2WFCA

Crystal structure of peroxiredoxin 5 from arenicola marina
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
159
structure length
159
Chain Sequence
PIKEGDKLPAVTVFGATPNDKVNMAELFAGKKGVLFAVPGAFTPGSSKTHLPGYVEQAAAIHGKGVDIIACMAVNDSFVMDAWGKAHGADDKVQMLADPGGAFTKAVDMELDLSAVLGNVRSKRYSLVIEDGVVTKVNVEPDGKGLTCSLAPNILSQLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PEROXIREDOXIN 5
publication title Crystal Structure of Peroxiredoxin 5 from Arenicola Marina
rcsb
source organism Arenicola marina
molecule tags Oxidoreductase
total genus 43
structure length 159
sequence length 159
chains with identical sequence B, C, D
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2009-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08534 Redoxin Redoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2wfcA00
1ERTA 5ECIB 1XWAA 1U3IA 4AF2A 1AQWA 2YWMA 2MMNA 1ZYEA 4DEJA 1TRWA 2WB9A 3N9JA 1M9AA 3HDCA 2L4QA 1YY7A 2VLTA 2AV4A 3P8WA 5JCUA 1AIUA 2JU5A 2H74A 3ZRDA 3D6IA 3DKSA 2PGTA 1ML6A 2H0HA 3MSZA 4AJ8A 3C1SA 2LJAA 4PNFA 4K7NA 1CQGA 1PD21 2LSTA 3QAVA 3C71A 3DEXA 1O6JA 2FD3A 1T00A 1SK2A 2H66A 5ECRB 4TRXA 1SKRB 8GSSA 2V41A 3GH9A 1ZZYA 5D9XA 4GQCA 1ZYQB 5D8IA 2F51A 2HLSA 4J57E 1BYEA 3HA9A 1X9SB 5D96A 2H19A 3BBYA 1TK8B 4D73B 1NW2A 1X9WB 2C3TA 1HD2A 3I6AA 4IHUA 2GQMA 2L4CA 1E2YA 4MLYA 4K6XA 2FWGA 4JEDA 5F06A 4JBBA 1CQHA 4PUAA 3L0HA 3LXTA 1K3LA 3G7IA 2EIQA 2GGTA 1X0RA 2N5FA 3RPPA 3IAM2 4TKYA 3U6VA 4AGSA 4ID0A 1YDKA 3DMLA 3LYPA 1YKCA 1ERUA 3CRUA 2HRNA 3IAS2 2QKEA 1Y25A 1O73A 1T7PB 2CV4A 4TVEA 3FHKA 4MP4A 4NV5A 2CVKA 3KH7A 4V2NA 3TJKA 4F9ZA 2YP6A 2LKUA 2RM6A 4IS0A 2I1UA 4FH8A 3D4TA 1HNAA 2DBCA 5J3RA 1JFUA 2CAQA 1V58A 4KSMA 1HNBA 5DDLA 1F2EA 3VWUA 4HOJA 5F07A 1GUHA 1JZRA 3EC3A 1M2AA 4MPFA 2R37A 2P5QA 5C00A 3QD9A 4DSSB 1AC1A 3APQA 3W6GA 1AXDA 3LG6A 2VL9A 2O89A 4X1UA 3BCIA 4ZB9A 4MMMA 5LD0A 1THXA 2VOCA 2WS2A 3ZVJA 2VIMA 3A2VA 4PX1A 1ACVA 2YWOA 6GSYA 1V40A 2LS5A 2MBTA 1GUMA 3TKSA 2H1DA 2YJHA 18GSA 3HVVA 3QAWA 2OBIA 1SJ6A 5CYYA 1ZL9A 6GSXA 2VL3A 1GRXA 2VAFA 5J4UA 1A0FA 4HJ2A 2DJ3A 2WDUA 1VGLA 4KX4A 2TRCP 3F3QA 3KTBA 2YNXA 1T1VA 3IC4A 4HDEA 3WT1A 3KGKA 5ECKB 1GP1A 2F8FA 3GL5A 2PU9C 3GKMA 4RI7A 2VUPA 3EU3A 4EDZA 3H1NA 3H93A 2H6XA 3I69A 1PX7A 4XIHA 2A4VA 3CYNA 1FB6A 2AAWA 2LRNA 3UMAA 5ID2A 4IQ1A 4POMA 1ABAA 6GSSA 1O85A 4XS6A 1TTZA 2O8VB 3C1RA 4K7OA 1OE7A 2C0EA 5CRWA 1BAYA 3KIJA 2VCWA 2MMOA 4TW5A 3EINA 4OFMA 1V57A 4JZQA 5G30A 2O7KA 1EZKA 2HZFA 3UVTA 2YPMA 1LJRA 2GTUA 3G7YA 4V1Ap 3I9V2 4MZCA 3US3A 4QL7A 3HCZA 4PXOA 1A2LA 3HXSA 4HEA2 1R26A 5CRHA 2CZ3A 3DVWA 2OADA 5FHIA 4KA0A 2CX4A 1TI1A 3KM6A 2PMTA 4EC0A 4JR4A 4POLA 2H0GA 3D22A 2FWFA 2ON5A 4N11A 2JZTA 3TKPA 1J0FA 3EU4A 3R2QA 5AN1A 4XCSA 1LBKA 3UAPA 1U3AA 4DVCA 12GSA 2HYXA 1OE8A 1WP0A 3GTUB 2H75A 1OYJA 3WGXA 4JR6A 4NPBA 4XRDA 2H76A 1A2JA 2C8UA 5JCGA 3HHVA 3H79A 4FO5A 1B9XC 1GNWA 3QAGA 3VI7A 2RUEA 2PVOC 4TR1B 3EMPA 3MNGA 1I9DA 1SENA 2X99A 4FYUA 3HJPA 1R5PA 5EPFA 2K8VA 5DCGA 2VM1A 1F3BA 3DYRA 4BA7A 5D73A 2HE3A 3FW2A 1M9BA 2B7JA 1ZMAA 2OACA 3GIXA 1FAAA 2F3MA 2I3YA 2WGRA 3CSJA 4GCIA 3M9KA 3NOFA 4MJEA 2IMEA 4WR5A 2IJYA 2GVPA 5C04A 4N10A 2H1AA 2WCIA 5DQSA 4N0ZA 1C72A 2CQ9A 4KDUA 3MAKA 4ZBAA 2L5LA 2X64A 4HU7A 3C73A 2FA8A 1JZOA 4MJBA 1ON4A 2K18A 1V2AA 14GSA 4MA9A 2HI7A 1Q4JA 2VL2C 4TR4A 4NXIA 3KP9A 5GZZB 5AIXA 3LYKA 3QMXA 5DJLA 3VI5A 4WBJA 2VD1A 4EVMA 4YQMA 2L57A 2CT6A 3D0ZA 1WRYA 2DMMA 5GSSA 5CAXA 4WXTA 2YCDA 1MD3A 2TRXA 2MMAA 3M1GA 3GTUA 4EO3A 1QFNA 2YZUA 2C4JA 3APOA 2LV3A 1DE2A 1YEXA 5ECQB 1TOFA 5DQYA 1G6YA 2OE1A 5KN0A 1ZOFA 1S3CA 2B5EA 1TP9A 3P90A 1M2BA 1GSEA 4GLTA 2IPAA 4NHZA 3A2XA 4TOPA 2IIYA 1X5CA 2DJJA 3ZFLA 1SKSB 4F0CA 1Z7PA 1YF0A 4EDYA 1TRUA 5A5KA 4I5QA 3DGQA 4KCAA 5IO0A 5J9BA 3L9VA 3Q74A 4KNDA 3F63A 2HRFA 2OKAA 5G5EA 4I6XA 4YQVA 3QCPA 5ECSA 5F05A 3VWXA 3TRPA 1V9WA 3FR3A 2QC7A 3WGEA 3TKRA 4RQXA 4AJ7A 4HUAA 3HJMA 3TJJA 1ZCPA 3PINA 4PNGA 2RUFA 3GH6A 4ACSA 2MYGA 2I4AA 4YH2A 1M2DA 3IHQA 2B6MA 5LCZA 5HFGA 1XWKA 4ML6A 5E59A 2XC2A 3VWVA 4XS4A 4PUFC 1YQ1A 1GTAA 1J08A 1EGOA 2J9HA 1PX6A 3E9JB 2B1KA 2E0QA 3L4NA 4E8HA 2DSAA 1H4OA 2C3QA 4G19A 5KN1A 2F8AA 4EUYA 1M99A 1BG5A 5KEJA 1MDIA 4OCFA 3WD6A 3BD2A 3IDVA 1U88A 1K3YA 1V98A 5FWGA 3ERFA 1J9BA 1S3DA 2PN8A 3IR4A 4MH2A 1K0NA 4JU5A 2RIIA 2AYTA 3ZL5A 4ZL8A 2JZRA 2LNSA 3VPTA 1Q98A 5B8BA 4PGTA 3RHCA 1K0AA 5A4VA 1DE1A 4NHWA 3BJ5A 3TKSE 3TB2A 2QGVA 4HZ4A 3ZFBA 2H01A 1XW9A 3CSIA 2B7KA 5DAKB 6GSVA 5KN2A 1MEKA 4ECJA 3UEMA 2DIZA 5EY6A 1XXUA 4WF4A 4LL4B 1WIKA 4WR4A 2LQOA 3SBCA 4KDYA 4QL9A 2MBSA 1W4VA 2VCTA 3APSA 4GF0A 2XBIA 2AB6A 5HR1A 4ECCA 1A0RP 1B4QA 4WF5A 1HQOA 3F4RA 3FK8A 2FWEA 4MZBA 1O8XA 2LRTA 5INYA 2BTOT 3M0FA 4EL1A 4XTSA 5IOWA 4EXJA 3I43A 2J23A 4K0NA 2L6CA 4WETA 4KGIA 2Z9SA 5HQPA 3DWVA 4ZBDA 2OE3A 4GSSA 1G7OA 2A2SA 3GNJA 5H5SA 2QSIA 3GURA 2P0GA 2C3NA 2XHFA 2IWTA 3A5WA 1PN9A 3TCOA 2B5XA 3UIWA 1XZOA 2HSYA 1SU9A 1Z6NA 1SKWB 2A2RA 3MWHA 1FB0A 1GTIA 4DSRA 3ZTLA 4ZILA 1JHBA 1EGRA 1XVQA 5IPHA 4G10A 3RHBA 1Z9HA 4BVYA 2R3XA 1E6BA 1K0DA 1XWCA 5DAKA 3Q6OA 3MDKA 1AUCA 2NBSA 1OC9B 1QXHA 4O7HA 4D73A 3UL3A 3J7Yk 4GTUA 1GH2A 1UC7A 1YZXA 2JADA 3ERWA 2GLRA 1K3OA 5ABRA 2H1BA 2X8HA 3NIVA 1XPVA 1A2MA 1O81A 5B6NA 2ALBA 2CZ2A 3F6FA 9GSSA 1BX9A 1JZDA 3J7Yb 2MMZA 3KMNA 1B8XA 2FCHA 5CREA 5JWQB 1QUWA 1VF2A 5G5FA 2VCZA 3TJBA 3KTLA 3FEUA 3ISOA 2OBKA 4GQFA 1XCCA 2CVBA 3VLNA 3D4MA 5FT3A 1TI3A 2VLVA 1FG4A 1VF1A 1OAZA 2LTKA 2FLSA 2DC5A 2I81A 3O3TA 1R5AA 3C7MA 5G2ZA 2M72A 1Y6EA 4P3YB 4NAXA 3VURA 2DJKA 4YQUA 3RPNA 3ZIVA 4ZB8A 4POBA 4MDCA 1SYXA 2XPDA 5DCHA 3GRXA 1JLWA 3TOTA 5ELGA 4HI7A 4O32A 1ERVA 3HY2A 5LNKe 2NTOA 1JLVA 4DSQA 2KLXA 3FZ5A 4K2DA 4IW9A 3HJOA 5KN3A 1SJIA 3KD0A 4HJMA 4MCUA 1XVWA 2DJ1A 2JSZA 4DSSA 1NSWA 1G6WA 1K0MA 4MF5A 5AGYA 3QOUA 1SL2B 4V2MA 3IOSA 4ILFA 2PVQA 2OJLA 1TU7A 5J5NA 4KCEA 1SD9A 3CMIA 5ECMB 5HR2A 2V32A 4TXOB 1OVNA 4GSTA 1JZWA 1AQXA 1PL1A 3PGTA 2B3SA 1SK0A 4O5RA 5D9VA 5IMZA 2ZNMA 3LSZA 3U5RE 3ZMKA 2R5GA 1HNCA 2M80A 5D9WA 1GULA 1VF4A 4PURA 4MF6A 4MJAA 3GN3A 3VPQA 5A4UA 2H8LA 4MH3A 2FA4A 2M46A 3HD5A 2G2QA 1PKZA 1PL2A 3EURA 3L9SA 1XIYA 5DJMA 2C0GA 1B48A 2YWNA 1Z5YE 1K0BA 3GMFA 4IJ3A 3LEFA 3QDNA 2LQQA 4AJ6A 1Z6MA 2YN1A 1GL8A 22GSA 4YAPA 5B7CA 1XBSA 2JSYA 4GXZA 2P31A 2AJQB 4G9HA 2GZZA 3V1WA 3M8NA 2O87A 2L5OA 2O85A 3FZ4A 4L5LA 1FVKA 3KH9A 2C0DA 3IK9A 4TXOA 5CRDA 2CX3A 2WRTA 1FO5A 2PBJA 4K1FA 2JZSA 2LJRA 1YEPA 1VRSD 2V6KA 2GQLA 1ST9A 2DJ2A 4N0VA 4I2UA 2GT5A 5J9CA 1PSQA 1FW1A 2D2ZA 3L9UA 4LLRA 4IP6A 3GKKA 2V1MA 2KUCA 3DIEA 1T8EB 5EVOA 2PERA 1RW1A 1WE0A 3GFKA 2AUVA 3HZ8A 1ZGNA 3AY8A 1DBYA 2IMFA 3A2WA 2FUG2 4F03A 3FYGA 2H6YA 1KTEA 5IMAA 4MZWA 5IOXA 1OKTA 2MZCA 2HT9A 2LJKA 3ZIJA 3CTGA 13GSA 3IBHA 4OFNA 1PKWA 3HYPA 2EIRA 2GDRA 3CBUA 1FOVA 4LL1B 2FNOA 3WT2A 2LNTA 1THOA 5CRGA 2XPEA 3DVXA 3IV4A 2L6DA 1XOAA 1PA3A 4TR1A 3EWLA 1MTCA 4HZ2A 5D9TA 5DVBA 1G0TA 5IM9A 2TIRA 2KP1A 3LGCA 2K9FA 2K8SA 5HFKA 4POKA 4X43A 3DRNA 4Q5RA 2DIYA 4G2EA 4I2TA 4TXVA 4IP1A 1SJZA 1ERWA 1QGVA 2HZEB 19GSA 3D21A 1A8LA 2EIOA 2WJUA 3FR9A 1NHOA 5H5QA 5IIZA 2B1LA 1XW6A 1EOHA 1GLQA 2H6ZA 5DALB 4F82A 3LORA 3D5JA 4WEYA 3IE3A 1GTUA 2DLXA 4K9ZA 1X9MB 5DBQA 1DUGA 1RK4A 1U87A 4FIWA 4WKWA 1PMTA 3KXOA 3PH9A 4ISDA 1URMA 1MDJA 4F2IA 4J2FA 1MDKA 1R4WA 1GUKA 3QFAC 4ZIJA 1GTBA 2IMDA 3VK9A 4I97A 5AIVA 1O8WA 2VCQA 3ME8A 5GAPD 3ZITA 3CXGA 4LMWA 3P7XA 4BWSA 4N30A 2PWJA 1PGTA 4HQZA 1X5EA 5H5RA 3H4KA 2HSHA 3GL3A 4OO4A 3UBKA 4ECBA 4F0BA 1QQ2A 1OKDA 3TGZA 4XS1A 2HZEA 4K7IA 2YV9A 2C0FA 3GKXA 3UBLA 3UJ1A 3ZMLA 3HVSA 4IVFA 1EV4A 2NVLA 2VO4A 3FKFA 3F4SA 2DMLA 4LA1A 4HU9A 2VCVA 4GWRA 2VD0A 4XHMA 1AQVA 5DALA 3KZQA 3RDWA 3IA1A 17GSA 2V6OA 1WMJA 4PQIA 4K0GA 1SYRA 5ELAA 5E4WA 3WYWA 2GSTA 1GSUA 3GKNA 2GSQA 4MF7A 4CW9A 1TRVA 3OR5A 3KMOA 2N5BA 3UARA 3Q19A 4OO5A 4IKHA 2L59A 20GSA 3CSHA 1N8JA 2G0FA 4K8MA 2PUKC 3JCML 3F8UA 3UVHA 1NHYA 2BMXA 5ECNB 5ECHB 5A4WA 2YJ7A 2RLIA 1OC8A 3C8EA 3HKRA 3UOMA 5IMDA 1A8YA 6GSTA 5F8BA 3RAZA 3FY7A 4OCEA 10GSA 2E7PA 2FGXA 1AW9A 5G31A 2WFCA 2JACA 4ZBBA 1K0OA 2HFDA 4Z7XA 1TK5B 4LMVA 3PR8A 4IQAA 4RUVA 1WOUA 1A24A 1F37A 1EP8A 3FZ9A 5HR3A 2R4VA 5AISA 1BJXA 3EMXA 1GSFA 4BWQA 1Z7RA 4MABA 1I5GA 4O92A 3F6DA 1EP7A 1Z3EA 3ZZXA 2JL4A 4J56E 4KAEA 4V1Ag 3FR6A 3G9BA 4TN8A 4BVXA 1TRSA 2H0IA 1T4ZA 3IK7A 2K6VA 2PPTA 3EE2A 2VLUA 3H8QA 2OE0A 3M3MA 3ZREA 4NWYA 1MD4A 3KCMA 2YWIA 2H72A 1XWGA 3G7JA 4MPGA 5ID2B 3LQ7A 3VFIA 4KE3A 1SK1A 1T4YA 1EV9A 3L78A 3TJFA 4HS1A 2WULA 2H70A 5L71A 2X8GA 1XOBA 5JWOB 3M9JA 3IRAA 2VCXA 2RM5A 6GSWA 2YV7A 4ECIA 3O6TA 4ZXGA 4H86A 1TXXA 3IXRA 3K8NA 2C80A 2ON7A 2ZUPA 4RI6A 5GSTA 1VF3A 4KH7A 1RQMA 3W8JA 4IGJA 2KOKA 4MK3A 4OWYA 1DSBA 4CDOA 3F4TA 1K0CA 1YF1A 4BL7A 1M7TA 2YOIA 1GSSA 3BCKA 3TOUA 5B8AA 3F9UA 4OFTA 11GSA 1EEJA 5CNWA 4GSNA 2R6KA 1OC9A 3LFLA 4IN0A 5ENUA 3ED3A 2H73A 4TR3A 1EWXA 3LWAA 1EEMA 4TR0A 5COHA 1G7EA 3HZ4A 1F9MA 1O7UA 1SL0B 1SL1B 2FWHA 5ECPB 1TKDB 4IJIA 2IMKA 1NM3A 5IO2A 5IMCA 3CRTA 4ZL9A 3GHAA 1GWCA 2NPBA 16GSA 1UN2A 1BQ7A 5IMVA 2VL2A 1LU4A 4PQ1A 1XFLA 1WWJA 2H30A 3GYKA 3TUEA 1TU8A 2GZPA 4I8BA 2V2GA 3TRQA 1UVZA 3BOAA 4EKZA 1R7HA 5HFIA 1GSDA 4WBRD 3TKQA 1USBA 2F9SA 4PQHA 4ML1A 3GSTA 2GS3A 2X8CA 2HXKA 2XBQA 3TRXA 2CAIA 3EYTA 4ZL7A 5IPGA 3FRCA 1PRXA 4EF0A 1A23A 3SWLA 2KP2A 1BEDA 5JWRB 2LEGA 3A3TA 2I9HA 3ZLPA 2E2MA 1GSQA 3ERGA 5CO3A 3TKSC 3ME7A 1YKAA 4QQ7A 2H1GA 7GSSA 2ES7A 4XRAA 3NZNA 2CA8A 5D93A 3E0UA 1XWBA 3FZAA 3GX8A 3TJGA 4RQRA 6GSUA 4X0XA 2WZ9A 4ZB6A 4L5OA 4Q5NA 4L8EA 1GSYA 2BJXA 1N2AA 5J41A 2EC4A 1M0UA 2C1YA 4KB3A 4KW6A 2FHEA 2B5YA 3IPZA 4OMVA 2IN3A 2FY6A 3P2AA 1UA5A 1TK0B 1HYUA 3KEBA 4L0UA 4ULXA 1TW9A 2AHEA 1TJDA 3W8SA 2LRCA 3F0IA 1TDIA 1QK8A 1XW5A 1OC3A 4YAVA 1GNEA 1B9YC 1WPIA 4KSOA 3GA4A 3LJRA 2GSRA 3CTFA 1SD8A 1B4PA 3GX0A 1IYIA 3RBTA 4FYCA 1GLPA 2GQKA 2NDOA 2DJ0A 1F3AA 3GV1A 5F0GA 2KHPA 4GRFA 4IELA 1WJKA 1YJ6A 1KEBA 3GUSA 1AAZA 2CVDA 3S9FA 3WGDA 5G1KA 1EOGA 5HR0A 4KUNA 5IQYA 1FHEA 2R2JA 1X5DA 3Q18A 2IFQB 4OD7A 4FYBA 2OA7A 4KDXA 1W89A 5ECLB 5G1LA 5IMFA 5GAND 4XS4B 2HNLA 4MJCA 2GZYA 1PQNA 5CP1A 4BPYA 2IMIA 4NV2A 4IBPA 2P5RA 4Q5QA 5B6MA 2GT6A 3ZVJD 3QPMA 4Q5FA 3DXBA 3F3RA 2ZCTA 3TDGA 4JE1A 3HVXA 1F6MC 2VM2A 3E3EA 3N5OA 1QMVA 1S3AA 1H75A 5ECOB 4E8EA 4NMUA 1FVJA 1T3BA 2REMA 4EE0A 3QFBC 2YANA 4CHSA 1KBNA 5EL8A 3KP8A 3KJYA 3GSSA 5JCWA 3ZYWA 3EVIA 2E2GA 2GSSA 3O76A 4L0WA 4JRRA 3VWWA 2N5AA 4HQSA 2H71A 1IYHA 4V2LA 3DD3A 1ILOA 2YZHA 3QR6A 1KNGA 2IL3A 2LUSA 2IFQA 1U6TA 3LXZA
