1UC7A

Crystal structure of dsbdgamma
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
124
structure length
124
Chain Sequence
AQTQTHLNFTQIKTVDELNQALVEAKGKPVMLDLYADWCVACKEFEKYTFSDPQVQKALADTVLLQANVTANDAQDVALLKHLNVLGLPTILFFDGQGQEHPQARVTGFMDAETFSAHLRDRQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Thiol:disulfide interchange protein dsbD
publication title Crystal structure of DsbDgamma reveals the mechanism of redox potential shift and substrate specificity(1)
pubmed doi rcsb
source organism Escherichia coli
total genus 41
structure length 124
sequence length 124
chains with identical sequence B
ec nomenclature ec 1.8.1.8: Protein-disulfide reductase.
pdb deposition date 2003-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13899 Thioredoxin_7 Thioredoxin-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1uc7A00
1TRWA 1A0RP 1TDIA 5ID2B 2P5QA 1O85A 2H1AA 4EL1A 1WMJA 4ML6A 4IP1A 4MH3A 2J23A 1Q98A 5HFKA 1BEDA 2WULA 4POLA 4DSRA 4OFTA 3P8WA 2R3XA 4JEDA 4HJ2A 3F3QA 6GSYA 1F2EA 4K2DA 1T4YA 3IXRA 1X5DA 1AQWA 3I6AA 2HXKA 4EC0A 4O92A 3EINA 2LSTA 1FAAA 2O85A 3EURA 4IKHA 3IHQA 1OC9A 1QMVA 1VRSD 3L78A 4MK3A 5EPFA 2IMDA 2CQ9A 1QXHA 3UJ1A 1I9DA 3QR6A 4FYBA 1SKWB 2YV9A 2OJLA 3EMXA 3EWLA 3D22A 4PNGA 3CSJA 3DVXA 2FNOA 2JZRA 1U3IA 2FGXA 3BJ5A 2FUG2 1XWGA 3GSSA 3P2AA 4NPBA 4DEJA 3FK8A 4IN0A 2LUSA 1YF0A 2L6CA 3FW2A 1R5PA 1VF4A 4WKWA 3KXOA 2HSYA 3UVTA 3O3TA 2V41A 1W4VA 2HLSA 3HDCA 4FYCA 3PGTA 3FR9A 4KDXA 2OE3A 5INYA 4QQ7A 4HU9A 3ZLPA 2H71A 2B7KA 3ERGA 1PL2A 1U87A 5DAKA 4LA1A 3LEFA 3H8QA 3Q6OA 2FWGA 2X8HA 3GKKA 1UA5A 3GTUB 2MMNA 1K0NA 2G0FA 2MMAA 1EWXA 1EV9A 2FLSA 2C0DA 3O6TA 2WZ9A 1F9MA 3ISOA 2LJRA 3SWLA 5HR1A 2GS3A 2MZCA 5DALB 1T3BA 2IWTA 1FVKA 3PR8A 5ECOB 1TK8B 13GSA 2VCVA 1T7PB 1SD9A 1URMA 4POKA 3QMXA 3GYKA 1ERTA 4YH2A 3CSIA 3TUEA 1YKCA 2HZFA 1SYRA 1XZOA 2LJAA 4EE0A 2YWIA 1SENA 2L5LA 5H5SA 3KH9A 4I2TA 2PPTA 1KTEA 3QCPA 3I43A 3EVIA 5G5EA 4WETA 3TDGA 4XCSA 3UMAA 1PKZA 1YEPA 2KUCA 3F4TA 2XHFA 4MZBA 2GSQA 3HY2A 4MMMA 3LJRA 3VWWA 4EO3A 5B6MA 4NMUA 4I97A 3KEBA 3MSZA 2VLUA 4KE3A 3M3MA 3FR3A 4GXZA 4PURA 3DMLA 3V1WA 1LJRA 3TCOA 2PWJA 1GSQA 1M2BA 4GQCA 5ECQB 4KDYA 3IE3A 3C1SA 2E7PA 2A2SA 5IPGA 4MF6A 3QAWA 2RLIA 4ZL7A 3HCZA 3IDVA 4N30A 5FT3A 4WR4A 2X8CA 2HFDA 1PGTA 2MMZA 2VOCA 3DD3A 1GNEA 1VF3A 4QL7A 20GSA 1YQ1A 3C7MA 2ALBA 2H6XA 3LORA 1K0AA 1QQ2A 1XOBA 2R6KA 1A0FA 1WP0A 4ZBDA 2ON5A 5AGYA 3IR4A 1NHOA 1C72A 3ED3A 5HFGA 1R4WA 3P7XA 4ECBA 4GQFA 2NTOA 4ZB9A 4HS1A 2HE3A 4MPGA 1RQMA 3BOAA 3APOA 4J2FA 2J9HA 5KN3A 4I8BA 1T1VA 3BD2A 5CP1A 3TJFA 3KJYA 5CRHA 1JLVA 3CTFA 3IAM2 2VL2A 1GTIA 3GURA 4WR5A 6GSWA 1NSWA 2L4CA 3A2WA 2XBIA 2ON7A 3VWXA 2R2JA 5KN2A 1F37A 3CSHA 4GCIA 2WJUA 3F63A 3CMIA 2R4VA 4GF0A 4J56E 4TR0A 1RW1A 2VCWA 1EP8A 2M80A 1J9BA 3GMFA 5IOWA 3RHCA 2IL3A 5D9WA 2CVDA 2DJJA 1A2MA 4WF4A 3WGDA 1Z7PA 4GTUA 3HZ4A 2DIYA 1PN9A 2CX4A 2DIZA 2YJ7A 2VL3A 4TR1A 3W8JA 2I81A 4OFNA 3M9KA 3UAPA 2VCTA 1OKDA 2DMLA 3GKNA 4V1Ap 2O89A 3DXBA 5L71A 4KCAA 2L5OA 3GX0A 1SL0B 10GSA 1AUCA 1OC3A 5J3RA 4TR4A 1NW2A 2GVPA 4HQZA 1SJZA 5JCWA 5D9XA 2M46A 3IK7A 1V58A 4ZL9A 1XOAA 4AGSA 1PX7A 1Z6NA 5D9TA 2YWNA 1WPIA 2XC2A 1ZOFA 1QK8A 2CV4A 3KTLA 2OE0A 4HJMA 4N11A 3HHVA 1TK5B 3MNGA 1JHBA 2H72A 1ZYQB 3H4KA 3IAS2 2IN3A 4L0WA 5H5RA 1KEBA 2FY6A 4AJ7A 5G5FA 5JWOB 1M2AA 4Q5NA 1LBKA 4P3YB 2YP6A 2KP2A 3L9UA 4Z7XA 2H66A 2K18A 3GL5A 4NV2A 1ACVA 1Y6EA 4AF2A 1TP9A 2JZSA 2YN1A 2IFQB 1T8EB 3GX8A 4KUNA 4ZL8A 1QFNA 4DSQA 2OKAA 3SBCA 3S9FA 4KAEA 5ECIB 1V2AA 4PNFA 4XIHA 1GP1A 2GQMA 1HQOA 3KP9A 3ERFA 4PX1A 3TB2A 3TKSC 4BVXA 1ABAA 4BWSA 3HVSA 2IPAA 1K3OA 1GSDA 3IOSA 3UOMA 1MDJA 5AISA 1ZMAA 1Q4JA 3GL3A 3ZTLA 3ZZXA 1GSEA 1YKAA 2VCZA 5JWQB 1Z7RA 1B4QA 1EV4A 1THOA 4ZB6A 2PVOC 1AQXA 1O6JA 1TRSA 2EIOA 2O87A 5ENUA 1QGVA 3HXSA 2H0IA 1TOFA 1J0FA 5ECRB 1K0MA 3KGKA 3KTBA 4PXOA 5AIVA 3ZREA 4RI6A 4BA7A 3A2VA 1HYUA 1MD3A 2PBJA 5CAXA 1AAZA 5J5NA 4EXJA 3PINA 2VL2C 2RUFA 3GRXA 2L6DA 3DVWA 1OYJA 3HJPA 5A5KA 2WGRA 4POMA 3TRXA 3UVHA 6GSVA 1K0DA 2MMOA 3ZMLA 1WWJA 2GLRA 2C4JA 4NHZA 1O8WA 3GN3A 5DCHA 2DLXA 4OFMA 3KZQA 3KH7A 2EIRA 1GTUA 3LSZA 4I6XA 4GLTA 2QSIA 2H19A 5IPHA 4XS6A 1Z9HA 5DCGA 3WGEA 3EU3A 4ECCA 2VM2A 2Z9SA 4HUAA 2NDOA 4MJCA 1M7TA 1O81A 2KOKA 3G7JA 2VO4A 3D5JA 2H01A 1SJIA 1SU9A 1SKSB 3GSTA 4F9ZA 1XFLA 4XHMA 1YF1A 1O7UA 3EE2A 5ECSA 2GTUA 1GSYA 2FHEA 1PD21 1Z3EA 3GHAA 2I3YA 1WJKA 1GLPA 3WD6A 1X9WB 1DE2A 3ZIVA 1XWKA 3VPQA 3VI5A 1MDIA 2GSSA 3LYPA 2CA8A 2VD0A 3D4TA 4WEYA 1A24A 18GSA 4G10A 4IJIA 4ECIA 3UARA 2CZ2A 3KD0A 1A2JA 4D73B 4OD7A 2C0GA 4JE1A 3QOUA 4HQSA 2EC4A 5ELAA 1N2AA 3ZVJA 5JCGA 4MP4A 3F9UA 1OKTA 1PSQA 2H1BA 1M9AA 2I9HA 3N9JA 1M9BA 4CW9A 4X1UA 1M0UA 4V1Ag 5GAPD 4EVMA 2D2ZA 4N0ZA 1ZCPA 4F0BA 3ERWA 3F0IA 3HJMA 2DJ1A 3H79A 1FG4A 3M9JA 3IK9A 5IO2A 5GAND 2GQLA 1GTBA 2LTKA 2FCHA 4I2UA 3ZL5A 2ZNMA 1ST9A 2VCQA 2GT6A 4K7NA 1XW5A 2YZUA 4FIWA 3U6VA 5LNKe 2LQQA 4XS4A 1Y25A 3LG6A 1B4PA 1PL1A 3CYNA 3TGZA 3KP8A 4ZILA 4YAVA 1M2DA 5D73A 3E0UA 4NHWA 3TRPA 4IHUA 2QGVA 2VIMA 2YOIA 5C04A 2B5YA 1SD8A 3FRCA 5B8BA 2DBCA 5GZZB 2B6MA 1WIKA 3W6GA 4RUVA 3F8UA 2PGTA 3WGXA 3L9VA 4O5RA 5LD0A 1B48A 4HEA2 4F03A 4XTSA 1S3DA 1F3AA 3FZ5A 5B6NA 2P31A 4BPYA 3RDWA 2M72A 3VPTA 16GSA 1Z6MA 3NOFA 1TXXA 1VF2A 1SKRB 2YNXA 1B9YC 4OCFA 3NZNA 1TI1A 3L4NA 2HZEA 2X99A 4IQ1A 5D8IA 4DSSA 1XCCA 4OWYA 2H1GA 1GULA 3DKSA 3LQ7A 4CHSA 4DVCA 3M0FA 1T4ZA 1X5EA 3G7IA 3TOTA 3U5RE 3TKSA 2XPEA 1JFUA 5F8BA 2N5FA 3D0ZA 3MAKA 4MZWA 4K8MA 3LWAA 1USBA 1O73A 3BCKA 1XVWA 2H76A 5D93A 2LJKA 4MABA 3DIEA 2GSTA 3FHKA 3GA4A 3IBHA 2R37A 1UC7A 2KHPA 2OE1A 5FHIA 1ERVA 2H30A 1B9XC 4AJ8A 2PMTA 2V1MA 2OBKA 2VAFA 3WT2A 3RBTA 3R2QA 4V2NA 2JSYA 3L0HA 1ERUA 4JU5A 5ECHB 5CRGA 1THXA 5AIXA 2PN8A 2JZTA 4JRRA 2CVBA 3VWUA 4LL4B 2C8UA 4KDUA 4L5LA 3RPNA 2ES7A 1BAYA 1UVZA 2I4AA 3Q74A 5G31A 5KEJA 4TXOA 1OVNA 3A5WA 1ILOA 5DQYA 3TOUA 2PERA 5DAKB 4MJEA 4L0UA 4K7OA 3F4SA 3N5OA 4EDZA 5ELGA 2IJYA 4HZ2A 1TW9A 2MBTA 3EC3A 3NIVA 4MJBA 2YCDA 4NWYA 5CRDA 1TRVA 2P0GA 2AJQB 3ZYWA 3VWVA 5C00A 3GKMA 1XWBA 2A2RA 2F8FA 2GZYA 3GIXA 2FWHA 2C0EA 1SK2A 1XPVA 4LL1B 5CYYA 1DUGA 1K3LA 2BJXA 3VFIA 1SJ6A 4MF5A 4YQMA 3BBYA 3KMOA 2YJHA 4ZBAA 3QAVA 4I5QA 5IO0A 2LRCA 2K8SA 3APQA 5ID2A 4XRDA 4MJAA 5IMVA 2L59A 3QPMA 3D4MA 3KCMA 4FH8A 1WRYA 1TI3A 2H0HA 2C3TA 1U88A 1TU7A 1K0BA 1OE7A 4GWRA 3C73A 1MDKA 2V32A 3E9JB 2DJ2A 2WS2A 4HI7A 5G2ZA 4YQVA 1LU4A 1K3YA 2JACA 4L5OA 3Q18A 2E2GA 3GH9A 1IYHA 5JCUA 2I1UA 2AB6A 3RAZA 1EZKA 2V2GA 1AXDA 5GSSA 4RQRA 1GH2A 3HZ8A 5DQSA 2A4VA 4KW6A 4ID0A 2NVLA 5J4UA 1QUWA 4N10A 4MF7A 1PKWA 1GSUA 5GSTA 4TOPA 1X5CA 1FW1A 1ML6A 1X9MB 3JCML 3A3TA 5FWGA 3ZIJA 3WT1A 4F0CA 4ZXGA 3IC4A 5HR2A 5A4VA 1R5AA 5A4WA 1JZRA 2C3QA 2FA8A 3F4RA 3TJGA 1KNGA 3IA1A 2F51A 3ME8A 2DMMA 2WRTA 1MD4A 4MH2A 4OMVA 1GSFA 2AV4A 4KSOA 3TJKA 5B7CA 1DSBA 4YAPA 4X0XA 2XPDA 5E4WA 2AYTA 1AQVA 5KN1A 2HNLA 1HD2A 2L4QA 3W8SA 1GTAA 2AAWA 1XIYA 1BQ7A 2IMFA 3FYGA 4Q5QA 3ZRDA 4LMVA 1SL1B 4J57E 4RI7A 3HA9A 3EMPA 3GTUA 2HRNA 4WF5A 1T00A 1EEMA 5H5QA 3GUSA 4NXIA 4EF0A 2N5AA 1XW6A 4LLRA 3G7YA 2FA4A 4HOJA 3APSA 2B7JA 1AIUA 3ZVJD 2LV3A 5DALA 3TJJA 2H6ZA 5A4UA 3PH9A 2JL4A 2NBSA 4V2MA 4G2EA 4WBRD 3DGQA 2AHEA 2F9SA 1DE1A 6GSTA 3QFBC 4FYUA 4JR6A 2PUKC 1A2LA 4TR1B 4KX4A 2JSZA 1U6TA 2WDUA 4IJ3A 1YY7A 2E2MA 3O76A 3TKPA 5CRWA 1PMTA 2RUEA 2GQKA 5DJMA 4AJ6A 2H1DA 4IELA 1XWAA 4H86A 3UIWA 4NV5A 2CVKA 2CAQA 2H6YA 3DRNA 2K6VA 1E6BA 4PQHA 5IQYA 5LCZA 2E0QA 4TR3A 2YZHA 1CQGA 5HQPA 3KIJA 2ZUPA 2RM6A 4OO4A 4ISDA 2LQOA 2X64A 3FZ9A 4HDEA 3DEXA 8GSSA 3C8EA 3HVXA 1NM3A 4JZQA 2C0FA 1V40A 4ECJA 5HR3A 2RM5A 1GRXA 1FO5A 3QFAC 3RHBA 4ML1A 4F2IA 4F82A 4MDCA 2BTOT 4PGTA 4GRFA 5G30A 3EU4A 1F3BA 1EOHA 4JR4A 2PVQA 3UBKA 2IMEA 1GNWA 1PX6A 2IMIA 4K1FA 1GL8A 1V57A 1XVQA 4TXVA 3F6FA 2AUVA 4K7IA 1G0TA 3I69A 3CXGA 5DDLA 4XRAA 1BX9A 1AC1A 3F6DA 3GH6A 3GV1A 5EY6A 11GSA 1YEXA 2DJ3A 3ZITA 3LFLA 2F3MA 4KH7A 1W89A 5IIZA 4HZ4A 3K8NA 2GT5A 4PUFC 1X9SB 5IOXA 4KNDA 9GSSA 5EL8A 1MEKA 3AY8A 1J08A 1F6MC 1FB0A 7GSSA 1XWCA 4LMWA 5ECMB 1AW9A 3I9V2 1K0CA 5IMFA 2LKUA 2H73A 3M8NA 1EP7A 5G1KA 2HI7A 2B3SA 3HJOA 3VLNA 2B1KA 1OC8A 5J41A 3D21A 1M99A 2C3NA 3GFKA 4GSNA 2CX3A 1G7EA 5G1LA 2R5GA 3QDNA 4OO5A 4X43A 1H75A 4PUAA 4CDOA 14GSA 1I5GA 4IP6A 1WE0A 3A2XA 2YPMA 3E3EA 4G19A 5F06A 3DWVA 1EEJA 1OAZA 1Z5YE 4YQUA 5CNWA 4GSTA 1E2YA 2XBQA 5D96A 4N0VA 1IYIA 1VGLA 5KN0A 5ECPB 2VUPA 1EGOA 4PQIA 4WBJA 1A8YA 4IVFA 4IBPA 1SK1A 1VF1A 1G7OA 1CQHA 4E8EA 2PU9C 4KGIA 5IMCA 2H0GA 2GZZA 1R26A 5HR0A 3FZAA 3WYWA 3H1NA 6GSXA 2QKEA 3TKQA 1DBYA 1ZZYA 2TRXA 2QC7A 3KM6A 2H74A 3UBLA 5ECLB 1JZOA 1R7HA 4V2LA 5EVOA 4EUYA 3QD9A 5F0GA 2C80A 1OC9B 1GLQA 4K6XA 4ILFA 2KP1A 4E8HA 2LNTA 2FD3A 3OR5A 3MDKA 5IMZA 3BCIA 2H70A 12GSA 3EYTA 3D6IA 3LXTA 1TJDA 1S3CA 4FO5A 1SYXA 2VCXA 2KLXA 2MYGA 2YV7A 2IFQA 3TKSE 1B8XA 3FR6A 2FWEA 3US3A 2DC5A 19GSA 2DJ0A 5J9CA 3VURA 2B1LA 1V98A 1TK0B 3UL3A 3FZ4A 3M1GA 3HKRA 2ZCTA 1GSSA 4TVEA 6GSUA 1HNBA 2B5EA 4L8EA 2GDRA 4POBA 2N5BA 2HSHA 4IS0A 2V6OA 2L57A 4K0GA 4TW5A 3IPZA 2O8VB 4WXTA 1A8LA 1BG5A 3HVVA 1ZYEA 3CRUA 1N8JA 4G9HA 2K8VA 2WB9A 5DBQA 1XW9A 4KB3A 4MZCA 1EOGA 5JWRB 17GSA 1ZGNA 2EIQA 2HRFA 3FY7A 4IGJA 4O32A 4NAXA 2O7KA 3QAGA 1ERWA 2TIRA 2VLTA 5AN1A 1HNAA 3L9SA 2H8LA 3C1RA 5HFIA 3ZFLA 2GGTA 4XS4B 2JU5A 1ZL9A 2NPBA 3LYKA 2F8AA 3VI7A 4XS1A 1JZWA 4KA0A 4MPFA 1HNCA 1SL2B 5J9BA 5COHA 2X8GA 5ECKB 4OCEA 2K9FA 1GUKA 2LS5A 4TKYA 4BWQA 4EKZA 4Q5FA 1PQNA 2VM1A 4MA9A 1YJ6A 4IQAA 1U3AA 4ZBBA 5F07A 1V9WA 2DSAA 1GUHA 1H4OA 3HD5A 1FOVA 2VLVA 3H93A 1RK4A 3CRTA 5B8AA 3ZFBA 4ZIJA 3UEMA 1TU8A 3J7Yk 2YANA 2H75A 2MBSA 3Q19A 4BL7A 5DVBA 1XBSA 3G9BA 1SK0A 1GUMA 3ZMKA 3HYPA 1MTCA 1K0OA 2IMKA 2HYXA 2CZ3A 3TRQA 1TKDB 1GWCA 4O7HA 1FVJA 4MCUA 22GSA 2GZPA 4BVYA 3FKFA 2HZEB 4DSSB 1TTZA 4K0NA 5CREA 2OA7A 5IMDA 3P90A 3GKXA 1NHYA 2LNSA 5ECNB 5F05A 2CT6A 4IW9A 1BJXA 4JBBA 2VD1A 4ACSA 3IV4A 2RIIA 2DJKA 1FB6A 1XXUA 2WFCA 3GNJA 5IM9A 2B5XA 5D9VA 3DYRA 3TKRA 2HT9A 2YWMA 4MLYA 1UN2A 3RPPA 2BMXA 3J7Yb 3KMNA 4EDYA 5CO3A 2OADA 4D73A 4KSMA 1KBNA 1EGRA 3CTGA 4ULXA 3C71A 1ON4A 1YZXA 4HU7A 2V6KA 3ME7A 1X0RA 1O8XA 1FHEA 4TRXA 3VK9A 2CAIA 1A23A 2IIYA 1G6WA 3TJBA 1BYEA 3LGCA 2OACA 3CBUA 2WCIA 2OBIA 4TXOB 5ABRA 4ZB8A 4KCEA 4PQ1A 2P5RA 4TN8A 3LXZA 2FWFA 3MWHA 2C1YA 1S3AA 1TRUA 3F3RA 5IMAA 2G2QA 1OE8A 1PRXA 2REMA 1G6YA 2LRTA 2JADA 3IRAA 2YWOA 4RQXA 4QL9A 5E59A 2TRCP 1YDKA 1JZDA 5DJLA 1JLWA 2LEGA 1PA3A 4GSSA 2LRNA 2VL9A 2GSRA 3FEUA 4K9ZA 1WOUA 6GSSA 4Q5RA
