5JWQB

Crystal structure of kaic s431e in complex with foldswitch-stabilized kaib from thermosynechococcus elongatus
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
88
structure length
88
Chain Sequence
TAVLKLYVAGNTPNSVRALKTLNNILEKEFKGVYALKVIDVLKNPQLAEEDKILATPTLAKVLPPPVRRIIGDLSNREKVLAGLDLLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords Circadian clock protein kinase KaiC
publication title Structural basis of the day-night transition in a bacterial circadian clock.
pubmed doi rcsb
source organism Thermosynechococcus elongatus (strain bp-1)
total genus 15
structure length 88
sequence length 88
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07689 KaiB KaiB domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5jwqB00
2AB6A 3ZLPA 3OR5A 4LA1A 2HFDA 2JZSA 3NZNA 1GLQA 1U3AA 1UC7A 2N5FA 1O8XA 4MZBA 4I5QA 1XXUA 2J23A 3KCMA 3RBTA 4I2UA 5IO2A 3O3TA 1Y6EA 4K0NA 5ELAA 2CX4A 4FIWA 1HYUA 1Q98A 5DALB 4NXIA 1ZYEA 4KDXA 4HJ2A 1TU7A 3BOAA 4HQSA 3E9JB 2LRCA 12GSA 1VF4A 1QQ2A 1LJRA 4K9ZA 4CW9A 1RK4A 1ZGNA 2NPBA 4TR0A 2DBCA 3IV4A 2WGRA 2F8AA 3WYWA 4GTUA 3UBLA 4K0GA 4HI7A 1M2AA 4LLRA 2M80A 1C72A 4POBA 1EEMA 4EE0A 1X9WB 2OBKA 6GSSA 3L78A 4TW5A 2IMKA 5D9XA 5FHIA 1AQWA 2DJ0A 3GN3A 3LGCA 2LQOA 4ULXA 1SJIA 2V6OA 2PGTA 2JZRA 1TP9A 1Y25A 1SD8A 2C3NA 1A8YA 1YEPA 2GZYA 1PQNA 3GH9A 4NPBA 4D73B 5GAPD 3KMNA 3H8QA 4XS6A 1O8WA 2PWJA 1OKDA 2A4VA 2P5RA 2AAWA 3N5OA 3FZ9A 3CMIA 4E8EA 3G9BA 3ED3A 1ZCPA 4JRRA 3TRPA 3Q18A 4BPYA 3VURA 4TR1B 1AUCA 4NMUA 1XWBA 1S3AA 2C4JA 1TRSA 3TJJA 5FWGA 3P90A 4Z7XA 3KH9A 2KOKA 3M3MA 5CO3A 1GWCA 4PXOA 3A2XA 5D96A 2DLXA 1YDKA 2H1GA 3W6GA 3L4NA 4DSRA 1T3BA 4EUYA 5L71A 5DCGA 1F9MA 4GF0A 2AV4A 1VF3A 1XW5A 4NHWA 3TRXA 3P2AA 5ECMB 4NHZA 2HYXA 1GH2A 3GA4A 1F6MC 3F4SA 3IPZA 1SK2A 5DJLA 1PGTA 3W8SA 1FB6A 3C73A 5IM9A 3GSSA 4TXOB 4HZ4A 3VI5A 1NHYA 5ECNB 3J7Yk 1KTEA 4KW6A 4MABA 4KUNA 2HZFA 4XHMA 2KUCA 1BQ7A 2HSYA 4V1Ag 3US3A 2FUG2 3IRAA 1T4ZA 3FW2A 2ALBA 2QSIA 2H72A 2E2GA 2GSSA 2QGVA 1PL1A 1M9BA 2GVPA 2WS2A 5DQSA 5LNKe 4IQAA 5D9VA 2MMAA 2VL9A 1LBKA 2H19A 3KP9A 2CA8A 3EMPA 3RAZA 4MF5A 1MDIA 1DE2A 2Z9SA 3IR4A 3LSZA 2KP2A 4HUAA 1UVZA 1PL2A 3BJ5A 3APSA 4N0ZA 1N2AA 3TB2A 1QUWA 1DE1A 4WBJA 4WKWA 5ECOB 4KA0A 2GSQA 4ZB8A 1MD4A 1J0FA 5KEJA 4G2EA 3FY7A 5HR0A 2B7KA 2DSAA 1T00A 1PSQA 1AIUA 17GSA 3CYNA 1QGVA 3RPPA 3IDVA 3UBKA 4I97A 1CQGA 3KEBA 3L0HA 4ZBDA 2ZNMA 3TOTA 1O81A 3M9JA 1GTBA 1FVJA 1B9XC 3ISOA 4X43A 1BX9A 3RHBA 2ES7A 3HHVA 5KN2A 3EVIA 5G31A 3GL3A 1WP0A 1JHBA 4ZL9A 1JZOA 1EGOA 3UIWA 3A3TA 1XOBA 4I2TA 2D2ZA 4ZL7A 3TJFA 3WGDA 2AHEA 2LS5A 1K0MA 4N30A 4J57E 1G6WA 5B6NA 2JSYA 4ECJA 2I1UA 1V40A 3EE2A 3HXSA 2YNXA 2EC4A 3GSTA 4X0XA 5J4UA 2RUEA 1ZL9A 4J56E 3DD3A 5IMDA 2V6KA 4IP6A 4MH2A 1NM3A 1TI1A 4RQRA 4YQVA 4YQUA 2VAFA 3LWAA 2ZUPA 1URMA 2XPDA 1MDJA 2WZ9A 5C00A 1GTUA 1GSUA 2H75A 1GTAA 4IJIA 2MMOA 4P3YB 3KD0A 5FT3A 2BMXA 1YY7A 1A2MA 4MJBA 2FY6A 4ECBA 1O6JA 2KP1A 5HFKA 2GTUA 3UAPA 3C8EA 3QDNA 5LCZA 3UOMA 3FEUA 3VWVA 1JZDA 5ID2B 2IN3A 1OC9B 1EOHA 2IFQB 3GNJA 3GFKA 1FOVA 4LMVA 5JWQB 3GL5A 2E0QA 1TK8B 2YJ7A 4FYUA 1BJXA 2LQQA 4F9ZA 1TDIA 4PQIA 2DIYA 2A2SA 5ECLB 1Z6NA 5F05A 2FWGA 4PQHA 1MTCA 1WE0A 2IIYA 3APOA 5DQYA 3S9FA 1TW9A 3DKSA 1GUMA 1R7HA 3ZZXA 4FH8A 2VCWA 1OE8A 3GTUB 1U3IA 3ZIVA 1Z7RA 1RQMA 1ABAA 1GNWA 1SL0B 1SKRB 3IAM2 2O87A 1BYEA 1BAYA 4L0UA 2C3QA 1XWGA 3GHAA 2DJJA 3F6FA 4GSNA 1FW1A 1AW9A 3QFBC 2YWMA 5ECSA 4GSTA 2C1YA 1XW9A 1B9YC 5JWRB 3HVVA 2NVLA 1WRYA 4O7HA 3JCML 5GZZB 3ZL5A 3F4TA 1ERWA 5IMVA 4G9HA 2DMLA 3FR9A 3DYRA 1THXA 4LL4B 4RI7A 2J9HA 3IK7A 4POMA 4F03A 3I69A 3VWUA 2M72A 2OBIA 1A2LA 3CTFA 2JADA 4CHSA 2OE3A 3UL3A 5ELGA 3TKPA 4DEJA 2IL3A 3TOUA 3QOUA 5EPFA 6GSTA 3GYKA 4N10A 4POKA 2L4QA 4AJ6A 3J7Yb 2N5AA 2L4CA 2V1MA 3M1GA 3F9UA 1ILOA 2B7JA 1B48A 1THOA 3MDKA 3UMAA 1B8XA 4HOJA 2VCVA 5DAKB 5A4WA 1M7TA 4MJEA 2H6XA 1ZOFA 1TI3A 4FYBA 1YQ1A 3QFAC 4F2IA 1Q4JA 1R5PA 13GSA 2WFCA 1GSSA 3EURA 2CVKA 4Q5QA 1EP7A 1YKCA 3KIJA 2K18A 2VCZA 3WD6A 5ECIB 5F06A 5ENUA 2FA8A 2R2JA 2YWOA 5DJMA 2CVBA 3EWLA 3KM6A 2CV4A 3KGKA 4XS4A 1A8LA 3FK8A 3LQ7A 5CNWA 2V2GA 4IP1A 1HNBA 1NW2A 4PNFA 5AISA 1PKWA 1XWCA 2PVOC 5JCWA 4G10A 1OC3A 20GSA 4N0VA 2X8GA 2GDRA 2K9FA 3UARA 5A4UA 1V2AA 2HSHA 2FGXA 3HVXA 3P7XA 3PINA 1YJ6A 1VRSD 2EIRA 2VO4A 1T7PB 1K0DA 3ME8A 4EL1A 2WJUA 4PX1A 2CVDA 3GKXA 2CZ2A 2GSTA 1Z3EA 3H79A 3LJRA 2VM2A 4KAEA 3CSJA 3GH6A 5HFGA 3TRQA 1K0OA 2BJXA 4RI6A 3VLNA 2B1KA 2C0DA 4ACSA 1XFLA 4KE3A 4PURA 4GLTA 5B8BA 4IVFA 5KN1A 1A23A 2YV9A 3CTGA 3GX8A 4AF2A 1VGLA 1EP8A 4EVMA 1AQVA 2I9HA 2K8SA 4RUVA 5CRGA 2JACA 5D9WA 1FG4A 3PGTA 2HE3A 5D9TA 5DBQA 3ZIJA 1AXDA 1EGRA 5COHA 2DMMA 3M8NA 2PUKC 1TRUA 2PN8A 4PUFC 5ECHB 3UVHA 1F37A 2L5OA 1U6TA 1TTZA 1XCCA 2PERA 4MH3A 2HZEA 3K8NA 3RPNA 5IPHA 2R3XA 2C80A 2AUVA 2FWHA 2LNSA 4EF0A 2H30A 2L57A 4ZXGA 1U87A 3D6IA 2I3YA 4DSSB 5ECQB 2DIZA 2WRTA 3QPMA 14GSA 3ZMKA 4HEA2 3LYKA 5ECRB 4PGTA 2NDOA 1NHOA 4HS1A 1XVQA 4KSOA 4BL7A 2GSRA 2PU9C 4MPGA 5J41A 2PPTA 3C1SA 6GSWA 2C8UA 1V98A 1UA5A 2HNLA 2HXKA 4K6XA 1CQHA 5H5SA 1QK8A 2H0HA 2H1DA 2YPMA 2H71A 1SKWB 2O8VB 4ZB9A 1F3BA 2VOCA 4QL7A 2AJQB 3KTLA 3IC4A 4KCEA 5CRHA 1BEDA 1T4YA 2XBIA 4POLA 2LEGA 3TKSE 2VD1A 2LJRA 3QCPA 4KB3A 1WIKA 1Z9HA 4K1FA 2VCQA 2R5GA 1ML6A 4PNGA 2OE1A 3LXZA 2KHPA 3G7YA 3LORA 1J08A 3QAGA 5ABRA 2GZPA 3MAKA 5B7CA 1JZWA 4L5OA 5IMAA 2E7PA 11GSA 4MMMA 5D8IA 3Q6OA 4JR4A 1KNGA 3QAVA 3P8WA 2VCTA 5G30A 1F2EA 1SJ6A 4JE1A 1A0RP 4IGJA 3HYPA 4AJ7A 5HR1A 1A24A 5JCUA 2GLRA 5CREA 4IN0A 3R2QA 1ACVA 2V41A 4OFTA 3IE3A 2GGTA 1GRXA 1KEBA 4ISDA 3ERFA 4NWYA 3IK9A 2X99A 5EL8A 2WCIA 3L9UA 4KX4A 1Z5YE 3MSZA 1U88A 4V2LA 3ZVJA 4EXJA 2YP6A 5GSTA 3ZFLA 2VL3A 2YV7A 3FZ5A 1EOGA 1T1VA 4WR5A 5HR3A 2GT6A 1ZYQB 2FLSA 1MDKA 2B3SA 4O32A 1EWXA 1K0NA 4ILFA 1AQXA 1Z6MA 5J9BA 4ML6A 1XOAA 2P5QA 4L8EA 3ERGA 4XIHA 3U6VA 2L6DA 2JL4A 1M2DA 2H76A 2H6ZA 4HU7A 5F0GA 3QAWA 2CAQA 2K6VA 2GS3A 4KDUA 1M99A 2M46A 3KJYA 4MA9A 1SD9A 2FA4A 1VF1A 4TR4A 1A2JA 3I43A 1K3YA 2NTOA 1SKSB 5DDLA 4CDOA 4OD7A 3W8JA 1W4VA 2PVQA 2PMTA 3ERWA 3D4TA 4WR4A 3HJMA 2CAIA 1ZMAA 1G7EA 1XBSA 5DVBA 1SENA 3QMXA 2P31A 2YN1A 1G7OA 2MZCA 3IA1A 1K0BA 3BBYA 4XRDA 1QMVA 1N8JA 2VLTA 4MJCA 4OO4A 2H1AA 3ZVJD 4IQ1A 4BVYA 3UVTA 3E3EA 4ZILA 3M0FA 4EDZA 3FRCA 5DCHA 1F3AA 2RLIA 1TK0B 4ZBBA 1ZZYA 1W89A 2GQKA 3CRUA 4NV5A 3D22A 5B8AA 4FO5A 4EDYA 4JBBA 2F9SA 1M2BA 3WT2A 1GULA 1X5DA 2H66A 2MBSA 4I8BA 22GSA 2O89A 2RM5A 3L9VA 2O85A 3MNGA 5C04A 4MPFA 2REMA 1ON4A 5AIVA 2FHEA 2XC2A 1GTIA 4MZCA 2B1LA 3D4MA 5D93A 1PN9A 4KNDA 5DALA 3SBCA 1MD3A 2GT5A 5G1KA 2LJAA 1JLWA 6GSVA 3FZAA 2HT9A 3A2WA 4XCSA 5HFIA 1OKTA 5J3RA 4OFMA 2YOIA 2E2MA 1E6BA 3TKSC 6GSXA 2CZ3A 4OFNA 2B5YA 1FO5A 4BWSA 2GQMA 1GL8A 3KP8A 5B6MA 4IHUA 4NAXA 1TRWA 2WDUA 2OA7A 4HU9A 2RM6A 3C1RA 3MWHA 3CSHA 4BA7A 3DVXA 3QD9A 3TJKA 2X64A 4O92A 4TXVA 4GQCA 4XS1A 5IO0A 3FYGA 4F0CA 2B5EA 2PBJA 1J9BA 1IYHA 2C0FA 1T8EB 6GSYA 2CT6A 2OACA 3EC3A 5ECPB 5F8BA 2LJKA 3ZREA 2JU5A 4WF5A 2N5BA 2IMFA 4Q5FA 3HY2A 3IHQA 3TJBA 1SL2B 4L0WA 4D73A 4GXZA 2HRNA 1G0TA 2WB9A 1AC1A 5GSSA 2H6YA 2H1BA 3C7MA 3ZITA 4TR1A 4EC0A 5D73A 2LTKA 4YAVA 3G7JA 3G7IA 3ME7A 3D21A 1H4OA 4MF6A 1TKDB 2WULA 3HCZA 1USBA 3CRTA 1X0RA 4DVCA 2MYGA 1OVNA 3DVWA 2EIQA 3TDGA 1GUHA 1SK0A 2ON7A 2TRXA 3TCOA 3IOSA 1Z7PA 3FKFA 1EEJA 2QC7A 1WWJA 3DWVA 1SU9A 3ZFBA 1K3LA 1I5GA 1FB0A 4JZQA 1XWKA 5LD0A 1RW1A 4MP4A 2CQ9A 3DEXA 2DJ3A 2VLVA 1PRXA 4OWYA 4AGSA 4ZB6A 1TU8A 1ERUA 2LKUA 4ZBAA 2H70A 4TXOA 4LMWA 4RQXA 4QL9A 4I6XA 5IOXA 4MZWA 1EV9A 5KN0A 2IMEA 1OE7A 2CX3A 2C0EA 4MDCA 3VWXA 4LL1B 3AY8A 3I9V2 1TJDA 4YQMA 3TJGA 1WOUA 4KCAA 4V2MA 4WEYA 3PH9A 3HZ8A 2R6KA 3GKKA 3GUSA 5E4WA 8GSSA 1YF1A 19GSA 4KDYA 2TIRA 2JSZA 4MK3A 4EO3A 2R37A 2IWTA 4MJAA 2MMNA 5G1LA 1GSEA 3FR6A 4MCUA 3APQA 1TK5B 1ST9A 2X8CA 3CXGA 3I6AA 1R5AA 4JEDA 5IQYA 5AIXA 2X8HA 9GSSA 4AJ8A 3TKSA 3VPTA 3GIXA 2EIOA 1OYJA 4IBPA 3Q74A 3NOFA 4TRXA 1SYXA 1SJZA 3UEMA 1V58A 3WGEA 2F3MA 3KTBA 4ECCA 2OKAA 1DUGA 3F3QA 4IKHA 2HLSA 1O85A 3BCKA 3RHCA 4JU5A 2IJYA 3ZMLA 4GWRA 1BG5A 2GQLA 1X5EA 2H8LA 3DRNA 5GAND 2IMIA 1E2YA 1GUKA 2H73A 2MMZA 2ZCTA 4OCFA 3EU4A 2QKEA 3DMLA 2XHFA 3FZ4A 1PX6A 1UN2A 4DSQA 5KN3A 4KSMA 5J5NA 1OC8A 2VLUA 1EV4A 2LRTA 3EMXA 4E8HA 1JZRA 5F07A 3GV1A 2FD3A 1TXXA 3VI7A 3F8UA 2GZZA 3L9SA 2P0GA 1H75A 1TRVA 2F51A 4GRFA 4PUAA 2RUFA 1R26A 1DSBA 4QQ7A 5IIZA 3A5WA 3GX0A 3WT1A 3V1WA 3VPQA 2B5XA 2IMDA 1B4QA 1HNAA 1PKZA 2XPEA 2BTOT 4V2NA 2RIIA 2YJHA 4XS4B 4YH2A 5ID2A 1ERTA 1WJKA 1OC9A 2IFQA 2OJLA 1EZKA 4BWQA 5J9CA 3ZYWA 3WGXA 3F6DA 3LEFA 3IXRA 3BD2A 4XRAA 5INYA 5JWOB 1OAZA 3LG6A 1K0CA 3TKRA 3H1NA 2G0FA 3O6TA 4ML1A 3GKMA 5A4VA 5CAXA 4TKYA 4J2FA 2DJ1A 3EYTA 1PMTA 4H86A 2HI7A 3M9KA 5CRWA 4JR6A 1G6YA 2YCDA 1GP1A 1X5CA 3GTUA 5H5RA 2G2QA 3HD5A 2FCHA 4K8MA 2YANA 5H5QA 3D5JA 3DGQA 2K8VA 2NBSA 4XTSA 5IMFA 3F4RA 1MEKA 3VWWA 4TOPA 3FR3A 1XW6A 3HDCA 4TVEA 3HA9A 3GMFA 3A2VA 5HQPA 3CBUA 4K7OA 1YF0A 4IW9A 1YEXA 5HR2A 1TOFA 1K3OA 4G19A 3HJOA 4NV2A 3IBHA 3ZTLA 3N9JA 4BVXA 2LNTA 4HZ2A 4IS0A 2HZEB 2LSTA 2VL2C 2FWEA 5A5KA 1HNCA 4WF4A 3TUEA 2VD0A 3LYPA 2LV3A 3KZQA 5G2ZA 4GSSA 1GSQA 3KMOA 4F82A 3PR8A 2FWFA 2IPAA 2XBQA 2R4VA 1XIYA 2DC5A 2L5LA 2YZHA 1QXHA 4Q5NA 2MBTA 4L5LA 2YWIA 1GNEA 3DIEA 4Q5RA 2L59A 3HZ4A 3ZRDA 2H01A 1A0FA 2H0IA 5IMCA 2LUSA 3GURA 3BCIA 4TR3A 2A2RA 2ON5A 2LRNA 5EVOA 3TKQA 1M0UA 5DAKA 4GCIA 4K7IA 4O5RA 1FHEA 2L6CA 3F0IA 3H4KA 1M9AA 4K7NA 3KXOA 4WXTA 1GSYA 5AN1A 3QR6A 1GSDA 5G5FA 3LXTA 4WETA 3C71A 4ZIJA 1GSFA 3E0UA 1SK1A 1I9DA 4HDEA 2F8FA 18GSA 2DJ2A 1LU4A 3RDWA 1O73A 3GRXA 7GSSA 5IPGA 2TRCP 3D0ZA 1QFNA 1X9MB 1XVWA 1B4PA 3SWLA 2V32A 4IELA 4OCEA 4HQZA 5G5EA 4WBRD 4OMVA 5EY6A 3O76A 4ZL8A 2C3TA 2O7KA 1VF2A 5AGYA 1V9WA 2KLXA 1NSWA 3VK9A 1YKAA 3U5RE 1JFUA 5CP1A 5CRDA 1SYRA 1PX7A 1DBYA 1JLVA 1SL1B 2DJKA 3FHKA 2VM1A 1X9SB 2VCXA 1KBNA 4N11A 3EU3A 5IMZA 1S3DA 4ID0A 3UJ1A 4ECIA 4V1Ap 3EINA 2HRFA 4TN8A 2AYTA 1GLPA 4EKZA 1O7UA 5ECKB 4IJ3A 2OADA 1HQOA 2VIMA 3HKRA 1PA3A 4FYCA 1FVKA 3TGZA 2FNOA 1R4WA 1K0AA 4X1UA 2B6MA 3F3RA 4F0BA 1XPVA 1HD2A 3HVSA 4MF7A 5JCGA 1PD21 1AAZA 2VL2A 3HJPA 4PQ1A 3KH7A 4KH7A 1WPIA 3VFIA 4OO5A 2VUPA 3GKNA 4HJMA 1XZOA 4GQFA 5E59A 4DSSA 5IOWA 2JZTA 2OE0A 4K2DA 2YZUA 2H74A 3LFLA 3DXBA 3Q19A 1YZXA 4YAPA 3H93A 1WMJA 2I4AA 2H0GA 2C0GA 4KGIA 16GSA 1ERVA 3IAS2 6GSUA 1S3CA 5CYYA 4MLYA 2I81A 1XWAA 2YWNA 3NIVA 3CSIA 1IYIA 3F63A 10GSA 1FAAA 1V57A