chains in the Genus database with same CATH superfamily
1ERTA 5ECIB 1XWAA 1U3IA 4AF2A 1AQWA 3IC8A 2YWMA 2MMNA 1ZYEA 4DEJA 1TRWA 2WB9A 3N9JA 1M9AA 3HDCA 2L4QA 1YY7A 3FMWA 2VLTA 2AV4A 3P8WA 5JCUA 1AIUA 2JU5A 2H74A 3ZRDA 3D6IA 4BIKA 3DKSA 2PGTA 1ML6A 2H0HA 3MSZA 4AJ8A 3C1SA 2LJAA 4PNFA 4K7NA 1CQGA 1PD21 2LSTA 3QAVA 3C71A 3DEXA 1O6JA 2FD3A 1T00A 1SK2A 2H66A 4X4JA 5ECRB 4TRXA 1SKRB 8GSSA 2V41A 3GH9A 1ZZYA 5D9XA 4GQCA 1ZYQB 5D8IA 2F51A 2HLSA 4J57E 5BMUA 1BYEA 3HA9A 1X9SB 5D96A 2H19A 3BBYA 1TK8B 4D73B 1NW2A 1X9WB 2X4AA 2C3TA 1HD2A 3I6AA 4IHUA 2GQMA 2L4CA 1E2YA 4MLYA 4G0IA 4K6XA 2FWGA 4JEDA 5F06A 4JBBA 1CQHA 4PUAA 3L0HA 3LXTA 1K3LA 3G7IA 2EIQA 2GGTA 1X0RA 2N5FA 3RPPA 4EIPA 2R0CA 3IAM2 4TKYA 3U6VA 4AGSA 4ID0A 1YDKA 2A2PA 3DMLA 3LYPA 1YKCA 1ERUA 3CRUA 4CY6A 2HRNA 3IAS2 2QKEA 1M3IA 1Y25A 1O73A 1T7PB 2CV4A 4TVEA 3FHKA 4MP4A 4NV5A 2CVKA 3KH7A 4V2NA 3TJKA 4F9ZA 2YP6A 2LKUA 2RM6A 4IS0A 2I1UA 4FH8A 3D4TA 1HNAA 2DBCA 5J3RA 1JFUA 2CAQA 1V58A 4KSMA 1HNBA 5DDLA 1F2EA 3VWUA 4HOJA 5F07A 4MPFA 1GUHA 1JZRA 1M2AA 3EC3A 2QA2A 2P5QA 2R37A 5C00A 3QD9A 4DSSB 1AC1A 3APQA 4PTSA 3W6GA 1AXDA 3LG6A 2VL9A 2O89A 4X1UA 3BCIA 4ZB9A 4MMMA 5LD0A 2UZ8A 1THXA 2VOCA 2WS2A 3ZVJA 2VIMA 3A2VA 4PX1A 1ACVA 2YWOA 6GSYA 1V40A 2LS5A 2MBTA 1GUMA 3TKSA 2H1DA 2YJHA 18GSA 3HVVA 3QAWA 2OBIA 1SJ6A 5CYYA 1ZL9A 6GSXA 2VL3A 1GRXA 2VAFA 5J4UA 1A0FA 4HJ2A 2DJ3A 2WDUA 1VGLA 4KX4A 2TRCP 3F3QA 3KTBA 2YNXA 1T1VA 3IC4A 4HDEA 3WT1A 3KGKA 5ECKB 1GP1A 2F8FA 3GL5A 2PU9C 3GKMA 4RI7A 2VUPA 3EU3A 4EDZA 3H1NA 2DKIA 3H93A 2H6XA 1PFOA 3I69A 1PX7A 4XIHA 2A4VA 3CYNA 4USSA 1FB6A 2AAWA 2LRNA 3UMAA 5ID2A 4IQ1A 4POMA 1ABAA 6GSSA 4MNNA 1O85A 4XS6A 1TTZA 2O8VB 3C1RA 4K7OA 1OE7A 2C0EA 4G0KA 5CRWA 1BAYA 3KIJA 2VCWA 2MMOA 4TW5A 3EINA 4OFMA 1V57A 4JZQA 5G30A 2O7KA 1EZKA 2HZFA 3UVTA 2YPMA 1LJRA 2GTUA 3G7YA 4V1Ap 3I9V2 4MZCA 3US3A 4QL7A 3HCZA 4PXOA 1A2LA 3HXSA 4HEA2 1R26A 5CRHA 2CZ3A 3DVWA 2OADA 5FHIA 4KA0A 2CX4A 1TI1A 3KM6A 2PMTA 4EC0A 4JR4A 2QA1A 4POLA 2H0GA 3D22A 2FWFA 2ON5A 4N11A 2JZTA 3TKPA 1J0FA 3EU4A 3R2QA 5AN1A 4XCSA 1LBKA 3UAPA 1U3AA 4DVCA 12GSA 2HYXA 1OE8A 1WP0A 3GTUB 2H75A 1OYJA 3WGXA 4JR6A 4NPBA 4XRDA 2H76A 1A2JA 2C8UA 1S3RA 5JCGA 3HHVA 3H79A 4FO5A 1B9XC 1GNWA 3QAGA 3VI7A 2RUEA 2PVOC 4TR1B 3EMPA 3MNGA 1I9DA 1SENA 2X99A 4FYUA 3HJPA 1R5PA 5EPFA 2K8VA 5DCGA 2VM1A 1F3BA 3DYRA 4BA7A 5D73A 2HE3A 3FW2A 1M9BA 2B7JA 1ZMAA 2OACA 3GIXA 1FAAA 2F3MA 2I3YA 2WGRA 3CSJA 4GCIA 4Z2TA 3M9KA 3NOFA 4MJEA 2IMEA 4WR5A 2IJYA 2GVPA 5C04A 4N10A 2H1AA 2WCIA 5DQSA 4N0ZA 1C72A 2CQ9A 4KDUA 3MAKA 4ZBAA 2L5LA 2X64A 4HU7A 3C73A 2FA8A 1JZOA 4MJBA 1ON4A 2K18A 1V2AA 14GSA 4MA9A 2HI7A 3IHGA 1Q4JA 2VL2C 4TR4A 4NXIA 3KP9A 5GZZB 5AIXA 3LYKA 3QMXA 5DJLA 3VI5A 4WBJA 2VD1A 4EVMA 5KOXA 4YQMA 2L57A 2CT6A 3D0ZA 3R3EA 1WRYA 2DMMA 5GSSA 5CAXA 4WXTA 2YCDA 1MD3A 2TRXA 2MMAA 3M1GA 3GTUA 4EO3A 1QFNA 2YZUA 2C4JA 3APOA 2A4HA 2LV3A 1DE2A 1YEXA 5ECQB 1TOFA 4O5UA 5DQYA 1G6YA 2OE1A 5KN0A 1ZOFA 1S3CA 2B5EA 1TP9A 3P90A 1M2BA 1GSEA 4GLTA 2IPAA 4NHZA 3A2XA 4TOPA 2IIYA 1X5CA 2DJJA 3ZFLA 1SKSB 4F0CA 1Z7PA 1YF0A 4EDYA 1TRUA 5A5KA 4I5QA 3DGQA 4KCAA 5IO0A 5J9BA 3L9VA 3Q74A 4KNDA 3F63A 2HRFA 2OKAA 5G5EA 4I6XA 4YQVA 3QCPA 5ECSA 5F05A 3VWXA 3TRPA 1V9WA 3FR3A 2QC7A 3WGEA 3TKRA 4RQXA 4AJ7A 4HUAA 3HJMA 3TJJA 1ZCPA 3PINA 4PNGA 2RUFA 3GH6A 4ACSA 2MYGA 2I4AA 4YH2A 1M2DA 3IHQA 2B6MA 5LCZA 5HFGA 1XWKA 4ML6A 5E59A 2XC2A 3VWVA 4XS4A 4K2XA 4PUFC 1YQ1A 1GTAA 1J08A 1EGOA 2J9HA 1PX6A 3E9JB 2B1KA 2E0QA 3L4NA 4E8HA 2DSAA 1H4OA 2C3QA 4G19A 5KN1A 2F8AA 4EUYA 1M99A 1BG5A 5KEJA 1MDIA 4OCFA 3WD6A 3BD2A 3IDVA 1U88A 1K3YA 1V98A 5FWGA 3ERFA 1J9BA 1S3DA 2PN8A 3IR4A 4MH2A 1K0NA 4JU5A 2RIIA 2AYTA 3ZL5A 4ZL8A 2JZRA 2LNSA 3VPTA 1Q98A 5B8BA 4PGTA 3RHCA 1K0AA 5A4VA 1DE1A 4NHWA 3BJ5A 3TKSE 3TB2A 4BVYB 2QGVA 4HZ4A 3ZFBA 2H01A 1XW9A 3CSIA 2B7KA 5DAKB 6GSVA 5KN2A 1MEKA 4ECJA 3UEMA 2DIZA 5EY6A 1XXUA 4WF4A 4LL4B 1WIKA 4WR4A 2LQOA 3SBCA 4KDYA 4QL9A 2MBSA 1W4VA 2VCTA 3APSA 4GF0A 2XBIA 2AB6A 5HR1A 4ECCA 1A0RP 1B4QA 4WF5A 1HQOA 3F4RA 3FK8A 2FWEA 4MZBA 1O8XA 2LRTA 5INYA 2BTOT 3M0FA 4EL1A 4XTSA 5IOWA 4EXJA 3I43A 2J23A 4K0NA 2L6CA 4WETA 4KGIA 2Z9SA 5HQPA 3DWVA 4ZBDA 2OE3A 4GSSA 1G7OA 2A2SA 3GNJA 5H5SA 4FQUA 2QSIA 3GURA 2P0GA 2C3NA 3PPUA 2XHFA 2IWTA 3A5WA 1PN9A 3TCOA 2B5XA 3UIWA 1XZOA 2HSYA 1SU9A 1Z6NA 1SKWB 3A5IA 2A2RA 3MWHA 1FB0A 1GTIA 4DSRA 3ZTLA 4ZILA 1JHBA 1EGRA 1XVQA 5IPHA 4G10A 3RHBA 1Z9HA 4BVYA 2R3XA 1E6BA 1K0DA 1XWCA 4CY8A 5DAKA 3Q6OA 3MDKA 1AUCA 2NBSA 1OC9B 1QXHA 4O7HA 4D73A 3UL3A 3J7Yk 4GTUA 1GH2A 1UC7A 1YZXA 2JADA 3ERWA 2GLRA 1K3OA 5ABRA 2H1BA 2X8HA 3NIVA 1XPVA 1A2MA 1O81A 5B6NA 2ALBA 2CZ2A 3F6FA 9GSSA 1BX9A 1JZDA 3J7Yb 3HVNA 2MMZA 3KMNA 1B8XA 2FCHA 5CREA 5JWQB 1QUWA 1VF2A 5G5FA 2VCZA 3TJBA 3KTLA 1M3JA 3FEUA 3ISOA 2OBKA 4GQFA 1XCCA 2CVBA 3VLNA 3D4MA 5FT3A 1TI3A 2VLVA 1FG4A 1VF1A 1OAZA 2LTKA 2FLSA 2DC5A 2I81A 3O3TA 1R5AA 3C7MA 5G2ZA 2M72A 1Y6EA 4P3YB 4NAXA 3VURA 2DJKA 4YQUA 3RPNA 3ZIVA 4ZB8A 4POBA 4MDCA 1SYXA 2XPDA 5DCHA 3GRXA 1JLWA 3TOTA 5ELGA 1ZYNA 4HI7A 4O32A 1ERVA 3HY2A 5LNKe 2NTOA 1JLVA 4DSQA 2KLXA 3FZ5A 4K2DA 4IW9A 4Z2UA 3HJOA 5KN3A 1SJIA 3KD0A 4HJMA 4MCUA 1XVWA 2DJ1A 2JSZA 4DSSA 1NSWA 4YKGA 1G6WA 1K0MA 4MF5A 5AGYA 3QOUA 1SL2B 4V2MA 3IOSA 4ILFA 2PVQA 2OJLA 1TU7A 5J5NA 4KCEA 1SD9A 3CMIA 5ECMB 5HR2A 2V32A 4TXOB 1OVNA 4GSTA 1JZWA 1AQXA 1PL1A 3PGTA 2B3SA 1SK0A 4O5RA 5D9VA 5IMZA 2ZNMA 3LSZA 3U5RE 3ZMKA 2R5GA 1HNCA 2M80A 5D9WA 1GULA 1VF4A 4PURA 4MF6A 4MJAA 3GN3A 3VPQA 5A4UA 2H8LA 4MH3A 2FA4A 2M46A 3HD5A 2G2QA 1PKZA 1PL2A 3EURA 3L9SA 1XIYA 4K5RA 5DJMA 2C0GA 1B48A 1PN0A 2YWNA 1Z5YE 1K0BA 3GMFA 4IJ3A 3LEFA 2X49A 3QDNA 2LQQA 4AJ6A 1Z6MA 2YN1A 1GL8A 22GSA 4YAPA 5B7CA 1XBSA 2JSYA 4GXZA 2P31A 2AJQB 4G9HA 2GZZA 3V1WA 3M8NA 2O87A 2L5OA 2O85A 3FZ4A 4L5LA 1FVKA 3KH9A 2C0DA 3IK9A 4TXOA 5CRDA 2CX3A 2WRTA 1FO5A 2PBJA 4K1FA 4O5QA 2JZSA 2LJRA 1YEPA 1VRSD 2V6KA 2GQLA 1ST9A 2DJ2A 4N0VA 4I2UA 2GT5A 5J9CA 1PSQA 1FW1A 2D2ZA 3L9UA 4LLRA 4IP6A 3GKKA 2V1MA 2KUCA 3DIEA 1T8EB 5EVOA 2PERA 1RW1A 1WE0A 3GFKA 2AUVA 3HZ8A 1FOHA 1ZGNA 3AY8A 1DBYA 2IMFA 3A2WA 2FUG2 4F03A 3FYGA 2H6YA 1KTEA 5IMAA 4MZWA 5IOXA 4HSCX 1OKTA 2MZCA 2HT9A 2LJKA 3ZIJA 3CTGA 13GSA 3IBHA 4OFNA 1PKWA 3HYPA 2EIRA 2GDRA 3CBUA 3LW9A 1FOVA 4LL1B 2FNOA 3WT2A 2LNTA 1THOA 5CRGA 2XPEA 3DVXA 2HSMA 3IV4A 2L6DA 1XOAA 1PA3A 4TR1A 3EWLA 1MTCA 4HZ2A 5D9TA 5DVBA 1G0TA 5IM9A 2TIRA 2KP1A 3LGCA 2K9FA 2K8SA 5HFKA 4POKA 4X43A 3DRNA 4Q5RA 2DIYA 4G2EA 4I2TA 4TXVA 4IP1A 1SJZA 1ERWA 1QGVA 2HZEB 19GSA 3D21A 1A8LA 2EIOA 2WJUA 3FR9A 1NHOA 5H5QA 5IIZA 2B1LA 1XW6A 1EOHA 4EIQA 1GLQA 2H6ZA 5DALB 4F82A 3LORA 3D5JA 4WEYA 3IE3A 1GTUA 2DLXA 4K9ZA 1X9MB 5DBQA 1DUGA 1RK4A 1U87A 4FIWA 4WKWA 1PMTA 3KXOA 3PH9A 4ISDA 1URMA 1MDJA 4F2IA 4J2FA 1MDKA 1R4WA 1GUKA 3QFAC 4ZIJA 1GTBA 2IMDA 3VK9A 4I97A 5AIVA 1O8WA 2VCQA 3ME8A 5GAPD 3ZITA 3CXGA 4LMWA 3P7XA 4BWSA 4A5PA 4N30A 2PWJA 1PGTA 4HQZA 1X5EA 5H5RA 3H4KA 2HSHA 3GL3A 4OO4A 3UBKA 4ECBA 4F0BA 1QQ2A 1OKDA 3TGZA 4XS1A 2HZEA 4K7IA 2YV9A 2C0FA 3GKXA 3UBLA 3UJ1A 3ZMLA 3HVSA 4IVFA 1EV4A 2NVLA 2VO4A 3FKFA 3F4SA 2DMLA 4LA1A 4HU9A 2VCVA 4GWRA 2VD0A 4XHMA 1AQVA 5DALA 3KZQA 3RDWA 3IA1A 17GSA 2V6OA 1WMJA 4PQIA 4K0GA 1SYRA 5ELAA 5E4WA 3WYWA 2GSTA 1GSUA 3GKNA 2GSQA 4BVXB 4MF7A 4CW9A 3MYDA 1TRVA 3OR5A 3KMOA 2N5BA 3UARA 3Q19A 4OO5A 4IKHA 2L59A 20GSA 3CSHA 1N8JA 2G0FA 4K8MA 2PUKC 3JCML 3F8UA 3UVHA 1NHYA 2BMXA 5ECNB 5ECHB 5A4WA 2YJ7A 2RLIA 1OC8A 3C8EA 3HKRA 3UOMA 5IMDA 1A8YA 6GSTA 5F8BA 3RAZA 3FY7A 2HRAA 4OCEA 10GSA 2E7PA 2FGXA 1AW9A 5G31A 2WFCA 2JACA 4ZBBA 1K0OA 2HFDA 4Z7XA 1TK5B 4Z2RA 4LMVA 3PR8A 4IQAA 4RUVA 1WOUA 1A24A 1F37A 2HRKA 1EP8A 3FZ9A 5HR3A 2R4VA 5AISA 4BL7B 1BJXA 3EMXA 1GSFA 4BWQA 1Z7RA 4MABA 1I5GA 4O92A 3F6DA 1EP7A 1Z3EA 3ZZXA 2JL4A 4J56E 4KAEA 4V1Ag 3FR6A 1XG8A 3G9BA 4TN8A 4BVXA 3MIXA 1TRSA 2H0IA 1T4ZA 3IK7A 2K6VA 2PPTA 3EE2A 2VLUA 3H8QA 2OE0A 3M3MA 3ZREA 4NWYA 1MD4A 3KCMA 2YWIA 2H72A 1XWGA 3G7JA 4MPGA 5ID2B 3LQ7A 3VFIA 4KE3A 1SK1A 1T4YA 1EV9A 3L78A 3TJFA 4HS1A 2WULA 2H70A 5L71A 2X8GA 1XOBA 5JWOB 3M9JA 3IRAA 2VCXA 2RM5A 6GSWA 2YV7A 4ECIA 3O6TA 2R0GA 4ZXGA 4H86A 1TXXA 3IXRA 3CQFA 3K8NA 2C80A 2ON7A 2ZUPA 4RI6A 5GSTA 1VF3A 4KH7A 1RQMA 3W8JA 4IGJA 2KOKA 4MK3A 4OWYA 1DSBA 4CDOA 3F4TA 1K0CA 1YF1A 4BL7A 1M7TA 2YOIA 1GSSA 3BCKA 3TOUA 5B8AA 3F9UA 4OFTA 11GSA 2DKHA 1EEJA 5CNWA 