 2PUKC 3C8EA 2X8HA 14GSA 1ERUA 1VRSD 4MP4A 2ZCTA 5AIVA 4F82A 2RLIA 3DVXA 3EE2A 5IOWA 4D73B 4OMVA 1K3YA 1MEKA 4TW5A 2EIOA 4HUAA 1PL1A 1NSWA 4MZCA 2VCQA 1GH2A 2FCHA 1OVNA 2YWIA 4ZIJA 2H6XA 2P5QA 4QQ7A 1V40A 1T4YA 3EU3A 5C04A 3TKSA 1U88A 1XWAA 5IPHA 2OBIA 4WETA 3UAPA 3GURA 3WT1A 1XBSA 4N11A 2H0GA 3D21A 5IPGA 2F3MA 3APOA 5CRWA 5ID2B 20GSA 3CXGA 4F03A 3FR9A 4X0XA 2XPEA 5AN1A 2AAWA 4ECCA 2Z9SA 1FG4A 4V2LA 1YY7A 4LA1A 4AJ6A 2CVDA 4DSSA 2YOIA 2E2MA 5IMAA 4QL9A 4DSRA 1ST9A 2H71A 4ZL8A 5EPFA 3IPZA 2PERA 2K8SA 4ML6A 2X99A 4DEJA 2QKEA 3TOTA 1G0TA 3A2XA 3FHKA 1TRSA 4OWYA 1VF1A 2X8CA 1CQGA 1IYHA 2L5LA 4PNFA 2XC2A 2CV4A 2B6MA 3HVSA 3I69A 1DE2A 1K0DA 4QL7A 4RUVA 2H1BA 4LL4B 3GKNA 5LNKe 4HEA2 1SYRA 1K0AA 2VAFA 1ACVA 3FZ4A 3LORA 1VGLA 4YQUA 3M8NA 1GSDA 4F9ZA 1C72A 2CZ2A 1LJRA 5ECPB 5JWQB 3LXZA 5FWGA 4O5UA 1OE7A 1MD4A 4F2IA 3TCOA 3HVVA 1O8XA 2IFQA 3ERFA 4DSQA 3HY2A 1ZGNA 5FT3A 4K7IA 5ELAA 4MJCA 3NZNA 2C0GA 4WEYA 4ECJA 4PUFC 2GQMA 2DMLA 2WB9A 3ZIJA 1J9BA 1TP9A 3C1SA 3F9UA 2V1MA 2K18A 3DXBA 4TXVA 1XW5A 1ILOA 1BQ7A 2DMMA 4F0BA 3CRUA 3TJFA 1FB6A 4KGIA 2LRNA 2VL3A 2AUVA 3JCML 4FYCA 3ZFLA 2DKIA 2CX4A 1AC1A 4KE3A 3BD2A 3AY8A 4KW6A 1SJZA 3GFKA 2KOKA 1DUGA 5D96A 2VL2A 1HNBA 4X43A 2NPBA 3TJJA 4MMMA 4HZ4A 4MJAA 2DJ0A 2VLTA 4HQZA 2DJ3A 4TN8A 1M9BA 3IXRA 2FA8A 3F6FA 2B7JA 4IP1A 3G7YA 3MYDA 3F4SA 3IBHA 2K8VA 1YJ6A 4XS4A 1GSSA 2LJRA 2A4HA 3J7Yb 1RQMA 4WBJA 1OE8A 4YAVA 3D4MA 3LXTA 4Z2UA 3W8JA 4ZBDA 5DVBA 4V2NA 2IMDA 4K2XA 1JZWA 3LQ7A 1SL2B 2YWMA 4KA0A 3ZFBA 3EMXA 2B1LA 2V6OA 3KH7A 3BCIA 3GKXA 3EC3A 4EIPA 4POMA 16GSA 1KEBA 1F3AA 1PX7A 1EGRA 1R7HA 1SJ6A 1YF0A 3L4NA 4L0UA 4EXJA 4TVEA 5J9BA 1SYXA 4HDEA 1HNAA 2E0QA 3GTUB 1GSUA 3IK9A 4IGJA 3H93A 4ZBAA 2EIQA 3HKRA 3UL3A 1M0UA 3APQA 3ERGA 5D9VA 2HSYA 1FB0A 4IN0A 3KH9A 2GSRA 1WMJA 4MABA 3KMNA 1ERVA 1QXHA 3ZYWA 1B9YC 5AIXA 3QFBC 1SKSB 2M46A 3IOSA 2WDUA 3P2AA 2GTUA 2LJAA 2EC4A 3GMFA 1SL0B 1BG5A 3ED3A 2VCVA 2X4AA 4V2MA 3KMOA 2HRFA 2O7KA 1YZXA 4NHWA 1O85A 5F8BA 1K0CA 1XW9A 3Q6OA 3SWLA 5IMCA 2L5OA 1SK1A 2WFCA 5G5EA 3EWLA 3U5RE 2H0HA 4L8EA 5ECSA 5CAXA 2N5FA 1KBNA 1A2MA 4K7OA 4MLYA 2UZ8A 3DEXA 1ABAA 4IS0A 2C0DA 4NPBA 3VURA 2J23A 1U6TA 1USBA 2PPTA 4PQIA 3KP8A 4HJ2A 1TW9A 3MAKA 2JL4A 5HFGA 2C80A 3W8SA 1M2DA 1A23A 2FWEA 4LLRA 1PKZA 2GT5A 3US3A 1EOGA 1ZYQB 3WD6A 1KTEA 1XFLA 4A5PA 4EDZA 3D0ZA 3EU4A 1PQNA 4K6XA 1YKAA 3LGCA 3UOMA 2YZUA 4PQ1A 1PRXA 4EVMA 3VI7A 5ECQB 2GGTA 4WF5A 1HNCA 5J5NA 1R5AA 2FUG2 2JU5A 4PQHA 1O6JA 1N2AA 3QAVA 4I6XA 1EEMA 1NHOA 1U3AA 3SBCA 2JZRA 5HR0A 1JLWA 3A2VA 1HQOA 2FNOA 2VL2C 4GRFA 4MPGA 3ME7A 2H01A 1XXUA 4N0VA 5H5QA 1VF2A 1GLPA 2GQLA 2F51A 5J41A 3ZITA 5A4VA 2L59A 2WGRA 1M99A 1FVJA 3IR4A 1Z7RA 4J2FA 1BEDA 5CRGA 1BAYA 1W89A 5DQSA 3KGKA 2FGXA 2MMAA 3PGTA 3FY7A 2E7PA 3G9BA 4MF5A 2PVQA 5D9TA 2K9FA 1MTCA 5ECNB 5L71A 5IMFA 1ZMAA 1F3BA 4KAEA 3TKQA 2IMKA 1GSFA 5J9CA 2HXKA 3TJGA 3MIXA 2A2SA 1YEPA 1UN2A 4MH2A 4WBRD 3GHAA 4O32A 1OC9A 1DE1A 3GYKA 4ZILA 4OFMA 5EVOA 4HU7A 4K8MA 3GX8A 4KB3A 8GSSA 5EL8A 2IL3A 2V32A 2JADA 2WCIA 2GZPA 2AYTA 1QMVA 2NVLA 1SD8A 3BJ5A 2I3YA 2LNTA 2YCDA 2VLUA 4HI7A 4HOJA 1M2BA 4I2UA 5IO0A 5KN1A 1ON4A 4MA9A 3CTFA 4EIQA 3GRXA 5DALA 4BVYA 1NW2A 5D9WA 4E8HA 4MF7A 2MMZA 1T4ZA 4EKZA 1XWBA 3P8WA 2GSSA 2IMIA 2HZEA 4XRAA 3Q74A 3A5WA 3KD0A 4WR5A 4KUNA 4KSMA 4GLTA 4YQMA 5A4UA 2HZFA 4BWSA 4CDOA 2FD3A 5ECHB 5GAPD 2R5GA 4OO5A 2XBIA 2CX3A 4ZB9A 3UVHA 1BJXA 3U6VA 4RQXA 5GSSA 3HCZA 1OYJA 2FA4A 3BBYA 5BRTA 1ZYNA 4AJ7A 3H4KA 1FO5A 3A2WA 1K3LA 5DQYA 4PXOA 5B8AA 4FIWA 4I8BA 1ERWA 2C8UA 4BL7A 4GF0A 1PL2A 2XBQA 4TR1A 2ALBA 3P7XA 1TU8A 4KCEA 2DJ2A 1AIUA 2GVPA 2REMA 2N5AA 3F6DA 4TXOB 3L9UA 5HFIA 18GSA 3M9JA 1U3IA 2O87A 2P0GA 6GSTA 1SL1B 1F9MA 4G0IA 11GSA 1O7UA 3WGEA 3L0HA 4NMUA 5DCGA 4CY6A 1F6MC 3TDGA 1G6YA 5F0GA 2YPMA 1GLQA 3KJYA 3TOUA 2OJLA 3LSZA 3GL5A 5C00A 3N9JA 1AQVA 4OD7A 2MMOA 3E3EA 1B4PA 4IQAA 4WKWA 3IAS2 4KF9A 1EWXA 2HFDA 5IIZA 3VWVA 2GLRA 2CVKA 1EOHA 3QFAC 2GZZA 3FMWA 3ZLPA 3ERWA 3BCKA 2YJ7A 3GNJA 1GSYA 4LL1B 1TTZA 2GSQA 1FVKA 4JR4A 1J0FA 2XHFA 2B3SA 5KN2A 3FYGA 2I81A 1V98A 1VF3A 7GSSA 4WF4A 4EC0A 3LJRA 2H8LA 4JE1A 1PMTA 1X9WB 3M3MA 1YKCA 12GSA 4XRDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H1N A;  3KTL A;  4KDX A;  2VD1 A;  1UC7 A;  3ZZX A;  2LS5 A;  4XCS A;  1TK8 B;  2YV9 A;  4JED A;  4IEL A;  1OC8 A;  1JZD A;  1ZCP A;  3LFL A;  5HR2 A;  4ZB6 A;  1EV9 A;  2GZY A;  3TKP A;  2V2G A;  4K1F A;  1OKD A;  2ON5 A;  2VOC A;  2CAQ A;  1Q98 A;  3TRQ A;  3FEU A;  5IO2 A;  3S9F A;  4EO3 A;  4PNG A;  1A8Y A;  5IMZ A;  3ZL5 A;  1OAZ A;  4YAP A;  1V58 A;  2PVO C;  2I4A A;  4DVC A;  3G7I A;  9GSS A;  1AW9 A;  1X5E A;  3I43 A;  2C3Q A;  2O89 A;  5EY6 A;  1HYU A;  3FZ9 A;  4NV5 A;  3TKR A;  4E8E A;  2LJK A;  1X0R A;  3DRN A;  2R3X A;  2H6Z A;  2LEG A;  5ECI B;  5ECO B;  1XVQ A;  4RI6 A;  1Y25 A;  17GS A;  4O7H A;  4EDY A;  4TRX A;  1MD3 A;  3RDW A;  1GUH A;  4ECB A;  3RPP A;  1URM A;  5INY A;  2H73 A;  1B48 A;  4BVX A;  1ZL9 A;  2LUS A;  3EYT A;  4ILF A;  1A24 A;  4IW9 A;  2RUE A;  5H5S A;  2PWJ A;  5JCU A;  4ULX A;  5B6M A;  1WP0 A;  2OA7 A;  1QK8 A;  4ECI A;  3ME8 A;  1PGT A;  4LMW A;  3KTB A;  3MSZ A;  4N10 A;  1TRU A;  2PGT A;  1S3A A;  6GSU A;  2NTO A;  2H19 A;  4BPY A;  5FHI A;  4DSS B;  1ZYE A;  1EZK A;  6GSS A;  1YEX A;  5E4W A;  4JU5 A;  3TJK A;  1WPI A;  3VPT A;  1GTU A;  5LCZ A;  2M72 A;  2HNL A;  1XOA A;  2TRC P;  4ML1 A;  4K2D A;  1V2A A;  1SEN A;  2OE0 A;  5B7C A;  4ACS A;  1MDI A;  3W6G A;  4HS1 A;  3TKS C;  1YDK A;  2DBC A;  4MDC A;  2P5R A;  4MH3 A;  5G2Z A;  1GTA A;  2KP1 A;  3FR6 A;  2L6D A;  3F4T A;  5F05 A;  3LEF A;  3GST A;  3F63 A;  4KH7 A;  4AJ8 A;  1TOF A;  2H1G A;  3IHQ A;  1GWC A;  1K0M A;  2VCT A;  3IRA A;  3M9K A;  1WJK A;  4AGS A;  1UVZ A;  1TKD B;  3L9V A;  2H0I A;  2GST A;  3ZVJ D;  2RM6 A;  1Z7P A;  4MCU A;  4KSO A;  3IV4 A;  3HZ4 A;  3TB2 A;  2IFQ B;  1SD9 A;  1XWG A;  2MZC A;  4EL1 A;  5DAK A;  3LYK A;  5ABR A;  1Z3E A;  1XW6 A;  4FYU A;  2QC7 A;  2H1A A;  2PU9 C;  1J08 A;  4JBB A;  4I2T A;  3M0F A;  4FYB