3TKSC

Crystal structure of full-length human peroxiredoxin 4 in three different redox states
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
197
structure length
196
Chain Sequence
HLSKAKISKPAPYWEGTAVIDGEFKELKLTDYRGKYLVFFFYPLDFTFVPTEIIAFGDRLEEFRSINTEVVACSVDSQFTHLAWINTPRRQGGLGPIRIPLLSDLTHQISKDYGVYLEDSGHTLRGLFIIDDKGILRQITLNDLPVGRSVDETLRLVQAFQYTDKHGEVCPAGWKPGSETIIPDPAGKLKYFDKLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Peroxiredoxin-4
publication title Structural insights into the peroxidase activity and inactivation of human peroxiredoxin 4
pubmed doi rcsb
source organism Homo sapiens
total genus 64
structure length 196
sequence length 197
chains with identical sequence D
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2011-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00578 AhpC-TSA AhpC/TSA family
C PF10417 1-cysPrx_C C-terminal domain of 1-Cys peroxiredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3tksC00
1X9MB 3FZAA 1YEPA 4MJCA 3NOFA 4NWYA 2B1LA 1SKWB 3KP9A 2B5XA 2VCWA 1V98A 3CXGA 4BA7A 2O7KA 2R2JA 1K0OA 1XFLA 1AC1A 3H93A 2DJKA 2LS5A 1GTIA 1Z6MA 4MZWA 1YKAA 4I2TA 4FYCA 1RK4A 4KGIA 2MBTA 3D4MA 2X8HA 4NAXA 1ERUA 1AQWA 4L8EA 2QSIA 1YEXA 2CZ2A 3HYPA 5B8AA 10GSA 3KD0A 4ECBA 5CRWA 1GH2A 1TI3A 3M1GA 4ZIJA 5ID2A 5H5SA 3CSIA 2VIMA 1F3BA 2IMEA 3LFLA 4OCEA 8GSSA 1Z3EA 2FNOA 4FO5A 1TK5B 4MF6A 2GQLA 4TR4A 1WWJA 5F06A 5G1LA 3TDGA 1F9MA 3ME8A 2VLTA 2C3QA 4ZL8A 2YP6A 5FWGA 1TKDB 4F0CA 3VWXA 4BWQA 4JR6A 3F4SA 3JCML 1QUWA 3VI5A 2D2ZA 4LA1A 3GNJA 4ULXA 4L0UA 1Z7PA 1TI1A 4TXOA 3C71A 1V57A 1XWAA 4LMWA 2DMMA 4PQIA 2H6ZA 3E9JB 3O3TA 5D8IA 3RDWA 4ILFA 1QMVA 5AN1A 3HKRA 1VF3A 3F9UA 2PN8A 2MMOA 2FA4A 2WDUA 1GUMA 2GGTA 4HZ2A 4J57E 1C72A 2CVKA 2VL2A 1VF1A 1GSEA 1X9WB 3VWVA 2VCQA 2DLXA 3EMPA 3DIEA 4O5RA 2OADA 3ERFA 1PN9A 4MH3A 2NVLA 1A2MA 5F05A 3UEMA 1EEMA 3P7XA 4TR3A 4GF0A 1VF4A 4MF7A 1SYRA 1O81A 5FT3A 2C1YA 5HR0A 4NHZA 3TJBA 4IS0A 3LEFA 5GAPD 3GKKA 3IDVA 2F8AA 2PBJA 1CQHA 2VCZA 1FAAA 3IXRA 1ON4A 2NBSA 2H66A 2I9HA 3VK9A 4PNGA 1A0FA 5ELGA 2HE3A 1EGOA 3HXSA 2RLIA 3GUSA 1AIUA 1GSDA 2FWFA 2CAIA 2FLSA 3FEUA 1AUCA 1GTUA 4GWRA 2J23A 6GSUA 20GSA 2DJ3A 2O85A 2GS3A 2V41A 7GSSA 1LJRA 4KCAA 3EWLA 3HHVA 1XPVA 4TKYA 3KGKA 5LCZA 1M2AA 2LJAA 4GQFA 2OKAA 1OE8A 1OE7A 1XOBA 1SK2A 1K0AA 5DAKB 2LJRA 1SYXA 4OFMA 4KH7A 1DUGA 2KOKA 4DSSA 5G5EA 1M99A 3IV4A 5IM9A 1TK8B 3QAGA 4NHWA 3F63A 1G7EA 3UIWA 2XBIA 4GQCA 9GSSA 2IMKA 4OFTA 2WZ9A 1OC8A 4AF2A 1RQMA 2REMA 2CX3A 3D22A 2P31A 5ECMB 2YJHA 2DJ1A 3MWHA 4ZILA 1LU4A 5A4WA 3GKMA 4K0NA 3Q18A 3Q74A 2EIRA 4L0WA 1ZL9A 4EO3A 5B8BA 3IBHA 4V2NA 1F37A 1X5DA 2YWOA 1R5PA 2CX4A 3E3EA 1FG4A 2VM2A 2GDRA 4TR1A 4RQRA 4TN8A 2YOIA 1GL8A 5DJLA 1A24A 4POLA 2DMLA 5KEJA 3D21A 3BD2A 5B6MA 5DCHA 4L5LA 1J9BA 2L5OA 2F3MA 2DSAA 1GSFA 1PA3A 3ZMLA 5ABRA 5B7CA 4MK3A 5C00A 1JLWA 4IQ1A 4KDUA 3KEBA 4QQ7A 1XBSA 2HFDA 3TJJA 5E59A 2GZZA 2C80A 4OO5A 2G2QA 16GSA 2ZNMA 2AHEA 4IJIA 2OE1A 1EOHA 3UVHA 1U87A 1THXA 5CO3A 2V6KA 3HDCA 3C1RA 1QXHA 4XIHA 1SK1A 3M9KA 2L4QA 5GZZB 3GV1A 4JR4A 3UAPA 6GSTA 1MEKA 3RBTA 3G7JA 2DC5A 2LQQA 2TIRA 2HRNA 2YZUA 4ECJA 3RHCA 1XIYA 3FYGA 12GSA 1PX6A 1XWCA 4Q5QA 2PGTA 1XWGA 1PGTA 1TRUA 3RPPA 5IMAA 1VGLA 1UVZA 3DEXA 1BEDA 2B7KA 1YQ1A 1T8EB 3DXBA 5IQYA 1BYEA 2B3SA 3TOTA 3CMIA 1OKTA 3ZVJA 3UVTA 1O85A 1ZYQB 2H6XA 1Q98A 4O92A 1B4QA 3VWUA 1TRWA 3L9UA 3H79A 1ST9A 3F8UA 2Z9SA 1JZWA 1MD4A 4TXOB 1FW1A 4G19A 2FY6A 4OMVA 4H86A 3EE2A 2CVBA 5J41A 4KX4A 3GFKA 2IFQB 3TRPA 1THOA 1K3OA 1TU8A 2C8UA 4F9ZA 3VPTA 2L57A 3TCOA 1JZDA 4IN0A 4ZXGA 4O32A 2M80A 5EY6A 4PGTA 3IAS2 3QR6A 4GRFA 3IAM2 1W89A 2OBIA 5DAKA 4K2DA 1G0TA 3QAVA 4Q5RA 5IOWA 3W8JA 2LEGA 1UN2A 2K6VA 4IKHA 4IQAA 2XC2A 1SKRB 1G7OA 3FK8A 1OAZA 3CYNA 3QMXA 2K8VA 1KNGA 3F6DA 4HJ2A 1V9WA 1DSBA 1EOGA 1IYIA 2B7JA 2GTUA 3RPNA 2H1DA 1K3LA 4X43A 2QC7A 3LQ7A 1ZOFA 5DQSA 1HD2A 1O8WA 4PQ1A 2X8GA 1M2DA 3J7Yk 3BCIA 1ZMAA 3DVWA 1BG5A 2K18A 2XPDA 3NZNA 2H1GA 3FR6A 2HSYA 4J2FA 3G9BA 1M9AA 4AJ7A 3OR5A 4L5OA 3QFBC 4K1FA 2ZUPA 3HZ4A 2XBQA 2C3NA 3MAKA 3MNGA 3TJKA 1YZXA 2CV4A 1R4WA 2YZHA 5F0GA 1PL1A 4V2LA 2JZRA 2YV9A 1WIKA 3FKFA 3CBUA 4X1UA 4ZB8A 1GWCA 2E2GA 2LRCA 3KM6A 5F07A 3GX0A 2KUCA 3LG6A 3ERGA 2GQMA 3GL5A 5CYYA 5IMVA 1X9SB 4PNFA 3LYKA 5L71A 1XVQA 3GA4A 3FR9A 1BQ7A 4I6XA 4DSSB 1XW5A 5D9XA 3TKRA 5COHA 3TGZA 2GT6A 2JU5A 5JCWA 3K8NA 1A2JA 4V1Ag 4G2EA 3HJOA 4EXJA 4FIWA 3ZIVA 2LSTA 4WEYA 3ZIJA 5EVOA 4GXZA 2DJ0A 2HZEB 2ZCTA 4K7IA 5G2ZA 4MH2A 1PL2A 1B8XA 3ERWA 3LSZA 4ZB6A 1EV4A 4EDYA 1T7PB 2PMTA 4ZBBA 4ML6A 2IWTA 1TXXA 2VUPA 5HR2A 2LUSA 1XWBA 2A2SA 2G0FA 1FVJA 4TR1B 2VM1A 2H0IA 3H8QA 3FR3A 2HSHA 2YWMA 4AJ6A 1H4OA 4LL1B 4EUYA 3GSSA 1WJKA 2QGVA 1XXUA 2LKUA 2KP2A 3ZFLA 2C4JA 1PD21 2LV3A 1T4ZA 1K0NA 4OCFA 2IFQA 4K9ZA 2RIIA 4JEDA 1A8YA 1YY7A 3HZ8A 4JRRA 3CSJA 1SU9A 3HD5A 1SKSB 5HFGA 2EC4A 4HU9A 2IL3A 4KSMA 5IOXA 3HVSA 1T00A 5HR1A 2P5QA 4EC0A 4CDOA 2NPBA 2VCVA 1LBKA 2L59A 4NPBA 1HQOA 2IMFA 3TKQA 3DVXA 3MDKA 4GTUA 2GSQA 1FB0A 2KP1A 3WGEA 2GSTA 3U6VA 1FHEA 1OYJA 4RI7A 3DMLA 4IVFA 4WKWA 3LGCA 2B1KA 4WXTA 4KSOA 2R4VA 2H8LA 2ALBA 4ECCA 4WR5A 4Q5NA 2CQ9A 4X0XA 3US3A 1EP7A 1PQNA 2GSRA 1J08A 4ML1A 2OJLA 2LJKA 3KTBA 3R2QA 1X5CA 5J4UA 3PINA 6GSVA 3CRTA 4KUNA 3TUEA 3LXTA 5H5RA 4QL9A 3PGTA 1PMTA 1ILOA 3UOMA 2F9SA 2JADA 2H1AA 1TRVA 3EINA 1PKZA 4PXOA 1ACVA 2R6KA 5CRDA 1XVWA 4FYUA 1XW9A 2B5YA 3F0IA 3ZVJD 4EDZA 2VL3A 3C1SA 2L6DA 3GRXA 3UBKA 1B4PA 3GURA 5EL8A 5JWQB 4IW9A 2R37A 1O7UA 5E4WA 1YKCA 1K0MA 2C0FA 3FZ5A 5ENUA 5CRHA 2NDOA 3GN3A 22GSA 5G1KA 3LORA 3E0UA 3LYPA 3I9V2 2JACA 2VLVA 5DCGA 2PUKC 3O6TA 2MYGA 1I5GA 3ZTLA 3IHQA 3GH9A 2DJJA 4F2IA 2TRXA 4XS1A 3TRQA 3QD9A 3EVIA 2NTOA 2HRFA 1A0RP 4MCUA 1M7TA 3IOSA 5LD0A 2JZSA 3KTLA 1M2BA 1GSSA 2FWHA 3SWLA 3F3QA 2H72A 5D9VA 1GULA 4KDYA 2J9HA 4PQHA 1E2YA 2RM6A 4MPGA 2K9FA 1BX9A 3WGXA 3GYKA 3G7YA 1K0BA 1QQ2A 4YQMA 3TKSC 1BJXA 5GSTA 5IMDA 2IMIA 4TRXA 2HZEA 3ZREA 2R3XA 2IJYA 1HNBA 3I69A 1GLPA 3KH9A 5FHIA 3EC3A 1FB6A 2CZ3A 2HZFA 2N5BA 4F82A 2L6CA 4KE3A 5JCGA 4BVXA 4N0ZA 1GSYA 4K7OA 5HR3A 1PRXA 2XPEA 1AAZA 3ZFBA 4F03A 4BL7A 2AJQB 5IPGA 3C73A 3GTUB 4YQVA 3L9VA 1TK0B 3IC4A 1ZYEA 4FH8A 3A2XA 3N5OA 2N5FA 4D73B 1XW6A 1VF2A 1NW2A 3IRAA 1V2AA 1N2AA 5IMFA 3GSTA 3L4NA 3IK7A 1WPIA 2FD3A 1T4YA 5G30A 3D0ZA 2WB9A 5AIVA 2X8CA 3LWAA 3QPMA 5DBQA 1J0FA 3DGQA 2E7PA 2H75A 2WFCA 1GNWA 5AGYA 1JZRA 2V2GA 4GSNA 1WRYA 1GUKA 3ZYWA 4MPFA 3D4TA 3EU3A 3M8NA 1XWKA 1A2LA 1ZGNA 5ECRB 3GIXA 4XRDA 1EGRA 2GZPA 4WR4A 5DJMA 2H71A 2RM5A 1CQGA 4MA9A 3ED3A 1SJ6A 2CAQA 3TB2A 1FOVA 5G31A 2GLRA 2JSYA 3VPQA 3S9FA 5A5KA 6GSYA 2O8VB 1SD9A 2A2RA 3BCKA 2IN3A 5J9BA 1Q4JA 4ZBDA 2VLUA 4KB3A 2PWJA 2RUEA 1XCCA 3GX8A 3EU4A 3M9JA 4HOJA 2LNSA 4MJBA 3RAZA 3CTFA 2YWNA 1S3AA 3UJ1A 1WE0A 5IIZA 4PX1A 11GSA 5ECHB 1GP1A 4QL7A 1ERWA 4JZQA 1TOFA 5ECSA 3DD3A 6GSSA 4IP6A 2LRTA 4Z7XA 2GQKA 1Z7RA 2O89A 1YDKA 2LQOA 3IA1A 1K0DA 1TJDA 2YV7A 3P90A 1T3BA 3A2VA 1GTBA 3I43A 1QGVA 4OO4A 4MZCA 3KXOA 4KNDA 3FZ9A 3W6GA 3FZ4A 3H1NA 1PKWA 1DE1A 3CSHA 4LLRA 6GSWA 1EZKA 3IE3A 1MDKA 2FWEA 1YJ6A 1I9DA 1MD3A 3C7MA 4P3YB 3UMAA 2MMZA 4KDXA 4YAPA 3APQA 4MZBA 2E2MA 2H30A 4JBBA 2CT6A 1OVNA 3F4TA 1M9BA 5LNKe 3N9JA 2DIZA 4WBJA 1URMA 3WGDA 2VO4A 3QOUA 1K0CA 3GMFA 3UARA 5C04A 3L0HA 2VCTA 4JU5A 1U3IA 4NMUA 2AAWA 4I2UA 3CRUA 4OWYA 2OACA 4CW9A 1WMJA 1DBYA 1Z9HA 4WF4A 2H1BA 2OE3A 2PERA 3WT2A 5G5FA 3GTUA 3KZQA 1OKDA 1JLVA 18GSA 4DSRA 1U6TA 4I5QA 4D73A 5ECNB 3Q6OA 4IELA 1A8LA 1MDJA 2L5LA 1T1VA 2I4AA 1ML6A 1HNCA 3GHAA 1Z6NA 3A5WA 1G6YA 2IIYA 1EV9A 1KTEA 1GSQA 1X0RA 2HYXA 4PURA 2H74A 4HDEA 5HQPA 2P0GA 3CTGA 5CNWA 4KAEA 4E8HA 2VAFA 5D9WA 5J9CA 17GSA 1B48A 1Y25A 5A4VA 3C8EA 4XS4B 2ON7A 4RUVA 1H75A 1X5EA 4E8EA 1OC9B 2LRNA 1NSWA 1Y6EA 1UC7A 1HYUA 1USBA 2HI7A 5D9TA 4POBA 3TKSA 1F6MC 2PVQA 4TXVA 1PX7A 1F2EA 3L78A 2V32A 3FW2A 4YH2A 4GSTA 3ZITA 2H01A 3HCZA 4I97A 3UBLA 2L4CA 4ZBAA 4O7HA 1FO5A 2R5GA 4IBPA 2YWIA 2GSSA 5IMCA 14GSA 3D5JA 4LMVA 5AISA 4HS1A 1AXDA 3V1WA 2WCIA 2X99A 2JZTA 1B9YC 3FRCA 3P2AA 2HNLA 3KJYA 4CHSA 4K7NA 2TRCP 1TTZA 3D6IA 4MP4A 2HLSA 5CRGA 4YQUA 1V58A 4BWSA 3PH9A 1IYHA 4V1Ap 5IMZA 2YCDA 3M0FA 2MMNA 3NIVA 3BOAA 4IHUA 6GSXA 4G9HA 3APSA 2M72A 2FGXA 3PR8A 3Q19A 4WBRD 4JE1A 3WYWA 1ZCPA 3I6AA 2F8FA 1S3CA 1O73A 2O87A 4KA0A 2K8SA 4FYBA 4HI7A 2B5EA 2VD0A 4TOPA 4IJ3A 4J56E 3TOUA 5F8BA 5KN0A 5EPFA 4Q5FA 4PUFC 5HFKA 4RI6A 3W8SA 2P5RA 1DE2A 5INYA 5D73A 4N0VA 4GLTA 4DSQA 2HT9A 5J5NA 1GNEA 3GL3A 3DKSA 2C3TA 4WF5A 5ECKB 4HQZA 1EP8A 2KLXA 1GLQA 4EL1A 1N8JA 2N5AA 3VFIA 4HEA2 3HJMA 3ZRDA 3F3RA 2FUG2 4ZB9A 3VI7A 3SBCA 1SJIA 4XTSA 1SL2B 3HJPA 5ECLB 3GKXA 1R5AA 13GSA 5J3RA 3M3MA 5CP1A 1M0UA 1AQVA 1U88A 1QFNA 5D96A 1TP9A 4ISDA 1EEJA 1JHBA 2H73A 2LTKA 2F51A 1YF1A 1TU7A 1S3DA 3ISOA 1VRSD 4POMA 4N11A 3U5RE 4OD7A 4GCIA 2IPAA 3VLNA 1R7HA 2GZYA 3EYTA 2JL4A 1O8XA 4ZL7A 2OA7A 4ZL9A 1KBNA 3KIJA 3KCMA 1HNAA 4HU7A 5B6NA 5JWOB 2AUVA 5DVBA 3G7IA 5A4UA 4IGJA 1GTAA 5IO2A 1ERTA 2E0QA 3DRNA 4GSSA 2CA8A 2I3YA 4MMMA 1SENA 2H0HA 2MMAA 4XHMA 1JFUA 2A4VA 3TRXA 3FHKA 3APOA 1R26A 2FA8A 5KN3A 1JZOA 3QCPA 4XS4A 4NXIA 5DALB 3TJGA 2I1UA 1TDIA 5GSSA 4LL4B 1OC9A 4KCEA 1FVKA 4XRAA 2YNXA 3GKNA 2C0DA 4MF5A 4RQXA 4PUAA 3QDNA 5KN1A 5DQYA 2VD1A 3FY7A 1AW9A 2KHPA 3ZMKA 4ECIA 5CREA 1WOUA 2DBCA 3HVXA 5D93A 1QK8A 4N30A 2AYTA 2WS2A 4MJAA 19GSA 3P8WA 2HXKA 1NM3A 1K3YA 2LNTA 3TJFA 1UA5A 5GAND 1TW9A 4ID0A 1PSQA 2GT5A 3UL3A 3DYRA 1U3AA 3ME7A 2RUFA 3KP8A 4XS6A 2ON5A 4AGSA 2YN1A 4ACSA 1V40A 1O6JA 4EVMA 3A2WA 3ZL5A 2GVPA 5AIXA 2WJUA 1SJZA 2VCXA 2BMXA 2PPTA 1YF0A 3KH7A 4MJEA 5ECOB 5JWRB 3LJRA 2BJXA 2VL2C 4POKA 3EURA 2XHFA 3F6FA 5H5QA 1A23A 4DEJA 1ERVA 2DJ2A 2I81A 3ZLPA 5ECQB 2PU9C 5ID2B 4BVYA 3A3TA 3L9SA 3TKSE 3IK9A 3AY8A 4HQSA 5ECIB 4V2MA 3WT1A 2YANA 4TW5A 5JCUA 3MSZA 2QKEA 2H19A 4K8MA 3IR4A 3BJ5A 2IMDA 1SL0B 2M46A 1GUHA 1SD8A 2JSZA 2V1MA 3GH6A 3QAWA 4N10A 4NV2A 1XZOA 4F0BA 1BAYA 2EIQA 2FCHA 4K0GA 2MZCA 5IO0A 4DVCA 1XOAA 2X64A 1TRSA 3KMNA 1NHOA 2FHEA 2WULA 3ZZXA 1EWXA 2OBKA 2YPMA 4OFNA 1F3AA 4EE0A 3HVVA 2YJ7A 4MDCA 2WGRA 4HUAA 5KN2A 1E6BA 4XCSA 1Z5YE 2VOCA 3DWVA 1MDIA 3KMOA 4EKZA 4IP1A 3LXZA 3TKPA 1GSUA 4TR0A 3WD6A 2DIYA 2H6YA 1KEBA 4KW6A 1AQXA 2MBSA 2CVDA 2WRTA 3J7Yb 1SL1B 4AJ8A 2PVOC 4HJMA 3VWWA 1MTCA 1WP0A 1NHYA 1OC3A 1ABAA 3IPZA 2V6OA 2OE0A 4WETA 5DDLA 5DALA 1W4VA 3QFAC 2AB6A 2H0GA 1GRXA 1ZZYA 2VL9A 2FWGA 3F4RA 5IPHA 2EIOA 2C0EA 4MLYA 5ELAA 3EMXA 2C0GA 4BPYA 5CAXA 1G6WA 3HY2A 3VURA 4I8BA 4K6XA 4MABA 2ES7A 2BTOT 4HZ4A 1B9XC 3RHBA 1RW1A 5HFIA 4G10A 4EF0A 4TVEA 2B6MA 3O76A 3BBYA 2AV4A 3H4KA 2H76A 2H70A 3HA9A 4NV5A 1SK0A 5ECPB 4YAVA
