2H6ZA

Crystal structure of thioredoxin mutant e44d in hexagonal (p61) space group
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
108
structure length
108
Chain Sequence
SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDDIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Thioredoxin
publication title A stability pattern of protein hydrophobic mutations that reflects evolutionary structural optimization.
pubmed doi rcsb
source organism Escherichia coli
total genus 30
structure length 108
sequence length 108
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2h6zA00
3KTLA 5GZZB 4MJAA 5EL8A 2YPMA 1LBKA 3UJ1A 2LQQA 3M9KA 4N0ZA 1ST9A 3LORA 1M9AA 5J9BA 1EOGA 13GSA 4ULXA 5ECSA 4ISDA 2HE3A 3FR9A 1SKRB 4KAEA 1THOA 4MP4A 1KNGA 2GQMA 2HYXA 4WETA 4OO4A 2HSHA 1Y6EA 3TOTA 1TTZA 3EMXA 1GTBA 5DAKB 1A0FA 1MDKA 2H1DA 3CSHA 4L5OA 1XWGA 2GZYA 1TK0B 1NHYA 1TP9A 3CYNA 1V57A 3ZLPA 4JE1A 3G7IA 1Z5YE 4YAVA 5B6NA 5G1LA 3DWVA 2C0EA 5IMCA 1YF1A 2K8VA 1XIYA 4TXOB 4KE3A 4MF6A 3U5RE 3MSZA 1KBNA 1Q98A 5D8IA 3E9JB 2FWFA 22GSA 2RM6A 5CREA 2DJ1A 1ZOFA 3Q18A 3CRTA 1R4WA 4K9ZA 4IP6A 2JADA 3KMNA 1SK1A 1XVQA 4HQSA 4MF5A 6GSTA 1OE8A 1SKWB 3HVVA 1OYJA 3GTUB 3IHQA 3A2WA 3QMXA 2H30A 3ZFLA 3L0HA 4DVCA 3LYPA 4HUAA 3KIJA 4PNFA 14GSA 3HVXA 4TR3A 5J9CA 3ZIJA 1HD2A 1OC9A 4TXVA 3DEXA 1Y25A 1TI1A 1WPIA 4KA0A 2DJJA 3EMPA 2IPAA 4OFTA 3KTBA 4GSSA 4WF5A 2C0DA 4MJCA 3TJBA 1WOUA 5JWQB 5HFKA 3FR6A 4V1Ap 1N2AA 3VPTA 4IELA 3C8EA 2O85A 2A2RA 2YNXA 1TK5B 1VF2A 3QOUA 3IR4A 3ZL5A 4HU9A 2H0IA 5ID2A 3EYTA 3GKMA 5CNWA 3GMFA 3W8SA 1X9MB 1EZKA 1G7EA 3D0ZA 3GFKA 3L78A 2TRCP 1K0BA 2XC2A 4MF7A 4FYBA 1X5EA 2L6DA 3CMIA 1W4VA 5L71A 1HYUA 2VL2A 4MCUA 3CTGA 3TJGA 1NW2A 2BTOT 2HXKA 3ZRDA 3VWUA 2K6VA 4K7NA 4O5RA 1S3DA 2IMDA 4K6XA 5KN3A 3F9UA 2VL9A 1F2EA 5JWRB 2H8LA 2VCXA 2OE0A 5AGYA 3A3TA 3U6VA 3EINA 3KJYA 2C80A 5CO3A 1TDIA 1C72A 2LRNA 2VD0A 2L6CA 3DGQA 2GVPA 1SD9A 2V1MA 2P31A 2DJ3A 3HXSA 1RK4A 3ISOA 3KP8A 4IVFA 2EIQA 3LG6A 2BMXA 3VWVA 2HZEA 3L9UA 3TJKA 4KX4A 2NDOA 2GT5A 2B7KA 1YZXA 4ZBBA 4V2NA 3NOFA 4J57E 4QL9A 1SYXA 1B4QA 2VD1A 4BWQA 4NWYA 1PA3A 4MZWA 4KCAA 1V40A 1G6YA 2ON7A 3GL3A 5ECPB 4IKHA 1E2YA 2WB9A 3I6AA 1T3BA 4K7IA 2CQ9A 4RUVA 4Q5QA 1KEBA 1QK8A 3IRAA 5G1KA 1GUMA 2HFDA 3KM6A 1GTIA 2DJ0A 5A4UA 2PU9C 3WYWA 2GZZA 4JBBA 4DEJA 4CDOA 3F3RA 3TDGA 4P3YB 1HNBA 4IP1A 1A0RP 2H1GA 2J9HA 4GF0A 4HJ2A 3KH9A 4EDYA 1VRSD 3IAM2 3UL3A 2GGTA 1OC9B 3UAPA 2LNSA 4EE0A 1TJDA 4MH3A 1VF4A 4CHSA 3RPPA 4KH7A 2PBJA 2LQOA 2VCVA 2H01A 4TVEA 4PGTA 1GSDA 1CQGA 5CRGA 1Z7PA 4XS4B 3IDVA 3VFIA 1ZYEA 1GSUA 3I9V2 4K2DA 2H70A 3BOAA 3EVIA 1V9WA 2JU5A 10GSA 2KP1A 5F05A 2GSQA 5IO0A 5B7CA 1GRXA 3GX8A 1XW9A 1GLQA 1UC7A 2VIMA 2F51A 3UMAA 5D9VA 2H74A 2R4VA 3CBUA 1OC3A 4KDXA 5D9WA 2GDRA 2VLUA 1HNAA 1LJRA 6GSYA 1DUGA 4ZB6A 2RUEA 4V2MA 4F0CA 4DSQA 2E2MA 2B1KA 1PX7A 4NMUA 5GSSA 4F0BA 3E0UA 2PVOC 1ILOA 1HNCA 4ZL9A 4HS1A 1T8EB 2AAWA 2DJ2A 4GLTA 3TRPA 8GSSA 12GSA 3HA9A 4ECBA 3QFAC 5COHA 5IPGA 4BL7A 1MDIA 3S9FA 1TW9A 3BCIA 3FZ5A 1F3BA 4AJ7A 1O7UA 4ILFA 2V41A 1H4OA 3TKSC 2H1AA 4AJ8A 5KN0A 3VWWA 4YAPA 3V1WA 2DIYA 1PRXA 2X99A 3ME7A 2C0FA 4EKZA 1T1VA 4MK3A 1SU9A 2V2GA 2LJRA 3WGEA 5IMZA 2C1YA 4PQHA 4JZQA 3ZITA 1F37A 3G9BA 4HU7A 1BX9A 2C4JA 1M9BA 4I5QA 4WXTA 1Z3EA 1GTAA 3WT2A 3HJMA 17GSA 4KW6A 1YJ6A 1MTCA 3IBHA 3UARA 1UVZA 2ZUPA 2R6KA 4GXZA 2VCWA 3TJFA 1TRSA 2R37A 3F4TA 1B4PA 1XVWA 4KSMA 4ECCA 4PUAA 2EIOA 2F8AA 5D93A 4ZBAA 1IYHA 4KB3A 3NIVA 3GYKA 3NZNA 5DBQA 2RLIA 1OC8A 2NPBA 3M3MA 1AXDA 4NV5A 2H19A 2YANA 1T7PB 1X0RA 2CX3A 1A2MA 5DQYA 4GWRA 2AYTA 3LXTA 4L5LA 4O7HA 1JZRA 3ZYWA 2LS5A 4NXIA 2VCQA 2VLTA 1GSYA 2YWOA 3KMOA 4ZXGA 5INYA 2OADA 2GSSA 4MPGA 1GNWA 3JCML 5ENUA 4EDZA 1KTEA 3UBLA 2B1LA 2A2SA 3VWXA 4ID0A 4LA1A 3APOA 3GL5A 4KCEA 4TR1A 1O6JA 3FEUA 2I9HA 1A2JA 3IPZA 2JSYA 2FA8A 1GSEA 3ERWA 2IWTA 2GT6A 3WT1A 1FB0A 3WD6A 2FWGA 3GKNA 3P8WA 3GN3A 1H75A 4IW9A 2WFCA 4HOJA 2CVDA 1PSQA 3GA4A 1PQNA 3M9JA 3P90A 2DIZA 5AN1A 2OA7A 4FIWA 1B9YC 3DKSA 2LUSA 1GSQA 4YQMA 2TRXA 1WRYA 5FT3A 1S3AA 1TOFA 1O8WA 3H8QA 4L0WA 2GS3A 1FO5A 1R26A 5LNKe 2P5RA 4KSOA 4K8MA 4I8BA 2R5GA 5DALA 5G30A 5ELGA 1F6MC 3EE2A 4IBPA 1J08A 2HLSA 4IN0A 2RUFA 3IA1A 4L0UA 2QKEA 2L4QA 3ZTLA 3TUEA 1N8JA 3IE3A 1XW5A 3TJJA 2MYGA 2C3TA 4YQVA 2IIYA 1XWAA 2VM1A 1EEMA 2CVBA 3HJPA 1U87A 1YQ1A 3HZ8A 3GSTA 4N10A 1Z6NA 2G2QA 2AJQB 4MABA 2CX4A 2F3MA 3HYPA 1GP1A 3BJ5A 3KCMA 3FRCA 4TRXA 3ME8A 4TKYA 4V2LA 2MMZA 2CA8A 3FZ9A 2MMOA 4MLYA 2LRTA 2VM2A 1OAZA 5G2ZA 1SENA 3FYGA 5KEJA 4PUFC 3LYKA 1AW9A 3ZVJD 3GX0A 5ECMB 5DCHA 2GQKA 2IFQA 2ON5A 2VOCA 2JZTA 2H73A 4WR4A 1OKTA 1QUWA 2FWEA 3TCOA 2LJAA 4LL4B 4DSSB 4TR1B 4F82A 3D4TA 2FD3A 3DD3A 3LFLA 3I43A 5LD0A 5ECQB 4OWYA 2FLSA 2P5QA 4FH8A 1IYIA 1PL1A 5IMFA 2L5LA 2M80A 1PN9A 2V6KA 1O81A 4ZILA 5HR3A 3F4RA 2D2ZA 1F9MA 3HDCA 3CXGA 3HKRA 4IQ1A 5GAPD 5B8BA 4GSTA 1THXA 3LJRA 2HI7A 4I2TA 2H75A 2B5XA 2PWJA 3P7XA 2ES7A 3QCPA 3KZQA 4GQCA 4X43A 1WP0A 3MNGA 1G7OA 1JHBA 5C00A 5JCUA 5F06A 3TGZA 2NVLA 1TRWA 2VUPA 3H1NA 1XWBA 1BQ7A 3IOSA 2J23A 1JLVA 4GTUA 2PGTA 1ERWA 2HRFA 3RHCA 3TRQA 1OE7A 4JR6A 2WS2A 1XFLA 4KDYA 2YN1A 3UBKA 5F0GA 2B3SA 2R3XA 4K1FA 3QR6A 4GRFA 4AJ6A 1EV9A 1K0MA 5B6MA 1R5PA 3IXRA 4O32A 1YF0A 5A5KA 2IL3A 3PGTA 3UVTA 1FAAA 3EWLA 1W89A 2JZSA 3ZFBA 5KN1A 2CVKA 3APSA 3TKSE 2YCDA 2K18A 4OMVA 3PINA 3KXOA 3L9SA 4YQUA 2Z9SA 3ERFA 2WCIA 4IGJA 2LKUA 5FWGA 5DVBA 1FHEA 5CP1A 2I3YA 1QGVA 5ECIB 3CSJA 4WKWA 1EGRA 3LEFA 1A8LA 3H93A 3QPMA 2VL3A 2JACA 2IMIA 4KNDA 3DMLA 1NM3A 2C3QA 4V1Ag 5CYYA 3Q74A 1SKSB 3GH9A 4FYCA 2OACA 5G5EA 1ON4A 2F8FA 1G0TA 4ZL7A 5CAXA 3LWAA 4H86A 1BYEA 3OR5A 2N5BA 2N5AA 5AISA 4D73A 1AUCA 1A24A 3VLNA 3CRUA 2IJYA 2NTOA 3DXBA 1S3CA 2GTUA 3GKKA 2B7JA 2M46A 1X5CA 4HJMA 4IJ3A 3VK9A 5ID2B 5GSTA 4E8HA 3TRXA 3P2AA 2I81A 2WDUA 3J7Yk 2V32A 3GH6A 1QQ2A 1Z9HA 1UN2A 2B5YA 4IHUA 3MDKA 1XBSA 3L9VA 4E8EA 5AIXA 2DC5A 2DMLA 4POKA 3GURA 4EF0A 1K0NA 2H76A 1ZMAA 2FGXA 4N11A 4PNGA 3C1SA 4I97A 6GSXA 4J2FA 5IOXA 4EUYA 3VI5A 3H79A 4ZIJA 2DLXA 2H0GA 3GNJA 4KGIA 1X9SB 3ZREA 2WZ9A 4O92A 6GSSA 3FHKA 3HZ4A 2YZHA 3G7YA 1U3AA 2I4AA 4YH2A 2HZEB 3RAZA 5A4VA 1EP7A 1JFUA 4XIHA 4K0NA 1Z7RA 3WGDA 3QAWA 1FVJA 1XXUA 3KP9A 2JL4A 5DCGA 2RM5A 1Z6MA 6GSWA 1T4ZA 5D9TA 4ZBDA 4JRRA 2H66A 2O7KA 3M0FA 3LGCA 3D21A 2O89A 2B6MA 3R2QA 1V98A 2VO4A 4ML6A 5IMVA 1DBYA 5JWOB 1R7HA 2EIRA 1AQVA 1GTUA 4MJEA 3QAGA 3HY2A 4GCIA 5D96A 2H6ZA 1ZCPA 5EPFA 2IMFA 5GAND 2MZCA 1DE1A 4EC0A 5E59A 3L4NA 1GNEA 3RPNA 4PURA 4TR0A 1PKZA 2DMMA 4KUNA 1SK0A 2HZFA 2VLVA 1V58A 2PUKC 4CW9A 5ELAA 1PGTA 4LMVA 2WRTA 3PH9A 2PERA 3EU4A 4JR4A 1M7TA 2MBTA 2XBQA 3HCZA 4Q5RA 2PMTA 1UA5A 3FR3A 1FB6A 4EO3A 2H1BA 2OBKA 3D5JA 1MD3A 1GH2A 5DJMA 1GUHA 2PN8A 6GSUA 5D73A 5IO2A 1NHOA 4WBRD 3GTUA 2V6OA 4RI7A 3EURA 3H4KA 3UIWA 2G0FA 1F3AA 3QD9A 1EOHA 2GLRA 3UVHA 2R2JA 4BVYA 2OE1A 4XTSA 3DYRA 1NSWA 4TN8A 1YKAA 4X0XA 4GQFA 1YY7A 5D9XA 5IMAA 1GULA 3GSSA 3LSZA 4XRAA 1ERUA 1ACVA 4N30A 4RQXA 4XRDA 2YWIA 1K0AA 2QSIA 4G19A 1AAZA 5ABRA 4WBJA 3GRXA 4IQAA 5DQSA 3DRNA 3ZMLA 1R5AA 3N9JA 3KEBA 3LXZA 5LCZA 2H6XA 1RQMA 3GUSA 5G5FA 1TU8A 3VURA 2HSYA 3O76A 2CT6A 4MMMA 4PX1A 3D4MA 1AQWA 4NPBA 1K3OA 1K0CA 3ERGA 1SJZA 1LU4A 5DJLA 1AC1A 2IMKA 2CAIA 1EV4A 4MH2A 3EU3A 4Z7XA 3PR8A 1K0OA 3Q19A 1TK8B 1URMA 2REMA 3MAKA 1ERTA 19GSA 20GSA 5CRDA 2XHFA 4Q5FA 1XCCA 1PL2A 1PX6A 4NHWA 1JZWA 3DVWA 1GWCA 1X9WB 2WGRA 1K0DA 4POLA 2X8CA 1YEPA 2VCZA 3O3TA 4OD7A 2FNOA 2ZCTA 1XWKA 2AHEA 4KDUA 3MWHA 2KUCA 1DSBA 1A8YA 2DSAA 3GHAA 2L5OA 1X5DA 2P0GA 2B5EA 1HQOA 1XWCA 3TKRA 4WF4A 2WULA 2YV7A 2DJKA 4J56E 1V2AA 4ZB8A 3AY8A 1WWJA 3FZAA 3W8JA 1QFNA 2N5FA 2ALBA 5AIVA 2X8GA 4MDCA 4F03A 1ERVA 1T4YA 4MPFA 2CZ2A 4ECJA 5J41A 3HD5A 5ECLB 2HRNA 2E0QA 3EC3A 2BJXA 1M99A 2LTKA 3DIEA 1J0FA 5J4UA 11GSA 1A23A 3TKPA 5H5QA 3C7MA 1TU7A 2FY6A 1U3IA 5JCGA 1USBA 3TKSA 4I6XA 2NBSA 1E6BA 4WEYA 4XS4A 1M0UA 4LLRA 4PXOA 3TOUA 1JZDA 2XBIA 2H71A 4AGSA 3SWLA 1VGLA 1WE0A 5KN2A 5ECOB 1YEXA 2IMEA 3UOMA 2X8HA 1G6WA 1QXHA 3CTFA 4G10A 2PVQA 2HNLA 4MJBA 5H5SA 7GSSA 5HR0A 3A2VA 3N5OA 1WIKA 2LSTA 3GV1A 3KD0A 2O8VB 3BD2A 5DALB 5G31A 4F9ZA 2F9SA 1JLWA 2L4CA 4Q5NA 3W6GA 1BEDA 2C8UA 4K0GA 5JCWA 3VPQA 4BWSA 1PMTA 1MD4A 4TW5A 3IAS2 3IK9A 3O6TA 3I69A 4QQ7A 4WR5A 3IK7A 5ECHB 1U88A 3ED3A 1M2DA 1BJXA 3ZIVA 5C04A 3TKQA 1I9DA 5CRWA 5HR2A 6GSVA 4OCEA 4DSRA 2I1UA 2GSRA 1FG4A 2LV3A 5HFGA 5IOWA 3HVSA 4MZBA 4GSNA 5B8AA 3HHVA 2MMNA 5EVOA 1VF3A 3C73A 4FYUA 2QGVA 5ECRB 3E3EA 2CV4A 1M2AA 2E2GA 9GSSA 1VF1A 2WJUA 5E4WA 1SD8A 1SYRA 5IMDA 2H6YA 4LMWA 5J5NA 3APQA 2YV9A 2TIRA 2YJ7A 1J9BA 4HEA2 5DDLA 3D6IA 3DVXA 5EY6A 1FOVA 1WJKA 5IM9A 1K3LA 3C71A 3F0IA 2IFQB 4ZL8A 4TOPA 1AIUA 4POMA 1TI3A 2IN3A 1XW6A 4BVXA 2LEGA 2YWMA 1SL2B 1YDKA 2CAQA 1B48A 4LL1B 2RIIA 4HZ4A 5ECKB 4BPYA 4JEDA 2L59A 1FW1A 2YZUA 1GSSA 1I5GA 4L8EA 2EC4A 4XS1A 1SL0B 5FHIA 1ABAA 1TRVA 2LRCA 4OFMA 3J7Yb 2H0HA 4IJIA 3KH7A 3FK8A 1EP8A 1TKDB 1CQHA 1EEJA 3IC4A 4OO5A 2FHEA 2HT9A 2OBIA 1DE2A 2C0GA 4FO5A 3F63A 4JU5A 2KP2A 2FCHA 3FY7A 3UEMA 2E7PA 2XPDA 2VAFA 4OCFA 3RDWA 2H72A 1TXXA 2CZ3A 2GQLA 1XOAA 3HJOA 1ZZYA 2FUG2 1BAYA 3QAVA 1TRUA 2YWNA 4MA9A 2AUVA 1MEKA 4AF2A 1YKCA 4G2EA 4EVMA 1O8XA 18GSA 1ZYQB 2AV4A 2PPTA 4POBA 3KGKA 1XPVA 3GIXA 4RI6A 1ZGNA 2XPEA 2GZPA 3M8NA 2M72A 1PKWA 3C1RA 1ML6A 5F07A 4NV2A 1QMVA 2KHPA 3F8UA 4IS0A 1OKDA 1O85A 2JSZA 2K8SA 4TR4A 3BCKA 2OJLA 4ECIA 5J3RA 3M1GA 1SL1B 2YJHA 2MMAA 1B8XA 2LJKA 3K8NA 3WGXA 1GSFA 1U6TA 4ACSA 2AB6A 2VCTA 3G7JA 1K3YA 5HQPA 2FA4A 4F2IA 3GKXA 1GL8A 5DAKA 2VL2C 1XOBA 2FWHA 1EGOA 3F6DA 4G9HA 4X1UA 5ECNB 4BA7A 4HQZA 3RBTA 2KLXA 1B9XC 16GSA 2K9FA 5F8BA 3F3QA 5H5RA 4NAXA 5IQYA 2KOKA 5IIZA 4D73B 4TXOA 1AQXA 3F6FA 1A2LA 3SBCA 4ZB9A 2OKAA 3CSIA 5HFIA 3D22A 4K7OA 2ZNMA 4HZ2A 3A2XA 2C3NA 2YOIA 2OE3A 3QDNA 1WMJA 4XCSA 4XHMA 5HR1A 2YP6A 3QFBC 3ZMKA 1GLPA 2LNTA 3F4SA 2X64A 1PD21 3A5WA 1JZOA 1MDJA 4NHZA 2DBCA 4XS6A 3FW2A 3IV4A 1OVNA 1BG5A 4HI7A 4PQIA 1SK2A 3ZVJA 1Q4JA 2A4VA 4PQ1A 5CRHA 4HDEA 3TB2A 5IPHA 3BBYA 3RHBA 4MZCA 4DSSA 2MBSA 1SJ6A 1EWXA 3VI7A 4ML1A 1O73A 2L57A 1XZOA 4I2UA 1FVKA 3US3A 3Q6OA 2JZRA 4EL1A 2QC7A 4N0VA 2O87A 1RW1A 4RQRA 2GSTA 5A4WA 3FZ4A 4OFNA 4EXJA 1T00A 1SJIA 1M2BA 1ZL9A 3LQ7A 4QL7A 3ZZXA 1GUKA 3FKFA