4GSNA 2R6KA 1OC9A 3LFLA 4KF9A 4IN0A 5ENUA 3ED3A 2H73A 4TR3A 1EWXA 3LWAA 1EEMA 4TR0A 5COHA 1G7EA 3HZ4A 1F9MA 1O7UA 1SL0B 1SL1B 2FWHA 5ECPB 1TKDB 4IJIA 2IMKA 1NM3A 5IO2A 5IMCA 3CRTA 4ZL9A 3GHAA 1GWCA 2NPBA 16GSA 2R0PA 1UN2A 1BQ7A 5IMVA 2VL2A 1LU4A 4PQ1A 1XFLA 1WWJA 2H30A 3GYKA 3TUEA 1TU8A 2GZPA 4I8BA 2V2GA 3TRQA 1UVZA 3BOAA 4EKZA 1R7HA 5HFIA 1GSDA 4WBRD 3TKQA 1USBA 2F9SA 4PQHA 4ML1A 3GSTA 2GS3A 2X8CA 2HXKA 2XBQA 3TRXA 2CAIA 5KOWA 3EYTA 4ZL7A 5IPGA 3FRCA 1PRXA 4EF0A 1A23A 3SWLA 2KP2A 1BEDA 5JWRB 2LEGA 3A3TA 2I9HA 3ZLPA 2E2MA 1GSQA 3ERGA 5CO3A 3TKSC 3ME7A 5BRTA 1YKAA 4QQ7A 2H1GA 7GSSA 2ES7A 4XRAA 3NZNA 1ZYPA 2CA8A 5D93A 3E0UA 1XWBA 3FZAA 3GX8A 3TJGA 4RQRA 6GSUA 4X0XA 2WZ9A 4ZB6A 4L5OA 4Q5NA 4L8EA 1GSYA 2BJXA 1N2AA 5J41A 2EC4A 1M0UA 2C1YA 4KB3A 4KW6A 2FHEA 2B5YA 3IPZA 4OMVA 2IN3A 2FY6A 3P2AA 1UA5A 1TK0B 1HYUA 3KEBA 4L0UA 4ULXA 1TW9A 2AHEA 1TJDA 3W8SA 2LRCA 3F0IA 3EPTA 1TDIA 1QK8A 1XW5A 1OC3A 4YAVA 1GNEA 1B9YC 1WPIA 4KSOA 3GA4A 3LJRA 2GSRA 3CTFA 1SD8A 1B4PA 3GX0A 1IYIA 3RBTA 4FYCA 1GLPA 2GQKA 2NDOA 2DJ0A 1F3AA 3GV1A 5F0GA 2KHPA 4GRFA 4IELA 1WJKA 1YJ6A 1KEBA 3GUSA 1AAZA 4K5SA 2CVDA 3S9FA 3WGDA 5G1KA 1EOGA 5HR0A 4KUNA 5IQYA 1FHEA 2R2JA 1X5DA 3Q18A 2IFQB 4OD7A 4FYBA 2OA7A 4KDXA 1W89A 5ECLB 5G1LA 5IMFA 5GAND 4XS4B 2HNLA 4MJCA 2GZYA 1PQNA 5CP1A 4BPYA 2IMIA 4NV2A 4IBPA 2P5RA 4Q5QA 5B6MA 2GT6A 3ZVJD 3QPMA 4Q5FA 3DXBA 3F3RA 2ZCTA 3TDGA 4JE1A 4G0LA 3HVXA 1F6MC 2VM2A 3E3EA 3N5OA 1QMVA 4YKFA 1S3AA 1H75A 5ECOB 4E8EA 4NMUA 1FVJA 1T3BA 2REMA 4EE0A 3QFBC 2YANA 4CHSA 1KBNA 5EL8A 4ICYA 3KP8A 3KJYA 3GSSA 5JCWA 3ZYWA 3EVIA 2E2GA 2GSSA 3O76A 4L0WA 4JRRA 3VWWA 2N5AA 4HQSA 2H71A 1IYHA 4V2LA 3DD3A 1ILOA 2YZHA 3QR6A 1KNGA 2IL3A 2LUSA 2IFQA 1U6TA 3LXZA
chains in the Genus database with same CATH topology
1ERTA 5ECIB 1XWAA 1U3IA 4AF2A 1AQWA 3IC8A 2YWMA 2MMNA 1ZYEA 4DEJA 1TRWA 2WB9A 3N9JA 1M9AA 3HDCA 2L4QA 1YY7A 3FMWA 2VLTA 2AV4A 3P8WA 5JCUA 1AIUA 2JU5A 2H74A 3ZRDA 3D6IA 3DKSA 2PGTA 1ML6A 2H0HA 3MSZA 4AJ8A 3C1SA 2LJAA 4PNFA 4K7NA 1CQGA 1PD21 2LSTA 3QAVA 3C71A 3DEXA 1O6JA 2FD3A 1T00A 1SK2A 2H66A 4X4JA 5ECRB 4TRXA 1SKRB 8GSSA 2V41A 3GH9A 1ZZYA 5D9XA 4GQCA 1ZYQB 5D8IA 2F51A 2HLSA 4J57E 5BMUA 1BYEA 3HA9A 1X9SB 5D96A 2H19A 3BBYA 1TK8B 4D73B 1NW2A 1X9WB 2X4AA 2C3TA 1HD2A 3I6AA 4IHUA 2GQMA 2L4CA 1E2YA 4MLYA 4G0IA 4K6XA 2FWGA 4JEDA 5F06A 4JBBA 1CQHA 4PUAA 3L0HA 3LXTA 1K3LA 3G7IA 2EIQA 2GGTA 1X0RA 2N5FA 3RPPA 4EIPA 2R0CA 3IAM2 4TKYA 3U6VA 4AGSA 4ID0A 1YDKA 2A2PA 3DMLA 3LYPA 1YKCA 1ERUA 3CRUA 4CY6A 2HRNA 3IAS2 2QKEA 1Y25A 1O73A 1T7PB 2CV4A 4TVEA 3FHKA 4MP4A 4NV5A 2CVKA 3KH7A 4V2NA 3TJKA 4F9ZA 2YP6A 2LKUA 2RM6A 4IS0A 2I1UA 4FH8A 3D4TA 1HNAA 2DBCA 5J3RA 1JFUA 2CAQA 1V58A 4KSMA 1HNBA 5DDLA 1F2EA 3VWUA 4HOJA 5F07A 4MPFA 1GUHA 1JZRA 1M2AA 3EC3A 2QA2A 2P5QA 2R37A 5C00A 3QD9A 4DSSB 1AC1A 3APQA 4PTSA 3W6GA 1AXDA 3LG6A 2VL9A 2O89A 4X1UA 3BCIA 4ZB9A 4MMMA 5LD0A 2UZ8A 1THXA 2VOCA 2WS2A 3ZVJA 2VIMA 3A2VA 4PX1A 1ACVA 2YWOA 6GSYA 1V40A 2LS5A 2MBTA 1GUMA 3TKSA 2H1DA 2YJHA 18GSA 3HVVA 3QAWA 2OBIA 1SJ6A 5CYYA 1ZL9A 6GSXA 2VL3A 1GRXA 2VAFA 5J4UA 1A0FA 4HJ2A 2DJ3A 2WDUA 1VGLA 4KX4A 2TRCP 3F3QA 3KTBA 2YNXA 1T1VA 3IC4A 4HDEA 3WT1A 3KGKA 5ECKB 1GP1A 2F8FA 3GL5A 2PU9C 3GKMA 4RI7A 2VUPA 3EU3A 4EDZA 3H1NA 2DKIA 3H93A 2H6XA 3I69A 1PX7A 4XIHA 2A4VA 3CYNA 4USSA 1FB6A 2AAWA 2LRNA 3UMAA 5ID2A 4IQ1A 4POMA 1ABAA 6GSSA 4MNNA 1O85A 4XS6A 1TTZA 2O8VB 3C1RA 4K7OA 1OE7A 2C0EA 4G0KA 5CRWA 1BAYA 3KIJA 2VCWA 2MMOA 4TW5A 3EINA 4OFMA 1V57A 4JZQA 5G30A 2O7KA 1EZKA 2HZFA 3UVTA 2YPMA 1LJRA 2GTUA 3G7YA 4V1Ap 3I9V2 4MZCA 3US3A 4QL7A 3HCZA 4PXOA 1A2LA 3HXSA 4HEA2 1R26A 5CRHA 2CZ3A 3DVWA 2OADA 5FHIA 4KA0A 2CX4A 1TI1A 3KM6A 2PMTA 4EC0A 4JR4A 2QA1A 4POLA 2H0GA 3D22A 2FWFA 2ON5A 4N11A 2JZTA 3TKPA 1J0FA 3EU4A 3R2QA 5AN1A 4XCSA 1LBKA 3UAPA 1U3AA 4DVCA 12GSA 2HYXA 1OE8A 1WP0A 3GTUB 2H75A 1OYJA 3WGXA 4JR6A 4NPBA 4XRDA 2H76A 1A2JA 2C8UA 5JCGA 3HHVA 3H79A 4FO5A 1B9XC 1GNWA 3QAGA 3VI7A 2RUEA 2PVOC 4TR1B 3EMPA 3MNGA 1I9DA 1SENA 2X99A 4FYUA 3HJPA 1R5PA 5EPFA 2K8VA 5DCGA 2VM1A 1F3BA 3DYRA 4BA7A 5D73A 2HE3A 3FW2A 1M9BA 2B7JA 1ZMAA 2OACA 3GIXA 1FAAA 2F3MA 2I3YA 2WGRA 3CSJA 4GCIA 4Z2TA 3M9KA 3NOFA 4MJEA 2IMEA 4WR5A 2IJYA 2GVPA 5C04A 4N10A 2H1AA 2WCIA 5DQSA 4N0ZA 1C72A 2CQ9A 4KDUA 3MAKA 4ZBAA 2L5LA 2X64A 4HU7A 3C73A 2FA8A 1JZOA 4MJBA 1ON4A 2K18A 1V2AA 14GSA 4MA9A 2HI7A 3IHGA 1Q4JA 2VL2C 4TR4A 4NXIA 3KP9A 5GZZB 5AIXA 3LYKA 3QMXA 5DJLA 3VI5A 4WBJA 2VD1A 4EVMA 5KOXA 4YQMA 2L57A 2CT6A 3D0ZA 3R3EA 1WRYA 2DMMA 5GSSA 5CAXA 4WXTA 2YCDA 1MD3A 2TRXA 2MMAA 3M1GA 3GTUA 4EO3A 1QFNA 2YZUA 2C4JA 3APOA 2A4HA 2LV3A 1DE2A 1YEXA 5ECQB 1TOFA 4O5UA 5DQYA 1G6YA 2OE1A 5KN0A 1ZOFA 1S3CA 2B5EA 1TP9A 3P90A 1M2BA 1GSEA 4GLTA 2IPAA 4NHZA 3A2XA 4TOPA 2IIYA 1X5CA 2DJJA 3ZFLA 1SKSB 4F0CA 1Z7PA 1YF0A 4EDYA 1TRUA 5A5KA 4I5QA 3DGQA 4KCAA 5IO0A 5J9BA 3L9VA 3Q74A 4KNDA 3F63A 2HRFA 2OKAA 5G5EA 4I6XA 4YQVA 3QCPA 5ECSA 5F05A 3VWXA 3TRPA 1V9WA 3FR3A 2QC7A 3WGEA 3TKRA 4RQXA 4AJ7A 4HUAA 3HJMA 3TJJA 1ZCPA 3PINA 4PNGA 2RUFA 3GH6A 4ACSA 2MYGA 2I4AA 4YH2A 1M2DA 3IHQA 2B6MA 5LCZA 5HFGA 1XWKA 4ML6A 5E59A 2XC2A 3VWVA 4XS4A 4K2XA 4PUFC 1YQ1A 1GTAA 1J08A 1EGOA 2J9HA 1PX6A 3E9JB 2B1KA 2E0QA 3L4NA 4E8HA 2DSAA 1H4OA 2C3QA 4G19A 5KN1A 2F8AA 4EUYA 1M99A 1BG5A 5KEJA 1MDIA 4OCFA 3WD6A 3BD2A 3IDVA 1U88A 1K3YA 1V98A 5FWGA 3ERFA 1J9BA 1S3DA 2PN8A 3IR4A 4MH2A 1K0NA 4JU5A 2RIIA 2AYTA 3ZL5A 4ZL8A 2JZRA 2LNSA 3VPTA 1Q98A 5B8BA 4PGTA 3RHCA 1K0AA 5A4VA 1DE1A 4NHWA 3BJ5A 3TKSE 3TB2A 4BVYB 2QGVA 4HZ4A 3ZFBA 2H01A 1XW9A 3CSIA 2B7KA 5DAKB 6GSVA 5KN2A 1MEKA 4ECJA 3UEMA 2DIZA 5EY6A 1XXUA 4WF4A 4LL4B 1WIKA 4WR4A 2LQOA 3SBCA 4KDYA 4QL9A 2MBSA 1W4VA 2VCTA 3APSA 4GF0A 2XBIA 2AB6A 5HR1A 4ECCA 1A0RP 1B4QA 4WF5A 1HQOA 3F4RA 3FK8A 2FWEA 4MZBA 1O8XA 2LRTA 5INYA 2BTOT 3M0FA 4EL1A 4XTSA 5IOWA 4EXJA 3I43A 2J23A 4K0NA 2L6CA 4WETA 4KGIA 2Z9SA 5HQPA 3DWVA 4ZBDA 2OE3A 4GSSA 1G7OA 2A2SA 3GNJA 5H5SA 4FQUA 2QSIA 3GURA 2P0GA 2C3NA 3PPUA 2XHFA 2IWTA 3A5WA 1PN9A 3TCOA 2B5XA 3UIWA 1XZOA 2HSYA 1SU9A 1Z6NA 1SKWB 3A5IA 2A2RA 3MWHA 1FB0A 1GTIA 4DSRA 3ZTLA 4ZILA 1JHBA 1EGRA 1XVQA 5IPHA 4G10A 3RHBA 1Z9HA 4BVYA 2R3XA 1E6BA 1K0DA 1XWCA 4CY8A 5DAKA 3Q6OA 3MDKA 1AUCA 2NBSA 1OC9B 1QXHA 4O7HA 4D73A 3UL3A 3J7Yk 4GTUA 1GH2A 1UC7A 1YZXA 2JADA 3ERWA 2GLRA 1K3OA 5ABRA 2H1BA 2X8HA 3NIVA 1XPVA 1A2MA 1O81A 5B6NA 2ALBA 2CZ2A 3F6FA 9GSSA 1BX9A 1JZDA 3J7Yb 2MMZA 3KMNA 1B8XA 2FCHA 5CREA 5JWQB 1QUWA 1VF2A 5G5FA 2VCZA 3TJBA 3KTLA 3FEUA 3ISOA 2OBKA 4GQFA 1XCCA 2CVBA 3VLNA 3D4MA 5FT3A 1TI3A 2VLVA 1FG4A 1VF1A 1OAZA 2LTKA 2FLSA 2DC5A 2I81A 3O3TA 1R5AA 3C7MA 5G2ZA 2M72A 1Y6EA 4P3YB 4NAXA 3VURA 2DJKA 4YQUA 3RPNA 3ZIVA 4ZB8A 4POBA 4MDCA 1SYXA 2XPDA 5DCHA 3GRXA 1JLWA 3TOTA 5ELGA 1ZYNA 4HI7A 4O32A 1ERVA 3HY2A 5LNKe 2NTOA 1JLVA 4DSQA 2KLXA 3FZ5A 4K2DA 4IW9A 4Z2UA 3HJOA 5KN3A 1SJIA 3KD0A 4HJMA 4MCUA 1XVWA 2DJ1A 2JSZA 4DSSA 1NSWA 4YKGA 1G6WA 1K0MA 4MF5A 5AGYA 3QOUA 1SL2B 4V2MA 3IOSA 4ILFA 2PVQA 2OJLA 1TU7A 5J5NA 4KCEA 1SD9A 3CMIA 5ECMB 5HR2A 2V32A 4TXOB 1OVNA 4GSTA 1JZWA 1AQXA 1PL1A 3PGTA 2B3SA 1SK0A 4O5RA 5D9VA 5IMZA 2ZNMA 3LSZA 3U5RE 3ZMKA 2R5GA 1HNCA 2M80A 5D9WA 1GULA 1VF4A 4PURA 4MF6A 4MJAA 3GN3A 3VPQA 5A4UA 2H8LA 4MH3A 2FA4A 2M46A 3HD5A 2G2QA 1PKZA 1PL2A 3EURA 3L9SA 1XIYA 4K5RA 5DJMA 2C0GA 1B48A 1PN0A 2YWNA 1Z5YE 1K0BA 3GMFA 4IJ3A 3LEFA 2X49A 3QDNA 2LQQA 4AJ6A 1Z6MA 2YN1A 1GL8A 22GSA 4YAPA 5B7CA 1XBSA 2JSYA 4GXZA 2P31A 2AJQB 4G9HA 2GZZA 3V1WA 3M8NA 2O87A 2L5OA 2O85A 3FZ4A 4L5LA 1FVKA 3KH9A 2C0DA 3IK9A 4TXOA 5CRDA 2CX3A 2WRTA 1FO5A 2PBJA 4K1FA 4O5QA 2JZSA 2LJRA 1YEPA 1VRSD 2V6KA 2GQLA 1ST9A 2DJ2A 4N0VA 4I2UA 2GT5A 5J9CA 1PSQA 1FW1A 2D2ZA 3L9UA 4LLRA 4IP6A 3GKKA 2V1MA 2KUCA 3DIEA 1T8EB 5EVOA 2PERA 1RW1A 1WE0A 3GFKA 2AUVA 3HZ8A 1FOHA 1ZGNA 3AY8A 1DBYA 2IMFA 3A2WA 2FUG2 4F03A 3FYGA 2H6YA 1KTEA 5IMAA 4MZWA 5IOXA 1OKTA 2MZCA 2HT9A 2LJKA 3ZIJA 3CTGA 13GSA 3IBHA 4OFNA 1PKWA 3HYPA 2EIRA 2GDRA 3CBUA 3LW9A 1FOVA 4LL1B 2FNOA 3WT2A 2LNTA 1THOA 5CRGA 2XPEA 3DVXA 2HSMA 3IV4A 2L6DA 1XOAA 1PA3A 4TR1A 3EWLA 1MTCA 4HZ2A 5D9TA 5DVBA 1G0TA 5IM9A 2TIRA 2KP1A 3LGCA 2K9FA 2K8SA 5HFKA 4POKA 4X43A 3DRNA 4Q5RA 2DIYA 4G2EA 4I2TA 4TXVA 4IP1A 1SJZA 1ERWA 1QGVA 2HZEB 19GSA 3D21A 1A8LA 2EIOA 2WJUA 3FR9A 1NHOA 5H5QA 5IIZA 2B1LA 1XW6A 1EOHA 4EIQA 1GLQA 2H6ZA 5DALB 4F82A 3LORA 3D5JA 4WEYA 3IE3A 1GTUA 2DLXA 4K9ZA 1X9MB 5DBQA 1DUGA 1RK4A 1U87A 4FIWA 4WKWA 1PMTA 3KXOA 3PH9A 4ISDA 1URMA 1MDJA 4F2IA 4J2FA 1MDKA 1R4WA 1GUKA 3QFAC 4ZIJA 1GTBA 2IMDA 3VK9A 4I97A 5AIVA 1O8WA 2VCQA 3ME8A 5GAPD 3ZITA 3CXGA 4LMWA 3P7XA 4BWSA 4A5PA 4N30A 2PWJA 1PGTA 4HQZA 1X5EA 5H5RA 3H4KA 2HSHA 3GL3A 4OO4A 3UBKA 4ECBA 4F0BA 1QQ2A 1OKDA 3TGZA 4XS1A 2HZEA 4K7IA 2YV9A 2C0FA 3GKXA 3UBLA 3UJ1A 3ZMLA 3HVSA 4IVFA 1EV4A 2NVLA 2VO4A 3FKFA 3F4SA 2DMLA 4LA1A 4HU9A 2VCVA 4GWRA 2VD0A 4XHMA 1AQVA 5DALA 3KZQA 3RDWA 3IA1A 17GSA 2V6OA 1WMJA 4PQIA 4K0GA 1SYRA 5ELAA 5E4WA 3WYWA 2GSTA 1GSUA 3GKNA 2GSQA 4BVXB 4MF7A 4CW9A 3MYDA 1TRVA 3OR5A 3KMOA 2N5BA 3UARA 3Q19A 4OO5A 4IKHA 2L59A 20GSA 3CSHA 1N8JA 2G0FA 4K8MA 2PUKC 3JCML 3F8UA 3UVHA 1NHYA 2BMXA 5ECNB 5ECHB 5A4WA 2YJ7A 2RLIA 1OC8A 3C8EA 3HKRA 3UOMA 5IMDA 1A8YA 6GSTA 5F8BA 3RAZA 3FY7A 2HRAA 4OCEA 10GSA 2E7PA 2FGXA 1AW9A 5G31A 2WFCA 2JACA 4ZBBA 1K0OA 2HFDA 4Z7XA 1TK5B 4Z2RA 4LMVA 3PR8A 4IQAA 4RUVA 1WOUA 1A24A 1F37A 2HRKA 1EP8A 3FZ9A 5HR3A 2R4VA 5AISA 4BL7B 1BJXA 3EMXA 1GSFA 