chains in the Genus database with same CATH superfamily
1TRWA 1A0RP 1TDIA 5ID2B 1S3RA 2P5QA 1O85A 2H1AA 4EL1A 1WMJA 4ML6A 4IP1A 4MH3A 2J23A 1Q98A 5HFKA 1BEDA 4Z2UA 2WULA 4POLA 4DSRA 4OFTA 3P8WA 2R3XA 4JEDA 4HJ2A 3F3QA 6GSYA 1F2EA 4K2DA 1T4YA 3IXRA 1X5DA 1AQWA 3I6AA 2HXKA 4EC0A 4O92A 3EINA 2LSTA 1FAAA 2O85A 3EURA 4IKHA 3IHQA 1OC9A 1QMVA 1VRSD 3L78A 4MK3A 5EPFA 2IMDA 2CQ9A 1QXHA 3UJ1A 1I9DA 3QR6A 4FYBA 1SKWB 2YV9A 2OJLA 3EMXA 3EWLA 3D22A 4PNGA 3CSJA 3DVXA 2FNOA 2JZRA 1U3IA 2FGXA 3BJ5A 2FUG2 1XWGA 3GSSA 3P2AA 4NPBA 4DEJA 3FK8A 4IN0A 2LUSA 1YF0A 2L6CA 3FW2A 1R5PA 1VF4A 4WKWA 3KXOA 2HSYA 3UVTA 3O3TA 2V41A 1W4VA 2HLSA 3HDCA 4FYCA 3PGTA 3FR9A 4KDXA 2OE3A 5INYA 4QQ7A 3LW9A 4HU9A 3ZLPA 2H71A 2B7KA 3ERGA 1PL2A 1U87A 5DAKA 4LA1A 3LEFA 3H8QA 3Q6OA 2FWGA 2X8HA 3GKKA 1UA5A 3GTUB 2MMNA 4O5UA 1K0NA 2G0FA 2MMAA 1EWXA 1EV9A 2FLSA 2C0DA 3O6TA 2WZ9A 1F9MA 3ISOA 2LJRA 3SWLA 5HR1A 2GS3A 2MZCA 5DALB 1T3BA 1ZYNA 2IWTA 1FVKA 3PR8A 5ECOB 1TK8B 13GSA 2VCVA 1T7PB 3IHGA 1SD9A 1URMA 4POKA 3QMXA 3GYKA 1ERTA 4YH2A 3CSIA 3TUEA 1YKCA 2HZFA 1SYRA 1XZOA 2LJAA 4PTSA 4EE0A 2YWIA 1SENA 2L5LA 5H5SA 3KH9A 4I2TA 2PPTA 1KTEA 3QCPA 3MYDA 3I43A 3EVIA 5G5EA 4WETA 3TDGA 4XCSA 3UMAA 1PKZA 1YEPA 2KUCA 3F4TA 2XHFA 4MZBA 2GSQA 3HY2A 4MMMA 3LJRA 3VWWA 4EO3A 5B6MA 4NMUA 4I97A 3KEBA 3MSZA 2VLUA 4KE3A 3M3MA 3FR3A 4GXZA 4PURA 3DMLA 3V1WA 1LJRA 3TCOA 2PWJA 1GSQA 1M2BA 4GQCA 5ECQB 4X4JA 4KDYA 3IE3A 3C1SA 2E7PA 2A2SA 5IPGA 4MF6A 3QAWA 2RLIA 4ZL7A 3HCZA 3IDVA 4N30A 5FT3A 4WR4A 2X8CA 2HFDA 1PGTA 2MMZA 2VOCA 3DD3A 1GNEA 1VF3A 4QL7A 20GSA 1YQ1A 3C7MA 2ALBA 2H6XA 3LORA 1K0AA 1QQ2A 1XOBA 2R6KA 1A0FA 1WP0A 4ZBDA 2ON5A 2HRAA 5AGYA 3IR4A 1NHOA 1C72A 3ED3A 5HFGA 1R4WA 3P7XA 4ECBA 4GQFA 2NTOA 4ZB9A 4HS1A 2HE3A 4MPGA 1RQMA 4J2FA 3APOA 3BOAA 2R0GA 2J9HA 5KN3A 4I8BA 1T1VA 3BD2A 4CY6A 5CP1A 3TJFA 3KJYA 3PPUA 5CRHA 1JLVA 2A2PA 3CTFA 3IAM2 2VL2A 1GTIA 3GURA 4WR5A 6GSWA 1NSWA 2L4CA 3A2WA 2XBIA 3R3EA 2ON7A 3VWXA 2R2JA 5KN2A 1F37A 3CSHA 4GCIA 2WJUA 3F63A 3CMIA 2R4VA 4GF0A 4J56E 4TR0A 1RW1A 2VCWA 1EP8A 2M80A 1J9BA 3GMFA 5IOWA 3RHCA 2IL3A 5D9WA 2CVDA 2DJJA 1A2MA 4WF4A 3WGDA 1Z7PA 4GTUA 2HRKA 3HZ4A 2DIYA 1PN9A 2CX4A 2DIZA 2YJ7A 2VL3A 4TR1A 3W8JA 2I81A 4OFNA 3M9KA 3UAPA 2VCTA 1OKDA 2DMLA 3GKNA 4V1Ap 2O89A 3DXBA 5L71A 4KCAA 2L5OA 3GX0A 1SL0B 10GSA 1AUCA 1OC3A 5J3RA 4TR4A 1NW2A 2GVPA 4HQZA 1SJZA 5JCWA 5D9XA 2M46A 3IK7A 1V58A 4ZL9A 1XOAA 4AGSA 1PX7A 1Z6NA 5D9TA 2YWNA 1WPIA 2XC2A 1ZOFA 1QK8A 2CV4A 3KTLA 2OE0A 4HJMA 4N11A 3HHVA 1TK5B 3MNGA 1JHBA 2H72A 1ZYQB 3H4KA 3IAS2 2IN3A 4L0WA 5H5RA 1KEBA 2FY6A 4AJ7A 5G5FA 5JWOB 1M2AA 4Q5NA 1LBKA 4P3YB 2YP6A 2KP2A 3L9UA 4Z7XA 2H66A 2K18A 3GL5A 4NV2A 1ACVA 1Y6EA 4AF2A 1TP9A 2JZSA 2YN1A 2IFQB 1T8EB 3GX8A 4KUNA 4ZL8A 1QFNA 4FQUA 4DSQA 2OKAA 3SBCA 3S9FA 4KAEA 5ECIB 1V2AA 4PNFA 4XIHA 1GP1A 2GQMA 1HQOA 3KP9A 3ERFA 4PX1A 3TB2A 3TKSC 4BVXA 1ABAA 4BWSA 3HVSA 2IPAA 1K3OA 1GSDA 3IOSA 3UOMA 1MDJA 5AISA 1ZMAA 1Q4JA 3GL3A 3ZTLA 3ZZXA 1GSEA 1YKAA 2VCZA 5JWQB 1Z7RA 1B4QA 1EV4A 1THOA 4ZB6A 2PVOC 1AQXA 1O6JA 1TRSA 2EIOA 2O87A 5ENUA 1QGVA 3HXSA 2H0IA 1TOFA 1J0FA 5ECRB 1K0MA 4YKFA 3KGKA 3KTBA 4PXOA 5AIVA 3ZREA 4RI6A 4BA7A 3A2VA 1HYUA 1MD3A 2PBJA 5CAXA 1AAZA 5J5NA 4EXJA 3PINA 2VL2C 2RUFA 3GRXA 2L6DA 3DVWA 1OYJA 3HJPA 5A5KA 2WGRA 4POMA 3TRXA 3UVHA 6GSVA 1K0DA 2MMOA 3ZMLA 1WWJA 2GLRA 2C4JA 4NHZA 1O8WA 3GN3A 5DCHA 2DLXA 4OFMA 3KZQA 3KH7A 2EIRA 1GTUA 3LSZA 4I6XA 4GLTA 2QSIA 2H19A 5IPHA 4XS6A 5BMUA 1Z9HA 5DCGA 3WGEA 3EU3A 4ECCA 2VM2A 2Z9SA 4HUAA 2NDOA 4MJCA 4BL7B 4ICYA 1M7TA 1O81A 2KOKA 3G7JA 2VO4A 3D5JA 2H01A 1SJIA 1SU9A 1SKSB 3GSTA 4F9ZA 1XFLA 4XHMA 1YF1A 1O7UA 3EE2A 4BVYB 5ECSA 2GTUA 1GSYA 2FHEA 1PD21 1Z3EA 3GHAA 2I3YA 1WJKA 1GLPA 3WD6A 5KOWA 1X9WB 1DE2A 2HSMA 3ZIVA 1XWKA 3VPQA 3VI5A 1MDIA 2GSSA 3LYPA 2CA8A 2A4HA 2VD0A 3D4TA 4WEYA 1A24A 18GSA 4MNNA 4G10A 4IJIA 4ECIA 3UARA 2CZ2A 4G0IA 3KD0A 1A2JA 4D73B 4OD7A 2C0GA 4JE1A 3QOUA 4HQSA 2EC4A 5ELAA 1N2AA 3ZVJA 5JCGA 4MP4A 3F9UA 1OKTA 1PSQA 2H1BA 1M9AA 2I9HA 3N9JA 1M9BA 4CW9A 4X1UA 1M0UA 4V1Ag 5GAPD 4EVMA 2D2ZA 4N0ZA 1ZCPA 4F0BA 3ERWA 3F0IA 3HJMA 2DJ1A 3H79A 1FG4A 3M9JA 3IK9A 5IO2A 5GAND 2GQLA 1GTBA 2LTKA 2FCHA 4I2UA 3ZL5A 2ZNMA 1ST9A 2VCQA 2GT6A 4K7NA 1XW5A 2YZUA 4FIWA 3U6VA 5LNKe 2LQQA 4XS4A 1Y25A 3LG6A 1B4PA 1PL1A 3CYNA 3TGZA 3KP8A 4ZILA 4YAVA 1M2DA 5D73A 3E0UA 3A5IA 4NHWA 3TRPA 4IHUA 2QGVA 2VIMA 2YOIA 5C04A 2B5YA 1SD8A 3FRCA 5B8BA 2DBCA 5GZZB 2B6MA 1WIKA 3W6GA 4RUVA 3F8UA 2PGTA 3WGXA 3L9VA 4O5RA 5LD0A 1B48A 4HEA2 4F03A 4XTSA 1S3DA 1F3AA 2R0CA 3FZ5A 5B6NA 2P31A 4BPYA 3RDWA 2M72A 3VPTA 16GSA 1Z6MA 3NOFA 1TXXA 1VF2A 1SKRB 2YNXA 1B9YC 4OCFA 3NZNA 1TI1A 3L4NA 2HZEA 2X99A 4IQ1A 5D8IA 4DSSA 1XCCA 4OWYA 2H1GA 1GULA 3DKSA 3LQ7A 4CHSA 4DVCA 3M0FA 1T4ZA 1X5EA 3G7IA 3TOTA 3U5RE 3TKSA 2XPEA 1JFUA 5F8BA 2N5FA 3D0ZA 3MAKA 4MZWA 4K8MA 3LWAA 1USBA 1O73A 3BCKA 1XVWA 2H76A 5D93A 2LJKA 4MABA 3DIEA 2GSTA 3FHKA 3GA4A 3IBHA 2R37A 1UC7A 2KHPA 2OE1A 5FHIA 1ERVA 2H30A 1B9XC 4AJ8A 2PMTA 2V1MA 2OBKA 2VAFA 3WT2A 3RBTA 3R2QA 4V2NA 2JSYA 3L0HA 1ERUA 4JU5A 5ECHB 5CRGA 1THXA 5AIXA 2PN8A 2JZTA 4JRRA 2CVBA 3VWUA 4LL4B 2C8UA 4KDUA 4L5LA 3RPNA 2ES7A 1BAYA 1UVZA 2I4AA 3Q74A 5G31A 5KEJA 4TXOA 1OVNA 3A5WA 1ILOA 5DQYA 3TOUA 2PERA 5DAKB 4MJEA 4L0UA 4K7OA 3F4SA 3N5OA 4EDZA 5ELGA 2IJYA 4HZ2A 1TW9A 2MBTA 3EC3A 3NIVA 4MJBA 2YCDA 4NWYA 3HVNA 5CRDA 1TRVA 2P0GA 2AJQB 3ZYWA 3VWVA 5C00A 3GKMA 1XWBA 2A2RA 2F8FA 2GZYA 3GIXA 2FWHA 2C0EA 1SK2A 1XPVA 4LL1B 5CYYA 1DUGA 1K3LA 2BJXA 3VFIA 1SJ6A 4MF5A 4YQMA 3BBYA 3KMOA 2YJHA 4ZBAA 3QAVA 4I5QA 5IO0A 2LRCA 2K8SA 3APQA 5ID2A 4XRDA 4MJAA 5IMVA 2L59A 3QPMA 3D4MA 3KCMA 4FH8A 1WRYA 1TI3A 2H0HA 4Z2RA 2C3TA 1U88A 1TU7A 1K0BA 1OE7A 4GWRA 3C73A 1MDKA 2V32A 3E9JB 2DJ2A 2WS2A 4HI7A 4KF9A 5G2ZA 4YQVA 1LU4A 1K3YA 2JACA 4L5OA 3Q18A 2E2GA 3GH9A 1IYHA 5JCUA 2I1UA 2AB6A 3RAZA 1EZKA 2V2GA 1AXDA 5GSSA 4RQRA 4A5PA 1GH2A 3HZ8A 5DQSA 2A4VA 4KW6A 4ID0A 2NVLA 5J4UA 1QUWA 4N10A 4MF7A 1PKWA 1GSUA 5GSTA 4TOPA 1X5CA 1FW1A 1ML6A 1X9MB 3JCML 3A3TA 5FWGA 3ZIJA 4EIQA 3WT1A 4F0CA 4ZXGA 3IC4A 5HR2A 5A4VA 1R5AA 5A4WA 1JZRA 2C3QA 2FA8A 3F4RA 2DKHA 3TJGA 1KNGA 3IA1A 1FOHA 2F51A 3ME8A 2DMMA 2WRTA 1MD4A 4MH2A 4OMVA 1GSFA 2AV4A 4KSOA 3TJKA 5B7CA 1DSBA 4YAPA 4X0XA 4BIKA 4G0KA 2XPDA 5E4WA 2AYTA 1AQVA 2X49A 5KN1A 2HNLA 1HD2A 2L4QA 3W8SA 1GTAA 2AAWA 2UZ8A 1XIYA 1BQ7A 2IMFA 3FYGA 4Q5QA 3ZRDA 4LMVA 1SL1B 4J57E 4RI7A 3HA9A 3EMPA 3GTUA 2HRNA 4WF5A 1T00A 1EEMA 5H5QA 3GUSA 4NXIA 4EF0A 2N5AA 1XW6A 4LLRA 3G7YA 2FA4A 4HOJA 3APSA 2B7JA 1AIUA 3ZVJD 2LV3A 5DALA 3TJJA 2H6ZA 5A4UA 3PH9A 2JL4A 2NBSA 4V2MA 4G2EA 4WBRD 3DGQA 2AHEA 2F9SA 1DE1A 6GSTA 3QFBC 4FYUA 4JR6A 2PUKC 1A2LA 4TR1B 4KX4A 2JSZA 1U6TA 2WDUA 4IJ3A 1YY7A 2E2MA 3O76A 3TKPA 5CRWA 1PMTA 2RUEA 2GQKA 5DJMA 4AJ6A 2H1DA 4IELA 1XWAA 4H86A 3UIWA 4NV5A 2CVKA 2CAQA 2H6YA 3DRNA 2K6VA 1E6BA 4PQHA 5IQYA 5LCZA 1PFOA 2E0QA 4TR3A 2YZHA 1CQGA 5HQPA 3KIJA 5BRTA 2ZUPA 2RM6A 4OO4A 4ISDA 2LQOA 2X64A 5KOXA 3FZ9A 4HDEA 3DEXA 8GSSA 3C8EA 2DKIA 3HVXA 1NM3A 4JZQA 2C0FA 1V40A 4ECJA 5HR3A 2RM5A 1GRXA 1FO5A 3QFAC 3RHBA 4ML1A 4F2IA 4F82A 4MDCA 2BTOT 4PGTA 4GRFA 5G30A 3EU4A 1F3BA 1EOHA 4JR4A 2PVQA 3UBKA 2IMEA 1GNWA 1PX6A 2IMIA 4K1FA 1GL8A 1V57A 1XVQA 4TXVA 3F6FA 2AUVA 4K7IA 1G0TA 3I69A 1XG8A 3CXGA 5DDLA 4XRAA 1BX9A 1AC1A 3F6DA 3GH6A 3GV1A 5EY6A 11GSA 1YEXA 2DJ3A 3ZITA 3LFLA 2F3MA 4KH7A 1W89A 5IIZA 4HZ4A 3K8NA 2GT5A 4BVXB 4PUFC 1X9SB 5IOXA 4KNDA 9GSSA 5EL8A 1MEKA 3AY8A 1J08A 1F6MC 1FB0A 7GSSA 1XWCA 4LMWA 5ECMB 1AW9A 3I9V2 1K0CA 5IMFA 2LKUA 2H73A 3M8NA 1EP7A 1M3JA 5G1KA 2HI7A 2B3SA 3HJOA 3VLNA 2B1KA 1OC8A 5J41A 3D21A 1M99A 2C3NA 3GFKA 4GSNA 2CX3A 1G7EA 5G1LA 2R5GA 3QDNA 4OO5A 4X43A 1H75A 4PUAA 4CDOA 14GSA 1I5GA 4IP6A 1WE0A 3A2XA 2YPMA 3E3EA 4G19A 5F06A 3DWVA 1EEJA 1OAZA 1Z5YE 4YQUA 5CNWA 4GSTA 1E2YA 2XBQA 5D96A 4N0VA 1IYIA 1VGLA 4O5QA 5KN0A 5ECPB 2VUPA 1EGOA 4PQIA 4WBJA 1A8YA 4IVFA 4IBPA 1SK1A 1VF1A 1G7OA 1CQHA 4E8EA 2PU9C 4KGIA 5IMCA 3CQFA 2H0GA 2GZZA 1R26A 5HR0A 3FZAA 3WYWA 3H1NA 6GSXA 2QKEA 4YKGA 3TKQA 1DBYA 1ZZYA 2TRXA 2QC7A 3KM6A 2H74A 2R0PA 3UBLA 5ECLB 1JZOA 1R7HA 4V2LA 5EVOA 4EUYA 3QD9A 5F0GA 2C80A 1OC9B 1GLQA 4K6XA 4ILFA 2KP1A 4E8HA 2LNTA 2FD3A 3OR5A 3MDKA 5IMZA 3BCIA 2H70A 12GSA 3EYTA 3D6IA 3LXTA 1TJDA 1S3CA 4FO5A 1SYXA 2VCXA 2KLXA 2MYGA 2YV7A 2IFQA 3TKSE 1B8XA 