A;  2JZS A;  4HU9 A;  2FHE A;  3J7Y k;  1Z6N A;  1GTB A;  1DBY A;  4I5Q A;  2BJX A;  2JSY A;  4CHS A;  3WGX A;  2AHE A;  3QOU A;  1ML6 A;  2F9S A;  3C73 A;  4D73 A;  3HYP A;  5JWO B;  3NOF A;  3L9S A;  3QDN A;  3C71 A;  3HJP A;  2C1Y A;  3D22 A;  1NHY A;  1B8X A;  3UVT A;  1KNG A;  3RHC A;  3CSH A;  3KM6 A;  1X5D A;  4IVF A;  3G7J A;  4ZBB A;  5HR1 A;  1EGO A;  1TJD A;  2FLS A;  1AQW A;  1GTI A;  4AF2 A;  2R4V A;  5J3R A;  3CSI A;  5ID2 A;  2MBS A;  3QD9 A;  4NWY A;  1OKT A;  5JCG A;  1G7E A;  4RQR A;  5A4W A;  1N8J A;  1CQH A;  2ON7 A;  2D2Z A;  2H66 A;  4XS4 B;  4J57 E;  3O76 A;  3TKS E;  1GSQ A;  4H86 A;  4EE0 A;  6GSW A;  3A3T A;  1PD2 1;  3CSJ A;  5DJL A;  2C4J A;  2QSI A;  3Q19 A;  4I97 A;  5DCH A;  2CZ3 A;  1PX6 A;  2BMX A;  4LMV A;  1GUM A;  4Q5N A;  2VCX A;  3CMI A;  5A5K A;  2ZUP A;  4MK3 A;  1O73 A;  2ES7 A;  2H76 A;  3APS A;  5AGY A;  3GH6 A;  3PH9 A;  3RAZ A;  4HJM A;  2FWF A;  3E9J B;  4O92 A;  2C0F A;  1H75 A;  2VCZ A;  3ISO A;  3QR6 A;  5HQP A;  2PMT A;  4OO4 A;  1OC3 A;  4XHM A;  5F06 A;  4GSS A;  1EV4 A;  2HI7 A;  4TR3 A;  2VL9 A;  5G1K A;  2FWG A;  2B1K A;  4V1A p;  2B5Y A;  2FY6 A;  3UEM A;  1AXD A;  3CBU A;  6GSY A;  1XPV A;  3FRC A;  4V1A g;  4L5L A;  4POB A;  3H8Q A;  4JZQ A;  2LQO A;  1SK2 A;  5H5R A;  1AQX A;  3DKS A;  2LTK A;  3VLN A;  5B8B A;  5ENU A;  5AIS A;  4KND A;  2IN3 A;  1M2A A;  4XS1 A;  1VF4 A;  3E0U A;  4X1U A;  2VLV A;  4PX1 A;  4WXT A;  2YN1 A;  2AJQ B;  3GKM A;  4MPF A;  3GA4 A;  2X64 A;  2RII A;  4HQS A;  1AUC A;  1TK0 B;  1Z6M A;  4TOP A;  2O8V B;  2JAC A;  2CVB A;  1TI1 A;  2YP6 A;  3KCM A;  4XTS A;  1R5P A;  2F8F A;  5CP1 A;  2H70 A;  2IIY A;  1XOB A;  2HT9 A;  13GS A;  1V57 A;  5ECR B;  1PA3 A;  1G6W A;  2V41 A;  2KLX A;  3TRP A;  3LWA A;  2OAD A;  3IE3 A;  3RBT A;  1A0R P;  2OKA A;  3HJM A;  3HXS A;  4OFT A;  2HRN A;  2VO4 A;  2GQK A;  1QFN A;  4WR4 A;  5CRE A;  2OBK A;  4KCA A;  5CRH A;  3TUE A;  5DDL A;  3D6I A;  1TDI A;  3UMA A;  2G0F A;  2TIR A;  2GS3 A;  3OR5 A;  1PSQ A;  4GSN A;  3GKK A;  3V1W A;  5E59 A;  2L6C A;  1XZO A;  3PIN A;  4ZXG A;  1T7P B;  1NM3 A;  3QCP A;  2R6K A;  3ZRD A;  4ID0 A;  3VWW A;  2TRX A;  2NBS A;  4G10 A;  2B5X A;  2G2Q A;  2L4Q A;  1PN9 A;  3MNG A;  3ZIV A;  1SJI A;  3KEB A;  2YWO A;  2JZT A;  1RK4 A;  3FK8 A;  4GST A;  4IBP A;  1M7T A;  3QMX A;  3DYR A;  4TR0 A;  3KIJ A;  1EEJ A;  4GCI A;  2C3N A;  1EP8 A;  1F37 A;  1MDJ A;  1BYE A;  3UBL A;  3GTU A;  3M1G A;  4K0N A;  2YNX A;  2WZ9 A;  2YJH A;  5DJM A;  4POL A;  5F07 A;  1WE0 A;  2IJY A;  5LD0 A;  5GAN D;  1FW1 A;  3HVX A;  1XCC A;  3ZTL A;  2WRT A;  4MJE A;  3FKF A;  1T8E B;  3LYP A;  3F3Q A;  4PUA A;  3WT2 A;  5ECL B;  1K3O A;  2LKU A;  3ZML A;  4ZB8 A;  1X5C A;  1FOV A;  1XVW A;  1GNW A;  5D9X A;  2VCW A;  3TJB A;  3QAG A;  1SK0 A;  1GP1 A;  2GT6 A;  2L4C A;  3PR8 A;  1U87 A;  4N30 A;  1OC9 B;  2WUL A;  1I9D A;  4Q5R A;  3FZA A;  4O5R A;  5G1L A;  4K9Z A;  3IK7 A;  1YF1 A;  1O8W A;  2A4V A;  3VFI A;  3F8U A;  2XPD A;  4KDU A;  3QPM A;  3DGQ A;  4EF0 A;  1TK5 B;  3C1R A;  1LBK A;  3GH9 A;  3WGD A;  2PBJ A;  2VM2 A;  2QGV A;  2EIR A;  5D93 A;  4P3Y B;  5IMD A;  5DAL B;  4GQC A;  5JWR B;  3GIX A;  2HZE B;  1ZOF A;  1MDK A;  2F8A A;  2DLX A;  1UA5 A;  4POK A;  4XS6 A;  3I9V 2;  2J9H A;  1SKW B;  2X8G A;  3KZQ A;  2DIZ A;  1S3D A;  3CRT A;  4PUR A;  3C7M A;  2H74 A;  3KP9 A;  2BTO T;  1ERT A;  1TRV A;  2IMF A;  4XIH A;  1X9M B;  4MF6 A;  2DIY A;  3HJO A;  2V6K A;  4IP6 A;  3IDV A;  3GN3 A;  3RHB A;  3DD3 A;  1LU4 A;  1R4W A;  4OCE A;  2LNS A;  1AAZ A;  4KX4 A;  3VWX A;  4Q5F A;  1XWC A;  3F0I A;  2RUF A;  5KN3 A;  2YAN A;  4ZL7 A;  2PN8 A;  4TR1 B;  1A2L A;  2CA8 A;  4BWQ A;  1TU7 A;  3TGZ A;  1XIY A;  1RW1 A;  3WYW A;  2H72 A;  4ZL9 A;  2A2R A;  3F3R A;  3DWV A;  1B4Q A;  2K6V A;  5IQY A;  4NXI A;  3I6A A;  2VM1 A;  3O3T A;  2HYX A;  2N5B A;  1HD2 A;  2IME A;  4NHZ A;  5IMV A;  2L57 A;  3IAM 2;  3UAR A;  3HA9 A;  4IKH A;  4OFN A;  3BOA A;  3L78 A;  1JZO A;  1TI3 A;  2HE3 A;  1S3C A;  1T1V A;  3F4R A;  2H30 A;  2ZNM A;  2DJK A;  2M80 A;  3UIW A;  1I5G A;  2E2G A;  2B7K A;  1T00 A;  2VIM A;  1K0O A;  5J4U A;  3Q18 A;  2AB6 A;  3EMP A;  1EP7 A;  5CRD A;  3EUR A;  1QQ2 A;  2O85 A;  2OE1 A;  1SKR B;  2WJU A;  2YZH A;  4KDY A;  1THX A;  3VWU A;  1THO A;  3FR3 A;  1JLV A;  3R2Q A;  3ZMK A;  3IA1 A;  3EIN A;  2LV3 A;  4NAX A;  2MMN A;  1A0F A;  1H4O A;  3KXO A;  2RM5 A;  2GDR A;  3FW2 A;  1BX9 A;  1A2J A;  1TXX A;  2CT6 A;  2H6Y A;  4IJI A;  3UJ1 A;  5G5F A;  5DBQ A;  4RI7 A;  1GL8 A;  2C0E A;  4K7N A;  2DC5 A;  1WRY A;  1G7O A;  2KP2 A;  3ZRE A;  5ELG A;  2YWN A;  4TKY A;  3DVW A;  1F2E A;  10GS A;  4G2E A;  3MDK A;  2VUP A;  3P90 A;  2DSA A;  1DSB A;  3VPQ A;  4PGT A;  1GSE A;  4L5O A;  2I9H A;  1JZR A;  5CO3 A;  1TRW A;  5GZZ B;  1GUK A;  3DIE A;  1JHB A;  4HZ2 A;  4FH8 A;  1E2Y A;  4YH2 A;  2LRT A;  3TRX A;  5CYY A;  3MWH A;  2HLS A;  2P31 A;  2OE3 A;  4K0G A;  1V9W A;  1B9X C;  1SU9 A;  3K8N A;  1O81 A;  2CAI A;  3GSS A;  2LRC A;  4J56 E;  1FHE A;  4JR6 A;  3GV1 A;  5G30 A;  4GXZ A;  4L0W A;  4TXO A;  5B6N A;  1GNE A;  3CTG A;  1ZZY A;  3NIV A;  4G9H A;  4ISD A;  2YV7 A;  5IM9 A;  1Z9H A;  2MBT A;  3O6T A;  1R26 A;  1IYI A;  2DJ1 A;  1JFU A;  1WOU A;  5HFK A;  2IPA A;  2R2J A;  2B5E A;  2KUC A;  3GUS A;  4CW9 A;  2MYG A;  2LST A;  5ECK B;  2DJJ A;  3VK9 A;  3QAW A;  1Q4J A;  2AV4 A;  1X9S B;  1Y6E A;  4N0Z A;  4Q5Q A;  1E6B A;  3HZ8 A;  1K0B A;  4MZB A;  4OCF A;  3HD5 A;  5KEJ A;  3LG6 A;  4G19 A;  1K0N A;  4BA7 A;  1YQ1 A;  5G31 A;  3GX0 A;  5IOX A;  1QGV A;  2R37 A;  3HHV A;  5KN0 A;  5D73 A;  4JRR A;  4IHU A;  1WIK A;  4EUY A;  4IQ1 A;  3N5O A;  3GL3 A;  1W4V A;  1XWK A;  5COH A;  1GRX A;  4MJB A;  22GS A;  2WS2 A;  3VI5 A;  4YQV A;  3HDC A;  5JCW A;  3D4T A;  5CNW A;  19GS A;  3RPN A;  2HSH A;  2LQQ A;  2OAC A;  3IC4 A;  2FWH A;  2IWT A;  4NV2 A;  4GWR A;  2C3T A;  3H79 A;  3DML A;  1WWJ A;  4GTU A;  1M9A A;  1PKW A;  