chains in the Genus database with same CATH superfamily
2AB6A 3ZLPA 3OR5A 4LA1A 2HFDA 2JZSA 3NZNA 1GLQA 1U3AA 1UC7A 2N5FA 1O8XA 4MZBA 4I5QA 1XXUA 2J23A 3KCMA 3RBTA 4I2UA 5IO2A 3O3TA 1Y6EA 4K0NA 5ELAA 2CX4A 4FIWA 1HYUA 1Q98A 5DALB 4NXIA 4CY8A 1ZYEA 4KDXA 4HJ2A 1TU7A 3BOAA 4HQSA 3E9JB 2LRCA 12GSA 1VF4A 1QQ2A 1LJRA 4USSA 4K9ZA 4CW9A 1RK4A 1ZGNA 2NPBA 4TR0A 2DBCA 3IV4A 2WGRA 2F8AA 3WYWA 4GTUA 3UBLA 4K0GA 4HI7A 1M2AA 4LLRA 2M80A 1C72A 4POBA 1EEMA 4EE0A 1X9WB 2OBKA 6GSSA 3L78A 4TW5A 4Z2UA 2IMKA 2R0CA 5D9XA 5FHIA 1AQWA 2DJ0A 3GN3A 3LGCA 2LQOA 4ULXA 1SJIA 2V6OA 2PGTA 2JZRA 1TP9A 1Y25A 1SD8A 2C3NA 1A8YA 1YEPA 2GZYA 1PQNA 3GH9A 4NPBA 4D73B 5GAPD 3KMNA 3H8QA 4XS6A 1O8WA 2PWJA 1OKDA 2A4VA 2P5RA 2AAWA 3N5OA 3FZ9A 3CMIA 4E8EA 3G9BA 3ED3A 1ZCPA 4JRRA 3TRPA 3Q18A 4BPYA 3VURA 4TR1B 1AUCA 4NMUA 1XWBA 1S3AA 2C4JA 1TRSA 3TJJA 5FWGA 3P90A 4Z7XA 3KH9A 2KOKA 3M3MA 5CO3A 1GWCA 4PXOA 3A2XA 5D96A 2DLXA 1YDKA 2H1GA 3MYDA 3W6GA 3L4NA 4DSRA 1T3BA 4EUYA 5L71A 5DCGA 1F9MA 4GF0A 2AV4A 4A5PA 1VF3A 1XW5A 4NHWA 3TRXA 3P2AA 5ECMB 4NHZA 2HYXA 1GH2A 3GA4A 1F6MC 3F4SA 3IPZA 1SK2A 5DJLA 1PGTA 3W8SA 1FB6A 3C73A 5IM9A 3GSSA 4TXOB 4HZ4A 3VI5A 1NHYA 5ECNB 3J7Yk 1KTEA 4KW6A 4MABA 4KUNA 2HZFA 4XHMA 2KUCA 1BQ7A 2HSYA 4V1Ag 3US3A 2FUG2 3IRAA 1T4ZA 3FW2A 2ALBA 2QSIA 2H72A 2E2GA 2GSSA 2QGVA 1PL1A 1M9BA 2GVPA 2WS2A 5DQSA 5LNKe 4IQAA 4MNNA 5D9VA 2MMAA 2VL9A 1LBKA 2H19A 3KP9A 2CA8A 3EMPA 3RAZA 4MF5A 1MDIA 1DE2A 2Z9SA 3IR4A 3LSZA 2KP2A 4HUAA 1UVZA 1PL2A 3BJ5A 3APSA 4N0ZA 1N2AA 3TB2A 1QUWA 1DE1A 4WBJA 4WKWA 5ECOB 4KA0A 2GSQA 4ZB8A 1MD4A 1J0FA 5KEJA 4G2EA 2UZ8A 3FY7A 5HR0A 2B7KA 2DSAA 1T00A 1PSQA 1AIUA 17GSA 3CYNA 1QGVA 3RPPA 3IDVA 3UBKA 4I97A 1CQGA 3KEBA 3L0HA 4ZBDA 2ZNMA 3TOTA 1O81A 3M9JA 1GTBA 1FVJA 1B9XC 3ISOA 4X43A 1BX9A 3RHBA 2ES7A 1FOHA 3HHVA 5KN2A 3EVIA 5G31A 3GL3A 1WP0A 1JHBA 4ZL9A 1JZOA 1EGOA 3UIWA 3A3TA 4ICYA 1XOBA 4I2TA 2D2ZA 4ZL7A 3TJFA 3WGDA 2AHEA 2LS5A 1K0MA 4N30A 4J57E 1G6WA 5B6NA 2JSYA 4ECJA 2I1UA 1V40A 3EE2A 3HXSA 2YNXA 2EC4A 3GSTA 4X0XA 5J4UA 2RUEA 1ZL9A 4J56E 3DD3A 5IMDA 2V6KA 4IP6A 4MH2A 1NM3A 1TI1A 4RQRA 4YQVA 4YQUA 2VAFA 3LWAA 2ZUPA 1URMA 2XPDA 1MDJA 2WZ9A 5C00A 1GTUA 1GSUA 2H75A 1GTAA 4IJIA 2MMOA 4P3YB 3KD0A 5FT3A 2BMXA 1YY7A 1A2MA 4MJBA 2FY6A 4ECBA 1O6JA 2KP1A 3A5IA 5HFKA 2GTUA 3UAPA 3C8EA 3QDNA 5LCZA 3UOMA 3FEUA 3VWVA 1JZDA 5ID2B 2IN3A 1OC9B 1EOHA 2IFQB 3GNJA 3GFKA 1FOVA 4LMVA 5JWQB 3GL5A 2E0QA 1TK8B 2YJ7A 4FYUA 1BJXA 4HSCX 2LQQA 4F9ZA 1TDIA 4PQIA 2DIYA 2A2SA 5ECLB 1Z6NA 5F05A 2FWGA 4PQHA 1MTCA 1WE0A 2IIYA 3APOA 5DQYA 3S9FA 1TW9A 3DKSA 1GUMA 1R7HA 3ZZXA 4FH8A 2VCWA 1OE8A 3GTUB 1U3IA 3ZIVA 1Z7RA 1RQMA 1ABAA 1GNWA 4FQUA 1SL0B 1SKRB 3IAM2 2O87A 1BYEA 1BAYA 4L0UA 2C3QA 1XWGA 3GHAA 2DJJA 3F6FA 4GSNA 1FW1A 1AW9A 3QFBC 2YWMA 5ECSA 4GSTA 2C1YA 1XW9A 1B9YC 5JWRB 3HVVA 2NVLA 1WRYA 4O7HA 3JCML 5GZZB 4BVXB 3ZL5A 3F4TA 1ERWA 5IMVA 4G9HA 2DMLA 3FR9A 2HRAA 3DYRA 1ZYPA 1THXA 4LL4B 4RI7A 2J9HA 3IK7A 4POMA 4F03A 4K5RA 3I69A 3VWUA 2M72A 2OBIA 1A2LA 3CTFA 2JADA 4CHSA 2OE3A 3UL3A 5ELGA 3TKPA 4DEJA 2IL3A 3TOUA 3R3EA 3QOUA 5EPFA 6GSTA 3GYKA 4N10A 4POKA 2L4QA 4AJ6A 3J7Yb 2N5AA 2L4CA 2V1MA 3M1GA 3F9UA 1ILOA 2B7JA 1B48A 1THOA 3MDKA 3UMAA 2HSMA 1B8XA 4HOJA 2A2PA 2VCVA 5DAKB 5A4WA 1M7TA 4MJEA 2H6XA 1ZOFA 1TI3A 4FYBA 1YQ1A 3QFAC 4F2IA 1Q4JA 1R5PA 13GSA 3PPUA 2WFCA 1GSSA 3EURA 2CVKA 4Q5QA 1EP7A 1YKCA 3KIJA 4G0KA 2K18A 2VCZA 3WD6A 5ECIB 5F06A 5ENUA 4KF9A 2FA8A 2R2JA 2YWOA 5DJMA 2CVBA 3EWLA 3KM6A 2CV4A 3KGKA 4XS4A 1A8LA 3FK8A 3LQ7A 5CNWA 2V2GA 4IP1A 1HNBA 1NW2A 4PNFA 5AISA 1PKWA 1XWCA 2PVOC 5JCWA 4G10A 1OC3A 20GSA 4N0VA 2X8GA 2GDRA 2K9FA 3UARA 5A4UA 1V2AA 2HSHA 4PTSA 2FGXA 3HVXA 3P7XA 3PINA 1YJ6A 1VRSD 2EIRA 2VO4A 1T7PB 2X4AA 1K0DA 3ME8A 4EL1A 2WJUA 4PX1A 2CVDA 3GKXA 2CZ2A 2GSTA 4BIKA 1Z3EA 3H79A 3LJRA 2VM2A 4KAEA 3CSJA 3GH6A 5HFGA 3TRQA 1K0OA 2BJXA 4RI6A 3VLNA 2B1KA 2C0DA 4ACSA 1XFLA 4KE3A 4PURA 4GLTA 5B8BA 4IVFA 5KN1A 1A23A 2YV9A 3CTGA 3GX8A 4AF2A 1VGLA 1EP8A 4EVMA 1AQVA 2I9HA 2K8SA 4RUVA 5CRGA 2JACA 5D9WA 1FG4A 3PGTA 2HE3A 5D9TA 5DBQA 3ZIJA 1AXDA 1EGRA 5COHA 2DMMA 3M8NA 2PUKC 1TRUA 2PN8A 4PUFC 5ECHB 3UVHA 1F37A 2L5OA 1U6TA 1TTZA 1XCCA 2PERA 4MH3A 2HZEA 3K8NA 3RPNA 5IPHA 2R3XA 2C80A 2AUVA 2FWHA 2LNSA 4EF0A 2H30A 2L57A 4ZXGA 1U87A 3D6IA 2I3YA 4DSSB 5ECQB 2DIZA 2WRTA 3QPMA 14GSA 3ZMKA 4HEA2 3LYKA 5ECRB 4PGTA 4CY6A 2NDOA 1NHOA 4HS1A 1XVQA 4KSOA 4BL7A 2GSRA 2PU9C 4MPGA 5J41A 2PPTA 3C1SA 6GSWA 2C8UA 1V98A 1UA5A 2HNLA 2HXKA 4K6XA 1CQHA 5H5SA 1QK8A 2H0HA 2H1DA 2YPMA 2H71A 1SKWB 2O8VB 4ZB9A 1F3BA 2VOCA 4QL7A 2AJQB 3KTLA 3IC4A 4KCEA 5CRHA 1BEDA 1T4YA 2XBIA 4POLA 2LEGA 3TKSE 2VD1A 2LJRA 3QCPA 4KB3A 1WIKA 1Z9HA 4K1FA 2VCQA 2R5GA 1ML6A 4O5UA 4PNGA 2OE1A 3LXZA 2KHPA 3G7YA 3LORA 1J08A 3QAGA 5ABRA 2GZPA 3MAKA 5B7CA 1JZWA 4L5OA 4K5SA 5IMAA 2E7PA 11GSA 4MMMA 5D8IA 3Q6OA 4JR4A 1KNGA 3QAVA 3P8WA 2VCTA 5G30A 1F2EA 1SJ6A 4JE1A 1A0RP 4IGJA 3HYPA 4AJ7A 5HR1A 1A24A 5JCUA 2GLRA 5CREA 4IN0A 3R2QA 1ACVA 2V41A 4OFTA 3CQFA 2GGTA 3IE3A 1GRXA 1XG8A 1KEBA 4ISDA 3ERFA 4NWYA 3IK9A 2X99A 5EL8A 2WCIA 3L9UA 4KX4A 1Z5YE 3MSZA 1U88A 4V2LA 3ZVJA 2QA1A 4EXJA 2YP6A 2R0PA 5GSTA 3ZFLA 2VL3A 2YV7A 3FZ5A 1EOGA 1T1VA 4WR5A 5HR3A 2GT6A 1ZYQB 2FLSA 1MDKA 2B3SA 4O32A 1EWXA 1K0NA 4ILFA 1AQXA 1Z6MA 5J9BA 4ML6A 1XOAA 2P5QA 4L8EA 3ERGA 4XIHA 3U6VA 2L6DA 2JL4A 1M2DA 2H76A 2H6ZA 4HU7A 5F0GA 3QAWA 2CAQA 2K6VA 2GS3A 4KDUA 1M99A 2M46A 3KJYA 4MA9A 1SD9A 1PFOA 2FA4A 1VF1A 4TR4A 1A2JA 3I43A 1K3YA 2NTOA 1SKSB 5DDLA 4CDOA 4OD7A 3W8JA 1W4VA 2PVQA 2PMTA 3ERWA 3D4TA 4WR4A 3HJMA 2CAIA 1ZMAA 1G7EA 1XBSA 5DVBA 1SENA 3QMXA 2P31A 2YN1A 1G7OA 2MZCA 3IA1A 1K0BA 3BBYA 4XRDA 1QMVA 1N8JA 2VLTA 4YKFA 4MJCA 4OO4A 2H1AA 3ZVJD 4IQ1A 4BVYA 3UVTA 3E3EA 4ZILA 3M0FA 4EDZA 3FRCA 5DCHA 1F3AA 2RLIA 1TK0B 4ZBBA 1ZZYA 1W89A 2GQKA 3CRUA 4NV5A 3D22A 5B8AA 4FO5A 4EDYA 4JBBA 2F9SA 1M2BA 3WT2A 1GULA 1X5DA 2H66A 2MBSA 4I8BA 22GSA 2O89A 2RM5A 3L9VA 2O85A 3MNGA 5C04A 4MPFA 2REMA 1ON4A 5AIVA 2FHEA 2XC2A 1GTIA 4MZCA 2B1LA 3D4MA 4YKGA 5D93A 1PN9A 4KNDA 5DALA 3SBCA 1MD3A 2GT5A 5G1KA 2LJAA 1JLWA 6GSVA 3FZAA 2HT9A 3A2WA 4XCSA 5HFIA 1OKTA 5J3RA 4OFMA 2YOIA 2E2MA 1E6BA 3TKSC 6GSXA 2CZ3A 4OFNA 2B5YA 1FO5A 4BWSA 2GQMA 1GL8A 3KP8A 5KOXA 5B6MA 4IHUA 4NAXA 1TRWA 2WDUA 2OA7A 4HU9A 2RM6A 3C1RA 3MWHA 3CSHA 4BA7A 3DVXA 3QD9A 3TJKA 2X64A 4O92A 4TXVA 4GQCA 4XS1A 5IO0A 3FYGA 4F0CA 2B5EA 2PBJA 1J9BA 1IYHA 2C0FA 1T8EB 6GSYA 2CT6A 2OACA 3EC3A 5ECPB 5F8BA 2LJKA 3ZREA 2JU5A 4WF5A 2N5BA 2IMFA 4Q5FA 4EIPA 3HY2A 3IHQA 3TJBA 1SL2B 4L0WA 4D73A 4GXZA 2HRNA 1G0TA 2A4HA 2WB9A 1AC1A 5GSSA 4O5QA 2H6YA 2H1BA 3C7MA 3ZITA 4TR1A 4EC0A 5D73A 2LTKA 4YAVA 3G7JA 3G7IA 3ME7A 3D21A 1H4OA 4MF6A 1TKDB 2WULA 4Z2TA 3HCZA 1PN0A 2QA2A 1USBA 3CRTA 1X0RA 4DVCA 2MYGA 1OVNA 3DVWA 2EIQA 3TDGA 1GUHA 1SK0A 2ON7A 2TRXA 3TCOA 3IOSA 1Z7PA 3FKFA 1EEJA 2QC7A 1WWJA 3DWVA 1SU9A 3ZFBA 1K3LA 1I5GA 1FB0A 4JZQA 1XWKA 5LD0A 1RW1A 4MP4A 2CQ9A 3DEXA 2DJ3A 2VLVA 1PRXA 4OWYA 4AGSA 4ZB6A 1TU8A 1ERUA 2LKUA 4ZBAA 2H70A 4TXOA 4LMWA 4RQXA 4QL9A 4I6XA 5IOXA 4MZWA 1EV9A 5KN0A 2IMEA 1OE7A 2CX3A 4X4JA 2C0EA 4MDCA 3VWXA 4LL1B 3AY8A 3I9V2 1TJDA 4YQMA 3TJGA 1WOUA 4KCAA 4V2MA 4WEYA 3PH9A 3HZ8A 2R6KA 3GKKA 3GUSA 5E4WA 8GSSA 1YF1A 19GSA 4KDYA 2TIRA 2JSZA 4MK3A 4EO3A 2R37A 2IWTA 4MJAA 2MMNA 5G1LA 1GSEA 3FR6A 4MCUA 3APQA 1TK5B 5BMUA 3IHGA 1ST9A 2X8CA 3CXGA 3I6AA 1R5AA 4JEDA 5IQYA 5AIXA 1M3JA 2X8HA 9GSSA 4AJ8A 3TKSA 3VPTA 3GIXA 2EIOA 1OYJA 4IBPA 3Q74A 3NOFA 4TRXA 1SYXA 1SJZA 3UEMA 1V58A 4Z2RA 3WGEA 2F3MA 3KTBA 4ECCA 2OKAA 1DUGA 3F3QA 4IKHA 2HLSA 1O85A 3BCKA 3RHCA 4JU5A 2IJYA 3MIXA 3ZMLA 4GWRA 1BG5A 2GQLA 1X5EA 2H8LA 3DRNA 5GAND 2IMIA 1E2YA 1GUKA 2H73A 2MMZA 2ZCTA 4OCFA 3EU4A 2QKEA 3DMLA 2XHFA 3FZ4A 1PX6A 1UN2A 4DSQA 5KN3A 4KSMA 1S3RA 5J5NA 1OC8A 2VLUA 3HVNA 1EV4A 2LRTA 3EMXA 4E8HA 1JZRA 5KOWA 5F07A 3GV1A 2FD3A 1TXXA 3VI7A 3F8UA 2GZZA 3L9SA 2P0GA 1H75A 5BRTA 1TRVA 2F51A 3FMWA 4GRFA 4PUAA 2RUFA 1R26A 1DSBA 3IC8A 4QQ7A 5IIZA 3A5WA 3GX0A 3WT1A 3V1WA 3VPQA 2B5XA 2IMDA 1B4QA 1HNAA 1PKZA 2XPEA 2BTOT 4V2NA 2RIIA 2YJHA 4XS4B 4YH2A 5ID2A 1ERTA 1WJKA 4EIQA 1OC9A 2IFQA 2OJLA 1EZKA 4BWQA 5J9CA 3ZYWA 3WGXA 3F6DA 3LEFA 2HRKA 3IXRA 3BD2A 4XRAA 2DKIA 5INYA 5JWOB 1OAZA 3LG6A 1K0CA 3TKRA 3H1NA 2G0FA 3O6TA 4ML1A 3GKMA 5A4VA 5CAXA 4TKYA 4J2FA 2DJ1A 3EYTA 1PMTA 4H86A 2HI7A 3M9KA 5CRWA 4JR6A 1G6YA 2YCDA 1GP1A 1X5CA 3GTUA 5H5RA 2G2QA 3HD5A 2FCHA 