4K2XA 3FR6A 2FWEA 3US3A 2DC5A 19GSA 2DJ0A 5J9CA 3VURA 2B1LA 1V98A 1TK0B 3UL3A 3FZ4A 3IC8A 3M1GA 3HKRA 2ZCTA 1GSSA 4TVEA 4HSCX 6GSUA 1HNBA 2B5EA 4L8EA 2GDRA 1PN0A 4POBA 2N5BA 2HSHA 4IS0A 2V6OA 2L57A 4K0GA 4TW5A 3IPZA 2O8VB 1M3IA 4WXTA 1A8LA 1BG5A 3HVVA 1ZYEA 3CRUA 1N8JA 4G9HA 1ZYPA 2K8VA 2WB9A 5DBQA 1XW9A 4KB3A 4MZCA 1EOGA 5JWRB 17GSA 1ZGNA 2EIQA 2HRFA 3FY7A 4IGJA 4O32A 4NAXA 2O7KA 3QAGA 1ERWA 4CY8A 2TIRA 2VLTA 5AN1A 1HNAA 3L9SA 2H8LA 3C1RA 5HFIA 3ZFLA 2GGTA 4XS4B 2JU5A 4K5SA 1ZL9A 2NPBA 3LYKA 2F8AA 3VI7A 4XS1A 1JZWA 4KA0A 4MPFA 3EPTA 1HNCA 1SL2B 5J9BA 5COHA 2X8GA 5ECKB 3MIXA 4OCEA 2K9FA 2QA1A 1GUKA 2LS5A 4TKYA 4BWQA 4EKZA 4Q5FA 1PQNA 2VM1A 4MA9A 4EIPA 1YJ6A 4IQAA 1U3AA 4ZBBA 1V9WA 5F07A 2DSAA 1GUHA 1H4OA 3HD5A 1FOVA 2VLVA 3H93A 1RK4A 3CRTA 5B8AA 3ZFBA 4ZIJA 3UEMA 1TU8A 3J7Yk 2YANA 2H75A 2MBSA 3Q19A 4BL7A 5DVBA 1XBSA 3G9BA 1SK0A 1GUMA 3ZMKA 3HYPA 1MTCA 1K0OA 2IMKA 2HYXA 2CZ3A 3TRQA 1TKDB 1GWCA 4O7HA 1FVJA 4MCUA 22GSA 2GZPA 4BVYA 3FKFA 2HZEB 4DSSB 1TTZA 4K0NA 5CREA 2OA7A 5IMDA 3P90A 3GKXA 1NHYA 2LNSA 5ECNB 5F05A 2CT6A 4IW9A 1BJXA 4Z2TA 4JBBA 2VD1A 4ACSA 3IV4A 2RIIA 2DJKA 1FB6A 1XXUA 2WFCA 3GNJA 5IM9A 2B5XA 5D9VA 3DYRA 3TKRA 2HT9A 2YWMA 4MLYA 2QA2A 1UN2A 4G0LA 3RPPA 2BMXA 3J7Yb 3KMNA 4K5RA 4EDYA 5CO3A 2OADA 4D73A 4KSMA 1KBNA 1EGRA 3CTGA 4ULXA 3C71A 1ON4A 1YZXA 4HU7A 2V6KA 3ME7A 1X0RA 1O8XA 1FHEA 4TRXA 3VK9A 2CAIA 1A23A 2IIYA 1G6WA 3TJBA 1BYEA 3LGCA 2OACA 3CBUA 2WCIA 2OBIA 4TXOB 5ABRA 4ZB8A 4KCEA 4PQ1A 2P5RA 4TN8A 4USSA 3LXZA 2FWFA 3MWHA 2C1YA 1S3AA 1TRUA 3F3RA 5IMAA 2X4AA 2G2QA 1OE8A 1PRXA 2REMA 1G6YA 2LRTA 2JADA 3FMWA 3IRAA 2YWOA 4RQXA 4QL9A 5E59A 2TRCP 1YDKA 1JZDA 5DJLA 1JLWA 2LEGA 1PA3A 4GSSA 2LRNA 2VL9A 2GSRA 3FEUA 4K9ZA 1WOUA 6GSSA 4Q5RA
chains in the Genus database with same CATH topology
1TRWA 1A0RP 1TDIA 5ID2B 2P5QA 1O85A 2H1AA 4EL1A 1WMJA 4ML6A 4IP1A 4MH3A 2J23A 1Q98A 5HFKA 1BEDA 4Z2UA 2WULA 4POLA 4DSRA 4OFTA 3P8WA 2R3XA 4JEDA 4HJ2A 3F3QA 6GSYA 1F2EA 4K2DA 1T4YA 3IXRA 1X5DA 1AQWA 3I6AA 2HXKA 4EC0A 4O92A 3EINA 2LSTA 1FAAA 2O85A 3EURA 4IKHA 3IHQA 1OC9A 1QMVA 1VRSD 3L78A 4MK3A 5EPFA 2IMDA 2CQ9A 1QXHA 3UJ1A 1I9DA 3QR6A 4FYBA 1SKWB 2YV9A 2OJLA 3EMXA 3EWLA 3D22A 4PNGA 3CSJA 3DVXA 2FNOA 2JZRA 1U3IA 2FGXA 3BJ5A 2FUG2 1XWGA 3GSSA 3P2AA 4NPBA 4DEJA 3FK8A 4IN0A 2LUSA 1YF0A 2L6CA 3FW2A 1R5PA 1VF4A 4WKWA 3KXOA 2HSYA 3UVTA 3O3TA 2V41A 1W4VA 2HLSA 3HDCA 4FYCA 3PGTA 3FR9A 4KDXA 2OE3A 5INYA 4QQ7A 3LW9A 4HU9A 3ZLPA 2H71A 2B7KA 3ERGA 1PL2A 1U87A 5DAKA 4LA1A 3LEFA 3H8QA 3Q6OA 2FWGA 2X8HA 3GKKA 1UA5A 3GTUB 2MMNA 4O5UA 1K0NA 2G0FA 2MMAA 1EWXA 1EV9A 2FLSA 2C0DA 3O6TA 2WZ9A 1F9MA 3ISOA 2LJRA 3SWLA 5HR1A 2GS3A 2MZCA 5DALB 1T3BA 1ZYNA 2IWTA 1FVKA 3PR8A 5ECOB 1TK8B 13GSA 2VCVA 1T7PB 3IHGA 1SD9A 1URMA 4POKA 3QMXA 3GYKA 1ERTA 4YH2A 3CSIA 3TUEA 1YKCA 2HZFA 1SYRA 1XZOA 2LJAA 4PTSA 4EE0A 2YWIA 1SENA 2L5LA 5H5SA 3KH9A 4I2TA 2PPTA 1KTEA 3QCPA 3MYDA 3I43A 3EVIA 5G5EA 4WETA 3TDGA 4XCSA 3UMAA 1PKZA 1YEPA 2KUCA 3F4TA 2XHFA 4MZBA 2GSQA 3HY2A 4MMMA 3LJRA 3VWWA 4EO3A 5B6MA 4NMUA 4I97A 3KEBA 3MSZA 2VLUA 4KE3A 3M3MA 3FR3A 4GXZA 4PURA 3DMLA 3V1WA 1LJRA 3TCOA 2PWJA 1GSQA 1M2BA 4GQCA 5ECQB 4X4JA 4KDYA 3IE3A 3C1SA 2E7PA 2A2SA 5IPGA 4MF6A 3QAWA 2RLIA 4ZL7A 3HCZA 3IDVA 4N30A 5FT3A 4WR4A 2X8CA 2HFDA 1PGTA 2MMZA 2VOCA 3DD3A 1GNEA 1VF3A 4QL7A 20GSA 1YQ1A 3C7MA 2ALBA 2H6XA 3LORA 1K0AA 1QQ2A 1XOBA 2R6KA 1A0FA 1WP0A 4ZBDA 2ON5A 2HRAA 5AGYA 3IR4A 1NHOA 1C72A 3ED3A 5HFGA 1R4WA 3P7XA 4ECBA 4GQFA 2NTOA 4ZB9A 4HS1A 2HE3A 4MPGA 1RQMA 4J2FA 3APOA 3BOAA 2R0GA 2J9HA 5KN3A 4I8BA 1T1VA 3BD2A 4CY6A 5CP1A 3TJFA 3KJYA 3PPUA 5CRHA 1JLVA 2A2PA 3CTFA 3IAM2 2VL2A 1GTIA 3GURA 4WR5A 6GSWA 1NSWA 2L4CA 3A2WA 2XBIA 3R3EA 2ON7A 3VWXA 2R2JA 5KN2A 1F37A 3CSHA 4GCIA 2WJUA 3F63A 3CMIA 2R4VA 4GF0A 4J56E 4TR0A 1RW1A 2VCWA 1EP8A 2M80A 1J9BA 3GMFA 5IOWA 3RHCA 2IL3A 5D9WA 2CVDA 2DJJA 1A2MA 4WF4A 3WGDA 1Z7PA 4GTUA 2HRKA 3HZ4A 2DIYA 1PN9A 2CX4A 2DIZA 2YJ7A 2VL3A 4TR1A 3W8JA 2I81A 4OFNA 3M9KA 3UAPA 2VCTA 1OKDA 2DMLA 3GKNA 4V1Ap 2O89A 3DXBA 5L71A 4KCAA 2L5OA 3GX0A 1SL0B 10GSA 1AUCA 1OC3A 5J3RA 4TR4A 1NW2A 2GVPA 4HQZA 1SJZA 5JCWA 5D9XA 2M46A 3IK7A 1V58A 4ZL9A 1XOAA 4AGSA 1PX7A 1Z6NA 5D9TA 2YWNA 1WPIA 2XC2A 1ZOFA 1QK8A 2CV4A 3KTLA 2OE0A 4HJMA 4N11A 3HHVA 1TK5B 3MNGA 1JHBA 2H72A 1ZYQB 3H4KA 3IAS2 2IN3A 4L0WA 5H5RA 1KEBA 2FY6A 4AJ7A 5G5FA 5JWOB 1M2AA 4Q5NA 1LBKA 4P3YB 2YP6A 2KP2A 3L9UA 4Z7XA 2H66A 2K18A 3GL5A 4NV2A 1ACVA 1Y6EA 4AF2A 1TP9A 2JZSA 2YN1A 2IFQB 1T8EB 3GX8A 4KUNA 4ZL8A 1QFNA 4FQUA 4DSQA 2OKAA 3SBCA 3S9FA 4KAEA 5ECIB 1V2AA 4PNFA 4XIHA 1GP1A 2GQMA 1HQOA 3KP9A 3ERFA 4PX1A 3TB2A 3TKSC 4BVXA 1ABAA 4BWSA 3HVSA 2IPAA 1K3OA 1GSDA 3IOSA 3UOMA 1MDJA 5AISA 1ZMAA 1Q4JA 3GL3A 3ZTLA 3ZZXA 1GSEA 1YKAA 2VCZA 5JWQB 1Z7RA 1B4QA 1EV4A 1THOA 4ZB6A 2PVOC 1AQXA 1O6JA 1TRSA 2EIOA 2O87A 5ENUA 1QGVA 3HXSA 2H0IA 1TOFA 1J0FA 5ECRB 1K0MA 4YKFA 3KGKA 3KTBA 4PXOA 5AIVA 3ZREA 4RI6A 4BA7A 3A2VA 1HYUA 1MD3A 2PBJA 5CAXA 1AAZA 5J5NA 4EXJA 3PINA 2VL2C 2RUFA 3GRXA 2L6DA 3DVWA 1OYJA 3HJPA 5A5KA 2WGRA 4POMA 3TRXA 3UVHA 6GSVA 1K0DA 2MMOA 3ZMLA 1WWJA 2GLRA 2C4JA 4NHZA 1O8WA 3GN3A 5DCHA 2DLXA 4OFMA 3KZQA 3KH7A 2EIRA 1GTUA 3LSZA 4I6XA 4GLTA 2QSIA 2H19A 5IPHA 4XS6A 5BMUA 1Z9HA 5DCGA 3WGEA 3EU3A 4ECCA 2VM2A 2Z9SA 4HUAA 2NDOA 4MJCA 4BL7B 4ICYA 1M7TA 1O81A 2KOKA 3G7JA 2VO4A 3D5JA 2H01A 1SJIA 1SU9A 1SKSB 3GSTA 4F9ZA 1XFLA 4XHMA 1YF1A 1O7UA 3EE2A 4BVYB 5ECSA 2GTUA 1GSYA 2FHEA 1PD21 1Z3EA 3GHAA 2I3YA 1WJKA 1GLPA 3WD6A 5KOWA 1X9WB 1DE2A 2HSMA 3ZIVA 1XWKA 3VPQA 3VI5A 1MDIA 2GSSA 3LYPA 2CA8A 2A4HA 2VD0A 3D4TA 4WEYA 1A24A 18GSA 4MNNA 4G10A 4IJIA 4ECIA 3UARA 2CZ2A 4G0IA 3KD0A 1A2JA 4D73B 4OD7A 2C0GA 4JE1A 3QOUA 4HQSA 2EC4A 5ELAA 1N2AA 3ZVJA 5JCGA 4MP4A 3F9UA 1OKTA 1PSQA 2H1BA 1M9AA 2I9HA 3N9JA 1M9BA 4CW9A 4X1UA 1M0UA 4V1Ag 5GAPD 4EVMA 2D2ZA 4N0ZA 1ZCPA 4F0BA 3ERWA 3F0IA 3HJMA 2DJ1A 3H79A 1FG4A 3M9JA 3IK9A 5IO2A 5GAND 2GQLA 1GTBA 2LTKA 2FCHA 4I2UA 3ZL5A 2ZNMA 1ST9A 2VCQA 2GT6A 4K7NA 1XW5A 2YZUA 4FIWA 3U6VA 5LNKe 2LQQA 4XS4A 1Y25A 3LG6A 1B4PA 1PL1A 3CYNA 3TGZA 3KP8A 4ZILA 4YAVA 1M2DA 5D73A 3E0UA 3A5IA 4NHWA 3TRPA 4IHUA 2QGVA 2VIMA 2YOIA 5C04A 2B5YA 1SD8A 3FRCA 5B8BA 2DBCA 5GZZB 2B6MA 1WIKA 3W6GA 4RUVA 3F8UA 2PGTA 3WGXA 3L9VA 4O5RA 5LD0A 1B48A 4HEA2 4F03A 4XTSA 1S3DA 1F3AA 2R0CA 3FZ5A 5B6NA 2P31A 4BPYA 3RDWA 2M72A 3VPTA 16GSA 1Z6MA 3NOFA 1TXXA 1VF2A 1SKRB 2YNXA 1B9YC 4OCFA 3NZNA 1TI1A 3L4NA 2HZEA 2X99A 4IQ1A 5D8IA 4DSSA 1XCCA 4OWYA 2H1GA 1GULA 3DKSA 3LQ7A 4CHSA 4DVCA 3M0FA 1T4ZA 1X5EA 3G7IA 3TOTA 3U5RE 3TKSA 2XPEA 1JFUA 5F8BA 2N5FA 3D0ZA 3MAKA 4MZWA 4K8MA 3LWAA 1USBA 1O73A 3BCKA 1XVWA 2H76A 5D93A 2LJKA 4MABA 3DIEA 2GSTA 3FHKA 3GA4A 3IBHA 2R37A 1UC7A 2KHPA 2OE1A 5FHIA 1ERVA 2H30A 1B9XC 4AJ8A 2PMTA 2V1MA 2OBKA 2VAFA 3WT2A 3RBTA 3R2QA 4V2NA 2JSYA 3L0HA 1ERUA 4JU5A 5ECHB 5CRGA 1THXA 5AIXA 2PN8A 2JZTA 4JRRA 2CVBA 3VWUA 4LL4B 2C8UA 4KDUA 4L5LA 3RPNA 2ES7A 1BAYA 1UVZA 2I4AA 3Q74A 5G31A 5KEJA 4TXOA 1OVNA 3A5WA 1ILOA 5DQYA 3TOUA 2PERA 5DAKB 4MJEA 4L0UA 4K7OA 3F4SA 3N5OA 4EDZA 5ELGA 2IJYA 4HZ2A 1TW9A 2MBTA 3EC3A 3NIVA 4MJBA 2YCDA 4NWYA 5CRDA 1TRVA 2P0GA 2AJQB 3ZYWA 3VWVA 5C00A 3GKMA 1XWBA 2A2RA 2F8FA 2GZYA 3GIXA 2FWHA 2C0EA 1SK2A 1XPVA 4LL1B 5CYYA 1DUGA 1K3LA 2BJXA 3VFIA 1SJ6A 4MF5A 4YQMA 3BBYA 3KMOA 2YJHA 4ZBAA 3QAVA 4I5QA 5IO0A 2LRCA 2K8SA 3APQA 5ID2A 4XRDA 4MJAA 5IMVA 2L59A 3QPMA 3D4MA 3KCMA 4FH8A 1WRYA 1TI3A 2H0HA 4Z2RA 2C3TA 1U88A 1TU7A 1K0BA 1OE7A 4GWRA 3C73A 1MDKA 2V32A 3E9JB 2DJ2A 2WS2A 4HI7A 4KF9A 5G2ZA 4YQVA 1LU4A 1K3YA 2JACA 4L5OA 3Q18A 2E2GA 3GH9A 1IYHA 5JCUA 2I1UA 2AB6A 3RAZA 1EZKA 2V2GA 1AXDA 5GSSA 4RQRA 4A5PA 1GH2A 3HZ8A 5DQSA 2A4VA 4KW6A 4ID0A 2NVLA 5J4UA 1QUWA 4N10A 4MF7A 1PKWA 1GSUA 5GSTA 4TOPA 1X5CA 1FW1A 1ML6A 1X9MB 3JCML 3A3TA 5FWGA 3ZIJA 4EIQA 3WT1A 4F0CA 4ZXGA 3IC4A 5HR2A 5A4VA 1R5AA 5A4WA 1JZRA 2C3QA 2FA8A 3F4RA 2DKHA 3TJGA 1KNGA 3IA1A 1FOHA 2F51A 3ME8A 2DMMA 2WRTA 1MD4A 4MH2A 4OMVA 1GSFA 2AV4A 4KSOA 3TJKA 5B7CA 1DSBA 4YAPA 4X0XA 4G0KA 2XPDA 5E4WA 2AYTA 1AQVA 2X49A 5KN1A 2HNLA 1HD2A 2L4QA 3W8SA 1GTAA 2AAWA 2UZ8A 1XIYA 1BQ7A 2IMFA 3FYGA 4Q5QA 3ZRDA 4LMVA 1SL1B 4J57E 4RI7A 3HA9A 3EMPA 3GTUA 2HRNA 4WF5A 1T00A 1EEMA 5H5QA 3GUSA 4NXIA 4EF0A 2N5AA 1XW6A 4LLRA 3G7YA 2FA4A 4HOJA 3APSA 2B7JA 1AIUA 3ZVJD 2LV3A 5DALA 3TJJA 2H6ZA 5A4UA 3PH9A 2JL4A 2NBSA 4V2MA 4G2EA 4WBRD 3DGQA 2AHEA 2F9SA 1DE1A 6GSTA 3QFBC 4FYUA 4JR6A 2PUKC 1A2LA 4TR1B 4KX4A 2JSZA 1U6TA 2WDUA 4IJ3A 1YY7A 2E2MA 3O76A 3TKPA 5CRWA 1PMTA 2RUEA 2GQKA 5DJMA 4AJ6A 2H1DA 4IELA 1XWAA 4H86A 3UIWA 4NV5A 2CVKA 2CAQA 2H6YA 3DRNA 2K6VA 1E6BA 4PQHA 5IQYA 5LCZA 2E0QA 4TR3A 2YZHA 1CQGA 5HQPA 3KIJA 5BRTA 2ZUPA 2RM6A 4OO4A 4ISDA 2LQOA 2X64A 5KOXA 3FZ9A 4HDEA 3DEXA 8GSSA 3C8EA 2DKIA 3HVXA 1NM3A 4JZQA 2C0FA 1V40A 4ECJA 5HR3A 2RM5A 1GRXA 1FO5A 3QFAC 3RHBA 4ML1A 4F2IA 4F82A 4MDCA 2BTOT 4PGTA 4GRFA 5G30A 3EU4A 1F3BA 1EOHA 4JR4A 2PVQA 3UBKA 2IMEA 1GNWA 1PX6A 2IMIA 4K1FA 1GL8A 1V57A 1XVQA 4TXVA 3F6FA 2AUVA 4K7IA 1G0TA 3I69A 3CXGA 5DDLA 4XRAA 1BX9A 1AC1A 3F6DA 3GH6A 3GV1A 5EY6A 11GSA 1YEXA 2DJ3A 3ZITA 3LFLA 2F3MA 4KH7A 1W89A 5IIZA 4HZ4A 3K8NA 2GT5A 4BVXB 4PUFC 1X9SB 5IOXA 4KNDA 9GSSA 5EL8A 1MEKA 3AY8A 1J08A 1F6MC 1FB0A 7GSSA 1XWCA 4LMWA 5ECMB 1AW9A 3I9V2 1K0CA 5IMFA 2LKUA 2H73A 3M8NA 1EP7A 5G1KA 2HI7A 2B3SA 3HJOA 3VLNA 2B1KA 1OC8A 5J41A 3D21A 1M99A 2C3NA 3GFKA 4GSNA 2CX3A 1G7EA 5G1LA 2R5GA 3QDNA 