5ECM B;  4TR4 A;  1FAA A;  4FO5 A;  6GSV A;  5D8I A;  2H1D A;  5DAK B;  6GSX A;  4Z7X A;  3FZ5 A;  2CQ9 A;  2NDO A;  3UBK A;  3EVI A;  2H75 A;  3CYN A;  1QUW A;  2VD0 A;  2I1U A;  4F0C A;  3D5J A;  5HR3 A;  2KHP A;  2JSZ A;  4GQF A;  4MZW A;  4IJ3 A;  3ZVJ A;  1Z5Y E;  1GUL A;  5GST A;  1T3B A;  1A8L A;  2PUK C;  3C8E A;  2X8H A;  14GS A;  1ERU A;  1VRS D;  4MP4 A;  2ZCT A;  5AIV A;  4F82 A;  2RLI A;  3DVX A;  3EE2 A;  5IOW A;  4D73 B;  4OMV A;  1K3Y A;  1MEK A;  4TW5 A;  2EIO A;  4HUA A;  1PL1 A;  1NSW A;  4MZC A;  2VCQ A;  1GH2 A;  2FCH A;  1OVN A;  2YWI A;  4ZIJ A;  2H6X A;  2P5Q A;  4QQ7 A;  1V40 A;  1T4Y A;  3EU3 A;  5C04 A;  3TKS A;  1U88 A;  1XWA A;  5IPH A;  2OBI A;  4WET A;  3UAP A;  3GUR A;  3WT1 A;  1XBS A;  4N11 A;  2H0G A;  3D21 A;  5IPG A;  2F3M A;  3APO A;  5CRW A;  5ID2 B;  20GS A;  3CXG A;  4F03 A;  3FR9 A;  4X0X A;  2XPE A;  5AN1 A;  2AAW A;  4ECC A;  2Z9S A;  1FG4 A;  4V2L A;  1YY7 A;  4LA1 A;  4AJ6 A;  2CVD A;  4DSS A;  2YOI A;  2E2M A;  5IMA A;  4QL9 A;  4DSR A;  1ST9 A;  2H71 A;  4ZL8 A;  5EPF A;  3IPZ A;  2PER A;  2K8S A;  4ML6 A;  2X99 A;  4DEJ A;  2QKE A;  3TOT A;  1G0T A;  3A2X A;  3FHK A;  1TRS A;  4OWY A;  1VF1 A;  2X8C A;  1CQG A;  1IYH A;  2L5L A;  4PNF A;  2XC2 A;  2CV4 A;  2B6M A;  3HVS A;  3I69 A;  1DE2 A;  1K0D A;  4QL7 A;  4RUV A;  2H1B A;  4LL4 B;  3GKN A;  5LNK e;  4HEA 2;  1SYR A;  1K0A A;  2VAF A;  1ACV A;  3FZ4 A;  3LOR A;  1VGL A;  4YQU A;  3M8N A;  1GSD A;  4F9Z A;  1C72 A;  2CZ2 A;  1LJR A;  5ECP B;  5JWQ B;  3LXZ A;  5FWG A;  1OE7 A;  1MD4 A;  4F2I A;  3TCO A;  3HVV A;  1O8X A;  2IFQ A;  3ERF A;  4DSQ A;  3HY2 A;  1ZGN A;  5FT3 A;  4K7I A;  5ELA A;  4MJC A;  3NZN A;  2C0G A;  4WEY A;  4ECJ A;  4PUF C;  2GQM A;  2DML A;  2WB9 A;  3ZIJ A;  1J9B A;  1TP9 A;  3C1S A;  3F9U A;  2V1M A;  2K18 A;  3DXB A;  4TXV A;  1XW5 A;  1ILO A;  1BQ7 A;  2DMM A;  4F0B A;  3CRU A;  3TJF A;  1FB6 A;  4KGI A;  2LRN A;  2VL3 A;  2AUV A;  3JCM L;  4FYC A;  3ZFL A;  2CX4 A;  1AC1 A;  4KE3 A;  3BD2 A;  3AY8 A;  4KW6 A;  1SJZ A;  3GFK A;  2KOK A;  1DUG A;  5D96 A;  2VL2 A;  1HNB A;  4X43 A;  2NPB A;  3TJJ A;  4MMM A;  4HZ4 A;  4MJA A;  2DJ0 A;  2VLT A;  4HQZ A;  2DJ3 A;  4TN8 A;  1M9B A;  3IXR A;  2FA8 A;  3F6F A;  2B7J A;  4IP1 A;  3G7Y A;  3F4S A;  3IBH A;  2K8V A;  1YJ6 A;  4XS4 A;  1GSS A;  2LJR A;  3J7Y b;  1RQM A;  4WBJ A;  1OE8 A;  4YAV A;  3D4M A;  3LXT A;  3W8J A;  4ZBD A;  5DVB A;  4V2N A;  2IMD A;  1JZW A;  3LQ7 A;  1SL2 B;  2YWM A;  4KA0 A;  3ZFB A;  3EMX A;  2B1L A;  2V6O A;  3KH7 A;  3BCI A;  3GKX A;  3EC3 A;  4POM A;  16GS A;  1KEB A;  1F3A A;  1PX7 A;  1EGR A;  1R7H A;  1SJ6 A;  1YF0 A;  3L4N A;  4L0U A;  4EXJ A;  4TVE A;  5J9B A;  1SYX A;  4HDE A;  1HNA A;  2E0Q A;  3GTU B;  1GSU A;  3IK9 A;  4IGJ A;  3H93 A;  4ZBA A;  2EIQ A;  3HKR A;  3UL3 A;  1M0U A;  3APQ A;  3ERG A;  5D9V A;  2HSY A;  1FB0 A;  4IN0 A;  3KH9 A;  2GSR A;  1WMJ A;  4MAB A;  3KMN A;  1ERV A;  1QXH A;  3ZYW A;  1B9Y C;  5AIX A;  3QFB C;  1SKS B;  2M46 A;  3IOS A;  2WDU A;  3P2A A;  2GTU A;  2LJA A;  2EC4 A;  3GMF A;  1SL0 B;  1BG5 A;  3ED3 A;  2VCV A;  4V2M A;  3KMO A;  2HRF A;  2O7K A;  1YZX A;  4NHW A;  1O85 A;  5F8B A;  1K0C A;  1XW9 A;  3Q6O A;  3SWL A;  5IMC A;  2L5O A;  1SK1 A;  2WFC A;  5G5E A;  3EWL A;  3U5R E;  2H0H A;  4L8E A;  5ECS A;  5CAX A;  2N5F A;  1KBN A;  1A2M A;  4K7O A;  4MLY A;  3DEX A;  1ABA A;  4IS0 A;  2C0D A;  4NPB A;  3VUR A;  2J23 A;  1U6T A;  1USB A;  2PPT A;  4PQI A;  3KP8 A;  4HJ2 A;  1TW9 A;  3MAK A;  2JL4 A;  5HFG A;  2C80 A;  3W8S A;  1M2D A;  1A23 A;  2FWE A;  4LLR A;  1PKZ A;  2GT5 A;  3US3 A;  1EOG A;  1ZYQ B;  3WD6 A;  1KTE A;  1XFL A;  4EDZ A;  3D0Z A;  3EU4 A;  1PQN A;  4K6X A;  1YKA A;  3LGC A;  3UOM A;  2YZU A;  4PQ1 A;  1PRX A;  4EVM A;  3VI7 A;  5ECQ B;  2GGT A;  4WF5 A;  1HNC A;  5J5N A;  1R5A A;  2FUG 2;  2JU5 A;  4PQH A;  1O6J A;  1N2A A;  3QAV A;  4I6X A;  1EEM A;  1NHO A;  1U3A A;  3SBC A;  2JZR A;  5HR0 A;  1JLW A;  3A2V A;  1HQO A;  2FNO A;  2VL2 C;  4GRF A;  4MPG A;  3ME7 A;  2H01 A;  1XXU A;  4N0V A;  5H5Q A;  1VF2 A;  1GLP A;  2GQL A;  2F51 A;  5J41 A;  3ZIT A;  5A4V A;  2L59 A;  2WGR A;  1M99 A;  1FVJ A;  3IR4 A;  1Z7R A;  4J2F A;  1BED A;  5CRG A;  1BAY A;  1W89 A;  5DQS A;  3KGK A;  2FGX A;  2MMA A;  3PGT A;  3FY7 A;  2E7P A;  3G9B A;  4MF5 A;  2PVQ A;  5D9T A;  2K9F A;  1MTC A;  5ECN B;  5L71 A;  5IMF A;  1ZMA A;  1F3B A;  4KAE A;  3TKQ A;  2IMK A;  1GSF A;  5J9C A;  2HXK A;  3TJG A;  2A2S A;  1YEP A;  1UN2 A;  4MH2 A;  4WBR D;  3GHA A;  4O32 A;  1OC9 A;  1DE1 A;  3GYK A;  4ZIL A;  4OFM A;  5EVO A;  4HU7 A;  4K8M A;  3GX8 A;  4KB3 A;  8GSS A;  5EL8 A;  2IL3 A;  2V32 A;  2JAD A;  2WCI A;  2GZP A;  2AYT A;  1QMV A;  2NVL A;  1SD8 A;  3BJ5 A;  2I3Y A;  2LNT A;  2YCD A;  2VLU A;  4HI7 A;  4HOJ A;  1M2B A;  4I2U A;  5IO0 A;  5KN1 A;  1ON4 A;  4MA9 A;  3CTF A;  3GRX A;  5DAL A;  4BVY A;  1NW2 A;  5D9W A;  4E8H A;  4MF7 A;  2MMZ A;  1T4Z A;  4EKZ A;  1XWB A;  3P8W A;  2GSS A;  2IMI A;  2HZE A;  4XRA A;  3Q74 A;  3A5W A;  3KD0 A;  4WR5 A;  4KUN A;  4KSM A;  4GLT A;  4YQM A;  5A4U A;  2HZF A;  4BWS A;  4CDO A;  2FD3 A;  5ECH B;  5GAP D;  2R5G A;  4OO5 A;  2XBI A;  2CX3 A;  4ZB9 A;  3UVH A;  1BJX A;  3U6V A;  4RQX A;  5GSS A;  3HCZ A;  1OYJ A;  2FA4 A;  3BBY A;  4AJ7 A;  3H4K A;  1FO5 A;  3A2W A;  1K3L A;  5DQY A;  4PXO A;  5B8A A;  4FIW A;  4I8B A;  1ERW A;  2C8U A;  4BL7 A;  4GF0 A;  1PL2 A;  2XBQ A;  4TR1 A;  2ALB A;  3P7X A;  1TU8 A;  4KCE A;  2DJ2 A;  1AIU A;  2GVP A;  2REM A;  2N5A A;  3F6D A;  4TXO B;  3L9U A;  5HFI A;  18GS A;  3M9J A;  1U3I A;  2O87 A;  2P0G A;  6GST A;  1SL1 B;  1F9M A;  11GS A;  1O7U A;  3WGE A;  3L0H A;  5DCG A;  4NMU A;  1F6M C;  3TDG A;  1G6Y A;  5F0G A;  2YPM A;  1GLQ A;  3KJY A;  3TOU A;  2OJL A;  3LSZ A;  3GL5 A;  5C00 A;  3N9J A;  1AQV A;  4OD7 A;  2MMO A;  3E3E A;  1B4P A;  4IQA A;  4WKW A;  3IAS 2;  1EWX A;  2HFD A;  5IIZ A;  3VWV A;  2GLR A;  2CVK A;  1EOH A;  3QFA C;  2GZZ A;  3ZLP A;  3ERW A;  3BCK A;  2YJ7 A;  3GNJ A;  1GSY A;  4LL1 B;  1TTZ A;  2GSQ A;  1FVK A;  4JR4 A;  1J0F A;  2XHF A;  2B3S A;  5KN2 A;  3FYG A;  2I81 A;  1V98 A;  1VF3 A;  7GSS A;  4WF4 A;  4EC0 A;  3LJR A;  2H8L A;  4JE1 A;  1PMT A;  1X9W B;  3M3M A;  1YKC A;  12GS A;  4XRD A; 