chains in the Genus database with same CATH superfamily
3KTLA 5GZZB 4MJAA 5EL8A 2YPMA 1LBKA 3UJ1A 2LQQA 3M9KA 4N0ZA 1ST9A 3LORA 1M9AA 5J9BA 1EOGA 13GSA 4ULXA 5ECSA 4ISDA 2HE3A 4X4JA 3FR9A 1SKRB 4KAEA 1THOA 2QA1A 4MP4A 1KNGA 2GQMA 2HYXA 4WETA 4OO4A 2HSHA 1Y6EA 3TOTA 1TTZA 3EMXA 1GTBA 5DAKB 1A0FA 1MDKA 2H1DA 3CSHA 4L5OA 1XWGA 2GZYA 1TK0B 1NHYA 1TP9A 3CYNA 1V57A 3ZLPA 4JE1A 3G7IA 1Z5YE 4YAVA 5B6NA 5G1LA 3DWVA 2C0EA 5IMCA 1YF1A 2K8VA 1XIYA 4TXOB 4KE3A 4MF6A 3U5RE 3MSZA 1KBNA 1Q98A 3MIXA 3E9JB 5D8IA 2FWFA 5KOXA 22GSA 2RM6A 5CREA 2DJ1A 1ZOFA 3Q18A 3CRTA 1R4WA 4K9ZA 4IP6A 2JADA 3KMNA 1SK1A 1XVQA 4HQSA 4MF5A 6GSTA 1OE8A 1SKWB 3HVVA 1OYJA 3FMWA 3GTUB 3IHQA 1FOHA 3A2WA 3QMXA 2H30A 3MYDA 3ZFLA 3L0HA 4DVCA 3LYPA 4HUAA 3KIJA 4PNFA 14GSA 3HVXA 4TR3A 5J9CA 3ZIJA 4BVYB 1HD2A 4TXVA 1OC9A 3DEXA 1Y25A 1TI1A 1WPIA 4KA0A 2DJJA 3EMPA 2IPAA 4OFTA 3KTBA 2UZ8A 4GSSA 4WF5A 2C0DA 4MJCA 3TJBA 4EIQA 1WOUA 5JWQB 5HFKA 3FR6A 4V1Ap 1N2AA 3VPTA 4IELA 3C8EA 2O85A 2A2RA 2YNXA 1TK5B 1VF2A 3QOUA 3IR4A 3ZL5A 4HU9A 2H0IA 5ID2A 3EYTA 3GKMA 5CNWA 3GMFA 3W8SA 1X9MB 1EZKA 1G7EA 3D0ZA 3GFKA 3L78A 2TRCP 1K0BA 2XC2A 4MF7A 4FYBA 1X5EA 2L6DA 3CMIA 1W4VA 5L71A 1HYUA 2VL2A 4MCUA 3CTGA 3TJGA 1NW2A 2BTOT 2HXKA 3ZRDA 3VWUA 2K6VA 4K7NA 4O5RA 3A5IA 1S3DA 2IMDA 4K6XA 5KN3A 3F9UA 2VL9A 1F2EA 5JWRB 2H8LA 3IC8A 2VCXA 2OE0A 5AGYA 3A3TA 3U6VA 3EINA 2X49A 3KJYA 2C80A 5CO3A 1TDIA 1C72A 2LRNA 2VD0A 2L6CA 3DGQA 2GVPA 1SD9A 2V1MA 2P31A 2DJ3A 3HXSA 1RK4A 3ISOA 3KP8A 4IVFA 2EIQA 3LG6A 2BMXA 3VWVA 2HZEA 3L9UA 3TJKA 4KX4A 2NDOA 2GT5A 2B7KA 1YZXA 4ZBBA 4V2NA 3NOFA 4J57E 4QL9A 1SYXA 1B4QA 2VD1A 4BWQA 4NWYA 1PA3A 4MZWA 4KCAA 1V40A 1G6YA 2ON7A 3GL3A 5ECPB 4IKHA 1E2YA 2WB9A 3I6AA 1T3BA 1PFOA 4K7IA 2CQ9A 4RUVA 4Q5QA 1KEBA 1QK8A 3IRAA 5G1KA 1GUMA 2HFDA 3KM6A 1GTIA 2DJ0A 5A4UA 2PU9C 3WYWA 2GZZA 4JBBA 4DEJA 4CDOA 3F3RA 3TDGA 4P3YB 1HNBA 4IP1A 1A0RP 2H1GA 2J9HA 4GF0A 4HJ2A 3KH9A 4EDYA 1VRSD 3IAM2 3UL3A 2GGTA 1OC9B 3UAPA 2LNSA 4KF9A 4EE0A 1TJDA 4MH3A 1VF4A 4CHSA 3RPPA 4KH7A 2PBJA 2LQOA 2VCVA 2H01A 4TVEA 4PGTA 1GSDA 1CQGA 5CRGA 1Z7PA 4XS4B 3IDVA 3VFIA 1ZYEA 1GSUA 3I9V2 4K2DA 2H70A 3BOAA 3EVIA 1V9WA 2JU5A 10GSA 2KP1A 5F05A 2GSQA 5IO0A 5B7CA 1GRXA 3GX8A 1XW9A 1GLQA 1UC7A 2VIMA 2F51A 3UMAA 5D9VA 2H74A 2R4VA 3CBUA 1OC3A 4KDXA 5D9WA 2GDRA 2VLUA 1HNAA 1LJRA 6GSYA 1DUGA 4ZB6A 2RUEA 4V2MA 4F0CA 4DSQA 2E2MA 2B1KA 1PX7A 4NMUA 5GSSA 4F0BA 3E0UA 2PVOC 1ILOA 1HNCA 4ZL9A 4HS1A 1T8EB 2AAWA 2DJ2A 4GLTA 3TRPA 8GSSA 12GSA 3HA9A 4ECBA 3QFAC 5COHA 5IPGA 4BL7A 2DKIA 4K5RA 1MDIA 4O5UA 3S9FA 1TW9A 3BCIA 3FZ5A 1F3BA 4AJ7A 1O7UA 4ILFA 2V41A 1H4OA 3TKSC 2H1AA 4AJ8A 5KN0A 3VWWA 4YAPA 3V1WA 2DIYA 1PRXA 2X99A 3ME7A 2C0FA 4EKZA 1T1VA 4MK3A 1SU9A 2V2GA 2LJRA 3WGEA 5IMZA 2C1YA 4PQHA 4JZQA 3ZITA 1F37A 3G9BA 4HU7A 2A2PA 1BX9A 2C4JA 1M9BA 4I5QA 4WXTA 1Z3EA 1GTAA 3WT2A 3HJMA 4BVXB 17GSA 4KW6A 1YJ6A 1MTCA 3IBHA 4USSA 3UARA 1UVZA 2ZUPA 2R6KA 4GXZA 2VCWA 3TJFA 1TRSA 2R37A 3F4TA 1B4PA 1XVWA 4KSMA 4ECCA 4PUAA 2EIOA 2F8AA 5D93A 4ZBAA 1IYHA 4KB3A 3NIVA 3GYKA 3NZNA 5DBQA 2RLIA 1OC8A 2NPBA 3M3MA 1AXDA 4NV5A 2H19A 2YANA 1T7PB 1X0RA 2CX3A 1A2MA 5DQYA 4GWRA 2AYTA 3LXTA 4L5LA 4O7HA 1JZRA 3ZYWA 2LS5A 4NXIA 2VCQA 2VLTA 1GSYA 2YWOA 3KMOA 4ZXGA 5INYA 2OADA 2GSSA 4MPGA 1GNWA 3JCML 5ENUA 4EDZA 1KTEA 3UBLA 2B1LA 2A2SA 3VWXA 4ID0A 4LA1A 3APOA 3GL5A 4KCEA 4TR1A 1O6JA 3FEUA 2I9HA 1A2JA 3IPZA 2JSYA 4G0IA 2FA8A 1GSEA 3ERWA 2IWTA 2GT6A 3WT1A 1FB0A 3WD6A 2FWGA 3GKNA 3P8WA 3GN3A 1H75A 4IW9A 2WFCA 4HOJA 2CVDA 1PSQA 3GA4A 1PQNA 3M9JA 3P90A 2DIZA 5AN1A 2OA7A 4FIWA 1B9YC 3DKSA 2LUSA 1GSQA 4YQMA 2TRXA 1WRYA 5FT3A 1S3AA 1TOFA 1O8WA 3H8QA 4L0WA 2GS3A 1FO5A 1R26A 5LNKe 2P5RA 4KSOA 4K8MA 4I8BA 2R5GA 5DALA 5G30A 5ELGA 1F6MC 3EE2A 4IBPA 1J08A 2HLSA 4IN0A 2RUFA 3CQFA 3IA1A 4L0UA 2QKEA 2L4QA 4EIPA 3ZTLA 3TUEA 1N8JA 3IE3A 1XW5A 3TJJA 2MYGA 2C3TA 4YQVA 2IIYA 1XWAA 2VM1A 1EEMA 2CVBA 1ZYNA 3HJPA 1U87A 1YQ1A 3HZ8A 3GSTA 4N10A 1Z6NA 2G2QA 2AJQB 4MABA 2CX4A 2F3MA 4YKFA 3HYPA 1GP1A 3BJ5A 3KCMA 3FRCA 4TRXA 3ME8A 4TKYA 4V2LA 2MMZA 2CA8A 4FQUA 3FZ9A 2MMOA 4MLYA 2LRTA 2VM2A 1OAZA 2HRAA 1SENA 5G2ZA 3FYGA 5KEJA 4PUFC 3LYKA 1AW9A 3ZVJD 3GX0A 5ECMB 5DCHA 2GQKA 2IFQA 2ON5A 2VOCA 2JZTA 2H73A 4WR4A 1OKTA 1QUWA 2FWEA 3TCOA 2LJAA 4LL4B 4DSSB 4TR1B 4F82A 3D4TA 2FD3A 3DD3A 3LFLA 3I43A 5LD0A 5ECQB 4OWYA 2FLSA 2P5QA 4FH8A 1IYIA 1PL1A 5IMFA 2L5LA 2M80A 1PN9A 2V6KA 1O81A 4BIKA 4ZILA 5HR3A 3F4RA 2D2ZA 1F9MA 3HDCA 3CXGA 3HKRA 4IQ1A 4A5PA 5GAPD 5B8BA 3PPUA 4GSTA 1THXA 3LJRA 2HI7A 1M3JA 4I2TA 2H75A 2B5XA 2PWJA 3P7XA 2ES7A 3QCPA 3KZQA 4GQCA 4X43A 1WP0A 3MNGA 1G7OA 1JHBA 5C00A 5JCUA 5F06A 3TGZA 2NVLA 1TRWA 2VUPA 2A4HA 3H1NA 1XWBA 1BQ7A 3IOSA 2J23A 1JLVA 4GTUA 2PGTA 1ERWA 2HRFA 3RHCA 3TRQA 1OE7A 4JR6A 2WS2A 2R0CA 1XFLA 4KDYA 2YN1A 3UBKA 5F0GA 2B3SA 2R3XA 4K1FA 3QR6A 4GRFA 4AJ6A 1EV9A 1K0MA 4CY8A 5B6MA 1R5PA 3IXRA 4O32A 1YF0A 5A5KA 2IL3A 3PGTA 3UVTA 1FAAA 3EWLA 1W89A 2JZSA 3ZFBA 5KN1A 2CVKA 3APSA 3TKSE 2YCDA 2K18A 4OMVA 3PINA 3KXOA 3L9SA 4YQUA 2Z9SA 3ERFA 2WCIA 4IGJA 2LKUA 5FWGA 5DVBA 1FHEA 5CP1A 2DKHA 2I3YA 1QGVA 5ECIB 3CSJA 4WKWA 1EGRA 4PTSA 3LEFA 1A8LA 3H93A 3QPMA 2VL3A 2JACA 2IMIA 4KNDA 3DMLA 1NM3A 2C3QA 4V1Ag 5CYYA 3Q74A 1SKSB 3GH9A 4FYCA 2OACA 5G5EA 1ON4A 2F8FA 1G0TA 4ZL7A 5CAXA 3LWAA 4H86A 1BYEA 3OR5A 2N5BA 2N5AA 5AISA 4D73A 1AUCA 1A24A 3VLNA 3CRUA 2IJYA 2NTOA 3DXBA 1S3CA 2GTUA 3HVNA 3GKKA 2B7JA 2M46A 1X5CA 4HJMA 4IJ3A 4K2XA 3VK9A 5ID2B 5GSTA 4E8HA 3TRXA 3P2AA 5KOWA 2I81A 2WDUA 3J7Yk 2V32A 3GH6A 1QQ2A 1Z9HA 1S3RA 1UN2A 2B5YA 4IHUA 3MDKA 1XBSA 3L9VA 4E8EA 5AIXA 2DC5A 2DMLA 4POKA 3GURA 4EF0A 1K0NA 2H76A 1ZMAA 2FGXA 4N11A 4PNGA 3C1SA 4I97A 6GSXA 4J2FA 5IOXA 4EUYA 3VI5A 3H79A 4ZIJA 2DLXA 2H0GA 3GNJA 4KGIA 1X9SB 3ZREA 2WZ9A 4O92A 6GSSA 3FHKA 3HZ4A 2YZHA 3G7YA 1U3AA 2I4AA 4YH2A 2HZEB 3RAZA 5A4VA 1EP7A 1JFUA 4XIHA 2HRKA 4K0NA 1PN0A 1Z7RA 3WGDA 3QAWA 1FVJA 1XXUA 1M3IA 3KP9A 2JL4A 5DCGA 2RM5A 1Z6MA 6GSWA 1T4ZA 5D9TA 4ZBDA 4JRRA 2H66A 2O7KA 3M0FA 3LGCA 3D21A 2O89A 2B6MA 3R2QA 1V98A 4G0KA 2VO4A 4ML6A 5IMVA 1DBYA 5JWOB 2R0GA 1R7HA 2EIRA 5BMUA 1AQVA 1GTUA 4MJEA 3QAGA 3HY2A 4GCIA 2H6ZA 5D96A 1ZCPA 5EPFA 2IMFA 5GAND 2MZCA 1DE1A 4EC0A 5E59A 3L4NA 1GNEA 3RPNA 4PURA 4TR0A 1PKZA 2DMMA 4KUNA 1SK0A 2HZFA 2VLVA 1V58A 2PUKC 4CW9A 5ELAA 1PGTA 4LMVA 2WRTA 3PH9A 2PERA 3EU4A 4JR4A 1M7TA 2MBTA 2XBQA 3HCZA 4Q5RA 2PMTA 1UA5A 3FR3A 1FB6A 4EO3A 2H1BA 2OBKA 3D5JA 1MD3A 1GH2A 5DJMA 1GUHA 4HSCX 2PN8A 6GSUA 5D73A 5IO2A 1NHOA 4WBRD 2HSMA 3GTUA 2V6OA 4RI7A 3EURA 3H4KA 3UIWA 2G0FA 1F3AA 3QD9A 1EOHA 2GLRA 3UVHA 2R2JA 4BVYA 2OE1A 4XTSA 3DYRA 1NSWA 4TN8A 5BRTA 1YKAA 4K5SA 4X0XA 4GQFA 1YY7A 5D9XA 5IMAA 1GULA 3GSSA 3LSZA 4XRAA 1ERUA 1ACVA 4N30A 4BL7B 4RQXA 4Z2UA 4CY6A 4XRDA 2YWIA 1K0AA 2QSIA 4G19A 1AAZA 5ABRA 4WBJA 3GRXA 4IQAA 5DQSA 3DRNA 3ZMLA 1R5AA 3N9JA 3KEBA 3LXZA 5LCZA 2H6XA 1RQMA 3GUSA 5G5FA 1TU8A 3VURA 2HSYA 4Z2RA 3O76A 2CT6A 4MMMA 4PX1A 3D4MA 1AQWA 4NPBA 1K3OA 1K0CA 3ERGA 1SJZA 1LU4A 5DJLA 1AC1A 2IMKA 2CAIA 1EV4A 4MH2A 3EU3A 4Z7XA 3PR8A 1K0OA 3Q19A 1TK8B 1URMA 2REMA 3MAKA 1ERTA 19GSA 20GSA 5CRDA 2XHFA 2R0PA 4Q5FA 1XCCA 1PL2A 1PX6A 4NHWA 1JZWA 3DVWA 1GWCA 1X9WB 2WGRA 1K0DA 4POLA 2X8CA 1YEPA 2VCZA 3O3TA 4OD7A 2FNOA 2ZCTA 1XWKA 2AHEA 4KDUA 3MWHA 2KUCA 1DSBA 1A8YA 2DSAA 3GHAA 2L5OA 1X5DA 2P0GA 2B5EA 1HQOA 1XWCA 3TKRA 4WF4A 2WULA 2YV7A 2DJKA 4J56E 1V2AA 4ZB8A 3AY8A 1WWJA 3FZAA 3W8JA 1QFNA 2N5FA 2ALBA 5AIVA 3R3EA 2X8GA 4MDCA 4F03A 1ERVA 1T4YA 4MNNA 4MPFA 2CZ2A 4ECJA 5J41A 3HD5A 1ZYPA 2E0QA 3EC3A 2HRNA 5ECLB 2BJXA 1M99A 2LTKA 3DIEA 4YKGA 1J0FA 5J4UA 11GSA 1A23A 3TKPA 5H5QA 3C7MA 1TU7A 2FY6A 1U3IA 5JCGA 1USBA 3TKSA 4I6XA 2NBSA 1E6BA 4WEYA 4XS4A 1M0UA 4LLRA 4PXOA 3TOUA 1JZDA 2XBIA 2H71A 4AGSA 3SWLA 1VGLA 1WE0A 5KN2A 5ECOB 1YEXA 2IMEA 3UOMA 2X8HA 1G6WA 1QXHA 3CTFA 4G10A 2PVQA 2HNLA 4MJBA 5H5SA 7GSSA 5HR0A 3A2VA 3N5OA 1WIKA 2LSTA 3GV1A 3KD0A 2O8VB 3BD2A 5DALB 5G31A 4F9ZA 2F9SA 1JLWA 2L4CA 4Q5NA 3W6GA 1BEDA 2C8UA 4K0GA 5JCWA 3VPQA 4BWSA 1PMTA 1MD4A 4TW5A 3IAS2 3IK9A 3O6TA 3I69A 4QQ7A 4WR5A 3IK7A 5ECHB 1U88A 3ED3A 1M2DA 1BJXA 3ZIVA 5C04A 3TKQA 1I9DA 5CRWA 5HR2A 6GSVA 4OCEA 4DSRA 2I1UA 2GSRA 1FG4A 2LV3A 5HFGA 3IHGA 5IOWA 3HVSA 4MZBA 4GSNA 5B8AA 3HHVA 2MMNA 5EVOA 1VF3A 3C73A 4FYUA 2QGVA 5ECRB 3E3EA 2CV4A 1M2AA 2E2GA 9GSSA 1VF1A 2WJUA 5E4WA 1SD8A 1SYRA 5IMDA 2H6YA 4LMWA 5J5NA 3APQA 2YV9A 2TIRA 2YJ7A 3EPTA 1J9BA 4HEA2 5DDLA 3D6IA 3DVXA 5EY6A 1FOVA 1WJKA 5IM9A 1K3LA 3C71A 3F0IA 2IFQB 2X4AA 4ZL8A 4TOPA 1AIUA 4POMA 1TI3A 2IN3A 1XW6A 