4OO5A 4X43A 1H75A 4PUAA 4CDOA 14GSA 1I5GA 4IP6A 1WE0A 3A2XA 2YPMA 3E3EA 4G19A 5F06A 3DWVA 1EEJA 1OAZA 1Z5YE 4YQUA 5CNWA 4GSTA 1E2YA 2XBQA 5D96A 4N0VA 1IYIA 1VGLA 4O5QA 5KN0A 5ECPB 2VUPA 1EGOA 4PQIA 4WBJA 1A8YA 4IVFA 4IBPA 1SK1A 1VF1A 1G7OA 1CQHA 4E8EA 2PU9C 4KGIA 5IMCA 2H0GA 2GZZA 1R26A 5HR0A 3FZAA 3WYWA 3H1NA 6GSXA 2QKEA 4YKGA 3TKQA 1DBYA 1ZZYA 2TRXA 2QC7A 3KM6A 2H74A 2R0PA 3UBLA 5ECLB 1JZOA 1R7HA 4V2LA 5EVOA 4EUYA 3QD9A 5F0GA 2C80A 1OC9B 1GLQA 4K6XA 4ILFA 2KP1A 4E8HA 2LNTA 2FD3A 3OR5A 3MDKA 5IMZA 3BCIA 2H70A 12GSA 3EYTA 3D6IA 3LXTA 1TJDA 1S3CA 4FO5A 1SYXA 2VCXA 2KLXA 2MYGA 2YV7A 2IFQA 3TKSE 1B8XA 4K2XA 3FR6A 2FWEA 3US3A 2DC5A 19GSA 2DJ0A 5J9CA 3VURA 2B1LA 1V98A 1TK0B 3UL3A 3FZ4A 3IC8A 3M1GA 3HKRA 2ZCTA 1GSSA 4TVEA 6GSUA 1HNBA 2B5EA 4L8EA 2GDRA 1PN0A 4POBA 2N5BA 2HSHA 4IS0A 2V6OA 2L57A 4K0GA 4TW5A 3IPZA 2O8VB 4WXTA 1A8LA 1BG5A 3HVVA 1ZYEA 3CRUA 1N8JA 4G9HA 1ZYPA 2K8VA 2WB9A 5DBQA 1XW9A 4KB3A 4MZCA 1EOGA 5JWRB 17GSA 1ZGNA 2EIQA 2HRFA 3FY7A 4IGJA 4O32A 4NAXA 2O7KA 3QAGA 1ERWA 4CY8A 2TIRA 2VLTA 5AN1A 1HNAA 3L9SA 2H8LA 3C1RA 5HFIA 3ZFLA 2GGTA 4XS4B 2JU5A 4K5SA 1ZL9A 2NPBA 3LYKA 2F8AA 3VI7A 4XS1A 1JZWA 4KA0A 4MPFA 3EPTA 1HNCA 1SL2B 5J9BA 5COHA 2X8GA 5ECKB 3MIXA 4OCEA 2K9FA 2QA1A 1GUKA 2LS5A 4TKYA 4BWQA 4EKZA 4Q5FA 1PQNA 2VM1A 4MA9A 4EIPA 1YJ6A 4IQAA 1U3AA 4ZBBA 1V9WA 5F07A 2DSAA 1GUHA 1H4OA 3HD5A 1FOVA 2VLVA 3H93A 1RK4A 3CRTA 5B8AA 3ZFBA 4ZIJA 3UEMA 1TU8A 3J7Yk 2YANA 2H75A 2MBSA 3Q19A 4BL7A 5DVBA 1XBSA 3G9BA 1SK0A 1GUMA 3ZMKA 3HYPA 1MTCA 1K0OA 2IMKA 2HYXA 2CZ3A 3TRQA 1TKDB 1GWCA 4O7HA 1FVJA 4MCUA 22GSA 2GZPA 4BVYA 3FKFA 2HZEB 4DSSB 1TTZA 4K0NA 5CREA 2OA7A 5IMDA 3P90A 3GKXA 1NHYA 2LNSA 5ECNB 5F05A 2CT6A 4IW9A 1BJXA 4Z2TA 4JBBA 2VD1A 4ACSA 3IV4A 2RIIA 2DJKA 1FB6A 1XXUA 2WFCA 3GNJA 5IM9A 2B5XA 5D9VA 3DYRA 3TKRA 2HT9A 2YWMA 4MLYA 2QA2A 1UN2A 4G0LA 3RPPA 2BMXA 3J7Yb 3KMNA 4K5RA 4EDYA 5CO3A 2OADA 4D73A 4KSMA 1KBNA 1EGRA 3CTGA 4ULXA 3C71A 1ON4A 1YZXA 4HU7A 2V6KA 3ME7A 1X0RA 1O8XA 1FHEA 4TRXA 3VK9A 2CAIA 1A23A 2IIYA 1G6WA 3TJBA 1BYEA 3LGCA 2OACA 3CBUA 2WCIA 2OBIA 4TXOB 5ABRA 4ZB8A 4KCEA 4PQ1A 2P5RA 4TN8A 4USSA 3LXZA 2FWFA 3MWHA 2C1YA 1S3AA 1TRUA 3F3RA 5IMAA 2X4AA 2G2QA 1OE8A 1PRXA 2REMA 1G6YA 2LRTA 2JADA 3FMWA 3IRAA 2YWOA 4RQXA 4QL9A 5E59A 2TRCP 1YDKA 1JZDA 5DJLA 1JLWA 2LEGA 1PA3A 4GSSA 2LRNA 2VL9A 2GSRA 3FEUA 4K9ZA 1WOUA 6GSSA 4Q5RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TRW A;  1A0R P;  1TDI A;  5ID2 B;  2P5Q A;  1O85 A;  2H1A A;  4EL1 A;  1WMJ A;  4ML6 A;  4IP1 A;  4MH3 A;  2J23 A;  1Q98 A;  5HFK A;  1BED A;  2WUL A;  4POL A;  4DSR A;  4OFT A;  3P8W A;  2R3X A;  4JED A;  4HJ2 A;  3F3Q A;  6GSY A;  1F2E A;  4K2D A;  1T4Y A;  3IXR A;  1X5D A;  1AQW A;  3I6A A;  2HXK A;  4EC0 A;  4O92 A;  3EIN A;  2LST A;  1FAA A;  2O85 A;  3EUR A;  4IKH A;  3IHQ A;  1OC9 A;  1QMV A;  1VRS D;  3L78 A;  4MK3 A;  5EPF A;  2IMD A;  2CQ9 A;  1QXH A;  3UJ1 A;  1I9D A;  3QR6 A;  4FYB A;  1SKW B;  2YV9 A;  2OJL A;  3EMX A;  3EWL A;  3D22 A;  4PNG A;  3CSJ A;  3DVX A;  2FNO A;  2JZR A;  1U3I A;  2FGX A;  3BJ5 A;  2FUG 2;  1XWG A;  3GSS A;  3P2A A;  4NPB A;  4DEJ A;  3FK8 A;  4IN0 A;  2LUS A;  1YF0 A;  2L6C A;  3FW2 A;  1R5P A;  1VF4 A;  4WKW A;  3KXO A;  2HSY A;  3UVT A;  3O3T A;  2V41 A;  1W4V A;  2HLS A;  3HDC A;  4FYC A;  3PGT A;  3FR9 A;  4KDX A;  2OE3 A;  5INY A;  4QQ7 A;  4HU9 A;  3ZLP A;  2H71 A;  2B7K A;  3ERG A;  1PL2 A;  1U87 A;  5DAK A;  4LA1 A;  3LEF A;  3H8Q A;  3Q6O A;  2FWG A;  2X8H A;  3GKK A;  1UA5 A;  3GTU B;  2MMN A;  1K0N A;  2G0F A;  2MMA A;  1EWX A;  1EV9 A;  2FLS A;  2C0D A;  3O6T A;  2WZ9 A;  1F9M A;  3ISO A;  2LJR A;  3SWL A;  5HR1 A;  2GS3 A;  2MZC A;  5DAL B;  1T3B A;  2IWT A;  1FVK A;  3PR8 A;  5ECO B;  1TK8 B;  13GS A;  2VCV A;  1T7P B;  1SD9 A;  1URM A;  4POK A;  3QMX A;  3GYK A;  1ERT A;  4YH2 A;  3CSI A;  3TUE A;  1YKC A;  2HZF A;  1SYR A;  1XZO A;  2LJA A;  4EE0 A;  2YWI A;  1SEN A;  2L5L A;  5H5S A;  3KH9 A;  4I2T A;  2PPT A;  1KTE A;  3QCP A;  3I43 A;  3EVI A;  5G5E A;  4WET A;  3TDG A;  4XCS A;  3UMA A;  1PKZ A;  1YEP A;  2KUC A;  3F4T A;  2XHF A;  4MZB A;  2GSQ A;  3HY2 A;  4MMM A;  3LJR A;  3VWW A;  4EO3 A;  5B6M A;  4NMU A;  4I97 A;  3KEB A;  3MSZ A;  2VLU A;  4KE3 A;  3M3M A;  3FR3 A;  4GXZ A;  4PUR A;  3DML A;  3V1W A;  1LJR A;  3TCO A;  2PWJ A;  1GSQ A;  1M2B A;  4GQC A;  5ECQ B;  4KDY A;  3IE3 A;  3C1S A;  2E7P A;  2A2S A;  5IPG A;  4MF6 A;  3QAW A;  2RLI A;  4ZL7 A;  3HCZ A;  3IDV A;  4N30 A;  5FT3 A;  4WR4 A;  2X8C A;  2HFD A;  1PGT A;  2MMZ A;  2VOC A;  3DD3 A;  1GNE A;  1VF3 A;  4QL7 A;  20GS A;  1YQ1 A;  3C7M A;  2ALB A;  2H6X A;  3LOR A;  1K0A A;  1QQ2 A;  1XOB A;  2R6K A;  1A0F A;  1WP0 A;  4ZBD A;  2ON5 A;  5AGY A;  3IR4 A;  1NHO A;  1C72 A;  3ED3 A;  5HFG A;  1R4W A;  3P7X A;  4ECB A;  4GQF A;  2NTO A;  4ZB9 A;  4HS1 A;  2HE3 A;  4MPG A;  1RQM A;  3BOA A;  3APO A;  4J2F A;  2J9H A;  5KN3 A;  4I8B A;  1T1V A;  3BD2 A;  5CP1 A;  3TJF A;  3KJY A;  5CRH A;  1JLV A;  3CTF A;  3IAM 2;  2VL2 A;  1GTI A;  3GUR A;  4WR5 A;  6GSW A;  1NSW A;  2L4C A;  3A2W A;  2XBI A;  2ON7 A;  3VWX A;  2R2J A;  5KN2 A;  1F37 A;  3CSH A;  4GCI A;  2WJU A;  3F63 A;  3CMI A;  2R4V A;  4GF0 A;  4J56 E;  4TR0 A;  1RW1 A;  2VCW A;  1EP8 A;  2M80 A;  1J9B A;  3GMF A;  5IOW A;  3RHC A;  2IL3 A;  5D9W A;  2CVD A;  2DJJ A;  1A2M A;  4WF4 A;  3WGD A;  1Z7P A;  4GTU A;  3HZ4 A;  2DIY A;  1PN9 A;  2CX4 A;  2DIZ A;  2YJ7 A;  2VL3 A;  4TR1 A;  3W8J A;  2I81 A;  4OFN A;  3M9K A;  3UAP A;  2VCT A;  1OKD A;  2DML A;  3GKN A;  4V1A p;  2O89 A;  3DXB A;  5L71 A;  4KCA A;  2L5O A;  3GX0 A;  1SL0 B;  10GS A;  1AUC A;  1OC3 A;  5J3R A;  4TR4 A;  1NW2 A;  2GVP A;  4HQZ A;  1SJZ A;  5JCW A;  5D9X A;  2M46 A;  3IK7 A;  1V58 A;  4ZL9 A;  1XOA A;  4AGS A;  1PX7 A;  1Z6N A;  5D9T A;  2YWN A;  1WPI A;  2XC2 A;  1ZOF A;  1QK8 A;  2CV4 A;  3KTL A;  2OE0 A;  4HJM A;  4N11 A;  3HHV A;  1TK5 B;  3MNG A;  1JHB A;  2H72 A;  1ZYQ B;  3H4K A;  3IAS 2;  2IN3 A;  4L0W A;  5H5R A;  1KEB A;  2FY6 A;  4AJ7 A;  5G5F A;  5JWO B;  1M2A A;  4Q5N A;  1LBK A;  4P3Y B;  2YP6 A;  2KP2 A;  3L9U A;  4Z7X A;  2H66 A;  2K18 A;  3GL5 A;  4NV2 A;  1ACV A;  1Y6E A;  4AF2 A;  1TP9 A;  2JZS A;  2YN1 A;  2IFQ B;  1T8E B;  3GX8 A;  4KUN A;  4ZL8 A;  1QFN A;  4DSQ A;  2OKA A;  3SBC A;  3S9F A;  4KAE A;  5ECI B;  1V2A A;  4PNF A;  4XIH A;  1GP1 A;  2GQM A;  1HQO A;  3KP9 A;  3ERF A;  4PX1 A;  3TB2 A;  3TKS C;  4BVX A;  1ABA A;  4BWS A;  3HVS A;  2IPA A;  1K3O A;  1GSD A;  3IOS A;  3UOM A;  1MDJ A;  5AIS A;  1ZMA A;  1Q4J A;  3GL3 A;  3ZTL A;  3ZZX A;  1GSE A;  1YKA A;  2VCZ A;  5JWQ B;  1Z7R A;  1B4Q A;  1EV4 A;  1THO A;  4ZB6 A;  2PVO C;  1AQX A;  1O6J A;  1TRS A;  2EIO A;  2O87 A;  5ENU A;  1QGV A;  3HXS A;  2H0I A;  1TOF A;  1J0F A;  5ECR B;  1K0M A;  3KGK A;  3KTB A;  4PXO A;  5AIV A;  3ZRE A;  4RI6 A;  4BA7 A;  3A2V A;  1HYU A;  1MD3 A;  2PBJ A;  5CAX A;  1AAZ A;  5J5N A;  4EXJ A;  3PIN A;  2VL2 C;  2RUF A;  3GRX A;  2L6D A;  3DVW A;  1OYJ A;  3HJP A;  5A5K A;  2WGR A;  4POM A;  3TRX A;  3UVH A;  6GSV A;  1K0D A;  2MMO A;  3ZML A;  1WWJ A;  2GLR A;  2C4J A;  4NHZ A;  1O8W A;  3GN3 A;  5DCH A;  2DLX A;  4OFM A;  3KZQ A;  3KH7 A;  2EIR A;  1GTU A;  3LSZ A;  4I6X A;  4GLT A;  2QSI A;  2H19 A;  5IPH A;  4XS6 A;  1Z9H A;  5DCG A;  3WGE A;  3EU3 A;  4ECC A;  2VM2 A;  2Z9S A;  4HUA A;  2NDO A;  4MJC A;  1M7T A;  1O81 A;  2KOK A;  3G7J A;  2VO4 A;  3D5J A;  2H01 A;  1SJI A;  1SU9 A;  1SKS B;  3GST A;  4F9Z A;  1XFL A;  4XHM A;  1YF1 A;  1O7U A;  3EE2 A;  5ECS A;  2GTU A;  1GSY A;  2FHE A;  1PD2 1;  1Z3E A;  3GHA A;  2I3Y A;  1WJK A;  1GLP A;  3WD6 A;  1X9W B;  1DE2 A;  3ZIV A;  1XWK A;  3VPQ A;  3VI5 A;  1MDI A;  2GSS A;  3LYP A;  2CA8 A;  2VD0 A;  3D4T A;  4WEY A;  1A24 A;  18GS A;  4G10 A;  4IJI A;  4ECI A;  3UAR A;  2CZ2 A;  3KD0 A;  1A2J A;  4D73 B;  4OD7 A;  2C0G A;  4JE1 A;  3QOU A;  4HQS A;  2EC4 A;  5ELA A;  1N2A A;  3ZVJ A;  5JCG A;  4MP4 A;  3F9U A;  1OKT A;  1PSQ A;  2H1B A;  1M9A A;  2I9H A;  3N9J A;  1M9B A;  4CW9 A;  4X1U A;  1M0U A;  4V1A g;  5GAP D;  4EVM A;  2D2Z A;  4N0Z A;  1ZCP A;  4F0B A;  3ERW A;  3F0I A;  3HJM A;  2DJ1 A;  3H79 A;  1FG4 A;  3M9J A;  3IK9 A;  5IO2 A;  5GAN D;  2GQL A;  1GTB A;  2LTK A;  2FCH A;  4I2U A;  3ZL5 A;  2ZNM A;  1ST9 A;  2VCQ A;  2GT6 A;  4K7N A;  1XW5 A;  2YZU A;  4FIW A;  3U6V A;  5LNK e;  2LQQ A;  4XS4 A;  1Y25 A;  3LG6 A;  1B4P A;  1PL1 A;  3CYN A;  3TGZ A;  3KP8 A;  4ZIL A;  4YAV A;  1M2D A;  5D73 A;  3E0U A;  4NHW A;  3TRP A;  4IHU A;  2QGV A;  2VIM A;  2YOI A;  5C04 A;  2B5Y A;  1SD8 A;  3FRC A;  5B8B A;  2DBC A;  5GZZ B;  2B6M A;  1WIK A;  3W6G A;  4RUV A;  3F8U A;  2PGT A;  3WGX A;  3L9V A;  4O5R A;  5LD0 A;  1B48 A;  4HEA 2;  4F03 A;  4XTS A;  1S3D A;  1F3A A;  3FZ5 A;  5B6N A;  2P31 A;  4BPY A;  3RDW A;  2M72 A;  3VPT A;  16GS A;  1Z6M A;  3NOF A;  1TXX A;  1VF2 A;  1SKR B;  2YNX A;  1B9Y C;  4OCF A;  3NZN A;  1TI1 A;  3L4N A;  2HZE A;  2X99 A;  4IQ1 A;  5D8I A;  4DSS A;  1XCC A;  4OWY A;  2H1G A;  1GUL A;  3DKS A;  3LQ7 A;  4CHS A;  4DVC A;  3M0F A;  1T4Z A;  1X5E A;  3G7I A;  3TOT A;  3U5R E;  3TKS A;  2XPE A;  1JFU A;  5F8B A;  2N5F A;  3D0Z A;  3MAK A;  4MZW A;  4K8M A;  3LWA A;  1USB A;  1O73 A;  3BCK A;  