#chains in the Genus database with same CATH topology
 3H1N A;  3KTL A;  4KDX A;  2VD1 A;  1UC7 A;  3ZZX A;  2LS5 A;  4XCS A;  1TK8 B;  2YV9 A;  4JED A;  4IEL A;  1OC8 A;  1JZD A;  1ZCP A;  3LFL A;  5HR2 A;  4ZB6 A;  1EV9 A;  5KOW A;  2GZY A;  3TKP A;  1FOH A;  2R0G A;  2V2G A;  4K1F A;  1OKD A;  2ON5 A;  2VOC A;  2CAQ A;  1Q98 A;  3TRQ A;  3FEU A;  5IO2 A;  3S9F A;  4EO3 A;  4PNG A;  1A8Y A;  4ICY A;  5IMZ A;  3ZL5 A;  1OAZ A;  4YAP A;  1V58 A;  2PVO C;  2I4A A;  4DVC A;  3G7I A;  9GSS A;  1AW9 A;  1X5E A;  3I43 A;  2C3Q A;  2O89 A;  5EY6 A;  1HYU A;  3FZ9 A;  4NV5 A;  3TKR A;  4E8E A;  2LJK A;  1X0R A;  3DRN A;  2R3X A;  2H6Z A;  2LEG A;  5ECI B;  5ECO B;  1XVQ A;  2R0C A;  4RI6 A;  1Y25 A;  17GS A;  4O7H A;  4EDY A;  4TRX A;  1MD3 A;  3RDW A;  1GUH A;  4ECB A;  3RPP A;  1URM A;  5INY A;  2H73 A;  1B48 A;  4BVX A;  1ZL9 A;  2LUS A;  3EYT A;  4ILF A;  1A24 A;  4IW9 A;  2RUE A;  5H5S A;  2PWJ A;  5JCU A;  4ULX A;  5B6M A;  1WP0 A;  2OA7 A;  1QK8 A;  4ECI A;  3ME8 A;  1PGT A;  4LMW A;  3IHG A;  3KTB A;  3MSZ A;  4N10 A;  1TRU A;  2PGT A;  1S3A A;  6GSU A;  2NTO A;  2H19 A;  4BPY A;  5FHI A;  4DSS B;  1ZYE A;  1EZK A;  6GSS A;  1YEX A;  5E4W A;  4JU5 A;  3TJK A;  1WPI A;  3IC8 A;  3VPT A;  1GTU A;  5LCZ A;  2M72 A;  2HNL A;  1XOA A;  2TRC P;  4ML1 A;  4K2D A;  1V2A A;  1SEN A;  2OE0 A;  5B7C A;  4ACS A;  1MDI A;  3W6G A;  4HS1 A;  3TKS C;  1YDK A;  2DBC A;  2HRK A;  4MDC A;  2P5R A;  4MH3 A;  5G2Z A;  1GTA A;  2KP1 A;  3FR6 A;  2L6D A;  3F4T A;  5F05 A;  3LEF A;  2HSM A;  3GST A;  3F63 A;  4KH7 A;  4AJ8 A;  1TOF A;  1XG8 A;  2H1G A;  3IHQ A;  1GWC A;  1K0M A;  2VCT A;  3IRA A;  3M9K A;  1WJK A;  4AGS A;  1UVZ A;  1TKD B;  3L9V A;  2H0I A;  2GST A;  3ZVJ D;  2RM6 A;  1Z7P A;  4MCU A;  4KSO A;  3IV4 A;  3HZ4 A;  3TB2 A;  2IFQ B;  1SD9 A;  1XWG A;  2MZC A;  4EL1 A;  5DAK A;  3LYK A;  5ABR A;  1Z3E A;  1XW6 A;  4FYU A;  2QC7 A;  2H1A A;  2PU9 C;  1J08 A;  4JBB A;  4I2T A;  3M0F A;  4FYB A;  2JZS A;  4HU9 A;  2FHE A;  3J7Y k;  1Z6N A;  1GTB A;  1DBY A;  4I5Q A;  2BJX A;  2JSY A;  4CHS A;  3WGX A;  2AHE A;  3QOU A;  1ML6 A;  2F9S A;  3C73 A;  4D73 A;  3HYP A;  5JWO B;  3NOF A;  3L9S A;  3QDN A;  3C71 A;  3HJP A;  2C1Y A;  3D22 A;  1NHY A;  1B8X A;  3UVT A;  1KNG A;  3RHC A;  3CSH A;  3KM6 A;  1X5D A;  4IVF A;  3G7J A;  4ZBB A;  5HR1 A;  1EGO A;  1TJD A;  2FLS A;  1AQW A;  1S3R A;  1GTI A;  4AF2 A;  2R4V A;  5J3R A;  3CSI A;  5ID2 A;  2MBS A;  3QD9 A;  4NWY A;  1OKT A;  5JCG A;  1G7E A;  4RQR A;  5A4W A;  1N8J A;  1CQH A;  2ON7 A;  2D2Z A;  2H66 A;  4XS4 B;  4J57 E;  3O76 A;  3TKS E;  1GSQ A;  4H86 A;  4EE0 A;  6GSW A;  3A3T A;  1PD2 1;  3CSJ A;  5DJL A;  2C4J A;  2QSI A;  3Q19 A;  4I97 A;  5DCH A;  2CZ3 A;  1PX6 A;  2BMX A;  4LMV A;  1GUM A;  4Q5N A;  2VCX A;  3CMI A;  5A5K A;  4BIK A;  2ZUP A;  4MK3 A;  1O73 A;  2ES7 A;  2H76 A;  3APS A;  5AGY A;  3PPU A;  3GH6 A;  3PH9 A;  3RAZ A;  4HJM A;  2FWF A;  3E9J B;  2HRA A;  4O92 A;  2C0F A;  4K5R A;  1H75 A;  2VCZ A;  3ISO A;  3QR6 A;  5HQP A;  2PMT A;  4OO4 A;  1OC3 A;  4XHM A;  5F06 A;  4GSS A;  1EV4 A;  2HI7 A;  4TR3 A;  2VL9 A;  5G1K A;  2FWG A;  2B1K A;  4V1A p;  2B5Y A;  2FY6 A;  3UEM A;  1AXD A;  3CBU A;  6GSY A;  1XPV A;  3FRC A;  4V1A g;  4L5L A;  4POB A;  3H8Q A;  4JZQ A;  2LQO A;  1SK2 A;  4FQU A;  5H5R A;  1AQX A;  3DKS A;  2LTK A;  3VLN A;  5B8B A;  5ENU A;  5AIS A;  4KND A;  2IN3 A;  1M2A A;  4XS1 A;  1VF4 A;  3E0U A;  2QA1 A;  4X1U A;  2VLV A;  4PX1 A;  4WXT A;  2YN1 A;  2AJQ B;  3GKM A;  4MPF A;  3GA4 A;  2X64 A;  2RII A;  4HQS A;  1AUC A;  1TK0 B;  1Z6M A;  4TOP A;  2O8V B;  2JAC A;  2CVB A;  1TI1 A;  2YP6 A;  3KCM A;  3R3E A;  4XTS A;  1R5P A;  2F8F A;  5CP1 A;  2H70 A;  2IIY A;  1XOB A;  2HT9 A;  13GS A;  1V57 A;  5ECR B;  1PA3 A;  1G6W A;  2V41 A;  2KLX A;  3TRP A;  3LWA A;  2OAD A;  1M3I A;  3IE3 A;  3RBT A;  1A0R P;  2OKA A;  3HJM A;  3HXS A;  4OFT A;  2HRN A;  2VO4 A;  2GQK A;  1QFN A;  4WR4 A;  5CRE A;  2OBK A;  4KCA A;  5CRH A;  3TUE A;  5DDL A;  3D6I A;  1TDI A;  3UMA A;  2G0F A;  1ZYP A;  2TIR A;  2GS3 A;  3OR5 A;  1PSQ A;  4GSN A;  3GKK A;  4G0K A;  3V1W A;  5E59 A;  2L6C A;  4K5S A;  1XZO A;  4CY8 A;  3PIN A;  4ZXG A;  1T7P B;  1NM3 A;  3QCP A;  2R6K A;  3ZRD A;  4ID0 A;  3VWW A;  2TRX A;  2NBS A;  4G10 A;  2B5X A;  2G2Q A;  2L4Q A;  1PN9 A;  3MNG A;  3ZIV A;  2A2P A;  1SJI A;  3KEB A;  2YWO A;  2JZT A;  1RK4 A;  3FK8 A;  4GST A;  4IBP A;  1M7T A;  3QMX A;  3DYR A;  4TR0 A;  3KIJ A;  1EEJ A;  4GCI A;  2C3N A;  1EP8 A;  1F37 A;  1MDJ A;  1BYE A;  3UBL A;  3GTU A;  3M1G A;  4K0N A;  2YNX A;  2WZ9 A;  2YJH A;  5DJM A;  4POL A;  5F07 A;  1WE0 A;  2IJY A;  5LD0 A;  5GAN D;  1FW1 A;  3HVX A;  1XCC A;  3ZTL A;  2WRT A;  4MJE A;  3FKF A;  1T8E B;  3LYP A;  3F3Q A;  4PUA A;  3WT2 A;  5ECL B;  1K3O A;  2LKU A;  3ZML A;  4ZB8 A;  1X5C A;  1FOV A;  1XVW A;  1GNW A;  5D9X A;  2VCW A;  3TJB A;  3QAG A;  1SK0 A;  1GP1 A;  2GT6 A;  2L4C A;  3PR8 A;  1U87 A;  4N30 A;  1OC9 B;  2WUL A;  1I9D A;  4Q5R A;  3FZA A;  4O5R A;  5G1L A;  4K9Z A;  3IK7 A;  1YF1 A;  1O8W A;  2A4V A;  3VFI A;  3F8U A;  2XPD A;  4KDU A;  3QPM A;  3DGQ A;  4EF0 A;  1TK5 B;  3C1R A;  1LBK A;  3GH9 A;  3WGD A;  2PBJ A;  2VM2 A;  2QGV A;  2EIR A;  5D93 A;  4P3Y B;  5IMD A;  5DAL B;  4BVY B;  4GQC A;  4X4J A;  5JWR B;  3GIX A;  2HZE B;  1ZOF A;  1MDK A;  2F8A A;  2DLX A;  1UA5 A;  4POK A;  4XS6 A;  3I9V 2;  2J9H A;  1SKW B;  2X8G A;  3KZQ A;  2DIZ A;  1S3D A;  3CRT A;  4PUR A;  3C7M A;  2H74 A;  3KP9 A;  2BTO T;  1ERT A;  1TRV A;  2IMF A;  4XIH A;  1X9M B;  4MF6 A;  2DIY A;  3HJO A;  2V6K A;  4IP6 A;  3IDV A;  1M3J A;  3GN3 A;  3RHB A;  3DD3 A;  