chains in the Genus database with same CATH superfamily
1X9MB 3FZAA 1YEPA 4MJCA 3NOFA 4NWYA 2B1LA 1SKWB 3KP9A 2B5XA 2VCWA 1V98A 3CXGA 4BA7A 2O7KA 2R2JA 1K0OA 1XFLA 1AC1A 3H93A 2DJKA 2LS5A 1GTIA 1Z6MA 4MZWA 1YKAA 3A5IA 4I2TA 4FYCA 1RK4A 4KGIA 2MBTA 3D4MA 2X8HA 4NAXA 1ERUA 1AQWA 4L8EA 2QSIA 1YEXA 2CZ2A 3HYPA 5B8AA 10GSA 3KD0A 4ECBA 5CRWA 1GH2A 1TI3A 3MYDA 3M1GA 4ZIJA 5ID2A 5H5SA 3CSIA 2VIMA 1F3BA 2IMEA 3LFLA 4OCEA 8GSSA 1Z3EA 2FNOA 4FO5A 1TK5B 4MF6A 2GQLA 4TR4A 1WWJA 5F06A 5G1LA 3TDGA 1F9MA 2HSMA 3ME8A 2VLTA 3PPUA 2C3QA 4ZL8A 2YP6A 5FWGA 1TKDB 4F0CA 3VWXA 4BWQA 4JR6A 3F4SA 3JCML 1QUWA 3VI5A 2D2ZA 4LA1A 3GNJA 4ULXA 4L0UA 1Z7PA 1TI1A 4TXOA 3C71A 1V57A 1XWAA 4LMWA 2DMMA 4PQIA 2H6ZA 4Z2RA 3E9JB 1M3IA 3O3TA 5D8IA 3RDWA 4ILFA 1QMVA 5AN1A 3HKRA 1VF3A 3F9UA 2PN8A 2MMOA 2FA4A 2WDUA 1GUMA 2GGTA 4HZ2A 3MIXA 4J57E 1C72A 2CVKA 2VL2A 1VF1A 1GSEA 1X9WB 3VWVA 2VCQA 2DLXA 3EMPA 3DIEA 4O5RA 2OADA 3ERFA 1PN9A 4MH3A 2NVLA 1A2MA 5F05A 3UEMA 1EEMA 3P7XA 4TR3A 4GF0A 1VF4A 4MF7A 1SYRA 2X4AA 1O81A 5FT3A 2C1YA 5HR0A 4NHZA 3TJBA 4IS0A 3LEFA 5GAPD 3GKKA 3IDVA 2F8AA 2PBJA 1CQHA 2VCZA 3CQFA 1FAAA 4G0KA 1FOHA 3IXRA 1ON4A 2R0GA 2NBSA 2H66A 2I9HA 3VK9A 4PNGA 1A0FA 5ELGA 2HE3A 1EGOA 3HXSA 2RLIA 3GUSA 1AIUA 1GSDA 2FWFA 2CAIA 2FLSA 3FEUA 1AUCA 1GTUA 4GWRA 2J23A 6GSUA 20GSA 2DJ3A 2HRKA 2O85A 2GS3A 2V41A 7GSSA 1LJRA 4KCAA 3EWLA 3HHVA 1XPVA 4TKYA 3KGKA 5LCZA 1M2AA 2LJAA 4GQFA 2OKAA 4K5RA 1OE8A 1OE7A 1XOBA 1SK2A 1K0AA 5DAKB 2LJRA 1SYXA 4OFMA 4KH7A 1DUGA 2KOKA 4DSSA 5G5EA 1M99A 3IV4A 5IM9A 1TK8B 3QAGA 4NHWA 3F63A 1G7EA 3UIWA 2XBIA 4GQCA 9GSSA 2IMKA 4OFTA 2WZ9A 4EIPA 1OC8A 4AF2A 1RQMA 2REMA 2CX3A 3D22A 2P31A 5ECMB 2YJHA 2DJ1A 3MWHA 4ZILA 1LU4A 5A4WA 3GKMA 4K0NA 3Q18A 3Q74A 2EIRA 4L0WA 1ZL9A 4EO3A 5B8BA 3IBHA 4V2NA 1F37A 1X5DA 2YWOA 1R5PA 2CX4A 3E3EA 1FG4A 2VM2A 2GDRA 4TR1A 4RQRA 4TN8A 2YOIA 1GL8A 5DJLA 1A24A 4POLA 2DMLA 5KEJA 3D21A 3BD2A 5B6MA 5DCHA 4L5LA 1J9BA 2L5OA 2F3MA 2DSAA 1GSFA 1PA3A 3ZMLA 5ABRA 5B7CA 4MK3A 5C00A 1JLWA 4CY8A 4IQ1A 4KDUA 3KEBA 4QQ7A 1XBSA 2HFDA 3TJJA 5E59A 2GZZA 2C80A 4OO5A 2G2QA 16GSA 2ZNMA 2AHEA 4IJIA 2OE1A 1EOHA 3UVHA 1U87A 1THXA 5CO3A 2V6KA 3HDCA 3C1RA 1QXHA 4XIHA 1SK1A 3M9KA 2L4QA 5GZZB 3GV1A 4JR4A 3UAPA 6GSTA 1MEKA 3RBTA 3G7JA 2DC5A 2LQQA 2TIRA 2HRNA 2YZUA 4ECJA 1PN0A 3RHCA 1XIYA 3FYGA 12GSA 1PX6A 1XWCA 4Q5QA 2PGTA 1XWGA 1PGTA 1TRUA 3RPPA 5IMAA 1VGLA 1UVZA 3DEXA 1BEDA 2B7KA 1YQ1A 1T8EB 3DXBA 5IQYA 1BYEA 2B3SA 3TOTA 3CMIA 1OKTA 3ZVJA 4O5UA 3UVTA 1O85A 1ZYQB 2H6XA 1Q98A 4O92A 1B4QA 3VWUA 1TRWA 3L9UA 3H79A 1ST9A 3F8UA 2Z9SA 1JZWA 1MD4A 4TXOB 1FW1A 4G19A 2FY6A 4OMVA 4H86A 2X49A 4K5SA 3EE2A 2CVBA 2QA2A 5J41A 4KX4A 3GFKA 2IFQB 3TRPA 1THOA 1K3OA 1TU8A 2C8UA 4F9ZA 3VPTA 2L57A 3TCOA 1JZDA 4IN0A 4G0LA 4ZXGA 4O32A 2M80A 5EY6A 4PGTA 3IAS2 3QR6A 4GRFA 3IAM2 1W89A 2OBIA 5DAKA 4K2DA 1G0TA 3QAVA 4Q5RA 5IOWA 3W8JA 2LEGA 1UN2A 2K6VA 4IKHA 4IQAA 2XC2A 1SKRB 1G7OA 3FK8A 1OAZA 3CYNA 3QMXA 2K8VA 1KNGA 3F6DA 4HJ2A 1V9WA 1DSBA 1EOGA 1IYIA 2B7JA 2GTUA 3RPNA 2H1DA 1K3LA 4X43A 2QC7A 3LQ7A 1ZOFA 5DQSA 1HD2A 1O8WA 4PQ1A 2X8GA 1M2DA 3J7Yk 3BCIA 1ZMAA 3DVWA 1BG5A 2K18A 2XPDA 3NZNA 2H1GA 3FR6A 2HSYA 4J2FA 3G9BA 4HSCX 1M9AA 4AJ7A 3OR5A 4L5OA 3QFBC 4K1FA 2ZUPA 3HZ4A 2XBQA 2C3NA 3MAKA 3MNGA 3TJKA 1YZXA 2CV4A 1R4WA 2YZHA 5F0GA 1PL1A 4V2LA 2JZRA 2YV9A 3IC8A 1WIKA 3FKFA 3CBUA 4X1UA 4ZB8A 1GWCA 4KF9A 2E2GA 2LRCA 3KM6A 5F07A 3GX0A 2KUCA 3LG6A 3ERGA 2GQMA 3GL5A 5CYYA 5IMVA 1X9SB 4PNFA 3LYKA 5L71A 1XVQA 3GA4A 3FR9A 1BQ7A 4I6XA 4DSSB 1XW5A 5D9XA 3TKRA 5COHA 3TGZA 2GT6A 2JU5A 5JCWA 3K8NA 1A2JA 4V1Ag 4G2EA 3HJOA 4EXJA 4FIWA 3ZIVA 2LSTA 4WEYA 3ZIJA 5EVOA 4GXZA 2DJ0A 2HZEB 2ZCTA 4K7IA 5G2ZA 4MH2A 1PL2A 1B8XA 3ERWA 3LSZA 4ZB6A 1EV4A 4EDYA 1T7PB 2PMTA 4ZBBA 4ML6A 2IWTA 1TXXA 2VUPA 5HR2A 2LUSA 1XWBA 2A2SA 2G0FA 1FVJA 4TR1B 2VM1A 2H0IA 3H8QA 3FR3A 4BVXB 2HSHA 2YWMA 4AJ6A 1H4OA 4LL1B 4EUYA 3GSSA 1WJKA 2QGVA 1XXUA 2LKUA 2KP2A 3ZFLA 2C4JA 4BL7B 1PD21 2LV3A 1T4ZA 1K0NA 4OCFA 2IFQA 4K9ZA 2RIIA 4JEDA 1A8YA 1YY7A 3HZ8A 4JRRA 3CSJA 1SU9A 3HD5A 1SKSB 5HFGA 2EC4A 4HU9A 2IL3A 4KSMA 5IOXA 3HVSA 1T00A 5HR1A 2P5QA 4EC0A 4CDOA 2NPBA 5BRTA 2VCVA 1LBKA 2L59A 4NPBA 1HQOA 2IMFA 3TKQA 3DVXA 3MDKA 4GTUA 2GSQA 1FB0A 2KP1A 3WGEA 5KOXA 2GSTA 3U6VA 1FHEA 1OYJA 4RI7A 3DMLA 4IVFA 4WKWA 3LGCA 2B1KA 4WXTA 4KSOA 2R4VA 2H8LA 3HVNA 2ALBA 4ECCA 4WR5A 4Q5NA 2CQ9A 4X0XA 3US3A 1EP7A 1PQNA 2GSRA 1J08A 4ML1A 2OJLA 2LJKA 3KTBA 3R2QA 1X5CA 5J4UA 3PINA 6GSVA 3CRTA 4KUNA 3TUEA 3LXTA 5H5RA 4QL9A 3PGTA 1PMTA 1ILOA 3UOMA 2F9SA 2JADA 2H1AA 1TRVA 3EINA 1PKZA 4PXOA 1ACVA 2R6KA 5CRDA 1XVWA 4FYUA 4O5QA 1ZYPA 1XW9A 2B5YA 3F0IA 3ZVJD 4EDZA 2VL3A 3C1SA 4A5PA 2L6DA 3GRXA 3UBKA 5KOWA 4PTSA 1B4PA 3GURA 5EL8A 5JWQB 4IW9A 2R37A 1O7UA 2R0PA 5E4WA 1YKCA 1K0MA 2C0FA 3FZ5A 5ENUA 5CRHA 2NDOA 3GN3A 22GSA 5G1KA 3LORA 3E0UA 3LYPA 3I9V2 2JACA 2VLVA 5DCGA 2PUKC 3O6TA 2MYGA 1I5GA 3ZTLA 3IHQA 3GH9A 2DJJA 4F2IA 2TRXA 4XS1A 1PFOA 3TRQA 1S3RA 3QD9A 3EVIA 2NTOA 2HRFA 3IHGA 1A0RP 4MCUA 1M7TA 3IOSA 5LD0A 2JZSA 3KTLA 1M2BA 1GSSA 2FWHA 4MNNA 3SWLA 3F3QA 2H72A 5D9VA 1GULA 4KDYA 2J9HA 4PQHA 1E2YA 2RM6A 4Z2TA 4MPGA 4K2XA 2K9FA 1BX9A 3WGXA 3GYKA 3EPTA 3G7YA 1K0BA 1QQ2A 4YQMA 3TKSC 1BJXA 3LW9A 5GSTA 5IMDA 2IMIA 4TRXA 2HZEA 3ZREA 2R3XA 2IJYA 1HNBA 3I69A 1GLPA 3KH9A 5FHIA 3EC3A 1FB6A 2CZ3A 2HZFA 2N5BA 4F82A 2L6CA 4KE3A 5JCGA 4BVXA 4N0ZA 1GSYA 4K7OA 5HR3A 1PRXA 2XPEA 1AAZA 3ZFBA 4F03A 4BL7A 2AJQB 5IPGA 3C73A 3GTUB 4YQVA 3L9VA 1TK0B 3IC4A 1ZYEA 4FH8A 3A2XA 3N5OA 2N5FA 4D73B 1XW6A 1VF2A 1NW2A 3IRAA 1V2AA 1N2AA 5IMFA 3GSTA 3L4NA 3IK7A 1WPIA 2FD3A 1T4YA 5G30A 3D0ZA 2WB9A 5AIVA 2X8CA 3LWAA 3QPMA 5DBQA 4YKGA 1J0FA 3DGQA 2E7PA 2H75A 2WFCA 1GNWA 5AGYA 1JZRA 2V2GA 4GSNA 1WRYA 1GUKA 3ZYWA 4MPFA 3D4TA 3EU3A 3M8NA 1XWKA 1A2LA 1ZGNA 5ECRB 3GIXA 4XRDA 1EGRA 2GZPA 4WR4A 5DJMA 2H71A 2RM5A 1CQGA 4MA9A 3ED3A 1SJ6A 2CAQA 3TB2A 1FOVA 5G31A 2GLRA 2JSYA 3VPQA 3S9FA 5A5KA 6GSYA 2O8VB 3R3EA 1SD9A 2A2RA 3BCKA 4EIQA 2IN3A 5J9BA 1Q4JA 4ZBDA 2VLUA 4KB3A 2PWJA 2RUEA 1XCCA 3GX8A 3EU4A 3M9JA 4HOJA 2LNSA 4MJBA 3RAZA 3CTFA 2YWNA 1S3AA 3UJ1A 1WE0A 5IIZA 4PX1A 11GSA 5ECHB 1GP1A 4QL7A 1ERWA 4JZQA 1TOFA 5ECSA 3DD3A 6GSSA 4IP6A 2LRTA 4Z7XA 2GQKA 1Z7RA 2O89A 1YDKA 2LQOA 3IA1A 1K0DA 1TJDA 2YV7A 3P90A 1T3BA 3A2VA 1GTBA 3I43A 1QGVA 4OO4A 4MZCA 3KXOA 4KNDA 3FZ9A 3W6GA 3FZ4A 3H1NA 1PKWA 1DE1A 3CSHA 4LLRA 6GSWA 1EZKA 3IE3A 1MDKA 2FWEA 1YJ6A 1I9DA 1MD3A 3C7MA 4P3YB 3UMAA 2MMZA 4KDXA 1M3JA 4YAPA 3APQA 4MZBA 2E2MA 2H30A 4JBBA 2CT6A 1OVNA 3F4TA 1M9BA 5LNKe 3N9JA 2DIZA 4WBJA 4G0IA 1URMA 3WGDA 2VO4A 3QOUA 1K0CA 3GMFA 3UARA 5C04A 3L0HA 2VCTA 4JU5A 1U3IA 4NMUA 2AAWA 4I2UA 3CRUA 4OWYA 2OACA 4CW9A 1WMJA 1DBYA 1Z9HA 4WF4A 2DKIA 2H1BA 2OE3A 2PERA 3WT2A 4Z2UA 5G5FA 3GTUA 3KZQA 1OKDA 1JLVA 18GSA 4DSRA 1U6TA 4I5QA 4D73A 5ECNB 3Q6OA 4IELA 1A8LA 1MDJA 2L5LA 3FMWA 1T1VA 2I4AA 1ML6A 1HNCA 3GHAA 1Z6NA 3A5WA 1G6YA 2IIYA 1EV9A 1KTEA 1GSQA 1X0RA 2HYXA 4PURA 2H74A 4HDEA 5HQPA 2P0GA 3CTGA 5CNWA 4KAEA 4E8HA 2VAFA 5D9WA 2A2PA 5J9CA 17GSA 1B48A 1Y25A 5A4VA 3C8EA 4XS4B 2ON7A 4RUVA 1H75A 1X5EA 4E8EA 1OC9B 2LRNA 1NSWA 1Y6EA 1UC7A 1HYUA 1USBA 2HI7A 5D9TA 4POBA 3TKSA 1F6MC 2PVQA 4TXVA 1PX7A 1F2EA 3L78A 2V32A 3FW2A 4YH2A 4GSTA 3ZITA 2H01A 3HCZA 4I97A 3UBLA 2L4CA 4ZBAA 4O7HA 1FO5A 2R5GA 4IBPA 2YWIA 2GSSA 5IMCA 14GSA 3D5JA 4LMVA 5AISA 4HS1A 1AXDA 3V1WA 2WCIA 2X99A 2JZTA 1B9YC 3FRCA 3P2AA 2HNLA 3KJYA 4CHSA 4K7NA 2TRCP 1TTZA 3D6IA 4MP4A 2HLSA 5CRGA 4YQUA 1V58A 4BWSA 3PH9A 1IYHA 4V1Ap 5IMZA 2YCDA 3M0FA 2R0CA 2MMNA 3NIVA 3BOAA 4IHUA 6GSXA 4G9HA 3APSA 2M72A 2HRAA 2FGXA 2QA1A 4YKFA 3PR8A 3Q19A 4WBRD 4JE1A 3WYWA 1ZCPA 3I6AA 2F8FA 1S3CA 1O73A 2O87A 4KA0A 4ICYA 2K8SA 4FYBA 4HI7A 2B5EA 2VD0A 4TOPA 2UZ8A 4IJ3A 4J56E 3TOUA 5F8BA 5KN0A 5EPFA 4Q5FA 4PUFC 5HFKA 4RI6A 3W8SA 2P5RA 1DE2A 5INYA 4USSA 5D73A 4N0VA 4GLTA 4DSQA 2HT9A 5J5NA 4BVYB 1GNEA 3GL3A 3DKSA 2C3TA 4WF5A 5ECKB 4HQZA 1EP8A 2KLXA 1GLQA 4EL1A 1N8JA 2N5AA 3VFIA 4HEA2 3HJMA 3ZRDA 3F3RA 2FUG2 4ZB9A 2DKHA 3VI7A 3SBCA 1SJIA 1ZYNA 4XTSA 1SL2B 3HJPA 5ECLB 3GKXA 1R5AA 13GSA 5J3RA 3M3MA 5CP1A 1M0UA 1AQVA 1U88A 1QFNA 5D96A 1TP9A 4ISDA 1EEJA 1JHBA 2H73A 2LTKA 2F51A 1YF1A 1TU7A 1S3DA 3ISOA 1VRSD 4POMA 4N11A 3U5RE 4OD7A 