1XVW A;  2H76 A;  5D93 A;  2LJK A;  4MAB A;  3DIE A;  2GST A;  3FHK A;  3GA4 A;  3IBH A;  2R37 A;  1UC7 A;  2KHP A;  2OE1 A;  5FHI A;  1ERV A;  2H30 A;  1B9X C;  4AJ8 A;  2PMT A;  2V1M A;  2OBK A;  2VAF A;  3WT2 A;  3RBT A;  3R2Q A;  4V2N A;  2JSY A;  3L0H A;  1ERU A;  4JU5 A;  5ECH B;  5CRG A;  1THX A;  5AIX A;  2PN8 A;  2JZT A;  4JRR A;  2CVB A;  3VWU A;  4LL4 B;  2C8U A;  4KDU A;  4L5L A;  3RPN A;  2ES7 A;  1BAY A;  1UVZ A;  2I4A A;  3Q74 A;  5G31 A;  5KEJ A;  4TXO A;  1OVN A;  3A5W A;  1ILO A;  5DQY A;  3TOU A;  2PER A;  5DAK B;  4MJE A;  4L0U A;  4K7O A;  3F4S A;  3N5O A;  4EDZ A;  5ELG A;  2IJY A;  4HZ2 A;  1TW9 A;  2MBT A;  3EC3 A;  3NIV A;  4MJB A;  2YCD A;  4NWY A;  5CRD A;  1TRV A;  2P0G A;  2AJQ B;  3ZYW A;  3VWV A;  5C00 A;  3GKM A;  1XWB A;  2A2R A;  2F8F A;  2GZY A;  3GIX A;  2FWH A;  2C0E A;  1SK2 A;  1XPV A;  4LL1 B;  5CYY A;  1DUG A;  1K3L A;  2BJX A;  3VFI A;  1SJ6 A;  4MF5 A;  4YQM A;  3BBY A;  3KMO A;  2YJH A;  4ZBA A;  3QAV A;  4I5Q A;  5IO0 A;  2LRC A;  2K8S A;  3APQ A;  5ID2 A;  4XRD A;  4MJA A;  5IMV A;  2L59 A;  3QPM A;  3D4M A;  3KCM A;  4FH8 A;  1WRY A;  1TI3 A;  2H0H A;  2C3T A;  1U88 A;  1TU7 A;  1K0B A;  1OE7 A;  4GWR A;  3C73 A;  1MDK A;  2V32 A;  3E9J B;  2DJ2 A;  2WS2 A;  4HI7 A;  5G2Z A;  4YQV A;  1LU4 A;  1K3Y A;  2JAC A;  4L5O A;  3Q18 A;  2E2G A;  3GH9 A;  1IYH A;  5JCU A;  2I1U A;  2AB6 A;  3RAZ A;  1EZK A;  2V2G A;  1AXD A;  5GSS A;  4RQR A;  1GH2 A;  3HZ8 A;  5DQS A;  2A4V A;  4KW6 A;  4ID0 A;  2NVL A;  5J4U A;  1QUW A;  4N10 A;  4MF7 A;  1PKW A;  1GSU A;  5GST A;  4TOP A;  1X5C A;  1FW1 A;  1ML6 A;  1X9M B;  3JCM L;  3A3T A;  5FWG A;  3ZIJ A;  3WT1 A;  4F0C A;  4ZXG A;  3IC4 A;  5HR2 A;  5A4V A;  1R5A A;  5A4W A;  1JZR A;  2C3Q A;  2FA8 A;  3F4R A;  3TJG A;  1KNG A;  3IA1 A;  2F51 A;  3ME8 A;  2DMM A;  2WRT A;  1MD4 A;  4MH2 A;  4OMV A;  1GSF A;  2AV4 A;  4KSO A;  3TJK A;  5B7C A;  1DSB A;  4YAP A;  4X0X A;  2XPD A;  5E4W A;  2AYT A;  1AQV A;  5KN1 A;  2HNL A;  1HD2 A;  2L4Q A;  3W8S A;  1GTA A;  2AAW A;  1XIY A;  1BQ7 A;  2IMF A;  3FYG A;  4Q5Q A;  3ZRD A;  4LMV A;  1SL1 B;  4J57 E;  4RI7 A;  3HA9 A;  3EMP A;  3GTU A;  2HRN A;  4WF5 A;  1T00 A;  1EEM A;  5H5Q A;  3GUS A;  4NXI A;  4EF0 A;  2N5A A;  1XW6 A;  4LLR A;  3G7Y A;  2FA4 A;  4HOJ A;  3APS A;  2B7J A;  1AIU A;  3ZVJ D;  2LV3 A;  5DAL A;  3TJJ A;  2H6Z A;  5A4U A;  3PH9 A;  2JL4 A;  2NBS A;  4V2M A;  4G2E A;  4WBR D;  3DGQ A;  2AHE A;  2F9S A;  1DE1 A;  6GST A;  3QFB C;  4FYU A;  4JR6 A;  2PUK C;  1A2L A;  4TR1 B;  4KX4 A;  2JSZ A;  1U6T A;  2WDU A;  4IJ3 A;  1YY7 A;  2E2M A;  3O76 A;  3TKP A;  5CRW A;  1PMT A;  2RUE A;  2GQK A;  5DJM A;  4AJ6 A;  2H1D A;  4IEL A;  1XWA A;  4H86 A;  3UIW A;  4NV5 A;  2CVK A;  2CAQ A;  2H6Y A;  3DRN A;  2K6V A;  1E6B A;  4PQH A;  5IQY A;  5LCZ A;  2E0Q A;  4TR3 A;  2YZH A;  1CQG A;  5HQP A;  3KIJ A;  2ZUP A;  2RM6 A;  4OO4 A;  4ISD A;  2LQO A;  2X64 A;  3FZ9 A;  4HDE A;  3DEX A;  8GSS A;  3C8E A;  3HVX A;  1NM3 A;  4JZQ A;  2C0F A;  1V40 A;  4ECJ A;  5HR3 A;  2RM5 A;  1GRX A;  1FO5 A;  3QFA C;  3RHB A;  4ML1 A;  4F2I A;  4F82 A;  4MDC A;  2BTO T;  4PGT A;  4GRF A;  5G30 A;  3EU4 A;  1F3B A;  1EOH A;  4JR4 A;  2PVQ A;  3UBK A;  2IME A;  1GNW A;  1PX6 A;  2IMI A;  4K1F A;  1GL8 A;  1V57 A;  1XVQ A;  4TXV A;  3F6F A;  2AUV A;  4K7I A;  1G0T A;  3I69 A;  3CXG A;  5DDL A;  4XRA A;  1BX9 A;  1AC1 A;  3F6D A;  3GH6 A;  3GV1 A;  5EY6 A;  11GS A;  1YEX A;  2DJ3 A;  3ZIT A;  3LFL A;  2F3M A;  4KH7 A;  1W89 A;  5IIZ A;  4HZ4 A;  3K8N A;  2GT5 A;  4PUF C;  1X9S B;  5IOX A;  4KND A;  9GSS A;  5EL8 A;  1MEK A;  3AY8 A;  1J08 A;  1F6M C;  1FB0 A;  7GSS A;  1XWC A;  4LMW A;  5ECM B;  1AW9 A;  3I9V 2;  1K0C A;  5IMF A;  2LKU A;  2H73 A;  3M8N A;  1EP7 A;  5G1K A;  2HI7 A;  2B3S A;  3HJO A;  3VLN A;  2B1K A;  1OC8 A;  5J41 A;  3D21 A;  1M99 A;  2C3N A;  3GFK A;  4GSN A;  2CX3 A;  1G7E A;  5G1L A;  2R5G A;  3QDN A;  4OO5 A;  4X43 A;  1H75 A;  4PUA A;  4CDO A;  14GS A;  1I5G A;  4IP6 A;  1WE0 A;  3A2X A;  2YPM A;  3E3E A;  4G19 A;  5F06 A;  3DWV A;  1EEJ A;  1OAZ A;  1Z5Y E;  4YQU A;  5CNW A;  4GST A;  1E2Y A;  2XBQ A;  5D96 A;  4N0V A;  1IYI A;  1VGL A;  5KN0 A;  5ECP B;  2VUP A;  1EGO A;  4PQI A;  4WBJ A;  1A8Y A;  4IVF A;  4IBP A;  1SK1 A;  1VF1 A;  1G7O A;  1CQH A;  4E8E A;  2PU9 C;  4KGI A;  5IMC A;  2H0G A;  2GZZ A;  1R26 A;  5HR0 A;  3FZA A;  3WYW A;  3H1N A;  6GSX A;  2QKE A;  3TKQ A;  1DBY A;  1ZZY A;  2TRX A;  2QC7 A;  3KM6 A;  2H74 A;  3UBL A;  5ECL B;  1JZO A;  1R7H A;  4V2L A;  5EVO A;  4EUY A;  3QD9 A;  5F0G A;  2C80 A;  1OC9 B;  1GLQ A;  4K6X A;  4ILF A;  2KP1 A;  4E8H A;  2LNT A;  2FD3 A;  3OR5 A;  3MDK A;  5IMZ A;  3BCI A;  2H70 A;  12GS A;  3EYT A;  3D6I A;  3LXT A;  1TJD A;  1S3C A;  4FO5 A;  1SYX A;  2VCX A;  2KLX A;  2MYG A;  2YV7 A;  2IFQ A;  3TKS E;  1B8X A;  3FR6 A;  2FWE A;  3US3 A;  2DC5 A;  19GS A;  2DJ0 A;  5J9C A;  3VUR A;  2B1L A;  1V98 A;  1TK0 B;  3UL3 A;  3FZ4 A;  3M1G A;  3HKR A;  2ZCT A;  1GSS A;  4TVE A;  6GSU A;  1HNB A;  2B5E A;  4L8E A;  2GDR A;  4POB A;  2N5B A;  2HSH A;  4IS0 A;  2V6O A;  2L57 A;  4K0G A;  4TW5 A;  3IPZ A;  2O8V B;  4WXT A;  1A8L A;  1BG5 A;  3HVV A;  1ZYE A;  3CRU A;  1N8J A;  4G9H A;  2K8V A;  2WB9 A;  5DBQ A;  1XW9 A;  4KB3 A;  4MZC A;  1EOG A;  5JWR B;  17GS A;  1ZGN A;  2EIQ A;  2HRF A;  3FY7 A;  4IGJ A;  4O32 A;  4NAX A;  2O7K A;  3QAG A;  1ERW A;  2TIR A;  2VLT A;  5AN1 A;  1HNA A;  3L9S A;  2H8L A;  3C1R A;  5HFI A;  3ZFL A;  2GGT A;  4XS4 B;  2JU5 A;  1ZL9 A;  2NPB A;  3LYK A;  2F8A A;  3VI7 A;  4XS1 A;  1JZW A;  4KA0 A;  4MPF A;  1HNC A;  1SL2 B;  5J9B A;  5COH A;  2X8G A;  5ECK B;  4OCE A;  2K9F A;  1GUK A;  2LS5 A;  4TKY A;  4BWQ A;  4EKZ A;  4Q5F A;  1PQN A;  2VM1 A;  4MA9 A;  1YJ6 A;  4IQA A;  1U3A A;  4ZBB A;  5F07 A;  1V9W A;  2DSA A;  1GUH A;  1H4O A;  3HD5 A;  1FOV A;  2VLV A;  3H93 A;  1RK4 A;  3CRT A;  5B8A A;  3ZFB A;  4ZIJ A;  3UEM A;  1TU8 A;  3J7Y k;  2YAN A;  2H75 A;  2MBS A;  3Q19 A;  4BL7 A;  5DVB A;  1XBS A;  3G9B A;  1SK0 A;  1GUM A;  3ZMK A;  3HYP A;  1MTC A;  1K0O A;  2IMK A;  2HYX A;  2CZ3 A;  3TRQ A;  1TKD B;  1GWC A;  4O7H A;  1FVJ A;  4MCU A;  22GS A;  2GZP A;  4BVY A;  3FKF A;  2HZE B;  4DSS B;  1TTZ A;  4K0N A;  5CRE A;  2OA7 A;  5IMD A;  3P90 A;  3GKX A;  1NHY A;  2LNS A;  5ECN B;  5F05 A;  2CT6 A;  4IW9 A;  1BJX A;  4JBB A;  2VD1 A;  4ACS A;  3IV4 A;  2RII A;  2DJK A;  1FB6 A;  1XXU A;  2WFC A;  3GNJ A;  5IM9 A;  2B5X A;  5D9V A;  3DYR A;  3TKR A;  2HT9 A;  2YWM A;  4MLY A;  1UN2 A;  3RPP A;  2BMX A;  3J7Y b;  3KMN A;  4EDY A;  5CO3 A;  2OAD A;  4D73 A;  4KSM A;  1KBN A;  1EGR A;  3CTG A;  4ULX A;  3C71 A;  1ON4 A;  1YZX A;  4HU7 A;  2V6K A;  3ME7 A;  1X0R A;  1O8X A;  1FHE A;  4TRX A;  3VK9 A;  2CAI A;  1A23 A;  2IIY A;  1G6W A;  3TJB A;  1BYE A;  3LGC A;  2OAC A;  3CBU A;  2WCI A;  2OBI A;  4TXO B;  5ABR A;  4ZB8 A;  4KCE A;  4PQ1 A;  2P5R A;  4TN8 A;  3LXZ A;  2FWF A;  3MWH A;  2C1Y A;  1S3A A;  1TRU A;  3F3R A;  5IMA A;  2G2Q A;  1OE8 A;  1PRX A;  2REM A;  1G6Y A;  2LRT A;  2JAD A;  3IRA A;  2YWO A;  4RQX A;  4QL9 A;  5E59 A;  2TRC P;  1YDK A;  1JZD A;  5DJL A;  1JLW A;  2LEG A;  1PA3 A;  4GSS A;  2LRN A;  2VL9 A;  2GSR A;  3FEU A;  4K9Z A;  1WOU A;  6GSS A;  4Q5R A; 
#chains in the Genus database with same CATH topology
 1TRW A;  1A0R P;  1TDI A;  5ID2 B;  1S3R A;  2P5Q A;  1O85 A;  2H1A A;  4EL1 A;  1WMJ A;  4ML6 A;  4IP1 A;  4MH3 A;  2J23 A;  1Q98 A;  5HFK A;  1BED A;  4Z2U A;  2WUL A;  4POL A;  4DSR A;  4OFT A;  3P8W A;  2R3X A;  4JED A;  4HJ2 A;  3F3Q A;  6GSY A;  1F2E A;  4K2D A;  1T4Y A;  3IXR A;  1X5D A;  1AQW A;  3I6A A;  2HXK A;  4EC0 A;  4O92 A;  3EIN A;  2LST A;  1FAA A;  2O85 A;  3EUR A;  4IKH A;  3IHQ A;  1OC9 A;  1QMV A;  1VRS D;  3L78 A;  4MK3 A;  5EPF A;  2IMD A;  2CQ9 A;  1QXH A;  3UJ1 A;  1I9D A;  3QR6 A;  4FYB A;  1SKW B;  2YV9 A;  2OJL A;  3EMX A;  3EWL A;  3D22 A;  4PNG A;  3CSJ A;  3DVX A;  2FNO A;  2JZR A;  1U3I A;  2FGX A;  3BJ5 A;  2FUG 2;  1XWG A;  3GSS A;  3P2A A;  4NPB A;  4DEJ A;  3FK8 A;  4IN0 A;  2LUS A;  1YF0 A;  2L6C A;  3FW2 A;  1R5P A;  1VF4 A;  4WKW A;  3KXO A;  2HSY A;  3UVT A;  3O3T A;  2V41 A;  1W4V A;  2HLS A;  3HDC A;  4FYC A;  3PGT A;  3FR9 A;  4KDX A;  2OE3 A;  5INY A;  4QQ7 A;  3LW9 A;  4HU9 A;  3ZLP A;  2H71 A;  2B7K A;  3ERG A;  1PL2 A;  1U87 A;  5DAK A;  4LA1 A;  3LEF A;  3H8Q A;  3Q6O A;  2FWG A;  2X8H A;  3GKK A;  1UA5 A;  3GTU B;  2MMN A;  4O5U A;  1K0N A;  2G0F A;  2MMA A;  1EWX A;  1EV9 A;  2FLS A;  2C0D A;  3O6T A;  2WZ9 A;  1F9M A;  3ISO A;  2LJR A;  3SWL A;  5HR1 A;  2GS3 A;  2MZC A;  5DAL B;  1T3B A;  1ZYN A;  2IWT A;  1FVK A;  3PR8 A;  5ECO B;  1TK8 B;  13GS A;  2VCV A;  1T7P B;  3IHG A;  1SD9 A;  1URM A;  4POK A;  3QMX A;  3GYK A;  1ERT A;  4YH2 A;  3CSI A;  3TUE A;  1YKC A;  2HZF A;  1SYR A;  1XZO A;  2LJA A;  4PTS A;  4EE0 A;  2YWI A;  1SEN A;  2L5L A;  5H5S A;  3KH9 A;  4I2T A;  2PPT A;  1KTE A;  3QCP A;  3MYD A;  3I43 A;  3EVI A;  5G5E A;  4WET A;  3TDG A;  4XCS A;  3UMA A;  1PKZ A;  1YEP A;  2KUC A;  3F4T A;  2XHF A;  4MZB A;  2GSQ A;  3HY2 A;  4MMM A;  3LJR A;  3VWW A;  4EO3 A;  5B6M A;  4NMU A;  4I97 A;  3KEB A;  3MSZ A;  2VLU A;  