4BVXA 2LEGA 2YWMA 1SL2B 1YDKA 2CAQA 1B48A 4LL1B 2RIIA 4HZ4A 5ECKB 4BPYA 4JEDA 2L59A 1FW1A 2YZUA 1GSSA 1I5GA 4L8EA 2EC4A 4XS1A 4O5QA 1SL0B 1XG8A 5FHIA 1ABAA 1TRVA 2LRCA 4OFMA 3J7Yb 2H0HA 4IJIA 3KH7A 3FK8A 1EP8A 1TKDB 1CQHA 1EEJA 3IC4A 4OO5A 2FHEA 2HT9A 2OBIA 1DE2A 2C0GA 3LW9A 4FO5A 3F63A 4G0LA 4JU5A 2KP2A 2FCHA 3FY7A 3UEMA 2E7PA 2XPDA 2VAFA 4OCFA 3RDWA 2H72A 1TXXA 2CZ3A 2GQLA 1XOAA 3HJOA 1ZZYA 2FUG2 1BAYA 3QAVA 1TRUA 2YWNA 4MA9A 2AUVA 1MEKA 4AF2A 1YKCA 4G2EA 4EVMA 1O8XA 18GSA 1ZYQB 2QA2A 2AV4A 2PPTA 4POBA 3KGKA 1XPVA 3GIXA 4RI6A 1ZGNA 2XPEA 2GZPA 3M8NA 2M72A 1PKWA 3C1RA 1ML6A 5F07A 4NV2A 1QMVA 2KHPA 3F8UA 4IS0A 1OKDA 1O85A 2JSZA 2K8SA 4TR4A 3BCKA 2OJLA 4ECIA 5J3RA 3M1GA 1SL1B 2YJHA 2MMAA 1B8XA 2LJKA 3K8NA 3WGXA 1GSFA 1U6TA 4ACSA 2AB6A 2VCTA 3G7JA 1K3YA 5HQPA 2FA4A 4F2IA 3GKXA 1GL8A 5DAKA 2VL2C 1XOBA 2FWHA 1EGOA 3F6DA 4G9HA 4X1UA 5ECNB 4BA7A 4HQZA 3RBTA 2KLXA 1B9XC 16GSA 2K9FA 5F8BA 3F3QA 5H5RA 4NAXA 5IQYA 2KOKA 5IIZA 4D73B 4TXOA 1AQXA 3F6FA 1A2LA 3SBCA 4ZB9A 2OKAA 3CSIA 5HFIA 3D22A 4K7OA 2ZNMA 4HZ2A 3A2XA 2C3NA 2YOIA 2OE3A 3QDNA 1WMJA 4XCSA 4XHMA 5HR1A 2YP6A 3QFBC 3ZMKA 1GLPA 2LNTA 3F4SA 2X64A 1PD21 3A5WA 1JZOA 1MDJA 4NHZA 2DBCA 4XS6A 3FW2A 3IV4A 1OVNA 1BG5A 4HI7A 4PQIA 1SK2A 3ZVJA 1Q4JA 2A4VA 4PQ1A 5CRHA 4HDEA 3TB2A 5IPHA 3BBYA 3RHBA 4MZCA 4DSSA 2MBSA 1SJ6A 1EWXA 3VI7A 4ML1A 1O73A 2L57A 1XZOA 4I2UA 1FVKA 3US3A 3Q6OA 2JZRA 4EL1A 2QC7A 4N0VA 2O87A 1RW1A 4RQRA 2GSTA 5A4WA 4Z2TA 3FZ4A 4OFNA 4EXJA 1T00A 1SJIA 1M2BA 1ZL9A 3LQ7A 4QL7A 3ZZXA 4ICYA 1GUKA 3FKFA
chains in the Genus database with same CATH topology
3KTLA 5GZZB 4MJAA 5EL8A 2YPMA 1LBKA 3UJ1A 2LQQA 3M9KA 4N0ZA 1ST9A 3LORA 1M9AA 5J9BA 1EOGA 13GSA 4ULXA 5ECSA 4ISDA 2HE3A 4X4JA 3FR9A 1SKRB 4KAEA 1THOA 2QA1A 4MP4A 1KNGA 2GQMA 2HYXA 4WETA 4OO4A 2HSHA 1Y6EA 3TOTA 1TTZA 3EMXA 1GTBA 5DAKB 1A0FA 1MDKA 2H1DA 3CSHA 4L5OA 1XWGA 2GZYA 1TK0B 1NHYA 1TP9A 3CYNA 1V57A 3ZLPA 4JE1A 3G7IA 1Z5YE 4YAVA 5B6NA 5G1LA 3DWVA 2C0EA 5IMCA 1YF1A 2K8VA 1XIYA 4TXOB 4KE3A 4MF6A 3U5RE 3MSZA 1KBNA 1Q98A 3MIXA 3E9JB 5D8IA 2FWFA 5KOXA 22GSA 2RM6A 5CREA 2DJ1A 1ZOFA 3Q18A 3CRTA 1R4WA 4K9ZA 4IP6A 2JADA 3KMNA 1SK1A 1XVQA 4HQSA 4MF5A 6GSTA 1OE8A 1SKWB 3HVVA 1OYJA 3FMWA 3GTUB 3IHQA 1FOHA 3A2WA 3QMXA 2H30A 3MYDA 3ZFLA 3L0HA 4DVCA 3LYPA 4HUAA 3KIJA 4PNFA 14GSA 3HVXA 4TR3A 5J9CA 3ZIJA 4BVYB 1HD2A 4TXVA 1OC9A 3DEXA 1Y25A 1TI1A 1WPIA 4KA0A 2DJJA 3EMPA 2IPAA 4OFTA 3KTBA 2UZ8A 4GSSA 4WF5A 2C0DA 4MJCA 3TJBA 4EIQA 1WOUA 5JWQB 5HFKA 3FR6A 4V1Ap 1N2AA 3VPTA 4IELA 3C8EA 2O85A 2A2RA 2YNXA 1TK5B 1VF2A 3QOUA 3IR4A 3ZL5A 4HU9A 2H0IA 5ID2A 3EYTA 3GKMA 5CNWA 3GMFA 3W8SA 1X9MB 1EZKA 1G7EA 3D0ZA 3GFKA 3L78A 2TRCP 1K0BA 2XC2A 4MF7A 4FYBA 1X5EA 2L6DA 3CMIA 1W4VA 5L71A 1HYUA 2VL2A 4MCUA 3CTGA 3TJGA 1NW2A 2BTOT 2HXKA 3ZRDA 3VWUA 2K6VA 4K7NA 4O5RA 3A5IA 1S3DA 2IMDA 4K6XA 5KN3A 3F9UA 2VL9A 1F2EA 5JWRB 2H8LA 3IC8A 2VCXA 2OE0A 5AGYA 3A3TA 3U6VA 3EINA 2X49A 3KJYA 2C80A 5CO3A 1TDIA 1C72A 2LRNA 2VD0A 2L6CA 3DGQA 2GVPA 1SD9A 2V1MA 2P31A 2DJ3A 3HXSA 1RK4A 3ISOA 3KP8A 4IVFA 2EIQA 3LG6A 2BMXA 3VWVA 2HZEA 3L9UA 3TJKA 4KX4A 2NDOA 2GT5A 2B7KA 1YZXA 4ZBBA 4V2NA 3NOFA 4J57E 4QL9A 1SYXA 1B4QA 2VD1A 4BWQA 4NWYA 1PA3A 4MZWA 4KCAA 1V40A 1G6YA 2ON7A 3GL3A 5ECPB 4IKHA 1E2YA 2WB9A 3I6AA 1T3BA 4K7IA 2CQ9A 4RUVA 4Q5QA 1KEBA 1QK8A 3IRAA 5G1KA 1GUMA 2HFDA 3KM6A 1GTIA 2DJ0A 5A4UA 2PU9C 3WYWA 2GZZA 4JBBA 4DEJA 4CDOA 3F3RA 3TDGA 4P3YB 1HNBA 4IP1A 1A0RP 2H1GA 2J9HA 4GF0A 4HJ2A 3KH9A 4EDYA 1VRSD 3IAM2 3UL3A 2GGTA 1OC9B 3UAPA 2LNSA 4KF9A 4EE0A 1TJDA 4MH3A 1VF4A 4CHSA 3RPPA 4KH7A 2PBJA 2LQOA 2VCVA 2H01A 4TVEA 4PGTA 1GSDA 1CQGA 5CRGA 1Z7PA 4XS4B 3IDVA 3VFIA 1ZYEA 1GSUA 3I9V2 4K2DA 2H70A 3BOAA 3EVIA 1V9WA 2JU5A 10GSA 2KP1A 5F05A 2GSQA 5IO0A 5B7CA 1GRXA 3GX8A 1XW9A 1GLQA 1UC7A 2VIMA 2F51A 3UMAA 5D9VA 2H74A 2R4VA 3CBUA 1OC3A 4KDXA 5D9WA 2GDRA 2VLUA 1HNAA 1LJRA 6GSYA 1DUGA 4ZB6A 2RUEA 4V2MA 4F0CA 4DSQA 2E2MA 2B1KA 1PX7A 4NMUA 5GSSA 4F0BA 3E0UA 2PVOC 1ILOA 1HNCA 4ZL9A 4HS1A 1T8EB 2AAWA 2DJ2A 4GLTA 3TRPA 8GSSA 12GSA 3HA9A 4ECBA 3QFAC 5COHA 5IPGA 4BL7A 2DKIA 4K5RA 1MDIA 4O5UA 3S9FA 1TW9A 3BCIA 3FZ5A 1F3BA 4AJ7A 1O7UA 4ILFA 2V41A 1H4OA 3TKSC 2H1AA 4AJ8A 5KN0A 3VWWA 4YAPA 3V1WA 2DIYA 1PRXA 2X99A 3ME7A 2C0FA 4EKZA 1T1VA 4MK3A 1SU9A 2V2GA 2LJRA 3WGEA 5IMZA 2C1YA 4PQHA 4JZQA 3ZITA 1F37A 3G9BA 4HU7A 2A2PA 1BX9A 2C4JA 1M9BA 4I5QA 4WXTA 1Z3EA 1GTAA 3WT2A 3HJMA 4BVXB 17GSA 4KW6A 1YJ6A 1MTCA 3IBHA 4USSA 3UARA 1UVZA 2ZUPA 2R6KA 4GXZA 2VCWA 3TJFA 1TRSA 2R37A 3F4TA 1B4PA 1XVWA 4KSMA 4ECCA 4PUAA 2EIOA 2F8AA 5D93A 4ZBAA 1IYHA 4KB3A 3NIVA 3GYKA 3NZNA 5DBQA 2RLIA 1OC8A 2NPBA 3M3MA 1AXDA 4NV5A 2H19A 2YANA 1T7PB 1X0RA 2CX3A 1A2MA 5DQYA 4GWRA 2AYTA 3LXTA 4L5LA 4O7HA 1JZRA 3ZYWA 2LS5A 4NXIA 2VCQA 2VLTA 1GSYA 2YWOA 3KMOA 4ZXGA 5INYA 2OADA 2GSSA 4MPGA 1GNWA 3JCML 5ENUA 4EDZA 1KTEA 3UBLA 2B1LA 2A2SA 3VWXA 4ID0A 4LA1A 3APOA 3GL5A 4KCEA 4TR1A 1O6JA 3FEUA 2I9HA 1A2JA 3IPZA 2JSYA 4G0IA 2FA8A 1GSEA 3ERWA 2IWTA 2GT6A 3WT1A 1FB0A 3WD6A 2FWGA 3GKNA 3P8WA 3GN3A 1H75A 4IW9A 2WFCA 4HOJA 2CVDA 1PSQA 3GA4A 1PQNA 3M9JA 3P90A 2DIZA 5AN1A 2OA7A 4FIWA 1B9YC 3DKSA 2LUSA 1GSQA 4YQMA 2TRXA 1WRYA 5FT3A 1S3AA 1TOFA 1O8WA 3H8QA 4L0WA 2GS3A 1FO5A 1R26A 5LNKe 2P5RA 4KSOA 4K8MA 4I8BA 2R5GA 5DALA 5G30A 5ELGA 1F6MC 3EE2A 4IBPA 1J08A 2HLSA 4IN0A 2RUFA 3IA1A 4L0UA 2QKEA 2L4QA 4EIPA 3ZTLA 3TUEA 1N8JA 3IE3A 1XW5A 3TJJA 2MYGA 2C3TA 4YQVA 2IIYA 1XWAA 2VM1A 1EEMA 2CVBA 1ZYNA 3HJPA 1U87A 1YQ1A 3HZ8A 3GSTA 4N10A 1Z6NA 2G2QA 2AJQB 4MABA 2CX4A 2F3MA 4YKFA 3HYPA 1GP1A 3BJ5A 3KCMA 3FRCA 4TRXA 3ME8A 4TKYA 4V2LA 2MMZA 2CA8A 4FQUA 3FZ9A 2MMOA 4MLYA 2LRTA 2VM2A 1OAZA 2HRAA 1SENA 5G2ZA 3FYGA 5KEJA 4PUFC 3LYKA 1AW9A 3ZVJD 3GX0A 5ECMB 5DCHA 2GQKA 2IFQA 2ON5A 2VOCA 2JZTA 2H73A 4WR4A 1OKTA 1QUWA 2FWEA 3TCOA 2LJAA 4LL4B 4DSSB 4TR1B 4F82A 3D4TA 2FD3A 3DD3A 3LFLA 3I43A 5LD0A 5ECQB 4OWYA 2FLSA 2P5QA 4FH8A 1IYIA 1PL1A 5IMFA 2L5LA 2M80A 1PN9A 2V6KA 1O81A 4ZILA 5HR3A 3F4RA 2D2ZA 1F9MA 3HDCA 3CXGA 3HKRA 4IQ1A 4A5PA 5GAPD 5B8BA 3PPUA 4GSTA 1THXA 3LJRA 2HI7A 4I2TA 2H75A 2B5XA 2PWJA 3P7XA 2ES7A 3QCPA 3KZQA 4GQCA 4X43A 1WP0A 3MNGA 1G7OA 1JHBA 5C00A 5JCUA 5F06A 3TGZA 2NVLA 1TRWA 2VUPA 2A4HA 3H1NA 1XWBA 1BQ7A 3IOSA 2J23A 1JLVA 4GTUA 2PGTA 1ERWA 2HRFA 3RHCA 3TRQA 1OE7A 4JR6A 2WS2A 2R0CA 1XFLA 4KDYA 2YN1A 3UBKA 5F0GA 2B3SA 2R3XA 4K1FA 3QR6A 4GRFA 4AJ6A 1EV9A 1K0MA 4CY8A 5B6MA 1R5PA 3IXRA 4O32A 1YF0A 5A5KA 2IL3A 3PGTA 3UVTA 1FAAA 3EWLA 1W89A 2JZSA 3ZFBA 5KN1A 2CVKA 3APSA 3TKSE 2YCDA 2K18A 4OMVA 3PINA 3KXOA 3L9SA 4YQUA 2Z9SA 3ERFA 2WCIA 4IGJA 2LKUA 5FWGA 5DVBA 1FHEA 5CP1A 2DKHA 2I3YA 1QGVA 5ECIB 3CSJA 4WKWA 1EGRA 4PTSA 3LEFA 1A8LA 3H93A 3QPMA 2VL3A 2JACA 2IMIA 4KNDA 3DMLA 1NM3A 2C3QA 4V1Ag 5CYYA 3Q74A 1SKSB 3GH9A 4FYCA 2OACA 5G5EA 1ON4A 2F8FA 1G0TA 4ZL7A 5CAXA 3LWAA 4H86A 1BYEA 3OR5A 2N5BA 2N5AA 5AISA 4D73A 1AUCA 1A24A 3VLNA 3CRUA 2IJYA 2NTOA 3DXBA 1S3CA 2GTUA 3GKKA 2B7JA 2M46A 1X5CA 4HJMA 4IJ3A 4K2XA 3VK9A 5ID2B 5GSTA 4E8HA 3TRXA 3P2AA 5KOWA 2I81A 2WDUA 3J7Yk 2V32A 3GH6A 1QQ2A 1Z9HA 1UN2A 2B5YA 4IHUA 3MDKA 1XBSA 3L9VA 4E8EA 5AIXA 2DC5A 2DMLA 4POKA 3GURA 4EF0A 1K0NA 2H76A 1ZMAA 2FGXA 4N11A 4PNGA 3C1SA 4I97A 6GSXA 4J2FA 5IOXA 4EUYA 3VI5A 3H79A 4ZIJA 2DLXA 2H0GA 3GNJA 4KGIA 1X9SB 3ZREA 2WZ9A 4O92A 6GSSA 3FHKA 3HZ4A 2YZHA 3G7YA 1U3AA 2I4AA 4YH2A 2HZEB 3RAZA 5A4VA 1EP7A 1JFUA 4XIHA 2HRKA 4K0NA 1PN0A 1Z7RA 3WGDA 3QAWA 1FVJA 1XXUA 3KP9A 2JL4A 5DCGA 2RM5A 1Z6MA 6GSWA 1T4ZA 5D9TA 4ZBDA 4JRRA 2H66A 2O7KA 3M0FA 3LGCA 3D21A 2O89A 2B6MA 3R2QA 1V98A 4G0KA 2VO4A 4ML6A 5IMVA 1DBYA 5JWOB 2R0GA 1R7HA 2EIRA 5BMUA 1AQVA 1GTUA 4MJEA 3QAGA 3HY2A 4GCIA 5D96A 2H6ZA 1ZCPA 5EPFA 2IMFA 5GAND 2MZCA 1DE1A 4EC0A 5E59A 3L4NA 1GNEA 3RPNA 4PURA 4TR0A 1PKZA 2DMMA 4KUNA 1SK0A 2HZFA 2VLVA 1V58A 2PUKC 4CW9A 5ELAA 1PGTA 4LMVA 2WRTA 3PH9A 2PERA 3EU4A 4JR4A 1M7TA 2MBTA 2XBQA 3HCZA 4Q5RA 2PMTA 1UA5A 3FR3A 1FB6A 4EO3A 2H1BA 2OBKA 3D5JA 1MD3A 1GH2A 5DJMA 1GUHA 2PN8A 6GSUA 5D73A 5IO2A 1NHOA 4WBRD 2HSMA 3GTUA 2V6OA 4RI7A 3EURA 3H4KA 3UIWA 2G0FA 1F3AA 3QD9A 1EOHA 2GLRA 3UVHA 2R2JA 4BVYA 2OE1A 4XTSA 3DYRA 1NSWA 4TN8A 5BRTA 1YKAA 4K5SA 4X0XA 4GQFA 1YY7A 5D9XA 5IMAA 1GULA 3GSSA 3LSZA 4XRAA 1ERUA 1ACVA 4N30A 4BL7B 4RQXA 4Z2UA 4CY6A 4XRDA 2YWIA 1K0AA 2QSIA 4G19A 1AAZA 5ABRA 4WBJA 3GRXA 4IQAA 5DQSA 3DRNA 3ZMLA 1R5AA 3N9JA 3KEBA 3LXZA 5LCZA 2H6XA 1RQMA 3GUSA 5G5FA 1TU8A 3VURA 2HSYA 4Z2RA 3O76A 2CT6A 4MMMA 4PX1A 3D4MA 1AQWA 4NPBA 1K3OA 1K0CA 3ERGA 1SJZA 1LU4A 5DJLA 1AC1A 2IMKA 2CAIA 1EV4A 4MH2A 3EU3A 4Z7XA 3PR8A 1K0OA 3Q19A 1TK8B 1URMA 2REMA 3MAKA 1ERTA 19GSA 20GSA 5CRDA 2XHFA 2R0PA 4Q5FA 1XCCA 1PL2A 1PX6A 4NHWA 1JZWA 3DVWA 1GWCA 1X9WB 2WGRA 1K0DA 4POLA 2X8CA 1YEPA 2VCZA 3O3TA 4OD7A 2FNOA 2ZCTA 1XWKA 2AHEA 4KDUA 3MWHA 2KUCA 1DSBA 1A8YA 2DSAA 3GHAA 2L5OA 1X5DA 2P0GA 2B5EA 1HQOA 1XWCA 3TKRA 4WF4A 2WULA 2YV7A 2DJKA 4J56E 1V2AA 4ZB8A 3AY8A 1WWJA 3FZAA 3W8JA 1QFNA 2N5FA 2ALBA 5AIVA 3R3EA 2X8GA 4MDCA 4F03A 1ERVA 1T4YA 4MNNA 4MPFA 2CZ2A 4ECJA 5J41A 3HD5A 1ZYPA 2E0QA 3EC3A 2HRNA 5ECLB 2BJXA 1M99A 2LTKA 3DIEA 4YKGA 1J0FA 5J4UA 11GSA 1A23A 3TKPA 5H5QA 3C7MA 1TU7A 2FY6A 1U3IA 5JCGA 1USBA 3TKSA 4I6XA 2NBSA 1E6BA 4WEYA 4XS4A 1M0UA 4LLRA 4PXOA 3TOUA 1JZDA 2XBIA 2H71A 4AGSA 3SWLA 1VGLA 1WE0A 5KN2A 5ECOB 1YEXA 2IMEA 3UOMA 2X8HA 1G6WA 1QXHA 3CTFA 4G10A 2PVQA 2HNLA 4MJBA 5H5SA 7GSSA 5HR0A 