4GCIA 2IPAA 3VLNA 1R7HA 2GZYA 3EYTA 2JL4A 1O8XA 4ZL7A 2OA7A 4ZL9A 1KBNA 4BIKA 3KIJA 3KCMA 1HNAA 4HU7A 5B6NA 5JWOB 2AUVA 5DVBA 3G7IA 5A4UA 4IGJA 1GTAA 5IO2A 1ERTA 2E0QA 3DRNA 4GSSA 2CA8A 2I3YA 4MMMA 1SENA 2H0HA 2MMAA 4XHMA 1JFUA 2A4VA 3TRXA 3FHKA 3APOA 1R26A 2FA8A 5KN3A 1JZOA 3QCPA 4XS4A 4NXIA 5DALB 3TJGA 2I1UA 1TDIA 5GSSA 4LL4B 1OC9A 4KCEA 1FVKA 4XRAA 2YNXA 3GKNA 2C0DA 4MF5A 4X4JA 4RQXA 4PUAA 3QDNA 5KN1A 5DQYA 2VD1A 3FY7A 1AW9A 2KHPA 3ZMKA 4ECIA 5CREA 1WOUA 2DBCA 3HVXA 5D93A 1QK8A 4N30A 2AYTA 2WS2A 4MJAA 19GSA 3P8WA 2HXKA 1NM3A 1K3YA 2LNTA 3TJFA 1UA5A 5GAND 1TW9A 4ID0A 1PSQA 2GT5A 3UL3A 3DYRA 1U3AA 3ME7A 2RUFA 3KP8A 4XS6A 2ON5A 4AGSA 2YN1A 4ACSA 1V40A 1O6JA 4EVMA 3A2WA 3ZL5A 2GVPA 5AIXA 2WJUA 1SJZA 2VCXA 2BMXA 2PPTA 1YF0A 3KH7A 4MJEA 5ECOB 5JWRB 3LJRA 2BJXA 2VL2C 4POKA 3EURA 2XHFA 3F6FA 5H5QA 1A23A 4DEJA 1ERVA 2DJ2A 2I81A 3ZLPA 5ECQB 2PU9C 5ID2B 4BVYA 3A3TA 3L9SA 3TKSE 3IK9A 3AY8A 4HQSA 5BMUA 5ECIB 4V2MA 3WT1A 2YANA 4TW5A 5JCUA 3MSZA 2QKEA 2H19A 4K8MA 3IR4A 3BJ5A 2IMDA 1SL0B 2M46A 1GUHA 1SD8A 2JSZA 2V1MA 3GH6A 3QAWA 4N10A 4NV2A 1XZOA 4F0BA 1BAYA 2EIQA 2FCHA 4K0GA 2MZCA 5IO0A 4DVCA 1XOAA 2X64A 1TRSA 3KMNA 1NHOA 4FQUA 2FHEA 2WULA 3ZZXA 1EWXA 2OBKA 2YPMA 4OFNA 1F3AA 4EE0A 3HVVA 2YJ7A 4MDCA 2WGRA 4HUAA 5KN2A 1E6BA 4XCSA 1Z5YE 2VOCA 3DWVA 1MDIA 3KMOA 4EKZA 4IP1A 3LXZA 3TKPA 1GSUA 4TR0A 3WD6A 2DIYA 2H6YA 1KEBA 4KW6A 4CY6A 1AQXA 2MBSA 2CVDA 2WRTA 3J7Yb 1SL1B 1XG8A 4AJ8A 2PVOC 4HJMA 3VWWA 1MTCA 1WP0A 1NHYA 1OC3A 1ABAA 3IPZA 2V6OA 2OE0A 4WETA 5DDLA 5DALA 1W4VA 3QFAC 2AB6A 2H0GA 1GRXA 1ZZYA 2VL9A 2FWGA 3F4RA 5IPHA 2EIOA 2C0EA 4MLYA 5ELAA 3EMXA 2C0GA 4BPYA 5CAXA 1G6WA 3HY2A 3VURA 4I8BA 4K6XA 4MABA 2ES7A 2BTOT 4HZ4A 1B9XC 3RHBA 1RW1A 5HFIA 4G10A 4EF0A 4TVEA 2B6MA 3O76A 3BBYA 2AV4A 3H4KA 2H76A 2H70A 3HA9A 4NV5A 1SK0A 5ECPB 2A4HA 4YAVA
chains in the Genus database with same CATH topology
1X9MB 3FZAA 1YEPA 4MJCA 3NOFA 4NWYA 2B1LA 1SKWB 3KP9A 2B5XA 2VCWA 1V98A 3CXGA 4BA7A 2O7KA 2R2JA 1K0OA 1XFLA 1AC1A 3H93A 2DJKA 2LS5A 1GTIA 1Z6MA 4MZWA 1YKAA 3A5IA 4I2TA 4FYCA 1RK4A 4KGIA 2MBTA 3D4MA 2X8HA 4NAXA 1ERUA 1AQWA 4L8EA 2QSIA 1YEXA 2CZ2A 3HYPA 5B8AA 10GSA 3KD0A 4ECBA 5CRWA 1GH2A 1TI3A 3MYDA 3M1GA 4ZIJA 5ID2A 5H5SA 3CSIA 2VIMA 1F3BA 2IMEA 3LFLA 4OCEA 8GSSA 1Z3EA 2FNOA 4FO5A 1TK5B 4MF6A 2GQLA 4TR4A 1WWJA 5F06A 5G1LA 3TDGA 1F9MA 2HSMA 3ME8A 2VLTA 3PPUA 2C3QA 4ZL8A 2YP6A 5FWGA 1TKDB 4F0CA 3VWXA 4BWQA 4JR6A 3F4SA 3JCML 1QUWA 3VI5A 2D2ZA 4LA1A 3GNJA 4ULXA 4L0UA 1Z7PA 1TI1A 4TXOA 3C71A 1V57A 1XWAA 4LMWA 2DMMA 4PQIA 2H6ZA 4Z2RA 3E9JB 3O3TA 5D8IA 3RDWA 4ILFA 1QMVA 5AN1A 3HKRA 1VF3A 3F9UA 2PN8A 2MMOA 2FA4A 2WDUA 1GUMA 2GGTA 4HZ2A 3MIXA 4J57E 1C72A 2CVKA 2VL2A 1VF1A 1GSEA 1X9WB 3VWVA 2VCQA 2DLXA 3EMPA 3DIEA 4O5RA 2OADA 3ERFA 1PN9A 4MH3A 2NVLA 1A2MA 5F05A 3UEMA 1EEMA 3P7XA 4TR3A 4GF0A 1VF4A 4MF7A 1SYRA 2X4AA 1O81A 5FT3A 2C1YA 5HR0A 4NHZA 3TJBA 4IS0A 3LEFA 5GAPD 3GKKA 3IDVA 2F8AA 2PBJA 1CQHA 2VCZA 1FAAA 4G0KA 1FOHA 3IXRA 1ON4A 2R0GA 2NBSA 2H66A 2I9HA 3VK9A 4PNGA 1A0FA 5ELGA 2HE3A 1EGOA 3HXSA 2RLIA 3GUSA 1AIUA 1GSDA 2FWFA 2CAIA 2FLSA 3FEUA 1AUCA 1GTUA 4GWRA 2J23A 6GSUA 20GSA 2DJ3A 2HRKA 2O85A 2GS3A 2V41A 7GSSA 1LJRA 4KCAA 3EWLA 3HHVA 1XPVA 4TKYA 3KGKA 5LCZA 1M2AA 2LJAA 4GQFA 2OKAA 4K5RA 1OE8A 1OE7A 1XOBA 1SK2A 1K0AA 5DAKB 2LJRA 1SYXA 4OFMA 4KH7A 1DUGA 2KOKA 4DSSA 5G5EA 1M99A 3IV4A 5IM9A 1TK8B 3QAGA 4NHWA 3F63A 1G7EA 3UIWA 2XBIA 4GQCA 9GSSA 2IMKA 4OFTA 2WZ9A 4EIPA 1OC8A 4AF2A 1RQMA 2REMA 2CX3A 3D22A 2P31A 5ECMB 2YJHA 2DJ1A 3MWHA 4ZILA 1LU4A 5A4WA 3GKMA 4K0NA 3Q18A 3Q74A 2EIRA 4L0WA 1ZL9A 4EO3A 5B8BA 3IBHA 4V2NA 1F37A 1X5DA 2YWOA 1R5PA 2CX4A 3E3EA 1FG4A 2VM2A 2GDRA 4TR1A 4RQRA 4TN8A 2YOIA 1GL8A 5DJLA 1A24A 4POLA 2DMLA 5KEJA 3D21A 3BD2A 5B6MA 5DCHA 4L5LA 1J9BA 2L5OA 2F3MA 2DSAA 1GSFA 1PA3A 3ZMLA 5ABRA 5B7CA 4MK3A 5C00A 1JLWA 4CY8A 4IQ1A 4KDUA 3KEBA 4QQ7A 1XBSA 2HFDA 3TJJA 5E59A 2GZZA 2C80A 4OO5A 2G2QA 16GSA 2ZNMA 2AHEA 4IJIA 2OE1A 1EOHA 3UVHA 1U87A 1THXA 5CO3A 2V6KA 3HDCA 3C1RA 1QXHA 4XIHA 1SK1A 3M9KA 2L4QA 5GZZB 3GV1A 4JR4A 3UAPA 6GSTA 1MEKA 3RBTA 3G7JA 2DC5A 2LQQA 2TIRA 2HRNA 2YZUA 4ECJA 1PN0A 3RHCA 1XIYA 3FYGA 12GSA 1PX6A 1XWCA 4Q5QA 2PGTA 1XWGA 1PGTA 1TRUA 3RPPA 5IMAA 1VGLA 1UVZA 3DEXA 1BEDA 2B7KA 1YQ1A 1T8EB 3DXBA 5IQYA 1BYEA 2B3SA 3TOTA 3CMIA 1OKTA 3ZVJA 4O5UA 3UVTA 1O85A 1ZYQB 2H6XA 1Q98A 4O92A 1B4QA 3VWUA 1TRWA 3L9UA 3H79A 1ST9A 3F8UA 2Z9SA 1JZWA 1MD4A 4TXOB 1FW1A 4G19A 2FY6A 4OMVA 4H86A 2X49A 4K5SA 3EE2A 2CVBA 2QA2A 5J41A 4KX4A 3GFKA 2IFQB 3TRPA 1THOA 1K3OA 1TU8A 2C8UA 4F9ZA 3VPTA 2L57A 3TCOA 1JZDA 4IN0A 4G0LA 4ZXGA 4O32A 2M80A 5EY6A 4PGTA 3IAS2 3QR6A 4GRFA 3IAM2 1W89A 2OBIA 5DAKA 4K2DA 1G0TA 3QAVA 4Q5RA 5IOWA 3W8JA 2LEGA 1UN2A 2K6VA 4IKHA 4IQAA 2XC2A 1SKRB 1G7OA 3FK8A 1OAZA 3CYNA 3QMXA 2K8VA 1KNGA 3F6DA 4HJ2A 1V9WA 1DSBA 1EOGA 1IYIA 2B7JA 2GTUA 3RPNA 2H1DA 1K3LA 4X43A 2QC7A 3LQ7A 1ZOFA 5DQSA 1HD2A 1O8WA 4PQ1A 2X8GA 1M2DA 3J7Yk 3BCIA 1ZMAA 3DVWA 1BG5A 2K18A 2XPDA 3NZNA 2H1GA 3FR6A 2HSYA 4J2FA 3G9BA 1M9AA 4AJ7A 3OR5A 4L5OA 3QFBC 4K1FA 2ZUPA 3HZ4A 2XBQA 2C3NA 3MAKA 3MNGA 3TJKA 1YZXA 2CV4A 1R4WA 2YZHA 5F0GA 1PL1A 4V2LA 2JZRA 2YV9A 3IC8A 1WIKA 3FKFA 3CBUA 4X1UA 4ZB8A 1GWCA 4KF9A 2E2GA 2LRCA 3KM6A 5F07A 3GX0A 2KUCA 3LG6A 3ERGA 2GQMA 3GL5A 5CYYA 5IMVA 1X9SB 4PNFA 3LYKA 5L71A 1XVQA 3GA4A 3FR9A 1BQ7A 4I6XA 4DSSB 1XW5A 5D9XA 3TKRA 5COHA 3TGZA 2GT6A 2JU5A 5JCWA 3K8NA 1A2JA 4V1Ag 4G2EA 3HJOA 4EXJA 4FIWA 3ZIVA 2LSTA 4WEYA 3ZIJA 5EVOA 4GXZA 2DJ0A 2HZEB 2ZCTA 4K7IA 5G2ZA 4MH2A 1PL2A 1B8XA 3ERWA 3LSZA 4ZB6A 1EV4A 4EDYA 1T7PB 2PMTA 4ZBBA 4ML6A 2IWTA 1TXXA 2VUPA 5HR2A 2LUSA 1XWBA 2A2SA 2G0FA 1FVJA 4TR1B 2VM1A 2H0IA 3H8QA 3FR3A 4BVXB 2HSHA 2YWMA 4AJ6A 1H4OA 4LL1B 4EUYA 3GSSA 1WJKA 2QGVA 1XXUA 2LKUA 2KP2A 3ZFLA 2C4JA 4BL7B 1PD21 2LV3A 1T4ZA 1K0NA 4OCFA 2IFQA 4K9ZA 2RIIA 4JEDA 1A8YA 1YY7A 3HZ8A 4JRRA 3CSJA 1SU9A 3HD5A 1SKSB 5HFGA 2EC4A 4HU9A 2IL3A 4KSMA 5IOXA 3HVSA 1T00A 5HR1A 2P5QA 4EC0A 4CDOA 2NPBA 5BRTA 2VCVA 1LBKA 2L59A 4NPBA 1HQOA 2IMFA 3TKQA 3DVXA 3MDKA 4GTUA 2GSQA 1FB0A 2KP1A 3WGEA 5KOXA 2GSTA 3U6VA 1FHEA 1OYJA 4RI7A 3DMLA 4IVFA 4WKWA 3LGCA 2B1KA 4WXTA 4KSOA 2R4VA 2H8LA 2ALBA 4ECCA 4WR5A 4Q5NA 2CQ9A 4X0XA 3US3A 1EP7A 1PQNA 2GSRA 1J08A 4ML1A 2OJLA 2LJKA 3KTBA 3R2QA 1X5CA 5J4UA 3PINA 6GSVA 3CRTA 4KUNA 3TUEA 3LXTA 5H5RA 4QL9A 3PGTA 1PMTA 1ILOA 3UOMA 2F9SA 2JADA 2H1AA 1TRVA 3EINA 1PKZA 4PXOA 1ACVA 2R6KA 5CRDA 1XVWA 4FYUA 4O5QA 1ZYPA 1XW9A 2B5YA 3F0IA 3ZVJD 4EDZA 2VL3A 3C1SA 4A5PA 2L6DA 3GRXA 3UBKA 5KOWA 4PTSA 1B4PA 3GURA 5EL8A 5JWQB 4IW9A 2R37A 1O7UA 2R0PA 5E4WA 1YKCA 1K0MA 2C0FA 3FZ5A 5ENUA 5CRHA 2NDOA 3GN3A 22GSA 5G1KA 3LORA 3E0UA 3LYPA 3I9V2 2JACA 2VLVA 5DCGA 2PUKC 3O6TA 2MYGA 1I5GA 3ZTLA 3IHQA 3GH9A 2DJJA 4F2IA 2TRXA 4XS1A 3TRQA 3QD9A 3EVIA 2NTOA 2HRFA 3IHGA 1A0RP 4MCUA 1M7TA 3IOSA 5LD0A 2JZSA 3KTLA 1M2BA 1GSSA 2FWHA 4MNNA 3SWLA 3F3QA 2H72A 5D9VA 1GULA 4KDYA 2J9HA 4PQHA 1E2YA 2RM6A 4Z2TA 4MPGA 4K2XA 2K9FA 1BX9A 3WGXA 3GYKA 3EPTA 3G7YA 1K0BA 1QQ2A 4YQMA 3TKSC 1BJXA 3LW9A 5GSTA 5IMDA 2IMIA 4TRXA 2HZEA 3ZREA 2R3XA 2IJYA 1HNBA 3I69A 1GLPA 3KH9A 5FHIA 3EC3A 1FB6A 2CZ3A 2HZFA 2N5BA 4F82A 2L6CA 4KE3A 5JCGA 4BVXA 4N0ZA 1GSYA 4K7OA 5HR3A 1PRXA 2XPEA 1AAZA 3ZFBA 4F03A 4BL7A 2AJQB 5IPGA 3C73A 3GTUB 4YQVA 3L9VA 1TK0B 3IC4A 1ZYEA 4FH8A 3A2XA 3N5OA 2N5FA 4D73B 1XW6A 1VF2A 1NW2A 3IRAA 1V2AA 1N2AA 5IMFA 3GSTA 3L4NA 3IK7A 1WPIA 2FD3A 1T4YA 5G30A 3D0ZA 2WB9A 5AIVA 2X8CA 3LWAA 3QPMA 5DBQA 4YKGA 1J0FA 3DGQA 2E7PA 2H75A 2WFCA 1GNWA 5AGYA 1JZRA 2V2GA 4GSNA 1WRYA 1GUKA 3ZYWA 4MPFA 3D4TA 3EU3A 3M8NA 1XWKA 1A2LA 1ZGNA 5ECRB 3GIXA 4XRDA 1EGRA 2GZPA 4WR4A 5DJMA 2H71A 2RM5A 1CQGA 4MA9A 3ED3A 1SJ6A 2CAQA 3TB2A 1FOVA 5G31A 2GLRA 2JSYA 3VPQA 3S9FA 5A5KA 6GSYA 2O8VB 3R3EA 1SD9A 2A2RA 3BCKA 4EIQA 2IN3A 5J9BA 1Q4JA 4ZBDA 2VLUA 4KB3A 2PWJA 2RUEA 1XCCA 3GX8A 3EU4A 3M9JA 4HOJA 2LNSA 4MJBA 3RAZA 3CTFA 2YWNA 1S3AA 3UJ1A 1WE0A 5IIZA 4PX1A 11GSA 5ECHB 1GP1A 4QL7A 1ERWA 4JZQA 1TOFA 5ECSA 3DD3A 6GSSA 4IP6A 2LRTA 4Z7XA 2GQKA 1Z7RA 2O89A 1YDKA 2LQOA 3IA1A 1K0DA 1TJDA 2YV7A 3P90A 1T3BA 3A2VA 1GTBA 3I43A 1QGVA 4OO4A 4MZCA 3KXOA 4KNDA 3FZ9A 3W6GA 3FZ4A 3H1NA 1PKWA 1DE1A 3CSHA 4LLRA 6GSWA 1EZKA 3IE3A 1MDKA 2FWEA 1YJ6A 1I9DA 1MD3A 3C7MA 4P3YB 3UMAA 2MMZA 4KDXA 4YAPA 3APQA 4MZBA 2E2MA 2H30A 4JBBA 2CT6A 1OVNA 3F4TA 1M9BA 5LNKe 3N9JA 2DIZA 4WBJA 4G0IA 1URMA 3WGDA 2VO4A 3QOUA 1K0CA 3GMFA 3UARA 5C04A 3L0HA 2VCTA 4JU5A 1U3IA 4NMUA 2AAWA 4I2UA 3CRUA 4OWYA 2OACA 4CW9A 1WMJA 1DBYA 1Z9HA 4WF4A 2DKIA 2H1BA 2OE3A 2PERA 3WT2A 4Z2UA 5G5FA 3GTUA 3KZQA 1OKDA 1JLVA 18GSA 4DSRA 1U6TA 4I5QA 4D73A 5ECNB 3Q6OA 4IELA 1A8LA 1MDJA 2L5LA 3FMWA 1T1VA 2I4AA 1ML6A 1HNCA 3GHAA 1Z6NA 3A5WA 1G6YA 2IIYA 1EV9A 1KTEA 1GSQA 1X0RA 2HYXA 4PURA 2H74A 4HDEA 5HQPA 2P0GA 3CTGA 5CNWA 4KAEA 4E8HA 2VAFA 5D9WA 2A2PA 5J9CA 17GSA 1B48A 1Y25A 5A4VA 3C8EA 4XS4B 2ON7A 4RUVA 1H75A 1X5EA 4E8EA 1OC9B 2LRNA 1NSWA 1Y6EA 1UC7A 1HYUA 1USBA 2HI7A 5D9TA 4POBA 3TKSA 1F6MC 2PVQA 4TXVA 1PX7A 1F2EA 3L78A 2V32A 3FW2A 4YH2A 4GSTA 3ZITA 2H01A 3HCZA 4I97A 3UBLA 2L4CA 4ZBAA 4O7HA 1FO5A 2R5GA 4IBPA 2YWIA 2GSSA 5IMCA 14GSA 3D5JA 4LMVA 5AISA 4HS1A 1AXDA 3V1WA 2WCIA 2X99A 2JZTA 1B9YC 3FRCA 3P2AA 2HNLA 3KJYA 4CHSA 4K7NA 2TRCP 1TTZA 3D6IA 4MP4A 2HLSA 5CRGA 4YQUA 1V58A 4BWSA 3PH9A 1IYHA 4V1Ap 5IMZA 2YCDA 3M0FA 2R0CA 2MMNA 3NIVA 3BOAA 4IHUA 6GSXA 4G9HA 3APSA 2M72A 2HRAA 2FGXA 2QA1A 