4KE3 A;  3M3M A;  3FR3 A;  4GXZ A;  4PUR A;  3DML A;  3V1W A;  1LJR A;  3TCO A;  2PWJ A;  1GSQ A;  1M2B A;  4GQC A;  5ECQ B;  4X4J A;  4KDY A;  3IE3 A;  3C1S A;  2E7P A;  2A2S A;  5IPG A;  4MF6 A;  3QAW A;  2RLI A;  4ZL7 A;  3HCZ A;  3IDV A;  4N30 A;  5FT3 A;  4WR4 A;  2X8C A;  2HFD A;  1PGT A;  2MMZ A;  2VOC A;  3DD3 A;  1GNE A;  1VF3 A;  4QL7 A;  20GS A;  1YQ1 A;  3C7M A;  2ALB A;  2H6X A;  3LOR A;  1K0A A;  1QQ2 A;  1XOB A;  2R6K A;  1A0F A;  1WP0 A;  4ZBD A;  2ON5 A;  2HRA A;  5AGY A;  3IR4 A;  1NHO A;  1C72 A;  3ED3 A;  5HFG A;  1R4W A;  3P7X A;  4ECB A;  4GQF A;  2NTO A;  4ZB9 A;  4HS1 A;  2HE3 A;  4MPG A;  1RQM A;  4J2F A;  3APO A;  3BOA A;  2R0G A;  2J9H A;  5KN3 A;  4I8B A;  1T1V A;  3BD2 A;  4CY6 A;  5CP1 A;  3TJF A;  3KJY A;  3PPU A;  5CRH A;  1JLV A;  2A2P A;  3CTF A;  3IAM 2;  2VL2 A;  1GTI A;  3GUR A;  4WR5 A;  6GSW A;  1NSW A;  2L4C A;  3A2W A;  2XBI A;  3R3E A;  2ON7 A;  3VWX A;  2R2J A;  5KN2 A;  1F37 A;  3CSH A;  4GCI A;  2WJU A;  3F63 A;  3CMI A;  2R4V A;  4GF0 A;  4J56 E;  4TR0 A;  1RW1 A;  2VCW A;  1EP8 A;  2M80 A;  1J9B A;  3GMF A;  5IOW A;  3RHC A;  2IL3 A;  5D9W A;  2CVD A;  2DJJ A;  1A2M A;  4WF4 A;  3WGD A;  1Z7P A;  4GTU A;  2HRK A;  3HZ4 A;  2DIY A;  1PN9 A;  2CX4 A;  2DIZ A;  2YJ7 A;  2VL3 A;  4TR1 A;  3W8J A;  2I81 A;  4OFN A;  3M9K A;  3UAP A;  2VCT A;  1OKD A;  2DML A;  3GKN A;  4V1A p;  2O89 A;  3DXB A;  5L71 A;  4KCA A;  2L5O A;  3GX0 A;  1SL0 B;  10GS A;  1AUC A;  1OC3 A;  5J3R A;  4TR4 A;  1NW2 A;  2GVP A;  4HQZ A;  1SJZ A;  5JCW A;  5D9X A;  2M46 A;  3IK7 A;  1V58 A;  4ZL9 A;  1XOA A;  4AGS A;  1PX7 A;  1Z6N A;  5D9T A;  2YWN A;  1WPI A;  2XC2 A;  1ZOF A;  1QK8 A;  2CV4 A;  3KTL A;  2OE0 A;  4HJM A;  4N11 A;  3HHV A;  1TK5 B;  3MNG A;  1JHB A;  2H72 A;  1ZYQ B;  3H4K A;  3IAS 2;  2IN3 A;  4L0W A;  5H5R A;  1KEB A;  2FY6 A;  4AJ7 A;  5G5F A;  5JWO B;  1M2A A;  4Q5N A;  1LBK A;  4P3Y B;  2YP6 A;  2KP2 A;  3L9U A;  4Z7X A;  2H66 A;  2K18 A;  3GL5 A;  4NV2 A;  1ACV A;  1Y6E A;  4AF2 A;  1TP9 A;  2JZS A;  2YN1 A;  2IFQ B;  1T8E B;  3GX8 A;  4KUN A;  4ZL8 A;  1QFN A;  4FQU A;  4DSQ A;  2OKA A;  3SBC A;  3S9F A;  4KAE A;  5ECI B;  1V2A A;  4PNF A;  4XIH A;  1GP1 A;  2GQM A;  1HQO A;  3KP9 A;  3ERF A;  4PX1 A;  3TB2 A;  3TKS C;  4BVX A;  1ABA A;  4BWS A;  3HVS A;  2IPA A;  1K3O A;  1GSD A;  3IOS A;  3UOM A;  1MDJ A;  5AIS A;  1ZMA A;  1Q4J A;  3GL3 A;  3ZTL A;  3ZZX A;  1GSE A;  1YKA A;  2VCZ A;  5JWQ B;  1Z7R A;  1B4Q A;  1EV4 A;  1THO A;  4ZB6 A;  2PVO C;  1AQX A;  1O6J A;  1TRS A;  2EIO A;  2O87 A;  5ENU A;  1QGV A;  3HXS A;  2H0I A;  1TOF A;  1J0F A;  5ECR B;  1K0M A;  4YKF A;  3KGK A;  3KTB A;  4PXO A;  5AIV A;  3ZRE A;  4RI6 A;  4BA7 A;  3A2V A;  1HYU A;  1MD3 A;  2PBJ A;  5CAX A;  1AAZ A;  5J5N A;  4EXJ A;  3PIN A;  2VL2 C;  2RUF A;  3GRX A;  2L6D A;  3DVW A;  1OYJ A;  3HJP A;  5A5K A;  2WGR A;  4POM A;  3TRX A;  3UVH A;  6GSV A;  1K0D A;  2MMO A;  3ZML A;  1WWJ A;  2GLR A;  2C4J A;  4NHZ A;  1O8W A;  3GN3 A;  5DCH A;  2DLX A;  4OFM A;  3KZQ A;  3KH7 A;  2EIR A;  1GTU A;  3LSZ A;  4I6X A;  4GLT A;  2QSI A;  2H19 A;  5IPH A;  4XS6 A;  5BMU A;  1Z9H A;  5DCG A;  3WGE A;  3EU3 A;  4ECC A;  2VM2 A;  2Z9S A;  4HUA A;  2NDO A;  4MJC A;  4BL7 B;  4ICY A;  1M7T A;  1O81 A;  2KOK A;  3G7J A;  2VO4 A;  3D5J A;  2H01 A;  1SJI A;  1SU9 A;  1SKS B;  3GST A;  4F9Z A;  1XFL A;  4XHM A;  1YF1 A;  1O7U A;  3EE2 A;  4BVY B;  5ECS A;  2GTU A;  1GSY A;  2FHE A;  1PD2 1;  1Z3E A;  3GHA A;  2I3Y A;  1WJK A;  1GLP A;  3WD6 A;  5KOW A;  1X9W B;  1DE2 A;  2HSM A;  3ZIV A;  1XWK A;  3VPQ A;  3VI5 A;  1MDI A;  2GSS A;  3LYP A;  2CA8 A;  2A4H A;  2VD0 A;  3D4T A;  4WEY A;  1A24 A;  18GS A;  4MNN A;  4G10 A;  4IJI A;  4ECI A;  3UAR A;  2CZ2 A;  4G0I A;  3KD0 A;  1A2J A;  4D73 B;  4OD7 A;  2C0G A;  4JE1 A;  3QOU A;  4HQS A;  2EC4 A;  5ELA A;  1N2A A;  3ZVJ A;  5JCG A;  4MP4 A;  3F9U A;  1OKT A;  1PSQ A;  2H1B A;  1M9A A;  2I9H A;  3N9J A;  1M9B A;  4CW9 A;  4X1U A;  1M0U A;  4V1A g;  5GAP D;  4EVM A;  2D2Z A;  4N0Z A;  1ZCP A;  4F0B A;  3ERW A;  3F0I A;  3HJM A;  2DJ1 A;  3H79 A;  1FG4 A;  3M9J A;  3IK9 A;  5IO2 A;  5GAN D;  2GQL A;  1GTB A;  2LTK A;  2FCH A;  4I2U A;  3ZL5 A;  2ZNM A;  1ST9 A;  2VCQ A;  2GT6 A;  4K7N A;  1XW5 A;  2YZU A;  4FIW A;  3U6V A;  5LNK e;  2LQQ A;  4XS4 A;  1Y25 A;  3LG6 A;  1B4P A;  1PL1 A;  3CYN A;  3TGZ A;  3KP8 A;  4ZIL A;  4YAV A;  1M2D A;  5D73 A;  3E0U A;  3A5I A;  4NHW A;  3TRP A;  4IHU A;  2QGV A;  2VIM A;  2YOI A;  5C04 A;  2B5Y A;  1SD8 A;  3FRC A;  5B8B A;  2DBC A;  5GZZ B;  2B6M A;  1WIK A;  3W6G A;  4RUV A;  3F8U A;  2PGT A;  3WGX A;  3L9V A;  4O5R A;  5LD0 A;  1B48 A;  4HEA 2;  4F03 A;  4XTS A;  1S3D A;  1F3A A;  2R0C A;  3FZ5 A;  5B6N A;  2P31 A;  4BPY A;  3RDW A;  2M72 A;  3VPT A;  16GS A;  1Z6M A;  3NOF A;  1TXX A;  1VF2 A;  1SKR B;  2YNX A;  1B9Y C;  4OCF A;  3NZN A;  1TI1 A;  3L4N A;  2HZE A;  2X99 A;  4IQ1 A;  5D8I A;  4DSS A;  1XCC A;  4OWY A;  2H1G A;  1GUL A;  3DKS A;  3LQ7 A;  4CHS A;  4DVC A;  3M0F A;  1T4Z A;  1X5E A;  3G7I A;  3TOT A;  3U5R E;  3TKS A;  2XPE A;  1JFU A;  5F8B A;  2N5F A;  3D0Z A;  3MAK A;  4MZW A;  4K8M A;  3LWA A;  1USB A;  1O73 A;  3BCK A;  1XVW A;  2H76 A;  5D93 A;  2LJK A;  4MAB A;  3DIE A;  2GST A;  3FHK A;  3GA4 A;  3IBH A;  2R37 A;  1UC7 A;  2KHP A;  2OE1 A;  5FHI A;  1ERV A;  2H30 A;  1B9X C;  4AJ8 A;  2PMT A;  2V1M A;  2OBK A;  2VAF A;  3WT2 A;  3RBT A;  3R2Q A;  4V2N A;  2JSY A;  3L0H A;  1ERU A;  4JU5 A;  5ECH B;  5CRG A;  1THX A;  5AIX A;  2PN8 A;  2JZT A;  4JRR A;  2CVB A;  3VWU A;  4LL4 B;  2C8U A;  4KDU A;  4L5L A;  3RPN A;  2ES7 A;  1BAY A;  1UVZ A;  2I4A A;  3Q74 A;  5G31 A;  5KEJ A;  4TXO A;  1OVN A;  3A5W A;  1ILO A;  5DQY A;  3TOU A;  2PER A;  5DAK B;  4MJE A;  4L0U A;  4K7O A;  3F4S A;  3N5O A;  4EDZ A;  5ELG A;  2IJY A;  4HZ2 A;  1TW9 A;  2MBT A;  3EC3 A;  3NIV A;  4MJB A;  2YCD A;  4NWY A;  3HVN A;  5CRD A;  1TRV A;  2P0G A;  2AJQ B;  3ZYW A;  3VWV A;  5C00 A;  3GKM A;  1XWB A;  2A2R A;  2F8F A;  2GZY A;  3GIX A;  2FWH A;  2C0E A;  1SK2 A;  1XPV A;  4LL1 B;  5CYY A;  1DUG A;  1K3L A;  2BJX A;  3VFI A;  1SJ6 A;  4MF5 A;  4YQM A;  3BBY A;  3KMO A;  2YJH A;  4ZBA A;  3QAV A;  4I5Q A;  5IO0 A;  2LRC A;  2K8S A;  3APQ A;  5ID2 A;  4XRD A;  4MJA A;  5IMV A;  2L59 A;  3QPM A;  3D4M A;  3KCM A;  4FH8 A;  1WRY A;  1TI3 A;  2H0H A;  4Z2R A;  2C3T A;  1U88 A;  1TU7 A;  1K0B A;  1OE7 A;  4GWR A;  3C73 A;  1MDK A;  2V32 A;  3E9J B;  2DJ2 A;  2WS2 A;  4HI7 A;  4KF9 A;  5G2Z A;  4YQV A;  1LU4 A;  1K3Y A;  2JAC A;  4L5O A;  3Q18 A;  2E2G A;  3GH9 A;  1IYH A;  5JCU A;  2I1U A;  2AB6 A;  3RAZ A;  1EZK A;  2V2G A;  1AXD A;  5GSS A;  4RQR A;  4A5P A;  1GH2 A;  3HZ8 A;  5DQS A;  2A4V A;  4KW6 A;  4ID0 A;  2NVL A;  5J4U A;  1QUW A;  4N10 A;  4MF7 A;  1PKW A;  1GSU A;  5GST A;  4TOP A;  1X5C A;  1FW1 A;  1ML6 A;  1X9M B;  3JCM L;  3A3T A;  5FWG A;  3ZIJ A;  4EIQ A;  3WT1 A;  4F0C A;  4ZXG A;  3IC4 A;  5HR2 A;  5A4V A;  1R5A A;  5A4W A;  1JZR A;  2C3Q A;  2FA8 A;  3F4R A;  2DKH A;  3TJG A;  1KNG A;  3IA1 A;  1FOH A;  2F51 A;  3ME8 A;  2DMM A;  2WRT A;  1MD4 A;  4MH2 A;  4OMV A;  1GSF A;  2AV4 A;  4KSO A;  3TJK A;  5B7C A;  1DSB A;  4YAP A;  4X0X A;  4BIK A;  4G0K A;  2XPD A;  5E4W A;  2AYT A;  1AQV A;  2X49 A;  5KN1 A;  2HNL A;  1HD2 A;  2L4Q A;  3W8S A;  1GTA A;  2AAW A;  2UZ8 A;  1XIY A;  1BQ7 A;  2IMF A;  3FYG A;  4Q5Q A;  3ZRD A;  4LMV A;  1SL1 B;  4J57 E;  4RI7 A;  3HA9 A;  3EMP A;  3GTU A;  2HRN A;  4WF5 A;  1T00 A;  1EEM A;  5H5Q A;  3GUS A;  4NXI A;  4EF0 A;  2N5A A;  1XW6 A;  4LLR A;  3G7Y A;  2FA4 A;  4HOJ A;  3APS A;  2B7J A;  1AIU A;  3ZVJ D;  2LV3 A;  5DAL A;  3TJJ A;  2H6Z A;  5A4U A;  3PH9 A;  2JL4 A;  2NBS A;  4V2M A;  4G2E A;  4WBR D;  3DGQ A;  2AHE A;  2F9S A;  1DE1 A;  6GST A;  3QFB C;  4FYU A;  4JR6 A;  2PUK C;  1A2L A;  4TR1 B;  4KX4 A;  2JSZ A;  1U6T A;  2WDU A;  4IJ3 A;  1YY7 A;  2E2M A;  3O76 A;  3TKP A;  5CRW A;  1PMT A;  2RUE A;  2GQK A;  5DJM A;  4AJ6 A;  2H1D A;  4IEL A;  1XWA A;  4H86 A;  3UIW A;  4NV5 A;  2CVK A;  2CAQ A;  2H6Y A;  3DRN A;  2K6V A;  1E6B A;  4PQH A;  5IQY A;  5LCZ A;  1PFO A;  2E0Q A;  4TR3 A;  2YZH A;  1CQG A;  5HQP A;  3KIJ A;  5BRT A;  2ZUP A;  2RM6 A;  4OO4 A;  4ISD A;  2LQO A;  2X64 A;  5KOX A;  3FZ9 A;  4HDE A;  3DEX A;  8GSS A;  3C8E A;  2DKI A;  3HVX A;  1NM3 A;  4JZQ A;  2C0F A;  1V40 A;  4ECJ A;  5HR3 A;  2RM5 A;  1GRX A;  1FO5 A;  3QFA C;  3RHB A;  4ML1 A;  4F2I A;  4F82 A;  4MDC A;  2BTO T;  4PGT A;  4GRF A;  5G30 A;  3EU4 A;  1F3B A;  1EOH A;  4JR4 A;  2PVQ A;  3UBK A;  2IME A;  1GNW A;  1PX6 A;  2IMI A;  4K1F A;  1GL8 A;  1V57 A;  1XVQ A;  4TXV A;  3F6F A;  2AUV A;  4K7I A;  1G0T A;  3I69 A;  1XG8 A;  3CXG A;  5DDL A;  4XRA A;  1BX9 A;  1AC1 A;  3F6D A;  3GH6 A;  3GV1 A;  5EY6 A;  11GS A;  1YEX A;  2DJ3 A;  3ZIT A;  3LFL A;  2F3M A;  4KH7 A;  1W89 A;  5IIZ A;  4HZ4 A;  3K8N A;  2GT5 A;  4BVX B;  4PUF C;  1X9S B;  5IOX A;  4KND A;  9GSS A;  5EL8 A;  1MEK A;  3AY8 A;  1J08 A;  1F6M C;  1FB0 A;  7GSS A;  1XWC A;  4LMW A;  5ECM B;  1AW9 A;  3I9V 2;  1K0C A;  5IMF A;  2LKU A;  2H73 A;  3M8N A;  1EP7 A;  1M3J A;  5G1K A;  2HI7 A;  2B3S A;  3HJO A;  3VLN A;  2B1K A;  1OC8 A;  