4BWQA 1Z7RA 4MABA 1I5GA 4O92A 3F6DA 1EP7A 1Z3EA 3ZZXA 2JL4A 4J56E 4KAEA 4V1Ag 3FR6A 3G9BA 4TN8A 4BVXA 3MIXA 1TRSA 2H0IA 1T4ZA 3IK7A 2K6VA 2PPTA 3EE2A 2VLUA 3H8QA 2OE0A 3M3MA 3ZREA 4NWYA 1MD4A 3KCMA 2YWIA 2H72A 1XWGA 3G7JA 4MPGA 5ID2B 3LQ7A 3VFIA 4KE3A 1SK1A 1T4YA 1EV9A 3L78A 3TJFA 4HS1A 2WULA 2H70A 5L71A 2X8GA 1XOBA 5JWOB 3M9JA 3IRAA 2VCXA 2RM5A 6GSWA 2YV7A 4ECIA 3O6TA 2R0GA 4ZXGA 4H86A 1TXXA 3IXRA 3K8NA 2C80A 2ON7A 2ZUPA 4RI6A 5GSTA 1VF3A 4KH7A 1RQMA 3W8JA 4IGJA 2KOKA 4MK3A 4OWYA 1DSBA 4CDOA 3F4TA 1K0CA 1YF1A 4BL7A 1M7TA 2YOIA 1GSSA 3BCKA 3TOUA 5B8AA 3F9UA 4OFTA 11GSA 2DKHA 1EEJA 5CNWA 4GSNA 2R6KA 1OC9A 3LFLA 4KF9A 4IN0A 5ENUA 3ED3A 2H73A 4TR3A 1EWXA 3LWAA 1EEMA 4TR0A 5COHA 1G7EA 3HZ4A 1F9MA 1O7UA 1SL0B 1SL1B 2FWHA 5ECPB 1TKDB 4IJIA 2IMKA 1NM3A 5IO2A 5IMCA 3CRTA 4ZL9A 3GHAA 1GWCA 2NPBA 16GSA 2R0PA 1UN2A 1BQ7A 5IMVA 2VL2A 1LU4A 4PQ1A 1XFLA 1WWJA 2H30A 3GYKA 3TUEA 1TU8A 2GZPA 4I8BA 2V2GA 3TRQA 1UVZA 3BOAA 4EKZA 1R7HA 5HFIA 1GSDA 4WBRD 3TKQA 1USBA 2F9SA 4PQHA 4ML1A 3GSTA 2GS3A 2X8CA 2HXKA 2XBQA 3TRXA 2CAIA 5KOWA 3EYTA 4ZL7A 5IPGA 3FRCA 1PRXA 4EF0A 1A23A 3SWLA 2KP2A 1BEDA 5JWRB 2LEGA 3A3TA 2I9HA 3ZLPA 2E2MA 1GSQA 3ERGA 5CO3A 3TKSC 3ME7A 5BRTA 1YKAA 4QQ7A 2H1GA 7GSSA 2ES7A 4XRAA 3NZNA 1ZYPA 2CA8A 5D93A 3E0UA 1XWBA 3FZAA 3GX8A 3TJGA 4RQRA 6GSUA 4X0XA 2WZ9A 4ZB6A 4L5OA 4Q5NA 4L8EA 1GSYA 2BJXA 1N2AA 5J41A 2EC4A 1M0UA 2C1YA 4KB3A 4KW6A 2FHEA 2B5YA 3IPZA 4OMVA 2IN3A 2FY6A 3P2AA 1UA5A 1TK0B 1HYUA 3KEBA 4L0UA 4ULXA 1TW9A 2AHEA 1TJDA 3W8SA 2LRCA 3F0IA 3EPTA 1TDIA 1QK8A 1XW5A 1OC3A 4YAVA 1GNEA 1B9YC 1WPIA 4KSOA 3GA4A 3LJRA 2GSRA 3CTFA 1SD8A 1B4PA 3GX0A 1IYIA 3RBTA 4FYCA 1GLPA 2GQKA 2NDOA 2DJ0A 1F3AA 3GV1A 5F0GA 2KHPA 4GRFA 4IELA 1WJKA 1YJ6A 1KEBA 3GUSA 1AAZA 4K5SA 2CVDA 3S9FA 3WGDA 5G1KA 1EOGA 5HR0A 4KUNA 5IQYA 1FHEA 2R2JA 1X5DA 3Q18A 2IFQB 4OD7A 4FYBA 2OA7A 4KDXA 1W89A 5ECLB 5G1LA 5IMFA 5GAND 4XS4B 2HNLA 4MJCA 2GZYA 1PQNA 5CP1A 4BPYA 2IMIA 4NV2A 4IBPA 2P5RA 4Q5QA 5B6MA 2GT6A 3ZVJD 3QPMA 4Q5FA 3DXBA 3F3RA 2ZCTA 3TDGA 4JE1A 4G0LA 3HVXA 1F6MC 2VM2A 3E3EA 3N5OA 1QMVA 4YKFA 1S3AA 1H75A 5ECOB 4E8EA 4NMUA 1FVJA 1T3BA 2REMA 4EE0A 3QFBC 2YANA 4CHSA 1KBNA 5EL8A 4ICYA 3KP8A 3KJYA 3GSSA 5JCWA 3ZYWA 3EVIA 2E2GA 2GSSA 3O76A 4L0WA 4JRRA 3VWWA 2N5AA 4HQSA 2H71A 1IYHA 4V2LA 3DD3A 1ILOA 2YZHA 3QR6A 1KNGA 2IL3A 2LUSA 2IFQA 1U6TA 3LXZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ERT A;  5ECI B;  1XWA A;  1U3I A;  4AF2 A;  1AQW A;  2YWM A;  2MMN A;  1ZYE A;  4DEJ A;  1TRW A;  2WB9 A;  3N9J A;  1M9A A;  3HDC A;  2L4Q A;  1YY7 A;  2VLT A;  2AV4 A;  3P8W A;  5JCU A;  1AIU A;  2JU5 A;  2H74 A;  3ZRD A;  3D6I A;  3DKS A;  2PGT A;  1ML6 A;  2H0H A;  3MSZ A;  4AJ8 A;  3C1S A;  2LJA A;  4PNF A;  4K7N A;  1CQG A;  1PD2 1;  2LST A;  3QAV A;  3C71 A;  3DEX A;  1O6J A;  2FD3 A;  1T00 A;  1SK2 A;  2H66 A;  5ECR B;  4TRX A;  1SKR B;  8GSS A;  2V41 A;  3GH9 A;  1ZZY A;  5D9X A;  4GQC A;  1ZYQ B;  5D8I A;  2F51 A;  2HLS A;  4J57 E;  1BYE A;  3HA9 A;  1X9S B;  5D96 A;  2H19 A;  3BBY A;  1TK8 B;  4D73 B;  1NW2 A;  1X9W B;  2C3T A;  1HD2 A;  3I6A A;  4IHU A;  2GQM A;  2L4C A;  1E2Y A;  4MLY A;  4K6X A;  2FWG A;  4JED A;  5F06 A;  4JBB A;  1CQH A;  4PUA A;  3L0H A;  3LXT A;  1K3L A;  3G7I A;  2EIQ A;  2GGT A;  1X0R A;  2N5F A;  3RPP A;  3IAM 2;  4TKY A;  3U6V A;  4AGS A;  4ID0 A;  1YDK A;  3DML A;  3LYP A;  1YKC A;  1ERU A;  3CRU A;  2HRN A;  3IAS 2;  2QKE A;  1Y25 A;  1O73 A;  1T7P B;  2CV4 A;  4TVE A;  3FHK A;  4MP4 A;  4NV5 A;  2CVK A;  3KH7 A;  4V2N A;  3TJK A;  4F9Z A;  2YP6 A;  2LKU A;  2RM6 A;  4IS0 A;  2I1U A;  4FH8 A;  3D4T A;  1HNA A;  2DBC A;  5J3R A;  1JFU A;  2CAQ A;  1V58 A;  4KSM A;  1HNB A;  5DDL A;  1F2E A;  3VWU A;  4HOJ A;  5F07 A;  1GUH A;  1JZR A;  3EC3 A;  1M2A A;  4MPF A;  2R37 A;  2P5Q A;  5C00 A;  3QD9 A;  4DSS B;  1AC1 A;  3APQ A;  3W6G A;  1AXD A;  3LG6 A;  2VL9 A;  2O89 A;  4X1U A;  3BCI A;  4ZB9 A;  4MMM A;  5LD0 A;  1THX A;  2VOC A;  2WS2 A;  3ZVJ A;  2VIM A;  3A2V A;  4PX1 A;  1ACV A;  2YWO A;  6GSY A;  1V40 A;  2LS5 A;  2MBT A;  1GUM A;  3TKS A;  2H1D A;  2YJH A;  18GS A;  3HVV A;  3QAW A;  2OBI A;  1SJ6 A;  5CYY A;  1ZL9 A;  6GSX A;  2VL3 A;  1GRX A;  2VAF A;  5J4U A;  1A0F A;  4HJ2 A;  2DJ3 A;  2WDU A;  1VGL A;  4KX4 A;  2TRC P;  3F3Q A;  3KTB A;  2YNX A;  1T1V A;  3IC4 A;  4HDE A;  3WT1 A;  3KGK A;  5ECK B;  1GP1 A;  2F8F A;  3GL5 A;  2PU9 C;  3GKM A;  4RI7 A;  2VUP A;  3EU3 A;  4EDZ A;  3H1N A;  3H93 A;  2H6X A;  3I69 A;  1PX7 A;  4XIH A;  2A4V A;  3CYN A;  1FB6 A;  2AAW A;  2LRN A;  3UMA A;  5ID2 A;  4IQ1 A;  4POM A;  1ABA A;  6GSS A;  1O85 A;  4XS6 A;  1TTZ A;  2O8V B;  3C1R A;  4K7O A;  1OE7 A;  2C0E A;  5CRW A;  1BAY A;  3KIJ A;  2VCW A;  2MMO A;  4TW5 A;  3EIN A;  4OFM A;  1V57 A;  4JZQ A;  5G30 A;  2O7K A;  1EZK A;  2HZF A;  3UVT A;  2YPM A;  1LJR A;  2GTU A;  3G7Y A;  4V1A p;  3I9V 2;  4MZC A;  3US3 A;  4QL7 A;  3HCZ A;  4PXO A;  1A2L A;  3HXS A;  4HEA 2;  1R26 A;  5CRH A;  2CZ3 A;  3DVW A;  2OAD A;  5FHI A;  4KA0 A;  2CX4 A;  1TI1 A;  3KM6 A;  2PMT A;  4EC0 A;  4JR4 A;  4POL A;  2H0G A;  3D22 A;  2FWF A;  2ON5 A;  4N11 A;  2JZT A;  3TKP A;  1J0F A;  3EU4 A;  3R2Q A;  5AN1 A;  4XCS A;  1LBK A;  3UAP A;  1U3A A;  4DVC A;  12GS A;  2HYX A;  1OE8 A;  1WP0 A;  3GTU B;  2H75 A;  1OYJ A;  3WGX A;  4JR6 A;  4NPB A;  4XRD A;  2H76 A;  1A2J A;  2C8U A;  5JCG A;  3HHV A;  3H79 A;  4FO5 A;  1B9X C;  1GNW A;  3QAG A;  3VI7 A;  2RUE A;  2PVO C;  4TR1 B;  3EMP A;  3MNG A;  1I9D A;  1SEN A;  2X99 A;  4FYU A;  3HJP A;  1R5P A;  5EPF A;  2K8V A;  5DCG A;  2VM1 A;  1F3B A;  3DYR A;  4BA7 A;  5D73 A;  2HE3 A;  3FW2 A;  1M9B A;  2B7J A;  1ZMA A;  2OAC A;  3GIX A;  1FAA A;  2F3M A;  2I3Y A;  2WGR A;  3CSJ A;  4GCI A;  3M9K A;  3NOF A;  4MJE A;  2IME A;  4WR5 A;  2IJY A;  2GVP A;  5C04 A;  4N10 A;  2H1A A;  2WCI A;  5DQS A;  4N0Z A;  1C72 A;  2CQ9 A;  4KDU A;  3MAK A;  4ZBA A;  2L5L A;  2X64 A;  4HU7 A;  3C73 A;  2FA8 A;  1JZO A;  4MJB A;  1ON4 A;  2K18 A;  1V2A A;  14GS A;  4MA9 A;  2HI7 A;  1Q4J A;  2VL2 C;  4TR4 A;  4NXI A;  3KP9 A;  5GZZ B;  5AIX A;  3LYK A;  3QMX A;  5DJL A;  3VI5 A;  4WBJ A;  2VD1 A;  4EVM A;  4YQM A;  2L57 A;  2CT6 A;  3D0Z A;  1WRY A;  2DMM A;  5GSS A;  5CAX A;  4WXT A;  2YCD A;  1MD3 A;  2TRX A;  2MMA A;  3M1G A;  3GTU A;  4EO3 A;  1QFN A;  2YZU A;  2C4J A;  3APO A;  2LV3 A;  1DE2 A;  1YEX A;  5ECQ B;  1TOF A;  5DQY A;  1G6Y A;  2OE1 A;  5KN0 A;  1ZOF A;  1S3C A;  2B5E A;  1TP9 A;  3P90 A;  1M2B A;  1GSE A;  4GLT A;  2IPA A;  4NHZ A;  3A2X A;  4TOP A;  2IIY A;  1X5C A;  2DJJ A;  3ZFL A;  1SKS B;  4F0C A;  1Z7P A;  1YF0 A;  4EDY A;  1TRU A;  5A5K A;  4I5Q A;  3DGQ A;  4KCA A;  5IO0 A;  5J9B A;  3L9V A;  3Q74 A;  4KND A;  3F63 A;  2HRF A;  2OKA A;  5G5E A;  4I6X A;  4YQV A;  3QCP A;  5ECS A;  5F05 A;  3VWX A;  3TRP A;  1V9W A;  3FR3 A;  2QC7 A;  3WGE A;  3TKR A;  4RQX A;  4AJ7 A;  4HUA A;  3HJM A;  3TJJ A;  1ZCP A;  3PIN A;  4PNG A;  2RUF A;  3GH6 A;  4ACS A;  2MYG A;  2I4A A;  4YH2 A;  1M2D A;  3IHQ A;  2B6M A;  5LCZ A;  5HFG A;  1XWK A;  4ML6 A;  5E59 A;  2XC2 A;  3VWV A;  4XS4 A;  4PUF C;  1YQ1 A;  1GTA A;  1J08 A;  1EGO A;  2J9H A;  1PX6 A;  3E9J B;  2B1K A;  2E0Q A;  3L4N A;  4E8H A;  2DSA A;  1H4O A;  2C3Q A;  4G19 A;  5KN1 A;  2F8A A;  4EUY A;  1M99 A;  1BG5 A;  5KEJ A;  1MDI A;  4OCF A;  3WD6 A;  3BD2 A;  3IDV A;  1U88 A;  1K3Y A;  1V98 A;  5FWG A;  3ERF A;  1J9B A;  1S3D A;  2PN8 A;  3IR4 A;  4MH2 A;  1K0N A;  4JU5 A;  2RII A;  2AYT A;  3ZL5 A;  4ZL8 A;  2JZR A;  2LNS A;  3VPT A;  1Q98 A;  5B8B A;  4PGT A;  3RHC A;  1K0A A;  5A4V A;  1DE1 A;  4NHW A;  3BJ5 A;  3TKS E;  3TB2 A;  2QGV A;  4HZ4 A;  3ZFB A;  2H01 A;  1XW9 A;  3CSI A;  2B7K A;  5DAK B;  6GSV A;  5KN2 A;  1MEK A;  4ECJ A;  3UEM A;  2DIZ A;  5EY6 A;  1XXU A;  4WF4 A;  4LL4 B;  1WIK A;  4WR4 A;  2LQO A;  3SBC A;  4KDY A;  4QL9 A;  2MBS A;  1W4V A;  2VCT A;  3APS A;  4GF0 A;  2XBI A;  2AB6 A;  5HR1 A;  4ECC A;  1A0R P;  1B4Q A;  4WF5 A;  1HQO A;  3F4R A;  3FK8 A;  2FWE A;  4MZB A;  1O8X A;  2LRT A;  5INY A;  2BTO T;  3M0F A;  4EL1 A;  4XTS A;  5IOW A;  4EXJ A;  3I43 A;  2J23 A;  4K0N A;  2L6C A;  4WET A;  4KGI A;  2Z9S A;  5HQP A;  3DWV A;  4ZBD A;  2OE3 A;  4GSS A;  1G7O A;  2A2S A;  3GNJ A;  5H5S A;  2QSI A;  3GUR A;  2P0G A;  2C3N A;  2XHF A;  2IWT A;  3A5W A;  1PN9 A;  3TCO A;  2B5X A;  3UIW A;  1XZO A;  2HSY A;  1SU9 A;  1Z6N A;  1SKW B;  2A2R A;  3MWH A;  1FB0 A;  1GTI A;  4DSR A;  3ZTL A;  4ZIL A;  1JHB A;  1EGR A;  1XVQ A;  5IPH A;  4G10 A;  3RHB A;  1Z9H A;  4BVY A;  2R3X A;  1E6B A;  1K0D A;  1XWC A;  5DAK A;  3Q6O A;  3MDK A;  1AUC A;  2NBS A;  1OC9 B;  1QXH A;  4O7H A;  4D73 A;  3UL3 A;  3J7Y k;  4GTU A;  1GH2 A;  1UC7 A;  1YZX A;  2JAD A;  3ERW A;  2GLR A;  1K3O A;  5ABR A;  2H1B A;  2X8H A;  3NIV A;  1XPV A;  1A2M A;  1O81 A;  5B6N A;  2ALB A;  2CZ2 A;  3F6F A;  9GSS A;  1BX9 A;  1JZD A;  3J7Y b;  2MMZ A;  3KMN A;  1B8X A;  2FCH A;  5CRE A;  5JWQ B;  1QUW A;  1VF2 A;  5G5F A;  2VCZ A;  3TJB A;  3KTL A;  3FEU A;  3ISO A;  2OBK A;  4GQF A;  1XCC A;  2CVB A;  3VLN A;  3D4M A;  5FT3 A;  1TI3 A;  2VLV A;  1FG4 A;  1VF1 A;  1OAZ A;  2LTK A;  2FLS A;  2DC5 A;  2I81 A;  3O3T A;  1R5A A;  3C7M A;  5G2Z A;  2M72 A;  1Y6E A;  4P3Y