1LU4 A;  4Z2R A;  4USS A;  1R4W A;  4OCE A;  2LNS A;  1AAZ A;  4KX4 A;  3VWX A;  4Q5F A;  1XWC A;  3F0I A;  2RUF A;  4BL7 B;  5KN3 A;  2YAN A;  4ZL7 A;  2PN8 A;  4TR1 B;  4PTS A;  1A2L A;  2CA8 A;  4BWQ A;  1TU7 A;  3TGZ A;  3CQF A;  1XIY A;  4YKF A;  1RW1 A;  3WYW A;  2H72 A;  4ZL9 A;  2A2R A;  3F3R A;  3DWV A;  1B4Q A;  2K6V A;  5IQY A;  4NXI A;  3I6A A;  2VM1 A;  3O3T A;  2HYX A;  2N5B A;  1HD2 A;  2IME A;  4NHZ A;  5IMV A;  2L57 A;  3IAM 2;  3UAR A;  3HA9 A;  4IKH A;  4OFN A;  3BOA A;  3L78 A;  1JZO A;  1TI3 A;  2DKH A;  2HE3 A;  1S3C A;  1T1V A;  3F4R A;  2H30 A;  2ZNM A;  2DJK A;  2M80 A;  3UIW A;  1I5G A;  2E2G A;  2B7K A;  1T00 A;  2VIM A;  4G0L A;  1K0O A;  5J4U A;  3Q18 A;  2AB6 A;  3EMP A;  1EP7 A;  5CRD A;  3EUR A;  1QQ2 A;  2O85 A;  2OE1 A;  1SKR B;  2WJU A;  2YZH A;  4KDY A;  1THX A;  3VWU A;  1THO A;  3FR3 A;  1JLV A;  3R2Q A;  5KOX A;  3ZMK A;  3IA1 A;  3EIN A;  2LV3 A;  4NAX A;  2MMN A;  1A0F A;  1H4O A;  3KXO A;  2RM5 A;  2GDR A;  3FW2 A;  1BX9 A;  1A2J A;  1TXX A;  2CT6 A;  2H6Y A;  4IJI A;  3UJ1 A;  5G5F A;  5DBQ A;  4RI7 A;  1GL8 A;  2C0E A;  4K7N A;  2DC5 A;  1WRY A;  1G7O A;  2KP2 A;  3ZRE A;  5ELG A;  2YWN A;  4TKY A;  3DVW A;  1F2E A;  10GS A;  4G2E A;  3MDK A;  2VUP A;  3P90 A;  2DSA A;  1DSB A;  3VPQ A;  4PGT A;  1GSE A;  4L5O A;  2I9H A;  1JZR A;  2QA2 A;  5CO3 A;  1TRW A;  5GZZ B;  1GUK A;  4Z2T A;  3DIE A;  1JHB A;  4HZ2 A;  4FH8 A;  1E2Y A;  4YH2 A;  2LRT A;  3A5I A;  4YKG A;  3TRX A;  5CYY A;  3MWH A;  2HLS A;  2P31 A;  2OE3 A;  4K0G A;  1V9W A;  1B9X C;  1SU9 A;  3K8N A;  1O81 A;  2CAI A;  3GSS A;  2LRC A;  4J56 E;  1FHE A;  4JR6 A;  3GV1 A;  5G30 A;  4GXZ A;  4L0W A;  4TXO A;  4BVX B;  5B6N A;  1GNE A;  3CTG A;  1ZZY A;  3NIV A;  4G9H A;  4ISD A;  2YV7 A;  5IM9 A;  1Z9H A;  2MBT A;  3O6T A;  1R26 A;  1IYI A;  2DJ1 A;  1JFU A;  1WOU A;  5HFK A;  2IPA A;  2R2J A;  2B5E A;  2KUC A;  3GUS A;  4CW9 A;  2MYG A;  2LST A;  5ECK B;  2DJJ A;  3VK9 A;  3QAW A;  1Q4J A;  2AV4 A;  2R0P A;  1X9S B;  1Y6E A;  4N0Z A;  4Q5Q A;  3EPT A;  1E6B A;  3HZ8 A;  1PN0 A;  1K0B A;  4MZB A;  4OCF A;  3HD5 A;  5KEJ A;  3LG6 A;  4G19 A;  1K0N A;  4BA7 A;  1YQ1 A;  5G31 A;  3GX0 A;  4MNN A;  5IOX A;  1QGV A;  2R37 A;  3HHV A;  4O5Q A;  5KN0 A;  5D73 A;  4JRR A;  4IHU A;  1WIK A;  4EUY A;  4IQ1 A;  3N5O A;  3GL3 A;  2X49 A;  1W4V A;  1XWK A;  5COH A;  1GRX A;  4MJB A;  22GS A;  2WS2 A;  3VI5 A;  4YQV A;  3HDC A;  5JCW A;  3D4T A;  5CNW A;  19GS A;  3RPN A;  2HSH A;  2LQQ A;  2OAC A;  3IC4 A;  2FWH A;  2IWT A;  3LW9 A;  4NV2 A;  4GWR A;  2C3T A;  3H79 A;  3DML A;  1WWJ A;  4GTU A;  1M9A A;  1PKW A;  5ECM B;  4TR4 A;  1FAA A;  4FO5 A;  6GSV A;  5D8I A;  2H1D A;  5DAK B;  6GSX A;  4Z7X A;  3FZ5 A;  2CQ9 A;  2NDO A;  3UBK A;  3EVI A;  2H75 A;  3CYN A;  1QUW A;  2VD0 A;  2I1U A;  4F0C A;  3D5J A;  5HR3 A;  2KHP A;  2JSZ A;  4GQF A;  4MZW A;  5BMU A;  4IJ3 A;  3ZVJ A;  1Z5Y E;  1GUL A;  5GST A;  1T3B A;  1A8L A;  2PUK C;  3C8E A;  2X8H A;  14GS A;  1ERU A;  1VRS D;  4MP4 A;  2ZCT A;  5AIV A;  4F82 A;  2RLI A;  3DVX A;  3EE2 A;  5IOW A;  4D73 B;  4OMV A;  1K3Y A;  1MEK A;  4TW5 A;  2EIO A;  4HUA A;  1PL1 A;  1NSW A;  4MZC A;  2VCQ A;  1GH2 A;  2FCH A;  1OVN A;  2YWI A;  4ZIJ A;  2H6X A;  2P5Q A;  4QQ7 A;  1V40 A;  1T4Y A;  3EU3 A;  5C04 A;  3TKS A;  1U88 A;  1XWA A;  5IPH A;  2OBI A;  4WET A;  3UAP A;  3GUR A;  3WT1 A;  1XBS A;  4N11 A;  2H0G A;  3D21 A;  5IPG A;  2F3M A;  3APO A;  5CRW A;  5ID2 B;  20GS A;  3CXG A;  4F03 A;  3FR9 A;  4X0X A;  2XPE A;  5AN1 A;  2AAW A;  4ECC A;  2Z9S A;  1FG4 A;  4V2L A;  1YY7 A;  4LA1 A;  4AJ6 A;  2CVD A;  4DSS A;  2YOI A;  2E2M A;  5IMA A;  4QL9 A;  4DSR A;  1ST9 A;  2H71 A;  4ZL8 A;  5EPF A;  3IPZ A;  2PER A;  2K8S A;  3HVN A;  4ML6 A;  2X99 A;  4DEJ A;  2QKE A;  3TOT A;  1G0T A;  3A2X A;  3FHK A;  1TRS A;  4OWY A;  1VF1 A;  2X8C A;  1CQG A;  1IYH A;  2L5L A;  4PNF A;  2XC2 A;  2CV4 A;  2B6M A;  3HVS A;  3I69 A;  1DE2 A;  1K0D A;  4QL7 A;  4RUV A;  2H1B A;  4LL4 B;  3GKN A;  5LNK e;  4HEA 2;  1SYR A;  1K0A A;  2VAF A;  1ACV A;  3FZ4 A;  3LOR A;  1VGL A;  4YQU A;  3M8N A;  1GSD A;  4F9Z A;  1C72 A;  2CZ2 A;  1LJR A;  5ECP B;  5JWQ B;  3LXZ A;  5FWG A;  4O5U A;  1OE7 A;  1MD4 A;  4F2I A;  3TCO A;  3HVV A;  1O8X A;  2IFQ A;  3ERF A;  4DSQ A;  3HY2 A;  1ZGN A;  5FT3 A;  4K7I A;  5ELA A;  4MJC A;  3NZN A;  2C0G A;  4WEY A;  4ECJ A;  4PUF C;  2GQM A;  2DML A;  2WB9 A;  3ZIJ A;  1J9B A;  1TP9 A;  3C1S A;  3F9U A;  2V1M A;  2K18 A;  3DXB A;  4TXV A;  1XW5 A;  1ILO A;  1BQ7 A;  2DMM A;  4F0B A;  3CRU A;  3TJF A;  1FB6 A;  4KGI A;  2LRN A;  2VL3 A;  2AUV A;  3JCM L;  4FYC A;  3ZFL A;  2DKI A;  2CX4 A;  1AC1 A;  4KE3 A;  3BD2 A;  3AY8 A;  4KW6 A;  1SJZ A;  3GFK A;  2KOK A;  1DUG A;  5D96 A;  2VL2 A;  1HNB A;  4X43 A;  2NPB A;  3TJJ A;  4MMM A;  4HZ4 A;  4MJA A;  2DJ0 A;  2VLT A;  4HQZ A;  1PFO A;  2DJ3 A;  4TN8 A;  1M9B A;  3IXR A;  2FA8 A;  3F6F A;  2B7J A;  4IP1 A;  3G7Y A;  3MYD A;  3F4S A;  3IBH A;  2K8V A;  1YJ6 A;  4XS4 A;  1GSS A;  2LJR A;  2A4H A;  3J7Y b;  1RQM A;  4WBJ A;  1OE8 A;  4YAV A;  3D4M A;  3LXT A;  4Z2U A;  3W8J A;  4ZBD A;  5DVB A;  4V2N A;  2IMD A;  4K2X A;  1JZW A;  3LQ7 A;  1SL2 B;  2YWM A;  4KA0 A;  3ZFB A;  3EMX A;  2B1L A;  2V6O A;  3KH7 A;  3BCI A;  3GKX A;  3EC3 A;  4EIP A;  4POM A;  16GS A;  1KEB A;  1F3A A;  1PX7 A;  1EGR A;  1R7H A;  1SJ6 A;  1YF0 A;  3L4N A;  4L0U A;  4EXJ A;  4TVE A;  5J9B A;  1SYX A;  4HDE A;  1HNA A;  2E0Q A;  3GTU B;  1GSU A;  3IK9 A;  4IGJ A;  3H93 A;  4ZBA A;  2EIQ A;  3HKR A;  3UL3 A;  1M0U A;  3APQ A;  3ERG A;  5D9V A;  2HSY A;  1FB0 A;  4IN0 A;  3KH9 A;  2GSR A;  1WMJ A;  4MAB A;  3KMN A;  1ERV A;  1QXH A;  3ZYW A;  1B9Y C;  5AIX A;  3QFB C;  1SKS B;  2M46 A;  3IOS A;  2WDU A;  3P2A A;  2GTU A;  2LJA A;  2EC4 A;  3GMF A;  1SL0 B;  1BG5 A;  3ED3 A;  2VCV A;  2X4A A;  4V2M A;  3KMO A;  2HRF A;  2O7K A;  1YZX A;  4NHW A;  1O85 A;  5F8B A;  1K0C A;  1XW9 A;  3Q6O A;  3SWL