4YKFA 3PR8A 3Q19A 4WBRD 4JE1A 3WYWA 1ZCPA 3I6AA 2F8FA 1S3CA 1O73A 2O87A 4KA0A 4ICYA 2K8SA 4FYBA 4HI7A 2B5EA 2VD0A 4TOPA 2UZ8A 4IJ3A 4J56E 3TOUA 5F8BA 5KN0A 5EPFA 4Q5FA 4PUFC 5HFKA 4RI6A 3W8SA 2P5RA 1DE2A 5INYA 4USSA 5D73A 4N0VA 4GLTA 4DSQA 2HT9A 5J5NA 4BVYB 1GNEA 3GL3A 3DKSA 2C3TA 4WF5A 5ECKB 4HQZA 1EP8A 2KLXA 1GLQA 4EL1A 1N8JA 2N5AA 3VFIA 4HEA2 3HJMA 3ZRDA 3F3RA 2FUG2 4ZB9A 2DKHA 3VI7A 3SBCA 1SJIA 1ZYNA 4XTSA 1SL2B 3HJPA 5ECLB 3GKXA 1R5AA 13GSA 5J3RA 3M3MA 5CP1A 1M0UA 1AQVA 1U88A 1QFNA 5D96A 1TP9A 4ISDA 1EEJA 1JHBA 2H73A 2LTKA 2F51A 1YF1A 1TU7A 1S3DA 3ISOA 1VRSD 4POMA 4N11A 3U5RE 4OD7A 4GCIA 2IPAA 3VLNA 1R7HA 2GZYA 3EYTA 2JL4A 1O8XA 4ZL7A 2OA7A 4ZL9A 1KBNA 3KIJA 3KCMA 1HNAA 4HU7A 5B6NA 5JWOB 2AUVA 5DVBA 3G7IA 5A4UA 4IGJA 1GTAA 5IO2A 1ERTA 2E0QA 3DRNA 4GSSA 2CA8A 2I3YA 4MMMA 1SENA 2H0HA 2MMAA 4XHMA 1JFUA 2A4VA 3TRXA 3FHKA 3APOA 1R26A 2FA8A 5KN3A 1JZOA 3QCPA 4XS4A 4NXIA 5DALB 3TJGA 2I1UA 1TDIA 5GSSA 4LL4B 1OC9A 4KCEA 1FVKA 4XRAA 2YNXA 3GKNA 2C0DA 4MF5A 4X4JA 4RQXA 4PUAA 3QDNA 5KN1A 5DQYA 2VD1A 3FY7A 1AW9A 2KHPA 3ZMKA 4ECIA 5CREA 1WOUA 2DBCA 3HVXA 5D93A 1QK8A 4N30A 2AYTA 2WS2A 4MJAA 19GSA 3P8WA 2HXKA 1NM3A 1K3YA 2LNTA 3TJFA 1UA5A 5GAND 1TW9A 4ID0A 1PSQA 2GT5A 3UL3A 3DYRA 1U3AA 3ME7A 2RUFA 3KP8A 4XS6A 2ON5A 4AGSA 2YN1A 4ACSA 1V40A 1O6JA 4EVMA 3A2WA 3ZL5A 2GVPA 5AIXA 2WJUA 1SJZA 2VCXA 2BMXA 2PPTA 1YF0A 3KH7A 4MJEA 5ECOB 5JWRB 3LJRA 2BJXA 2VL2C 4POKA 3EURA 2XHFA 3F6FA 5H5QA 1A23A 4DEJA 1ERVA 2DJ2A 2I81A 3ZLPA 5ECQB 2PU9C 5ID2B 4BVYA 3A3TA 3L9SA 3TKSE 3IK9A 3AY8A 4HQSA 5BMUA 5ECIB 4V2MA 3WT1A 2YANA 4TW5A 5JCUA 3MSZA 2QKEA 2H19A 4K8MA 3IR4A 3BJ5A 2IMDA 1SL0B 2M46A 1GUHA 1SD8A 2JSZA 2V1MA 3GH6A 3QAWA 4N10A 4NV2A 1XZOA 4F0BA 1BAYA 2EIQA 2FCHA 4K0GA 2MZCA 5IO0A 4DVCA 1XOAA 2X64A 1TRSA 3KMNA 1NHOA 4FQUA 2FHEA 2WULA 3ZZXA 1EWXA 2OBKA 2YPMA 4OFNA 1F3AA 4EE0A 3HVVA 2YJ7A 4MDCA 2WGRA 4HUAA 5KN2A 1E6BA 4XCSA 1Z5YE 2VOCA 3DWVA 1MDIA 3KMOA 4EKZA 4IP1A 3LXZA 3TKPA 1GSUA 4TR0A 3WD6A 2DIYA 2H6YA 1KEBA 4KW6A 4CY6A 1AQXA 2MBSA 2CVDA 2WRTA 3J7Yb 1SL1B 4AJ8A 2PVOC 4HJMA 3VWWA 1MTCA 1WP0A 1NHYA 1OC3A 1ABAA 3IPZA 2V6OA 2OE0A 4WETA 5DDLA 5DALA 1W4VA 3QFAC 2AB6A 2H0GA 1GRXA 1ZZYA 2VL9A 2FWGA 3F4RA 5IPHA 2EIOA 2C0EA 4MLYA 5ELAA 3EMXA 2C0GA 4BPYA 5CAXA 1G6WA 3HY2A 3VURA 4I8BA 4K6XA 4MABA 2ES7A 2BTOT 4HZ4A 1B9XC 3RHBA 1RW1A 5HFIA 4G10A 4EF0A 4TVEA 2B6MA 3O76A 3BBYA 2AV4A 3H4KA 2H76A 2H70A 3HA9A 4NV5A 1SK0A 5ECPB 2A4HA 4YAVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X9M B;  3FZA A;  1YEP A;  4MJC A;  3NOF A;  4NWY A;  2B1L A;  1SKW B;  3KP9 A;  2B5X A;  2VCW A;  1V98 A;  3CXG A;  4BA7 A;  2O7K A;  2R2J A;  1K0O A;  1XFL A;  1AC1 A;  3H93 A;  2DJK A;  2LS5 A;  1GTI A;  1Z6M A;  4MZW A;  1YKA A;  4I2T A;  4FYC A;  1RK4 A;  4KGI A;  2MBT A;  3D4M A;  2X8H A;  4NAX A;  1ERU A;  1AQW A;  4L8E A;  2QSI A;  1YEX A;  2CZ2 A;  3HYP A;  5B8A A;  10GS A;  3KD0 A;  4ECB A;  5CRW A;  1GH2 A;  1TI3 A;  3M1G A;  4ZIJ A;  5ID2 A;  5H5S A;  3CSI A;  2VIM A;  1F3B A;  2IME A;  3LFL A;  4OCE A;  8GSS A;  1Z3E A;  2FNO A;  4FO5 A;  1TK5 B;  4MF6 A;  2GQL A;  4TR4 A;  1WWJ A;  5F06 A;  5G1L A;  3TDG A;  1F9M A;  3ME8 A;  2VLT A;  2C3Q A;  4ZL8 A;  2YP6 A;  5FWG A;  1TKD B;  4F0C A;  3VWX A;  4BWQ A;  4JR6 A;  3F4S A;  3JCM L;  1QUW A;  3VI5 A;  2D2Z A;  4LA1 A;  3GNJ A;  4ULX A;  4L0U A;  1Z7P A;  1TI1 A;  4TXO A;  3C71 A;  1V57 A;  1XWA A;  4LMW A;  2DMM A;  4PQI A;  2H6Z A;  3E9J B;  3O3T A;  5D8I A;  3RDW A;  4ILF A;  1QMV A;  5AN1 A;  3HKR A;  1VF3 A;  3F9U A;  2PN8 A;  2MMO A;  2FA4 A;  2WDU A;  1GUM A;  2GGT A;  4HZ2 A;  4J57 E;  1C72 A;  2CVK A;  2VL2 A;  1VF1 A;  1GSE A;  1X9W B;  3VWV A;  2VCQ A;  2DLX A;  3EMP A;  3DIE A;  4O5R A;  2OAD A;  3ERF A;  1PN9 A;  4MH3 A;  2NVL A;  1A2M A;  5F05 A;  3UEM A;  1EEM A;  3P7X A;  4TR3 A;  4GF0 A;  1VF4 A;  4MF7 A;  1SYR A;  1O81 A;  5FT3 A;  2C1Y A;  5HR0 A;  4NHZ A;  3TJB A;  4IS0 A;  3LEF A;  5GAP D;  3GKK A;  3IDV A;  2F8A A;  2PBJ A;  1CQH A;  2VCZ A;  1FAA A;  3IXR A;  1ON4 A;  2NBS A;  2H66 A;  2I9H A;  3VK9 A;  4PNG A;  1A0F A;  5ELG A;  2HE3 A;  1EGO A;  3HXS A;  2RLI A;  3GUS A;  1AIU A;  1GSD A;  2FWF A;  2CAI A;  2FLS A;  3FEU A;  1AUC A;  1GTU A;  4GWR A;  2J23 A;  6GSU A;  20GS A;  2DJ3 A;  2O85 A;  2GS3 A;  2V41 A;  7GSS A;  1LJR A;  4KCA A;  3EWL A;  3HHV A;  1XPV A;  4TKY A;  3KGK A;  5LCZ A;  1M2A A;  2LJA A;  4GQF A;  2OKA A;  1OE8 A;  1OE7 A;  1XOB A;  1SK2 A;  1K0A A;  5DAK B;  2LJR A;  1SYX A;  4OFM A;  4KH7 A;  1DUG A;  2KOK A;  4DSS A;  5G5E A;  1M99 A;  3IV4 A;  5IM9 A;  1TK8 B;  3QAG A;  4NHW A;  3F63 A;  1G7E A;  3UIW A;  2XBI A;  4GQC A;  9GSS A;  2IMK A;  4OFT A;  2WZ9 A;  1OC8 A;  4AF2 A;  1RQM A;  2REM A;  2CX3 A;  3D22 A;  2P31 A;  5ECM B;  2YJH A;  2DJ1 A;  3MWH A;  4ZIL A;  1LU4 A;  5A4W A;  3GKM A;  4K0N A;  3Q18 A;  3Q74 A;  2EIR A;  4L0W A;  1ZL9 A;  4EO3 A;  5B8B A;  3IBH A;  4V2N A;  1F37 A;  1X5D A;  2YWO A;  1R5P A;  2CX4 A;  3E3E A;  1FG4 A;  2VM2 A;  2GDR A;  4TR1 A;  4RQR A;  4TN8 A;  2YOI A;  1GL8 A;  5DJL A;  1A24 A;  4POL A;  2DML A;  5KEJ A;  3D21 A;  3BD2 A;  5B6M A;  5DCH A;  4L5L A;  1J9B A;  2L5O A;  2F3M A;  2DSA A;  1GSF A;  1PA3 A;  3ZML A;  5ABR A;  5B7C A;  4MK3 A;  5C00 A;  1JLW A;  4IQ1 A;  4KDU A;  3KEB A;  4QQ7 A;  1XBS A;  2HFD A;  3TJJ A;  5E59 A;  2GZZ A;  2C80 A;  4OO5 A;  2G2Q A;  16GS A;  2ZNM A;  2AHE A;  4IJI A;  2OE1 A;  1EOH A;  3UVH A;  1U87 A;  1THX A;  5CO3 A;  2V6K A;  3HDC A;  3C1R A;  1QXH A;  4XIH A;  1SK1 A;  3M9K A;  2L4Q A;  5GZZ B;  3GV1 A;  4JR4 A;  3UAP A;  6GST A;  1MEK A;  3RBT A;  3G7J A;  2DC5 A;  2LQQ A;  2TIR A;  2HRN A;  2YZU A;  4ECJ A;  3RHC A;  1XIY A;  3FYG A;  12GS A;  1PX6 A;  1XWC A;  4Q5Q A;  2PGT A;  1XWG A;  1PGT A;  1TRU A;  3RPP A;  5IMA A;  1VGL A;  1UVZ A;  3DEX A;  1BED A;  2B7K A;  1YQ1 A;  1T8E B;  3DXB A;  5IQY A;  1BYE A;  2B3S A;  3TOT A;  3CMI A;  1OKT A;  3ZVJ A;  3UVT A;  1O85 A;  1ZYQ B;  2H6X A;  1Q98 A;  4O92 A;  1B4Q A;  3VWU A;  1TRW A;  3L9U A;  3H79 A;  1ST9 A;  3F8U A;  2Z9S A;  1JZW A;  1MD4 A;  4TXO B;  1FW1 A;  4G19 A;  2FY6 A;  4OMV A;  4H86 A;  3EE2 A;  2CVB A;  5J41 A;  4KX4 A;  3GFK A;  2IFQ B;  3TRP A;  1THO A;  1K3O A;  1TU8 A;  2C8U A;  4F9Z A;  3VPT A;  2L57 A;  3TCO A;  1JZD A;  4IN0 A;  4ZXG A;  4O32 A;  2M80 A;  5EY6 A;  4PGT A;  3IAS 2;  3QR6 A;  4GRF A;  3IAM 2;  1W89 A;  2OBI A;  5DAK A;  4K2D A;  1G0T A;  3QAV A;  4Q5R A;  5IOW A;  3W8J A;  2LEG A;  1UN2 A;  2K6V A;  4IKH A;  4IQA A;  2XC2 A;  1SKR B;  1G7O A;  3FK8 A;  1OAZ A;  3CYN A;  3QMX A;  2K8V A;  1KNG A;  3F6D A;  4HJ2 A;  1V9W A;  1DSB A;  1EOG A;  1IYI A;  2B7J A;  2GTU A;  3RPN A;  2H1D A;  1K3L A;  4X43 A;  2QC7 A;  3LQ7 A;  1ZOF A;  5DQS A;  1HD2 A;  1O8W A;  4PQ1 A;  2X8G A;  1M2D A;  3J7Y k;  3BCI A;  1ZMA A;  3DVW A;  1BG5 A;  2K18 A;  2XPD A;  3NZN A;  2H1G A;  3FR6 A;  2HSY A;  4J2F A;  3G9B A;  1M9A A;  4AJ7 A;  3OR5 A;  4L5O A;  3QFB C;  4K1F A;  2ZUP A;  3HZ4 A;  2XBQ A;  2C3N A;  3MAK A;  3MNG A;  3TJK A;  1YZX A;  2CV4 A;  1R4W A;  2YZH A;  5F0G A;  1PL1 A;  4V2L A;  2JZR A;  2YV9 A;  1WIK A;  3FKF A;  3CBU A;  4X1U A;  4ZB8 A;  1GWC A;  2E2G A;  2LRC A;  3KM6 A;  5F07 A;  3GX0 A;  2KUC A;  3LG6 A;  3ERG A;  2GQM A;  3GL5 A;  5CYY A;  5IMV A;  1X9S B;  4PNF A;  3LYK A;  5L71 A;  1XVQ A;  3GA4 A;  3FR9 A;  1BQ7 A;  4I6X A;  4DSS B;  1XW5 A;  5D9X A;  3TKR A;  5COH A;  3TGZ A;  2GT6 A;  2JU5 A;  5JCW A;  3K8N A;  1A2J A;  4V1A g;  4G2E A;  3HJO A;  4EXJ A;  4FIW A;  3ZIV A;  2LST A;  4WEY A;  3ZIJ A;  5EVO A;  4GXZ A;  2DJ0 A;  2HZE B;  2ZCT A;  4K7I A;  5G2Z A;  4MH2 A;  1PL2 A;  1B8X A;  3ERW A;  3LSZ A;  4ZB6 A;  1EV4 A;  4EDY A;  1T7P B;  2PMT A;  4ZBB A;  4ML6 A;  2IWT A;  1TXX A;  2VUP A;  5HR2 A;  2LUS A;  1XWB A;  2A2S A;  2G0F A;  1FVJ A;  4TR1 B;  2VM1 A;  2H0I A;  3H8Q A;  3FR3 A;  2HSH A;  2YWM A;  4AJ6 A;  1H4O A;  4LL1 B;  4EUY A;  3GSS A;  1WJK A;  2QGV A;  1XXU A;  2LKU A;  2KP2 A;  3ZFL A;  2C4J A;  1PD2 1;  2LV3 A;  1T4Z A;  1K0N A;  4OCF A;  2IFQ A;  4K9Z A;  2RII A;  4JED A;  1A8Y A;  1YY7 A;  3HZ8 A;  4JRR A;  3CSJ A;  1SU9 A;  3HD5 A;  1SKS B;  5HFG A;  2EC4 A;  4HU9 A;  2IL3 A;  4KSM A;  5IOX A;  3HVS A;  1T00 A;  5HR1 A;  2P5Q A;  4EC0 A;  4CDO A;  2NPB A;  2VCV A;  1LBK A;  2L59 A;  4NPB A;  1HQO A;  2IMF A;  3TKQ A;  3DVX A;  3MDK A;  4GTU A;  2GSQ A;  1FB0 A;  2KP1 A;  3WGE A;  2GST A;  3U6V A;  1FHE A;  1OYJ A;  4RI7 A;  3DML A;  4IVF A;  4WKW A;  3LGC A;  2B1K A;  4WXT A;  4KSO A;  2R4V A;  2H8L A;  2ALB A;  4ECC A;  4WR5 A;  4Q5N A;  2CQ9 A;  4X0X A;  3US3 A;  1EP7 A;  1PQN A;  2GSR A;  1J08 A;  4ML1 A;  2OJL A;  2LJK A;  3KTB A;  3R2Q A;  1X5C A;  5J4U A;  3PIN A;  6GSV A;  3CRT A;  4KUN A;  3TUE A;  3LXT A;  5H5R A;  4QL9 A;  3PGT A;  1PMT A;  1ILO A;  3UOM A;  2F9S A;  2JAD A;  2H1A A;  1TRV A;  3EIN A;  1PKZ A;  4PXO A;  1ACV A;  2R6K A;  5CRD A;  1XVW A;  4FYU A;  1XW9 A;  2B5Y A;  3F0I A;  3ZVJ D;  4EDZ A;  2VL3 A;  3C1S A;  2L6D A;  3GRX A;  3UBK A;  1B4P A;  3GUR A;  5EL8 A;  5JWQ B;  4IW9 A;  2R37 A;  1O7U A;  5E4W A;  1YKC A;  1K0M A;  2C0F A;  3FZ5 A;  5ENU A;  5CRH A;  2NDO A;  3GN3 A;  22GS A;  5G1K A;  3LOR A;  3E0U A;  3LYP A;  3I9V 2;  2JAC A;  2VLV A;  5DCG A;  