B;  4NAX A;  3VUR A;  2DJK A;  4YQU A;  3RPN A;  3ZIV A;  4ZB8 A;  4POB A;  4MDC A;  1SYX A;  2XPD A;  5DCH A;  3GRX A;  1JLW A;  3TOT A;  5ELG A;  4HI7 A;  4O32 A;  1ERV A;  3HY2 A;  5LNK e;  2NTO A;  1JLV A;  4DSQ A;  2KLX A;  3FZ5 A;  4K2D A;  4IW9 A;  3HJO A;  5KN3 A;  1SJI A;  3KD0 A;  4HJM A;  4MCU A;  1XVW A;  2DJ1 A;  2JSZ A;  4DSS A;  1NSW A;  1G6W A;  1K0M A;  4MF5 A;  5AGY A;  3QOU A;  1SL2 B;  4V2M A;  3IOS A;  4ILF A;  2PVQ A;  2OJL A;  1TU7 A;  5J5N A;  4KCE A;  1SD9 A;  3CMI A;  5ECM B;  5HR2 A;  2V32 A;  4TXO B;  1OVN A;  4GST A;  1JZW A;  1AQX A;  1PL1 A;  3PGT A;  2B3S A;  1SK0 A;  4O5R A;  5D9V A;  5IMZ A;  2ZNM A;  3LSZ A;  3U5R E;  3ZMK A;  2R5G A;  1HNC A;  2M80 A;  5D9W A;  1GUL A;  1VF4 A;  4PUR A;  4MF6 A;  4MJA A;  3GN3 A;  3VPQ A;  5A4U A;  2H8L A;  4MH3 A;  2FA4 A;  2M46 A;  3HD5 A;  2G2Q A;  1PKZ A;  1PL2 A;  3EUR A;  3L9S A;  1XIY A;  5DJM A;  2C0G A;  1B48 A;  2YWN A;  1Z5Y E;  1K0B A;  3GMF A;  4IJ3 A;  3LEF A;  3QDN A;  2LQQ A;  4AJ6 A;  1Z6M A;  2YN1 A;  1GL8 A;  22GS A;  4YAP A;  5B7C A;  1XBS A;  2JSY A;  4GXZ A;  2P31 A;  2AJQ B;  4G9H A;  2GZZ A;  3V1W A;  3M8N A;  2O87 A;  2L5O A;  2O85 A;  3FZ4 A;  4L5L A;  1FVK A;  3KH9 A;  2C0D A;  3IK9 A;  4TXO A;  5CRD A;  2CX3 A;  2WRT A;  1FO5 A;  2PBJ A;  4K1F A;  2JZS A;  2LJR A;  1YEP A;  1VRS D;  2V6K A;  2GQL A;  1ST9 A;  2DJ2 A;  4N0V A;  4I2U A;  2GT5 A;  5J9C A;  1PSQ A;  1FW1 A;  2D2Z A;  3L9U A;  4LLR A;  4IP6 A;  3GKK A;  2V1M A;  2KUC A;  3DIE A;  1T8E B;  5EVO A;  2PER A;  1RW1 A;  1WE0 A;  3GFK A;  2AUV A;  3HZ8 A;  1ZGN A;  3AY8 A;  1DBY A;  2IMF A;  3A2W A;  2FUG 2;  4F03 A;  3FYG A;  2H6Y A;  1KTE A;  5IMA A;  4MZW A;  5IOX A;  1OKT A;  2MZC A;  2HT9 A;  2LJK A;  3ZIJ A;  3CTG A;  13GS A;  3IBH A;  4OFN A;  1PKW A;  3HYP A;  2EIR A;  2GDR A;  3CBU A;  1FOV A;  4LL1 B;  2FNO A;  3WT2 A;  2LNT A;  1THO A;  5CRG A;  2XPE A;  3DVX A;  3IV4 A;  2L6D A;  1XOA A;  1PA3 A;  4TR1 A;  3EWL A;  1MTC A;  4HZ2 A;  5D9T A;  5DVB A;  1G0T A;  5IM9 A;  2TIR A;  2KP1 A;  3LGC A;  2K9F A;  2K8S A;  5HFK A;  4POK A;  4X43 A;  3DRN A;  4Q5R A;  2DIY A;  4G2E A;  4I2T A;  4TXV A;  4IP1 A;  1SJZ A;  1ERW A;  1QGV A;  2HZE B;  19GS A;  3D21 A;  1A8L A;  2EIO A;  2WJU A;  3FR9 A;  1NHO A;  5H5Q A;  5IIZ A;  2B1L A;  1XW6 A;  1EOH A;  1GLQ A;  2H6Z A;  5DAL B;  4F82 A;  3LOR A;  3D5J A;  4WEY A;  3IE3 A;  1GTU A;  2DLX A;  4K9Z A;  1X9M B;  5DBQ A;  1DUG A;  1RK4 A;  1U87 A;  4FIW A;  4WKW A;  1PMT A;  3KXO A;  3PH9 A;  4ISD A;  1URM A;  1MDJ A;  4F2I A;  4J2F A;  1MDK A;  1R4W A;  1GUK A;  3QFA C;  4ZIJ A;  1GTB A;  2IMD A;  3VK9 A;  4I97 A;  5AIV A;  1O8W A;  2VCQ A;  3ME8 A;  5GAP D;  3ZIT A;  3CXG A;  4LMW A;  3P7X A;  4BWS A;  4N30 A;  2PWJ A;  1PGT A;  4HQZ A;  1X5E A;  5H5R A;  3H4K A;  2HSH A;  3GL3 A;  4OO4 A;  3UBK A;  4ECB A;  4F0B A;  1QQ2 A;  1OKD A;  3TGZ A;  4XS1 A;  2HZE A;  4K7I A;  2YV9 A;  2C0F A;  3GKX A;  3UBL A;  3UJ1 A;  3ZML A;  3HVS A;  4IVF A;  1EV4 A;  2NVL A;  2VO4 A;  3FKF A;  3F4S A;  2DML A;  4LA1 A;  4HU9 A;  2VCV A;  4GWR A;  2VD0 A;  4XHM A;  1AQV A;  5DAL A;  3KZQ A;  3RDW A;  3IA1 A;  17GS A;  2V6O A;  1WMJ A;  4PQI A;  4K0G A;  1SYR A;  5ELA A;  5E4W A;  3WYW A;  2GST A;  1GSU A;  3GKN A;  2GSQ A;  4MF7 A;  4CW9 A;  1TRV A;  3OR5 A;  3KMO A;  2N5B A;  3UAR A;  3Q19 A;  4OO5 A;  4IKH A;  2L59 A;  20GS A;  3CSH A;  1N8J A;  2G0F A;  4K8M A;  2PUK C;  3JCM L;  3F8U A;  3UVH A;  1NHY A;  2BMX A;  5ECN B;  5ECH B;  5A4W A;  2YJ7 A;  2RLI A;  1OC8 A;  3C8E A;  3HKR A;  3UOM A;  5IMD A;  1A8Y A;  6GST A;  5F8B A;  3RAZ A;  3FY7 A;  4OCE A;  10GS A;  2E7P A;  2FGX A;  1AW9 A;  5G31 A;  2WFC A;  2JAC A;  4ZBB A;  1K0O A;  2HFD A;  4Z7X A;  1TK5 B;  4LMV A;  3PR8 A;  4IQA A;  4RUV A;  1WOU A;  1A24 A;  1F37 A;  1EP8 A;  3FZ9 A;  5HR3 A;  2R4V A;  5AIS A;  1BJX A;  3EMX A;  1GSF A;  4BWQ A;  1Z7R A;  4MAB A;  1I5G A;  4O92 A;  3F6D A;  1EP7 A;  1Z3E A;  3ZZX A;  2JL4 A;  4J56 E;  4KAE A;  4V1A g;  3FR6 A;  3G9B A;  4TN8 A;  4BVX A;  1TRS A;  2H0I A;  1T4Z A;  3IK7 A;  2K6V A;  2PPT A;  3EE2 A;  2VLU A;  3H8Q A;  2OE0 A;  3M3M A;  3ZRE A;  4NWY A;  1MD4 A;  3KCM A;  2YWI A;  2H72 A;  1XWG A;  3G7J A;  4MPG A;  5ID2 B;  3LQ7 A;  3VFI A;  4KE3 A;  1SK1 A;  1T4Y A;  1EV9 A;  3L78 A;  3TJF A;  4HS1 A;  2WUL A;  2H70 A;  5L71 A;  2X8G A;  1XOB A;  5JWO B;  3M9J A;  3IRA A;  2VCX A;  2RM5 A;  6GSW A;  2YV7 A;  4ECI A;  3O6T A;  4ZXG A;  4H86 A;  1TXX A;  3IXR A;  3K8N A;  2C80 A;  2ON7 A;  2ZUP A;  4RI6 A;  5GST A;  1VF3 A;  4KH7 A;  1RQM A;  3W8J A;  4IGJ A;  2KOK A;  4MK3 A;  4OWY A;  1DSB A;  4CDO A;  3F4T A;  1K0C A;  1YF1 A;  4BL7 A;  1M7T A;  2YOI A;  1GSS A;  3BCK A;  3TOU A;  5B8A A;  3F9U A;  4OFT A;  11GS A;  1EEJ A;  5CNW A;  4GSN A;  2R6K A;  1OC9 A;  3LFL A;  4IN0 A;  5ENU A;  3ED3 A;  2H73 A;  4TR3 A;  1EWX A;  3LWA A;  1EEM A;  4TR0 A;  5COH A;  1G7E A;  3HZ4 A;  1F9M A;  1O7U A;  1SL0 B;  1SL1 B;  2FWH A;  5ECP B;  1TKD B;  4IJI A;  2IMK A;  1NM3 A;  5IO2 A;  5IMC A;  3CRT A;  4ZL9 A;  3GHA A;  1GWC A;  2NPB A;  16GS A;  1UN2 A;  1BQ7 A;  5IMV A;  2VL2 A;  1LU4 A;  4PQ1 A;  1XFL A;  1WWJ A;  2H30 A;  3GYK A;  3TUE A;  1TU8 A;  2GZP A;  4I8B A;  2V2G A;  3TRQ A;  1UVZ A;  3BOA A;  4EKZ A;  1R7H A;  5HFI A;  1GSD A;  4WBR D;  3TKQ A;  1USB A;  2F9S A;  4PQH A;  4ML1 A;  3GST A;  2GS3 A;  2X8C A;  2HXK A;  2XBQ A;  3TRX A;  2CAI A;  3EYT A;  4ZL7 A;  5IPG A;  3FRC A;  1PRX A;  4EF0 A;  1A23 A;  3SWL A;  2KP2 A;  1BED A;  5JWR B;  2LEG A;  3A3T A;  2I9H A;  3ZLP A;  2E2M A;  1GSQ A;  3ERG A;  5CO3 A;  3TKS C;  3ME7 A;  1YKA A;  4QQ7 A;  2H1G A;  7GSS A;  2ES7 A;  4XRA A;  3NZN A;  2CA8 A;  5D93 A;  3E0U A;  1XWB A;  3FZA A;  3GX8 A;  3TJG A;  4RQR A;  6GSU A;  4X0X A;  2WZ9 A;  4ZB6 A;  4L5O A;  4Q5N A;  4L8E A;  1GSY A;  2BJX A;  1N2A A;  5J41 A;  2EC4 A;  1M0U A;  2C1Y A;  4KB3 A;  4KW6 A;  2FHE A;  2B5Y A;  3IPZ A;  4OMV A;  2IN3 A;  2FY6 A;  3P2A A;  1UA5 A;  1TK0 B;  1HYU A;  3KEB A;  4L0U A;  4ULX A;  1TW9 A;  2AHE A;  1TJD A;  3W8S A;  2LRC A;  3F0I A;  1TDI A;  1QK8 A;  1XW5 A;  1OC3 A;  4YAV A;  1GNE A;  1B9Y C;  1WPI A;  4KSO A;  3GA4 A;  3LJR A;  2GSR A;  3CTF A;  1SD8 A;  1B4P A;  3GX0 A;  1IYI A;  3RBT A;  4FYC A;  1GLP A;  2GQK A;  2NDO A;  2DJ0 A;  1F3A A;  3GV1 A;  5F0G A;  2KHP A;  4GRF A;  4IEL A;  1WJK A;  1YJ6 A;  1KEB A;  3GUS A;  1AAZ A;  2CVD A;  3S9F A;  3WGD A;  5G1K A;  1EOG A;  5HR0 A;  4KUN A;  5IQY A;  1FHE A;  2R2J A;  1X5D A;  3Q18 A;  2IFQ B;  4OD7 A;  4FYB A;  2OA7 A;  4KDX A;  1W89 A;  5ECL B;  5G1L A;  5IMF A;  5GAN D;  4XS4 B;  2HNL A;  4MJC A;  2GZY A;  1PQN A;  5CP1 A;  4BPY A;  2IMI A;  4NV2 A;  4IBP A;  2P5R A;  4Q5Q A;  5B6M A;  2GT6 A;  3ZVJ D;  3QPM A;  4Q5F A;  3DXB A;  3F3R A;  2ZCT A;  3TDG A;  4JE1 A;  3HVX A;  1F6M C;  2VM2 A;  3E3E A;  3N5O A;  1QMV A;  1S3A A;  1H75 A;  5ECO B;  4E8E A;  4NMU A;  1FVJ A;  1T3B A;  2REM A;  4EE0 A;  3QFB C;  2YAN A;  4CHS A;  1KBN A;  5EL8 A;  3KP8 A;  3KJY A;  3GSS A;  5JCW A;  3ZYW A;  3EVI A;  2E2G A;  2GSS A;  3O76 A;  4L0W A;  4JRR A;  3VWW A;  2N5A A;  4HQS A;  2H71 A;  1IYH A;  4V2L A;  3DD3 A;  1ILO A;  2YZH A;  3QR6 A;  1KNG A;  2IL3 A;  2LUS A;  2IFQ A;  1U6T A;  3LXZ A; 
#chains in the Genus database with same CATH topology
 1ERT A;  5ECI B;  1XWA A;  1U3I A;  4AF2 A;  1AQW A;  3IC8 A;  2YWM A;  2MMN A;  1ZYE A;  4DEJ A;  1TRW A;  2WB9 A;  3N9J A;  1M9A A;  3HDC A;  2L4Q A;  1YY7 A;  3FMW A;  2VLT A;  2AV4 A;  3P8W A;  5JCU A;  1AIU A;  2JU5 A;  2H74 A;  3ZRD A;  3D6I A;  4BIK A;  3DKS A;  2PGT A;  1ML6 A;  2H0H A;  3MSZ A;  4AJ8 A;  3C1S A;  2LJA A;  4PNF A;  4K7N A;  1CQG A;  1PD2 1;  2LST A;  3QAV A;  3C71 A;  3DEX A;  1O6J A;  2FD3 A;  1T00 A;  1SK2 A;  2H66 A;  4X4J A;  5ECR B;  4TRX A;  1SKR B;  8GSS A;  2V41 A;  3GH9 A;  1ZZY A;  5D9X A;  4GQC A;  1ZYQ B;  5D8I A;  2F51 A;  2HLS A;  4J57 E;  5BMU A;  1BYE A;  3HA9 A;  1X9S B;  5D96 A;  2H19 A;  3BBY A;  1TK8 B;  4D73 B;  1NW2 A;  1X9W B;  2X4A A;  2C3T A;  1HD2 A;  3I6A A;  4IHU A;  2GQM A;  2L4C A;  1E2Y A;  4MLY A;  4G0I A;  4K6X A;  2FWG A;  4JED A;  5F06 A;  4JBB A;  1CQH A;  4PUA A;  3L0H A;  3LXT A;  1K3L A;  3G7I A;  2EIQ A;  2GGT A;  1X0R A;  2N5F A;  3RPP A;  4EIP A;  2R0C A;  3IAM 2;  4TKY A;  3U6V A;  4AGS A;  4ID0 A;  1YDK A;  2A2P A;  3DML A;  3LYP A;  1YKC A;  1ERU A;  3CRU A;  4CY6 A;  2HRN A;  3IAS 2;  2QKE A;  1M3I A;  1Y25 A;  1O73 A;  1T7P B;  2CV4 A;  4TVE A;  3FHK A;  4MP4 A;  4NV5 A;  2CVK A;  3KH7 A;  4V2N A;  3TJK A;  4F9Z A;  2YP6 A;  2LKU A;  2RM6 A;  4IS0 A;  2I1U A;  4FH8 A;  3D4T A;  1HNA A;  2DBC A;  5J3R A;  1JFU A;  2CAQ A;  1V58 A;  4KSM A;  1HNB A;  5DDL A;  1F2E A;  3VWU A;  4HOJ A;  5F07 A;  4MPF A;  1GUH A;  1JZR A;  1M2A A;  3EC3 A;  2QA2 A;  2P5Q A;  2R37 A;  5C00 A;  3QD9 A;  4DSS B;  1AC1 A;  3APQ A;  4PTS A;  3W6G A;  1AXD A;  3LG6 A;  2VL9 A;  2O89 A;  4X1U A;  3BCI A;  4ZB9 A;  4MMM A;  5LD0 A;  2UZ8 A;  1THX A;  2VOC A;  2WS2 A;  3ZVJ A;  2VIM A;  3A2V A;  4PX1 A;  1ACV A;  2YWO A;  6GSY A;  1V40 A;  2LS5 A;  2MBT A;  1GUM A;  3TKS A;  2H1D A;  2YJH A;  18GS A;  3HVV A;  3QAW A;  2OBI A;  1SJ6 A;  5CYY A;  