A;  5IMC A;  2L5O A;  1SK1 A;  2WFC A;  5G5E A;  3EWL A;  3U5R E;  2H0H A;  4L8E A;  5ECS A;  5CAX A;  2N5F A;  1KBN A;  1A2M A;  4K7O A;  4MLY A;  2UZ8 A;  3DEX A;  1ABA A;  4IS0 A;  2C0D A;  4NPB A;  3VUR A;  2J23 A;  1U6T A;  1USB A;  2PPT A;  4PQI A;  3KP8 A;  4HJ2 A;  1TW9 A;  3MAK A;  2JL4 A;  5HFG A;  2C80 A;  3W8S A;  1M2D A;  1A23 A;  2FWE A;  4LLR A;  1PKZ A;  2GT5 A;  3US3 A;  1EOG A;  1ZYQ B;  3WD6 A;  1KTE A;  1XFL A;  4A5P A;  4EDZ A;  3D0Z A;  3EU4 A;  1PQN A;  4K6X A;  1YKA A;  3LGC A;  3UOM A;  2YZU A;  4PQ1 A;  1PRX A;  4EVM A;  3VI7 A;  5ECQ B;  2GGT A;  4WF5 A;  1HNC A;  5J5N A;  1R5A A;  2FUG 2;  2JU5 A;  4PQH A;  1O6J A;  1N2A A;  3QAV A;  4I6X A;  1EEM A;  1NHO A;  1U3A A;  3SBC A;  2JZR A;  5HR0 A;  1JLW A;  3A2V A;  1HQO A;  2FNO A;  2VL2 C;  4GRF A;  4MPG A;  3ME7 A;  2H01 A;  1XXU A;  4N0V A;  5H5Q A;  1VF2 A;  1GLP A;  2GQL A;  2F51 A;  5J41 A;  3ZIT A;  5A4V A;  2L59 A;  2WGR A;  1M99 A;  1FVJ A;  3IR4 A;  1Z7R A;  4J2F A;  1BED A;  5CRG A;  1BAY A;  1W89 A;  5DQS A;  3KGK A;  2FGX A;  2MMA A;  3PGT A;  3FY7 A;  2E7P A;  3G9B A;  4MF5 A;  2PVQ A;  5D9T A;  2K9F A;  1MTC A;  5ECN B;  5L71 A;  5IMF A;  1ZMA A;  1F3B A;  4KAE A;  3TKQ A;  2IMK A;  1GSF A;  5J9C A;  2HXK A;  3TJG A;  3MIX A;  2A2S A;  1YEP A;  1UN2 A;  4MH2 A;  4WBR D;  3GHA A;  4O32 A;  1OC9 A;  1DE1 A;  3GYK A;  4ZIL A;  4OFM A;  5EVO A;  4HU7 A;  4K8M A;  3GX8 A;  4KB3 A;  8GSS A;  5EL8 A;  2IL3 A;  2V32 A;  2JAD A;  2WCI A;  2GZP A;  2AYT A;  1QMV A;  2NVL A;  1SD8 A;  3BJ5 A;  2I3Y A;  2LNT A;  2YCD A;  2VLU A;  4HI7 A;  4HOJ A;  1M2B A;  4I2U A;  5IO0 A;  5KN1 A;  1ON4 A;  4MA9 A;  3CTF A;  4EIQ A;  3GRX A;  5DAL A;  4BVY A;  1NW2 A;  5D9W A;  4E8H A;  4MF7 A;  2MMZ A;  1T4Z A;  4EKZ A;  1XWB A;  3P8W A;  2GSS A;  2IMI A;  2HZE A;  4XRA A;  3Q74 A;  3A5W A;  3KD0 A;  4WR5 A;  4KUN A;  4KSM A;  4GLT A;  4YQM A;  5A4U A;  2HZF A;  4BWS A;  4CDO A;  2FD3 A;  5ECH B;  5GAP D;  2R5G A;  4OO5 A;  2XBI A;  2CX3 A;  4ZB9 A;  3UVH A;  1BJX A;  3U6V A;  4RQX A;  5GSS A;  3HCZ A;  1OYJ A;  2FA4 A;  3BBY A;  5BRT A;  1ZYN A;  4AJ7 A;  3H4K A;  1FO5 A;  3A2W A;  1K3L A;  5DQY A;  4PXO A;  5B8A A;  4FIW A;  4I8B A;  1ERW A;  2C8U A;  4BL7 A;  4GF0 A;  1PL2 A;  2XBQ A;  4TR1 A;  2ALB A;  3P7X A;  1TU8 A;  4KCE A;  2DJ2 A;  1AIU A;  2GVP A;  2REM A;  2N5A A;  3F6D A;  4TXO B;  3L9U A;  5HFI A;  18GS A;  3M9J A;  1U3I A;  2O87 A;  2P0G A;  6GST A;  4HSC X;  1SL1 B;  1F9M A;  4G0I A;  11GS A;  1O7U A;  3WGE A;  3L0H A;  4NMU A;  5DCG A;  4CY6 A;  1F6M C;  3TDG A;  1G6Y A;  5F0G A;  2YPM A;  1GLQ A;  3KJY A;  3TOU A;  2OJL A;  3LSZ A;  3GL5 A;  5C00 A;  3N9J A;  1AQV A;  4OD7 A;  2MMO A;  3E3E A;  1B4P A;  4IQA A;  4WKW A;  3IAS 2;  4KF9 A;  1EWX A;  2HFD A;  5IIZ A;  3VWV A;  2GLR A;  2CVK A;  1EOH A;  3QFA C;  2GZZ A;  3FMW A;  3ZLP A;  3ERW A;  3BCK A;  2YJ7 A;  3GNJ A;  1GSY A;  4LL1 B;  1TTZ A;  2GSQ A;  1FVK A;  4JR4 A;  1J0F A;  2XHF A;  2B3S A;  5KN2 A;  3FYG A;  2I81 A;  1V98 A;  1VF3 A;  7GSS A;  4WF4 A;  4EC0 A;  3LJR A;  2H8L A;  4JE1 A;  1PMT A;  1X9W B;  3M3M A;  1YKC A;  12GS A;  4XRD A; 
#chains in the Genus database with same CATH homology
 3H1N A;  3KTL A;  4KDX A;  2VD1 A;  1UC7 A;  3ZZX A;  2LS5 A;  4XCS A;  1TK8 B;  2YV9 A;  4JED A;  4IEL A;  1OC8 A;  1JZD A;  1ZCP A;  3LFL A;  5HR2 A;  4ZB6 A;  1EV9 A;  5KOW A;  2GZY A;  3TKP A;  1FOH A;  2R0G A;  2V2G A;  4K1F A;  1OKD A;  2ON5 A;  2VOC A;  2CAQ A;  1Q98 A;  3TRQ A;  3FEU A;  5IO2 A;  3S9F A;  4EO3 A;  4PNG A;  1A8Y A;  4ICY A;  5IMZ A;  3ZL5 A;  1OAZ A;  4YAP A;  1V58 A;  2PVO C;  2I4A A;  4DVC A;  3G7I A;  9GSS A;  1AW9 A;  1X5E A;  3I43 A;  2C3Q A;  2O89 A;  5EY6 A;  1HYU A;  3FZ9 A;  4NV5 A;  3TKR A;  4E8E A;  2LJK A;  1X0R A;  3DRN A;  2R3X A;  2H6Z A;  2LEG A;  5ECI B;  5ECO B;  1XVQ A;  2R0C A;  4RI6 A;  1Y25 A;  17GS A;  4O7H A;  4EDY A;  4TRX A;  1MD3 A;  3RDW A;  1GUH A;  4ECB A;  3RPP A;  1URM A;  5INY A;  2H73 A;  1B48 A;  4BVX A;  1ZL9 A;  2LUS A;  3EYT A;  4ILF A;  1A24 A;  4IW9 A;  2RUE A;  5H5S A;  2PWJ A;  5JCU A;  4ULX A;  5B6M A;  1WP0 A;  2OA7 A;  1QK8 A;  4ECI A;  3ME8 A;  1PGT A;  4LMW A;  3IHG A;  3KTB A;  3MSZ A;  4N10 A;  1TRU A;  2PGT A;  1S3A A;  6GSU A;  2NTO A;  2H19 A;  4BPY A;  5FHI A;  4DSS B;  1ZYE A;  1EZK A;  6GSS A;  1YEX A;  5E4W A;  4JU5 A;  3TJK A;  1WPI A;  3IC8 A;  3VPT A;  1GTU A;  5LCZ A;  2M72 A;  2HNL A;  1XOA A;  2TRC P;  4ML1 A;  4K2D A;  1V2A A;  1SEN A;  2OE0 A;  5B7C A;  4ACS A;  1MDI A;  3W6G A;  4HS1 A;  3TKS C;  1YDK A;  2DBC A;  2HRK A;  4MDC A;  2P5R A;  4MH3 A;  5G2Z A;  1GTA A;  2KP1 A;  3FR6 A;  2L6D A;  3F4T A;  5F05 A;  3LEF A;  2HSM A;  3GST A;  3F63 A;  4KH7 A;  4AJ8 A;  1TOF A;  2H1G A;  3IHQ A;  1GWC A;  1K0M A;  2VCT A;  3IRA A;  3M9K A;  1WJK A;  4AGS A;  1UVZ A;  1TKD B;  3L9V A;  2H0I A;  2GST A;  3ZVJ D;  2RM6 A;  1Z7P A;  4MCU A;  4KSO A;  3IV4 A;  3HZ4 A;  3TB2 A;  2IFQ B;  1SD9 A;  1XWG A;  2MZC A;  4EL1 A;  5DAK A;  3LYK A;  5ABR A;  1Z3E A;  1XW6 A;  4FYU A;  2QC7 A;  2H1A A;  2PU9 C;  1J08 A;  4JBB A;  4I2T A;  3M0F A;  4FYB A;  2JZS A;  4HU9 A;  2FHE A;  3J7Y k;  1Z6N A;  1GTB A;  1DBY A;  4I5Q A;  2BJX A;  2JSY A;  4CHS A;  3WGX A;  2AHE A;  3QOU A;  1ML6 A;  2F9S A;  3C73 A;  4D73 A;  3HYP A;  5JWO B;  3NOF A;  3L9S A;  3QDN A;  3C71 A;  3HJP A;  2C1Y A;  3D22 A;  1NHY A;  1B8X A;  3UVT A;  1KNG A;  3RHC A;  3CSH A;  3KM6 A;  1X5D A;  4IVF A;  3G7J A;  4ZBB A;  5HR1 A;  1EGO A;  1TJD A;  2FLS A;  1AQW A;  1GTI A;  4AF2 A;  2R4V A;  5J3R A;  3CSI A;  5ID2 A;  2MBS A;  3QD9 A;  4NWY A;  1OKT A;  5JCG A;  1G7E A;  4RQR A;  5A4W A;  1N8J A;  1CQH A;  2ON7 A;  2D2Z A;  2H66 A;  4XS4 B;  4J57 E;  3O76 A;  3TKS E;  1GSQ A;  4H86 A;  4EE0 A;  6GSW A;  3A3T A;  1PD2 1;  3CSJ A;  5DJL A;  2C4J A;  2QSI A;  3Q19 A;  4I97 A;  5DCH A;  2CZ3 A;  1PX6 A;  2BMX A;  4LMV A;  1GUM A;  4Q5N A;  2VCX A;  3CMI A;  5A5K A;  2ZUP A;  4MK3 