3A2VA 3N5OA 1WIKA 2LSTA 3GV1A 3KD0A 2O8VB 3BD2A 5DALB 5G31A 4F9ZA 2F9SA 1JLWA 2L4CA 4Q5NA 3W6GA 1BEDA 2C8UA 4K0GA 5JCWA 3VPQA 4BWSA 1PMTA 1MD4A 4TW5A 3IAS2 3IK9A 3O6TA 3I69A 4QQ7A 4WR5A 3IK7A 5ECHB 1U88A 3ED3A 1M2DA 1BJXA 3ZIVA 5C04A 3TKQA 1I9DA 5CRWA 5HR2A 6GSVA 4OCEA 4DSRA 2I1UA 2GSRA 1FG4A 2LV3A 5HFGA 3IHGA 5IOWA 3HVSA 4MZBA 4GSNA 5B8AA 3HHVA 2MMNA 5EVOA 1VF3A 3C73A 4FYUA 2QGVA 5ECRB 3E3EA 2CV4A 1M2AA 2E2GA 9GSSA 1VF1A 2WJUA 5E4WA 1SD8A 1SYRA 5IMDA 2H6YA 4LMWA 5J5NA 3APQA 2YV9A 2TIRA 2YJ7A 3EPTA 1J9BA 4HEA2 5DDLA 3D6IA 3DVXA 5EY6A 1FOVA 1WJKA 5IM9A 1K3LA 3C71A 3F0IA 2IFQB 2X4AA 4ZL8A 4TOPA 1AIUA 4POMA 1TI3A 2IN3A 1XW6A 4BVXA 2LEGA 2YWMA 1SL2B 1YDKA 2CAQA 1B48A 4LL1B 2RIIA 4HZ4A 5ECKB 4BPYA 4JEDA 2L59A 1FW1A 2YZUA 1GSSA 1I5GA 4L8EA 2EC4A 4XS1A 4O5QA 1SL0B 5FHIA 1ABAA 1TRVA 2LRCA 4OFMA 3J7Yb 2H0HA 4IJIA 3KH7A 3FK8A 1EP8A 1TKDB 1CQHA 1EEJA 3IC4A 4OO5A 2FHEA 2HT9A 2OBIA 1DE2A 2C0GA 3LW9A 4FO5A 3F63A 4G0LA 4JU5A 2KP2A 2FCHA 3FY7A 3UEMA 2E7PA 2XPDA 2VAFA 4OCFA 3RDWA 2H72A 1TXXA 2CZ3A 2GQLA 1XOAA 3HJOA 1ZZYA 2FUG2 1BAYA 3QAVA 1TRUA 2YWNA 4MA9A 2AUVA 1MEKA 4AF2A 1YKCA 4G2EA 4EVMA 1O8XA 18GSA 1ZYQB 2QA2A 2AV4A 2PPTA 4POBA 3KGKA 1XPVA 3GIXA 4RI6A 1ZGNA 2XPEA 2GZPA 3M8NA 2M72A 1PKWA 3C1RA 1ML6A 5F07A 4NV2A 1QMVA 2KHPA 3F8UA 4IS0A 1OKDA 1O85A 2JSZA 2K8SA 4TR4A 3BCKA 2OJLA 4ECIA 5J3RA 3M1GA 1SL1B 2YJHA 2MMAA 1B8XA 2LJKA 3K8NA 3WGXA 1GSFA 1U6TA 4ACSA 2AB6A 2VCTA 3G7JA 1K3YA 5HQPA 2FA4A 4F2IA 3GKXA 1GL8A 5DAKA 2VL2C 1XOBA 2FWHA 1EGOA 3F6DA 4G9HA 4X1UA 5ECNB 4BA7A 4HQZA 3RBTA 2KLXA 1B9XC 16GSA 2K9FA 5F8BA 3F3QA 5H5RA 4NAXA 5IQYA 2KOKA 5IIZA 4D73B 4TXOA 1AQXA 3F6FA 1A2LA 3SBCA 4ZB9A 2OKAA 3CSIA 5HFIA 3D22A 4K7OA 2ZNMA 4HZ2A 3A2XA 2C3NA 2YOIA 2OE3A 3QDNA 1WMJA 4XCSA 4XHMA 5HR1A 2YP6A 3QFBC 3ZMKA 1GLPA 2LNTA 3F4SA 2X64A 1PD21 3A5WA 1JZOA 1MDJA 4NHZA 2DBCA 4XS6A 3FW2A 3IV4A 1OVNA 1BG5A 4HI7A 4PQIA 1SK2A 3ZVJA 1Q4JA 2A4VA 4PQ1A 5CRHA 4HDEA 3TB2A 5IPHA 3BBYA 3RHBA 4MZCA 4DSSA 2MBSA 1SJ6A 1EWXA 3VI7A 4ML1A 1O73A 2L57A 1XZOA 4I2UA 1FVKA 3US3A 3Q6OA 2JZRA 4EL1A 2QC7A 4N0VA 2O87A 1RW1A 4RQRA 2GSTA 5A4WA 4Z2TA 3FZ4A 4OFNA 4EXJA 1T00A 1SJIA 1M2BA 1ZL9A 3LQ7A 4QL7A 3ZZXA 4ICYA 1GUKA 3FKFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KTL A;  5GZZ B;  4MJA A;  5EL8 A;  2YPM A;  1LBK A;  3UJ1 A;  2LQQ A;  3M9K A;  4N0Z A;  1ST9 A;  3LOR A;  1M9A A;  5J9B A;  1EOG A;  13GS A;  4ULX A;  5ECS A;  4ISD A;  2HE3 A;  3FR9 A;  1SKR B;  4KAE A;  1THO A;  4MP4 A;  1KNG A;  2GQM A;  2HYX A;  4WET A;  4OO4 A;  2HSH A;  1Y6E A;  3TOT A;  1TTZ A;  3EMX A;  1GTB A;  5DAK B;  1A0F A;  1MDK A;  2H1D A;  3CSH A;  4L5O A;  1XWG A;  2GZY A;  1TK0 B;  1NHY A;  1TP9 A;  3CYN A;  1V57 A;  3ZLP A;  4JE1 A;  3G7I A;  1Z5Y E;  4YAV A;  5B6N A;  5G1L A;  3DWV A;  2C0E A;  5IMC A;  1YF1 A;  2K8V A;  1XIY A;  4TXO B;  4KE3 A;  4MF6 A;  3U5R E;  3MSZ A;  1KBN A;  1Q98 A;  5D8I A;  3E9J B;  2FWF A;  22GS A;  2RM6 A;  5CRE A;  2DJ1 A;  1ZOF A;  3Q18 A;  3CRT A;  1R4W A;  4K9Z A;  4IP6 A;  2JAD A;  3KMN A;  1SK1 A;  1XVQ A;  4HQS A;  4MF5 A;  6GST A;  1OE8 A;  1SKW B;  3HVV A;  1OYJ A;  3GTU B;  3IHQ A;  3A2W A;  3QMX A;  2H30 A;  3ZFL A;  3L0H A;  4DVC A;  3LYP A;  4HUA A;  3KIJ A;  4PNF A;  14GS A;  3HVX A;  4TR3 A;  5J9C A;  3ZIJ A;  1HD2 A;  1OC9 A;  4TXV A;  3DEX A;  1Y25 A;  1TI1 A;  1WPI A;  4KA0 A;  2DJJ A;  3EMP A;  2IPA A;  4OFT A;  3KTB A;  4GSS A;  4WF5 A;  2C0D A;  4MJC A;  3TJB A;  1WOU A;  5JWQ B;  5HFK A;  3FR6 A;  4V1A p;  1N2A A;  3VPT A;  4IEL A;  3C8E A;  2O85 A;  2A2R A;  2YNX A;  1TK5 B;  1VF2 A;  3QOU A;  3IR4 A;  3ZL5 A;  4HU9 A;  2H0I A;  5ID2 A;  3EYT A;  3GKM A;  5CNW A;  3GMF A;  3W8S A;  1X9M B;  1EZK A;  1G7E A;  3D0Z A;  3GFK A;  3L78 A;  2TRC P;  1K0B A;  2XC2 A;  4MF7 A;  4FYB A;  1X5E A;  2L6D A;  3CMI A;  1W4V A;  5L71 A;  1HYU A;  2VL2 A;  4MCU A;  3CTG A;  3TJG A;  1NW2 A;  2BTO T;  2HXK A;  3ZRD A;  3VWU A;  2K6V A;  4K7N A;  4O5R A;  1S3D A;  2IMD A;  4K6X A;  5KN3 A;  3F9U A;  2VL9 A;  1F2E A;  5JWR B;  2H8L A;  2VCX A;  2OE0 A;  5AGY A;  3A3T A;  3U6V A;  3EIN A;  3KJY A;  2C80 A;  5CO3 A;  1TDI A;  1C72 A;  2LRN A;  2VD0 A;  2L6C A;  3DGQ A;  2GVP A;  1SD9 A;  2V1M A;  2P31 A;  2DJ3 A;  3HXS A;  1RK4 A;  3ISO A;  3KP8 A;  4IVF A;  2EIQ A;  3LG6 A;  2BMX A;  3VWV A;  2HZE A;  3L9U A;  3TJK A;  4KX4 A;  2NDO A;  2GT5 A;  2B7K A;  1YZX A;  4ZBB A;  4V2N A;  3NOF A;  4J57 E;  4QL9 A;  1SYX A;  1B4Q A;  2VD1 A;  4BWQ A;  4NWY A;  1PA3 A;  4MZW A;  4KCA A;  1V40 A;  1G6Y A;  2ON7 A;  3GL3 A;  5ECP B;  4IKH A;  1E2Y A;  2WB9 A;  3I6A A;  1T3B A;  4K7I A;  2CQ9 A;  4RUV A;  4Q5Q A;  1KEB A;  1QK8 A;  3IRA A;  5G1K A;  1GUM A;  2HFD A;  3KM6 A;  1GTI A;  2DJ0 A;  5A4U A;  2PU9 C;  3WYW A;  2GZZ A;  4JBB A;  4DEJ A;  4CDO A;  3F3R A;  3TDG A;  4P3Y B;  1HNB A;  4IP1 A;  1A0R P;  2H1G A;  2J9H A;  4GF0 A;  4HJ2 A;  3KH9 A;  4EDY A;  1VRS D;  3IAM 2;  3UL3 A;  2GGT A;  1OC9 B;  3UAP A;  2LNS A;  4EE0 A;  1TJD A;  4MH3 A;  1VF4 A;  4CHS A;  3RPP A;  4KH7 A;  2PBJ A;  2LQO A;  2VCV A;  2H01 A;  4TVE A;  4PGT A;  1GSD A;  1CQG A;  5CRG A;  1Z7P A;  4XS4 B;  3IDV A;  3VFI A;  1ZYE A;  1GSU A;  3I9V 2;  4K2D A;  2H70 A;  3BOA A;  3EVI A;  1V9W A;  2JU5 A;  10GS A;  2KP1 A;  5F05 A;  2GSQ A;  5IO0 A;  5B7C A;  1GRX A;  3GX8 A;  1XW9 A;  1GLQ A;  1UC7 A;  2VIM A;  2F51 A;  3UMA A;  5D9V A;  2H74 A;  2R4V A;  3CBU A;  1OC3 A;  4KDX A;  5D9W A;  2GDR A;  2VLU A;  1HNA A;  1LJR A;  6GSY A;  1DUG A;  4ZB6 A;  2RUE A;  4V2M A;  4F0C A;  4DSQ A;  2E2M A;  2B1K A;  1PX7 A;  4NMU A;  5GSS A;  4F0B A;  3E0U A;  2PVO C;  1ILO A;  1HNC A;  4ZL9 A;  4HS1 A;  1T8E B;  2AAW A;  2DJ2 A;  4GLT A;  3TRP A;  8GSS A;  12GS A;  3HA9 A;  4ECB A;  3QFA C;  5COH A;  5IPG A;  4BL7 A;  1MDI A;  3S9F A;  1TW9 A;  3BCI A;  3FZ5 A;  1F3B A;  4AJ7 A;  1O7U A;  4ILF A;  2V41 A;  1H4O A;  3TKS C;  2H1A A;  4AJ8 A;  5KN0 A;  3VWW A;  4YAP A;  3V1W A;  2DIY A;  1PRX A;  2X99 A;  3ME7 A;  2C0F A;  4EKZ A;  1T1V A;  4MK3 A;  1SU9 A;  2V2G A;  2LJR A;  3WGE A;  5IMZ A;  2C1Y A;  4PQH A;  4JZQ A;  3ZIT A;  1F37 A;  3G9B A;  4HU7 A;  1BX9 A;  2C4J A;  1M9B A;  4I5Q A;  4WXT A;  1Z3E A;  1GTA A;  3WT2 A;  3HJM A;  17GS A;  4KW6 A;  1YJ6 A;  1MTC A;  3IBH A;  3UAR A;  1UVZ A;  2ZUP A;  2R6K A;  4GXZ A;  2VCW A;  3TJF A;  1TRS A;  2R37 A;  3F4T A;  1B4P A;  1XVW A;  4KSM A;  4ECC A;  4PUA A;  2EIO A;  2F8A A;  5D93 A;  4ZBA A;  1IYH A;  4KB3 A;  3NIV A;  3GYK A;  3NZN A;  5DBQ A;  2RLI A;  1OC8 A;  2NPB A;  3M3M A;  1AXD A;  4NV5 A;  2H19 A;  2YAN A;  1T7P B;  1X0R A;  2CX3 A;  1A2M A;  5DQY A;  4GWR A;  2AYT A;  3LXT A;  4L5L A;  4O7H A;  1JZR A;  3ZYW A;  2LS5 A;  4NXI A;  2VCQ A;  2VLT A;  1GSY A;  2YWO A;  3KMO A;  4ZXG A;  5INY A;  2OAD A;  2GSS A;  4MPG A;  1GNW A;  3JCM L;  5ENU A;  4EDZ A;  1KTE A;  3UBL A;  2B1L A;  2A2S A;  3VWX A;  4ID0 A;  4LA1 A;  3APO A;  3GL5 A;  4KCE A;  4TR1 A;  1O6J A;  3FEU A;  2I9H A;  1A2J A;  3IPZ A;  2JSY A;  2FA8 A;  1GSE A;  3ERW A;  2IWT A;  2GT6 A;  3WT1 A;  1FB0 A;  3WD6 A;  2FWG A;  3GKN A;  3P8W A;  3GN3 A;  1H75 A;  4IW9 A;  2WFC A;  4HOJ A;  2CVD A;  1PSQ A;  3GA4 A;  1PQN A;  3M9J A;  3P90 A;  2DIZ A;  5AN1 A;  2OA7 A;  4FIW A;  1B9Y C;  3DKS A;  2LUS A;  1GSQ A;  4YQM A;  2TRX A;  1WRY A;  5FT3 A;  1S3A A;  1TOF A;  1O8W A;  3H8Q A;  4L0W A;  2GS3 A;  1FO5 A;  1R26 A;  5LNK e;  2P5R A;  4KSO A;  4K8M A;  4I8B A;  2R5G A;  5DAL A;  5G30 A;  5ELG A;  1F6M C;  3EE2 A;  4IBP A;  1J08 A;  2HLS A;  4IN0 A;  2RUF A;  3IA1 A;  4L0U A;  2QKE A;  2L4Q A;  3ZTL A;  3TUE A;  1N8J A;  3IE3 A;  1XW5 A;  3TJJ A;  2MYG A;  2C3T A;  4YQV A;  2IIY A;  1XWA A;  2VM1 A;  1EEM A;  2CVB A;  3HJP A;  1U87 A;  1YQ1 A;  3HZ8 A;  3GST A;  4N10 A;  1Z6N A;  2G2Q A;  2AJQ B;  4MAB A;  2CX4 A;  2F3M A;  3HYP A;  1GP1 A;  3BJ5 A;  3KCM A;  3FRC A;  4TRX A;  3ME8 A;  4TKY A;  4V2L A;  2MMZ A;  2CA8 A;  3FZ9 A;  2MMO A;  4MLY A;  2LRT A;  2VM2 A;  1OAZ A;  5G2Z A;  1SEN A;  3FYG A;  5KEJ A;  4PUF C;  3LYK A;  1AW9 A;  3ZVJ D;  3GX0 A;  5ECM B;  5DCH A;  2GQK A;  2IFQ A;  2ON5 A;  2VOC A;  2JZT A;  2H73 A;  4WR4 A;  1OKT A;  1QUW A;  2FWE A;  3TCO A;  2LJA A;  4LL4 B;  4DSS B;  4TR1 B;  4F82 A;  3D4T A;  2FD3 A;  3DD3 A;  3LFL A;  3I43 A;  5LD0 A;  5ECQ B;  4OWY A;  2FLS A;  2P5Q A;  4FH8 A;  1IYI A;  1PL1 A;  5IMF A;  2L5L A;  2M80 A;  1PN9 A;  2V6K A;  1O81 A;  4ZIL A;  5HR3 A;  3F4R A;  2D2Z A;  1F9M A;  3HDC A;  3CXG A;  3HKR A;  4IQ1 A;  5GAP D;  5B8B A;  4GST A;  1THX A;  3LJR A;  2HI7 A;  4I2T A;  2H75 A;  2B5X A;  2PWJ A;  3P7X A;  2ES7 A;  3QCP A;  3KZQ A;  4GQC A;  4X43 A;  1WP0 A;  3MNG A;  1G7O A;  1JHB A;  5C00 A;  5JCU A;  5F06 A;  3TGZ A;  2NVL A;  1TRW A;  2VUP A;  3H1N A;  1XWB A;  1BQ7 A;  3IOS A;  2J23 A;  1JLV A;  4GTU A;  2PGT A;  1ERW A;  2HRF A;  3RHC A;  3TRQ A;  1OE7 A;  4JR6 A;  2WS2 A;  1XFL A;  4KDY A;  2YN1 A;  3UBK A;  5F0G A;  2B3S A;  2R3X A;  4K1F A;  3QR6 A;  4GRF A;  4AJ6 A;  1EV9 A;  1K0M A;  5B6M A;  1R5P A;  3IXR A;  4O32 A;  1YF0 A;  5A5K A;  2IL3 A;  3PGT A;  3UVT A;  1FAA A;  3EWL A;  1W89 A;  2JZS A;  3ZFB A;  5KN1 A;  2CVK A;  3APS A;  3TKS E;  2YCD A;  2K18 A;  4OMV A;  3PIN A;  