2PUK C;  3O6T A;  2MYG A;  1I5G A;  3ZTL A;  3IHQ A;  3GH9 A;  2DJJ A;  4F2I A;  2TRX A;  4XS1 A;  3TRQ A;  3QD9 A;  3EVI A;  2NTO A;  2HRF A;  1A0R P;  4MCU A;  1M7T A;  3IOS A;  5LD0 A;  2JZS A;  3KTL A;  1M2B A;  1GSS A;  2FWH A;  3SWL A;  3F3Q A;  2H72 A;  5D9V A;  1GUL A;  4KDY A;  2J9H A;  4PQH A;  1E2Y A;  2RM6 A;  4MPG A;  2K9F A;  1BX9 A;  3WGX A;  3GYK A;  3G7Y A;  1K0B A;  1QQ2 A;  4YQM A;  3TKS C;  1BJX A;  5GST A;  5IMD A;  2IMI A;  4TRX A;  2HZE A;  3ZRE A;  2R3X A;  2IJY A;  1HNB A;  3I69 A;  1GLP A;  3KH9 A;  5FHI A;  3EC3 A;  1FB6 A;  2CZ3 A;  2HZF A;  2N5B A;  4F82 A;  2L6C A;  4KE3 A;  5JCG A;  4BVX A;  4N0Z A;  1GSY A;  4K7O A;  5HR3 A;  1PRX A;  2XPE A;  1AAZ A;  3ZFB A;  4F03 A;  4BL7 A;  2AJQ B;  5IPG A;  3C73 A;  3GTU B;  4YQV A;  3L9V A;  1TK0 B;  3IC4 A;  1ZYE A;  4FH8 A;  3A2X A;  3N5O A;  2N5F A;  4D73 B;  1XW6 A;  1VF2 A;  1NW2 A;  3IRA A;  1V2A A;  1N2A A;  5IMF A;  3GST A;  3L4N A;  3IK7 A;  1WPI A;  2FD3 A;  1T4Y A;  5G30 A;  3D0Z A;  2WB9 A;  5AIV A;  2X8C A;  3LWA A;  3QPM A;  5DBQ A;  1J0F A;  3DGQ A;  2E7P A;  2H75 A;  2WFC A;  1GNW A;  5AGY A;  1JZR A;  2V2G A;  4GSN A;  1WRY A;  1GUK A;  3ZYW A;  4MPF A;  3D4T A;  3EU3 A;  3M8N A;  1XWK A;  1A2L A;  1ZGN A;  5ECR B;  3GIX A;  4XRD A;  1EGR A;  2GZP A;  4WR4 A;  5DJM A;  2H71 A;  2RM5 A;  1CQG A;  4MA9 A;  3ED3 A;  1SJ6 A;  2CAQ A;  3TB2 A;  1FOV A;  5G31 A;  2GLR A;  2JSY A;  3VPQ A;  3S9F A;  5A5K A;  6GSY A;  2O8V B;  1SD9 A;  2A2R A;  3BCK A;  2IN3 A;  5J9B A;  1Q4J A;  4ZBD A;  2VLU A;  4KB3 A;  2PWJ A;  2RUE A;  1XCC A;  3GX8 A;  3EU4 A;  3M9J A;  4HOJ A;  2LNS A;  4MJB A;  3RAZ A;  3CTF A;  2YWN A;  1S3A A;  3UJ1 A;  1WE0 A;  5IIZ A;  4PX1 A;  11GS A;  5ECH B;  1GP1 A;  4QL7 A;  1ERW A;  4JZQ A;  1TOF A;  5ECS A;  3DD3 A;  6GSS A;  4IP6 A;  2LRT A;  4Z7X A;  2GQK A;  1Z7R A;  2O89 A;  1YDK A;  2LQO A;  3IA1 A;  1K0D A;  1TJD A;  2YV7 A;  3P90 A;  1T3B A;  3A2V A;  1GTB A;  3I43 A;  1QGV A;  4OO4 A;  4MZC A;  3KXO A;  4KND A;  3FZ9 A;  3W6G A;  3FZ4 A;  3H1N A;  1PKW A;  1DE1 A;  3CSH A;  4LLR A;  6GSW A;  1EZK A;  3IE3 A;  1MDK A;  2FWE A;  1YJ6 A;  1I9D A;  1MD3 A;  3C7M A;  4P3Y B;  3UMA A;  2MMZ A;  4KDX A;  4YAP A;  3APQ A;  4MZB A;  2E2M A;  2H30 A;  4JBB A;  2CT6 A;  1OVN A;  3F4T A;  1M9B A;  5LNK e;  3N9J A;  2DIZ A;  4WBJ A;  1URM A;  3WGD A;  2VO4 A;  3QOU A;  1K0C A;  3GMF A;  3UAR A;  5C04 A;  3L0H A;  2VCT A;  4JU5 A;  1U3I A;  4NMU A;  2AAW A;  4I2U A;  3CRU A;  4OWY A;  2OAC A;  4CW9 A;  1WMJ A;  1DBY A;  1Z9H A;  4WF4 A;  2H1B A;  2OE3 A;  2PER A;  3WT2 A;  5G5F A;  3GTU A;  3KZQ A;  1OKD A;  1JLV A;  18GS A;  4DSR A;  1U6T A;  4I5Q A;  4D73 A;  5ECN B;  3Q6O A;  4IEL A;  1A8L A;  1MDJ A;  2L5L A;  1T1V A;  2I4A A;  1ML6 A;  1HNC A;  3GHA A;  1Z6N A;  3A5W A;  1G6Y A;  2IIY A;  1EV9 A;  1KTE A;  1GSQ A;  1X0R A;  2HYX A;  4PUR A;  2H74 A;  4HDE A;  5HQP A;  2P0G A;  3CTG A;  5CNW A;  4KAE A;  4E8H A;  2VAF A;  5D9W A;  5J9C A;  17GS A;  1B48 A;  1Y25 A;  5A4V A;  3C8E A;  4XS4 B;  2ON7 A;  4RUV A;  1H75 A;  1X5E A;  4E8E A;  1OC9 B;  2LRN A;  1NSW A;  1Y6E A;  1UC7 A;  1HYU A;  1USB A;  2HI7 A;  5D9T A;  4POB A;  3TKS A;  1F6M C;  2PVQ A;  4TXV A;  1PX7 A;  1F2E A;  3L78 A;  2V32 A;  3FW2 A;  4YH2 A;  4GST A;  3ZIT A;  2H01 A;  3HCZ A;  4I97 A;  3UBL A;  2L4C A;  4ZBA A;  4O7H A;  1FO5 A;  2R5G A;  4IBP A;  2YWI A;  2GSS A;  5IMC A;  14GS A;  3D5J A;  4LMV A;  5AIS A;  4HS1 A;  1AXD A;  3V1W A;  2WCI A;  2X99 A;  2JZT A;  1B9Y C;  3FRC A;  3P2A A;  2HNL A;  3KJY A;  4CHS A;  4K7N A;  2TRC P;  1TTZ A;  3D6I A;  4MP4 A;  2HLS A;  5CRG A;  4YQU A;  1V58 A;  4BWS A;  3PH9 A;  1IYH A;  4V1A p;  5IMZ A;  2YCD A;  3M0F A;  2MMN A;  3NIV A;  3BOA A;  4IHU A;  6GSX A;  4G9H A;  3APS A;  2M72 A;  2FGX A;  3PR8 A;  3Q19 A;  4WBR D;  4JE1 A;  3WYW A;  1ZCP A;  3I6A A;  2F8F A;  1S3C A;  1O73 A;  2O87 A;  4KA0 A;  2K8S A;  4FYB A;  4HI7 A;  2B5E A;  2VD0 A;  4TOP A;  4IJ3 A;  4J56 E;  3TOU A;  5F8B A;  5KN0 A;  5EPF A;  4Q5F A;  4PUF C;  5HFK A;  4RI6 A;  3W8S A;  2P5R A;  1DE2 A;  5INY A;  5D73 A;  4N0V A;  4GLT A;  4DSQ A;  2HT9 A;  5J5N A;  1GNE A;  3GL3 A;  3DKS A;  2C3T A;  4WF5 A;  5ECK B;  4HQZ A;  1EP8 A;  2KLX A;  1GLQ A;  4EL1 A;  1N8J A;  2N5A A;  3VFI A;  4HEA 2;  3HJM A;  3ZRD A;  3F3R A;  2FUG 2;  4ZB9 A;  3VI7 A;  3SBC A;  1SJI A;  4XTS A;  1SL2 B;  3HJP A;  5ECL B;  3GKX A;  1R5A A;  13GS A;  5J3R A;  3M3M A;  5CP1 A;  1M0U A;  1AQV A;  1U88 A;  1QFN A;  5D96 A;  1TP9 A;  4ISD A;  1EEJ A;  1JHB A;  2H73 A;  2LTK A;  2F51 A;  1YF1 A;  1TU7 A;  1S3D A;  3ISO A;  1VRS D;  4POM A;  4N11 A;  3U5R E;  4OD7 A;  4GCI A;  2IPA A;  3VLN A;  1R7H A;  2GZY A;  3EYT A;  2JL4 A;  1O8X A;  4ZL7 A;  2OA7 A;  4ZL9 A;  1KBN A;  3KIJ A;  3KCM A;  1HNA A;  4HU7 A;  5B6N A;  5JWO B;  2AUV A;  5DVB A;  3G7I A;  5A4U A;  4IGJ A;  1GTA A;  5IO2 A;  1ERT A;  2E0Q A;  3DRN A;  4GSS A;  2CA8 A;  2I3Y A;  4MMM A;  1SEN A;  2H0H A;  2MMA A;  4XHM A;  1JFU A;  2A4V A;  3TRX A;  3FHK A;  3APO A;  1R26 A;  2FA8 A;  5KN3 A;  1JZO A;  3QCP A;  4XS4 A;  4NXI A;  5DAL B;  3TJG A;  2I1U A;  1TDI A;  5GSS A;  4LL4 B;  1OC9 A;  4KCE A;  1FVK A;  4XRA A;  2YNX A;  3GKN A;  2C0D A;  4MF5 A;  4RQX A;  4PUA A;  3QDN A;  5KN1 A;  5DQY A;  2VD1 A;  3FY7 A;  1AW9 A;  2KHP A;  3ZMK A;  4ECI A;  5CRE A;  1WOU A;  2DBC A;  3HVX A;  5D93 A;  1QK8 A;  4N30 A;  2AYT A;  2WS2 A;  4MJA A;  19GS A;  3P8W A;  2HXK A;  1NM3 A;  1K3Y A;  2LNT A;  3TJF A;  1UA5 A;  5GAN D;  1TW9 A;  4ID0 A;  1PSQ A;  2GT5 A;  3UL3 A;  3DYR A;  1U3A A;  3ME7 A;  2RUF A;  3KP8 A;  4XS6 A;  2ON5 A;  4AGS A;  2YN1 A;  4ACS A;  1V40 A;  1O6J A;  4EVM A;  3A2W A;  3ZL5 A;  2GVP A;  5AIX A;  2WJU A;  1SJZ A;  2VCX A;  2BMX A;  2PPT A;  1YF0 A;  3KH7 A;  4MJE A;  5ECO B;  5JWR B;  3LJR A;  2BJX A;  2VL2 C;  4POK A;  3EUR A;  2XHF A;  3F6F A;  5H5Q A;  1A23 A;  4DEJ A;  1ERV A;  2DJ2 A;  2I81 A;  3ZLP A;  5ECQ B;  2PU9 C;  5ID2 B;  4BVY A;  3A3T A;  3L9S A;  3TKS E;  3IK9 A;  3AY8 A;  4HQS A;  5ECI B;  4V2M A;  3WT1 A;  2YAN A;  4TW5 A;  5JCU A;  3MSZ A;  2QKE A;  2H19 A;  4K8M A;  3IR4 A;  3BJ5 A;  2IMD A;  1SL0 B;  2M46 A;  1GUH A;  1SD8 A;  2JSZ A;  2V1M A;  3GH6 A;  3QAW A;  4N10 A;  4NV2 A;  1XZO A;  4F0B A;  1BAY A;  2EIQ A;  2FCH A;  4K0G A;  2MZC A;  5IO0 A;  4DVC A;  1XOA A;  2X64 A;  1TRS A;  3KMN A;  1NHO A;  2FHE A;  2WUL A;  3ZZX A;  1EWX A;  2OBK A;  2YPM A;  4OFN A;  1F3A A;  4EE0 A;  3HVV A;  2YJ7 A;  4MDC A;  2WGR A;  4HUA A;  5KN2 A;  1E6B A;  4XCS A;  1Z5Y E;  2VOC A;  3DWV A;  1MDI A;  3KMO A;  4EKZ A;  4IP1 A;  3LXZ A;  3TKP A;  1GSU A;  4TR0 A;  3WD6 A;  2DIY A;  2H6Y A;  1KEB A;  4KW6 A;  1AQX A;  2MBS A;  2CVD A;  2WRT A;  3J7Y b;  1SL1 B;  4AJ8 A;  2PVO C;  4HJM A;  3VWW A;  1MTC A;  1WP0 A;  1NHY A;  1OC3 A;  1ABA A;  3IPZ A;  2V6O A;  2OE0 A;  4WET A;  5DDL A;  5DAL A;  1W4V A;  3QFA C;  2AB6 A;  2H0G A;  1GRX A;  1ZZY A;  2VL9 A;  2FWG A;  3F4R A;  5IPH A;  2EIO A;  2C0E A;  4MLY A;  5ELA A;  3EMX A;  2C0G A;  4BPY A;  5CAX A;  1G6W A;  3HY2 A;  3VUR A;  4I8B A;  4K6X A;  4MAB A;  2ES7 A;  2BTO T;  4HZ4 A;  1B9X C;  3RHB A;  1RW1 A;  5HFI A;  4G10 A;  4EF0 A;  4TVE A;  2B6M A;  3O76 A;  3BBY A;  2AV4 A;  3H4K A;  2H76 A;  2H70 A;  3HA9 A;  4NV5 A;  1SK0 A;  5ECP B;  4YAV A; 
#chains in the Genus database with same CATH topology
 1X9M B;  3FZA A;  1YEP A;  4MJC A;  3NOF A;  4NWY A;  2B1L A;  1SKW B;  3KP9 A;  2B5X A;  2VCW A;  1V98 A;  3CXG A;  4BA7 A;  2O7K A;  2R2J A;  1K0O A;  1XFL A;  1AC1 A;  3H93 A;  2DJK A;  2LS5 A;  1GTI A;  1Z6M A;  4MZW A;  1YKA A;  3A5I A;  4I2T A;  4FYC A;  1RK4 A;  4KGI A;  2MBT A;  3D4M A;  2X8H A;  4NAX A;  1ERU A;  1AQW A;  4L8E A;  2QSI A;  1YEX A;  2CZ2 A;  3HYP A;  5B8A A;  10GS A;  3KD0 A;  4ECB A;  5CRW A;  1GH2 A;  1TI3 A;  3MYD A;  3M1G A;  4ZIJ A;  5ID2 A;  5H5S A;  3CSI A;  2VIM A;  1F3B A;  2IME A;  3LFL A;  4OCE A;  8GSS A;  1Z3E A;  2FNO A;  4FO5 A;  1TK5 B;  4MF6 A;  2GQL A;  4TR4 A;  1WWJ A;  5F06 A;  5G1L A;  3TDG A;  1F9M A;  2HSM A;  3ME8 A;  2VLT A;  3PPU A;  2C3Q A;  4ZL8 A;  2YP6 A;  5FWG A;  1TKD B;  4F0C A;  3VWX A;  4BWQ A;  4JR6 A;  3F4S A;  3JCM L;  1QUW A;  3VI5 A;  2D2Z A;  4LA1 A;  3GNJ A;  4ULX A;  4L0U A;  1Z7P A;  1TI1 A;  4TXO A;  3C71 A;  1V57 A;  1XWA A;  4LMW A;  2DMM A;  4PQI A;  2H6Z A;  4Z2R A;  3E9J B;  1M3I A;  3O3T A;  5D8I A;  3RDW A;  4ILF A;  1QMV A;  5AN1 A;  3HKR A;  1VF3 A;  3F9U A;  2PN8 A;  2MMO A;  2FA4 A;  2WDU A;  1GUM A;  2GGT A;  4HZ2 A;  3MIX A;  4J57 E;  1C72 A;  2CVK A;  2VL2 A;  1VF1 A;  1GSE A;  1X9W B;  3VWV A;  2VCQ A;  2DLX A;  3EMP A;  3DIE A;  4O5R A;  2OAD A;  3ERF A;  1PN9 A;  4MH3 A;  2NVL A;  1A2M A;  5F05 A;  3UEM A;  1EEM A;  3P7X A;  4TR3 A;  4GF0 A;  1VF4 A;  4MF7 A;  1SYR A;  2X4A A;  1O81 A;  5FT3 A;  2C1Y A;  5HR0 A;  4NHZ A;  3TJB A;  4IS0 A;  3LEF A;  5GAP D;  3GKK A;  3IDV A;  2F8A A;  2PBJ A;  1CQH A;  2VCZ A;  3CQF A;  1FAA A;  4G0K A;  1FOH A;  3IXR A;  1ON4 A;  2R0G A;  2NBS A;  2H66 A;  2I9H A;  3VK9 A;  4PNG A;  1A0F A;  5ELG A;  2HE3 A;  1EGO A;  3HXS A;  2RLI A;  3GUS A;  1AIU A;  1GSD A;  2FWF A;  2CAI A;  2FLS A;  3FEU A;  1AUC A;  1GTU A;  