4K8MA 2YANA 5H5QA 3D5JA 3DGQA 2K8VA 2NBSA 4XTSA 5IMFA 3F4RA 1MEKA 3VWWA 4TOPA 3FR3A 4G0IA 1XW6A 3HDCA 4TVEA 3HA9A 3GMFA 3A2VA 5HQPA 3CBUA 4K7OA 1YF0A 4IW9A 1YEXA 5HR2A 1TOFA 1K3OA 4G19A 3HJOA 4NV2A 3IBHA 3ZTLA 3N9JA 4BVXA 2LNTA 4HZ2A 4IS0A 2HZEB 2LSTA 2VL2C 2FWEA 5A5KA 1HNCA 4WF4A 3TUEA 2VD0A 3LYPA 2LV3A 3KZQA 5G2ZA 4GSSA 1GSQA 3KMOA 4F82A 3PR8A 2FWFA 2IPAA 2XBQA 2R4VA 1XIYA 2DC5A 2L5LA 2YZHA 1QXHA 4Q5NA 2MBTA 4L5LA 2YWIA 1GNEA 3DIEA 4Q5RA 4BL7B 2L59A 3HZ4A 3LW9A 3ZRDA 2H01A 1A0FA 2H0IA 5IMCA 2LUSA 3GURA 4G0LA 3BCIA 4TR3A 2A2RA 2ON5A 2LRNA 5EVOA 3TKQA 1M0UA 5DAKA 4GCIA 4K7IA 4O5RA 1FHEA 2L6CA 3F0IA 3H4KA 1M9AA 4K7NA 3KXOA 4WXTA 1GSYA 5AN1A 3QR6A 1GSDA 5G5FA 3LXTA 4WETA 3C71A 2X49A 4ZIJA 2R0GA 1GSFA 3E0UA 1SK1A 1I9DA 4HDEA 2F8FA 18GSA 2DJ2A 1LU4A 3RDWA 3EPTA 1O73A 3GRXA 7GSSA 5IPGA 2TRCP 3D0ZA 1QFNA 1X9MB 1XVWA 1B4PA 3SWLA 2V32A 4IELA 4OCEA 4HQZA 5G5EA 4WBRD 4OMVA 5EY6A 3O76A 1ZYNA 4ZL8A 2C3TA 2O7KA 1VF2A 5AGYA 1V9WA 2KLXA 1NSWA 3VK9A 1YKAA 3U5RE 1JFUA 5CP1A 5CRDA 1SYRA 1PX7A 1DBYA 1JLVA 1SL1B 2DJKA 3FHKA 2VM1A 1X9SB 2VCXA 1KBNA 4N11A 3EU3A 5IMZA 1S3DA 4ID0A 3UJ1A 4ECIA 4V1Ap 3EINA 2HRFA 4TN8A 2AYTA 1GLPA 4EKZA 1O7UA 4K2XA 5ECKB 4IJ3A 2OADA 1HQOA 2VIMA 3HKRA 1PA3A 4FYCA 1FVKA 1M3IA 3TGZA 2FNOA 1R4WA 1K0AA 4X1UA 2B6MA 3F3RA 4F0BA 1XPVA 1HD2A 3HVSA 4MF7A 5JCGA 1PD21 1AAZA 2VL2A 3HJPA 4PQ1A 3KH7A 4KH7A 1WPIA 3VFIA 4OO5A 2VUPA 3GKNA 4HJMA 1XZOA 4GQFA 5E59A 4DSSA 5IOWA 2JZTA 2OE0A 4K2DA 2YZUA 2H74A 3LFLA 3DXBA 3Q19A 1YZXA 4YAPA 3H93A 1WMJA 2I4AA 2H0GA 2C0GA 4KGIA 4BVYB 16GSA 1ERVA 2DKHA 3IAS2 6GSUA 1S3CA 5CYYA 4MLYA 2I81A 1XWAA 2YWNA 3NIVA 3CSIA 1IYIA 3F63A 10GSA 1FAAA 1V57A
chains in the Genus database with same CATH topology
2AB6A 3ZLPA 3OR5A 4LA1A 2HFDA 2JZSA 3NZNA 1GLQA 1U3AA 1UC7A 2N5FA 1O8XA 4MZBA 4I5QA 1XXUA 2J23A 3KCMA 3RBTA 4I2UA 5IO2A 3O3TA 1Y6EA 4K0NA 5ELAA 2CX4A 4FIWA 1HYUA 1Q98A 5DALB 4NXIA 4CY8A 1ZYEA 4KDXA 4HJ2A 1TU7A 3BOAA 4HQSA 3E9JB 2LRCA 12GSA 1VF4A 1QQ2A 1LJRA 4USSA 4K9ZA 4CW9A 1RK4A 1ZGNA 2NPBA 4TR0A 2DBCA 3IV4A 2WGRA 2F8AA 3WYWA 4GTUA 3UBLA 4K0GA 4HI7A 1M2AA 4LLRA 2M80A 1C72A 4POBA 1EEMA 4EE0A 1X9WB 2OBKA 6GSSA 3L78A 4TW5A 4Z2UA 2IMKA 2R0CA 5D9XA 5FHIA 1AQWA 2DJ0A 3GN3A 3LGCA 2LQOA 4ULXA 1SJIA 2V6OA 2PGTA 2JZRA 1TP9A 1Y25A 1SD8A 2C3NA 1A8YA 1YEPA 2GZYA 1PQNA 3GH9A 4NPBA 4D73B 5GAPD 3KMNA 3H8QA 4XS6A 1O8WA 2PWJA 1OKDA 2A4VA 2P5RA 2AAWA 3N5OA 3FZ9A 3CMIA 4E8EA 3G9BA 3ED3A 1ZCPA 4JRRA 3TRPA 3Q18A 4BPYA 3VURA 4TR1B 1AUCA 4NMUA 1XWBA 1S3AA 2C4JA 1TRSA 3TJJA 5FWGA 3P90A 4Z7XA 3KH9A 2KOKA 3M3MA 5CO3A 1GWCA 4PXOA 3A2XA 5D96A 2DLXA 1YDKA 2H1GA 3MYDA 3W6GA 3L4NA 4DSRA 1T3BA 4EUYA 5L71A 5DCGA 1F9MA 4GF0A 2AV4A 4A5PA 1VF3A 1XW5A 4NHWA 3TRXA 3P2AA 5ECMB 4NHZA 2HYXA 1GH2A 3GA4A 1F6MC 3F4SA 3IPZA 1SK2A 5DJLA 1PGTA 3W8SA 1FB6A 3C73A 5IM9A 3GSSA 4TXOB 4HZ4A 3VI5A 1NHYA 5ECNB 3J7Yk 1KTEA 4KW6A 4MABA 4KUNA 2HZFA 4XHMA 2KUCA 1BQ7A 2HSYA 4V1Ag 3US3A 2FUG2 3IRAA 1T4ZA 3FW2A 2ALBA 2QSIA 2H72A 2E2GA 2GSSA 2QGVA 1PL1A 1M9BA 2GVPA 2WS2A 5DQSA 5LNKe 4IQAA 4MNNA 5D9VA 2MMAA 2VL9A 1LBKA 2H19A 3KP9A 2CA8A 3EMPA 3RAZA 4MF5A 1MDIA 1DE2A 2Z9SA 3IR4A 3LSZA 2KP2A 4HUAA 1UVZA 1PL2A 3BJ5A 3APSA 4N0ZA 1N2AA 3TB2A 1QUWA 1DE1A 4WBJA 4WKWA 5ECOB 4KA0A 2GSQA 4ZB8A 1MD4A 1J0FA 5KEJA 4G2EA 2UZ8A 3FY7A 5HR0A 2B7KA 2DSAA 1T00A 1PSQA 1AIUA 17GSA 3CYNA 1QGVA 3RPPA 3IDVA 3UBKA 4I97A 1CQGA 3KEBA 3L0HA 4ZBDA 2ZNMA 3TOTA 1O81A 3M9JA 1GTBA 1FVJA 1B9XC 3ISOA 4X43A 1BX9A 3RHBA 2ES7A 1FOHA 3HHVA 5KN2A 3EVIA 5G31A 3GL3A 1WP0A 1JHBA 4ZL9A 1JZOA 1EGOA 3UIWA 3A3TA 4ICYA 1XOBA 4I2TA 2D2ZA 4ZL7A 3TJFA 3WGDA 2AHEA 2LS5A 1K0MA 4N30A 4J57E 1G6WA 5B6NA 2JSYA 4ECJA 2I1UA 1V40A 3EE2A 3HXSA 2YNXA 2EC4A 3GSTA 4X0XA 5J4UA 2RUEA 1ZL9A 4J56E 3DD3A 5IMDA 2V6KA 4IP6A 4MH2A 1NM3A 1TI1A 4RQRA 4YQVA 4YQUA 2VAFA 3LWAA 2ZUPA 1URMA 2XPDA 1MDJA 2WZ9A 5C00A 1GTUA 1GSUA 2H75A 1GTAA 4IJIA 2MMOA 4P3YB 3KD0A 5FT3A 2BMXA 1YY7A 1A2MA 4MJBA 2FY6A 4ECBA 1O6JA 2KP1A 3A5IA 5HFKA 2GTUA 3UAPA 3C8EA 3QDNA 5LCZA 3UOMA 3FEUA 3VWVA 1JZDA 5ID2B 2IN3A 1OC9B 1EOHA 2IFQB 3GNJA 3GFKA 1FOVA 4LMVA 5JWQB 3GL5A 2E0QA 1TK8B 2YJ7A 4FYUA 1BJXA 2LQQA 4F9ZA 1TDIA 4PQIA 2DIYA 2A2SA 5ECLB 1Z6NA 5F05A 2FWGA 4PQHA 1MTCA 1WE0A 2IIYA 3APOA 5DQYA 3S9FA 1TW9A 3DKSA 1GUMA 1R7HA 3ZZXA 4FH8A 2VCWA 1OE8A 3GTUB 1U3IA 3ZIVA 1Z7RA 1RQMA 1ABAA 1GNWA 4FQUA 1SL0B 1SKRB 3IAM2 2O87A 1BYEA 1BAYA 4L0UA 2C3QA 1XWGA 3GHAA 2DJJA 3F6FA 4GSNA 1FW1A 1AW9A 3QFBC 2YWMA 5ECSA 4GSTA 2C1YA 1XW9A 1B9YC 5JWRB 3HVVA 2NVLA 1WRYA 4O7HA 3JCML 5GZZB 4BVXB 3ZL5A 3F4TA 1ERWA 5IMVA 4G9HA 2DMLA 3FR9A 2HRAA 3DYRA 1ZYPA 1THXA 4LL4B 4RI7A 2J9HA 3IK7A 4POMA 4F03A 4K5RA 3I69A 3VWUA 2M72A 2OBIA 1A2LA 3CTFA 2JADA 4CHSA 2OE3A 3UL3A 5ELGA 3TKPA 4DEJA 2IL3A 3TOUA 3R3EA 3QOUA 5EPFA 6GSTA 3GYKA 4N10A 4POKA 2L4QA 4AJ6A 3J7Yb 2N5AA 2L4CA 2V1MA 3M1GA 3F9UA 1ILOA 2B7JA 1B48A 1THOA 3MDKA 3UMAA 2HSMA 1B8XA 4HOJA 2A2PA 2VCVA 5DAKB 5A4WA 1M7TA 4MJEA 2H6XA 1ZOFA 1TI3A 4FYBA 1YQ1A 3QFAC 4F2IA 1Q4JA 1R5PA 13GSA 3PPUA 2WFCA 1GSSA 3EURA 2CVKA 4Q5QA 1EP7A 1YKCA 3KIJA 4G0KA 2K18A 2VCZA 3WD6A 5ECIB 5F06A 5ENUA 4KF9A 2FA8A 2R2JA 2YWOA 5DJMA 2CVBA 3EWLA 3KM6A 2CV4A 3KGKA 4XS4A 1A8LA 3FK8A 3LQ7A 5CNWA 2V2GA 4IP1A 1HNBA 1NW2A 4PNFA 5AISA 1PKWA 1XWCA 2PVOC 5JCWA 4G10A 1OC3A 20GSA 4N0VA 2X8GA 2GDRA 2K9FA 3UARA 5A4UA 1V2AA 2HSHA 4PTSA 2FGXA 3HVXA 3P7XA 3PINA 1YJ6A 1VRSD 2EIRA 2VO4A 1T7PB 2X4AA 1K0DA 3ME8A 4EL1A 2WJUA 4PX1A 2CVDA 3GKXA 2CZ2A 2GSTA 1Z3EA 3H79A 3LJRA 2VM2A 4KAEA 3CSJA 3GH6A 5HFGA 3TRQA 1K0OA 2BJXA 4RI6A 3VLNA 2B1KA 2C0DA 4ACSA 1XFLA 4KE3A 4PURA 4GLTA 5B8BA 4IVFA 5KN1A 1A23A 2YV9A 3CTGA 3GX8A 4AF2A 1VGLA 1EP8A 4EVMA 1AQVA 2I9HA 2K8SA 4RUVA 5CRGA 2JACA 5D9WA 1FG4A 3PGTA 2HE3A 5D9TA 5DBQA 3ZIJA 1AXDA 1EGRA 5COHA 2DMMA 3M8NA 2PUKC 1TRUA 2PN8A 4PUFC 5ECHB 3UVHA 1F37A 2L5OA 1U6TA 1TTZA 1XCCA 2PERA 4MH3A 2HZEA 3K8NA 3RPNA 5IPHA 2R3XA 2C80A 2AUVA 2FWHA 2LNSA 4EF0A 2H30A 2L57A 4ZXGA 1U87A 3D6IA 2I3YA 4DSSB 5ECQB 2DIZA 2WRTA 3QPMA 14GSA 3ZMKA 4HEA2 3LYKA 5ECRB 4PGTA 4CY6A 2NDOA 1NHOA 4HS1A 1XVQA 4KSOA 4BL7A 2GSRA 2PU9C 4MPGA 5J41A 2PPTA 3C1SA 6GSWA 2C8UA 1V98A 1UA5A 2HNLA 2HXKA 4K6XA 1CQHA 5H5SA 1QK8A 2H0HA 2H1DA 2YPMA 2H71A 1SKWB 2O8VB 4ZB9A 1F3BA 2VOCA 4QL7A 2AJQB 3KTLA 3IC4A 4KCEA 5CRHA 1BEDA 1T4YA 2XBIA 4POLA 2LEGA 3TKSE 2VD1A 2LJRA 3QCPA 4KB3A 1WIKA 1Z9HA 4K1FA 2VCQA 2R5GA 1ML6A 4O5UA 4PNGA 2OE1A 3LXZA 2KHPA 3G7YA 3LORA 1J08A 3QAGA 5ABRA 2GZPA 3MAKA 5B7CA 1JZWA 4L5OA 4K5SA 5IMAA 2E7PA 11GSA 4MMMA 5D8IA 3Q6OA 4JR4A 1KNGA 3QAVA 3P8WA 2VCTA 5G30A 1F2EA 1SJ6A 4JE1A 1A0RP 4IGJA 3HYPA 4AJ7A 5HR1A 1A24A 5JCUA 2GLRA 5CREA 4IN0A 3R2QA 1ACVA 2V41A 4OFTA 3IE3A 2GGTA 1GRXA 1KEBA 4ISDA 3ERFA 4NWYA 3IK9A 2X99A 5EL8A 2WCIA 3L9UA 4KX4A 1Z5YE 3MSZA 1U88A 4V2LA 3ZVJA 2QA1A 4EXJA 2YP6A 2R0PA 5GSTA 3ZFLA 2VL3A 2YV7A 3FZ5A 1EOGA 1T1VA 4WR5A 5HR3A 2GT6A 1ZYQB 2FLSA 1MDKA 2B3SA 4O32A 1EWXA 1K0NA 4ILFA 1AQXA 1Z6MA 5J9BA 4ML6A 1XOAA 2P5QA 4L8EA 3ERGA 4XIHA 3U6VA 2L6DA 2JL4A 1M2DA 2H76A 2H6ZA 4HU7A 5F0GA 3QAWA 2CAQA 2K6VA 2GS3A 4KDUA 1M99A 2M46A 3KJYA 4MA9A 1SD9A 2FA4A 1VF1A 4TR4A 1A2JA 3I43A 1K3YA 2NTOA 1SKSB 5DDLA 4CDOA 4OD7A 3W8JA 1W4VA 2PVQA 2PMTA 3ERWA 3D4TA 4WR4A 3HJMA 2CAIA 1ZMAA 1G7EA 1XBSA 5DVBA 1SENA 3QMXA 2P31A 2YN1A 1G7OA 2MZCA 3IA1A 1K0BA 3BBYA 4XRDA 1QMVA 1N8JA 2VLTA 4YKFA 4MJCA 4OO4A 2H1AA 3ZVJD 4IQ1A 4BVYA 3UVTA 3E3EA 4ZILA 3M0FA 4EDZA 3FRCA 5DCHA 1F3AA 2RLIA 1TK0B 4ZBBA 1ZZYA 1W89A 2GQKA 3CRUA 4NV5A 3D22A 5B8AA 4FO5A 4EDYA 4JBBA 2F9SA 1M2BA 3WT2A 1GULA 1X5DA 2H66A 2MBSA 4I8BA 22GSA 2O89A 2RM5A 3L9VA 2O85A 3MNGA 5C04A 4MPFA 2REMA 1ON4A 5AIVA 2FHEA 2XC2A 1GTIA 4MZCA 2B1LA 3D4MA 4YKGA 5D93A 1PN9A 4KNDA 5DALA 3SBCA 1MD3A 2GT5A 5G1KA 2LJAA 1JLWA 6GSVA 3FZAA 2HT9A 3A2WA 4XCSA 5HFIA 1OKTA 5J3RA 4OFMA 2YOIA 2E2MA 1E6BA 3TKSC 6GSXA 2CZ3A 4OFNA 2B5YA 1FO5A 4BWSA 2GQMA 1GL8A 3KP8A 5KOXA 5B6MA 4IHUA 4NAXA 1TRWA 2WDUA 2OA7A 4HU9A 2RM6A 3C1RA 3MWHA 3CSHA 4BA7A 3DVXA 3QD9A 3TJKA 2X64A 4O92A 4TXVA 4GQCA 4XS1A 5IO0A 3FYGA 4F0CA 2B5EA 2PBJA 1J9BA 1IYHA 2C0FA 1T8EB 6GSYA 2CT6A 2OACA 3EC3A 5ECPB 5F8BA 2LJKA 3ZREA 2JU5A 4WF5A 2N5BA 2IMFA 4Q5FA 4EIPA 3HY2A 3IHQA 3TJBA 1SL2B 4L0WA 4D73A 4GXZA 2HRNA 1G0TA 2A4HA 2WB9A 1AC1A 5GSSA 4O5QA 2H6YA 2H1BA 3C7MA 3ZITA 4TR1A 4EC0A 5D73A 2LTKA 4YAVA 3G7JA 3G7IA 3ME7A 3D21A 1H4OA 4MF6A 1TKDB 2WULA 4Z2TA 3HCZA 1PN0A 2QA2A 1USBA 3CRTA 1X0RA 4DVCA 2MYGA 1OVNA 3DVWA 2EIQA 3TDGA 1GUHA 1SK0A 2ON7A 2TRXA 3TCOA 3IOSA 1Z7PA 3FKFA 1EEJA 2QC7A 1WWJA 3DWVA 1SU9A 3ZFBA 1K3LA 1I5GA 1FB0A 4JZQA 1XWKA 5LD0A 1RW1A 4MP4A 2CQ9A 3DEXA 2DJ3A 2VLVA 1PRXA 4OWYA 4AGSA 4ZB6A 1TU8A 1ERUA 2LKUA 4ZBAA 2H70A 4TXOA 4LMWA 4RQXA 4QL9A 4I6XA 5IOXA 4MZWA 1EV9A 5KN0A 2IMEA 1OE7A 2CX3A 4X4JA 2C0EA 4MDCA 3VWXA 4LL1B 3AY8A 3I9V2 1TJDA 4YQMA 3TJGA 1WOUA 4KCAA 4V2MA 4WEYA 3PH9A 3HZ8A 2R6KA 3GKKA 3GUSA 5E4WA 8GSSA 1YF1A 19GSA 4KDYA 2TIRA 2JSZA 4MK3A 4EO3A 2R37A 2IWTA 4MJAA 2MMNA 5G1LA 1GSEA 3FR6A 4MCUA 3APQA 1TK5B 5BMUA 3IHGA 1ST9A 2X8CA 3CXGA 3I6AA 1R5AA 4JEDA 5IQYA 5AIXA 2X8HA 9GSSA 4AJ8A 3TKSA 3VPTA 3GIXA 2EIOA 1OYJA 4IBPA 3Q74A 3NOFA 4TRXA 1SYXA 1SJZA 3UEMA 1V58A 4Z2RA 3WGEA 2F3MA 3KTBA 4ECCA 2OKAA 1DUGA 3F3QA 4IKHA 2HLSA 1O85A 3BCKA 3RHCA 4JU5A 2IJYA 3MIXA 3ZMLA 4GWRA 1BG5A 2GQLA 1X5EA 2H8LA 3DRNA 5GAND 2IMIA 1E2YA 1GUKA 2H73A 2MMZA 2ZCTA 4OCFA 3EU4A 2QKEA 3DMLA 2XHFA 3FZ4A 1PX6A 1UN2A 