3KXO A;  3L9S A;  4YQU A;  2Z9S A;  3ERF A;  2WCI A;  4IGJ A;  2LKU A;  5FWG A;  5DVB A;  1FHE A;  5CP1 A;  2I3Y A;  1QGV A;  5ECI B;  3CSJ A;  4WKW A;  1EGR A;  3LEF A;  1A8L A;  3H93 A;  3QPM A;  2VL3 A;  2JAC A;  2IMI A;  4KND A;  3DML A;  1NM3 A;  2C3Q A;  4V1A g;  5CYY A;  3Q74 A;  1SKS B;  3GH9 A;  4FYC A;  2OAC A;  5G5E A;  1ON4 A;  2F8F A;  1G0T A;  4ZL7 A;  5CAX A;  3LWA A;  4H86 A;  1BYE A;  3OR5 A;  2N5B A;  2N5A A;  5AIS A;  4D73 A;  1AUC A;  1A24 A;  3VLN A;  3CRU A;  2IJY A;  2NTO A;  3DXB A;  1S3C A;  2GTU A;  3GKK A;  2B7J A;  2M46 A;  1X5C A;  4HJM A;  4IJ3 A;  3VK9 A;  5ID2 B;  5GST A;  4E8H A;  3TRX A;  3P2A A;  2I81 A;  2WDU A;  3J7Y k;  2V32 A;  3GH6 A;  1QQ2 A;  1Z9H A;  1UN2 A;  2B5Y A;  4IHU A;  3MDK A;  1XBS A;  3L9V A;  4E8E A;  5AIX A;  2DC5 A;  2DML A;  4POK A;  3GUR A;  4EF0 A;  1K0N A;  2H76 A;  1ZMA A;  2FGX A;  4N11 A;  4PNG A;  3C1S A;  4I97 A;  6GSX A;  4J2F A;  5IOX A;  4EUY A;  3VI5 A;  3H79 A;  4ZIJ A;  2DLX A;  2H0G A;  3GNJ A;  4KGI A;  1X9S B;  3ZRE A;  2WZ9 A;  4O92 A;  6GSS A;  3FHK A;  3HZ4 A;  2YZH A;  3G7Y A;  1U3A A;  2I4A A;  4YH2 A;  2HZE B;  3RAZ A;  5A4V A;  1EP7 A;  1JFU A;  4XIH A;  4K0N A;  1Z7R A;  3WGD A;  3QAW A;  1FVJ A;  1XXU A;  3KP9 A;  2JL4 A;  5DCG A;  2RM5 A;  1Z6M A;  6GSW A;  1T4Z A;  5D9T A;  4ZBD A;  4JRR A;  2H66 A;  2O7K A;  3M0F A;  3LGC A;  3D21 A;  2O89 A;  2B6M A;  3R2Q A;  1V98 A;  2VO4 A;  4ML6 A;  5IMV A;  1DBY A;  5JWO B;  1R7H A;  2EIR A;  1AQV A;  1GTU A;  4MJE A;  3QAG A;  3HY2 A;  4GCI A;  5D96 A;  2H6Z A;  1ZCP A;  5EPF A;  2IMF A;  5GAN D;  2MZC A;  1DE1 A;  4EC0 A;  5E59 A;  3L4N A;  1GNE A;  3RPN A;  4PUR A;  4TR0 A;  1PKZ A;  2DMM A;  4KUN A;  1SK0 A;  2HZF A;  2VLV A;  1V58 A;  2PUK C;  4CW9 A;  5ELA A;  1PGT A;  4LMV A;  2WRT A;  3PH9 A;  2PER A;  3EU4 A;  4JR4 A;  1M7T A;  2MBT A;  2XBQ A;  3HCZ A;  4Q5R A;  2PMT A;  1UA5 A;  3FR3 A;  1FB6 A;  4EO3 A;  2H1B A;  2OBK A;  3D5J A;  1MD3 A;  1GH2 A;  5DJM A;  1GUH A;  2PN8 A;  6GSU A;  5D73 A;  5IO2 A;  1NHO A;  4WBR D;  3GTU A;  2V6O A;  4RI7 A;  3EUR A;  3H4K A;  3UIW A;  2G0F A;  1F3A A;  3QD9 A;  1EOH A;  2GLR A;  3UVH A;  2R2J A;  4BVY A;  2OE1 A;  4XTS A;  3DYR A;  1NSW A;  4TN8 A;  1YKA A;  4X0X A;  4GQF A;  1YY7 A;  5D9X A;  5IMA A;  1GUL A;  3GSS A;  3LSZ A;  4XRA A;  1ERU A;  1ACV A;  4N30 A;  4RQX A;  4XRD A;  2YWI A;  1K0A A;  2QSI A;  4G19 A;  1AAZ A;  5ABR A;  4WBJ A;  3GRX A;  4IQA A;  5DQS A;  3DRN A;  3ZML A;  1R5A A;  3N9J A;  3KEB A;  3LXZ A;  5LCZ A;  2H6X A;  1RQM A;  3GUS A;  5G5F A;  1TU8 A;  3VUR A;  2HSY A;  3O76 A;  2CT6 A;  4MMM A;  4PX1 A;  3D4M A;  1AQW A;  4NPB A;  1K3O A;  1K0C A;  3ERG A;  1SJZ A;  1LU4 A;  5DJL A;  1AC1 A;  2IMK A;  2CAI A;  1EV4 A;  4MH2 A;  3EU3 A;  4Z7X A;  3PR8 A;  1K0O A;  3Q19 A;  1TK8 B;  1URM A;  2REM A;  3MAK A;  1ERT A;  19GS A;  20GS A;  5CRD A;  2XHF A;  4Q5F A;  1XCC A;  1PL2 A;  1PX6 A;  4NHW A;  1JZW A;  3DVW A;  1GWC A;  1X9W B;  2WGR A;  1K0D A;  4POL A;  2X8C A;  1YEP A;  2VCZ A;  3O3T A;  4OD7 A;  2FNO A;  2ZCT A;  1XWK A;  2AHE A;  4KDU A;  3MWH A;  2KUC A;  1DSB A;  1A8Y A;  2DSA A;  3GHA A;  2L5O A;  1X5D A;  2P0G A;  2B5E A;  1HQO A;  1XWC A;  3TKR A;  4WF4 A;  2WUL A;  2YV7 A;  2DJK A;  4J56 E;  1V2A A;  4ZB8 A;  3AY8 A;  1WWJ A;  3FZA A;  3W8J A;  1QFN A;  2N5F A;  2ALB A;  5AIV A;  2X8G A;  4MDC A;  4F03 A;  1ERV A;  1T4Y A;  4MPF A;  2CZ2 A;  4ECJ A;  5J41 A;  3HD5 A;  5ECL B;  2HRN A;  2E0Q A;  3EC3 A;  2BJX A;  1M99 A;  2LTK A;  3DIE A;  1J0F A;  5J4U A;  11GS A;  1A23 A;  3TKP A;  5H5Q A;  3C7M A;  1TU7 A;  2FY6 A;  1U3I A;  5JCG A;  1USB A;  3TKS A;  4I6X A;  2NBS A;  1E6B A;  4WEY A;  4XS4 A;  1M0U A;  4LLR A;  4PXO A;  3TOU A;  1JZD A;  2XBI A;  2H71 A;  4AGS A;  3SWL A;  1VGL A;  1WE0 A;  5KN2 A;  5ECO B;  1YEX A;  2IME A;  3UOM A;  2X8H A;  1G6W A;  1QXH A;  3CTF A;  4G10 A;  2PVQ A;  2HNL A;  4MJB A;  5H5S A;  7GSS A;  5HR0 A;  3A2V A;  3N5O A;  1WIK A;  2LST A;  3GV1 A;  3KD0 A;  2O8V B;  3BD2 A;  5DAL B;  5G31 A;  4F9Z A;  2F9S A;  1JLW A;  2L4C A;  4Q5N A;  3W6G A;  1BED A;  2C8U A;  4K0G A;  5JCW A;  3VPQ A;  4BWS A;  1PMT A;  1MD4 A;  4TW5 A;  3IAS 2;  3IK9 A;  3O6T A;  3I69 A;  4QQ7 A;  4WR5 A;  3IK7 A;  5ECH B;  1U88 A;  3ED3 A;  1M2D A;  1BJX A;  3ZIV A;  5C04 A;  3TKQ A;  1I9D A;  5CRW A;  5HR2 A;  6GSV A;  4OCE A;  4DSR A;  2I1U A;  2GSR A;  1FG4 A;  2LV3 A;  5HFG A;  5IOW A;  3HVS A;  4MZB A;  4GSN A;  5B8A A;  3HHV A;  2MMN A;  5EVO A;  1VF3 A;  3C73 A;  4FYU A;  2QGV A;  5ECR B;  3E3E A;  2CV4 A;  1M2A A;  2E2G A;  9GSS A;  1VF1 A;  2WJU A;  5E4W A;  1SD8 A;  1SYR A;  5IMD A;  2H6Y A;  4LMW A;  5J5N A;  3APQ A;  2YV9 A;  2TIR A;  2YJ7 A;  1J9B A;  4HEA 2;  5DDL A;  3D6I A;  3DVX A;  5EY6 A;  1FOV A;  1WJK A;  5IM9 A;  1K3L A;  3C71 A;  3F0I A;  2IFQ B;  4ZL8 A;  4TOP A;  1AIU A;  4POM A;  1TI3 A;  2IN3 A;  1XW6 A;  4BVX A;  2LEG A;  2YWM A;  1SL2 B;  1YDK A;  2CAQ A;  1B48 A;  4LL1 B;  2RII A;  4HZ4 A;  5ECK B;  4BPY A;  4JED A;  2L59 A;  1FW1 A;  2YZU A;  1GSS A;  1I5G A;  4L8E A;  2EC4 A;  4XS1 A;  1SL0 B;  5FHI A;  1ABA A;  1TRV A;  2LRC A;  4OFM A;  3J7Y b;  2H0H A;  4IJI A;  3KH7 A;  3FK8 A;  1EP8 A;  1TKD B;  1CQH A;  1EEJ A;  3IC4 A;  4OO5 A;  2FHE A;  2HT9 A;  2OBI A;  1DE2 A;  2C0G A;  4FO5 A;  3F63 A;  4JU5 A;  2KP2 A;  2FCH A;  3FY7 A;  3UEM A;  2E7P A;  2XPD A;  2VAF A;  4OCF A;  3RDW A;  2H72 A;  1TXX A;  2CZ3 A;  2GQL A;  1XOA A;  3HJO A;  1ZZY A;  2FUG 2;  1BAY A;  3QAV A;  1TRU A;  2YWN A;  4MA9 A;  2AUV A;  1MEK A;  4AF2 A;  1YKC A;  4G2E A;  4EVM A;  1O8X A;  18GS A;  1ZYQ B;  2AV4 A;  2PPT A;  4POB A;  3KGK A;  1XPV A;  3GIX A;  4RI6 A;  1ZGN A;  2XPE A;  2GZP A;  3M8N A;  2M72 A;  1PKW A;  3C1R A;  1ML6 A;  5F07 A;  4NV2 A;  1QMV A;  2KHP A;  3F8U A;  4IS0 A;  1OKD A;  1O85 A;  2JSZ A;  2K8S A;  4TR4 A;  3BCK A;  2OJL A;  4ECI A;  5J3R A;  3M1G A;  1SL1 B;  2YJH A;  2MMA A;  1B8X A;  2LJK A;  3K8N A;  3WGX A;  1GSF A;  1U6T A;  4ACS A;  2AB6 A;  2VCT A;  3G7J A;  1K3Y A;  5HQP A;  2FA4 A;  4F2I A;  3GKX A;  1GL8 A;  5DAK A;  2VL2 C;  1XOB A;  2FWH A;  1EGO A;  3F6D A;  4G9H A;  4X1U A;  5ECN B;  4BA7 A;  4HQZ A;  3RBT A;  2KLX A;  1B9X C;  16GS A;  2K9F A;  5F8B A;  3F3Q A;  5H5R A;  4NAX A;  5IQY A;  2KOK A;  5IIZ A;  4D73 B;  4TXO A;  1AQX A;  3F6F A;  1A2L A;  3SBC A;  4ZB9 A;  2OKA A;  3CSI A;  5HFI A;  3D22 A;  4K7O A;  2ZNM A;  4HZ2 A;  3A2X A;  2C3N A;  2YOI A;  2OE3 A;  3QDN A;  1WMJ A;  4XCS A;  4XHM A;  5HR1 A;  2YP6 A;  3QFB C;  3ZMK A;  1GLP A;  2LNT A;  3F4S A;  2X64 A;  1PD2 1;  3A5W A;  1JZO A;  1MDJ A;  4NHZ A;  2DBC A;  4XS6 A;  3FW2 A;  3IV4 A;  1OVN A;  1BG5 A;  4HI7 A;  4PQI A;  1SK2 A;  3ZVJ A;  1Q4J A;  2A4V A;  4PQ1 A;  5CRH A;  4HDE A;  3TB2 A;  5IPH A;  3BBY A;  3RHB A;  4MZC A;  4DSS A;  2MBS A;  1SJ6 A;  1EWX A;  3VI7 A;  4ML1 A;  1O73 A;  2L57 A;  1XZO A;  4I2U A;  1FVK A;  3US3 A;  3Q6O A;  2JZR A;  4EL1 A;  2QC7 A;  4N0V A;  2O87 A;  1RW1 A;  4RQR A;  2GST A;  5A4W A;  3FZ4 A;  4OFN A;  4EXJ A;  1T00 A;  1SJI A;  1M2B A;  1ZL9 A;  3LQ7 A;  4QL7 A;  3ZZX A;  1GUK A;  3FKF A; 
#chains in the Genus database with same CATH topology
 3KTL A;  5GZZ B;  4MJA A;  5EL8 A;  2YPM A;  1LBK A;  3UJ1 A;  2LQQ A;  3M9K A;  4N0Z A;  1ST9 A;  3LOR A;  1M9A A;  5J9B A;  1EOG A;  13GS A;  4ULX A;  5ECS A;  4ISD A;  2HE3 A;  4X4J A;  3FR9 A;  1SKR B;  4KAE A;  1THO A;  2QA1 A;  4MP4 A;  1KNG A;  2GQM A;  2HYX A;  4WET A;  4OO4 A;  2HSH A;  1Y6E A;  3TOT A;  1TTZ A;  3EMX A;  1GTB A;  5DAK B;  1A0F A;  1MDK A;  2H1D A;  3CSH A;  4L5O A;  1XWG A;  2GZY A;  1TK0 B;  1NHY A;  1TP9 A;  3CYN A;  1V57 A;  3ZLP A;  4JE1 A;  3G7I A;  1Z5Y E;  4YAV A;  5B6N A;  5G1L A;  3DWV A;  2C0E A;  5IMC A;  1YF1 A;  2K8V A;  1XIY A;  4TXO B;  4KE3 A;  4MF6 A;  3U5R E;  3MSZ A;  1KBN A;  1Q98 A;  3MIX A;  3E9J B;  5D8I A;  2FWF A;  5KOX A;  22GS A;  2RM6 A;  5CRE A;  2DJ1 A;  1ZOF A;  3Q18 A;  3CRT A;  1R4W A;  4K9Z A;  4IP6 A;  2JAD A;  3KMN A;  1SK1 A;  1XVQ A;  4HQS A;  4MF5 A;  6GST A;  1OE8 A;  1SKW B;  3HVV A;  1OYJ A;  3FMW A;  3GTU B;  3IHQ A;  1FOH A;  3A2W A;  3QMX A;  2H30 A;  3MYD A;  3ZFL A;  3L0H A;  4DVC A;  3LYP A;  4HUA A;  3KIJ A;  4PNF A;  14GS A;  3HVX A;  4TR3 A;  5J9C A;  3ZIJ A;  4BVY B;  1HD2 A;  4TXV A;  1OC9 A;  3DEX A;  1Y25 A;  1TI1 A;  1WPI A;  4KA0 A;  2DJJ A;  3EMP A;  2IPA A;  4OFT A;  3KTB A;  2UZ8 A;  4GSS A;  4WF5 A;  2C0D A;  4MJC A;  3TJB A;  4EIQ A;  1WOU A;  5JWQ B;  5HFK A;  3FR6 A;  4V1A p;  1N2A A;  3VPT A;  4IEL A;  3C8E A;  2O85 A;  2A2R A;  2YNX A;  1TK5 B;  1VF2 A;  3QOU A;  3IR4 A;  3ZL5 A;  4HU9 A;  2H0I A;  5ID2 A;  3EYT A;  3GKM A;  5CNW A;  3GMF A;  3W8S A;  1X9M B;  1EZK A;  1G7E A;  3D0Z A;  3GFK A;  3L78 A;  2TRC P;  1K0B A;  2XC2 A;  4MF7 A;  4FYB A;  1X5E A;  2L6D A;  3CMI A;  1W4V A;  5L71 A;  1HYU A;  2VL2 A;  4MCU A;  3CTG A;  3TJG A;  1NW2 A;  2BTO T;  2HXK A;  3ZRD A;  3VWU A;  2K6V A;  4K7N A;  4O5R A;  3A5I A;  1S3D A;  2IMD A;  4K6X A;  5KN3 A;  3F9U A;  2VL9 A;  1F2E A;  5JWR B;  2H8L A;  3IC8 A;  2VCX A;  2OE0 A;  5AGY A;  3A3T A;  3U6V A;  3EIN A;  2X49 A;  3KJY A;  2C80 