4GWR A;  2J23 A;  6GSU A;  20GS A;  2DJ3 A;  2HRK A;  2O85 A;  2GS3 A;  2V41 A;  7GSS A;  1LJR A;  4KCA A;  3EWL A;  3HHV A;  1XPV A;  4TKY A;  3KGK A;  5LCZ A;  1M2A A;  2LJA A;  4GQF A;  2OKA A;  4K5R A;  1OE8 A;  1OE7 A;  1XOB A;  1SK2 A;  1K0A A;  5DAK B;  2LJR A;  1SYX A;  4OFM A;  4KH7 A;  1DUG A;  2KOK A;  4DSS A;  5G5E A;  1M99 A;  3IV4 A;  5IM9 A;  1TK8 B;  3QAG A;  4NHW A;  3F63 A;  1G7E A;  3UIW A;  2XBI A;  4GQC A;  9GSS A;  2IMK A;  4OFT A;  2WZ9 A;  4EIP A;  1OC8 A;  4AF2 A;  1RQM A;  2REM A;  2CX3 A;  3D22 A;  2P31 A;  5ECM B;  2YJH A;  2DJ1 A;  3MWH A;  4ZIL A;  1LU4 A;  5A4W A;  3GKM A;  4K0N A;  3Q18 A;  3Q74 A;  2EIR A;  4L0W A;  1ZL9 A;  4EO3 A;  5B8B A;  3IBH A;  4V2N A;  1F37 A;  1X5D A;  2YWO A;  1R5P A;  2CX4 A;  3E3E A;  1FG4 A;  2VM2 A;  2GDR A;  4TR1 A;  4RQR A;  4TN8 A;  2YOI A;  1GL8 A;  5DJL A;  1A24 A;  4POL A;  2DML A;  5KEJ A;  3D21 A;  3BD2 A;  5B6M A;  5DCH A;  4L5L A;  1J9B A;  2L5O A;  2F3M A;  2DSA A;  1GSF A;  1PA3 A;  3ZML A;  5ABR A;  5B7C A;  4MK3 A;  5C00 A;  1JLW A;  4CY8 A;  4IQ1 A;  4KDU A;  3KEB A;  4QQ7 A;  1XBS A;  2HFD A;  3TJJ A;  5E59 A;  2GZZ A;  2C80 A;  4OO5 A;  2G2Q A;  16GS A;  2ZNM A;  2AHE A;  4IJI A;  2OE1 A;  1EOH A;  3UVH A;  1U87 A;  1THX A;  5CO3 A;  2V6K A;  3HDC A;  3C1R A;  1QXH A;  4XIH A;  1SK1 A;  3M9K A;  2L4Q A;  5GZZ B;  3GV1 A;  4JR4 A;  3UAP A;  6GST A;  1MEK A;  3RBT A;  3G7J A;  2DC5 A;  2LQQ A;  2TIR A;  2HRN A;  2YZU A;  4ECJ A;  1PN0 A;  3RHC A;  1XIY A;  3FYG A;  12GS A;  1PX6 A;  1XWC A;  4Q5Q A;  2PGT A;  1XWG A;  1PGT A;  1TRU A;  3RPP A;  5IMA A;  1VGL A;  1UVZ A;  3DEX A;  1BED A;  2B7K A;  1YQ1 A;  1T8E B;  3DXB A;  5IQY A;  1BYE A;  2B3S A;  3TOT A;  3CMI A;  1OKT A;  3ZVJ A;  4O5U A;  3UVT A;  1O85 A;  1ZYQ B;  2H6X A;  1Q98 A;  4O92 A;  1B4Q A;  3VWU A;  1TRW A;  3L9U A;  3H79 A;  1ST9 A;  3F8U A;  2Z9S A;  1JZW A;  1MD4 A;  4TXO B;  1FW1 A;  4G19 A;  2FY6 A;  4OMV A;  4H86 A;  2X49 A;  4K5S A;  3EE2 A;  2CVB A;  2QA2 A;  5J41 A;  4KX4 A;  3GFK A;  2IFQ B;  3TRP A;  1THO A;  1K3O A;  1TU8 A;  2C8U A;  4F9Z A;  3VPT A;  2L57 A;  3TCO A;  1JZD A;  4IN0 A;  4G0L A;  4ZXG A;  4O32 A;  2M80 A;  5EY6 A;  4PGT A;  3IAS 2;  3QR6 A;  4GRF A;  3IAM 2;  1W89 A;  2OBI A;  5DAK A;  4K2D A;  1G0T A;  3QAV A;  4Q5R A;  5IOW A;  3W8J A;  2LEG A;  1UN2 A;  2K6V A;  4IKH A;  4IQA A;  2XC2 A;  1SKR B;  1G7O A;  3FK8 A;  1OAZ A;  3CYN A;  3QMX A;  2K8V A;  1KNG A;  3F6D A;  4HJ2 A;  1V9W A;  1DSB A;  1EOG A;  1IYI A;  2B7J A;  2GTU A;  3RPN A;  2H1D A;  1K3L A;  4X43 A;  2QC7 A;  3LQ7 A;  1ZOF A;  5DQS A;  1HD2 A;  1O8W A;  4PQ1 A;  2X8G A;  1M2D A;  3J7Y k;  3BCI A;  1ZMA A;  3DVW A;  1BG5 A;  2K18 A;  2XPD A;  3NZN A;  2H1G A;  3FR6 A;  2HSY A;  4J2F A;  3G9B A;  4HSC X;  1M9A A;  4AJ7 A;  3OR5 A;  4L5O A;  3QFB C;  4K1F A;  2ZUP A;  3HZ4 A;  2XBQ A;  2C3N A;  3MAK A;  3MNG A;  3TJK A;  1YZX A;  2CV4 A;  1R4W A;  2YZH A;  5F0G A;  1PL1 A;  4V2L A;  2JZR A;  2YV9 A;  3IC8 A;  1WIK A;  3FKF A;  3CBU A;  4X1U A;  4ZB8 A;  1GWC A;  4KF9 A;  2E2G A;  2LRC A;  3KM6 A;  5F07 A;  3GX0 A;  2KUC A;  3LG6 A;  3ERG A;  2GQM A;  3GL5 A;  5CYY A;  5IMV A;  1X9S B;  4PNF A;  3LYK A;  5L71 A;  1XVQ A;  3GA4 A;  3FR9 A;  1BQ7 A;  4I6X A;  4DSS B;  1XW5 A;  5D9X A;  3TKR A;  5COH A;  3TGZ A;  2GT6 A;  2JU5 A;  5JCW A;  3K8N A;  1A2J A;  4V1A g;  4G2E A;  3HJO A;  4EXJ A;  4FIW A;  3ZIV A;  2LST A;  4WEY A;  3ZIJ A;  5EVO A;  4GXZ A;  2DJ0 A;  2HZE B;  2ZCT A;  4K7I A;  5G2Z A;  4MH2 A;  1PL2 A;  1B8X A;  3ERW A;  3LSZ A;  4ZB6 A;  1EV4 A;  4EDY A;  1T7P B;  2PMT A;  4ZBB A;  4ML6 A;  2IWT A;  1TXX A;  2VUP A;  5HR2 A;  2LUS A;  1XWB A;  2A2S A;  2G0F A;  1FVJ A;  4TR1 B;  2VM1 A;  2H0I A;  3H8Q A;  3FR3 A;  4BVX B;  2HSH A;  2YWM A;  4AJ6 A;  1H4O A;  4LL1 B;  4EUY A;  3GSS A;  1WJK A;  2QGV A;  1XXU A;  2LKU A;  2KP2 A;  3ZFL A;  2C4J A;  4BL7 B;  1PD2 1;  2LV3 A;  1T4Z A;  1K0N A;  4OCF A;  2IFQ A;  4K9Z A;  2RII A;  4JED A;  1A8Y A;  1YY7 A;  3HZ8 A;  4JRR A;  3CSJ A;  1SU9 A;  3HD5 A;  1SKS B;  5HFG A;  2EC4 A;  4HU9 A;  2IL3 A;  4KSM A;  5IOX A;  3HVS A;  1T00 A;  5HR1 A;  2P5Q A;  4EC0 A;  4CDO A;  2NPB A;  5BRT A;  2VCV A;  1LBK A;  2L59 A;  4NPB A;  1HQO A;  2IMF A;  3TKQ A;  3DVX A;  3MDK A;  4GTU A;  2GSQ A;  1FB0 A;  2KP1 A;  3WGE A;  5KOX A;  2GST A;  3U6V A;  1FHE A;  1OYJ A;  4RI7 A;  3DML A;  4IVF A;  4WKW A;  3LGC A;  2B1K A;  4WXT A;  4KSO A;  2R4V A;  2H8L A;  3HVN A;  2ALB A;  4ECC A;  4WR5 A;  4Q5N A;  2CQ9 A;  4X0X A;  3US3 A;  1EP7 A;  1PQN A;  2GSR A;  1J08 A;  4ML1 A;  2OJL A;  2LJK A;  3KTB A;  3R2Q A;  1X5C A;  5J4U A;  3PIN A;  6GSV A;  3CRT A;  4KUN A;  3TUE A;  3LXT A;  5H5R A;  4QL9 A;  3PGT A;  1PMT A;  1ILO A;  3UOM A;  2F9S A;  2JAD A;  2H1A A;  1TRV A;  3EIN A;  1PKZ A;  4PXO A;  1ACV A;  2R6K A;  5CRD A;  1XVW A;  4FYU A;  4O5Q A;  1ZYP A;  1XW9 A;  2B5Y A;  3F0I A;  3ZVJ D;  4EDZ A;  2VL3 A;  3C1S A;  4A5P A;  2L6D A;  3GRX A;  3UBK A;  5KOW A;  4PTS A;  1B4P A;  3GUR A;  5EL8 A;  5JWQ B;  4IW9 A;  2R37 A;  1O7U A;  2R0P A;  5E4W A;  1YKC A;  1K0M A;  2C0F A;  3FZ5 A;  5ENU A;  5CRH A;  2NDO A;  3GN3 A;  22GS A;  5G1K A;  3LOR A;  3E0U A;  3LYP A;  3I9V 2;  2JAC A;  2VLV A;  5DCG A;  2PUK C;  3O6T A;  2MYG A;  1I5G A;  3ZTL A;  3IHQ A;  3GH9 A;  2DJJ A;  4F2I A;  2TRX A;  4XS1 A;  1PFO A;  3TRQ A;  1S3R A;  3QD9 A;  3EVI A;  2NTO A;  2HRF A;  3IHG A;  1A0R P;  4MCU A;  1M7T A;  3IOS A;  5LD0 A;  2JZS A;  3KTL A;  1M2B A;  1GSS A;  2FWH A;  4MNN A;  3SWL A;  3F3Q A;  2H72 A;  5D9V A;  1GUL A;  4KDY A;  2J9H A;  4PQH A;  1E2Y A;  2RM6 A;  4Z2T A;  4MPG A;  4K2X A;  2K9F A;  1BX9 A;  3WGX A;  3GYK A;  3EPT A;  3G7Y A;  1K0B A;  1QQ2 A;  4YQM A;  3TKS C;  1BJX A;  3LW9 A;  5GST A;  5IMD A;  2IMI A;  4TRX A;  2HZE A;  3ZRE A;  2R3X A;  2IJY A;  1HNB A;  3I69 A;  1GLP A;  3KH9 A;  5FHI A;  3EC3 A;  1FB6 A;  2CZ3 A;  2HZF A;  2N5B A;  4F82 A;  2L6C A;  4KE3 A;  5JCG A;  4BVX A;  4N0Z A;  1GSY A;  4K7O A;  5HR3 A;  1PRX A;  2XPE A;  1AAZ A;  3ZFB A;  4F03 A;  4BL7 A;  2AJQ B;  5IPG A;  3C73 A;  3GTU B;  4YQV A;  3L9V A;  1TK0 B;  3IC4 A;  1ZYE A;  4FH8 A;  3A2X A;  3N5O A;  2N5F A;  4D73 B;  1XW6 A;  1VF2 A;  1NW2 A;  3IRA A;  1V2A A;  1N2A A;  5IMF A;  3GST A;  3L4N A;  3IK7 A;  1WPI A;  2FD3 A;  1T4Y A;  5G30 A;  3D0Z A;  2WB9 A;  5AIV A;  2X8C A;  3LWA A;  3QPM A;  5DBQ A;  4YKG A;  1J0F A;  3DGQ A;  2E7P A;  2H75 A;  2WFC A;  1GNW A;  5AGY A;  1JZR A;  2V2G A;  4GSN A;  1WRY A;  1GUK A;  3ZYW A;  4MPF A;  3D4T A;  3EU3 A;  3M8N A;  1XWK A;  1A2L A;  1ZGN A;  5ECR B;  3GIX A;  4XRD A;  1EGR A;  2GZP A;  4WR4 A;  5DJM A;  2H71 A;  2RM5 A;  1CQG A;  4MA9 A;  3ED3 A;  1SJ6 A;  2CAQ A;  3TB2 A;  1FOV A;  5G31 A;  2GLR A;  2JSY A;  3VPQ A;  3S9F A;  5A5K A;  6GSY A;  2O8V B;  3R3E A;  1SD9 A;  2A2R A;  3BCK A;  4EIQ A;  2IN3 A;  5J9B A;  1Q4J A;  4ZBD A;  2VLU A;  4KB3 A;  2PWJ A;  2RUE A;  1XCC A;  3GX8 A;  3EU4 A;  3M9J A;  4HOJ A;  2LNS A;  4MJB A;  3RAZ A;  3CTF A;  2YWN A;  1S3A A;  3UJ1 A;  1WE0 A;  5IIZ A;  4PX1 A;  11GS A;  5ECH B;  1GP1 A;  4QL7 A;  1ERW A;  4JZQ A;  1TOF A;  5ECS A;  3DD3 A;  6GSS A;  4IP6 A;  2LRT A;  4Z7X A;  2GQK A;  1Z7R A;  2O89 A;  1YDK A;  2LQO A;  3IA1 A;  1K0D A;  1TJD A;  2YV7 A;  3P90 A;  1T3B A;  3A2V A;  1GTB A;  3I43 A;  1QGV A;  4OO4 A;  4MZC A;  3KXO A;  4KND A;  3FZ9 A;  3W6G A;  3FZ4 A;  3H1N A;  1PKW A;  1DE1 A;  3CSH A;  4LLR A;  6GSW A;  1EZK A;  3IE3 A;  1MDK A;  2FWE A;  1YJ6 A;  1I9D A;  1MD3 A;  3C7M A;  4P3Y B;  3UMA A;  2MMZ A;  4KDX A;  1M3J A;  4YAP A;  3APQ A;  4MZB A;  2E2M A;  2H30 A;  4JBB A;  2CT6 A;  1OVN A;  3F4T A;  1M9B A;  5LNK e;  3N9J A;  2DIZ A;  4WBJ A;  4G0I A;  1URM A;  3WGD A;  2VO4 A;  3QOU A;  1K0C A;  3GMF A;  3UAR A;  5C04 A;  3L0H A;  2VCT A;  4JU5 A;  1U3I A;  4NMU A;  2AAW A;  4I2U A;  3CRU A;  4OWY A;  2OAC A;  4CW9 A;  1WMJ A;  1DBY A;  1Z9H A;  4WF4 A;  2DKI A;  2H1B A;  2OE3 A;  2PER A;  3WT2 A;  4Z2U A;  5G5F A;  3GTU A;  3KZQ A;  1OKD A;  1JLV A;  18GS A;  4DSR A;  1U6T A;  4I5Q A;  4D73 A;  5ECN B;  3Q6O A;  4IEL A;  1A8L A;  1MDJ A;  2L5L A;  3FMW A;  1T1V A;  2I4A A;  1ML6 A;  1HNC A;  3GHA A;  1Z6N A;  3A5W A;  1G6Y A;  2IIY A;  1EV9 A;  1KTE A;  1GSQ A;  1X0R A;  2HYX A;  4PUR A;  2H74 A;  4HDE A;  5HQP A;  2P0G A;  3CTG A;  5CNW A;  4KAE A;  4E8H A;  2VAF A;  5D9W A;  2A2P A;  5J9C A;  17GS A;  1B48 A;  1Y25 A;  5A4V A;  3C8E A;  4XS4 B;  2ON7 A;  4RUV A;  1H75 A;  1X5E A;  4E8E A;  1OC9 B;  2LRN A;  1NSW A;  1Y6E A;  1UC7 A;  1HYU A;  1USB A;  2HI7 A;  5D9T A;  4POB A;  3TKS A;  1F6M C;  2PVQ A;  4TXV A;  1PX7 A;  1F2E A;  3L78 A;  2V32 A;  3FW2 A;  4YH2 A;  4GST A;  3ZIT A;  2H01 A;  3HCZ A;  4I97 A;  3UBL A;  2L4C A;  4ZBA A;  4O7H A;  1FO5 A;  2R5G A;  4IBP A;  2YWI A;  2GSS A;  5IMC A;  14GS A;  3D5J A;  4LMV A;  5AIS A;  4HS1 A;  1AXD A;  3V1W A;  2WCI A;  2X99 A;  2JZT A;  1B9Y C;  3FRC A;  3P2A A;  2HNL A;  3KJY A;  4CHS A;  4K7N A;  2TRC P;  1TTZ A;  3D6I A;  4MP4 A;  2HLS A;  5CRG A;  4YQU A;  1V58 A;  4BWS A;  3PH9 A;  1IYH A;  4V1A p;  5IMZ A;  2YCD A;  3M0F A;  2R0C A;  2MMN A;  3NIV A;  3BOA A;  4IHU A;  6GSX A;  4G9H A;  3APS A;  2M72 