4DSQA 5KN3A 4KSMA 5J5NA 1OC8A 2VLUA 1EV4A 2LRTA 3EMXA 4E8HA 1JZRA 5KOWA 5F07A 3GV1A 2FD3A 1TXXA 3VI7A 3F8UA 2GZZA 3L9SA 2P0GA 1H75A 5BRTA 1TRVA 2F51A 3FMWA 4GRFA 4PUAA 2RUFA 1R26A 1DSBA 3IC8A 4QQ7A 5IIZA 3A5WA 3GX0A 3WT1A 3V1WA 3VPQA 2B5XA 2IMDA 1B4QA 1HNAA 1PKZA 2XPEA 2BTOT 4V2NA 2RIIA 2YJHA 4XS4B 4YH2A 5ID2A 1ERTA 1WJKA 4EIQA 1OC9A 2IFQA 2OJLA 1EZKA 4BWQA 5J9CA 3ZYWA 3WGXA 3F6DA 3LEFA 2HRKA 3IXRA 3BD2A 4XRAA 2DKIA 5INYA 5JWOB 1OAZA 3LG6A 1K0CA 3TKRA 3H1NA 2G0FA 3O6TA 4ML1A 3GKMA 5A4VA 5CAXA 4TKYA 4J2FA 2DJ1A 3EYTA 1PMTA 4H86A 2HI7A 3M9KA 5CRWA 4JR6A 1G6YA 2YCDA 1GP1A 1X5CA 3GTUA 5H5RA 2G2QA 3HD5A 2FCHA 4K8MA 2YANA 5H5QA 3D5JA 3DGQA 2K8VA 2NBSA 4XTSA 5IMFA 3F4RA 1MEKA 3VWWA 4TOPA 3FR3A 4G0IA 1XW6A 3HDCA 4TVEA 3HA9A 3GMFA 3A2VA 5HQPA 3CBUA 4K7OA 1YF0A 4IW9A 1YEXA 5HR2A 1TOFA 1K3OA 4G19A 3HJOA 4NV2A 3IBHA 3ZTLA 3N9JA 4BVXA 2LNTA 4HZ2A 4IS0A 2HZEB 2LSTA 2VL2C 2FWEA 5A5KA 1HNCA 4WF4A 3TUEA 2VD0A 3LYPA 2LV3A 3KZQA 5G2ZA 4GSSA 1GSQA 3KMOA 4F82A 3PR8A 2FWFA 2IPAA 2XBQA 2R4VA 1XIYA 2DC5A 2L5LA 2YZHA 1QXHA 4Q5NA 2MBTA 4L5LA 2YWIA 1GNEA 3DIEA 4Q5RA 4BL7B 2L59A 3HZ4A 3LW9A 3ZRDA 2H01A 1A0FA 2H0IA 5IMCA 2LUSA 3GURA 4G0LA 3BCIA 4TR3A 2A2RA 2ON5A 2LRNA 5EVOA 3TKQA 1M0UA 5DAKA 4GCIA 4K7IA 4O5RA 1FHEA 2L6CA 3F0IA 3H4KA 1M9AA 4K7NA 3KXOA 4WXTA 1GSYA 5AN1A 3QR6A 1GSDA 5G5FA 3LXTA 4WETA 3C71A 2X49A 4ZIJA 2R0GA 1GSFA 3E0UA 1SK1A 1I9DA 4HDEA 2F8FA 18GSA 2DJ2A 1LU4A 3RDWA 3EPTA 1O73A 3GRXA 7GSSA 5IPGA 2TRCP 3D0ZA 1QFNA 1X9MB 1XVWA 1B4PA 3SWLA 2V32A 4IELA 4OCEA 4HQZA 5G5EA 4WBRD 4OMVA 5EY6A 3O76A 1ZYNA 4ZL8A 2C3TA 2O7KA 1VF2A 5AGYA 1V9WA 2KLXA 1NSWA 3VK9A 1YKAA 3U5RE 1JFUA 5CP1A 5CRDA 1SYRA 1PX7A 1DBYA 1JLVA 1SL1B 2DJKA 3FHKA 2VM1A 1X9SB 2VCXA 1KBNA 4N11A 3EU3A 5IMZA 1S3DA 4ID0A 3UJ1A 4ECIA 4V1Ap 3EINA 2HRFA 4TN8A 2AYTA 1GLPA 4EKZA 1O7UA 4K2XA 5ECKB 4IJ3A 2OADA 1HQOA 2VIMA 3HKRA 1PA3A 4FYCA 1FVKA 3TGZA 2FNOA 1R4WA 1K0AA 4X1UA 2B6MA 3F3RA 4F0BA 1XPVA 1HD2A 3HVSA 4MF7A 5JCGA 1PD21 1AAZA 2VL2A 3HJPA 4PQ1A 3KH7A 4KH7A 1WPIA 3VFIA 4OO5A 2VUPA 3GKNA 4HJMA 1XZOA 4GQFA 5E59A 4DSSA 5IOWA 2JZTA 2OE0A 4K2DA 2YZUA 2H74A 3LFLA 3DXBA 3Q19A 1YZXA 4YAPA 3H93A 1WMJA 2I4AA 2H0GA 2C0GA 4KGIA 4BVYB 16GSA 1ERVA 2DKHA 3IAS2 6GSUA 1S3CA 5CYYA 4MLYA 2I81A 1XWAA 2YWNA 3NIVA 3CSIA 1IYIA 3F63A 10GSA 1FAAA 1V57A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AB6 A;  3ZLP A;  3OR5 A;  4LA1 A;  2HFD A;  2JZS A;  3NZN A;  1GLQ A;  1U3A A;  1UC7 A;  2N5F A;  1O8X A;  4MZB A;  4I5Q A;  1XXU A;  2J23 A;  3KCM A;  3RBT A;  4I2U A;  5IO2 A;  3O3T A;  1Y6E A;  4K0N A;  5ELA A;  2CX4 A;  4FIW A;  1HYU A;  1Q98 A;  5DAL B;  4NXI A;  1ZYE A;  4KDX A;  4HJ2 A;  1TU7 A;  3BOA A;  4HQS A;  3E9J B;  2LRC A;  12GS A;  1VF4 A;  1QQ2 A;  1LJR A;  4K9Z A;  4CW9 A;  1RK4 A;  1ZGN A;  2NPB A;  4TR0 A;  2DBC A;  3IV4 A;  2WGR A;  2F8A A;  3WYW A;  4GTU A;  3UBL A;  4K0G A;  4HI7 A;  1M2A A;  4LLR A;  2M80 A;  1C72 A;  4POB A;  1EEM A;  4EE0 A;  1X9W B;  2OBK A;  6GSS A;  3L78 A;  4TW5 A;  2IMK A;  5D9X A;  5FHI A;  1AQW A;  2DJ0 A;  3GN3 A;  3LGC A;  2LQO A;  4ULX A;  1SJI A;  2V6O A;  2PGT A;  2JZR A;  1TP9 A;  1Y25 A;  1SD8 A;  2C3N A;  1A8Y A;  1YEP A;  2GZY A;  1PQN A;  3GH9 A;  4NPB A;  4D73 B;  5GAP D;  3KMN A;  3H8Q A;  4XS6 A;  1O8W A;  2PWJ A;  1OKD A;  2A4V A;  2P5R A;  2AAW A;  3N5O A;  3FZ9 A;  3CMI A;  4E8E A;  3G9B A;  3ED3 A;  1ZCP A;  4JRR A;  3TRP A;  3Q18 A;  4BPY A;  3VUR A;  4TR1 B;  1AUC A;  4NMU A;  1XWB A;  1S3A A;  2C4J A;  1TRS A;  3TJJ A;  5FWG A;  3P90 A;  4Z7X A;  3KH9 A;  2KOK A;  3M3M A;  5CO3 A;  1GWC A;  4PXO A;  3A2X A;  5D96 A;  2DLX A;  1YDK A;  2H1G A;  3W6G A;  3L4N A;  4DSR A;  1T3B A;  4EUY A;  5L71 A;  5DCG A;  1F9M A;  4GF0 A;  2AV4 A;  1VF3 A;  1XW5 A;  4NHW A;  3TRX A;  3P2A A;  5ECM B;  4NHZ A;  2HYX A;  1GH2 A;  3GA4 A;  1F6M C;  3F4S A;  3IPZ A;  1SK2 A;  5DJL A;  1PGT A;  3W8S A;  1FB6 A;  3C73 A;  5IM9 A;  3GSS A;  4TXO B;  4HZ4 A;  3VI5 A;  1NHY A;  5ECN B;  3J7Y k;  1KTE A;  4KW6 A;  4MAB A;  4KUN A;  2HZF A;  4XHM A;  2KUC A;  1BQ7 A;  2HSY A;  4V1A g;  3US3 A;  2FUG 2;  3IRA A;  1T4Z A;  3FW2 A;  2ALB A;  2QSI A;  2H72 A;  2E2G A;  2GSS A;  2QGV A;  1PL1 A;  1M9B A;  2GVP A;  2WS2 A;  5DQS A;  5LNK e;  4IQA A;  5D9V A;  2MMA A;  2VL9 A;  1LBK A;  2H19 A;  3KP9 A;  2CA8 A;  3EMP A;  3RAZ A;  4MF5 A;  1MDI A;  1DE2 A;  2Z9S A;  3IR4 A;  3LSZ A;  2KP2 A;  4HUA A;  1UVZ A;  1PL2 A;  3BJ5 A;  3APS A;  4N0Z A;  1N2A A;  3TB2 A;  1QUW A;  1DE1 A;  4WBJ A;  4WKW A;  5ECO B;  4KA0 A;  2GSQ A;  4ZB8 A;  1MD4 A;  1J0F A;  5KEJ A;  4G2E A;  3FY7 A;  5HR0 A;  2B7K A;  2DSA A;  1T00 A;  1PSQ A;  1AIU A;  17GS A;  3CYN A;  1QGV A;  3RPP A;  3IDV A;  3UBK A;  4I97 A;  1CQG A;  3KEB A;  3L0H A;  4ZBD A;  2ZNM A;  3TOT A;  1O81 A;  3M9J A;  1GTB A;  1FVJ A;  1B9X C;  3ISO A;  4X43 A;  1BX9 A;  3RHB A;  2ES7 A;  3HHV A;  5KN2 A;  3EVI A;  5G31 A;  3GL3 A;  1WP0 A;  1JHB A;  4ZL9 A;  1JZO A;  1EGO A;  3UIW A;  3A3T A;  1XOB A;  4I2T A;  2D2Z A;  4ZL7 A;  3TJF A;  3WGD A;  2AHE A;  2LS5 A;  1K0M A;  4N30 A;  4J57 E;  1G6W A;  5B6N A;  2JSY A;  4ECJ A;  2I1U A;  1V40 A;  3EE2 A;  3HXS A;  2YNX A;  2EC4 A;  3GST A;  4X0X A;  5J4U A;  2RUE A;  1ZL9 A;  4J56 E;  3DD3 A;  5IMD A;  2V6K A;  4IP6 A;  4MH2 A;  1NM3 A;  1TI1 A;  4RQR A;  4YQV A;  4YQU A;  2VAF A;  3LWA A;  2ZUP A;  1URM A;  2XPD A;  1MDJ A;  2WZ9 A;  5C00 A;  1GTU A;  1GSU A;  2H75 A;  1GTA A;  4IJI A;  2MMO A;  4P3Y B;  3KD0 A;  5FT3 A;  2BMX A;  1YY7 A;  1A2M A;  4MJB A;  2FY6 A;  4ECB A;  1O6J A;  2KP1 A;  5HFK A;  2GTU A;  3UAP A;  3C8E A;  3QDN A;  5LCZ A;  3UOM A;  3FEU A;  3VWV A;  1JZD A;  5ID2 B;  2IN3 A;  1OC9 B;  1EOH A;  2IFQ B;  3GNJ A;  3GFK A;  1FOV A;  4LMV A;  5JWQ B;  3GL5 A;  2E0Q A;  1TK8 B;  2YJ7 A;  4FYU A;  1BJX A;  2LQQ A;  4F9Z A;  1TDI A;  4PQI A;  2DIY A;  2A2S A;  5ECL B;  1Z6N A;  5F05 A;  2FWG A;  4PQH A;  1MTC A;  1WE0 A;  2IIY A;  3APO A;  5DQY A;  3S9F A;  1TW9 A;  3DKS A;  1GUM A;  1R7H A;  3ZZX A;  4FH8 A;  2VCW A;  1OE8 A;  3GTU B;  1U3I A;  3ZIV A;  1Z7R A;  1RQM A;  1ABA A;  1GNW A;  1SL0 B;  1SKR B;  3IAM 2;  2O87 A;  1BYE A;  1BAY A;  4L0U A;  2C3Q A;  1XWG A;  3GHA A;  2DJJ A;  3F6F A;  4GSN A;  1FW1 A;  1AW9 A;  3QFB C;  2YWM A;  5ECS A;  4GST A;  2C1Y A;  1XW9 A;  1B9Y C;  5JWR B;  3HVV A;  2NVL A;  1WRY A;  4O7H A;  3JCM L;  5GZZ B;  3ZL5 A;  3F4T A;  1ERW A;  5IMV A;  4G9H A;  2DML A;  3FR9 A;  3DYR A;  1THX A;  4LL4 B;  4RI7 A;  2J9H A;  3IK7 A;  4POM A;  4F03 A;  3I69 A;  3VWU A;  2M72 A;  2OBI A;  1A2L A;  3CTF A;  2JAD A;  4CHS A;  2OE3 A;  3UL3 A;  5ELG A;  3TKP A;  4DEJ A;  2IL3 A;  3TOU A;  3QOU A;  5EPF A;  6GST A;  3GYK A;  4N10 A;  4POK A;  2L4Q A;  4AJ6 A;  3J7Y b;  2N5A A;  2L4C A;  2V1M A;  3M1G A;  3F9U A;  1ILO A;  2B7J A;  1B48 A;  1THO A;  3MDK A;  3UMA A;  1B8X A;  4HOJ A;  2VCV A;  5DAK B;  5A4W A;  1M7T A;  4MJE A;  2H6X A;  1ZOF A;  1TI3 A;  4FYB A;  1YQ1 A;  3QFA C;  4F2I A;  1Q4J A;  1R5P A;  13GS A;  2WFC A;  1GSS A;  3EUR A;  2CVK A;  4Q5Q A;  1EP7 A;  1YKC A;  3KIJ A;  2K18 A;  2VCZ A;  3WD6 A;  5ECI B;  5F06 A;  5ENU A;  2FA8 A;  2R2J A;  2YWO A;  5DJM A;  2CVB A;  3EWL A;  3KM6 A;  2CV4 A;  3KGK A;  4XS4 A;  1A8L A;  3FK8 A;  3LQ7 A;  5CNW A;  2V2G A;  4IP1 A;  1HNB A;  1NW2 A;  4PNF A;  5AIS A;  1PKW A;  1XWC A;  2PVO C;  5JCW A;  4G10 A;  1OC3 A;  20GS A;  4N0V A;  2X8G A;  2GDR A;  2K9F A;  3UAR A;  5A4U A;  1V2A A;  2HSH A;  2FGX A;  3HVX A;  3P7X A;  3PIN A;  1YJ6 A;  1VRS D;  2EIR A;  2VO4 A;  1T7P B;  1K0D A;  3ME8 A;  4EL1 A;  2WJU A;  4PX1 A;  2CVD A;  3GKX A;  2CZ2 A;  2GST A;  1Z3E A;  3H79 A;  3LJR A;  2VM2 A;  4KAE A;  3CSJ A;  3GH6 A;  5HFG A;  3TRQ A;  1K0O A;  2BJX A;  4RI6 A;  3VLN A;  2B1K A;  2C0D A;  4ACS A;  1XFL A;  4KE3 A;  4PUR A;  4GLT A;  5B8B A;  4IVF A;  5KN1 A;  1A23 A;  2YV9 A;  3CTG A;  3GX8 A;  4AF2 A;  1VGL A;  1EP8 A;  4EVM A;  1AQV A;  2I9H A;  2K8S A;  4RUV A;  5CRG A;  2JAC A;  5D9W A;  1FG4 A;  3PGT A;  2HE3 A;  5D9T A;  5DBQ A;  3ZIJ A;  1AXD A;  1EGR A;  5COH A;  2DMM A;  3M8N A;  2PUK C;  1TRU A;  2PN8 A;  4PUF C;  5ECH B;  3UVH A;  1F37 A;  2L5O A;  1U6T A;  1TTZ A;  1XCC A;  2PER A;  4MH3 A;  2HZE A;  3K8N A;  3RPN A;  5IPH A;  2R3X A;  2C80 A;  2AUV A;  2FWH A;  2LNS A;  4EF0 A;  2H30 A;  2L57 A;  4ZXG A;  1U87 A;  3D6I A;  2I3Y A;  4DSS B;  5ECQ B;  2DIZ A;  2WRT A;  3QPM A;  14GS A;  3ZMK A;  4HEA 2;  3LYK A;  5ECR B;  4PGT A;  2NDO A;  1NHO A;  4HS1 A;  1XVQ A;  4KSO A;  4BL7 A;  2GSR A;  2PU9 C;  4MPG A;  5J41 A;  2PPT A;  3C1S A;  6GSW A;  2C8U A;  1V98 A;  1UA5 A;  2HNL A;  2HXK A;  4K6X A;  1CQH A;  5H5S A;  1QK8 A;  2H0H A;  2H1D A;  2YPM A;  2H71 A;  1SKW B;  2O8V B;  4ZB9 A;  1F3B A;  2VOC A;  4QL7 A;  2AJQ B;  3KTL A;  3IC4 A;  4KCE A;  5CRH A;  1BED A;  1T4Y A;  2XBI A;  4POL A;  2LEG A;  3TKS E;  2VD1 A;  2LJR A;  3QCP A;  4KB3 A;  1WIK A;  1Z9H A;  4K1F A;  2VCQ A;  2R5G A;  1ML6 A;  4PNG A;  2OE1 A;  3LXZ A;  2KHP A;  3G7Y A;  3LOR A;  1J08 A;  3QAG A;  5ABR A;  2GZP A;  3MAK A;  5B7C A;  1JZW A;  4L5O A;  5IMA A;  2E7P A;  11GS A;  4MMM A;  5D8I A;  3Q6O A;  4JR4 A;  1KNG A;  3QAV A;  3P8W A;  2VCT A;  5G30 A;  1F2E A;  1SJ6 A;  4JE1 A;  1A0R