5J41 A;  3D21 A;  1M99 A;  2C3N A;  3GFK A;  4GSN A;  2CX3 A;  1G7E A;  5G1L A;  2R5G A;  3QDN A;  4OO5 A;  4X43 A;  1H75 A;  4PUA A;  4CDO A;  14GS A;  1I5G A;  4IP6 A;  1WE0 A;  3A2X A;  2YPM A;  3E3E A;  4G19 A;  5F06 A;  3DWV A;  1EEJ A;  1OAZ A;  1Z5Y E;  4YQU A;  5CNW A;  4GST A;  1E2Y A;  2XBQ A;  5D96 A;  4N0V A;  1IYI A;  1VGL A;  4O5Q A;  5KN0 A;  5ECP B;  2VUP A;  1EGO A;  4PQI A;  4WBJ A;  1A8Y A;  4IVF A;  4IBP A;  1SK1 A;  1VF1 A;  1G7O A;  1CQH A;  4E8E A;  2PU9 C;  4KGI A;  5IMC A;  3CQF A;  2H0G A;  2GZZ A;  1R26 A;  5HR0 A;  3FZA A;  3WYW A;  3H1N A;  6GSX A;  2QKE A;  4YKG A;  3TKQ A;  1DBY A;  1ZZY A;  2TRX A;  2QC7 A;  3KM6 A;  2H74 A;  2R0P A;  3UBL A;  5ECL B;  1JZO A;  1R7H A;  4V2L A;  5EVO A;  4EUY A;  3QD9 A;  5F0G A;  2C80 A;  1OC9 B;  1GLQ A;  4K6X A;  4ILF A;  2KP1 A;  4E8H A;  2LNT A;  2FD3 A;  3OR5 A;  3MDK A;  5IMZ A;  3BCI A;  2H70 A;  12GS A;  3EYT A;  3D6I A;  3LXT A;  1TJD A;  1S3C A;  4FO5 A;  1SYX A;  2VCX A;  2KLX A;  2MYG A;  2YV7 A;  2IFQ A;  3TKS E;  1B8X A;  4K2X A;  3FR6 A;  2FWE A;  3US3 A;  2DC5 A;  19GS A;  2DJ0 A;  5J9C A;  3VUR A;  2B1L A;  1V98 A;  1TK0 B;  3UL3 A;  3FZ4 A;  3IC8 A;  3M1G A;  3HKR A;  2ZCT A;  1GSS A;  4TVE A;  4HSC X;  6GSU A;  1HNB A;  2B5E A;  4L8E A;  2GDR A;  1PN0 A;  4POB A;  2N5B A;  2HSH A;  4IS0 A;  2V6O A;  2L57 A;  4K0G A;  4TW5 A;  3IPZ A;  2O8V B;  1M3I A;  4WXT A;  1A8L A;  1BG5 A;  3HVV A;  1ZYE A;  3CRU A;  1N8J A;  4G9H A;  1ZYP A;  2K8V A;  2WB9 A;  5DBQ A;  1XW9 A;  4KB3 A;  4MZC A;  1EOG A;  5JWR B;  17GS A;  1ZGN A;  2EIQ A;  2HRF A;  3FY7 A;  4IGJ A;  4O32 A;  4NAX A;  2O7K A;  3QAG A;  1ERW A;  4CY8 A;  2TIR A;  2VLT A;  5AN1 A;  1HNA A;  3L9S A;  2H8L A;  3C1R A;  5HFI A;  3ZFL A;  2GGT A;  4XS4 B;  2JU5 A;  4K5S A;  1ZL9 A;  2NPB A;  3LYK A;  2F8A A;  3VI7 A;  4XS1 A;  1JZW A;  4KA0 A;  4MPF A;  3EPT A;  1HNC A;  1SL2 B;  5J9B A;  5COH A;  2X8G A;  5ECK B;  3MIX A;  4OCE A;  2K9F A;  2QA1 A;  1GUK A;  2LS5 A;  4TKY A;  4BWQ A;  4EKZ A;  4Q5F A;  1PQN A;  2VM1 A;  4MA9 A;  4EIP A;  1YJ6 A;  4IQA A;  1U3A A;  4ZBB A;  1V9W A;  5F07 A;  2DSA A;  1GUH A;  1H4O A;  3HD5 A;  1FOV A;  2VLV A;  3H93 A;  1RK4 A;  3CRT A;  5B8A A;  3ZFB A;  4ZIJ A;  3UEM A;  1TU8 A;  3J7Y k;  2YAN A;  2H75 A;  2MBS A;  3Q19 A;  4BL7 A;  5DVB A;  1XBS A;  3G9B A;  1SK0 A;  1GUM A;  3ZMK A;  3HYP A;  1MTC A;  1K0O A;  2IMK A;  2HYX A;  2CZ3 A;  3TRQ A;  1TKD B;  1GWC A;  4O7H A;  1FVJ A;  4MCU A;  22GS A;  2GZP A;  4BVY A;  3FKF A;  2HZE B;  4DSS B;  1TTZ A;  4K0N A;  5CRE A;  2OA7 A;  5IMD A;  3P90 A;  3GKX A;  1NHY A;  2LNS A;  5ECN B;  5F05 A;  2CT6 A;  4IW9 A;  1BJX A;  4Z2T A;  4JBB A;  2VD1 A;  4ACS A;  3IV4 A;  2RII A;  2DJK A;  1FB6 A;  1XXU A;  2WFC A;  3GNJ A;  5IM9 A;  2B5X A;  5D9V A;  3DYR A;  3TKR A;  2HT9 A;  2YWM A;  4MLY A;  2QA2 A;  1UN2 A;  4G0L A;  3RPP A;  2BMX A;  3J7Y b;  3KMN A;  4K5R A;  4EDY A;  5CO3 A;  2OAD A;  4D73 A;  4KSM A;  1KBN A;  1EGR A;  3CTG A;  4ULX A;  3C71 A;  1ON4 A;  1YZX A;  4HU7 A;  2V6K A;  3ME7 A;  1X0R A;  1O8X A;  1FHE A;  4TRX A;  3VK9 A;  2CAI A;  1A23 A;  2IIY A;  1G6W A;  3TJB A;  1BYE A;  3LGC A;  2OAC A;  3CBU A;  2WCI A;  2OBI A;  4TXO B;  5ABR A;  4ZB8 A;  4KCE A;  4PQ1 A;  2P5R A;  4TN8 A;  4USS A;  3LXZ A;  2FWF A;  3MWH A;  2C1Y A;  1S3A A;  1TRU A;  3F3R A;  5IMA A;  2X4A A;  2G2Q A;  1OE8 A;  1PRX A;  2REM A;  1G6Y A;  2LRT A;  2JAD A;  3FMW A;  3IRA A;  2YWO A;  4RQX A;  4QL9 A;  5E59 A;  2TRC P;  1YDK A;  1JZD A;  5DJL A;  1JLW A;  2LEG A;  1PA3 A;  4GSS A;  2LRN A;  2VL9 A;  2GSR A;  3FEU A;  4K9Z A;  1WOU A;  6GSS A;  4Q5R A; 
#chains in the Genus database with same CATH homology
 1TRW A;  1A0R P;  1TDI A;  5ID2 B;  2P5Q A;  1O85 A;  2H1A A;  4EL1 A;  1WMJ A;  4ML6 A;  4IP1 A;  4MH3 A;  2J23 A;  1Q98 A;  5HFK A;  1BED A;  4Z2U A;  2WUL A;  4POL A;  4DSR A;  4OFT A;  3P8W A;  2R3X A;  4JED A;  4HJ2 A;  3F3Q A;  6GSY A;  1F2E A;  4K2D A;  1T4Y A;  3IXR A;  1X5D A;  1AQW A;  3I6A A;  2HXK A;  4EC0 A;  4O92 A;  3EIN A;  2LST A;  1FAA A;  2O85 A;  3EUR A;  4IKH A;  3IHQ A;  1OC9 A;  1QMV A;  1VRS D;  3L78 A;  4MK3 A;  5EPF A;  2IMD A;  2CQ9 A;  1QXH A;  3UJ1 A;  1I9D A;  3QR6 A;  4FYB A;  1SKW B;  2YV9 A;  2OJL A;  3EMX A;  3EWL A;  3D22 A;  4PNG A;  3CSJ A;  3DVX A;  2FNO A;  2JZR A;  1U3I A;  2FGX A;  3BJ5 A;  2FUG 2;  1XWG A;  3GSS A;  3P2A A;  4NPB A;  4DEJ A;  3FK8 A;  4IN0 A;  2LUS A;  1YF0 A;  2L6C A;  3FW2 A;  1R5P A;  1VF4 A;  4WKW A;  3KXO A;  2HSY A;  3UVT A;  3O3T A;  2V41 A;  1W4V A;  2HLS A;  3HDC A;  4FYC A;  3PGT A;  3FR9 A;  4KDX A;  2OE3 A;  5INY A;  4QQ7 A;  3LW9 A;  4HU9 A;  3ZLP A;  2H71 A;  2B7K A;  3ERG A;  1PL2 A;  1U87 A;  5DAK A;  4LA1 A;  3LEF A;  3H8Q A;  3Q6O A;  2FWG A;  2X8H A;  3GKK A;  1UA5 A;  3GTU B;  2MMN A;  4O5U A;  1K0N A;  2G0F A;  2MMA A;  1EWX A;  1EV9 A;  2FLS A;  2C0D A;  3O6T A;  2WZ9 A;  1F9M A;  3ISO A;  2LJR A;  3SWL A;  5HR1 A;  2GS3 A;  2MZC A;  5DAL B;  1T3B A;  1ZYN A;  2IWT A;  1FVK A;  3PR8 A;  5ECO B;  1TK8 B;  13GS A;  2VCV A;  1T7P B;  3IHG A;  1SD9 A;  1URM A;  4POK A;  3QMX A;  3GYK A;  1ERT A;  4YH2 A;  3CSI A;  3TUE A;  1YKC A;  2HZF A;  1SYR A;  1XZO A;  2LJA A;  4PTS A;  4EE0 A;  2YWI A;  1SEN A;  2L5L A;  5H5S A;  3KH9 A;  4I2T A;  2PPT A;  1KTE A;  3QCP A;  3MYD A;  3I43 A;  3EVI A;  5G5E A;  4WET A;  3TDG A;  4XCS A;  3UMA A;  1PKZ A;  1YEP A;  2KUC A;  3F4T A;  2XHF A;  4MZB A;  2GSQ A;  3HY2 A;  4MMM A;  3LJR A;  3VWW A;  4EO3 A;  5B6M A;  4NMU A;  4I97 A;  3KEB A;  3MSZ A;  2VLU A;  4KE3 A;  3M3M A;  3FR3 A;  4GXZ A;  4PUR A;  3DML A;  3V1W A;  1LJR A;  3TCO A;  2PWJ A;  1GSQ A;  1M2B A;  4GQC A;  5ECQ B;  4X4J A;  4KDY A;  3IE3 A;  3C1S A;  2E7P A;  2A2S A;  5IPG A;  4MF6 A;  3QAW A;  2RLI A;  4ZL7 A;  3HCZ A;  3IDV A;  4N30 A;  5FT3 A;  4WR4 A;  2X8C A;  2HFD A;  1PGT A;  2MMZ A;  2VOC A;  3DD3 A;  1GNE A;  1VF3 A;  4QL7 A;  20GS A;  1YQ1 A;  3C7M A;  2ALB A;  2H6X A;  3LOR A;  1K0A A;  1QQ2 A;  1XOB A;  2R6K A;  1A0F A;  1WP0 A;  4ZBD A;  2ON5 A;  2HRA A;  5AGY A;  3IR4 A;  1NHO A;  1C72 A;  3ED3 A;  5HFG A;  1R4W A;  3P7X A;  4ECB A;  4GQF A;  2NTO A;  4ZB9 A;  4HS1 A;  2HE3 A;  4MPG A;  1RQM A;  4J2F A;  3APO A;  3BOA A;  2R0G A;  2J9H A;  5KN3 A;  4I8B A;  1T1V A;  3BD2 A;  4CY6 A;  5CP1 A;  3TJF A;  3KJY A;  3PPU A;  5CRH A;  1JLV A;  2A2P A;  3CTF A;  3IAM 2;  2VL2 A;  1GTI A;  3GUR A;  4WR5 A;  6GSW A;  1NSW A;  2L4C A;  3A2W A;  2XBI A;  3R3E A;  2ON7 A;  3VWX A;  2R2J A;  5KN2 A;  1F37 A;  3CSH A;  4GCI A;  2WJU A;  3F63 A;  3CMI A;  2R4V A;  4GF0 A;  4J56 E;  4TR0 A;  1RW1 A;  2VCW A;  1EP8 A;  2M80 A;  1J9B A;  3GMF A;  5IOW A;  3RHC A;  2IL3 A;  5D9W A;  2CVD A;  2DJJ A;  1A2M A;  4WF4 A;  3WGD A;  1Z7P A;  4GTU A;  2HRK A;  3HZ4 A;  2DIY A;  1PN9 A;  2CX4 A;  2DIZ A;  2YJ7 A;  2VL3 A;  4TR1 A;  3W8J A;  2I81 A;  4OFN A;  3M9K A;  3UAP A;  2VCT A;  1OKD A;  2DML A;  3GKN A;  4V1A p;  2O89 A;  3DXB A;  5L71 A;  4KCA A;  2L5O A;  3GX0 A;  1SL0 B;  10GS A;  1AUC A;  1OC3 A;  5J3R A;  4TR4 A;  1NW2 A;  2GVP A;  4HQZ A;  1SJZ A;  5JCW A;  5D9X A;  2M46 A;  3IK7 A;  1V58 A;  4ZL9 A;  1XOA A;  4AGS A;  1PX7 A;  1Z6N A;  5D9T A;  2YWN A;  1WPI A;  2XC2 A;  1ZOF A;  1QK8 A;  2CV4 A;  3KTL A;  2OE0 A;  4HJM A;  4N11 A;  3HHV A;  1TK5 B;  3MNG A;  1JHB A;  2H72 A;  1ZYQ B;  3H4K A;  3IAS 2;  2IN3 A;  4L0W A;  5H5R A;  1KEB A;  2FY6 A;  4AJ7 A;  5G5F A;  5JWO B;  1M2A A;  4Q5N A;  1LBK A;  4P3Y B;  2YP6 A;  2KP2 A;  3L9U A;  4Z7X A;  2H66 A;  2K18 A;  3GL5 A;  4NV2 A;  1ACV A;  1Y6E A;  4AF2 A;  1TP9 A;  2JZS A;  2YN1 A;  2IFQ B;  1T8E B;  3GX8 A;  4KUN A;  4ZL8 A;  1QFN A;  4FQU A;  4DSQ A;  2OKA A;  3SBC A;  3S9F A;  4KAE A;  5ECI B;  1V2A A;  4PNF A;  4XIH A;  1GP1 A;  2GQM A;  1HQO A;  3KP9 A;  3ERF A;  4PX1 A;  3TB2 A;  3TKS C;  4BVX A;  1ABA A;  4BWS A;  3HVS A;  2IPA A;  1K3O A;  1GSD A;  3IOS A;  3UOM A;  1MDJ A;  5AIS A;  1ZMA A;  1Q4J A;  3GL3 A;  3ZTL A;  3ZZX A;  1GSE A;  1YKA A;  2VCZ A;  5JWQ B;  1Z7R A;  1B4Q A;  1EV4 A;  1THO A;  4ZB6 A;  2PVO C;  1AQX A;  1O6J A;  1TRS A;  2EIO A;  2O87 A;  5ENU A;  1QGV A;  3HXS A;  2H0I A;  1TOF A;  1J0F A;  5ECR B;  1K0M A;  4YKF A;  3KGK A;  3KTB A;  4PXO A;  5AIV A;  3ZRE A;  4RI6 A;  4BA7 A;  3A2V A;  1HYU A;  1MD3 A;  2PBJ A;  5CAX A;  1AAZ A;  5J5N A;  4EXJ A;  3PIN A;  2VL2 C;  2RUF A;  3GRX A;  2L6D A;  3DVW A;  1OYJ A;  3HJP A;  5A5K A;  2WGR A;  4POM A;  3TRX A;  3UVH A;  6GSV A;  1K0D A;  2MMO A;  3ZML A;  1WWJ A;  2GLR A;  2C4J A;  4NHZ A;  1O8W A;  3GN3 A;  5DCH A;  2DLX A;  4OFM A;  3KZQ A;  3KH7 A;  2EIR A;  1GTU A;  3LSZ A;  4I6X A;  4GLT A;  2QSI A;  2H19 A;  5IPH A;  4XS6 A;  5BMU A;  1Z9H A;  5DCG A;  3WGE A;  3EU3 A;  4ECC A;  2VM2 A;  2Z9S A;  4HUA A;  2NDO A;  4MJC A;  4BL7 B;  4ICY A;  1M7T A;  1O81 A;  2KOK A;  3G7J A;  2VO4 A;  3D5J A;  2H01 A;  1SJI A;  1SU9 A;  1SKS B;  3GST A;  4F9Z A;  1XFL A;  4XHM A;  1YF1 A;  1O7U A;  3EE2 A;  4BVY B;  5ECS A;  2GTU A;  1GSY A;  2FHE A;  1PD2 1;  1Z3E A;  3GHA A;  2I3Y A;  1WJK A;  1GLP A;  3WD6 A;  5KOW A;  1X9W B;  1DE2 A;  2HSM A;  3ZIV A;  1XWK A;  3VPQ A;  3VI5 A;  1MDI A;  2GSS A;  3LYP