A;  5CO3 A;  1TDI A;  1C72 A;  2LRN A;  2VD0 A;  2L6C A;  3DGQ A;  2GVP A;  1SD9 A;  2V1M A;  2P31 A;  2DJ3 A;  3HXS A;  1RK4 A;  3ISO A;  3KP8 A;  4IVF A;  2EIQ A;  3LG6 A;  2BMX A;  3VWV A;  2HZE A;  3L9U A;  3TJK A;  4KX4 A;  2NDO A;  2GT5 A;  2B7K A;  1YZX A;  4ZBB A;  4V2N A;  3NOF A;  4J57 E;  4QL9 A;  1SYX A;  1B4Q A;  2VD1 A;  4BWQ A;  4NWY A;  1PA3 A;  4MZW A;  4KCA A;  1V40 A;  1G6Y A;  2ON7 A;  3GL3 A;  5ECP B;  4IKH A;  1E2Y A;  2WB9 A;  3I6A A;  1T3B A;  1PFO A;  4K7I A;  2CQ9 A;  4RUV A;  4Q5Q A;  1KEB A;  1QK8 A;  3IRA A;  5G1K A;  1GUM A;  2HFD A;  3KM6 A;  1GTI A;  2DJ0 A;  5A4U A;  2PU9 C;  3WYW A;  2GZZ A;  4JBB A;  4DEJ A;  4CDO A;  3F3R A;  3TDG A;  4P3Y B;  1HNB A;  4IP1 A;  1A0R P;  2H1G A;  2J9H A;  4GF0 A;  4HJ2 A;  3KH9 A;  4EDY A;  1VRS D;  3IAM 2;  3UL3 A;  2GGT A;  1OC9 B;  3UAP A;  2LNS A;  4KF9 A;  4EE0 A;  1TJD A;  4MH3 A;  1VF4 A;  4CHS A;  3RPP A;  4KH7 A;  2PBJ A;  2LQO A;  2VCV A;  2H01 A;  4TVE A;  4PGT A;  1GSD A;  1CQG A;  5CRG A;  1Z7P A;  4XS4 B;  3IDV A;  3VFI A;  1ZYE A;  1GSU A;  3I9V 2;  4K2D A;  2H70 A;  3BOA A;  3EVI A;  1V9W A;  2JU5 A;  10GS A;  2KP1 A;  5F05 A;  2GSQ A;  5IO0 A;  5B7C A;  1GRX A;  3GX8 A;  1XW9 A;  1GLQ A;  1UC7 A;  2VIM A;  2F51 A;  3UMA A;  5D9V A;  2H74 A;  2R4V A;  3CBU A;  1OC3 A;  4KDX A;  5D9W A;  2GDR A;  2VLU A;  1HNA A;  1LJR A;  6GSY A;  1DUG A;  4ZB6 A;  2RUE A;  4V2M A;  4F0C A;  4DSQ A;  2E2M A;  2B1K A;  1PX7 A;  4NMU A;  5GSS A;  4F0B A;  3E0U A;  2PVO C;  1ILO A;  1HNC A;  4ZL9 A;  4HS1 A;  1T8E B;  2AAW A;  2DJ2 A;  4GLT A;  3TRP A;  8GSS A;  12GS A;  3HA9 A;  4ECB A;  3QFA C;  5COH A;  5IPG A;  4BL7 A;  2DKI A;  4K5R A;  1MDI A;  4O5U A;  3S9F A;  1TW9 A;  3BCI A;  3FZ5 A;  1F3B A;  4AJ7 A;  1O7U A;  4ILF A;  2V41 A;  1H4O A;  3TKS C;  2H1A A;  4AJ8 A;  5KN0 A;  3VWW A;  4YAP A;  3V1W A;  2DIY A;  1PRX A;  2X99 A;  3ME7 A;  2C0F A;  4EKZ A;  1T1V A;  4MK3 A;  1SU9 A;  2V2G A;  2LJR A;  3WGE A;  5IMZ A;  2C1Y A;  4PQH A;  4JZQ A;  3ZIT A;  1F37 A;  3G9B A;  4HU7 A;  2A2P A;  1BX9 A;  2C4J A;  1M9B A;  4I5Q A;  4WXT A;  1Z3E A;  1GTA A;  3WT2 A;  3HJM A;  4BVX B;  17GS A;  4KW6 A;  1YJ6 A;  1MTC A;  3IBH A;  4USS A;  3UAR A;  1UVZ A;  2ZUP A;  2R6K A;  4GXZ A;  2VCW A;  3TJF A;  1TRS A;  2R37 A;  3F4T A;  1B4P A;  1XVW A;  4KSM A;  4ECC A;  4PUA A;  2EIO A;  2F8A A;  5D93 A;  4ZBA A;  1IYH A;  4KB3 A;  3NIV A;  3GYK A;  3NZN A;  5DBQ A;  2RLI A;  1OC8 A;  2NPB A;  3M3M A;  1AXD A;  4NV5 A;  2H19 A;  2YAN A;  1T7P B;  1X0R A;  2CX3 A;  1A2M A;  5DQY A;  4GWR A;  2AYT A;  3LXT A;  4L5L A;  4O7H A;  1JZR A;  3ZYW A;  2LS5 A;  4NXI A;  2VCQ A;  2VLT A;  1GSY A;  2YWO A;  3KMO A;  4ZXG A;  5INY A;  2OAD A;  2GSS A;  4MPG A;  1GNW A;  3JCM L;  5ENU A;  4EDZ A;  1KTE A;  3UBL A;  2B1L A;  2A2S A;  3VWX A;  4ID0 A;  4LA1 A;  3APO A;  3GL5 A;  4KCE A;  4TR1 A;  1O6J A;  3FEU A;  2I9H A;  1A2J A;  3IPZ A;  2JSY A;  4G0I A;  2FA8 A;  1GSE A;  3ERW A;  2IWT A;  2GT6 A;  3WT1 A;  1FB0 A;  3WD6 A;  2FWG A;  3GKN A;  3P8W A;  3GN3 A;  1H75 A;  4IW9 A;  2WFC A;  4HOJ A;  2CVD A;  1PSQ A;  3GA4 A;  1PQN A;  3M9J A;  3P90 A;  2DIZ A;  5AN1 A;  2OA7 A;  4FIW A;  1B9Y C;  3DKS A;  2LUS A;  1GSQ A;  4YQM A;  2TRX A;  1WRY A;  5FT3 A;  1S3A A;  1TOF A;  1O8W A;  3H8Q A;  4L0W A;  2GS3 A;  1FO5 A;  1R26 A;  5LNK e;  2P5R A;  4KSO A;  4K8M A;  4I8B A;  2R5G A;  5DAL A;  5G30 A;  5ELG A;  1F6M C;  3EE2 A;  4IBP A;  1J08 A;  2HLS A;  4IN0 A;  2RUF A;  3CQF A;  3IA1 A;  4L0U A;  2QKE A;  2L4Q A;  4EIP A;  3ZTL A;  3TUE A;  1N8J A;  3IE3 A;  1XW5 A;  3TJJ A;  2MYG A;  2C3T A;  4YQV A;  2IIY A;  1XWA A;  2VM1 A;  1EEM A;  2CVB A;  1ZYN A;  3HJP A;  1U87 A;  1YQ1 A;  3HZ8 A;  3GST A;  4N10 A;  1Z6N A;  2G2Q A;  2AJQ B;  4MAB A;  2CX4 A;  2F3M A;  4YKF A;  3HYP A;  1GP1 A;  3BJ5 A;  3KCM A;  3FRC A;  4TRX A;  3ME8 A;  4TKY A;  4V2L A;  2MMZ A;  2CA8 A;  4FQU A;  3FZ9 A;  2MMO A;  4MLY A;  2LRT A;  2VM2 A;  1OAZ A;  2HRA A;  1SEN A;  5G2Z A;  3FYG A;  5KEJ A;  4PUF C;  3LYK A;  1AW9 A;  3ZVJ D;  3GX0 A;  5ECM B;  5DCH A;  2GQK A;  2IFQ A;  2ON5 A;  2VOC A;  2JZT A;  2H73 A;  4WR4 A;  1OKT A;  1QUW A;  2FWE A;  3TCO A;  2LJA A;  4LL4 B;  4DSS B;  4TR1 B;  4F82 A;  3D4T A;  2FD3 A;  3DD3 A;  3LFL A;  3I43 A;  5LD0 A;  5ECQ B;  4OWY A;  2FLS A;  2P5Q A;  4FH8 A;  1IYI A;  1PL1 A;  5IMF A;  2L5L A;  2M80 A;  1PN9 A;  2V6K A;  1O81 A;  4BIK A;  4ZIL A;  5HR3 A;  3F4R A;  2D2Z A;  1F9M A;  3HDC A;  3CXG A;  3HKR A;  4IQ1 A;  4A5P A;  5GAP D;  5B8B A;  3PPU A;  4GST A;  1THX A;  3LJR A;  2HI7 A;  1M3J A;  4I2T A;  2H75 A;  2B5X A;  2PWJ A;  3P7X A;  2ES7 A;  3QCP A;  3KZQ A;  4GQC A;  4X43 A;  1WP0 A;  3MNG A;  1G7O A;  1JHB A;  5C00 A;  5JCU A;  5F06 A;  3TGZ A;  2NVL A;  1TRW A;  2VUP A;  2A4H A;  3H1N A;  1XWB A;  1BQ7 A;  3IOS A;  2J23 A;  1JLV A;  4GTU A;  2PGT A;  1ERW A;  2HRF A;  3RHC A;  3TRQ A;  1OE7 A;  4JR6 A;  2WS2 A;  2R0C A;  1XFL A;  4KDY A;  2YN1 A;  3UBK A;  5F0G A;  2B3S A;  2R3X A;  4K1F A;  3QR6 A;  4GRF A;  4AJ6 A;  1EV9 A;  1K0M A;  4CY8 A;  5B6M A;  1R5P A;  3IXR A;  4O32 A;  1YF0 A;  5A5K A;  2IL3 A;  3PGT A;  3UVT A;  1FAA A;  3EWL A;  1W89 A;  2JZS A;  3ZFB A;  5KN1 A;  2CVK A;  3APS A;  3TKS E;  2YCD A;  2K18 A;  4OMV A;  3PIN A;  3KXO A;  3L9S A;  4YQU A;  2Z9S A;  3ERF A;  2WCI A;  4IGJ A;  2LKU A;  5FWG A;  5DVB A;  1FHE A;  5CP1 A;  2DKH A;  2I3Y A;  1QGV A;  5ECI B;  3CSJ A;  4WKW A;  1EGR A;  4PTS A;  3LEF A;  1A8L A;  3H93 A;  3QPM A;  2VL3 A;  2JAC A;  2IMI A;  4KND A;  3DML A;  1NM3 A;  2C3Q A;  4V1A g;  5CYY A;  3Q74 A;  1SKS B;  3GH9 A;  4FYC A;  2OAC A;  5G5E A;  1ON4 A;  2F8F A;  1G0T A;  4ZL7 A;  5CAX A;  3LWA A;  4H86 A;  1BYE A;  3OR5 A;  2N5B A;  2N5A A;  5AIS A;  4D73 A;  1AUC A;  1A24 A;  3VLN A;  3CRU A;  2IJY A;  2NTO A;  3DXB A;  1S3C A;  2GTU A;  3HVN A;  3GKK A;  2B7J A;  2M46 A;  1X5C A;  4HJM A;  4IJ3 A;  4K2X A;  3VK9 A;  5ID2 B;  5GST A;  4E8H A;  3TRX A;  3P2A A;  5KOW A;  2I81 A;  2WDU A;  3J7Y k;  2V32 A;  3GH6 A;  1QQ2 A;  1Z9H A;  1S3R A;  1UN2 A;  2B5Y A;  4IHU A;  3MDK A;  1XBS A;  3L9V A;  4E8E A;  5AIX A;  2DC5 A;  2DML A;  4POK A;  3GUR A;  4EF0 A;  1K0N A;  2H76 A;  1ZMA A;  2FGX A;  4N11 A;  4PNG A;  3C1S A;  4I97 A;  6GSX A;  4J2F A;  5IOX A;  4EUY A;  3VI5 A;  3H79 A;  4ZIJ A;  2DLX A;  2H0G A;  3GNJ A;  4KGI A;  1X9S B;  3ZRE A;  2WZ9 A;  4O92 A;  6GSS A;  3FHK A;  3HZ4 A;  2YZH A;  3G7Y A;  1U3A A;  2I4A A;  4YH2 A;  2HZE B;  3RAZ A;  5A4V A;  1EP7 A;  1JFU A;  4XIH A;  2HRK A;  4K0N A;  1PN0 A;  1Z7R A;  3WGD A;  3QAW A;  1FVJ A;  1XXU A;  1M3I A;  3KP9 A;  2JL4 A;  5DCG A;  2RM5 A;  1Z6M A;  6GSW A;  1T4Z A;  5D9T A;  4ZBD A;  4JRR A;  2H66 A;  2O7K A;  3M0F A;  3LGC A;  3D21 A;  2O89 A;  2B6M A;  3R2Q A;  1V98 A;  4G0K A;  2VO4 A;  4ML6 A;  5IMV A;  1DBY A;  5JWO B;  2R0G A;  1R7H A;  2EIR A;  5BMU A;  1AQV A;  1GTU A;  4MJE A;  3QAG A;  3HY2 A;  4GCI A;  2H6Z A;  5D96 A;  1ZCP A;  5EPF A;  2IMF A;  5GAN D;  2MZC A;  1DE1 A;  4EC0 A;  5E59 A;  3L4N A;  1GNE A;  3RPN A;  4PUR A;  4TR0 A;  1PKZ A;  2DMM A;  4KUN A;  1SK0 A;  2HZF A;  2VLV A;  1V58 A;  2PUK C;  4CW9 A;  5ELA A;  1PGT A;  4LMV A;  2WRT A;  3PH9 A;  2PER A;  3EU4 A;  4JR4 A;  1M7T A;  2MBT A;  2XBQ A;  3HCZ A;  4Q5R A;  2PMT A;  1UA5 A;  3FR3 A;  1FB6 A;  4EO3 A;  2H1B A;  2OBK A;  3D5J A;  1MD3 A;  1GH2 A;  5DJM A;  1GUH A;  4HSC X;  2PN8 A;  6GSU A;  5D73 A;  5IO2 A;  1NHO A;  4WBR D;  2HSM A;  3GTU A;  2V6O A;  4RI7 A;  3EUR A;  3H4K A;  3UIW A;  2G0F A;  1F3A A;  3QD9 A;  1EOH A;  2GLR A;  3UVH A;  2R2J A;  4BVY A;  2OE1 A;  4XTS A;  3DYR A;  1NSW A;  4TN8 A;  5BRT A;  1YKA A;  4K5S A;  4X0X A;  4GQF A;  1YY7 A;  5D9X A;  5IMA A;  1GUL A;  3GSS A;  3LSZ A;  4XRA A;  1ERU A;  1ACV A;  4N30 A;  4BL7 B;  4RQX A;  4Z2U A;  4CY6 A;  4XRD A;  2YWI A;  1K0A A;  2QSI A;  4G19 A;  1AAZ A;  5ABR A;  4WBJ A;  3GRX A;  4IQA A;  5DQS A;  3DRN A;  3ZML A;  1R5A A;  3N9J A;  3KEB A;  3LXZ A;  5LCZ A;  2H6X A;  1RQM A;  3GUS A;  5G5F A;  1TU8 A;  3VUR A;  2HSY A;  4Z2R A;  3O76 A;  2CT6 A;  4MMM A;  4PX1 A;  3D4M A;  1AQW A;  4NPB A;  1K3O A;  1K0C A;  3ERG A;  1SJZ A;  1LU4 A;  5DJL A;  1AC1 A;  2IMK A;  2CAI A;  1EV4 A;  4MH2 A;  3EU3 A;  4Z7X A;  3PR8 A;  1K0O A;  3Q19 A;  1TK8 B;  1URM A;  2REM A;  3MAK A;  1ERT A;  19GS A;  20GS A;  5CRD A;  2XHF A;  2R0P A;  4Q5F A;  1XCC A;  1PL2 A;  1PX6 A;  4NHW A;  1JZW A;  3DVW A;  1GWC A;  1X9W B;  2WGR A;  1K0D A;  4POL A;  2X8C A;  1YEP A;  2VCZ A;  3O3T A;  4OD7 A;  2FNO A;  2ZCT A;  1XWK A;  2AHE A;  4KDU A;  3MWH A;  2KUC A;  1DSB A;  1A8Y A;  2DSA A;  3GHA A;  2L5O A;  1X5D A;  2P0G A;  2B5E A;  1HQO A;  1XWC A;  3TKR A;  4WF4 A;  2WUL A;  2YV7 A;  2DJK A;  4J56 E;  1V2A A;  4ZB8 A;  3AY8 A;  1WWJ A;  3FZA A;  3W8J A;  1QFN A;  2N5F A;  2ALB A;  5AIV A;  3R3E A;  2X8G A;  4MDC A;  4F03 A;  1ERV A;  1T4Y A;  4MNN A;  4MPF A;  2CZ2 A;  4ECJ A;  5J41 A;  3HD5 A;  1ZYP A;  2E0Q A;  3EC3 A;  2HRN A;  5ECL B;  2BJX A;  1M99 A;  2LTK A;  3DIE A;  4YKG A;  1J0F A;  5J4U A;  11GS A;  1A23 A;  3TKP A;  5H5Q A;  3C7M A;  1TU7 A;  2FY6 A;  1U3I A;  5JCG A;  1USB A;  