P;  4IGJ A;  3HYP A;  4AJ7 A;  5HR1 A;  1A24 A;  5JCU A;  2GLR A;  5CRE A;  4IN0 A;  3R2Q A;  1ACV A;  2V41 A;  4OFT A;  3IE3 A;  2GGT A;  1GRX A;  1KEB A;  4ISD A;  3ERF A;  4NWY A;  3IK9 A;  2X99 A;  5EL8 A;  2WCI A;  3L9U A;  4KX4 A;  1Z5Y E;  3MSZ A;  1U88 A;  4V2L A;  3ZVJ A;  4EXJ A;  2YP6 A;  5GST A;  3ZFL A;  2VL3 A;  2YV7 A;  3FZ5 A;  1EOG A;  1T1V A;  4WR5 A;  5HR3 A;  2GT6 A;  1ZYQ B;  2FLS A;  1MDK A;  2B3S A;  4O32 A;  1EWX A;  1K0N A;  4ILF A;  1AQX A;  1Z6M A;  5J9B A;  4ML6 A;  1XOA A;  2P5Q A;  4L8E A;  3ERG A;  4XIH A;  3U6V A;  2L6D A;  2JL4 A;  1M2D A;  2H76 A;  2H6Z A;  4HU7 A;  5F0G A;  3QAW A;  2CAQ A;  2K6V A;  2GS3 A;  4KDU A;  1M99 A;  2M46 A;  3KJY A;  4MA9 A;  1SD9 A;  2FA4 A;  1VF1 A;  4TR4 A;  1A2J A;  3I43 A;  1K3Y A;  2NTO A;  1SKS B;  5DDL A;  4CDO A;  4OD7 A;  3W8J A;  1W4V A;  2PVQ A;  2PMT A;  3ERW A;  3D4T A;  4WR4 A;  3HJM A;  2CAI A;  1ZMA A;  1G7E A;  1XBS A;  5DVB A;  1SEN A;  3QMX A;  2P31 A;  2YN1 A;  1G7O A;  2MZC A;  3IA1 A;  1K0B A;  3BBY A;  4XRD A;  1QMV A;  1N8J A;  2VLT A;  4MJC A;  4OO4 A;  2H1A A;  3ZVJ D;  4IQ1 A;  4BVY A;  3UVT A;  3E3E A;  4ZIL A;  3M0F A;  4EDZ A;  3FRC A;  5DCH A;  1F3A A;  2RLI A;  1TK0 B;  4ZBB A;  1ZZY A;  1W89 A;  2GQK A;  3CRU A;  4NV5 A;  3D22 A;  5B8A A;  4FO5 A;  4EDY A;  4JBB A;  2F9S A;  1M2B A;  3WT2 A;  1GUL A;  1X5D A;  2H66 A;  2MBS A;  4I8B A;  22GS A;  2O89 A;  2RM5 A;  3L9V A;  2O85 A;  3MNG A;  5C04 A;  4MPF A;  2REM A;  1ON4 A;  5AIV A;  2FHE A;  2XC2 A;  1GTI A;  4MZC A;  2B1L A;  3D4M A;  5D93 A;  1PN9 A;  4KND A;  5DAL A;  3SBC A;  1MD3 A;  2GT5 A;  5G1K A;  2LJA A;  1JLW A;  6GSV A;  3FZA A;  2HT9 A;  3A2W A;  4XCS A;  5HFI A;  1OKT A;  5J3R A;  4OFM A;  2YOI A;  2E2M A;  1E6B A;  3TKS C;  6GSX A;  2CZ3 A;  4OFN A;  2B5Y A;  1FO5 A;  4BWS A;  2GQM A;  1GL8 A;  3KP8 A;  5B6M A;  4IHU A;  4NAX A;  1TRW A;  2WDU A;  2OA7 A;  4HU9 A;  2RM6 A;  3C1R A;  3MWH A;  3CSH A;  4BA7 A;  3DVX A;  3QD9 A;  3TJK A;  2X64 A;  4O92 A;  4TXV A;  4GQC A;  4XS1 A;  5IO0 A;  3FYG A;  4F0C A;  2B5E A;  2PBJ A;  1J9B A;  1IYH A;  2C0F A;  1T8E B;  6GSY A;  2CT6 A;  2OAC A;  3EC3 A;  5ECP B;  5F8B A;  2LJK A;  3ZRE A;  2JU5 A;  4WF5 A;  2N5B A;  2IMF A;  4Q5F A;  3HY2 A;  3IHQ A;  3TJB A;  1SL2 B;  4L0W A;  4D73 A;  4GXZ A;  2HRN A;  1G0T A;  2WB9 A;  1AC1 A;  5GSS A;  2H6Y A;  2H1B A;  3C7M A;  3ZIT A;  4TR1 A;  4EC0 A;  5D73 A;  2LTK A;  4YAV A;  3G7J A;  3G7I A;  3ME7 A;  3D21 A;  1H4O A;  4MF6 A;  1TKD B;  2WUL A;  3HCZ A;  1USB A;  3CRT A;  1X0R A;  4DVC A;  2MYG A;  1OVN A;  3DVW A;  2EIQ A;  3TDG A;  1GUH A;  1SK0 A;  2ON7 A;  2TRX A;  3TCO A;  3IOS A;  1Z7P A;  3FKF A;  1EEJ A;  2QC7 A;  1WWJ A;  3DWV A;  1SU9 A;  3ZFB A;  1K3L A;  1I5G A;  1FB0 A;  4JZQ A;  1XWK A;  5LD0 A;  1RW1 A;  4MP4 A;  2CQ9 A;  3DEX A;  2DJ3 A;  2VLV A;  1PRX A;  4OWY A;  4AGS A;  4ZB6 A;  1TU8 A;  1ERU A;  2LKU A;  4ZBA A;  2H70 A;  4TXO A;  4LMW A;  4RQX A;  4QL9 A;  4I6X A;  5IOX A;  4MZW A;  1EV9 A;  5KN0 A;  2IME A;  1OE7 A;  2CX3 A;  2C0E A;  4MDC A;  3VWX A;  4LL1 B;  3AY8 A;  3I9V 2;  1TJD A;  4YQM A;  3TJG A;  1WOU A;  4KCA A;  4V2M A;  4WEY A;  3PH9 A;  3HZ8 A;  2R6K A;  3GKK A;  3GUS A;  5E4W A;  8GSS A;  1YF1 A;  19GS A;  4KDY A;  2TIR A;  2JSZ A;  4MK3 A;  4EO3 A;  2R37 A;  2IWT A;  4MJA A;  2MMN A;  5G1L A;  1GSE A;  3FR6 A;  4MCU A;  3APQ A;  1TK5 B;  1ST9 A;  2X8C A;  3CXG A;  3I6A A;  1R5A A;  4JED A;  5IQY A;  5AIX A;  2X8H A;  9GSS A;  4AJ8 A;  3TKS A;  3VPT A;  3GIX A;  2EIO A;  1OYJ A;  4IBP A;  3Q74 A;  3NOF A;  4TRX A;  1SYX A;  1SJZ A;  3UEM A;  1V58 A;  3WGE A;  2F3M A;  3KTB A;  4ECC A;  2OKA A;  1DUG A;  3F3Q A;  4IKH A;  2HLS A;  1O85 A;  3BCK A;  3RHC A;  4JU5 A;  2IJY A;  3ZML A;  4GWR A;  1BG5 A;  2GQL A;  1X5E A;  2H8L A;  3DRN A;  5GAN D;  2IMI A;  1E2Y A;  1GUK A;  2H73 A;  2MMZ A;  2ZCT A;  4OCF A;  3EU4 A;  2QKE A;  3DML A;  2XHF A;  3FZ4 A;  1PX6 A;  1UN2 A;  4DSQ A;  5KN3 A;  4KSM A;  5J5N A;  1OC8 A;  2VLU A;  1EV4 A;  2LRT A;  3EMX A;  4E8H A;  1JZR A;  5F07 A;  3GV1 A;  2FD3 A;  1TXX A;  3VI7 A;  3F8U A;  2GZZ A;  3L9S A;  2P0G A;  1H75 A;  1TRV A;  2F51 A;  4GRF A;  4PUA A;  2RUF A;  1R26 A;  1DSB A;  4QQ7 A;  5IIZ A;  3A5W A;  3GX0 A;  3WT1 A;  3V1W A;  3VPQ A;  2B5X A;  2IMD A;  1B4Q A;  1HNA A;  1PKZ A;  2XPE A;  2BTO T;  4V2N A;  2RII A;  2YJH A;  4XS4 B;  4YH2 A;  5ID2 A;  1ERT A;  1WJK A;  1OC9 A;  2IFQ A;  2OJL A;  1EZK A;  4BWQ A;  5J9C A;  3ZYW A;  3WGX A;  3F6D A;  3LEF A;  3IXR A;  3BD2 A;  4XRA A;  5INY A;  5JWO B;  1OAZ A;  3LG6 A;  1K0C A;  3TKR A;  3H1N A;  2G0F A;  3O6T A;  4ML1 A;  3GKM A;  5A4V A;  5CAX A;  4TKY A;  4J2F A;  2DJ1 A;  3EYT A;  1PMT A;  4H86 A;  2HI7 A;  3M9K A;  5CRW A;  4JR6 A;  1G6Y A;  2YCD A;  1GP1 A;  1X5C A;  3GTU A;  5H5R A;  2G2Q A;  3HD5 A;  2FCH A;  4K8M A;  2YAN A;  5H5Q A;  3D5J A;  3DGQ A;  2K8V A;  2NBS A;  4XTS A;  5IMF A;  3F4R A;  1MEK A;  3VWW A;  4TOP A;  3FR3 A;  1XW6 A;  3HDC A;  4TVE A;  3HA9 A;  3GMF A;  3A2V A;  5HQP A;  3CBU A;  4K7O A;  1YF0 A;  4IW9 A;  1YEX A;  5HR2 A;  1TOF A;  1K3O A;  4G19 A;  3HJO A;  4NV2 A;  3IBH A;  3ZTL A;  3N9J A;  4BVX A;  2LNT A;  4HZ2 A;  4IS0 A;  2HZE B;  2LST A;  2VL2 C;  2FWE A;  5A5K A;  1HNC A;  4WF4 A;  3TUE A;  2VD0 A;  3LYP A;  2LV3 A;  3KZQ A;  5G2Z A;  4GSS A;  1GSQ A;  3KMO A;  4F82 A;  3PR8 A;  2FWF A;  2IPA A;  2XBQ A;  2R4V A;  1XIY A;  2DC5 A;  2L5L A;  2YZH A;  1QXH A;  4Q5N A;  2MBT A;  4L5L A;  2YWI A;  1GNE A;  3DIE A;  4Q5R A;  2L59 A;  3HZ4 A;  3ZRD A;  2H01 A;  1A0F A;  2H0I A;  5IMC A;  2LUS A;  3GUR A;  3BCI A;  4TR3 A;  2A2R A;  2ON5 A;  2LRN A;  5EVO A;  3TKQ A;  1M0U A;  5DAK A;  4GCI A;  4K7I A;  4O5R A;  1FHE A;  2L6C A;  3F0I A;  3H4K A;  1M9A A;  4K7N A;  3KXO A;  4WXT A;  1GSY A;  5AN1 A;  3QR6 A;  1GSD A;  5G5F A;  3LXT A;  4WET A;  3C71 A;  4ZIJ A;  1GSF A;  3E0U A;  1SK1 A;  1I9D A;  4HDE A;  2F8F A;  18GS A;  2DJ2 A;  1LU4 A;  3RDW A;  1O73 A;  3GRX A;  7GSS A;  5IPG A;  2TRC P;  3D0Z A;  1QFN A;  1X9M B;  1XVW A;  1B4P A;  3SWL A;  2V32 A;  4IEL A;  4OCE A;  4HQZ A;  5G5E A;  4WBR D;  4OMV A;  5EY6 A;  3O76 A;  4ZL8 A;  2C3T A;  2O7K A;  1VF2 A;  5AGY A;  1V9W A;  2KLX A;  1NSW A;  3VK9 A;  1YKA A;  3U5R E;  1JFU A;  5CP1 A;  5CRD A;  1SYR A;  1PX7 A;  1DBY A;  1JLV A;  1SL1 B;  2DJK A;  3FHK A;  2VM1 A;  1X9S B;  2VCX A;  1KBN A;  4N11 A;  3EU3 A;  5IMZ A;  1S3D A;  4ID0 A;  3UJ1 A;  4ECI A;  4V1A p;  3EIN A;  2HRF A;  4TN8 A;  2AYT A;  1GLP A;  4EKZ A;  1O7U A;  5ECK B;  4IJ3 A;  2OAD A;  1HQO A;  2VIM A;  3HKR A;  1PA3 A;  4FYC A;  1FVK A;  3TGZ A;  2FNO A;  1R4W A;  1K0A A;  4X1U A;  2B6M A;  3F3R A;  4F0B A;  1XPV A;  1HD2 A;  3HVS A;  4MF7 A;  5JCG A;  1PD2 1;  1AAZ A;  2VL2 A;  3HJP A;  4PQ1 A;  3KH7 A;  4KH7 A;  1WPI A;  3VFI A;  4OO5 A;  2VUP A;  3GKN A;  4HJM A;  1XZO A;  4GQF A;  5E59 A;  4DSS A;  5IOW A;  2JZT A;  2OE0 A;  4K2D A;  2YZU A;  2H74 A;  3LFL A;  3DXB A;  3Q19 A;  1YZX A;  4YAP A;  3H93 A;  1WMJ A;  2I4A A;  2H0G A;  2C0G A;  4KGI A;  16GS A;  1ERV A;  3IAS 2;  6GSU A;  1S3C A;  5CYY A;  4MLY A;  2I81 A;  1XWA A;  2YWN A;  3NIV A;  3CSI A;  1IYI A;  3F63 A;  10GS A;  1FAA A;  1V57 A; 
#chains in the Genus database with same CATH topology
 2AB6 A;  3ZLP A;  3OR5 A;  4LA1 A;  2HFD A;  2JZS A;  3NZN A;  1GLQ A;  1U3A A;  1UC7 A;  2N5F A;  1O8X A;  4MZB A;  4I5Q A;  1XXU A;  2J23 A;  3KCM A;  3RBT A;  4I2U A;  5IO2 A;  3O3T A;  1Y6E A;  4K0N A;  5ELA A;  2CX4 A;  4FIW A;  1HYU A;  1Q98 A;  5DAL B;  4NXI A;  4CY8 A;  1ZYE A;  4KDX A;  4HJ2 A;  1TU7 A;  3BOA A;  4HQS A;  3E9J B;  2LRC A;  12GS A;  1VF4 A;  1QQ2 A;  1LJR A;  4USS A;  4K9Z A;  4CW9 A;  1RK4 A;  1ZGN A;  2NPB A;  4TR0 A;  2DBC A;  3IV4 A;  2WGR A;  2F8A A;  3WYW A;  4GTU A;  3UBL A;  4K0G A;  4HI7 A;  1M2A A;  4LLR A;  2M80 A;  1C72 A;  4POB A;  1EEM A;  4EE0 A;  1X9W B;  2OBK A;  6GSS A;  3L78 A;  4TW5 A;  4Z2U A;  2IMK A;  2R0C A;  5D9X A;  5FHI A;  1AQW A;  2DJ0 A;  3GN3 A;  3LGC A;  2LQO A;  4ULX A;  1SJI A;  2V6O A;  2PGT A;  2JZR A;  1TP9 A;  1Y25 A;  1SD8 A;  2C3N A;  1A8Y A;  1YEP A;  2GZY A;  1PQN A;  3GH9 A;  4NPB A;  4D73 B;  5GAP D;  3KMN A;  3H8Q A;  4XS6 A;  1O8W A;  2PWJ A;  1OKD A;  2A4V A;  2P5R A;  2AAW A;  3N5O A;  3FZ9 A;  3CMI A;  4E8E A;  3G9B A;  3ED3 A;  1ZCP A;  4JRR A;  3TRP A;  3Q18 A;  4BPY A;  3VUR A;  4TR1 B;  1AUC A;  4NMU A;  1XWB A;  1S3A A;  2C4J A;  1TRS A;  3TJJ A;  5FWG A;  3P90 A;  4Z7X A;  3KH9 A;  2KOK A;  3M3M A;  5CO3 A;  1GWC A;  4PXO A;  3A2X A;  5D96 A;  2DLX A;  1YDK A;  2H1G A;  3MYD A;  3W6G A;  3L4N A;  4DSR A;  1T3B A;  4EUY A;  5L71 A;  5DCG A;  1F9M A;  4GF0 A;  2AV4 A;  4A5P A;  1VF3 A;  1XW5 A;  4NHW A;  3TRX A;  3P2A A;  5ECM B;  4NHZ A;  2HYX A;  1GH2 A;  3GA4 A;  1F6M C;  3F4S A;  3IPZ A;  1SK2 A;  5DJL A;  1PGT A;  3W8S A;  1FB6 A;  3C73 A;  5IM9 A;  3GSS A;  4TXO B;  4HZ4 A;  3VI5 A;  1NHY A;  5ECN B;  3J7Y k;  1KTE A;  4KW6 A;  4MAB A;  4KUN A;  2HZF A;  4XHM A;  2KUC A;  1BQ7 A;  2HSY A;  4V1A g;  3US3 A;  2FUG 2;  3IRA A;  1T4Z A;  3FW2 A;  2ALB A;  2QSI A;  2H72 A;  2E2G A;  2GSS A;  2QGV A;  1PL1 A;  1M9B A;  2GVP A;  2WS2 A;  