A;  2HRA A;  2FGX A;  2QA1 A;  4YKF A;  3PR8 A;  3Q19 A;  4WBR D;  4JE1 A;  3WYW A;  1ZCP A;  3I6A A;  2F8F A;  1S3C A;  1O73 A;  2O87 A;  4KA0 A;  4ICY A;  2K8S A;  4FYB A;  4HI7 A;  2B5E A;  2VD0 A;  4TOP A;  2UZ8 A;  4IJ3 A;  4J56 E;  3TOU A;  5F8B A;  5KN0 A;  5EPF A;  4Q5F A;  4PUF C;  5HFK A;  4RI6 A;  3W8S A;  2P5R A;  1DE2 A;  5INY A;  4USS A;  5D73 A;  4N0V A;  4GLT A;  4DSQ A;  2HT9 A;  5J5N A;  4BVY B;  1GNE A;  3GL3 A;  3DKS A;  2C3T A;  4WF5 A;  5ECK B;  4HQZ A;  1EP8 A;  2KLX A;  1GLQ A;  4EL1 A;  1N8J A;  2N5A A;  3VFI A;  4HEA 2;  3HJM A;  3ZRD A;  3F3R A;  2FUG 2;  4ZB9 A;  2DKH A;  3VI7 A;  3SBC A;  1SJI A;  1ZYN A;  4XTS A;  1SL2 B;  3HJP A;  5ECL B;  3GKX A;  1R5A A;  13GS A;  5J3R A;  3M3M A;  5CP1 A;  1M0U A;  1AQV A;  1U88 A;  1QFN A;  5D96 A;  1TP9 A;  4ISD A;  1EEJ A;  1JHB A;  2H73 A;  2LTK A;  2F51 A;  1YF1 A;  1TU7 A;  1S3D A;  3ISO A;  1VRS D;  4POM A;  4N11 A;  3U5R E;  4OD7 A;  4GCI A;  2IPA A;  3VLN A;  1R7H A;  2GZY A;  3EYT A;  2JL4 A;  1O8X A;  4ZL7 A;  2OA7 A;  4ZL9 A;  1KBN A;  4BIK A;  3KIJ A;  3KCM A;  1HNA A;  4HU7 A;  5B6N A;  5JWO B;  2AUV A;  5DVB A;  3G7I A;  5A4U A;  4IGJ A;  1GTA A;  5IO2 A;  1ERT A;  2E0Q A;  3DRN A;  4GSS A;  2CA8 A;  2I3Y A;  4MMM A;  1SEN A;  2H0H A;  2MMA A;  4XHM A;  1JFU A;  2A4V A;  3TRX A;  3FHK A;  3APO A;  1R26 A;  2FA8 A;  5KN3 A;  1JZO A;  3QCP A;  4XS4 A;  4NXI A;  5DAL B;  3TJG A;  2I1U A;  1TDI A;  5GSS A;  4LL4 B;  1OC9 A;  4KCE A;  1FVK A;  4XRA A;  2YNX A;  3GKN A;  2C0D A;  4MF5 A;  4X4J A;  4RQX A;  4PUA A;  3QDN A;  5KN1 A;  5DQY A;  2VD1 A;  3FY7 A;  1AW9 A;  2KHP A;  3ZMK A;  4ECI A;  5CRE A;  1WOU A;  2DBC A;  3HVX A;  5D93 A;  1QK8 A;  4N30 A;  2AYT A;  2WS2 A;  4MJA A;  19GS A;  3P8W A;  2HXK A;  1NM3 A;  1K3Y A;  2LNT A;  3TJF A;  1UA5 A;  5GAN D;  1TW9 A;  4ID0 A;  1PSQ A;  2GT5 A;  3UL3 A;  3DYR A;  1U3A A;  3ME7 A;  2RUF A;  3KP8 A;  4XS6 A;  2ON5 A;  4AGS A;  2YN1 A;  4ACS A;  1V40 A;  1O6J A;  4EVM A;  3A2W A;  3ZL5 A;  2GVP A;  5AIX A;  2WJU A;  1SJZ A;  2VCX A;  2BMX A;  2PPT A;  1YF0 A;  3KH7 A;  4MJE A;  5ECO B;  5JWR B;  3LJR A;  2BJX A;  2VL2 C;  4POK A;  3EUR A;  2XHF A;  3F6F A;  5H5Q A;  1A23 A;  4DEJ A;  1ERV A;  2DJ2 A;  2I81 A;  3ZLP A;  5ECQ B;  2PU9 C;  5ID2 B;  4BVY A;  3A3T A;  3L9S A;  3TKS E;  3IK9 A;  3AY8 A;  4HQS A;  5BMU A;  5ECI B;  4V2M A;  3WT1 A;  2YAN A;  4TW5 A;  5JCU A;  3MSZ A;  2QKE A;  2H19 A;  4K8M A;  3IR4 A;  3BJ5 A;  2IMD A;  1SL0 B;  2M46 A;  1GUH A;  1SD8 A;  2JSZ A;  2V1M A;  3GH6 A;  3QAW A;  4N10 A;  4NV2 A;  1XZO A;  4F0B A;  1BAY A;  2EIQ A;  2FCH A;  4K0G A;  2MZC A;  5IO0 A;  4DVC A;  1XOA A;  2X64 A;  1TRS A;  3KMN A;  1NHO A;  4FQU A;  2FHE A;  2WUL A;  3ZZX A;  1EWX A;  2OBK A;  2YPM A;  4OFN A;  1F3A A;  4EE0 A;  3HVV A;  2YJ7 A;  4MDC A;  2WGR A;  4HUA A;  5KN2 A;  1E6B A;  4XCS A;  1Z5Y E;  2VOC A;  3DWV A;  1MDI A;  3KMO A;  4EKZ A;  4IP1 A;  3LXZ A;  3TKP A;  1GSU A;  4TR0 A;  3WD6 A;  2DIY A;  2H6Y A;  1KEB A;  4KW6 A;  4CY6 A;  1AQX A;  2MBS A;  2CVD A;  2WRT A;  3J7Y b;  1SL1 B;  1XG8 A;  4AJ8 A;  2PVO C;  4HJM A;  3VWW A;  1MTC A;  1WP0 A;  1NHY A;  1OC3 A;  1ABA A;  3IPZ A;  2V6O A;  2OE0 A;  4WET A;  5DDL A;  5DAL A;  1W4V A;  3QFA C;  2AB6 A;  2H0G A;  1GRX A;  1ZZY A;  2VL9 A;  2FWG A;  3F4R A;  5IPH A;  2EIO A;  2C0E A;  4MLY A;  5ELA A;  3EMX A;  2C0G A;  4BPY A;  5CAX A;  1G6W A;  3HY2 A;  3VUR A;  4I8B A;  4K6X A;  4MAB A;  2ES7 A;  2BTO T;  4HZ4 A;  1B9X C;  3RHB A;  1RW1 A;  5HFI A;  4G10 A;  4EF0 A;  4TVE A;  2B6M A;  3O76 A;  3BBY A;  2AV4 A;  3H4K A;  2H76 A;  2H70 A;  3HA9 A;  4NV5 A;  1SK0 A;  5ECP B;  2A4H A;  4YAV A; 
#chains in the Genus database with same CATH homology
 1X9M B;  3FZA A;  1YEP A;  4MJC A;  3NOF A;  4NWY A;  2B1L A;  1SKW B;  3KP9 A;  2B5X A;  2VCW A;  1V98 A;  3CXG A;  4BA7 A;  2O7K A;  2R2J A;  1K0O A;  1XFL A;  1AC1 A;  3H93 A;  2DJK A;  2LS5 A;  1GTI A;  1Z6M A;  4MZW A;  1YKA A;  3A5I A;  4I2T A;  4FYC A;  1RK4 A;  4KGI A;  2MBT A;  3D4M A;  2X8H A;  4NAX A;  1ERU A;  1AQW A;  4L8E A;  2QSI A;  1YEX A;  2CZ2 A;  3HYP A;  5B8A A;  10GS A;  3KD0 A;  4ECB A;  5CRW A;  1GH2 A;  1TI3 A;  3MYD A;  3M1G A;  4ZIJ A;  5ID2 A;  5H5S A;  3CSI A;  2VIM A;  1F3B A;  2IME A;  3LFL A;  4OCE A;  8GSS A;  1Z3E A;  2FNO A;  4FO5 A;  1TK5 B;  4MF6 A;  2GQL A;  4TR4 A;  1WWJ A;  5F06 A;  5G1L A;  3TDG A;  1F9M A;  2HSM A;  3ME8 A;  2VLT A;  3PPU A;  2C3Q A;  4ZL8 A;  2YP6 A;  5FWG A;  1TKD B;  4F0C A;  3VWX A;  4BWQ A;  4JR6 A;  3F4S A;  3JCM L;  1QUW A;  3VI5 A;  2D2Z A;  4LA1 A;  3GNJ A;  4ULX A;  4L0U A;  1Z7P A;  1TI1 A;  4TXO A;  3C71 A;  1V57 A;  1XWA A;  4LMW A;  2DMM A;  4PQI A;  2H6Z A;  4Z2R A;  3E9J B;  3O3T A;  5D8I A;  3RDW A;  4ILF A;  1QMV A;  5AN1 A;  3HKR A;  1VF3 A;  3F9U A;  2PN8 A;  2MMO A;  2FA4 A;  2WDU A;  1GUM A;  2GGT A;  4HZ2 A;  3MIX A;  4J57 E;  1C72 A;  2CVK A;  2VL2 A;  1VF1 A;  1GSE A;  1X9W B;  3VWV A;  2VCQ A;  2DLX A;  3EMP A;  3DIE A;  4O5R A;  2OAD A;  3ERF A;  1PN9 A;  4MH3 A;  2NVL A;  1A2M A;  5F05 A;  3UEM A;  1EEM A;  3P7X A;  4TR3 A;  4GF0 A;  1VF4 A;  4MF7 A;  1SYR A;  2X4A A;  1O81 A;  5FT3 A;  2C1Y A;  5HR0 A;  4NHZ A;  3TJB A;  4IS0 A;  3LEF A;  5GAP D;  3GKK A;  3IDV A;  2F8A A;  2PBJ A;  1CQH A;  2VCZ A;  1FAA A;  4G0K A;  1FOH A;  3IXR A;  1ON4 A;  2R0G A;  2NBS A;  2H66 A;  2I9H A;  3VK9 A;  4PNG A;  1A0F A;  5ELG A;  2HE3 A;  1EGO A;  3HXS A;  2RLI A;  3GUS A;  1AIU A;  1GSD A;  2FWF A;  2CAI A;  2FLS A;  3FEU A;  1AUC A;  1GTU A;  4GWR A;  2J23 A;  6GSU A;  20GS A;  2DJ3 A;  2HRK A;  2O85 A;  2GS3 A;  2V41 A;  7GSS A;  1LJR A;  4KCA A;  3EWL A;  3HHV A;  1XPV A;  4TKY A;  3KGK A;  5LCZ A;  1M2A A;  2LJA A;  4GQF A;  2OKA A;  4K5R A;  1OE8 A;  1OE7 A;  1XOB A;  1SK2 A;  1K0A A;  5DAK B;  2LJR A;  1SYX A;  4OFM A;  4KH7 A;  1DUG A;  2KOK A;  4DSS A;  5G5E A;  1M99 A;  3IV4 A;  5IM9 A;  1TK8 B;  3QAG A;  4NHW A;  3F63 A;  1G7E A;  3UIW A;  2XBI A;  4GQC A;  9GSS A;  2IMK A;  4OFT A;  2WZ9 A;  4EIP A;  1OC8 A;  4AF2 A;  1RQM A;  2REM A;  2CX3 A;  3D22 A;  2P31 A;  5ECM B;  2YJH A;  2DJ1 A;  3MWH A;  4ZIL A;  1LU4 A;  5A4W A;  3GKM A;  4K0N A;  3Q18 A;  3Q74 A;  2EIR A;  4L0W A;  1ZL9 A;  4EO3 A;  5B8B A;  3IBH A;  4V2N A;  1F37 A;  1X5D A;  2YWO A;  1R5P A;  2CX4 A;  3E3E A;  1FG4 A;  2VM2 A;  2GDR A;  4TR1 A;  4RQR A;  4TN8 A;  2YOI A;  1GL8 A;  5DJL A;  1A24 A;  4POL A;  2DML A;  5KEJ A;  3D21 A;  3BD2 A;  5B6M A;  5DCH A;  4L5L A;  1J9B A;  2L5O A;  2F3M A;  2DSA A;  1GSF A;  1PA3 A;  3ZML A;  5ABR A;  5B7C A;  4MK3 A;  5C00 A;  1JLW A;  4CY8 A;  4IQ1 A;  4KDU A;  3KEB A;  4QQ7 A;  1XBS A;  2HFD A;  3TJJ A;  5E59 A;  2GZZ A;  2C80 A;  4OO5 A;  2G2Q A;  16GS A;  2ZNM A;  2AHE A;  4IJI A;  2OE1 A;  1EOH A;  3UVH A;  1U87 A;  1THX A;  5CO3 A;  2V6K A;  3HDC A;  3C1R A;  1QXH A;  4XIH A;  1SK1 A;  3M9K A;  2L4Q A;  5GZZ B;  3GV1 A;  4JR4 A;  3UAP A;  6GST A;  1MEK A;  3RBT A;  3G7J A;  2DC5 A;  2LQQ A;  2TIR A;  2HRN A;  2YZU A;  4ECJ A;  1PN0 A;  3RHC A;  1XIY A;  3FYG A;  12GS A;  1PX6 A;  1XWC A;  4Q5Q A;  2PGT A;  1XWG A;  1PGT A;  1TRU A;  3RPP A;  5IMA A;  1VGL A;  1UVZ A;  3DEX A;  1BED A;  2B7K A;  1YQ1 A;  1T8E B;  3DXB A;  5IQY A;  1BYE A;  2B3S A;  3TOT A;  3CMI A;  1OKT A;  3ZVJ A;  4O5U A;  3UVT A;  1O85 A;  1ZYQ B;  2H6X A;  1Q98 A;  4O92 A;  1B4Q A;  3VWU A;  1TRW A;  3L9U A;  3H79 A;  1ST9 A;  3F8U A;  2Z9S A;  1JZW A;  1MD4 A;  4TXO B;  1FW1 A;  4G19 A;  2FY6 A;  4OMV A;  4H86 A;  2X49 A;  4K5S A;  3EE2 A;  2CVB A;  2QA2 A;  5J41 A;  4KX4 A;  3GFK A;  2IFQ B;  3TRP A;  1THO A;  1K3O A;  1TU8 A;  2C8U A;  4F9Z A;  3VPT A;  2L57 A;  3TCO A;  1JZD A;  4IN0 A;  4G0L A;  4ZXG A;  4O32 A;  2M80 A;  5EY6 A;  4PGT A;  3IAS 2;  3QR6 A;  4GRF A;  3IAM 2;  1W89 A;  2OBI A;  5DAK A;  4K2D A;  1G0T A;  3QAV A;  4Q5R A;  5IOW A;  3W8J A;  2LEG A;  1UN2 A;  2K6V A;  4IKH A;  4IQA A;  2XC2 A;  1SKR B;  1G7O A;  3FK8 A;  1OAZ A;  3CYN A;  3QMX A;  2K8V A;  1KNG A;  3F6D A;  4HJ2 A;  1V9W A;  1DSB A;  1EOG A;  1IYI A;  2B7J A;  2GTU A;  3RPN A;  2H1D A;  1K3L A;  4X43 A;  2QC7 A;  3LQ7 A;  1ZOF A;  5DQS A;  1HD2 A;  1O8W A;  4PQ1 A;  2X8G A;  1M2D A;  3J7Y k;  3BCI A;  1ZMA A;  3DVW A;  1BG5 A;  2K18 A;  2XPD A;  3NZN A;  2H1G A;  3FR6 A;  2HSY A;  4J2F A;  3G9B A;  1M9A A;  4AJ7 A;  3OR5 A;  4L5O A;  3QFB C;  4K1F A;  2ZUP A;  3HZ4 A;  2XBQ A;  2C3N A;  3MAK A;  3MNG A;  3TJK A;  1YZX A;  2CV4 A;  1R4W A;  2YZH A;  5F0G A;  1PL1 A;  4V2L A;  2JZR A;  2YV9 A;  3IC8 A;  1WIK A;  3FKF A;  3CBU A;  4X1U A;  4ZB8 A;  1GWC A;  4KF9 A;  2E2G A;  2LRC A;  3KM6 A;  5F07 A;  3GX0 A;  2KUC A;  3LG6 A;  3ERG A;  2GQM A;  3GL5 A;  5CYY A;  5IMV A;  1X9S B;  4PNF A;  3LYK A;  5L71 A;  1XVQ A;  3GA4 A;  3FR9 A;  1BQ7 A;  4I6X A;  4DSS B;  1XW5 A;  5D9X A;  3TKR A;  5COH A;  3TGZ A;  2GT6 A;  2JU5 A;  5JCW A;  3K8N A;  1A2J A;  4V1A g;  4G2E A;  3HJO A;  4EXJ A;  4FIW A;  3ZIV A;  2LST A;  4WEY A;  3ZIJ A;  5EVO A;  4GXZ A;  2DJ0 A;  2HZE B;  2ZCT A;  4K7I A;  5G2Z A;  4MH2 A;  1PL2 A;  1B8X A;  3ERW A;  3LSZ A;  4ZB6 A;  1EV4 A;  4EDY A;  1T7P B;  2PMT A;  4ZBB A;  4ML6 A;  2IWT A;  1TXX A;  2VUP A;  5HR2 A;  2LUS A;  