3TKS A;  4I6X A;  2NBS A;  1E6B A;  4WEY A;  4XS4 A;  1M0U A;  4LLR A;  4PXO A;  3TOU A;  1JZD A;  2XBI A;  2H71 A;  4AGS A;  3SWL A;  1VGL A;  1WE0 A;  5KN2 A;  5ECO B;  1YEX A;  2IME A;  3UOM A;  2X8H A;  1G6W A;  1QXH A;  3CTF A;  4G10 A;  2PVQ A;  2HNL A;  4MJB A;  5H5S A;  7GSS A;  5HR0 A;  3A2V A;  3N5O A;  1WIK A;  2LST A;  3GV1 A;  3KD0 A;  2O8V B;  3BD2 A;  5DAL B;  5G31 A;  4F9Z A;  2F9S A;  1JLW A;  2L4C A;  4Q5N A;  3W6G A;  1BED A;  2C8U A;  4K0G A;  5JCW A;  3VPQ A;  4BWS A;  1PMT A;  1MD4 A;  4TW5 A;  3IAS 2;  3IK9 A;  3O6T A;  3I69 A;  4QQ7 A;  4WR5 A;  3IK7 A;  5ECH B;  1U88 A;  3ED3 A;  1M2D A;  1BJX A;  3ZIV A;  5C04 A;  3TKQ A;  1I9D A;  5CRW A;  5HR2 A;  6GSV A;  4OCE A;  4DSR A;  2I1U A;  2GSR A;  1FG4 A;  2LV3 A;  5HFG A;  3IHG A;  5IOW A;  3HVS A;  4MZB A;  4GSN A;  5B8A A;  3HHV A;  2MMN A;  5EVO A;  1VF3 A;  3C73 A;  4FYU A;  2QGV A;  5ECR B;  3E3E A;  2CV4 A;  1M2A A;  2E2G A;  9GSS A;  1VF1 A;  2WJU A;  5E4W A;  1SD8 A;  1SYR A;  5IMD A;  2H6Y A;  4LMW A;  5J5N A;  3APQ A;  2YV9 A;  2TIR A;  2YJ7 A;  3EPT A;  1J9B A;  4HEA 2;  5DDL A;  3D6I A;  3DVX A;  5EY6 A;  1FOV A;  1WJK A;  5IM9 A;  1K3L A;  3C71 A;  3F0I A;  2IFQ B;  2X4A A;  4ZL8 A;  4TOP A;  1AIU A;  4POM A;  1TI3 A;  2IN3 A;  1XW6 A;  4BVX A;  2LEG A;  2YWM A;  1SL2 B;  1YDK A;  2CAQ A;  1B48 A;  4LL1 B;  2RII A;  4HZ4 A;  5ECK B;  4BPY A;  4JED A;  2L59 A;  1FW1 A;  2YZU A;  1GSS A;  1I5G A;  4L8E A;  2EC4 A;  4XS1 A;  4O5Q A;  1SL0 B;  1XG8 A;  5FHI A;  1ABA A;  1TRV A;  2LRC A;  4OFM A;  3J7Y b;  2H0H A;  4IJI A;  3KH7 A;  3FK8 A;  1EP8 A;  1TKD B;  1CQH A;  1EEJ A;  3IC4 A;  4OO5 A;  2FHE A;  2HT9 A;  2OBI A;  1DE2 A;  2C0G A;  3LW9 A;  4FO5 A;  3F63 A;  4G0L A;  4JU5 A;  2KP2 A;  2FCH A;  3FY7 A;  3UEM A;  2E7P A;  2XPD A;  2VAF A;  4OCF A;  3RDW A;  2H72 A;  1TXX A;  2CZ3 A;  2GQL A;  1XOA A;  3HJO A;  1ZZY A;  2FUG 2;  1BAY A;  3QAV A;  1TRU A;  2YWN A;  4MA9 A;  2AUV A;  1MEK A;  4AF2 A;  1YKC A;  4G2E A;  4EVM A;  1O8X A;  18GS A;  1ZYQ B;  2QA2 A;  2AV4 A;  2PPT A;  4POB A;  3KGK A;  1XPV A;  3GIX A;  4RI6 A;  1ZGN A;  2XPE A;  2GZP A;  3M8N A;  2M72 A;  1PKW A;  3C1R A;  1ML6 A;  5F07 A;  4NV2 A;  1QMV A;  2KHP A;  3F8U A;  4IS0 A;  1OKD A;  1O85 A;  2JSZ A;  2K8S A;  4TR4 A;  3BCK A;  2OJL A;  4ECI A;  5J3R A;  3M1G A;  1SL1 B;  2YJH A;  2MMA A;  1B8X A;  2LJK A;  3K8N A;  3WGX A;  1GSF A;  1U6T A;  4ACS A;  2AB6 A;  2VCT A;  3G7J A;  1K3Y A;  5HQP A;  2FA4 A;  4F2I A;  3GKX A;  1GL8 A;  5DAK A;  2VL2 C;  1XOB A;  2FWH A;  1EGO A;  3F6D A;  4G9H A;  4X1U A;  5ECN B;  4BA7 A;  4HQZ A;  3RBT A;  2KLX A;  1B9X C;  16GS A;  2K9F A;  5F8B A;  3F3Q A;  5H5R A;  4NAX A;  5IQY A;  2KOK A;  5IIZ A;  4D73 B;  4TXO A;  1AQX A;  3F6F A;  1A2L A;  3SBC A;  4ZB9 A;  2OKA A;  3CSI A;  5HFI A;  3D22 A;  4K7O A;  2ZNM A;  4HZ2 A;  3A2X A;  2C3N A;  2YOI A;  2OE3 A;  3QDN A;  1WMJ A;  4XCS A;  4XHM A;  5HR1 A;  2YP6 A;  3QFB C;  3ZMK A;  1GLP A;  2LNT A;  3F4S A;  2X64 A;  1PD2 1;  3A5W A;  1JZO A;  1MDJ A;  4NHZ A;  2DBC A;  4XS6 A;  3FW2 A;  3IV4 A;  1OVN A;  1BG5 A;  4HI7 A;  4PQI A;  1SK2 A;  3ZVJ A;  1Q4J A;  2A4V A;  4PQ1 A;  5CRH A;  4HDE A;  3TB2 A;  5IPH A;  3BBY A;  3RHB A;  4MZC A;  4DSS A;  2MBS A;  1SJ6 A;  1EWX A;  3VI7 A;  4ML1 A;  1O73 A;  2L57 A;  1XZO A;  4I2U A;  1FVK A;  3US3 A;  3Q6O A;  2JZR A;  4EL1 A;  2QC7 A;  4N0V A;  2O87 A;  1RW1 A;  4RQR A;  2GST A;  5A4W A;  4Z2T A;  3FZ4 A;  4OFN A;  4EXJ A;  1T00 A;  1SJI A;  1M2B A;  1ZL9 A;  3LQ7 A;  4QL7 A;  3ZZX A;  4ICY A;  1GUK A;  3FKF A; 
#chains in the Genus database with same CATH homology
 3KTL A;  5GZZ B;  4MJA A;  5EL8 A;  2YPM A;  1LBK A;  3UJ1 A;  2LQQ A;  3M9K A;  4N0Z A;  1ST9 A;  3LOR A;  1M9A A;  5J9B A;  1EOG A;  13GS A;  4ULX A;  5ECS A;  4ISD A;  2HE3 A;  4X4J A;  3FR9 A;  1SKR B;  4KAE A;  1THO A;  2QA1 A;  4MP4 A;  1KNG A;  2GQM A;  2HYX A;  4WET A;  4OO4 A;  2HSH A;  1Y6E A;  3TOT A;  1TTZ A;  3EMX A;  1GTB A;  5DAK B;  1A0F A;  1MDK A;  2H1D A;  3CSH A;  4L5O A;  1XWG A;  2GZY A;  1TK0 B;  1NHY A;  1TP9 A;  3CYN A;  1V57 A;  3ZLP A;  4JE1 A;  3G7I A;  1Z5Y E;  4YAV A;  5B6N A;  5G1L A;  3DWV A;  2C0E A;  5IMC A;  1YF1 A;  2K8V A;  1XIY A;  4TXO B;  4KE3 A;  4MF6 A;  3U5R E;  3MSZ A;  1KBN A;  1Q98 A;  3MIX A;  3E9J B;  5D8I A;  2FWF A;  5KOX A;  22GS A;  2RM6 A;  5CRE A;  2DJ1 A;  1ZOF A;  3Q18 A;  3CRT A;  1R4W A;  4K9Z A;  4IP6 A;  2JAD A;  3KMN A;  1SK1 A;  1XVQ A;  4HQS A;  4MF5 A;  6GST A;  1OE8 A;  1SKW B;  3HVV A;  1OYJ A;  3FMW A;  3GTU B;  3IHQ A;  1FOH A;  3A2W A;  3QMX A;  2H30 A;  3MYD A;  3ZFL A;  3L0H A;  4DVC A;  3LYP A;  4HUA A;  3KIJ A;  4PNF A;  14GS A;  3HVX A;  4TR3 A;  5J9C A;  3ZIJ A;  4BVY B;  1HD2 A;  4TXV A;  1OC9 A;  3DEX A;  1Y25 A;  1TI1 A;  1WPI A;  4KA0 A;  2DJJ A;  3EMP A;  2IPA A;  4OFT A;  3KTB A;  2UZ8 A;  4GSS A;  4WF5 A;  2C0D A;  4MJC A;  3TJB A;  4EIQ A;  1WOU A;  5JWQ B;  5HFK A;  3FR6 A;  4V1A p;  1N2A A;  3VPT A;  4IEL A;  3C8E A;  2O85 A;  2A2R A;  2YNX A;  1TK5 B;  1VF2 A;  3QOU A;  3IR4 A;  3ZL5 A;  4HU9 A;  2H0I A;  5ID2 A;  3EYT A;  3GKM A;  5CNW A;  3GMF A;  3W8S A;  1X9M B;  1EZK A;  1G7E A;  3D0Z A;  3GFK A;  3L78 A;  2TRC P;  1K0B A;  2XC2 A;  4MF7 A;  4FYB A;  1X5E A;  2L6D A;  3CMI A;  1W4V A;  5L71 A;  1HYU A;  2VL2 A;  4MCU A;  3CTG A;  3TJG A;  1NW2 A;  2BTO T;  2HXK A;  3ZRD A;  3VWU A;  2K6V A;  4K7N A;  4O5R A;  3A5I A;  1S3D A;  2IMD A;  4K6X A;  5KN3 A;  3F9U A;  2VL9 A;  1F2E A;  5JWR B;  2H8L A;  3IC8 A;  2VCX A;  2OE0 A;  5AGY A;  3A3T A;  3U6V A;  3EIN A;  2X49 A;  3KJY A;  2C80 A;  5CO3 A;  1TDI A;  1C72 A;  2LRN A;  2VD0 A;  2L6C A;  3DGQ A;  2GVP A;  1SD9 A;  2V1M A;  2P31 A;  2DJ3 A;  3HXS A;  1RK4 A;  3ISO A;  3KP8 A;  4IVF A;  2EIQ A;  3LG6 A;  2BMX A;  3VWV A;  2HZE A;  3L9U A;  3TJK A;  4KX4 A;  2NDO A;  2GT5 A;  2B7K A;  1YZX A;  4ZBB A;  4V2N A;  3NOF A;  4J57 E;  4QL9 A;  1SYX A;  1B4Q A;  2VD1 A;  4BWQ A;  4NWY A;  1PA3 A;  4MZW A;  4KCA A;  1V40 A;  1G6Y A;  2ON7 A;  3GL3 A;  5ECP B;  4IKH A;  1E2Y A;  2WB9 A;  3I6A A;  1T3B A;  4K7I A;  2CQ9 A;  4RUV A;  4Q5Q A;  1KEB A;  1QK8 A;  3IRA A;  5G1K A;  1GUM A;  2HFD A;  3KM6 A;  1GTI A;  2DJ0 A;  5A4U A;  2PU9 C;  3WYW A;  2GZZ A;  4JBB A;  4DEJ A;  4CDO A;  3F3R A;  3TDG A;  4P3Y B;  1HNB A;  4IP1 A;  1A0R P;  2H1G A;  2J9H A;  4GF0 A;  4HJ2 A;  3KH9 A;  4EDY A;  1VRS D;  3IAM 2;  3UL3 A;  2GGT A;  1OC9 B;  3UAP A;  2LNS A;  4KF9 A;  4EE0 A;  1TJD A;  4MH3 A;  1VF4 A;  4CHS A;  3RPP A;  4KH7 A;  2PBJ A;  2LQO A;  2VCV A;  2H01 A;  4TVE A;  4PGT A;  1GSD A;  1CQG A;  5CRG A;  1Z7P A;  4XS4 B;  3IDV A;  3VFI A;  1ZYE A;  1GSU A;  3I9V 2;  4K2D A;  2H70 A;  3BOA A;  3EVI A;  1V9W A;  2JU5 A;  10GS A;  2KP1 A;  5F05 A;  2GSQ A;  5IO0 A;  5B7C A;  1GRX A;  3GX8 A;  1XW9 A;  1GLQ A;  1UC7 A;  2VIM A;  2F51 A;  3UMA A;  5D9V A;  2H74 A;  2R4V A;  3CBU A;  1OC3 A;  4KDX A;  5D9W A;  2GDR A;  2VLU A;  1HNA A;  1LJR A;  6GSY A;  1DUG A;  4ZB6 A;  2RUE A;  4V2M A;  4F0C A;  4DSQ A;  2E2M A;  2B1K A;  1PX7 A;  4NMU A;  5GSS A;  4F0B A;  3E0U A;  2PVO C;  1ILO A;  1HNC A;  4ZL9 A;  4HS1 A;  1T8E B;  2AAW A;  2DJ2 A;  4GLT A;  3TRP A;  8GSS A;  12GS A;  3HA9 A;  4ECB A;  3QFA C;  5COH A;  5IPG A;  4BL7 A;  2DKI A;  4K5R A;  1MDI A;  4O5U A;  3S9F A;  1TW9 A;  3BCI A;  3FZ5 A;  1F3B A;  4AJ7 A;  1O7U A;  4ILF A;  2V41 A;  1H4O A;  3TKS C;  2H1A A;  4AJ8 A;  5KN0 A;  3VWW A;  4YAP A;  3V1W A;  2DIY A;  1PRX A;  2X99 A;  3ME7 A;  2C0F A;  4EKZ A;  1T1V A;  4MK3 A;  1SU9 A;  2V2G A;  2LJR A;  3WGE A;  5IMZ A;  2C1Y A;  4PQH A;  4JZQ A;  3ZIT A;  1F37 A;  3G9B A;  4HU7 A;  2A2P A;  1BX9 A;  2C4J A;  1M9B A;  4I5Q A;  4WXT A;  1Z3E A;  1GTA A;  3WT2 A;  3HJM A;  4BVX B;  17GS A;  4KW6 A;  1YJ6 A;  1MTC A;  3IBH A;  4USS A;  3UAR A;  1UVZ A;  2ZUP A;  2R6K A;  4GXZ A;  2VCW A;  3TJF A;  1TRS A;  2R37 A;  3F4T A;  1B4P A;  1XVW A;  4KSM A;  4ECC A;  4PUA A;  2EIO A;  2F8A A;  5D93 A;  4ZBA A;  1IYH A;  4KB3 A;  3NIV A;  3GYK A;  3NZN A;  5DBQ A;  2RLI A;  1OC8 A;  2NPB A;  3M3M A;  1AXD A;  4NV5 A;  2H19 A;  2YAN A;  1T7P B;  1X0R A;  2CX3 A;  1A2M A;  5DQY A;  4GWR A;  2AYT A;  3LXT A;  4L5L A;  4O7H A;  1JZR A;  3ZYW A;  2LS5 A;  4NXI A;  2VCQ A;  2VLT A;  1GSY A;  2YWO A;  3KMO A;  4ZXG A;  5INY A;  2OAD A;  2GSS A;  4MPG A;  1GNW A;  3JCM L;  5ENU A;  4EDZ A;  1KTE A;  3UBL A;  2B1L A;  2A2S A;  3VWX A;  4ID0 A;  4LA1 A;  3APO A;  3GL5 A;  4KCE A;  4TR1 A;  1O6J A;  3FEU A;  2I9H A;  1A2J A;  3IPZ A;  2JSY A;  4G0I A;  2FA8 A;  1GSE A;  3ERW A;  2IWT A;  2GT6 A;  3WT1 A;  1FB0 A;  3WD6 A;  2FWG A;  3GKN A;  3P8W A;  3GN3 A;  1H75 A;  4IW9 A;  2WFC A;  4HOJ A;  2CVD A;  1PSQ A;  3GA4 A;  1PQN A;  3M9J A;  3P90 A;  2DIZ A;  5AN1 A;  2OA7 A;  4FIW A;  1B9Y C;  3DKS A;  2LUS A;  1GSQ A;  4YQM A;  2TRX A;  1WRY A;  5FT3 A;  1S3A A;  1TOF A;  1O8W A;  3H8Q A;  4L0W A;  2GS3 A;  1FO5 A;  1R26 A;  5LNK e;  2P5R A;  4KSO A;  4K8M A;  4I8B A;  2R5G A;  5DAL A;  5G30 A;  5ELG A;  1F6M C;  3EE2 A;  4IBP A;  1J08 A;  2HLS A;  4IN0 A;  2RUF A;  3IA1 A;  4L0U A;  2QKE A;  2L4Q A;  4EIP A;  3ZTL A;  3TUE A;  