5DQS A;  5LNK e;  4IQA A;  4MNN A;  5D9V A;  2MMA A;  2VL9 A;  1LBK A;  2H19 A;  3KP9 A;  2CA8 A;  3EMP A;  3RAZ A;  4MF5 A;  1MDI A;  1DE2 A;  2Z9S A;  3IR4 A;  3LSZ A;  2KP2 A;  4HUA A;  1UVZ A;  1PL2 A;  3BJ5 A;  3APS A;  4N0Z A;  1N2A A;  3TB2 A;  1QUW A;  1DE1 A;  4WBJ A;  4WKW A;  5ECO B;  4KA0 A;  2GSQ A;  4ZB8 A;  1MD4 A;  1J0F A;  5KEJ A;  4G2E A;  2UZ8 A;  3FY7 A;  5HR0 A;  2B7K A;  2DSA A;  1T00 A;  1PSQ A;  1AIU A;  17GS A;  3CYN A;  1QGV A;  3RPP A;  3IDV A;  3UBK A;  4I97 A;  1CQG A;  3KEB A;  3L0H A;  4ZBD A;  2ZNM A;  3TOT A;  1O81 A;  3M9J A;  1GTB A;  1FVJ A;  1B9X C;  3ISO A;  4X43 A;  1BX9 A;  3RHB A;  2ES7 A;  1FOH A;  3HHV A;  5KN2 A;  3EVI A;  5G31 A;  3GL3 A;  1WP0 A;  1JHB A;  4ZL9 A;  1JZO A;  1EGO A;  3UIW A;  3A3T A;  4ICY A;  1XOB A;  4I2T A;  2D2Z A;  4ZL7 A;  3TJF A;  3WGD A;  2AHE A;  2LS5 A;  1K0M A;  4N30 A;  4J57 E;  1G6W A;  5B6N A;  2JSY A;  4ECJ A;  2I1U A;  1V40 A;  3EE2 A;  3HXS A;  2YNX A;  2EC4 A;  3GST A;  4X0X A;  5J4U A;  2RUE A;  1ZL9 A;  4J56 E;  3DD3 A;  5IMD A;  2V6K A;  4IP6 A;  4MH2 A;  1NM3 A;  1TI1 A;  4RQR A;  4YQV A;  4YQU A;  2VAF A;  3LWA A;  2ZUP A;  1URM A;  2XPD A;  1MDJ A;  2WZ9 A;  5C00 A;  1GTU A;  1GSU A;  2H75 A;  1GTA A;  4IJI A;  2MMO A;  4P3Y B;  3KD0 A;  5FT3 A;  2BMX A;  1YY7 A;  1A2M A;  4MJB A;  2FY6 A;  4ECB A;  1O6J A;  2KP1 A;  3A5I A;  5HFK A;  2GTU A;  3UAP A;  3C8E A;  3QDN A;  5LCZ A;  3UOM A;  3FEU A;  3VWV A;  1JZD A;  5ID2 B;  2IN3 A;  1OC9 B;  1EOH A;  2IFQ B;  3GNJ A;  3GFK A;  1FOV A;  4LMV A;  5JWQ B;  3GL5 A;  2E0Q A;  1TK8 B;  2YJ7 A;  4FYU A;  1BJX A;  4HSC X;  2LQQ A;  4F9Z A;  1TDI A;  4PQI A;  2DIY A;  2A2S A;  5ECL B;  1Z6N A;  5F05 A;  2FWG A;  4PQH A;  1MTC A;  1WE0 A;  2IIY A;  3APO A;  5DQY A;  3S9F A;  1TW9 A;  3DKS A;  1GUM A;  1R7H A;  3ZZX A;  4FH8 A;  2VCW A;  1OE8 A;  3GTU B;  1U3I A;  3ZIV A;  1Z7R A;  1RQM A;  1ABA A;  1GNW A;  4FQU A;  1SL0 B;  1SKR B;  3IAM 2;  2O87 A;  1BYE A;  1BAY A;  4L0U A;  2C3Q A;  1XWG A;  3GHA A;  2DJJ A;  3F6F A;  4GSN A;  1FW1 A;  1AW9 A;  3QFB C;  2YWM A;  5ECS A;  4GST A;  2C1Y A;  1XW9 A;  1B9Y C;  5JWR B;  3HVV A;  2NVL A;  1WRY A;  4O7H A;  3JCM L;  5GZZ B;  4BVX B;  3ZL5 A;  3F4T A;  1ERW A;  5IMV A;  4G9H A;  2DML A;  3FR9 A;  2HRA A;  3DYR A;  1ZYP A;  1THX A;  4LL4 B;  4RI7 A;  2J9H A;  3IK7 A;  4POM A;  4F03 A;  4K5R A;  3I69 A;  3VWU A;  2M72 A;  2OBI A;  1A2L A;  3CTF A;  2JAD A;  4CHS A;  2OE3 A;  3UL3 A;  5ELG A;  3TKP A;  4DEJ A;  2IL3 A;  3TOU A;  3R3E A;  3QOU A;  5EPF A;  6GST A;  3GYK A;  4N10 A;  4POK A;  2L4Q A;  4AJ6 A;  3J7Y b;  2N5A A;  2L4C A;  2V1M A;  3M1G A;  3F9U A;  1ILO A;  2B7J A;  1B48 A;  1THO A;  3MDK A;  3UMA A;  2HSM A;  1B8X A;  4HOJ A;  2A2P A;  2VCV A;  5DAK B;  5A4W A;  1M7T A;  4MJE A;  2H6X A;  1ZOF A;  1TI3 A;  4FYB A;  1YQ1 A;  3QFA C;  4F2I A;  1Q4J A;  1R5P A;  13GS A;  3PPU A;  2WFC A;  1GSS A;  3EUR A;  2CVK A;  4Q5Q A;  1EP7 A;  1YKC A;  3KIJ A;  4G0K A;  2K18 A;  2VCZ A;  3WD6 A;  5ECI B;  5F06 A;  5ENU A;  4KF9 A;  2FA8 A;  2R2J A;  2YWO A;  5DJM A;  2CVB A;  3EWL A;  3KM6 A;  2CV4 A;  3KGK A;  4XS4 A;  1A8L A;  3FK8 A;  3LQ7 A;  5CNW A;  2V2G A;  4IP1 A;  1HNB A;  1NW2 A;  4PNF A;  5AIS A;  1PKW A;  1XWC A;  2PVO C;  5JCW A;  4G10 A;  1OC3 A;  20GS A;  4N0V A;  2X8G A;  2GDR A;  2K9F A;  3UAR A;  5A4U A;  1V2A A;  2HSH A;  4PTS A;  2FGX A;  3HVX A;  3P7X A;  3PIN A;  1YJ6 A;  1VRS D;  2EIR A;  2VO4 A;  1T7P B;  2X4A A;  1K0D A;  3ME8 A;  4EL1 A;  2WJU A;  4PX1 A;  2CVD A;  3GKX A;  2CZ2 A;  2GST A;  4BIK A;  1Z3E A;  3H79 A;  3LJR A;  2VM2 A;  4KAE A;  3CSJ A;  3GH6 A;  5HFG A;  3TRQ A;  1K0O A;  2BJX A;  4RI6 A;  3VLN A;  2B1K A;  2C0D A;  4ACS A;  1XFL A;  4KE3 A;  4PUR A;  4GLT A;  5B8B A;  4IVF A;  5KN1 A;  1A23 A;  2YV9 A;  3CTG A;  3GX8 A;  4AF2 A;  1VGL A;  1EP8 A;  4EVM A;  1AQV A;  2I9H A;  2K8S A;  4RUV A;  5CRG A;  2JAC A;  5D9W A;  1FG4 A;  3PGT A;  2HE3 A;  5D9T A;  5DBQ A;  3ZIJ A;  1AXD A;  1EGR A;  5COH A;  2DMM A;  3M8N A;  2PUK C;  1TRU A;  2PN8 A;  4PUF C;  5ECH B;  3UVH A;  1F37 A;  2L5O A;  1U6T A;  1TTZ A;  1XCC A;  2PER A;  4MH3 A;  2HZE A;  3K8N A;  3RPN A;  5IPH A;  2R3X A;  2C80 A;  2AUV A;  2FWH A;  2LNS A;  4EF0 A;  2H30 A;  2L57 A;  4ZXG A;  1U87 A;  3D6I A;  2I3Y A;  4DSS B;  5ECQ B;  2DIZ A;  2WRT A;  3QPM A;  14GS A;  3ZMK A;  4HEA 2;  3LYK A;  5ECR B;  4PGT A;  4CY6 A;  2NDO A;  1NHO A;  4HS1 A;  1XVQ A;  4KSO A;  4BL7 A;  2GSR A;  2PU9 C;  4MPG A;  5J41 A;  2PPT A;  3C1S A;  6GSW A;  2C8U A;  1V98 A;  1UA5 A;  2HNL A;  2HXK A;  4K6X A;  1CQH A;  5H5S A;  1QK8 A;  2H0H A;  2H1D A;  2YPM A;  2H71 A;  1SKW B;  2O8V B;  4ZB9 A;  1F3B A;  2VOC A;  4QL7 A;  2AJQ B;  3KTL A;  3IC4 A;  4KCE A;  5CRH A;  1BED A;  1T4Y A;  2XBI A;  4POL A;  2LEG A;  3TKS E;  2VD1 A;  2LJR A;  3QCP A;  4KB3 A;  1WIK A;  1Z9H A;  4K1F A;  2VCQ A;  2R5G A;  1ML6 A;  4O5U A;  4PNG A;  2OE1 A;  3LXZ A;  2KHP A;  3G7Y A;  3LOR A;  1J08 A;  3QAG A;  5ABR A;  2GZP A;  3MAK A;  5B7C A;  1JZW A;  4L5O A;  4K5S A;  5IMA A;  2E7P A;  11GS A;  4MMM A;  5D8I A;  3Q6O A;  4JR4 A;  1KNG A;  3QAV A;  3P8W A;  2VCT A;  5G30 A;  1F2E A;  1SJ6 A;  4JE1 A;  1A0R P;  4IGJ A;  3HYP A;  4AJ7 A;  5HR1 A;  1A24 A;  5JCU A;  2GLR A;  5CRE A;  4IN0 A;  3R2Q A;  1ACV A;  2V41 A;  4OFT A;  3CQF A;  2GGT A;  3IE3 A;  1GRX A;  1XG8 A;  1KEB A;  4ISD A;  3ERF A;  4NWY A;  3IK9 A;  2X99 A;  5EL8 A;  2WCI A;  3L9U A;  4KX4 A;  1Z5Y E;  3MSZ A;  1U88 A;  4V2L A;  3ZVJ A;  2QA1 A;  4EXJ A;  2YP6 A;  2R0P A;  5GST A;  3ZFL A;  2VL3 A;  2YV7 A;  3FZ5 A;  1EOG A;  1T1V A;  4WR5 A;  5HR3 A;  2GT6 A;  1ZYQ B;  2FLS A;  1MDK A;  2B3S A;  4O32 A;  1EWX A;  1K0N A;  4ILF A;  1AQX A;  1Z6M A;  5J9B A;  4ML6 A;  1XOA A;  2P5Q A;  4L8E A;  3ERG A;  4XIH A;  3U6V A;  2L6D A;  2JL4 A;  1M2D A;  2H76 A;  2H6Z A;  4HU7 A;  5F0G A;  3QAW A;  2CAQ A;  2K6V A;  2GS3 A;  4KDU A;  1M99 A;  2M46 A;  3KJY A;  4MA9 A;  1SD9 A;  1PFO A;  2FA4 A;  1VF1 A;  4TR4 A;  1A2J A;  3I43 A;  1K3Y A;  2NTO A;  1SKS B;  5DDL A;  4CDO A;  4OD7 A;  3W8J A;  1W4V A;  2PVQ A;  2PMT A;  3ERW A;  3D4T A;  4WR4 A;  3HJM A;  2CAI A;  1ZMA A;  1G7E A;  1XBS A;  5DVB A;  1SEN A;  3QMX A;  2P31 A;  2YN1 A;  1G7O A;  2MZC A;  3IA1 A;  1K0B A;  3BBY A;  4XRD A;  1QMV A;  1N8J A;  2VLT A;  4YKF A;  4MJC A;  4OO4 A;  2H1A A;  3ZVJ D;  4IQ1 A;  4BVY A;  3UVT A;  3E3E A;  4ZIL A;  3M0F A;  4EDZ A;  3FRC A;  5DCH A;  1F3A A;  2RLI A;  1TK0 B;  4ZBB A;  1ZZY A;  1W89 A;  2GQK A;  3CRU A;  4NV5 A;  3D22 A;  5B8A A;  4FO5 A;  4EDY A;  4JBB A;  2F9S A;  1M2B A;  3WT2 A;  1GUL A;  1X5D A;  2H66 A;  2MBS A;  4I8B A;  22GS A;  2O89 A;  2RM5 A;  3L9V A;  2O85 A;  3MNG A;  5C04 A;  4MPF A;  2REM A;  1ON4 A;  5AIV A;  2FHE A;  2XC2 A;  1GTI A;  4MZC A;  2B1L A;  3D4M A;  4YKG A;  5D93 A;  1PN9 A;  4KND A;  5DAL A;  3SBC A;  1MD3 A;  2GT5 A;  5G1K A;  2LJA A;  1JLW A;  6GSV A;  3FZA A;  2HT9 A;  3A2W A;  4XCS A;  5HFI A;  1OKT A;  5J3R A;  4OFM A;  2YOI A;  2E2M A;  1E6B A;  3TKS C;  6GSX A;  2CZ3 A;  4OFN A;  2B5Y A;  1FO5 A;  4BWS A;  2GQM A;  1GL8 A;  3KP8 A;  5KOX A;  5B6M A;  4IHU A;  4NAX A;  1TRW A;  2WDU A;  2OA7 A;  4HU9 A;  2RM6 A;  3C1R A;  3MWH A;  3CSH A;  4BA7 A;  3DVX A;  3QD9 A;  3TJK A;  2X64 A;  4O92 A;  4TXV A;  4GQC A;  4XS1 A;  5IO0 A;  3FYG A;  4F0C A;  2B5E A;  2PBJ A;  1J9B A;  1IYH A;  2C0F A;  1T8E B;  6GSY A;  2CT6 A;  2OAC A;  3EC3 A;  5ECP B;  5F8B A;  2LJK A;  3ZRE A;  2JU5 A;  4WF5 A;  2N5B A;  2IMF A;  4Q5F A;  4EIP A;  3HY2 A;  3IHQ A;  3TJB A;  1SL2 B;  4L0W A;  4D73 A;  4GXZ A;  2HRN A;  1G0T A;  2A4H A;  2WB9 A;  1AC1 A;  5GSS A;  4O5Q A;  2H6Y A;  2H1B A;  3C7M A;  3ZIT A;  4TR1 A;  4EC0 A;  5D73 A;  2LTK A;  4YAV A;  3G7J A;  3G7I A;  3ME7 A;  3D21 A;  1H4O A;  4MF6 A;  1TKD B;  2WUL A;  4Z2T A;  3HCZ A;  1PN0 A;  2QA2 A;  1USB A;  3CRT A;  1X0R A;  4DVC A;  2MYG A;  1OVN A;  3DVW A;  2EIQ A;  3TDG A;  1GUH A;  1SK0 A;  2ON7 A;  2TRX A;  3TCO A;  3IOS A;  1Z7P A;  3FKF A;  1EEJ A;  2QC7 A;  1WWJ A;  3DWV A;  1SU9 A;  3ZFB A;  1K3L A;  1I5G A;  1FB0 A;  4JZQ A;  1XWK A;  5LD0 A;  1RW1 A;  4MP4 A;  2CQ9 A;  3DEX A;  2DJ3 A;  2VLV A;  1PRX A;  4OWY A;  4AGS A;  4ZB6 A;  1TU8 A;  1ERU A;  2LKU A;  4ZBA A;  2H70 A;  4TXO A;  4LMW A;  4RQX A;  4QL9 A;  4I6X A;  5IOX A;  4MZW A;  1EV9 A;  5KN0 A;  2IME A;  1OE7 A;  2CX3 A;  4X4J A;  2C0E A;  4MDC A;  3VWX A;  4LL1 B;  3AY8 A;  3I9V 2;  1TJD A;  4YQM A;  3TJG A;  1WOU A;  4KCA A;  4V2M A;  4WEY A;  3PH9 A;  3HZ8 A;  2R6K A;  3GKK A;  3GUS A;  5E4W A;  8GSS A;  1YF1 A;  19GS A;  4KDY A;  2TIR A;  2JSZ A;  4MK3 A;  4EO3 A;  2R37 A;  2IWT A;  4MJA A;  2MMN A;  5G1L A;  1GSE A;  3FR6 A;  4MCU A;  3APQ A;  1TK5 B;  5BMU A;  3IHG A;  1ST9 A;  2X8C A;  3CXG A;  3I6A A;  1R5A A;  4JED A;  5IQY A;  5AIX A;  1M3J A;  2X8H A;  9GSS A;  4AJ8 A;  3TKS A;  3VPT A;  3GIX A;  2EIO A;  1OYJ A;  4IBP A;  3Q74 A;  3NOF A;  4TRX A;  1SYX A;  1SJZ A;  3UEM A;  1V58 A;  4Z2R A;  3WGE A;  2F3M A;  3KTB A;  4ECC A;  2OKA A;  1DUG A;  3F3Q A;  4IKH A;  2HLS A;  1O85 A;  3BCK A;  3RHC A;  4JU5 A;  2IJY A;  3MIX A;  3ZML A;  4GWR A;  1BG5 A;  2GQL