A;  2CA8 A;  2A4H A;  2VD0 A;  3D4T A;  4WEY A;  1A24 A;  18GS A;  4MNN A;  4G10 A;  4IJI A;  4ECI A;  3UAR A;  2CZ2 A;  4G0I A;  3KD0 A;  1A2J A;  4D73 B;  4OD7 A;  2C0G A;  4JE1 A;  3QOU A;  4HQS A;  2EC4 A;  5ELA A;  1N2A A;  3ZVJ A;  5JCG A;  4MP4 A;  3F9U A;  1OKT A;  1PSQ A;  2H1B A;  1M9A A;  2I9H A;  3N9J A;  1M9B A;  4CW9 A;  4X1U A;  1M0U A;  4V1A g;  5GAP D;  4EVM A;  2D2Z A;  4N0Z A;  1ZCP A;  4F0B A;  3ERW A;  3F0I A;  3HJM A;  2DJ1 A;  3H79 A;  1FG4 A;  3M9J A;  3IK9 A;  5IO2 A;  5GAN D;  2GQL A;  1GTB A;  2LTK A;  2FCH A;  4I2U A;  3ZL5 A;  2ZNM A;  1ST9 A;  2VCQ A;  2GT6 A;  4K7N A;  1XW5 A;  2YZU A;  4FIW A;  3U6V A;  5LNK e;  2LQQ A;  4XS4 A;  1Y25 A;  3LG6 A;  1B4P A;  1PL1 A;  3CYN A;  3TGZ A;  3KP8 A;  4ZIL A;  4YAV A;  1M2D A;  5D73 A;  3E0U A;  3A5I A;  4NHW A;  3TRP A;  4IHU A;  2QGV A;  2VIM A;  2YOI A;  5C04 A;  2B5Y A;  1SD8 A;  3FRC A;  5B8B A;  2DBC A;  5GZZ B;  2B6M A;  1WIK A;  3W6G A;  4RUV A;  3F8U A;  2PGT A;  3WGX A;  3L9V A;  4O5R A;  5LD0 A;  1B48 A;  4HEA 2;  4F03 A;  4XTS A;  1S3D A;  1F3A A;  2R0C A;  3FZ5 A;  5B6N A;  2P31 A;  4BPY A;  3RDW A;  2M72 A;  3VPT A;  16GS A;  1Z6M A;  3NOF A;  1TXX A;  1VF2 A;  1SKR B;  2YNX A;  1B9Y C;  4OCF A;  3NZN A;  1TI1 A;  3L4N A;  2HZE A;  2X99 A;  4IQ1 A;  5D8I A;  4DSS A;  1XCC A;  4OWY A;  2H1G A;  1GUL A;  3DKS A;  3LQ7 A;  4CHS A;  4DVC A;  3M0F A;  1T4Z A;  1X5E A;  3G7I A;  3TOT A;  3U5R E;  3TKS A;  2XPE A;  1JFU A;  5F8B A;  2N5F A;  3D0Z A;  3MAK A;  4MZW A;  4K8M A;  3LWA A;  1USB A;  1O73 A;  3BCK A;  1XVW A;  2H76 A;  5D93 A;  2LJK A;  4MAB A;  3DIE A;  2GST A;  3FHK A;  3GA4 A;  3IBH A;  2R37 A;  1UC7 A;  2KHP A;  2OE1 A;  5FHI A;  1ERV A;  2H30 A;  1B9X C;  4AJ8 A;  2PMT A;  2V1M A;  2OBK A;  2VAF A;  3WT2 A;  3RBT A;  3R2Q A;  4V2N A;  2JSY A;  3L0H A;  1ERU A;  4JU5 A;  5ECH B;  5CRG A;  1THX A;  5AIX A;  2PN8 A;  2JZT A;  4JRR A;  2CVB A;  3VWU A;  4LL4 B;  2C8U A;  4KDU A;  4L5L A;  3RPN A;  2ES7 A;  1BAY A;  1UVZ A;  2I4A A;  3Q74 A;  5G31 A;  5KEJ A;  4TXO A;  1OVN A;  3A5W A;  1ILO A;  5DQY A;  3TOU A;  2PER A;  5DAK B;  4MJE A;  4L0U A;  4K7O A;  3F4S A;  3N5O A;  4EDZ A;  5ELG A;  2IJY A;  4HZ2 A;  1TW9 A;  2MBT A;  3EC3 A;  3NIV A;  4MJB A;  2YCD A;  4NWY A;  5CRD A;  1TRV A;  2P0G A;  2AJQ B;  3ZYW A;  3VWV A;  5C00 A;  3GKM A;  1XWB A;  2A2R A;  2F8F A;  2GZY A;  3GIX A;  2FWH A;  2C0E A;  1SK2 A;  1XPV A;  4LL1 B;  5CYY A;  1DUG A;  1K3L A;  2BJX A;  3VFI A;  1SJ6 A;  4MF5 A;  4YQM A;  3BBY A;  3KMO A;  2YJH A;  4ZBA A;  3QAV A;  4I5Q A;  5IO0 A;  2LRC A;  2K8S A;  3APQ A;  5ID2 A;  4XRD A;  4MJA A;  5IMV A;  2L59 A;  3QPM A;  3D4M A;  3KCM A;  4FH8 A;  1WRY A;  1TI3 A;  2H0H A;  4Z2R A;  2C3T A;  1U88 A;  1TU7 A;  1K0B A;  1OE7 A;  4GWR A;  3C73 A;  1MDK A;  2V32 A;  3E9J B;  2DJ2 A;  2WS2 A;  4HI7 A;  4KF9 A;  5G2Z A;  4YQV A;  1LU4 A;  1K3Y A;  2JAC A;  4L5O A;  3Q18 A;  2E2G A;  3GH9 A;  1IYH A;  5JCU A;  2I1U A;  2AB6 A;  3RAZ A;  1EZK A;  2V2G A;  1AXD A;  5GSS A;  4RQR A;  4A5P A;  1GH2 A;  3HZ8 A;  5DQS A;  2A4V A;  4KW6 A;  4ID0 A;  2NVL A;  5J4U A;  1QUW A;  4N10 A;  4MF7 A;  1PKW A;  1GSU A;  5GST A;  4TOP A;  1X5C A;  1FW1 A;  1ML6 A;  1X9M B;  3JCM L;  3A3T A;  5FWG A;  3ZIJ A;  4EIQ A;  3WT1 A;  4F0C A;  4ZXG A;  3IC4 A;  5HR2 A;  5A4V A;  1R5A A;  5A4W A;  1JZR A;  2C3Q A;  2FA8 A;  3F4R A;  2DKH A;  3TJG A;  1KNG A;  3IA1 A;  1FOH A;  2F51 A;  3ME8 A;  2DMM A;  2WRT A;  1MD4 A;  4MH2 A;  4OMV A;  1GSF A;  2AV4 A;  4KSO A;  3TJK A;  5B7C A;  1DSB A;  4YAP A;  4X0X A;  4G0K A;  2XPD A;  5E4W A;  2AYT A;  1AQV A;  2X49 A;  5KN1 A;  2HNL A;  1HD2 A;  2L4Q A;  3W8S A;  1GTA A;  2AAW A;  2UZ8 A;  1XIY A;  1BQ7 A;  2IMF A;  3FYG A;  4Q5Q A;  3ZRD A;  4LMV A;  1SL1 B;  4J57 E;  4RI7 A;  3HA9 A;  3EMP A;  3GTU A;  2HRN A;  4WF5 A;  1T00 A;  1EEM A;  5H5Q A;  3GUS A;  4NXI A;  4EF0 A;  2N5A A;  1XW6 A;  4LLR A;  3G7Y A;  2FA4 A;  4HOJ A;  3APS A;  2B7J A;  1AIU A;  3ZVJ D;  2LV3 A;  5DAL A;  3TJJ A;  2H6Z A;  5A4U A;  3PH9 A;  2JL4 A;  2NBS A;  4V2M A;  4G2E A;  4WBR D;  3DGQ A;  2AHE A;  2F9S A;  1DE1 A;  6GST A;  3QFB C;  4FYU A;  4JR6 A;  2PUK C;  1A2L A;  4TR1 B;  4KX4 A;  2JSZ A;  1U6T A;  2WDU A;  4IJ3 A;  1YY7 A;  2E2M A;  3O76 A;  3TKP A;  5CRW A;  1PMT A;  2RUE A;  2GQK A;  5DJM A;  4AJ6 A;  2H1D A;  4IEL A;  1XWA A;  4H86 A;  3UIW A;  4NV5 A;  2CVK A;  2CAQ A;  2H6Y A;  3DRN A;  2K6V A;  1E6B A;  4PQH A;  5IQY A;  5LCZ A;  2E0Q A;  4TR3 A;  2YZH A;  1CQG A;  5HQP A;  3KIJ A;  5BRT A;  2ZUP A;  2RM6 A;  4OO4 A;  4ISD A;  2LQO A;  2X64 A;  5KOX A;  3FZ9 A;  4HDE A;  3DEX A;  8GSS A;  3C8E A;  2DKI A;  3HVX A;  1NM3 A;  4JZQ A;  2C0F A;  1V40 A;  4ECJ A;  5HR3 A;  2RM5 A;  1GRX A;  1FO5 A;  3QFA C;  3RHB A;  4ML1 A;  4F2I A;  4F82 A;  4MDC A;  2BTO T;  4PGT A;  4GRF A;  5G30 A;  3EU4 A;  1F3B A;  1EOH A;  4JR4 A;  2PVQ A;  3UBK A;  2IME A;  1GNW A;  1PX6 A;  2IMI A;  4K1F A;  1GL8 A;  1V57 A;  1XVQ A;  4TXV A;  3F6F A;  2AUV A;  4K7I A;  1G0T A;  3I69 A;  3CXG A;  5DDL A;  4XRA A;  1BX9 A;  1AC1 A;  3F6D A;  3GH6 A;  3GV1 A;  5EY6 A;  11GS A;  1YEX A;  2DJ3 A;  3ZIT A;  3LFL A;  2F3M A;  4KH7 A;  1W89 A;  5IIZ A;  4HZ4 A;  3K8N A;  2GT5 A;  4BVX B;  4PUF C;  1X9S B;  5IOX A;  4KND A;  9GSS A;  5EL8 A;  1MEK A;  3AY8 A;  1J08 A;  1F6M C;  1FB0 A;  7GSS A;  1XWC A;  4LMW A;  5ECM B;  1AW9 A;  3I9V 2;  1K0C A;  5IMF A;  2LKU A;  2H73 A;  3M8N A;  1EP7 A;  5G1K A;  2HI7 A;  2B3S A;  3HJO A;  3VLN A;  2B1K A;  1OC8 A;  5J41 A;  3D21 A;  1M99 A;  2C3N A;  3GFK A;  4GSN A;  2CX3 A;  1G7E A;  5G1L A;  2R5G A;  3QDN A;  4OO5 A;  4X43 A;  1H75 A;  4PUA A;  4CDO A;  14GS A;  1I5G A;  4IP6 A;  1WE0 A;  3A2X A;  2YPM A;  3E3E A;  4G19 A;  5F06 A;  3DWV A;  1EEJ A;  1OAZ A;  1Z5Y E;  4YQU A;  5CNW A;  4GST A;  1E2Y A;  2XBQ A;  5D96 A;  4N0V A;  1IYI A;  1VGL A;  4O5Q A;  5KN0 A;  5ECP B;  2VUP A;  1EGO A;  4PQI A;  4WBJ A;  1A8Y A;  4IVF A;  4IBP A;  1SK1 A;  1VF1 A;  1G7O A;  1CQH A;  4E8E A;  2PU9 C;  4KGI A;  5IMC A;  2H0G A;  2GZZ A;  1R26 A;  5HR0 A;  3FZA A;  3WYW A;  3H1N A;  6GSX A;  2QKE A;  4YKG A;  3TKQ A;  1DBY A;  1ZZY A;  2TRX A;  2QC7 A;  3KM6 A;  2H74 A;  2R0P A;  3UBL A;  5ECL B;  1JZO A;  1R7H A;  4V2L A;  5EVO A;  4EUY A;  3QD9 A;  5F0G A;  2C80 A;  1OC9 B;  1GLQ A;  4K6X A;  4ILF A;  2KP1 A;  4E8H A;  2LNT A;  2FD3 A;  3OR5 A;  3MDK A;  5IMZ A;  3BCI A;  2H70 A;  12GS A;  3EYT A;  3D6I A;  3LXT A;  1TJD A;  1S3C A;  4FO5 A;  1SYX A;  2VCX A;  2KLX A;  2MYG A;  2YV7 A;  2IFQ A;  3TKS E;  1B8X A;  4K2X A;  3FR6 A;  2FWE A;  3US3 A;  2DC5 A;  19GS A;  2DJ0 A;  5J9C A;  3VUR A;  2B1L A;  1V98 A;  1TK0 B;  3UL3 A;  3FZ4 A;  3IC8 A;  3M1G A;  3HKR A;  2ZCT A;  1GSS A;  4TVE A;  6GSU A;  1HNB A;  2B5E A;  4L8E A;  2GDR A;  1PN0 A;  4POB A;  2N5B A;  2HSH A;  4IS0 A;  2V6O A;  2L57 A;  4K0G A;  4TW5 A;  3IPZ A;  2O8V B;  4WXT A;  1A8L A;  1BG5 A;  3HVV A;  1ZYE A;  3CRU A;  1N8J A;  4G9H A;  1ZYP A;  2K8V A;  2WB9 A;  5DBQ A;  1XW9 A;  4KB3 A;  4MZC A;  1EOG A;  5JWR B;  17GS A;  1ZGN A;  2EIQ A;  2HRF A;  3FY7 A;  4IGJ A;  4O32 A;  4NAX A;  2O7K A;  3QAG A;  1ERW A;  4CY8 A;  2TIR A;  2VLT A;  5AN1 A;  1HNA A;  3L9S A;  2H8L A;  3C1R A;  5HFI A;  3ZFL A;  2GGT A;  4XS4 B;  2JU5 A;  4K5S A;  1ZL9 A;  2NPB A;  3LYK A;  2F8A A;  3VI7 A;  4XS1 A;  1JZW A;  4KA0 A;  4MPF A;  3EPT A;  1HNC A;  1SL2 B;  5J9B A;  5COH A;  2X8G A;  5ECK B;  3MIX A;  4OCE A;  2K9F A;  2QA1 A;  1GUK A;  2LS5 A;  4TKY A;  4BWQ A;  4EKZ A;  4Q5F A;  1PQN A;  2VM1 A;  4MA9 A;  4EIP A;  1YJ6 A;  4IQA A;  1U3A A;  4ZBB A;  1V9W A;  5F07 A;  2DSA A;  1GUH A;  1H4O A;  3HD5 A;  1FOV A;  2VLV A;  3H93 A;  1RK4 A;  3CRT A;  5B8A A;  3ZFB A;  4ZIJ A;  3UEM A;  1TU8 A;  3J7Y k;  2YAN A;  2H75 A;  2MBS A;  3Q19 A;  4BL7 A;  5DVB A;  1XBS A;  3G9B A;  1SK0 A;  1GUM A;  3ZMK A;  3HYP A;  1MTC A;  1K0O A;  2IMK A;  2HYX A;  2CZ3 A;  3TRQ A;  1TKD B;  1GWC A;  4O7H A;  1FVJ A;  4MCU A;  22GS A;  2GZP A;  4BVY A;  3FKF A;  2HZE B;  4DSS B;  1TTZ A;  4K0N A;  5CRE A;  2OA7 A;  5IMD A;  3P90 A;  3GKX A;  1NHY A;  2LNS A;  5ECN B;  5F05 A;  2CT6 A;  4IW9 A;  1BJX A;  4Z2T A;  4JBB A;  2VD1 A;  4ACS A;  3IV4 A;  2RII A;  2DJK A;  1FB6 A;  1XXU A;  2WFC A;  3GNJ A;  5IM9 A;  2B5X A;  5D9V A;  3DYR A;  3TKR A;  2HT9 A;  2YWM A;  4MLY A;  2QA2 A;  1UN2 A;  4G0L A;  3RPP A;  2BMX A;  3J7Y b;  3KMN A;  4K5R A;  4EDY A;  5CO3 A;  2OAD A;  4D73 A;  4KSM A;  1KBN A;  1EGR A;  3CTG A;  4ULX A;  3C71 A;  1ON4 A;  1YZX A;  4HU7 A;  2V6K A;  3ME7 A;  1X0R A;  1O8X A;  1FHE A;  4TRX A;  3VK9 A;  2CAI A;  1A23 A;  2IIY A;  1G6W A;  3TJB A;  1BYE A;  3LGC A;  2OAC A;  3CBU A;  2WCI A;  2OBI A;  4TXO B;  5ABR A;  4ZB8 A;  4KCE A;  4PQ1 A;  2P5R A;  4TN8 A;  4USS A;  3LXZ A;  2FWF A;  3MWH A;  2C1Y A;  1S3A A;  1TRU A;  3F3R A;  5IMA A;  2X4A A;  2G2Q A;  1OE8 A;  1PRX A;  2REM A;  1G6Y A;  2LRT A;  2JAD A;  3FMW A;  3IRA A;  2YWO A;  4RQX A;  4QL9 A;  5E59 A;  2TRC P;  1YDK A;  1JZD A;  5DJL A;  1JLW A;  2LEG A;  1PA3 A;  4GSS A;  2LRN A;  2VL9 A;  2GSR A;  3FEU A;  4K9Z A;  1WOU A;  6GSS A;  4Q5R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...