1ZL9 A;  6GSX A;  2VL3 A;  1GRX A;  2VAF A;  5J4U A;  1A0F A;  4HJ2 A;  2DJ3 A;  2WDU A;  1VGL A;  4KX4 A;  2TRC P;  3F3Q A;  3KTB A;  2YNX A;  1T1V A;  3IC4 A;  4HDE A;  3WT1 A;  3KGK A;  5ECK B;  1GP1 A;  2F8F A;  3GL5 A;  2PU9 C;  3GKM A;  4RI7 A;  2VUP A;  3EU3 A;  4EDZ A;  3H1N A;  2DKI A;  3H93 A;  2H6X A;  1PFO A;  3I69 A;  1PX7 A;  4XIH A;  2A4V A;  3CYN A;  4USS A;  1FB6 A;  2AAW A;  2LRN A;  3UMA A;  5ID2 A;  4IQ1 A;  4POM A;  1ABA A;  6GSS A;  4MNN A;  1O85 A;  4XS6 A;  1TTZ A;  2O8V B;  3C1R A;  4K7O A;  1OE7 A;  2C0E A;  4G0K A;  5CRW A;  1BAY A;  3KIJ A;  2VCW A;  2MMO A;  4TW5 A;  3EIN A;  4OFM A;  1V57 A;  4JZQ A;  5G30 A;  2O7K A;  1EZK A;  2HZF A;  3UVT A;  2YPM A;  1LJR A;  2GTU A;  3G7Y A;  4V1A p;  3I9V 2;  4MZC A;  3US3 A;  4QL7 A;  3HCZ A;  4PXO A;  1A2L A;  3HXS A;  4HEA 2;  1R26 A;  5CRH A;  2CZ3 A;  3DVW A;  2OAD A;  5FHI A;  4KA0 A;  2CX4 A;  1TI1 A;  3KM6 A;  2PMT A;  4EC0 A;  4JR4 A;  2QA1 A;  4POL A;  2H0G A;  3D22 A;  2FWF A;  2ON5 A;  4N11 A;  2JZT A;  3TKP A;  1J0F A;  3EU4 A;  3R2Q A;  5AN1 A;  4XCS A;  1LBK A;  3UAP A;  1U3A A;  4DVC A;  12GS A;  2HYX A;  1OE8 A;  1WP0 A;  3GTU B;  2H75 A;  1OYJ A;  3WGX A;  4JR6 A;  4NPB A;  4XRD A;  2H76 A;  1A2J A;  2C8U A;  1S3R A;  5JCG A;  3HHV A;  3H79 A;  4FO5 A;  1B9X C;  1GNW A;  3QAG A;  3VI7 A;  2RUE A;  2PVO C;  4TR1 B;  3EMP A;  3MNG A;  1I9D A;  1SEN A;  2X99 A;  4FYU A;  3HJP A;  1R5P A;  5EPF A;  2K8V A;  5DCG A;  2VM1 A;  1F3B A;  3DYR A;  4BA7 A;  5D73 A;  2HE3 A;  3FW2 A;  1M9B A;  2B7J A;  1ZMA A;  2OAC A;  3GIX A;  1FAA A;  2F3M A;  2I3Y A;  2WGR A;  3CSJ A;  4GCI A;  4Z2T A;  3M9K A;  3NOF A;  4MJE A;  2IME A;  4WR5 A;  2IJY A;  2GVP A;  5C04 A;  4N10 A;  2H1A A;  2WCI A;  5DQS A;  4N0Z A;  1C72 A;  2CQ9 A;  4KDU A;  3MAK A;  4ZBA A;  2L5L A;  2X64 A;  4HU7 A;  3C73 A;  2FA8 A;  1JZO A;  4MJB A;  1ON4 A;  2K18 A;  1V2A A;  14GS A;  4MA9 A;  2HI7 A;  3IHG A;  1Q4J A;  2VL2 C;  4TR4 A;  4NXI A;  3KP9 A;  5GZZ B;  5AIX A;  3LYK A;  3QMX A;  5DJL A;  3VI5 A;  4WBJ A;  2VD1 A;  4EVM A;  5KOX A;  4YQM A;  2L57 A;  2CT6 A;  3D0Z A;  3R3E A;  1WRY A;  2DMM A;  5GSS A;  5CAX A;  4WXT A;  2YCD A;  1MD3 A;  2TRX A;  2MMA A;  3M1G A;  3GTU A;  4EO3 A;  1QFN A;  2YZU A;  2C4J A;  3APO A;  2A4H A;  2LV3 A;  1DE2 A;  1YEX A;  5ECQ B;  1TOF A;  4O5U A;  5DQY A;  1G6Y A;  2OE1 A;  5KN0 A;  1ZOF A;  1S3C A;  2B5E A;  1TP9 A;  3P90 A;  1M2B A;  1GSE A;  4GLT A;  2IPA A;  4NHZ A;  3A2X A;  4TOP A;  2IIY A;  1X5C A;  2DJJ A;  3ZFL A;  1SKS B;  4F0C A;  1Z7P A;  1YF0 A;  4EDY A;  1TRU A;  5A5K A;  4I5Q A;  3DGQ A;  4KCA A;  5IO0 A;  5J9B A;  3L9V A;  3Q74 A;  4KND A;  3F63 A;  2HRF A;  2OKA A;  5G5E A;  4I6X A;  4YQV A;  3QCP A;  5ECS A;  5F05 A;  3VWX A;  3TRP A;  1V9W A;  3FR3 A;  2QC7 A;  3WGE A;  3TKR A;  4RQX A;  4AJ7 A;  4HUA A;  3HJM A;  3TJJ A;  1ZCP A;  3PIN A;  4PNG A;  2RUF A;  3GH6 A;  4ACS A;  2MYG A;  2I4A A;  4YH2 A;  1M2D A;  3IHQ A;  2B6M A;  5LCZ A;  5HFG A;  1XWK A;  4ML6 A;  5E59 A;  2XC2 A;  3VWV A;  4XS4 A;  4K2X A;  4PUF C;  1YQ1 A;  1GTA A;  1J08 A;  1EGO A;  2J9H A;  1PX6 A;  3E9J B;  2B1K A;  2E0Q A;  3L4N A;  4E8H A;  2DSA A;  1H4O A;  2C3Q A;  4G19 A;  5KN1 A;  2F8A A;  4EUY A;  1M99 A;  1BG5 A;  5KEJ A;  1MDI A;  4OCF A;  3WD6 A;  3BD2 A;  3IDV A;  1U88 A;  1K3Y A;  1V98 A;  5FWG A;  3ERF A;  1J9B A;  1S3D A;  2PN8 A;  3IR4 A;  4MH2 A;  1K0N A;  4JU5 A;  2RII A;  2AYT A;  3ZL5 A;  4ZL8 A;  2JZR A;  2LNS A;  3VPT A;  1Q98 A;  5B8B A;  4PGT A;  3RHC A;  1K0A A;  5A4V A;  1DE1 A;  4NHW A;  3BJ5 A;  3TKS E;  3TB2 A;  4BVY B;  2QGV A;  4HZ4 A;  3ZFB A;  2H01 A;  1XW9 A;  3CSI A;  2B7K A;  5DAK B;  6GSV A;  5KN2 A;  1MEK A;  4ECJ A;  3UEM A;  2DIZ A;  5EY6 A;  1XXU A;  4WF4 A;  4LL4 B;  1WIK A;  4WR4 A;  2LQO A;  3SBC A;  4KDY A;  4QL9 A;  2MBS A;  1W4V A;  2VCT A;  3APS A;  4GF0 A;  2XBI A;  2AB6 A;  5HR1 A;  4ECC A;  1A0R P;  1B4Q A;  4WF5 A;  1HQO A;  3F4R A;  3FK8 A;  2FWE A;  4MZB A;  1O8X A;  2LRT A;  5INY A;  2BTO T;  3M0F A;  4EL1 A;  4XTS A;  5IOW A;  4EXJ A;  3I43 A;  2J23 A;  4K0N A;  2L6C A;  4WET A;  4KGI A;  2Z9S A;  5HQP A;  3DWV A;  4ZBD A;  2OE3 A;  4GSS A;  1G7O A;  2A2S A;  3GNJ A;  5H5S A;  4FQU A;  2QSI A;  3GUR A;  2P0G A;  2C3N A;  3PPU A;  2XHF A;  2IWT A;  3A5W A;  1PN9 A;  3TCO A;  2B5X A;  3UIW A;  1XZO A;  2HSY A;  1SU9 A;  1Z6N A;  1SKW B;  3A5I A;  2A2R A;  3MWH A;  1FB0 A;  1GTI A;  4DSR A;  3ZTL A;  4ZIL A;  1JHB A;  1EGR A;  1XVQ A;  5IPH A;  4G10 A;  3RHB A;  1Z9H A;  4BVY A;  2R3X A;  1E6B A;  1K0D A;  1XWC A;  4CY8 A;  5DAK A;  3Q6O A;  3MDK A;  1AUC A;  2NBS A;  1OC9 B;  1QXH A;  4O7H A;  4D73 A;  3UL3 A;  3J7Y k;  4GTU A;  1GH2 A;  1UC7 A;  1YZX A;  2JAD A;  3ERW A;  2GLR A;  1K3O A;  5ABR A;  2H1B A;  2X8H A;  3NIV A;  1XPV A;  1A2M A;  1O81 A;  5B6N A;  2ALB A;  2CZ2 A;  3F6F A;  9GSS A;  1BX9 A;  1JZD A;  3J7Y b;  3HVN A;  2MMZ A;  3KMN A;  1B8X A;  2FCH A;  5CRE A;  5JWQ B;  1QUW A;  1VF2 A;  5G5F A;  2VCZ A;  3TJB A;  3KTL A;  1M3J A;  3FEU A;  3ISO A;  2OBK A;  4GQF A;  1XCC A;  2CVB A;  3VLN A;  3D4M A;  5FT3 A;  1TI3 A;  2VLV A;  1FG4 A;  1VF1 A;  1OAZ A;  2LTK A;  2FLS A;  2DC5 A;  2I81 A;  3O3T A;  1R5A A;  3C7M A;  5G2Z A;  2M72 A;  1Y6E A;  4P3Y B;  4NAX A;  3VUR A;  2DJK A;  4YQU A;  3RPN A;  3ZIV A;  4ZB8 A;  4POB A;  4MDC A;  1SYX A;  2XPD A;  5DCH A;  3GRX A;  1JLW A;  3TOT A;  5ELG A;  1ZYN A;  4HI7 A;  4O32 A;  1ERV A;  3HY2 A;  5LNK e;  2NTO A;  1JLV A;  4DSQ A;  2KLX A;  3FZ5 A;  4K2D A;  4IW9 A;  4Z2U A;  3HJO A;  5KN3 A;  1SJI A;  3KD0 A;  4HJM A;  4MCU A;  1XVW A;  2DJ1 A;  2JSZ A;  4DSS A;  1NSW A;  4YKG A;  1G6W A;  1K0M A;  4MF5 A;  5AGY A;  3QOU A;  1SL2 B;  4V2M A;  3IOS A;  4ILF A;  2PVQ A;  2OJL A;  1TU7 A;  5J5N A;  4KCE A;  1SD9 A;  3CMI A;  5ECM B;  5HR2 A;  2V32 A;  4TXO B;  1OVN A;  4GST A;  1JZW A;  1AQX A;  1PL1 A;  3PGT A;  2B3S A;  1SK0 A;  4O5R A;  5D9V A;  5IMZ A;  2ZNM A;  3LSZ A;  3U5R E;  3ZMK A;  2R5G A;  1HNC A;  2M80 A;  5D9W A;  1GUL A;  1VF4 A;  4PUR A;  4MF6 A;  4MJA A;  3GN3 A;  3VPQ A;  5A4U A;  2H8L A;  4MH3 A;  2FA4 A;  2M46 A;  3HD5 A;  2G2Q A;  1PKZ A;  1PL2 A;  3EUR A;  3L9S A;  1XIY A;  4K5R A;  5DJM A;  2C0G A;  1B48 A;  1PN0 A;  2YWN A;  1Z5Y E;  1K0B A;  3GMF A;  4IJ3 A;  3LEF A;  2X49 A;  3QDN A;  2LQQ A;  4AJ6 A;  1Z6M A;  2YN1 A;  1GL8 A;  22GS A;  4YAP A;  5B7C A;  1XBS A;  2JSY A;  4GXZ A;  2P31 A;  2AJQ B;  4G9H A;  2GZZ A;  3V1W A;  3M8N A;  2O87 A;  2L5O A;  2O85 A;  3FZ4 A;  4L5L A;  1FVK A;  3KH9 A;  2C0D A;  3IK9 A;  4TXO A;  5CRD A;  2CX3 A;  2WRT A;  1FO5 A;  2PBJ A;  4K1F A;  4O5Q A;  2JZS A;  2LJR A;  1YEP A;  1VRS D;  2V6K A;  2GQL A;  1ST9 A;  2DJ2 A;  4N0V A;  4I2U A;  2GT5 A;  5J9C A;  1PSQ A;  1FW1 A;  2D2Z A;  3L9U A;  4LLR A;  4IP6 A;  3GKK A;  2V1M A;  2KUC A;  3DIE A;  1T8E B;  5EVO A;  2PER A;  1RW1 A;  1WE0 A;  3GFK A;  2AUV A;  3HZ8 A;  1FOH A;  1ZGN A;  3AY8 A;  1DBY A;  2IMF A;  3A2W A;  2FUG 2;  4F03 A;  3FYG A;  2H6Y A;  1KTE A;  5IMA A;  4MZW A;  5IOX A;  4HSC X;  1OKT A;  2MZC A;  2HT9 A;  2LJK A;  3ZIJ A;  3CTG A;  13GS A;  3IBH A;  4OFN A;  1PKW A;  3HYP A;  2EIR A;  2GDR A;  3CBU A;  3LW9 A;  1FOV A;  4LL1 B;  2FNO A;  3WT2 A;  2LNT A;  1THO A;  5CRG A;  2XPE A;  3DVX A;  2HSM A;  3IV4 A;  2L6D A;  1XOA A;  1PA3 A;  4TR1 A;  3EWL A;  1MTC A;  4HZ2 A;  5D9T A;  5DVB A;  1G0T A;  5IM9 A;  2TIR A;  2KP1 A;  3LGC A;  2K9F A;  2K8S A;  5HFK A;  4POK A;  4X43 A;  3DRN A;  4Q5R A;  2DIY A;  4G2E A;  4I2T A;  4TXV A;  4IP1 A;  1SJZ A;  1ERW A;  1QGV A;  2HZE B;  19GS A;  3D21 A;  1A8L A;  2EIO A;  2WJU A;  3FR9 A;  1NHO A;  5H5Q A;  5IIZ A;  2B1L A;  1XW6 A;  1EOH A;  4EIQ A;  1GLQ A;  2H6Z A;  5DAL B;  4F82 A;  3LOR A;  3D5J A;  4WEY A;  3IE3 A;  1GTU A;  2DLX A;  4K9Z A;  1X9M B;  5DBQ A;  1DUG A;  1RK4 A;  1U87 A;  4FIW A;  4WKW A;  1PMT A;  3KXO A;  3PH9 A;  4ISD A;  1URM A;  1MDJ A;  4F2I A;  4J2F A;  1MDK A;  1R4W A;  1GUK A;  3QFA C;  4ZIJ A;  1GTB A;  2IMD A;  3VK9 A;  4I97 A;  5AIV A;  1O8W A;  2VCQ A;  3ME8 A;  5GAP D;  3ZIT A;  3CXG A;  4LMW A;  3P7X A;  4BWS A;  4A5P A;  4N30 A;  2PWJ A;  1PGT A;  4HQZ A;  1X5E A;  5H5R A;  3H4K A;  2HSH A;  3GL3 A;  4OO4 A;  3UBK A;  4ECB A;  4F0B A;  1QQ2 A;  1OKD A;  3TGZ A;  4XS1 A;  2HZE A;  4K7I A;  2YV9 A;  2C0F A;  3GKX A;  3UBL A;  3UJ1 A;  3ZML A;  3HVS A;  4IVF A;  1EV4 A;  2NVL A;  2VO4 A;  3FKF A;  3F4S A;  2DML A;  4LA1 A;  4HU9 A;  2VCV A;  4GWR A;  2VD0 A;  4XHM A;  1AQV A;  5DAL A;  3KZQ A;  3RDW A;  3IA1 A;  17GS A;  2V6O A;  1WMJ A;  4PQI A;  4K0G A;  1SYR A;  5ELA A;  5E4W A;  3WYW A;  2GST A;  1GSU A;  3GKN A;  2GSQ A;  4BVX B;  4MF7 A;  4CW9 A;  3MYD A;  1TRV A;  3OR5 A;  3KMO A;  2N5B A;  3UAR A;  3Q19 A;  4OO5 A;  4IKH A;  2L59 A;  20GS A;  3CSH A;  1N8J A;  2G0F A;  4K8M A;  2PUK C;  3JCM L;  3F8U A;  3UVH A;  1NHY A;  2BMX A;  5ECN B;  5ECH B;  5A4W A;  2YJ7 A;  2RLI A;  1OC8 A;  3C8E A;  3HKR A;  3UOM A;  5IMD A;  1A8Y A;  6GST A;  5F8B A;  3RAZ A;  3FY7 A;  2HRA A;  4OCE A;  10GS A;  2E7P A;  2FGX A;  1AW9 A;  5G31 A;  2WFC A;  2JAC A;  4ZBB A;  1K0O A;  2HFD A;  4Z7X A;  1TK5 B;  4Z2R A;  4LMV A;  3PR8 A;  4IQA