A;  1X5E A;  2H8L A;  3DRN A;  5GAN D;  2IMI A;  1E2Y A;  1GUK A;  2H73 A;  2MMZ A;  2ZCT A;  4OCF A;  3EU4 A;  2QKE A;  3DML A;  2XHF A;  3FZ4 A;  1PX6 A;  1UN2 A;  4DSQ A;  5KN3 A;  4KSM A;  1S3R A;  5J5N A;  1OC8 A;  2VLU A;  3HVN A;  1EV4 A;  2LRT A;  3EMX A;  4E8H A;  1JZR A;  5KOW A;  5F07 A;  3GV1 A;  2FD3 A;  1TXX A;  3VI7 A;  3F8U A;  2GZZ A;  3L9S A;  2P0G A;  1H75 A;  5BRT A;  1TRV A;  2F51 A;  3FMW A;  4GRF A;  4PUA A;  2RUF A;  1R26 A;  1DSB A;  3IC8 A;  4QQ7 A;  5IIZ A;  3A5W A;  3GX0 A;  3WT1 A;  3V1W A;  3VPQ A;  2B5X A;  2IMD A;  1B4Q A;  1HNA A;  1PKZ A;  2XPE A;  2BTO T;  4V2N A;  2RII A;  2YJH A;  4XS4 B;  4YH2 A;  5ID2 A;  1ERT A;  1WJK A;  4EIQ A;  1OC9 A;  2IFQ A;  2OJL A;  1EZK A;  4BWQ A;  5J9C A;  3ZYW A;  3WGX A;  3F6D A;  3LEF A;  2HRK A;  3IXR A;  3BD2 A;  4XRA A;  2DKI A;  5INY A;  5JWO B;  1OAZ A;  3LG6 A;  1K0C A;  3TKR A;  3H1N A;  2G0F A;  3O6T A;  4ML1 A;  3GKM A;  5A4V A;  5CAX A;  4TKY A;  4J2F A;  2DJ1 A;  3EYT A;  1PMT A;  4H86 A;  2HI7 A;  3M9K A;  5CRW A;  4JR6 A;  1G6Y A;  2YCD A;  1GP1 A;  1X5C A;  3GTU A;  5H5R A;  2G2Q A;  3HD5 A;  2FCH A;  4K8M A;  2YAN A;  5H5Q A;  3D5J A;  3DGQ A;  2K8V A;  2NBS A;  4XTS A;  5IMF A;  3F4R A;  1MEK A;  3VWW A;  4TOP A;  3FR3 A;  4G0I A;  1XW6 A;  3HDC A;  4TVE A;  3HA9 A;  3GMF A;  3A2V A;  5HQP A;  3CBU A;  4K7O A;  1YF0 A;  4IW9 A;  1YEX A;  5HR2 A;  1TOF A;  1K3O A;  4G19 A;  3HJO A;  4NV2 A;  3IBH A;  3ZTL A;  3N9J A;  4BVX A;  2LNT A;  4HZ2 A;  4IS0 A;  2HZE B;  2LST A;  2VL2 C;  2FWE A;  5A5K A;  1HNC A;  4WF4 A;  3TUE A;  2VD0 A;  3LYP A;  2LV3 A;  3KZQ A;  5G2Z A;  4GSS A;  1GSQ A;  3KMO A;  4F82 A;  3PR8 A;  2FWF A;  2IPA A;  2XBQ A;  2R4V A;  1XIY A;  2DC5 A;  2L5L A;  2YZH A;  1QXH A;  4Q5N A;  2MBT A;  4L5L A;  2YWI A;  1GNE A;  3DIE A;  4Q5R A;  4BL7 B;  2L59 A;  3HZ4 A;  3LW9 A;  3ZRD A;  2H01 A;  1A0F A;  2H0I A;  5IMC A;  2LUS A;  3GUR A;  4G0L A;  3BCI A;  4TR3 A;  2A2R A;  2ON5 A;  2LRN A;  5EVO A;  3TKQ A;  1M0U A;  5DAK A;  4GCI A;  4K7I A;  4O5R A;  1FHE A;  2L6C A;  3F0I A;  3H4K A;  1M9A A;  4K7N A;  3KXO A;  4WXT A;  1GSY A;  5AN1 A;  3QR6 A;  1GSD A;  5G5F A;  3LXT A;  4WET A;  3C71 A;  2X49 A;  4ZIJ A;  2R0G A;  1GSF A;  3E0U A;  1SK1 A;  1I9D A;  4HDE A;  2F8F A;  18GS A;  2DJ2 A;  1LU4 A;  3RDW A;  3EPT A;  1O73 A;  3GRX A;  7GSS A;  5IPG A;  2TRC P;  3D0Z A;  1QFN A;  1X9M B;  1XVW A;  1B4P A;  3SWL A;  2V32 A;  4IEL A;  4OCE A;  4HQZ A;  5G5E A;  4WBR D;  4OMV A;  5EY6 A;  3O76 A;  1ZYN A;  4ZL8 A;  2C3T A;  2O7K A;  1VF2 A;  5AGY A;  1V9W A;  2KLX A;  1NSW A;  3VK9 A;  1YKA A;  3U5R E;  1JFU A;  5CP1 A;  5CRD A;  1SYR A;  1PX7 A;  1DBY A;  1JLV A;  1SL1 B;  2DJK A;  3FHK A;  2VM1 A;  1X9S B;  2VCX A;  1KBN A;  4N11 A;  3EU3 A;  5IMZ A;  1S3D A;  4ID0 A;  3UJ1 A;  4ECI A;  4V1A p;  3EIN A;  2HRF A;  4TN8 A;  2AYT A;  1GLP A;  4EKZ A;  1O7U A;  4K2X A;  5ECK B;  4IJ3 A;  2OAD A;  1HQO A;  2VIM A;  3HKR A;  1PA3 A;  4FYC A;  1FVK A;  1M3I A;  3TGZ A;  2FNO A;  1R4W A;  1K0A A;  4X1U A;  2B6M A;  3F3R A;  4F0B A;  1XPV A;  1HD2 A;  3HVS A;  4MF7 A;  5JCG A;  1PD2 1;  1AAZ A;  2VL2 A;  3HJP A;  4PQ1 A;  3KH7 A;  4KH7 A;  1WPI A;  3VFI A;  4OO5 A;  2VUP A;  3GKN A;  4HJM A;  1XZO A;  4GQF A;  5E59 A;  4DSS A;  5IOW A;  2JZT A;  2OE0 A;  4K2D A;  2YZU A;  2H74 A;  3LFL A;  3DXB A;  3Q19 A;  1YZX A;  4YAP A;  3H93 A;  1WMJ A;  2I4A A;  2H0G A;  2C0G A;  4KGI A;  4BVY B;  16GS A;  1ERV A;  2DKH A;  3IAS 2;  6GSU A;  1S3C A;  5CYY A;  4MLY A;  2I81 A;  1XWA A;  2YWN A;  3NIV A;  3CSI A;  1IYI A;  3F63 A;  10GS A;  1FAA A;  1V57 A; 
#chains in the Genus database with same CATH homology
 2AB6 A;  3ZLP A;  3OR5 A;  4LA1 A;  2HFD A;  2JZS A;  3NZN A;  1GLQ A;  1U3A A;  1UC7 A;  2N5F A;  1O8X A;  4MZB A;  4I5Q A;  1XXU A;  2J23 A;  3KCM A;  3RBT A;  4I2U A;  5IO2 A;  3O3T A;  1Y6E A;  4K0N A;  5ELA A;  2CX4 A;  4FIW A;  1HYU A;  1Q98 A;  5DAL B;  4NXI A;  4CY8 A;  1ZYE A;  4KDX A;  4HJ2 A;  1TU7 A;  3BOA A;  4HQS A;  3E9J B;  2LRC A;  12GS A;  1VF4 A;  1QQ2 A;  1LJR A;  4USS A;  4K9Z A;  4CW9 A;  1RK4 A;  1ZGN A;  2NPB A;  4TR0 A;  2DBC A;  3IV4 A;  2WGR A;  2F8A A;  3WYW A;  4GTU A;  3UBL A;  4K0G A;  4HI7 A;  1M2A A;  4LLR A;  2M80 A;  1C72 A;  4POB A;  1EEM A;  4EE0 A;  1X9W B;  2OBK A;  6GSS A;  3L78 A;  4TW5 A;  4Z2U A;  2IMK A;  2R0C A;  5D9X A;  5FHI A;  1AQW A;  2DJ0 A;  3GN3 A;  3LGC A;  2LQO A;  4ULX A;  1SJI A;  2V6O A;  2PGT A;  2JZR A;  1TP9 A;  1Y25 A;  1SD8 A;  2C3N A;  1A8Y A;  1YEP A;  2GZY A;  1PQN A;  3GH9 A;  4NPB A;  4D73 B;  5GAP D;  3KMN A;  3H8Q A;  4XS6 A;  1O8W A;  2PWJ A;  1OKD A;  2A4V A;  2P5R A;  2AAW A;  3N5O A;  3FZ9 A;  3CMI A;  4E8E A;  3G9B A;  3ED3 A;  1ZCP A;  4JRR A;  3TRP A;  3Q18 A;  4BPY A;  3VUR A;  4TR1 B;  1AUC A;  4NMU A;  1XWB A;  1S3A A;  2C4J A;  1TRS A;  3TJJ A;  5FWG A;  3P90 A;  4Z7X A;  3KH9 A;  2KOK A;  3M3M A;  5CO3 A;  1GWC A;  4PXO A;  3A2X A;  5D96 A;  2DLX A;  1YDK A;  2H1G A;  3MYD A;  3W6G A;  3L4N A;  4DSR A;  1T3B A;  4EUY A;  5L71 A;  5DCG A;  1F9M A;  4GF0 A;  2AV4 A;  4A5P A;  1VF3 A;  1XW5 A;  4NHW A;  3TRX A;  3P2A A;  5ECM B;  4NHZ A;  2HYX A;  1GH2 A;  3GA4 A;  1F6M C;  3F4S A;  3IPZ A;  1SK2 A;  5DJL A;  1PGT A;  3W8S A;  1FB6 A;  3C73 A;  5IM9 A;  3GSS A;  4TXO B;  4HZ4 A;  3VI5 A;  1NHY A;  5ECN B;  3J7Y k;  1KTE A;  4KW6 A;  4MAB A;  4KUN A;  2HZF A;  4XHM A;  2KUC A;  1BQ7 A;  2HSY A;  4V1A g;  3US3 A;  2FUG 2;  3IRA A;  1T4Z A;  3FW2 A;  2ALB A;  2QSI A;  2H72 A;  2E2G A;  2GSS A;  2QGV A;  1PL1 A;  1M9B A;  2GVP A;  2WS2 A;  5DQS A;  5LNK e;  4IQA A;  4MNN A;  5D9V A;  2MMA A;  2VL9 A;  1LBK A;  2H19 A;  3KP9 A;  2CA8 A;  3EMP A;  3RAZ A;  4MF5 A;  1MDI A;  1DE2 A;  2Z9S A;  3IR4 A;  3LSZ A;  2KP2 A;  4HUA A;  1UVZ A;  1PL2 A;  3BJ5 A;  3APS A;  4N0Z A;  1N2A A;  3TB2 A;  1QUW A;  1DE1 A;  4WBJ A;  4WKW A;  5ECO B;  4KA0 A;  2GSQ A;  4ZB8 A;  1MD4 A;  1J0F A;  5KEJ A;  4G2E A;  2UZ8 A;  3FY7 A;  5HR0 A;  2B7K A;  2DSA A;  1T00 A;  1PSQ A;  1AIU A;  17GS A;  3CYN A;  1QGV A;  3RPP A;  3IDV A;  3UBK A;  4I97 A;  1CQG A;  3KEB A;  3L0H A;  4ZBD A;  2ZNM A;  3TOT A;  1O81 A;  3M9J A;  1GTB A;  1FVJ A;  1B9X C;  3ISO A;  4X43 A;  1BX9 A;  3RHB A;  2ES7 A;  1FOH A;  3HHV A;  5KN2 A;  3EVI A;  5G31 A;  3GL3 A;  1WP0 A;  1JHB A;  4ZL9 A;  1JZO A;  1EGO A;  3UIW A;  3A3T A;  4ICY A;  1XOB A;  4I2T A;  2D2Z A;  4ZL7 A;  3TJF A;  3WGD A;  2AHE A;  2LS5 A;  1K0M A;  4N30 A;  4J57 E;  1G6W A;  5B6N A;  2JSY A;  4ECJ A;  2I1U A;  1V40 A;  3EE2 A;  3HXS A;  2YNX A;  2EC4 A;  3GST A;  4X0X A;  5J4U A;  2RUE A;  1ZL9 A;  4J56 E;  3DD3 A;  5IMD A;  2V6K A;  4IP6 A;  4MH2 A;  1NM3 A;  1TI1 A;  4RQR A;  4YQV A;  4YQU A;  2VAF A;  3LWA A;  2ZUP A;  1URM A;  2XPD A;  1MDJ A;  2WZ9 A;  5C00 A;  1GTU A;  1GSU A;  2H75 A;  1GTA A;  4IJI A;  2MMO A;  4P3Y B;  3KD0 A;  5FT3 A;  2BMX A;  1YY7 A;  1A2M A;  4MJB A;  2FY6 A;  4ECB A;  1O6J A;  2KP1 A;  3A5I A;  5HFK A;  2GTU A;  3UAP A;  3C8E A;  3QDN A;  5LCZ A;  3UOM A;  3FEU A;  3VWV A;  1JZD A;  5ID2 B;  2IN3 A;  1OC9 B;  1EOH A;  2IFQ B;  3GNJ A;  3GFK A;  1FOV A;  4LMV A;  5JWQ B;  3GL5 A;  2E0Q A;  1TK8 B;  2YJ7 A;  4FYU A;  1BJX A;  2LQQ A;  4F9Z A;  1TDI A;  4PQI A;  2DIY A;  2A2S A;  5ECL B;  1Z6N A;  5F05 A;  2FWG A;  4PQH A;  1MTC A;  1WE0 A;  2IIY A;  3APO A;  5DQY A;  3S9F A;  1TW9 A;  3DKS A;  1GUM A;  1R7H A;  3ZZX A;  4FH8 A;  2VCW A;  1OE8 A;  3GTU B;  1U3I A;  3ZIV A;  1Z7R A;  1RQM A;  1ABA A;  1GNW A;  4FQU A;  1SL0 B;  1SKR B;  3IAM 2;  2O87 A;  1BYE A;  1BAY A;  4L0U A;  2C3Q A;  1XWG A;  3GHA A;  2DJJ A;  3F6F A;  4GSN A;  1FW1 A;  1AW9 A;  3QFB C;  2YWM A;  5ECS A;  4GST A;  2C1Y A;  1XW9 A;  1B9Y C;  5JWR B;  3HVV A;  2NVL A;  1WRY A;  4O7H A;  3JCM L;  5GZZ B;  4BVX B;  3ZL5 A;  3F4T A;  1ERW A;  5IMV A;  4G9H A;  2DML A;  3FR9 A;  2HRA A;  3DYR A;  1ZYP A;  1THX A;  4LL4 B;  4RI7 A;  2J9H A;  3IK7 A;  4POM A;  4F03 A;  4K5R A;  3I69 A;  3VWU A;  2M72 A;  2OBI A;  1A2L A;  3CTF A;  2JAD A;  4CHS A;  2OE3 A;  3UL3 A;  5ELG A;  3TKP A;  4DEJ A;  2IL3 A;  3TOU A;  3R3E A;  3QOU A;  5EPF A;  6GST A;  3GYK A;  4N10 A;  4POK A;  2L4Q A;  4AJ6 A;  3J7Y b;  2N5A A;  2L4C A;  2V1M A;  3M1G A;  3F9U A;  1ILO A;  2B7J A;  1B48 A;  1THO A;  3MDK A;  3UMA A;  2HSM A;  1B8X A;  4HOJ A;  2A2P A;  2VCV A;  5DAK B;  5A4W A;  1M7T A;  4MJE A;  2H6X A;  1ZOF A;  1TI3 A;  4FYB A;  1YQ1 A;  3QFA C;  4F2I A;  1Q4J A;  1R5P A;  13GS A;  3PPU A;  2WFC A;  1GSS A;  3EUR A;  2CVK A;  4Q5Q A;  1EP7 A;  1YKC A;  3KIJ A;  4G0K A;  2K18 A;  2VCZ A;  3WD6 A;  5ECI B;  5F06 A;  5ENU A;  4KF9 A;  2FA8 A;  2R2J A;  2YWO A;  5DJM A;  2CVB A;  3EWL A;  3KM6 A;  2CV4 A;  3KGK A;  4XS4 A;  1A8L A;  3FK8 A;  3LQ7 A;  5CNW A;  2V2G A;  4IP1 A;  1HNB A;  1NW2 A;  4PNF A;  5AIS A;  1PKW A;  1XWC A;  2PVO C;  5JCW A;  4G10 A;  1OC3 A;  20GS A;  4N0V A;  2X8G A;  2GDR A;  2K9F A;  3UAR A;  5A4U A;  1V2A A;  2HSH A;  4PTS A;  2FGX A;  3HVX A;  3P7X A;  3PIN A;  1YJ6 A;  1VRS D;  2EIR A;  2VO4 A;  1T7P B;  2X4A A;  1K0D A;  3ME8 A;  4EL1 A;  2WJU A;  4PX1 A;  2CVD A;  3GKX A;  2CZ2 A;  2GST A;  1Z3E A;  3H79 A;  3LJR A;  