1N8J A;  3IE3 A;  1XW5 A;  3TJJ A;  2MYG A;  2C3T A;  4YQV A;  2IIY A;  1XWA A;  2VM1 A;  1EEM A;  2CVB A;  1ZYN A;  3HJP A;  1U87 A;  1YQ1 A;  3HZ8 A;  3GST A;  4N10 A;  1Z6N A;  2G2Q A;  2AJQ B;  4MAB A;  2CX4 A;  2F3M A;  4YKF A;  3HYP A;  1GP1 A;  3BJ5 A;  3KCM A;  3FRC A;  4TRX A;  3ME8 A;  4TKY A;  4V2L A;  2MMZ A;  2CA8 A;  4FQU A;  3FZ9 A;  2MMO A;  4MLY A;  2LRT A;  2VM2 A;  1OAZ A;  2HRA A;  1SEN A;  5G2Z A;  3FYG A;  5KEJ A;  4PUF C;  3LYK A;  1AW9 A;  3ZVJ D;  3GX0 A;  5ECM B;  5DCH A;  2GQK A;  2IFQ A;  2ON5 A;  2VOC A;  2JZT A;  2H73 A;  4WR4 A;  1OKT A;  1QUW A;  2FWE A;  3TCO A;  2LJA A;  4LL4 B;  4DSS B;  4TR1 B;  4F82 A;  3D4T A;  2FD3 A;  3DD3 A;  3LFL A;  3I43 A;  5LD0 A;  5ECQ B;  4OWY A;  2FLS A;  2P5Q A;  4FH8 A;  1IYI A;  1PL1 A;  5IMF A;  2L5L A;  2M80 A;  1PN9 A;  2V6K A;  1O81 A;  4ZIL A;  5HR3 A;  3F4R A;  2D2Z A;  1F9M A;  3HDC A;  3CXG A;  3HKR A;  4IQ1 A;  4A5P A;  5GAP D;  5B8B A;  3PPU A;  4GST A;  1THX A;  3LJR A;  2HI7 A;  4I2T A;  2H75 A;  2B5X A;  2PWJ A;  3P7X A;  2ES7 A;  3QCP A;  3KZQ A;  4GQC A;  4X43 A;  1WP0 A;  3MNG A;  1G7O A;  1JHB A;  5C00 A;  5JCU A;  5F06 A;  3TGZ A;  2NVL A;  1TRW A;  2VUP A;  2A4H A;  3H1N A;  1XWB A;  1BQ7 A;  3IOS A;  2J23 A;  1JLV A;  4GTU A;  2PGT A;  1ERW A;  2HRF A;  3RHC A;  3TRQ A;  1OE7 A;  4JR6 A;  2WS2 A;  2R0C A;  1XFL A;  4KDY A;  2YN1 A;  3UBK A;  5F0G A;  2B3S A;  2R3X A;  4K1F A;  3QR6 A;  4GRF A;  4AJ6 A;  1EV9 A;  1K0M A;  4CY8 A;  5B6M A;  1R5P A;  3IXR A;  4O32 A;  1YF0 A;  5A5K A;  2IL3 A;  3PGT A;  3UVT A;  1FAA A;  3EWL A;  1W89 A;  2JZS A;  3ZFB A;  5KN1 A;  2CVK A;  3APS A;  3TKS E;  2YCD A;  2K18 A;  4OMV A;  3PIN A;  3KXO A;  3L9S A;  4YQU A;  2Z9S A;  3ERF A;  2WCI A;  4IGJ A;  2LKU A;  5FWG A;  5DVB A;  1FHE A;  5CP1 A;  2DKH A;  2I3Y A;  1QGV A;  5ECI B;  3CSJ A;  4WKW A;  1EGR A;  4PTS A;  3LEF A;  1A8L A;  3H93 A;  3QPM A;  2VL3 A;  2JAC A;  2IMI A;  4KND A;  3DML A;  1NM3 A;  2C3Q A;  4V1A g;  5CYY A;  3Q74 A;  1SKS B;  3GH9 A;  4FYC A;  2OAC A;  5G5E A;  1ON4 A;  2F8F A;  1G0T A;  4ZL7 A;  5CAX A;  3LWA A;  4H86 A;  1BYE A;  3OR5 A;  2N5B A;  2N5A A;  5AIS A;  4D73 A;  1AUC A;  1A24 A;  3VLN A;  3CRU A;  2IJY A;  2NTO A;  3DXB A;  1S3C A;  2GTU A;  3GKK A;  2B7J A;  2M46 A;  1X5C A;  4HJM A;  4IJ3 A;  4K2X A;  3VK9 A;  5ID2 B;  5GST A;  4E8H A;  3TRX A;  3P2A A;  5KOW A;  2I81 A;  2WDU A;  3J7Y k;  2V32 A;  3GH6 A;  1QQ2 A;  1Z9H A;  1UN2 A;  2B5Y A;  4IHU A;  3MDK A;  1XBS A;  3L9V A;  4E8E A;  5AIX A;  2DC5 A;  2DML A;  4POK A;  3GUR A;  4EF0 A;  1K0N A;  2H76 A;  1ZMA A;  2FGX A;  4N11 A;  4PNG A;  3C1S A;  4I97 A;  6GSX A;  4J2F A;  5IOX A;  4EUY A;  3VI5 A;  3H79 A;  4ZIJ A;  2DLX A;  2H0G A;  3GNJ A;  4KGI A;  1X9S B;  3ZRE A;  2WZ9 A;  4O92 A;  6GSS A;  3FHK A;  3HZ4 A;  2YZH A;  3G7Y A;  1U3A A;  2I4A A;  4YH2 A;  2HZE B;  3RAZ A;  5A4V A;  1EP7 A;  1JFU A;  4XIH A;  2HRK A;  4K0N A;  1PN0 A;  1Z7R A;  3WGD A;  3QAW A;  1FVJ A;  1XXU A;  3KP9 A;  2JL4 A;  5DCG A;  2RM5 A;  1Z6M A;  6GSW A;  1T4Z A;  5D9T A;  4ZBD A;  4JRR A;  2H66 A;  2O7K A;  3M0F A;  3LGC A;  3D21 A;  2O89 A;  2B6M A;  3R2Q A;  1V98 A;  4G0K A;  2VO4 A;  4ML6 A;  5IMV A;  1DBY A;  5JWO B;  2R0G A;  1R7H A;  2EIR A;  5BMU A;  1AQV A;  1GTU A;  4MJE A;  3QAG A;  3HY2 A;  4GCI A;  5D96 A;  2H6Z A;  1ZCP A;  5EPF A;  2IMF A;  5GAN D;  2MZC A;  1DE1 A;  4EC0 A;  5E59 A;  3L4N A;  1GNE A;  3RPN A;  4PUR A;  4TR0 A;  1PKZ A;  2DMM A;  4KUN A;  1SK0 A;  2HZF A;  2VLV A;  1V58 A;  2PUK C;  4CW9 A;  5ELA A;  1PGT A;  4LMV A;  2WRT A;  3PH9 A;  2PER A;  3EU4 A;  4JR4 A;  1M7T A;  2MBT A;  2XBQ A;  3HCZ A;  4Q5R A;  2PMT A;  1UA5 A;  3FR3 A;  1FB6 A;  4EO3 A;  2H1B A;  2OBK A;  3D5J A;  1MD3 A;  1GH2 A;  5DJM A;  1GUH A;  2PN8 A;  6GSU A;  5D73 A;  5IO2 A;  1NHO A;  4WBR D;  2HSM A;  3GTU A;  2V6O A;  4RI7 A;  3EUR A;  3H4K A;  3UIW A;  2G0F A;  1F3A A;  3QD9 A;  1EOH A;  2GLR A;  3UVH A;  2R2J A;  4BVY A;  2OE1 A;  4XTS A;  3DYR A;  1NSW A;  4TN8 A;  5BRT A;  1YKA A;  4K5S A;  4X0X A;  4GQF A;  1YY7 A;  5D9X A;  5IMA A;  1GUL A;  3GSS A;  3LSZ A;  4XRA A;  1ERU A;  1ACV A;  4N30 A;  4BL7 B;  4RQX A;  4Z2U A;  4CY6 A;  4XRD A;  2YWI A;  1K0A A;  2QSI A;  4G19 A;  1AAZ A;  5ABR A;  4WBJ A;  3GRX A;  4IQA A;  5DQS A;  3DRN A;  3ZML A;  1R5A A;  3N9J A;  3KEB A;  3LXZ A;  5LCZ A;  2H6X A;  1RQM A;  3GUS A;  5G5F A;  1TU8 A;  3VUR A;  2HSY A;  4Z2R A;  3O76 A;  2CT6 A;  4MMM A;  4PX1 A;  3D4M A;  1AQW A;  4NPB A;  1K3O A;  1K0C A;  3ERG A;  1SJZ A;  1LU4 A;  5DJL A;  1AC1 A;  2IMK A;  2CAI A;  1EV4 A;  4MH2 A;  3EU3 A;  4Z7X A;  3PR8 A;  1K0O A;  3Q19 A;  1TK8 B;  1URM A;  2REM A;  3MAK A;  1ERT A;  19GS A;  20GS A;  5CRD A;  2XHF A;  2R0P A;  4Q5F A;  1XCC A;  1PL2 A;  1PX6 A;  4NHW A;  1JZW A;  3DVW A;  1GWC A;  1X9W B;  2WGR A;  1K0D A;  4POL A;  2X8C A;  1YEP A;  2VCZ A;  3O3T A;  4OD7 A;  2FNO A;  2ZCT A;  1XWK A;  2AHE A;  4KDU A;  3MWH A;  2KUC A;  1DSB A;  1A8Y A;  2DSA A;  3GHA A;  2L5O A;  1X5D A;  2P0G A;  2B5E A;  1HQO A;  1XWC A;  3TKR A;  4WF4 A;  2WUL A;  2YV7 A;  2DJK A;  4J56 E;  1V2A A;  4ZB8 A;  3AY8 A;  1WWJ A;  3FZA A;  3W8J A;  1QFN A;  2N5F A;  2ALB A;  5AIV A;  3R3E A;  2X8G A;  4MDC A;  4F03 A;  1ERV A;  1T4Y A;  4MNN A;  4MPF A;  2CZ2 A;  4ECJ A;  5J41 A;  3HD5 A;  1ZYP A;  2E0Q A;  3EC3 A;  2HRN A;  5ECL B;  2BJX A;  1M99 A;  2LTK A;  3DIE A;  4YKG A;  1J0F A;  5J4U A;  11GS A;  1A23 A;  3TKP A;  5H5Q A;  3C7M A;  1TU7 A;  2FY6 A;  1U3I A;  5JCG A;  1USB A;  3TKS A;  4I6X A;  2NBS A;  1E6B A;  4WEY A;  4XS4 A;  1M0U A;  4LLR A;  4PXO A;  3TOU A;  1JZD A;  2XBI A;  2H71 A;  4AGS A;  3SWL A;  1VGL A;  1WE0 A;  5KN2 A;  5ECO B;  1YEX A;  2IME A;  3UOM A;  2X8H A;  1G6W A;  1QXH A;  3CTF A;  4G10 A;  2PVQ A;  2HNL A;  4MJB A;  5H5S A;  7GSS A;  5HR0 A;  3A2V A;  3N5O A;  1WIK A;  2LST A;  3GV1 A;  3KD0 A;  2O8V B;  3BD2 A;  5DAL B;  5G31 A;  4F9Z A;  2F9S A;  1JLW A;  2L4C A;  4Q5N A;  3W6G A;  1BED A;  2C8U A;  4K0G A;  5JCW A;  3VPQ A;  4BWS A;  1PMT A;  1MD4 A;  4TW5 A;  3IAS 2;  3IK9 A;  3O6T A;  3I69 A;  4QQ7 A;  4WR5 A;  3IK7 A;  5ECH B;  1U88 A;  3ED3 A;  1M2D A;  1BJX A;  3ZIV A;  5C04 A;  3TKQ A;  1I9D A;  5CRW A;  5HR2 A;  6GSV A;  4OCE A;  4DSR A;  2I1U A;  2GSR A;  1FG4 A;  2LV3 A;  5HFG A;  3IHG A;  5IOW A;  3HVS A;  4MZB A;  4GSN A;  5B8A A;  3HHV A;  2MMN A;  5EVO A;  1VF3 A;  3C73 A;  4FYU A;  2QGV A;  5ECR B;  3E3E A;  2CV4 A;  1M2A A;  2E2G A;  9GSS A;  1VF1 A;  2WJU A;  5E4W A;  1SD8 A;  1SYR A;  5IMD A;  2H6Y A;  4LMW A;  5J5N A;  3APQ A;  2YV9 A;  2TIR A;  2YJ7 A;  3EPT A;  1J9B A;  4HEA 2;  5DDL A;  3D6I A;  3DVX A;  5EY6 A;  1FOV A;  1WJK A;  5IM9 A;  1K3L A;  3C71 A;  3F0I A;  2IFQ B;  2X4A A;  4ZL8 A;  4TOP A;  1AIU A;  4POM A;  1TI3 A;  2IN3 A;  1XW6 A;  4BVX A;  2LEG A;  2YWM A;  1SL2 B;  1YDK A;  2CAQ A;  1B48 A;  4LL1 B;  2RII A;  4HZ4 A;  5ECK B;  4BPY A;  4JED A;  2L59 A;  1FW1 A;  2YZU A;  1GSS A;  1I5G A;  4L8E A;  2EC4 A;  4XS1 A;  4O5Q A;  1SL0 B;  5FHI A;  1ABA A;  1TRV A;  2LRC A;  4OFM A;  3J7Y b;  2H0H A;  4IJI A;  3KH7 A;  3FK8 A;  1EP8 A;  1TKD B;  1CQH A;  1EEJ A;  3IC4 A;  4OO5 A;  2FHE A;  2HT9 A;  2OBI A;  1DE2 A;  2C0G A;  3LW9 A;  4FO5 A;  3F63 A;  4G0L A;  4JU5 A;  2KP2 A;  2FCH A;  3FY7 A;  3UEM A;  2E7P A;  2XPD A;  2VAF A;  4OCF A;  3RDW A;  2H72 A;  1TXX A;  2CZ3 A;  2GQL A;  1XOA A;  3HJO A;  1ZZY A;  2FUG 2;  1BAY A;  3QAV A;  1TRU A;  2YWN A;  4MA9 A;  2AUV A;  1MEK A;  4AF2 A;  1YKC A;  4G2E A;  4EVM A;  1O8X A;  18GS A;  1ZYQ B;  2QA2 A;  2AV4 A;  2PPT A;  4POB A;  3KGK A;  1XPV A;  3GIX A;  4RI6 A;  1ZGN A;  2XPE A;  2GZP A;  3M8N A;  2M72 A;  1PKW A;  3C1R A;  1ML6 A;  5F07 A;  4NV2 A;  1QMV A;  2KHP A;  3F8U A;  4IS0 A;  1OKD A;  1O85 A;  2JSZ A;  2K8S A;  4TR4 A;  3BCK A;  2OJL A;  4ECI A;  5J3R A;  3M1G A;  1SL1 B;  2YJH A;  2MMA A;  1B8X A;  2LJK A;  3K8N A;  3WGX A;  1GSF A;  1U6T A;  4ACS A;  2AB6 A;  2VCT A;  3G7J A;  1K3Y A;  5HQP A;  2FA4 A;  4F2I A;  3GKX A;  1GL8 A;  5DAK A;  2VL2 C;  1XOB A;  2FWH A;  1EGO A;  3F6D A;  4G9H A;  4X1U A;  5ECN B;  4BA7 A;  4HQZ A;  3RBT A;  2KLX A;  1B9X C;  16GS A;  2K9F A;  5F8B A;  3F3Q A;  5H5R A;  4NAX A;  5IQY A;  2KOK A;  5IIZ A;  4D73 B;  4TXO A;  1AQX A;  3F6F A;  1A2L A;  3SBC A;  4ZB9 A;  2OKA A;  3CSI A;  5HFI A;  3D22 A;  4K7O A;  2ZNM A;  4HZ2 A;  3A2X A;  2C3N A;  2YOI A;  2OE3 A;  3QDN A;  1WMJ A;  4XCS A;  4XHM A;  5HR1 A;  2YP6 A;  3QFB C;  3ZMK A;  1GLP A;  2LNT A;  3F4S A;  2X64 A;  1PD2 1;  3A5W A;  1JZO A;  1MDJ A;  4NHZ A;  2DBC A;  4XS6 A;  3FW2 A;  3IV4 A;  1OVN A;  1BG5 A;  4HI7 A;  4PQI A;  1SK2 A;  3ZVJ A;  1Q4J A;  2A4V A;  4PQ1 A;  5CRH A;  4HDE A;  3TB2 A;  5IPH A;  3BBY A;  3RHB A;  4MZC A;  4DSS A;  2MBS A;  1SJ6 A;  1EWX A;  3VI7 A;  4ML1 A;  1O73 A;  2L57 A;  1XZO A;  4I2U A;  1FVK A;  3US3 A;  3Q6O A;  2JZR A;  4EL1 A;  2QC7 A;  4N0V A;  2O87 A;  1RW1 A;  4RQR A;  2GST A;  5A4W A;  4Z2T A;  3FZ4 A;  4OFN A;  4EXJ A;  1T00 A;  1SJI A;  1M2B A;  1ZL9 A;  3LQ7 A;  4QL7 A;  3ZZX A;  4ICY A;  1GUK A;  3FKF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...