A;  1O73 A;  2ES7 A;  2H76 A;  3APS A;  5AGY A;  3PPU A;  3GH6 A;  3PH9 A;  3RAZ A;  4HJM A;  2FWF A;  3E9J B;  2HRA A;  4O92 A;  2C0F A;  4K5R A;  1H75 A;  2VCZ A;  3ISO A;  3QR6 A;  5HQP A;  2PMT A;  4OO4 A;  1OC3 A;  4XHM A;  5F06 A;  4GSS A;  1EV4 A;  2HI7 A;  4TR3 A;  2VL9 A;  5G1K A;  2FWG A;  2B1K A;  4V1A p;  2B5Y A;  2FY6 A;  3UEM A;  1AXD A;  3CBU A;  6GSY A;  1XPV A;  3FRC A;  4V1A g;  4L5L A;  4POB A;  3H8Q A;  4JZQ A;  2LQO A;  1SK2 A;  4FQU A;  5H5R A;  1AQX A;  3DKS A;  2LTK A;  3VLN A;  5B8B A;  5ENU A;  5AIS A;  4KND A;  2IN3 A;  1M2A A;  4XS1 A;  1VF4 A;  3E0U A;  2QA1 A;  4X1U A;  2VLV A;  4PX1 A;  4WXT A;  2YN1 A;  2AJQ B;  3GKM A;  4MPF A;  3GA4 A;  2X64 A;  2RII A;  4HQS A;  1AUC A;  1TK0 B;  1Z6M A;  4TOP A;  2O8V B;  2JAC A;  2CVB A;  1TI1 A;  2YP6 A;  3KCM A;  3R3E A;  4XTS A;  1R5P A;  2F8F A;  5CP1 A;  2H70 A;  2IIY A;  1XOB A;  2HT9 A;  13GS A;  1V57 A;  5ECR B;  1PA3 A;  1G6W A;  2V41 A;  2KLX A;  3TRP A;  3LWA A;  2OAD A;  3IE3 A;  3RBT A;  1A0R P;  2OKA A;  3HJM A;  3HXS A;  4OFT A;  2HRN A;  2VO4 A;  2GQK A;  1QFN A;  4WR4 A;  5CRE A;  2OBK A;  4KCA A;  5CRH A;  3TUE A;  5DDL A;  3D6I A;  1TDI A;  3UMA A;  2G0F A;  1ZYP A;  2TIR A;  2GS3 A;  3OR5 A;  1PSQ A;  4GSN A;  3GKK A;  4G0K A;  3V1W A;  5E59 A;  2L6C A;  4K5S A;  1XZO A;  4CY8 A;  3PIN A;  4ZXG A;  1T7P B;  1NM3 A;  3QCP A;  2R6K A;  3ZRD A;  4ID0 A;  3VWW A;  2TRX A;  2NBS A;  4G10 A;  2B5X A;  2G2Q A;  2L4Q A;  1PN9 A;  3MNG A;  3ZIV A;  2A2P A;  1SJI A;  3KEB A;  2YWO A;  2JZT A;  1RK4 A;  3FK8 A;  4GST A;  4IBP A;  1M7T A;  3QMX A;  3DYR A;  4TR0 A;  3KIJ A;  1EEJ A;  4GCI A;  2C3N A;  1EP8 A;  1F37 A;  1MDJ A;  1BYE A;  3UBL A;  3GTU A;  3M1G A;  4K0N A;  2YNX A;  2WZ9 A;  2YJH A;  5DJM A;  4POL A;  5F07 A;  1WE0 A;  2IJY A;  5LD0 A;  5GAN D;  1FW1 A;  3HVX A;  1XCC A;  3ZTL A;  2WRT A;  4MJE A;  3FKF A;  1T8E B;  3LYP A;  3F3Q A;  4PUA A;  3WT2 A;  5ECL B;  1K3O A;  2LKU A;  3ZML A;  4ZB8 A;  1X5C A;  1FOV A;  1XVW A;  1GNW A;  5D9X A;  2VCW A;  3TJB A;  3QAG A;  1SK0 A;  1GP1 A;  2GT6 A;  2L4C A;  3PR8 A;  1U87 A;  4N30 A;  1OC9 B;  2WUL A;  1I9D A;  4Q5R A;  3FZA A;  4O5R A;  5G1L A;  4K9Z A;  3IK7 A;  1YF1 A;  1O8W A;  2A4V A;  3VFI A;  3F8U A;  2XPD A;  4KDU A;  3QPM A;  3DGQ A;  4EF0 A;  1TK5 B;  3C1R A;  1LBK A;  3GH9 A;  3WGD A;  2PBJ A;  2VM2 A;  2QGV A;  2EIR A;  5D93 A;  4P3Y B;  5IMD A;  5DAL B;  4BVY B;  4GQC A;  4X4J A;  5JWR B;  3GIX A;  2HZE B;  1ZOF A;  1MDK A;  2F8A A;  2DLX A;  1UA5 A;  4POK A;  4XS6 A;  3I9V 2;  2J9H A;  1SKW B;  2X8G A;  3KZQ A;  2DIZ A;  1S3D A;  3CRT A;  4PUR A;  3C7M A;  2H74 A;  3KP9 A;  2BTO T;  1ERT A;  1TRV A;  2IMF A;  4XIH A;  1X9M B;  4MF6 A;  2DIY A;  3HJO A;  2V6K A;  4IP6 A;  3IDV A;  3GN3 A;  3RHB A;  3DD3 A;  1LU4 A;  4Z2R A;  4USS A;  1R4W A;  4OCE A;  2LNS A;  1AAZ A;  4KX4 A;  3VWX A;  4Q5F A;  1XWC A;  3F0I A;  2RUF A;  4BL7 B;  5KN3 A;  2YAN A;  4ZL7 A;  2PN8 A;  4TR1 B;  4PTS A;  1A2L A;  2CA8 A;  4BWQ A;  1TU7 A;  3TGZ A;  1XIY A;  4YKF A;  1RW1 A;  3WYW A;  2H72 A;  4ZL9 A;  2A2R A;  3F3R A;  3DWV A;  1B4Q A;  2K6V A;  5IQY A;  4NXI A;  3I6A A;  2VM1 A;  3O3T A;  2HYX A;  2N5B A;  1HD2 A;  2IME A;  4NHZ A;  5IMV A;  2L57 A;  3IAM 2;  3UAR A;  3HA9 A;  4IKH A;  4OFN A;  3BOA A;  3L78 A;  1JZO A;  1TI3 A;  2DKH A;  2HE3 A;  1S3C A;  1T1V A;  3F4R A;  2H30 A;  2ZNM A;  2DJK A;  2M80 A;  3UIW A;  1I5G A;  2E2G A;  2B7K A;  1T00 A;  2VIM A;  4G0L A;  1K0O A;  5J4U A;  3Q18 A;  2AB6 A;  3EMP A;  1EP7 A;  5CRD A;  3EUR A;  1QQ2 A;  2O85 A;  2OE1 A;  1SKR B;  2WJU A;  2YZH A;  4KDY A;  1THX A;  3VWU A;  1THO A;  3FR3 A;  1JLV A;  3R2Q A;  5KOX A;  3ZMK A;  3IA1 A;  3EIN A;  2LV3 A;  4NAX A;  2MMN A;  1A0F A;  1H4O A;  3KXO A;  2RM5 A;  2GDR A;  3FW2 A;  1BX9 A;  1A2J A;  1TXX A;  2CT6 A;  2H6Y A;  4IJI A;  3UJ1 A;  5G5F A;  5DBQ A;  4RI7 A;  1GL8 A;  2C0E A;  4K7N A;  2DC5 A;  1WRY A;  1G7O A;  2KP2 A;  3ZRE A;  5ELG A;  2YWN A;  4TKY A;  3DVW A;  1F2E A;  10GS A;  4G2E A;  3MDK A;  2VUP A;  3P90 A;  2DSA A;  1DSB A;  3VPQ A;  4PGT A;  1GSE A;  4L5O A;  2I9H A;  1JZR A;  2QA2 A;  5CO3 A;  1TRW A;  5GZZ B;  1GUK A;  4Z2T A;  3DIE A;  1JHB A;  4HZ2 A;  4FH8 A;  1E2Y A;  4YH2 A;  2LRT A;  3A5I A;  4YKG A;  3TRX A;  5CYY A;  3MWH A;  2HLS A;  2P31 A;  2OE3 A;  4K0G A;  1V9W A;  1B9X C;  1SU9 A;  3K8N A;  1O81 A;  2CAI A;  3GSS A;  2LRC A;  4J56 E;  1FHE A;  4JR6 A;  3GV1 A;  5G30 A;  4GXZ A;  4L0W A;  4TXO A;  4BVX B;  5B6N A;  1GNE A;  3CTG A;  1ZZY A;  3NIV A;  4G9H A;  4ISD A;  2YV7 A;  5IM9 A;  1Z9H A;  2MBT A;  3O6T A;  1R26 A;  1IYI A;  2DJ1 A;  1JFU A;  1WOU A;  5HFK A;  2IPA A;  2R2J A;  2B5E A;  2KUC A;  3GUS A;  4CW9 A;  2MYG A;  2LST A;  5ECK B;  2DJJ A;  3VK9 A;  3QAW A;  1Q4J A;  2AV4 A;  2R0P A;  1X9S B;  1Y6E A;  4N0Z A;  4Q5Q A;  3EPT A;  1E6B A;  3HZ8 A;  1PN0 A;  1K0B A;  4MZB A;  4OCF A;  3HD5 A;  5KEJ A;  3LG6 A;  4G19 A;  1K0N A;  4BA7 A;  1YQ1 A;  5G31 A;  3GX0 A;  4MNN A;  5IOX A;  1QGV A;  2R37 A;  3HHV A;  4O5Q A;  5KN0 A;  5D73 A;  4JRR A;  4IHU A;  1WIK A;  4EUY A;  4IQ1 A;  3N5O A;  3GL3 A;  2X49 A;  1W4V A;  1XWK A;  5COH A;  1GRX A;  4MJB A;  22GS A;  2WS2 A;  3VI5 A;  4YQV A;  3HDC A;  5JCW A;  3D4T A;  5CNW A;  19GS A;  3RPN A;  2HSH A;  2LQQ A;  2OAC A;  3IC4 A;  2FWH A;  2IWT A;  3LW9 A;  4NV2 A;  4GWR A;  2C3T A;  3H79 A;  3DML A;  1WWJ A;  4GTU A;  1M9A A;  1PKW A;  5ECM B;  4TR4 A;  1FAA A;  4FO5 A;  6GSV A;  5D8I A;  2H1D A;  5DAK B;  6GSX A;  4Z7X A;  3FZ5 A;  2CQ9 A;  2NDO A;  3UBK A;  3EVI A;  2H75 A;  3CYN A;  1QUW A;  2VD0 A;  2I1U A;  4F0C A;  3D5J A;  5HR3 A;  2KHP A;  2JSZ A;  4GQF A;  4MZW A;  5BMU A;  4IJ3 A;  3ZVJ A;  1Z5Y E;  1GUL A;  5GST A;  1T3B A;  1A8L A;  2PUK C;  3C8E A;  2X8H A;  14GS A;  1ERU A;  1VRS D;  4MP4 A;  2ZCT A;  5AIV A;  4F82 A;  2RLI A;  3DVX A;  3EE2 A;  5IOW A;  4D73 B;  4OMV A;  1K3Y A;  1MEK A;  4TW5 A;  2EIO A;  4HUA A;  1PL1 A;  