2VM2 A;  4KAE A;  3CSJ A;  3GH6 A;  5HFG A;  3TRQ A;  1K0O A;  2BJX A;  4RI6 A;  3VLN A;  2B1K A;  2C0D A;  4ACS A;  1XFL A;  4KE3 A;  4PUR A;  4GLT A;  5B8B A;  4IVF A;  5KN1 A;  1A23 A;  2YV9 A;  3CTG A;  3GX8 A;  4AF2 A;  1VGL A;  1EP8 A;  4EVM A;  1AQV A;  2I9H A;  2K8S A;  4RUV A;  5CRG A;  2JAC A;  5D9W A;  1FG4 A;  3PGT A;  2HE3 A;  5D9T A;  5DBQ A;  3ZIJ A;  1AXD A;  1EGR A;  5COH A;  2DMM A;  3M8N A;  2PUK C;  1TRU A;  2PN8 A;  4PUF C;  5ECH B;  3UVH A;  1F37 A;  2L5O A;  1U6T A;  1TTZ A;  1XCC A;  2PER A;  4MH3 A;  2HZE A;  3K8N A;  3RPN A;  5IPH A;  2R3X A;  2C80 A;  2AUV A;  2FWH A;  2LNS A;  4EF0 A;  2H30 A;  2L57 A;  4ZXG A;  1U87 A;  3D6I A;  2I3Y A;  4DSS B;  5ECQ B;  2DIZ A;  2WRT A;  3QPM A;  14GS A;  3ZMK A;  4HEA 2;  3LYK A;  5ECR B;  4PGT A;  4CY6 A;  2NDO A;  1NHO A;  4HS1 A;  1XVQ A;  4KSO A;  4BL7 A;  2GSR A;  2PU9 C;  4MPG A;  5J41 A;  2PPT A;  3C1S A;  6GSW A;  2C8U A;  1V98 A;  1UA5 A;  2HNL A;  2HXK A;  4K6X A;  1CQH A;  5H5S A;  1QK8 A;  2H0H A;  2H1D A;  2YPM A;  2H71 A;  1SKW B;  2O8V B;  4ZB9 A;  1F3B A;  2VOC A;  4QL7 A;  2AJQ B;  3KTL A;  3IC4 A;  4KCE A;  5CRH A;  1BED A;  1T4Y A;  2XBI A;  4POL A;  2LEG A;  3TKS E;  2VD1 A;  2LJR A;  3QCP A;  4KB3 A;  1WIK A;  1Z9H A;  4K1F A;  2VCQ A;  2R5G A;  1ML6 A;  4O5U A;  4PNG A;  2OE1 A;  3LXZ A;  2KHP A;  3G7Y A;  3LOR A;  1J08 A;  3QAG A;  5ABR A;  2GZP A;  3MAK A;  5B7C A;  1JZW A;  4L5O A;  4K5S A;  5IMA A;  2E7P A;  11GS A;  4MMM A;  5D8I A;  3Q6O A;  4JR4 A;  1KNG A;  3QAV A;  3P8W A;  2VCT A;  5G30 A;  1F2E A;  1SJ6 A;  4JE1 A;  1A0R P;  4IGJ A;  3HYP A;  4AJ7 A;  5HR1 A;  1A24 A;  5JCU A;  2GLR A;  5CRE A;  4IN0 A;  3R2Q A;  1ACV A;  2V41 A;  4OFT A;  3IE3 A;  2GGT A;  1GRX A;  1KEB A;  4ISD A;  3ERF A;  4NWY A;  3IK9 A;  2X99 A;  5EL8 A;  2WCI A;  3L9U A;  4KX4 A;  1Z5Y E;  3MSZ A;  1U88 A;  4V2L A;  3ZVJ A;  2QA1 A;  4EXJ A;  2YP6 A;  2R0P A;  5GST A;  3ZFL A;  2VL3 A;  2YV7 A;  3FZ5 A;  1EOG A;  1T1V A;  4WR5 A;  5HR3 A;  2GT6 A;  1ZYQ B;  2FLS A;  1MDK A;  2B3S A;  4O32 A;  1EWX A;  1K0N A;  4ILF A;  1AQX A;  1Z6M A;  5J9B A;  4ML6 A;  1XOA A;  2P5Q A;  4L8E A;  3ERG A;  4XIH A;  3U6V A;  2L6D A;  2JL4 A;  1M2D A;  2H76 A;  2H6Z A;  4HU7 A;  5F0G A;  3QAW A;  2CAQ A;  2K6V A;  2GS3 A;  4KDU A;  1M99 A;  2M46 A;  3KJY A;  4MA9 A;  1SD9 A;  2FA4 A;  1VF1 A;  4TR4 A;  1A2J A;  3I43 A;  1K3Y A;  2NTO A;  1SKS B;  5DDL A;  4CDO A;  4OD7 A;  3W8J A;  1W4V A;  2PVQ A;  2PMT A;  3ERW A;  3D4T A;  4WR4 A;  3HJM A;  2CAI A;  1ZMA A;  1G7E A;  1XBS A;  5DVB A;  1SEN A;  3QMX A;  2P31 A;  2YN1 A;  1G7O A;  2MZC A;  3IA1 A;  1K0B A;  3BBY A;  4XRD A;  1QMV A;  1N8J A;  2VLT A;  4YKF A;  4MJC A;  4OO4 A;  2H1A A;  3ZVJ D;  4IQ1 A;  4BVY A;  3UVT A;  3E3E A;  4ZIL A;  3M0F A;  4EDZ A;  3FRC A;  5DCH A;  1F3A A;  2RLI A;  1TK0 B;  4ZBB A;  1ZZY A;  1W89 A;  2GQK A;  3CRU A;  4NV5 A;  3D22 A;  5B8A A;  4FO5 A;  4EDY A;  4JBB A;  2F9S A;  1M2B A;  3WT2 A;  1GUL A;  1X5D A;  2H66 A;  2MBS A;  4I8B A;  22GS A;  2O89 A;  2RM5 A;  3L9V A;  2O85 A;  3MNG A;  5C04 A;  4MPF A;  2REM A;  1ON4 A;  5AIV A;  2FHE A;  2XC2 A;  1GTI A;  4MZC A;  2B1L A;  3D4M A;  4YKG A;  5D93 A;  1PN9 A;  4KND A;  5DAL A;  3SBC A;  1MD3 A;  2GT5 A;  5G1K A;  2LJA A;  1JLW A;  6GSV A;  3FZA A;  2HT9 A;  3A2W A;  4XCS A;  5HFI A;  1OKT A;  5J3R A;  4OFM A;  2YOI A;  2E2M A;  1E6B A;  3TKS C;  6GSX A;  2CZ3 A;  4OFN A;  2B5Y A;  1FO5 A;  4BWS A;  2GQM A;  1GL8 A;  3KP8 A;  5KOX A;  5B6M A;  4IHU A;  4NAX A;  1TRW A;  2WDU A;  2OA7 A;  4HU9 A;  2RM6 A;  3C1R A;  3MWH A;  3CSH A;  4BA7 A;  3DVX A;  3QD9 A;  3TJK A;  2X64 A;  4O92 A;  4TXV A;  4GQC A;  4XS1 A;  5IO0 A;  3FYG A;  4F0C A;  2B5E A;  2PBJ A;  1J9B A;  1IYH A;  2C0F A;  1T8E B;  6GSY A;  2CT6 A;  2OAC A;  3EC3 A;  5ECP B;  5F8B A;  2LJK A;  3ZRE A;  2JU5 A;  4WF5 A;  2N5B A;  2IMF A;  4Q5F A;  4EIP A;  3HY2 A;  3IHQ A;  3TJB A;  1SL2 B;  4L0W A;  4D73 A;  4GXZ A;  2HRN A;  1G0T A;  2A4H A;  2WB9 A;  1AC1 A;  5GSS A;  4O5Q A;  2H6Y A;  2H1B A;  3C7M A;  3ZIT A;  4TR1 A;  4EC0 A;  5D73 A;  2LTK A;  4YAV A;  3G7J A;  3G7I A;  3ME7 A;  3D21 A;  1H4O A;  4MF6 A;  1TKD B;  2WUL A;  4Z2T A;  3HCZ A;  1PN0 A;  2QA2 A;  1USB A;  3CRT A;  1X0R A;  4DVC A;  2MYG A;  1OVN A;  3DVW A;  2EIQ A;  3TDG A;  1GUH A;  1SK0 A;  2ON7 A;  2TRX A;  3TCO A;  3IOS A;  1Z7P A;  3FKF A;  1EEJ A;  2QC7 A;  1WWJ A;  3DWV A;  1SU9 A;  3ZFB A;  1K3L A;  1I5G A;  1FB0 A;  4JZQ A;  1XWK A;  5LD0 A;  1RW1 A;  4MP4 A;  2CQ9 A;  3DEX A;  2DJ3 A;  2VLV A;  1PRX A;  4OWY A;  4AGS A;  4ZB6 A;  1TU8 A;  1ERU A;  2LKU A;  4ZBA A;  2H70 A;  4TXO A;  4LMW A;  4RQX A;  4QL9 A;  4I6X A;  5IOX A;  4MZW A;  1EV9 A;  5KN0 A;  2IME A;  1OE7 A;  2CX3 A;  4X4J A;  2C0E A;  4MDC A;  3VWX A;  4LL1 B;  3AY8 A;  3I9V 2;  1TJD A;  4YQM A;  3TJG A;  1WOU A;  4KCA A;  4V2M A;  4WEY A;  3PH9 A;  3HZ8 A;  2R6K A;  3GKK A;  3GUS A;  5E4W A;  8GSS A;  1YF1 A;  19GS A;  4KDY A;  2TIR A;  2JSZ A;  4MK3 A;  4EO3 A;  2R37 A;  2IWT A;  4MJA A;  2MMN A;  5G1L A;  1GSE A;  3FR6 A;  4MCU A;  3APQ A;  1TK5 B;  5BMU A;  3IHG A;  1ST9 A;  2X8C A;  3CXG A;  3I6A A;  1R5A A;  4JED A;  5IQY A;  5AIX A;  2X8H A;  9GSS A;  4AJ8 A;  3TKS A;  3VPT A;  3GIX A;  2EIO A;  1OYJ A;  4IBP A;  3Q74 A;  3NOF A;  4TRX A;  1SYX A;  1SJZ A;  3UEM A;  1V58 A;  4Z2R A;  3WGE A;  2F3M A;  3KTB A;  4ECC A;  2OKA A;  1DUG A;  3F3Q A;  4IKH A;  2HLS A;  1O85 A;  3BCK A;  3RHC A;  4JU5 A;  2IJY A;  3MIX A;  3ZML A;  4GWR A;  1BG5 A;  2GQL A;  1X5E A;  2H8L A;  3DRN A;  5GAN D;  2IMI A;  1E2Y A;  1GUK A;  2H73 A;  2MMZ A;  2ZCT A;  4OCF A;  3EU4 A;  2QKE A;  3DML A;  2XHF A;  3FZ4 A;  1PX6 A;  1UN2 A;  4DSQ A;  5KN3 A;  4KSM A;  5J5N A;  1OC8 A;  2VLU A;  1EV4 A;  2LRT A;  3EMX A;  4E8H A;  1JZR A;  5KOW A;  5F07 A;  3GV1 A;  2FD3 A;  1TXX A;  3VI7 A;  3F8U A;  2GZZ A;  3L9S A;  2P0G A;  1H75 A;  5BRT A;  1TRV A;  2F51 A;  3FMW A;  4GRF A;  4PUA A;  2RUF A;  1R26 A;  1DSB A;  3IC8 A;  4QQ7 A;  5IIZ A;  3A5W A;  3GX0 A;  3WT1 A;  3V1W A;  3VPQ A;  2B5X A;  2IMD A;  1B4Q A;  1HNA A;  1PKZ A;  2XPE A;  2BTO T;  4V2N A;  2RII A;  2YJH A;  4XS4 B;  4YH2 A;  5ID2 A;  1ERT A;  1WJK A;  4EIQ A;  1OC9 A;  2IFQ A;  2OJL A;  1EZK A;  4BWQ A;  5J9C A;  3ZYW A;  3WGX A;  3F6D A;  3LEF A;  2HRK A;  3IXR A;  3BD2 A;  4XRA A;  2DKI A;  5INY A;  5JWO B;  1OAZ A;  3LG6 A;  1K0C A;  3TKR A;  3H1N A;  2G0F A;  3O6T A;  4ML1 A;  3GKM A;  5A4V A;  5CAX A;  4TKY A;  4J2F A;  2DJ1 A;  3EYT A;  1PMT A;  4H86 A;  2HI7 A;  3M9K A;  5CRW A;  4JR6 A;  1G6Y A;  2YCD A;  1GP1 A;  1X5C A;  3GTU A;  5H5R A;  2G2Q A;  3HD5 A;  2FCH A;  4K8M A;  2YAN A;  5H5Q A;  3D5J A;  3DGQ A;  2K8V A;  2NBS A;  4XTS A;  5IMF A;  3F4R A;  1MEK A;  3VWW A;  4TOP A;  3FR3 A;  4G0I A;  1XW6 A;  3HDC A;  4TVE A;  3HA9 A;  3GMF A;  3A2V A;  5HQP A;  3CBU A;  4K7O A;  1YF0 A;  4IW9 A;  1YEX A;  5HR2 A;  1TOF A;  1K3O A;  4G19 A;  3HJO A;  4NV2 A;  3IBH A;  3ZTL A;  3N9J A;  4BVX A;  2LNT A;  4HZ2 A;  4IS0 A;  2HZE B;  2LST A;  2VL2 C;  2FWE A;  5A5K A;  1HNC A;  4WF4 A;  3TUE A;  2VD0 A;  3LYP A;  2LV3 A;  3KZQ A;  5G2Z A;  4GSS A;  1GSQ A;  3KMO A;  4F82 A;  3PR8 A;  2FWF A;  2IPA A;  2XBQ A;  2R4V A;  1XIY A;  2DC5 A;  2L5L A;  2YZH A;  1QXH A;  4Q5N A;  2MBT A;  4L5L A;  2YWI A;  1GNE A;  3DIE A;  4Q5R A;  4BL7 B;  2L59 A;  3HZ4 A;  3LW9 A;  3ZRD A;  2H01 A;  1A0F A;  2H0I A;  5IMC A;  2LUS A;  3GUR A;  4G0L A;  3BCI A;  4TR3 A;  2A2R A;  2ON5 A;  2LRN A;  5EVO A;  3TKQ A;  1M0U A;  5DAK A;  4GCI A;  4K7I A;  4O5R A;  1FHE A;  2L6C A;  3F0I A;  3H4K A;  1M9A A;  4K7N A;  3KXO A;  4WXT A;  1GSY A;  5AN1 A;  3QR6 A;  1GSD A;  5G5F A;  3LXT A;  4WET A;  3C71 A;  2X49 A;  4ZIJ A;  2R0G A;  1GSF A;  3E0U A;  1SK1 A;  1I9D A;  4HDE A;  2F8F A;  18GS A;  2DJ2 A;  1LU4 A;  3RDW A;  3EPT A;  1O73 A;  3GRX A;  7GSS A;  5IPG A;  2TRC P;  3D0Z A;  1QFN A;  1X9M B;  1XVW A;  1B4P A;  3SWL A;  2V32 A;  4IEL A;  4OCE A;  4HQZ A;  5G5E A;  4WBR D;  4OMV A;  5EY6 A;  3O76 A;  1ZYN A;  4ZL8 A;  2C3T A;  2O7K A;  1VF2 A;  5AGY A;  1V9W A;  2KLX A;  1NSW A;  3VK9 A;  1YKA A;  3U5R E;  1JFU A;  5CP1 A;  5CRD A;  1SYR A;  1PX7 A;  1DBY A;  1JLV A;  1SL1 B;  2DJK A;  3FHK A;  2VM1 A;  1X9S B;  2VCX A;  1KBN A;  4N11 A;  3EU3 A;  5IMZ A;  1S3D A;  4ID0 A;  3UJ1 A;  4ECI A;  4V1A p;  3EIN A;  2HRF A;  4TN8 A;  2AYT A;  1GLP A;  4EKZ A;  1O7U A;  4K2X A;  5ECK B;  4IJ3 A;  2OAD A;  1HQO A;  2VIM A;  3HKR A;  1PA3 A;  4FYC A;  1FVK A;  3TGZ A;  2FNO A;  1R4W A;  1K0A A;  4X1U A;  2B6M A;  3F3R A;  4F0B A;  1XPV A;  1HD2 A;  3HVS A;  4MF7 A;  5JCG A;  1PD2 1;  1AAZ A;  2VL2 A;  3HJP A;  4PQ1 A;  3KH7 A;  4KH7 A;  1WPI A;  3VFI A;  4OO5 A;  2VUP A;  3GKN A;  4HJM A;  1XZO A;  4GQF A;  5E59 A;  4DSS A;  5IOW A;  2JZT A;  2OE0 A;  4K2D A;  2YZU A;  2H74 A;  3LFL A;  3DXB A;  3Q19 A;  1YZX A;  4YAP A;  3H93 A;  1WMJ A;  2I4A A;  2H0G A;  2C0G A;  4KGI A;  4BVY B;  16GS A;  1ERV A;  2DKH A;  3IAS 2;  6GSU A;  1S3C A;  5CYY A;  4MLY A;  2I81 A;  1XWA A;  2YWN A;  3NIV A;  3CSI A;  1IYI A;  3F63 A;  10GS A;  1FAA A;  1V57 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...