A;  4RUV A;  1WOU A;  1A24 A;  1F37 A;  2HRK A;  1EP8 A;  3FZ9 A;  5HR3 A;  2R4V A;  5AIS A;  4BL7 B;  1BJX A;  3EMX A;  1GSF A;  4BWQ A;  1Z7R A;  4MAB A;  1I5G A;  4O92 A;  3F6D A;  1EP7 A;  1Z3E A;  3ZZX A;  2JL4 A;  4J56 E;  4KAE A;  4V1A g;  3FR6 A;  1XG8 A;  3G9B A;  4TN8 A;  4BVX A;  3MIX A;  1TRS A;  2H0I A;  1T4Z A;  3IK7 A;  2K6V A;  2PPT A;  3EE2 A;  2VLU A;  3H8Q A;  2OE0 A;  3M3M A;  3ZRE A;  4NWY A;  1MD4 A;  3KCM A;  2YWI A;  2H72 A;  1XWG A;  3G7J A;  4MPG A;  5ID2 B;  3LQ7 A;  3VFI A;  4KE3 A;  1SK1 A;  1T4Y A;  1EV9 A;  3L78 A;  3TJF A;  4HS1 A;  2WUL A;  2H70 A;  5L71 A;  2X8G A;  1XOB A;  5JWO B;  3M9J A;  3IRA A;  2VCX A;  2RM5 A;  6GSW A;  2YV7 A;  4ECI A;  3O6T A;  2R0G A;  4ZXG A;  4H86 A;  1TXX A;  3IXR A;  3CQF A;  3K8N A;  2C80 A;  2ON7 A;  2ZUP A;  4RI6 A;  5GST A;  1VF3 A;  4KH7 A;  1RQM A;  3W8J A;  4IGJ A;  2KOK A;  4MK3 A;  4OWY A;  1DSB A;  4CDO A;  3F4T A;  1K0C A;  1YF1 A;  4BL7 A;  1M7T A;  2YOI A;  1GSS A;  3BCK A;  3TOU A;  5B8A A;  3F9U A;  4OFT A;  11GS A;  2DKH A;  1EEJ A;  5CNW A;  4GSN A;  2R6K A;  1OC9 A;  3LFL A;  4KF9 A;  4IN0 A;  5ENU A;  3ED3 A;  2H73 A;  4TR3 A;  1EWX A;  3LWA A;  1EEM A;  4TR0 A;  5COH A;  1G7E A;  3HZ4 A;  1F9M A;  1O7U A;  1SL0 B;  1SL1 B;  2FWH A;  5ECP B;  1TKD B;  4IJI A;  2IMK A;  1NM3 A;  5IO2 A;  5IMC A;  3CRT A;  4ZL9 A;  3GHA A;  1GWC A;  2NPB A;  16GS A;  2R0P A;  1UN2 A;  1BQ7 A;  5IMV A;  2VL2 A;  1LU4 A;  4PQ1 A;  1XFL A;  1WWJ A;  2H30 A;  3GYK A;  3TUE A;  1TU8 A;  2GZP A;  4I8B A;  2V2G A;  3TRQ A;  1UVZ A;  3BOA A;  4EKZ A;  1R7H A;  5HFI A;  1GSD A;  4WBR D;  3TKQ A;  1USB A;  2F9S A;  4PQH A;  4ML1 A;  3GST A;  2GS3 A;  2X8C A;  2HXK A;  2XBQ A;  3TRX A;  2CAI A;  5KOW A;  3EYT A;  4ZL7 A;  5IPG A;  3FRC A;  1PRX A;  4EF0 A;  1A23 A;  3SWL A;  2KP2 A;  1BED A;  5JWR B;  2LEG A;  3A3T A;  2I9H A;  3ZLP A;  2E2M A;  1GSQ A;  3ERG A;  5CO3 A;  3TKS C;  3ME7 A;  5BRT A;  1YKA A;  4QQ7 A;  2H1G A;  7GSS A;  2ES7 A;  4XRA A;  3NZN A;  1ZYP A;  2CA8 A;  5D93 A;  3E0U A;  1XWB A;  3FZA A;  3GX8 A;  3TJG A;  4RQR A;  6GSU A;  4X0X A;  2WZ9 A;  4ZB6 A;  4L5O A;  4Q5N A;  4L8E A;  1GSY A;  2BJX A;  1N2A A;  5J41 A;  2EC4 A;  1M0U A;  2C1Y A;  4KB3 A;  4KW6 A;  2FHE A;  2B5Y A;  3IPZ A;  4OMV A;  2IN3 A;  2FY6 A;  3P2A A;  1UA5 A;  1TK0 B;  1HYU A;  3KEB A;  4L0U A;  4ULX A;  1TW9 A;  2AHE A;  1TJD A;  3W8S A;  2LRC A;  3F0I A;  3EPT A;  1TDI A;  1QK8 A;  1XW5 A;  1OC3 A;  4YAV A;  1GNE A;  1B9Y C;  1WPI A;  4KSO A;  3GA4 A;  3LJR A;  2GSR A;  3CTF A;  1SD8 A;  1B4P A;  3GX0 A;  1IYI A;  3RBT A;  4FYC A;  1GLP A;  2GQK A;  2NDO A;  2DJ0 A;  1F3A A;  3GV1 A;  5F0G A;  2KHP A;  4GRF A;  4IEL A;  1WJK A;  1YJ6 A;  1KEB A;  3GUS A;  1AAZ A;  4K5S A;  2CVD A;  3S9F A;  3WGD A;  5G1K A;  1EOG A;  5HR0 A;  4KUN A;  5IQY A;  1FHE A;  2R2J A;  1X5D A;  3Q18 A;  2IFQ B;  4OD7 A;  4FYB A;  2OA7 A;  4KDX A;  1W89 A;  5ECL B;  5G1L A;  5IMF A;  5GAN D;  4XS4 B;  2HNL A;  4MJC A;  2GZY A;  1PQN A;  5CP1 A;  4BPY A;  2IMI A;  4NV2 A;  4IBP A;  2P5R A;  4Q5Q A;  5B6M A;  2GT6 A;  3ZVJ D;  3QPM A;  4Q5F A;  3DXB A;  3F3R A;  2ZCT A;  3TDG A;  4JE1 A;  4G0L A;  3HVX A;  1F6M C;  2VM2 A;  3E3E A;  3N5O A;  1QMV A;  4YKF A;  1S3A A;  1H75 A;  5ECO B;  4E8E A;  4NMU A;  1FVJ A;  1T3B A;  2REM A;  4EE0 A;  3QFB C;  2YAN A;  4CHS A;  1KBN A;  5EL8 A;  4ICY A;  3KP8 A;  3KJY A;  3GSS A;  5JCW A;  3ZYW A;  3EVI A;  2E2G A;  2GSS A;  3O76 A;  4L0W A;  4JRR A;  3VWW A;  2N5A A;  4HQS A;  2H71 A;  1IYH A;  4V2L A;  3DD3 A;  1ILO A;  2YZH A;  3QR6 A;  1KNG A;  2IL3 A;  2LUS A;  2IFQ A;  1U6T A;  3LXZ A; 
#chains in the Genus database with same CATH homology
 1ERT A;  5ECI B;  1XWA A;  1U3I A;  4AF2 A;  1AQW A;  3IC8 A;  2YWM A;  2MMN A;  1ZYE A;  4DEJ A;  1TRW A;  2WB9 A;  3N9J A;  1M9A A;  3HDC A;  2L4Q A;  1YY7 A;  3FMW A;  2VLT A;  2AV4 A;  3P8W A;  5JCU A;  1AIU A;  2JU5 A;  2H74 A;  3ZRD A;  3D6I A;  3DKS A;  2PGT A;  1ML6 A;  2H0H A;  3MSZ A;  4AJ8 A;  3C1S A;  2LJA A;  4PNF A;  4K7N A;  1CQG A;  1PD2 1;  2LST A;  3QAV A;  3C71 A;  3DEX A;  1O6J A;  2FD3 A;  1T00 A;  1SK2 A;  2H66 A;  4X4J A;  5ECR B;  4TRX A;  1SKR B;  8GSS A;  2V41 A;  3GH9 A;  1ZZY A;  5D9X A;  4GQC A;  1ZYQ B;  5D8I A;  2F51 A;  2HLS A;  4J57 E;  5BMU A;  1BYE A;  3HA9 A;  1X9S B;  5D96 A;  2H19 A;  3BBY A;  1TK8 B;  4D73 B;  1NW2 A;  1X9W B;  2X4A A;  2C3T A;  1HD2 A;  3I6A A;  4IHU A;  2GQM A;  2L4C A;  1E2Y A;  4MLY A;  4G0I A;  4K6X A;  2FWG A;  4JED A;  5F06 A;  4JBB A;  1CQH A;  4PUA A;  3L0H A;  3LXT A;  1K3L A;  3G7I A;  2EIQ A;  2GGT A;  1X0R A;  2N5F A;  3RPP A;  4EIP A;  2R0C A;  3IAM 2;  4TKY A;  3U6V A;  4AGS A;  4ID0 A;  1YDK A;  2A2P A;  3DML A;  3LYP A;  1YKC A;  1ERU A;  3CRU A;  4CY6 A;  2HRN A;  3IAS 2;  2QKE A;  1Y25 A;  1O73 A;  1T7P B;  2CV4 A;  4TVE A;  3FHK A;  4MP4 A;  4NV5 A;  2CVK A;  3KH7 A;  4V2N A;  3TJK A;  4F9Z A;  2YP6 A;  2LKU A;  2RM6 A;  4IS0 A;  2I1U A;  4FH8 A;  3D4T A;  1HNA A;  2DBC A;  5J3R A;  1JFU A;  2CAQ A;  1V58 A;  4KSM A;  1HNB A;  5DDL A;  1F2E A;  3VWU A;  4HOJ A;  5F07 A;  4MPF A;  1GUH A;  1JZR A;  1M2A A;  3EC3 A;  2QA2 A;  2P5Q A;  2R37 A;  5C00 A;  3QD9 A;  4DSS B;  1AC1 A;  3APQ A;  4PTS A;  3W6G A;  1AXD A;  3LG6 A;  2VL9 A;  2O89 A;  4X1U A;  3BCI A;  4ZB9 A;  4MMM A;  5LD0 A;  2UZ8 A;  1THX A;  2VOC A;  2WS2 A;  3ZVJ A;  2VIM A;  3A2V A;  4PX1 A;  1ACV A;  2YWO A;  6GSY A;  1V40 A;  2LS5 A;  2MBT A;  1GUM A;  3TKS A;  2H1D A;  2YJH A;  18GS A;  3HVV A;  3QAW A;  2OBI A;  1SJ6 A;  5CYY A;  1ZL9 A;  6GSX A;  2VL3 A;  1GRX A;  2VAF A;  5J4U A;  1A0F A;  4HJ2 A;  2DJ3 A;  2WDU A;  1VGL A;  4KX4 A;  2TRC P;  3F3Q A;  3KTB A;  2YNX A;  1T1V A;  3IC4 A;  4HDE A;  3WT1 A;  3KGK A;  5ECK B;  1GP1 A;  2F8F A;  3GL5 A;  2PU9 C;  3GKM A;  4RI7 A;  2VUP A;  3EU3 A;  4EDZ A;  3H1N A;  2DKI A;  3H93 A;  2H6X A;  3I69 A;  1PX7 A;  4XIH A;  2A4V A;  3CYN A;  4USS A;  1FB6 A;  2AAW A;  2LRN A;  3UMA A;  5ID2 A;  4IQ1 A;  4POM A;  1ABA A;  6GSS A;  4MNN A;  1O85 A;  4XS6 A;  1TTZ A;  2O8V B;  3C1R A;  4K7O A;  1OE7 A;  2C0E A;  4G0K A;  5CRW A;  1BAY A;  3KIJ A;  2VCW A;  2MMO A;  4TW5 A;  3EIN A;  4OFM A;  1V57 A;  4JZQ A;  5G30 A;  2O7K A;  1EZK A;  2HZF A;  3UVT A;  2YPM A;  1LJR A;  2GTU A;  3G7Y A;  4V1A p;  3I9V 2;  4MZC A;  3US3 A;  4QL7 A;  3HCZ A;  4PXO A;  1A2L A;  3HXS A;  4HEA 2;  1R26 A;  5CRH A;  2CZ3 A;  3DVW A;  2OAD A;  5FHI A;  4KA0 A;  2CX4 A;  1TI1 A;  3KM6 A;  2PMT A;  4EC0 A;  4JR4 A;  2QA1 A;  4POL A;  2H0G A;  3D22 A;  2FWF A;  2ON5 A;  4N11 A;  2JZT A;  3TKP A;  1J0F A;  3EU4 A;  3R2Q A;  5AN1 A;  4XCS A;  1LBK A;  3UAP A;  1U3A A;  4DVC A;  12GS A;  2HYX A;  1OE8 A;  1WP0 A;  3GTU B;  2H75 A;  1OYJ A;  3WGX A;  4JR6 A;  4NPB A;  4XRD A;  2H76 A;  1A2J A;  2C8U A;  5JCG A;  3HHV A;  3H79 A;  4FO5 A;  1B9X C;  1GNW A;  3QAG A;  3VI7 A;  2RUE A;  2PVO C;  4TR1 B;  3EMP A;  3MNG A;  1I9D A;  1SEN A;  2X99 A;  4FYU A;  3HJP A;  1R5P A;  5EPF A;  2K8V A;  5DCG A;  2VM1 A;  1F3B A;  3DYR A;  4BA7 A;  5D73 A;  2HE3 A;  3FW2 A;  1M9B A;  2B7J A;  1ZMA A;  2OAC A;  3GIX A;  1FAA A;  2F3M A;  2I3Y A;  2WGR A;  3CSJ A;  4GCI A;  4Z2T A;  3M9K A;  3NOF A;  4MJE A;  2IME A;  4WR5 A;  2IJY A;  2GVP A;  5C04 A;  4N10 A;  2H1A A;  2WCI A;  5DQS A;  4N0Z A;  1C72 A;  2CQ9 A;  4KDU A;  3MAK A;  4ZBA A;  2L5L A;  2X64 A;  4HU7 A;  3C73 A;  2FA8 A;  1JZO A;  4MJB A;  1ON4 A;  2K18 A;  1V2A A;  14GS A;  4MA9 A;  2HI7 A;  3IHG A;  1Q4J A;  2VL2 C;  4TR4 A;  4NXI A;  3KP9 A;  5GZZ B;  5AIX A;  3LYK A;  3QMX A;  5DJL A;  3VI5 A;  4WBJ A;  2VD1 A;  4EVM A;  5KOX A;  4YQM A;  2L57 A;  2CT6 A;  3D0Z A;  3R3E A;  1WRY A;  2DMM A;  5GSS A;  5CAX A;  4WXT A;  2YCD A;  1MD3 A;  2TRX A;  2MMA A;  3M1G A;  3GTU A;  4EO3 A;  1QFN A;  2YZU A;  2C4J A;  3APO A;  2A4H A;  2LV3 A;  1DE2 A;  1YEX A;  5ECQ B;  1TOF A;  4O5U A;  5DQY A;  1G6Y A;  2OE1 A;  5KN0 A;  1ZOF A;  1S3C A;  2B5E A;  1TP9 A;  3P90 A;  1M2B A;  1GSE A;  4GLT A;  2IPA A;  4NHZ A;  3A2X A;  4TOP A;  2IIY A;  1X5C A;  2DJJ A;  3ZFL A;  1SKS B;  4F0C A;  1Z7P A;  1YF0 A;  4EDY A;  1TRU A;  5A5K A;  4I5Q A;  3DGQ A;  4KCA A;  5IO0 A;  5J9B A;  3L9V A;  3Q74 A;  4KND A;  3F63 A;  2HRF A;  2OKA A;  5G5E A;  4I6X A;  4YQV A;  3QCP A;  5ECS A;  5F05 A;  3VWX A;  3TRP A;  1V9W A;  3FR3 A;  2QC7 A;  3WGE A;  3TKR A;  4RQX A;  4AJ7 A;  4HUA A;  3HJM A;  3TJJ A;  1ZCP A;  3PIN A;  4PNG A;  2RUF A;  3GH6 A;  4ACS A;  2MYG A;  2I4A A;  4YH2 A;  1M2D A;  3IHQ A;  2B6M A;  5LCZ A;  5HFG A;  1XWK A;  4ML6 A;  5E59 A;  2XC2 A;  3VWV A;  4XS4 A;  4K2X A;  4PUF C;  1YQ1 A;  1GTA A;  1J08 A;  1EGO A;  2J9H A;  1PX6 A;  3E9J B;  2B1K A;  2E0Q A;  3L4N A;  4E8H A;  2DSA A;  1H4O A;  2C3Q A;  4G19 A;  5KN1 A;  2F8A A;  4EUY A;  1M99 A;  1BG5 A;  5KEJ A;  1MDI A;  4OCF A;  3WD6 A;  3BD2 A;  3IDV A;  1U88 A;  1K3Y A;  1V98 A;  5FWG A;  3ERF A;  1J9B A;  1S3D A;  2PN8 A;  3IR4 A;  4MH2 A;  1K0N A;  4JU5 A;  2RII A;  2AYT A;  3ZL5 A;  4ZL8 A;  2JZR A;  2LNS A;  3VPT A;  1Q98 A;  5B8B A;  4PGT A;  3RHC A;  1K0A A;  5A4V A;  1DE1 A;  4NHW A;  3BJ5 A;  3TKS E;  3TB2 A;  4BVY B;  2QGV A;  4HZ4 A;  3ZFB A;  2H01 A;  