1XWB A;  2A2S A;  2G0F A;  1FVJ A;  4TR1 B;  2VM1 A;  2H0I A;  3H8Q A;  3FR3 A;  4BVX B;  2HSH A;  2YWM A;  4AJ6 A;  1H4O A;  4LL1 B;  4EUY A;  3GSS A;  1WJK A;  2QGV A;  1XXU A;  2LKU A;  2KP2 A;  3ZFL A;  2C4J A;  4BL7 B;  1PD2 1;  2LV3 A;  1T4Z A;  1K0N A;  4OCF A;  2IFQ A;  4K9Z A;  2RII A;  4JED A;  1A8Y A;  1YY7 A;  3HZ8 A;  4JRR A;  3CSJ A;  1SU9 A;  3HD5 A;  1SKS B;  5HFG A;  2EC4 A;  4HU9 A;  2IL3 A;  4KSM A;  5IOX A;  3HVS A;  1T00 A;  5HR1 A;  2P5Q A;  4EC0 A;  4CDO A;  2NPB A;  5BRT A;  2VCV A;  1LBK A;  2L59 A;  4NPB A;  1HQO A;  2IMF A;  3TKQ A;  3DVX A;  3MDK A;  4GTU A;  2GSQ A;  1FB0 A;  2KP1 A;  3WGE A;  5KOX A;  2GST A;  3U6V A;  1FHE A;  1OYJ A;  4RI7 A;  3DML A;  4IVF A;  4WKW A;  3LGC A;  2B1K A;  4WXT A;  4KSO A;  2R4V A;  2H8L A;  2ALB A;  4ECC A;  4WR5 A;  4Q5N A;  2CQ9 A;  4X0X A;  3US3 A;  1EP7 A;  1PQN A;  2GSR A;  1J08 A;  4ML1 A;  2OJL A;  2LJK A;  3KTB A;  3R2Q A;  1X5C A;  5J4U A;  3PIN A;  6GSV A;  3CRT A;  4KUN A;  3TUE A;  3LXT A;  5H5R A;  4QL9 A;  3PGT A;  1PMT A;  1ILO A;  3UOM A;  2F9S A;  2JAD A;  2H1A A;  1TRV A;  3EIN A;  1PKZ A;  4PXO A;  1ACV A;  2R6K A;  5CRD A;  1XVW A;  4FYU A;  4O5Q A;  1ZYP A;  1XW9 A;  2B5Y A;  3F0I A;  3ZVJ D;  4EDZ A;  2VL3 A;  3C1S A;  4A5P A;  2L6D A;  3GRX A;  3UBK A;  5KOW A;  4PTS A;  1B4P A;  3GUR A;  5EL8 A;  5JWQ B;  4IW9 A;  2R37 A;  1O7U A;  2R0P A;  5E4W A;  1YKC A;  1K0M A;  2C0F A;  3FZ5 A;  5ENU A;  5CRH A;  2NDO A;  3GN3 A;  22GS A;  5G1K A;  3LOR A;  3E0U A;  3LYP A;  3I9V 2;  2JAC A;  2VLV A;  5DCG A;  2PUK C;  3O6T A;  2MYG A;  1I5G A;  3ZTL A;  3IHQ A;  3GH9 A;  2DJJ A;  4F2I A;  2TRX A;  4XS1 A;  3TRQ A;  3QD9 A;  3EVI A;  2NTO A;  2HRF A;  3IHG A;  1A0R P;  4MCU A;  1M7T A;  3IOS A;  5LD0 A;  2JZS A;  3KTL A;  1M2B A;  1GSS A;  2FWH A;  4MNN A;  3SWL A;  3F3Q A;  2H72 A;  5D9V A;  1GUL A;  4KDY A;  2J9H A;  4PQH A;  1E2Y A;  2RM6 A;  4Z2T A;  4MPG A;  4K2X A;  2K9F A;  1BX9 A;  3WGX A;  3GYK A;  3EPT A;  3G7Y A;  1K0B A;  1QQ2 A;  4YQM A;  3TKS C;  1BJX A;  3LW9 A;  5GST A;  5IMD A;  2IMI A;  4TRX A;  2HZE A;  3ZRE A;  2R3X A;  2IJY A;  1HNB A;  3I69 A;  1GLP A;  3KH9 A;  5FHI A;  3EC3 A;  1FB6 A;  2CZ3 A;  2HZF A;  2N5B A;  4F82 A;  2L6C A;  4KE3 A;  5JCG A;  4BVX A;  4N0Z A;  1GSY A;  4K7O A;  5HR3 A;  1PRX A;  2XPE A;  1AAZ A;  3ZFB A;  4F03 A;  4BL7 A;  2AJQ B;  5IPG A;  3C73 A;  3GTU B;  4YQV A;  3L9V A;  1TK0 B;  3IC4 A;  1ZYE A;  4FH8 A;  3A2X A;  3N5O A;  2N5F A;  4D73 B;  1XW6 A;  1VF2 A;  1NW2 A;  3IRA A;  1V2A A;  1N2A A;  5IMF A;  3GST A;  3L4N A;  3IK7 A;  1WPI A;  2FD3 A;  1T4Y A;  5G30 A;  3D0Z A;  2WB9 A;  5AIV A;  2X8C A;  3LWA A;  3QPM A;  5DBQ A;  4YKG A;  1J0F A;  3DGQ A;  2E7P A;  2H75 A;  2WFC A;  1GNW A;  5AGY A;  1JZR A;  2V2G A;  4GSN A;  1WRY A;  1GUK A;  3ZYW A;  4MPF A;  3D4T A;  3EU3 A;  3M8N A;  1XWK A;  1A2L A;  1ZGN A;  5ECR B;  3GIX A;  4XRD A;  1EGR A;  2GZP A;  4WR4 A;  5DJM A;  2H71 A;  2RM5 A;  1CQG A;  4MA9 A;  3ED3 A;  1SJ6 A;  2CAQ A;  3TB2 A;  1FOV A;  5G31 A;  2GLR A;  2JSY A;  3VPQ A;  3S9F A;  5A5K A;  6GSY A;  2O8V B;  3R3E A;  1SD9 A;  2A2R A;  3BCK A;  4EIQ A;  2IN3 A;  5J9B A;  1Q4J A;  4ZBD A;  2VLU A;  4KB3 A;  2PWJ A;  2RUE A;  1XCC A;  3GX8 A;  3EU4 A;  3M9J A;  4HOJ A;  2LNS A;  4MJB A;  3RAZ A;  3CTF A;  2YWN A;  1S3A A;  3UJ1 A;  1WE0 A;  5IIZ A;  4PX1 A;  11GS A;  5ECH B;  1GP1 A;  4QL7 A;  1ERW A;  4JZQ A;  1TOF A;  5ECS A;  3DD3 A;  6GSS A;  4IP6 A;  2LRT A;  4Z7X A;  2GQK A;  1Z7R A;  2O89 A;  1YDK A;  2LQO A;  3IA1 A;  1K0D A;  1TJD A;  2YV7 A;  3P90 A;  1T3B A;  3A2V A;  1GTB A;  3I43 A;  1QGV A;  4OO4 A;  4MZC A;  3KXO A;  4KND A;  3FZ9 A;  3W6G A;  3FZ4 A;  3H1N A;  1PKW A;  1DE1 A;  3CSH A;  4LLR A;  6GSW A;  1EZK A;  3IE3 A;  1MDK A;  2FWE A;  1YJ6 A;  1I9D A;  1MD3 A;  3C7M A;  4P3Y B;  3UMA A;  2MMZ A;  4KDX A;  4YAP A;  3APQ A;  4MZB A;  2E2M A;  2H30 A;  4JBB A;  2CT6 A;  1OVN A;  3F4T A;  1M9B A;  5LNK e;  3N9J A;  2DIZ A;  4WBJ A;  4G0I A;  1URM A;  3WGD A;  2VO4 A;  3QOU A;  1K0C A;  3GMF A;  3UAR A;  5C04 A;  3L0H A;  2VCT A;  4JU5 A;  1U3I A;  4NMU A;  2AAW A;  4I2U A;  3CRU A;  4OWY A;  2OAC A;  4CW9 A;  1WMJ A;  1DBY A;  1Z9H A;  4WF4 A;  2DKI A;  2H1B A;  2OE3 A;  2PER A;  3WT2 A;  4Z2U A;  5G5F A;  3GTU A;  3KZQ A;  1OKD A;  1JLV A;  18GS A;  4DSR A;  1U6T A;  4I5Q A;  4D73 A;  5ECN B;  3Q6O A;  4IEL A;  1A8L A;  1MDJ A;  2L5L A;  3FMW A;  1T1V A;  2I4A A;  1ML6 A;  1HNC A;  3GHA A;  1Z6N A;  3A5W A;  1G6Y A;  2IIY A;  1EV9 A;  1KTE A;  1GSQ A;  1X0R A;  2HYX A;  4PUR A;  2H74 A;  4HDE A;  5HQP A;  2P0G A;  3CTG A;  5CNW A;  4KAE A;  4E8H A;  2VAF A;  5D9W A;  2A2P A;  5J9C A;  17GS A;  1B48 A;  1Y25 A;  5A4V A;  3C8E A;  4XS4 B;  2ON7 A;  4RUV A;  1H75 A;  1X5E A;  4E8E A;  1OC9 B;  2LRN A;  1NSW A;  1Y6E A;  1UC7 A;  1HYU A;  1USB A;  2HI7 A;  5D9T A;  4POB A;  3TKS A;  1F6M C;  2PVQ A;  4TXV A;  1PX7 A;  1F2E A;  3L78 A;  2V32 A;  3FW2 A;  4YH2 A;  4GST A;  3ZIT A;  2H01 A;  3HCZ A;  4I97 A;  3UBL A;  2L4C A;  4ZBA A;  4O7H A;  1FO5 A;  2R5G A;  4IBP A;  2YWI A;  2GSS A;  5IMC A;  14GS A;  3D5J A;  4LMV A;  5AIS A;  4HS1 A;  1AXD A;  3V1W A;  2WCI A;  2X99 A;  2JZT A;  1B9Y C;  3FRC A;  3P2A A;  2HNL A;  3KJY A;  4CHS A;  4K7N A;  2TRC P;  1TTZ A;  3D6I A;  4MP4 A;  2HLS A;  5CRG A;  4YQU A;  1V58 A;  4BWS A;  3PH9 A;  1IYH A;  4V1A p;  5IMZ A;  2YCD A;  3M0F A;  2R0C A;  2MMN A;  3NIV A;  3BOA A;  4IHU A;  6GSX A;  4G9H A;  3APS A;  2M72 A;  2HRA A;  2FGX A;  2QA1 A;  4YKF A;  3PR8 A;  3Q19 A;  4WBR D;  4JE1 A;  3WYW A;  1ZCP A;  3I6A A;  2F8F A;  1S3C A;  1O73 A;  2O87 A;  4KA0 A;  4ICY A;  2K8S A;  4FYB A;  4HI7 A;  2B5E A;  2VD0 A;  4TOP A;  2UZ8 A;  4IJ3 A;  4J56 E;  3TOU A;  5F8B A;  5KN0 A;  5EPF A;  4Q5F A;  4PUF C;  5HFK A;  4RI6 A;  3W8S A;  2P5R A;  1DE2 A;  5INY A;  4USS A;  5D73 A;  4N0V A;  4GLT A;  4DSQ A;  2HT9 A;  5J5N A;  4BVY B;  1GNE A;  3GL3 A;  3DKS A;  2C3T A;  4WF5 A;  5ECK B;  4HQZ A;  1EP8 A;  2KLX A;  1GLQ A;  4EL1 A;  1N8J A;  2N5A A;  3VFI A;  4HEA 2;  3HJM A;  3ZRD A;  3F3R A;  2FUG 2;  4ZB9 A;  2DKH A;  3VI7 A;  3SBC A;  1SJI A;  1ZYN A;  4XTS A;  1SL2 B;  3HJP A;  5ECL B;  3GKX A;  1R5A A;  13GS A;  5J3R A;  3M3M A;  5CP1 A;  1M0U A;  1AQV A;  1U88 A;  1QFN A;  5D96 A;  1TP9 A;  4ISD A;  1EEJ A;  1JHB A;  2H73 A;  2LTK A;  2F51 A;  1YF1 A;  1TU7 A;  1S3D A;  3ISO A;  1VRS D;  4POM A;  4N11 A;  3U5R E;  4OD7 A;  4GCI A;  2IPA A;  3VLN A;  1R7H A;  2GZY A;  3EYT A;  2JL4 A;  1O8X A;  4ZL7 A;  2OA7 A;  4ZL9 A;  1KBN A;  3KIJ A;  3KCM A;  1HNA A;  4HU7 A;  5B6N A;  5JWO B;  2AUV A;  5DVB A;  3G7I A;  5A4U A;  4IGJ A;  1GTA A;  5IO2 A;  1ERT A;  2E0Q A;  3DRN A;  4GSS A;  2CA8 A;  2I3Y A;  4MMM A;  1SEN A;  2H0H A;  2MMA A;  4XHM A;  1JFU A;  2A4V A;  3TRX A;  3FHK A;  3APO A;  1R26 A;  2FA8 A;  5KN3 A;  1JZO A;  3QCP A;  4XS4 A;  4NXI A;  5DAL B;  3TJG A;  2I1U A;  1TDI A;  5GSS A;  4LL4 B;  1OC9 A;  4KCE A;  1FVK A;  4XRA A;  2YNX A;  3GKN A;  2C0D A;  4MF5 A;  4X4J A;  4RQX A;  4PUA A;  3QDN A;  5KN1 A;  5DQY A;  2VD1 A;  3FY7 A;  1AW9 A;  2KHP A;  3ZMK A;  4ECI A;  5CRE A;  1WOU A;  2DBC A;  3HVX A;  5D93 A;  1QK8 A;  4N30 A;  2AYT A;  2WS2 A;  4MJA A;  19GS A;  3P8W A;  2HXK A;  1NM3 A;  1K3Y A;  2LNT A;  3TJF A;  1UA5 A;  5GAN D;  1TW9 A;  4ID0 A;  1PSQ A;  2GT5 A;  3UL3 A;  3DYR A;  1U3A A;  3ME7 A;  2RUF A;  3KP8 A;  4XS6 A;  2ON5 A;  4AGS A;  2YN1 A;  4ACS A;  1V40 A;  1O6J A;  4EVM A;  3A2W A;  3ZL5 A;  2GVP A;  5AIX A;  2WJU A;  1SJZ A;  2VCX A;  2BMX A;  2PPT A;  1YF0 A;  3KH7 A;  4MJE A;  5ECO B;  5JWR B;  3LJR A;  2BJX A;  2VL2 C;  4POK A;  3EUR A;  2XHF A;  3F6F A;  5H5Q A;  1A23 A;  4DEJ A;  1ERV A;  2DJ2 A;  2I81 A;  3ZLP A;  5ECQ B;  2PU9 C;  5ID2 B;  4BVY A;  3A3T A;  3L9S A;  3TKS E;  3IK9 A;  3AY8 A;  4HQS A;  5BMU A;  5ECI B;  4V2M A;  3WT1 A;  2YAN A;  4TW5 A;  5JCU A;  3MSZ A;  2QKE A;  2H19 A;  4K8M A;  3IR4 A;  3BJ5 A;  2IMD A;  1SL0 B;  2M46 A;  1GUH A;  1SD8 A;  2JSZ A;  2V1M A;  3GH6 A;  3QAW A;  4N10 A;  4NV2 A;  1XZO A;  4F0B A;  1BAY A;  2EIQ A;  2FCH A;  4K0G A;  2MZC A;  5IO0 A;  4DVC A;  1XOA A;  2X64 A;  1TRS A;  3KMN A;  1NHO A;  4FQU A;  2FHE A;  2WUL A;  3ZZX A;  1EWX A;  2OBK A;  2YPM A;  4OFN A;  1F3A A;  4EE0 A;  3HVV A;  2YJ7 A;  4MDC A;  2WGR A;  4HUA A;  5KN2 A;  1E6B A;  4XCS A;  1Z5Y E;  2VOC A;  3DWV A;  1MDI A;  3KMO A;  4EKZ A;  4IP1 A;  3LXZ A;  3TKP A;  1GSU A;  4TR0 A;  3WD6 A;  2DIY A;  2H6Y A;  1KEB A;  4KW6 A;  4CY6 A;  1AQX A;  2MBS A;  2CVD A;  2WRT A;  3J7Y b;  1SL1 B;  4AJ8 A;  2PVO C;  4HJM A;  3VWW A;  1MTC A;  1WP0 A;  1NHY A;  1OC3 A;  1ABA A;  3IPZ A;  2V6O A;  2OE0 A;  4WET A;  5DDL A;  5DAL A;  1W4V A;  3QFA C;  2AB6 A;  2H0G A;  1GRX A;  1ZZY A;  2VL9 A;  2FWG A;  3F4R A;  5IPH A;  2EIO A;  2C0E A;  4MLY A;  5ELA A;  3EMX A;  2C0G A;  4BPY A;  5CAX A;  1G6W A;  3HY2 A;  3VUR A;  4I8B A;  4K6X A;  4MAB A;  2ES7 A;  2BTO T;  4HZ4 A;  1B9X C;  3RHB A;  1RW1 A;  5HFI A;  4G10 A;  4EF0 A;  4TVE A;  2B6M A;  3O76 A;  3BBY A;  2AV4 A;  3H4K A;  2H76 A;  2H70 A;  3HA9 A;  4NV5 A;  1SK0 A;  5ECP B;  2A4H A;  4YAV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...