1NSW A;  4MZC A;  2VCQ A;  1GH2 A;  2FCH A;  1OVN A;  2YWI A;  4ZIJ A;  2H6X A;  2P5Q A;  4QQ7 A;  1V40 A;  1T4Y A;  3EU3 A;  5C04 A;  3TKS A;  1U88 A;  1XWA A;  5IPH A;  2OBI A;  4WET A;  3UAP A;  3GUR A;  3WT1 A;  1XBS A;  4N11 A;  2H0G A;  3D21 A;  5IPG A;  2F3M A;  3APO A;  5CRW A;  5ID2 B;  20GS A;  3CXG A;  4F03 A;  3FR9 A;  4X0X A;  2XPE A;  5AN1 A;  2AAW A;  4ECC A;  2Z9S A;  1FG4 A;  4V2L A;  1YY7 A;  4LA1 A;  4AJ6 A;  2CVD A;  4DSS A;  2YOI A;  2E2M A;  5IMA A;  4QL9 A;  4DSR A;  1ST9 A;  2H71 A;  4ZL8 A;  5EPF A;  3IPZ A;  2PER A;  2K8S A;  4ML6 A;  2X99 A;  4DEJ A;  2QKE A;  3TOT A;  1G0T A;  3A2X A;  3FHK A;  1TRS A;  4OWY A;  1VF1 A;  2X8C A;  1CQG A;  1IYH A;  2L5L A;  4PNF A;  2XC2 A;  2CV4 A;  2B6M A;  3HVS A;  3I69 A;  1DE2 A;  1K0D A;  4QL7 A;  4RUV A;  2H1B A;  4LL4 B;  3GKN A;  5LNK e;  4HEA 2;  1SYR A;  1K0A A;  2VAF A;  1ACV A;  3FZ4 A;  3LOR A;  1VGL A;  4YQU A;  3M8N A;  1GSD A;  4F9Z A;  1C72 A;  2CZ2 A;  1LJR A;  5ECP B;  5JWQ B;  3LXZ A;  5FWG A;  4O5U A;  1OE7 A;  1MD4 A;  4F2I A;  3TCO A;  3HVV A;  1O8X A;  2IFQ A;  3ERF A;  4DSQ A;  3HY2 A;  1ZGN A;  5FT3 A;  4K7I A;  5ELA A;  4MJC A;  3NZN A;  2C0G A;  4WEY A;  4ECJ A;  4PUF C;  2GQM A;  2DML A;  2WB9 A;  3ZIJ A;  1J9B A;  1TP9 A;  3C1S A;  3F9U A;  2V1M A;  2K18 A;  3DXB A;  4TXV A;  1XW5 A;  1ILO A;  1BQ7 A;  2DMM A;  4F0B A;  3CRU A;  3TJF A;  1FB6 A;  4KGI A;  2LRN A;  2VL3 A;  2AUV A;  3JCM L;  4FYC A;  3ZFL A;  2DKI A;  2CX4 A;  1AC1 A;  4KE3 A;  3BD2 A;  3AY8 A;  4KW6 A;  1SJZ A;  3GFK A;  2KOK A;  1DUG A;  5D96 A;  2VL2 A;  1HNB A;  4X43 A;  2NPB A;  3TJJ A;  4MMM A;  4HZ4 A;  4MJA A;  2DJ0 A;  2VLT A;  4HQZ A;  2DJ3 A;  4TN8 A;  1M9B A;  3IXR A;  2FA8 A;  3F6F A;  2B7J A;  4IP1 A;  3G7Y A;  3MYD A;  3F4S A;  3IBH A;  2K8V A;  1YJ6 A;  4XS4 A;  1GSS A;  2LJR A;  2A4H A;  3J7Y b;  1RQM A;  4WBJ A;  1OE8 A;  4YAV A;  3D4M A;  3LXT A;  4Z2U A;  3W8J A;  4ZBD A;  5DVB A;  4V2N A;  2IMD A;  4K2X A;  1JZW A;  3LQ7 A;  1SL2 B;  2YWM A;  4KA0 A;  3ZFB A;  3EMX A;  2B1L A;  2V6O A;  3KH7 A;  3BCI A;  3GKX A;  3EC3 A;  4EIP A;  4POM A;  16GS A;  1KEB A;  1F3A A;  1PX7 A;  1EGR A;  1R7H A;  1SJ6 A;  1YF0 A;  3L4N A;  4L0U A;  4EXJ A;  4TVE A;  5J9B A;  1SYX A;  4HDE A;  1HNA A;  2E0Q A;  3GTU B;  1GSU A;  3IK9 A;  4IGJ A;  3H93 A;  4ZBA A;  2EIQ A;  3HKR A;  3UL3 A;  1M0U A;  3APQ A;  3ERG A;  5D9V A;  2HSY A;  1FB0 A;  4IN0 A;  3KH9 A;  2GSR A;  1WMJ A;  4MAB A;  3KMN A;  1ERV A;  1QXH A;  3ZYW A;  1B9Y C;  5AIX A;  3QFB C;  1SKS B;  2M46 A;  3IOS A;  2WDU A;  3P2A A;  2GTU A;  2LJA A;  2EC4 A;  3GMF A;  1SL0 B;  1BG5 A;  3ED3 A;  2VCV A;  2X4A A;  4V2M A;  3KMO A;  2HRF A;  2O7K A;  1YZX A;  4NHW A;  1O85 A;  5F8B A;  1K0C A;  1XW9 A;  3Q6O A;  3SWL A;  5IMC A;  2L5O A;  1SK1 A;  2WFC A;  5G5E A;  3EWL A;  3U5R E;  2H0H A;  4L8E A;  5ECS A;  5CAX A;  2N5F A;  1KBN A;  1A2M A;  4K7O A;  4MLY A;  2UZ8 A;  3DEX A;  1ABA A;  4IS0 A;  2C0D A;  4NPB A;  3VUR A;  2J23 A;  1U6T A;  1USB A;  2PPT A;  4PQI A;  3KP8 A;  4HJ2 A;  1TW9 A;  3MAK A;  2JL4 A;  5HFG A;  2C80 A;  3W8S A;  1M2D A;  1A23 A;  2FWE A;  4LLR A;  1PKZ A;  2GT5 A;  3US3 A;  1EOG A;  1ZYQ B;  3WD6 A;  1KTE A;  1XFL A;  4A5P A;  4EDZ A;  3D0Z A;  3EU4 A;  1PQN A;  4K6X A;  1YKA A;  3LGC A;  3UOM A;  2YZU A;  4PQ1 A;  1PRX A;  4EVM A;  3VI7 A;  5ECQ B;  2GGT A;  4WF5 A;  1HNC A;  5J5N A;  1R5A A;  2FUG 2;  2JU5 A;  4PQH A;  1O6J A;  1N2A A;  3QAV A;  4I6X A;  1EEM A;  1NHO A;  1U3A A;  3SBC A;  2JZR A;  5HR0 A;  1JLW A;  3A2V A;  1HQO A;  2FNO A;  2VL2 C;  4GRF A;  4MPG A;  3ME7 A;  2H01 A;  1XXU A;  4N0V A;  5H5Q A;  1VF2 A;  1GLP A;  2GQL A;  2F51 A;  5J41 A;  3ZIT A;  5A4V A;  2L59 A;  2WGR A;  1M99 A;  1FVJ A;  3IR4 A;  1Z7R A;  4J2F A;  1BED A;  5CRG A;  1BAY A;  1W89 A;  5DQS A;  3KGK A;  2FGX A;  2MMA A;  3PGT A;  3FY7 A;  2E7P A;  3G9B A;  4MF5 A;  2PVQ A;  5D9T A;  2K9F A;  1MTC A;  5ECN B;  5L71 A;  5IMF A;  1ZMA A;  1F3B A;  4KAE A;  3TKQ A;  2IMK A;  1GSF A;  5J9C A;  2HXK A;  3TJG A;  3MIX A;  2A2S A;  1YEP A;  1UN2 A;  4MH2 A;  4WBR D;  3GHA A;  4O32 A;  1OC9 A;  1DE1 A;  3GYK A;  4ZIL A;  4OFM A;  5EVO A;  4HU7 A;  4K8M A;  3GX8 A;  4KB3 A;  8GSS A;  5EL8 A;  2IL3 A;  2V32 A;  2JAD A;  2WCI A;  2GZP A;  2AYT A;  1QMV A;  2NVL A;  1SD8 A;  3BJ5 A;  2I3Y A;  2LNT A;  2YCD A;  2VLU A;  4HI7 A;  4HOJ A;  1M2B A;  4I2U A;  5IO0 A;  5KN1 A;  1ON4 A;  4MA9 A;  3CTF A;  4EIQ A;  3GRX A;  5DAL A;  4BVY A;  1NW2 A;  5D9W A;  4E8H A;  4MF7 A;  2MMZ A;  1T4Z A;  4EKZ A;  1XWB A;  3P8W A;  2GSS A;  2IMI A;  2HZE A;  4XRA A;  3Q74 A;  3A5W A;  3KD0 A;  4WR5 A;  4KUN A;  4KSM A;  4GLT A;  4YQM A;  5A4U A;  2HZF A;  4BWS A;  4CDO A;  2FD3 A;  5ECH B;  5GAP D;  2R5G A;  4OO5 A;  2XBI A;  2CX3 A;  4ZB9 A;  3UVH A;  1BJX A;  3U6V A;  4RQX A;  5GSS A;  3HCZ A;  1OYJ A;  2FA4 A;  3BBY A;  5BRT A;  1ZYN A;  4AJ7 A;  3H4K A;  1FO5 A;  3A2W A;  1K3L A;  5DQY A;  4PXO A;  5B8A A;  4FIW A;  4I8B A;  1ERW A;  2C8U A;  4BL7 A;  4GF0 A;  1PL2 A;  2XBQ A;  4TR1 A;  2ALB A;  3P7X A;  1TU8 A;  4KCE A;  2DJ2 A;  1AIU A;  2GVP A;  2REM A;  2N5A A;  3F6D A;  4TXO B;  3L9U A;  5HFI A;  18GS A;  3M9J A;  1U3I A;  2O87 A;  2P0G A;  6GST A;  1SL1 B;  1F9M A;  4G0I A;  11GS A;  1O7U A;  3WGE A;  3L0H A;  4NMU A;  5DCG A;  4CY6 A;  1F6M C;  3TDG A;  1G6Y A;  5F0G A;  2YPM A;  1GLQ A;  3KJY A;  3TOU A;  2OJL A;  3LSZ A;  3GL5 A;  5C00 A;  3N9J A;  1AQV A;  4OD7 A;  2MMO A;  3E3E A;  1B4P A;  4IQA A;  4WKW A;  3IAS 2;  4KF9 A;  1EWX A;  2HFD A;  5IIZ A;  3VWV A;  2GLR A;  2CVK A;  1EOH A;  3QFA C;  2GZZ A;  3FMW A;  3ZLP A;  3ERW A;  3BCK A;  2YJ7 A;  3GNJ A;  1GSY A;  4LL1 B;  1TTZ A;  2GSQ A;  1FVK A;  4JR4 A;  1J0F A;  2XHF A;  2B3S A;  5KN2 A;  3FYG A;  2I81 A;  1V98 A;  1VF3 A;  7GSS A;  4WF4 A;  4EC0 A;  3LJR A;  2H8L A;  4JE1 A;  1PMT A;  1X9W B;  3M3M A;  1YKC A;  12GS A;  4XRD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...