1XW9 A;  3CSI A;  2B7K A;  5DAK B;  6GSV A;  5KN2 A;  1MEK A;  4ECJ A;  3UEM A;  2DIZ A;  5EY6 A;  1XXU A;  4WF4 A;  4LL4 B;  1WIK A;  4WR4 A;  2LQO A;  3SBC A;  4KDY A;  4QL9 A;  2MBS A;  1W4V A;  2VCT A;  3APS A;  4GF0 A;  2XBI A;  2AB6 A;  5HR1 A;  4ECC A;  1A0R P;  1B4Q A;  4WF5 A;  1HQO A;  3F4R A;  3FK8 A;  2FWE A;  4MZB A;  1O8X A;  2LRT A;  5INY A;  2BTO T;  3M0F A;  4EL1 A;  4XTS A;  5IOW A;  4EXJ A;  3I43 A;  2J23 A;  4K0N A;  2L6C A;  4WET A;  4KGI A;  2Z9S A;  5HQP A;  3DWV A;  4ZBD A;  2OE3 A;  4GSS A;  1G7O A;  2A2S A;  3GNJ A;  5H5S A;  4FQU A;  2QSI A;  3GUR A;  2P0G A;  2C3N A;  3PPU A;  2XHF A;  2IWT A;  3A5W A;  1PN9 A;  3TCO A;  2B5X A;  3UIW A;  1XZO A;  2HSY A;  1SU9 A;  1Z6N A;  1SKW B;  3A5I A;  2A2R A;  3MWH A;  1FB0 A;  1GTI A;  4DSR A;  3ZTL A;  4ZIL A;  1JHB A;  1EGR A;  1XVQ A;  5IPH A;  4G10 A;  3RHB A;  1Z9H A;  4BVY A;  2R3X A;  1E6B A;  1K0D A;  1XWC A;  4CY8 A;  5DAK A;  3Q6O A;  3MDK A;  1AUC A;  2NBS A;  1OC9 B;  1QXH A;  4O7H A;  4D73 A;  3UL3 A;  3J7Y k;  4GTU A;  1GH2 A;  1UC7 A;  1YZX A;  2JAD A;  3ERW A;  2GLR A;  1K3O A;  5ABR A;  2H1B A;  2X8H A;  3NIV A;  1XPV A;  1A2M A;  1O81 A;  5B6N A;  2ALB A;  2CZ2 A;  3F6F A;  9GSS A;  1BX9 A;  1JZD A;  3J7Y b;  2MMZ A;  3KMN A;  1B8X A;  2FCH A;  5CRE A;  5JWQ B;  1QUW A;  1VF2 A;  5G5F A;  2VCZ A;  3TJB A;  3KTL A;  3FEU A;  3ISO A;  2OBK A;  4GQF A;  1XCC A;  2CVB A;  3VLN A;  3D4M A;  5FT3 A;  1TI3 A;  2VLV A;  1FG4 A;  1VF1 A;  1OAZ A;  2LTK A;  2FLS A;  2DC5 A;  2I81 A;  3O3T A;  1R5A A;  3C7M A;  5G2Z A;  2M72 A;  1Y6E A;  4P3Y B;  4NAX A;  3VUR A;  2DJK A;  4YQU A;  3RPN A;  3ZIV A;  4ZB8 A;  4POB A;  4MDC A;  1SYX A;  2XPD A;  5DCH A;  3GRX A;  1JLW A;  3TOT A;  5ELG A;  1ZYN A;  4HI7 A;  4O32 A;  1ERV A;  3HY2 A;  5LNK e;  2NTO A;  1JLV A;  4DSQ A;  2KLX A;  3FZ5 A;  4K2D A;  4IW9 A;  4Z2U A;  3HJO A;  5KN3 A;  1SJI A;  3KD0 A;  4HJM A;  4MCU A;  1XVW A;  2DJ1 A;  2JSZ A;  4DSS A;  1NSW A;  4YKG A;  1G6W A;  1K0M A;  4MF5 A;  5AGY A;  3QOU A;  1SL2 B;  4V2M A;  3IOS A;  4ILF A;  2PVQ A;  2OJL A;  1TU7 A;  5J5N A;  4KCE A;  1SD9 A;  3CMI A;  5ECM B;  5HR2 A;  2V32 A;  4TXO B;  1OVN A;  4GST A;  1JZW A;  1AQX A;  1PL1 A;  3PGT A;  2B3S A;  1SK0 A;  4O5R A;  5D9V A;  5IMZ A;  2ZNM A;  3LSZ A;  3U5R E;  3ZMK A;  2R5G A;  1HNC A;  2M80 A;  5D9W A;  1GUL A;  1VF4 A;  4PUR A;  4MF6 A;  4MJA A;  3GN3 A;  3VPQ A;  5A4U A;  2H8L A;  4MH3 A;  2FA4 A;  2M46 A;  3HD5 A;  2G2Q A;  1PKZ A;  1PL2 A;  3EUR A;  3L9S A;  1XIY A;  4K5R A;  5DJM A;  2C0G A;  1B48 A;  1PN0 A;  2YWN A;  1Z5Y E;  1K0B A;  3GMF A;  4IJ3 A;  3LEF A;  2X49 A;  3QDN A;  2LQQ A;  4AJ6 A;  1Z6M A;  2YN1 A;  1GL8 A;  22GS A;  4YAP A;  5B7C A;  1XBS A;  2JSY A;  4GXZ A;  2P31 A;  2AJQ B;  4G9H A;  2GZZ A;  3V1W A;  3M8N A;  2O87 A;  2L5O A;  2O85 A;  3FZ4 A;  4L5L A;  1FVK A;  3KH9 A;  2C0D A;  3IK9 A;  4TXO A;  5CRD A;  2CX3 A;  2WRT A;  1FO5 A;  2PBJ A;  4K1F A;  4O5Q A;  2JZS A;  2LJR A;  1YEP A;  1VRS D;  2V6K A;  2GQL A;  1ST9 A;  2DJ2 A;  4N0V A;  4I2U A;  2GT5 A;  5J9C A;  1PSQ A;  1FW1 A;  2D2Z A;  3L9U A;  4LLR A;  4IP6 A;  3GKK A;  2V1M A;  2KUC A;  3DIE A;  1T8E B;  5EVO A;  2PER A;  1RW1 A;  1WE0 A;  3GFK A;  2AUV A;  3HZ8 A;  1FOH A;  1ZGN A;  3AY8 A;  1DBY A;  2IMF A;  3A2W A;  2FUG 2;  4F03 A;  3FYG A;  2H6Y A;  1KTE A;  5IMA A;  4MZW A;  5IOX A;  1OKT A;  2MZC A;  2HT9 A;  2LJK A;  3ZIJ A;  3CTG A;  13GS A;  3IBH A;  4OFN A;  1PKW A;  3HYP A;  2EIR A;  2GDR A;  3CBU A;  3LW9 A;  1FOV A;  4LL1 B;  2FNO A;  3WT2 A;  2LNT A;  1THO A;  5CRG A;  2XPE A;  3DVX A;  2HSM A;  3IV4 A;  2L6D A;  1XOA A;  1PA3 A;  4TR1 A;  3EWL A;  1MTC A;  4HZ2 A;  5D9T A;  5DVB A;  1G0T A;  5IM9 A;  2TIR A;  2KP1 A;  3LGC A;  2K9F A;  2K8S A;  5HFK A;  4POK A;  4X43 A;  3DRN A;  4Q5R A;  2DIY A;  4G2E A;  4I2T A;  4TXV A;  4IP1 A;  1SJZ A;  1ERW A;  1QGV A;  2HZE B;  19GS A;  3D21 A;  1A8L A;  2EIO A;  2WJU A;  3FR9 A;  1NHO A;  5H5Q A;  5IIZ A;  2B1L A;  1XW6 A;  1EOH A;  4EIQ A;  1GLQ A;  2H6Z A;  5DAL B;  4F82 A;  3LOR A;  3D5J A;  4WEY A;  3IE3 A;  1GTU A;  2DLX A;  4K9Z A;  1X9M B;  5DBQ A;  1DUG A;  1RK4 A;  1U87 A;  4FIW A;  4WKW A;  1PMT A;  3KXO A;  3PH9 A;  4ISD A;  1URM A;  1MDJ A;  4F2I A;  4J2F A;  1MDK A;  1R4W A;  1GUK A;  3QFA C;  4ZIJ A;  1GTB A;  2IMD A;  3VK9 A;  4I97 A;  5AIV A;  1O8W A;  2VCQ A;  3ME8 A;  5GAP D;  3ZIT A;  3CXG A;  4LMW A;  3P7X A;  4BWS A;  4A5P A;  4N30 A;  2PWJ A;  1PGT A;  4HQZ A;  1X5E A;  5H5R A;  3H4K A;  2HSH A;  3GL3 A;  4OO4 A;  3UBK A;  4ECB A;  4F0B A;  1QQ2 A;  1OKD A;  3TGZ A;  4XS1 A;  2HZE A;  4K7I A;  2YV9 A;  2C0F A;  3GKX A;  3UBL A;  3UJ1 A;  3ZML A;  3HVS A;  4IVF A;  1EV4 A;  2NVL A;  2VO4 A;  3FKF A;  3F4S A;  2DML A;  4LA1 A;  4HU9 A;  2VCV A;  4GWR A;  2VD0 A;  4XHM A;  1AQV A;  5DAL A;  3KZQ A;  3RDW A;  3IA1 A;  17GS A;  2V6O A;  1WMJ A;  4PQI A;  4K0G A;  1SYR A;  5ELA A;  5E4W A;  3WYW A;  2GST A;  1GSU A;  3GKN A;  2GSQ A;  4BVX B;  4MF7 A;  4CW9 A;  3MYD A;  1TRV A;  3OR5 A;  3KMO A;  2N5B A;  3UAR A;  3Q19 A;  4OO5 A;  4IKH A;  2L59 A;  20GS A;  3CSH A;  1N8J A;  2G0F A;  4K8M A;  2PUK C;  3JCM L;  3F8U A;  3UVH A;  1NHY A;  2BMX A;  5ECN B;  5ECH B;  5A4W A;  2YJ7 A;  2RLI A;  1OC8 A;  3C8E A;  3HKR A;  3UOM A;  5IMD A;  1A8Y A;  6GST A;  5F8B A;  3RAZ A;  3FY7 A;  2HRA A;  4OCE A;  10GS A;  2E7P A;  2FGX A;  1AW9 A;  5G31 A;  2WFC A;  2JAC A;  4ZBB A;  1K0O A;  2HFD A;  4Z7X A;  1TK5 B;  4Z2R A;  4LMV A;  3PR8 A;  4IQA A;  4RUV A;  1WOU A;  1A24 A;  1F37 A;  2HRK A;  1EP8 A;  3FZ9 A;  5HR3 A;  2R4V A;  5AIS A;  4BL7 B;  1BJX A;  3EMX A;  1GSF A;  4BWQ A;  1Z7R A;  4MAB A;  1I5G A;  4O92 A;  3F6D A;  1EP7 A;  1Z3E A;  3ZZX A;  2JL4 A;  4J56 E;  4KAE A;  4V1A g;  3FR6 A;  3G9B A;  4TN8 A;  4BVX A;  3MIX A;  1TRS A;  2H0I A;  1T4Z A;  3IK7 A;  2K6V A;  2PPT A;  3EE2 A;  2VLU A;  3H8Q A;  2OE0 A;  3M3M A;  3ZRE A;  4NWY A;  1MD4 A;  3KCM A;  2YWI A;  2H72 A;  1XWG A;  3G7J A;  4MPG A;  5ID2 B;  3LQ7 A;  3VFI A;  4KE3 A;  1SK1 A;  1T4Y A;  1EV9 A;  3L78 A;  3TJF A;  4HS1 A;  2WUL A;  2H70 A;  5L71 A;  2X8G A;  1XOB A;  5JWO B;  3M9J A;  3IRA A;  2VCX A;  2RM5 A;  6GSW A;  2YV7 A;  4ECI A;  3O6T A;  2R0G A;  4ZXG A;  4H86 A;  1TXX A;  3IXR A;  3K8N A;  2C80 A;  2ON7 A;  2ZUP A;  4RI6 A;  5GST A;  1VF3 A;  4KH7 A;  1RQM A;  3W8J A;  4IGJ A;  2KOK A;  4MK3 A;  4OWY A;  1DSB A;  4CDO A;  3F4T A;  1K0C A;  1YF1 A;  4BL7 A;  1M7T A;  2YOI A;  1GSS A;  3BCK A;  3TOU A;  5B8A A;  3F9U A;  4OFT A;  11GS A;  2DKH A;  1EEJ A;  5CNW A;  4GSN A;  2R6K A;  1OC9 A;  3LFL A;  4KF9 A;  4IN0 A;  5ENU A;  3ED3 A;  2H73 A;  4TR3 A;  1EWX A;  3LWA A;  1EEM A;  4TR0 A;  5COH A;  1G7E A;  3HZ4 A;  1F9M A;  1O7U A;  1SL0 B;  1SL1 B;  2FWH A;  5ECP B;  1TKD B;  4IJI A;  2IMK A;  1NM3 A;  5IO2 A;  5IMC A;  3CRT A;  4ZL9 A;  3GHA A;  1GWC A;  2NPB A;  16GS A;  2R0P A;  1UN2 A;  1BQ7 A;  5IMV A;  2VL2 A;  1LU4 A;  4PQ1 A;  1XFL A;  1WWJ A;  2H30 A;  3GYK A;  3TUE A;  1TU8 A;  2GZP A;  4I8B A;  2V2G A;  3TRQ A;  1UVZ A;  3BOA A;  4EKZ A;  1R7H A;  5HFI A;  1GSD A;  4WBR D;  3TKQ A;  1USB A;  2F9S A;  4PQH A;  4ML1 A;  3GST A;  2GS3 A;  2X8C A;  2HXK A;  2XBQ A;  3TRX A;  2CAI A;  5KOW A;  3EYT A;  4ZL7 A;  5IPG A;  3FRC A;  1PRX A;  4EF0 A;  1A23 A;  3SWL A;  2KP2 A;  1BED A;  5JWR B;  2LEG A;  3A3T A;  2I9H A;  3ZLP A;  2E2M A;  1GSQ A;  3ERG A;  5CO3 A;  3TKS C;  3ME7 A;  5BRT A;  1YKA A;  4QQ7 A;  2H1G A;  7GSS A;  2ES7 A;  4XRA A;  3NZN A;  1ZYP A;  2CA8 A;  5D93 A;  3E0U A;  1XWB A;  3FZA A;  3GX8 A;  3TJG A;  4RQR A;  6GSU A;  4X0X A;  2WZ9 A;  4ZB6 A;  4L5O A;  4Q5N A;  4L8E A;  1GSY A;  2BJX A;  1N2A A;  5J41 A;  2EC4 A;  1M0U A;  2C1Y A;  4KB3 A;  4KW6 A;  2FHE A;  2B5Y A;  3IPZ A;  4OMV A;  2IN3 A;  2FY6 A;  3P2A A;  1UA5 A;  1TK0 B;  1HYU A;  3KEB A;  4L0U A;  4ULX A;  1TW9 A;  2AHE A;  1TJD A;  3W8S A;  2LRC A;  3F0I A;  3EPT A;  1TDI A;  1QK8 A;  1XW5 A;  1OC3 A;  4YAV A;  1GNE A;  1B9Y C;  1WPI A;  4KSO A;  3GA4 A;  3LJR A;  2GSR A;  3CTF A;  1SD8 A;  1B4P A;  3GX0 A;  1IYI A;  3RBT A;  4FYC A;  1GLP A;  2GQK A;  2NDO A;  2DJ0 A;  1F3A A;  3GV1 A;  5F0G A;  2KHP A;  4GRF A;  4IEL A;  1WJK A;  1YJ6 A;  1KEB A;  3GUS A;  1AAZ A;  4K5S A;  2CVD A;  3S9F A;  3WGD A;  5G1K A;  1EOG A;  5HR0 A;  4KUN A;  5IQY A;  1FHE A;  2R2J A;  1X5D A;  3Q18 A;  2IFQ B;  4OD7 A;  4FYB A;  2OA7 A;  4KDX A;  1W89 A;  5ECL B;  5G1L A;  5IMF A;  5GAN D;  4XS4 B;  2HNL A;  4MJC A;  2GZY A;  1PQN A;  5CP1 A;  4BPY A;  2IMI A;  4NV2 A;  4IBP A;  2P5R A;  4Q5Q A;  5B6M A;  2GT6 A;  3ZVJ D;  3QPM A;  4Q5F A;  3DXB A;  3F3R A;  2ZCT A;  3TDG A;  4JE1 A;  4G0L A;  3HVX A;  1F6M C;  2VM2 A;  3E3E A;  3N5O A;  1QMV A;  4YKF A;  1S3A A;  1H75 A;  5ECO B;  4E8E A;  4NMU A;  1FVJ A;  1T3B A;  2REM A;  4EE0 A;  3QFB C;  2YAN A;  4CHS A;  1KBN A;  5EL8 A;  4ICY A;  3KP8 A;  3KJY A;  3GSS A;  5JCW A;  3ZYW A;  3EVI A;  2E2G A;  2GSS A;  3O76 A;  4L0W A;  4JRR A;  3VWW A;  2N5A A;  4HQS A;  2H71 A;  1IYH A;  4V2L A;  3DD3 A;  1ILO A;  2YZH A;  3QR6 A;  1KNG A;  2IL3 A;  2LUS A;  2IFQ A;  1U6T A;  3LXZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...