2H6ZA

Crystal structure of thioredoxin mutant e44d in hexagonal (p61) space group
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
108
structure length
108
Chain Sequence
SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDDIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thioredoxin
publication title A stability pattern of protein hydrophobic mutations that reflects evolutionary structural optimization.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Electron transport
total genus 30
structure length 108
sequence length 108
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2h6zA00
3KZQA 3LG6A 3SWLA 4ZXGA 4FYUA 3TKPA 2IPAA 12GSA 1Z7RA 4MP4A 4QL7A 4WF4A 1SK1A 3LXTA 3GNJA 6GSXA 4F0CA 2FWFA 3CMIA 3H8QA 3PINA 2WFCA 3CBUA 2YN1A 4ZBDA 4V1Ap 4X43A 2VD0A 2B1LA 2V1MA 2OE1A 1Y6EA 4O5RA 2CZ2A 1Z6MA 2AJQB 4PQIA 2WCIA 1GWCA 1M7TA 1F2EA 4L5LA 1N8JA 1GP1A 1DSBA 3KJYA 5CRDA 1XW9A 4GQFA 5FT3A 4O7HA 1PSQA 4YAPA 4O32A 2N5FA 1A2MA 4XIHA 4IVFA 1ZOFA 3EU4A 5AIVA 1PL2A 3E3EA 4DVCA 4K9ZA 4G19A 4GCIA 4MZWA 4OCEA 2EIOA 2C80A 2R37A 3GYKA 3RHBA 4V1Ag 1U3AA 1TU8A 3HJMA 4N0VA 3TRPA 1SL2B 2DSAA 1GLQA 3CYNA 3WGXA 3ZTLA 20GSA 1R26A 2HRNA 1SYRA 1NHOA 2H6ZA 1AQWA 1V2AA 2ON5A 4GWRA 2OKAA 3TUEA 4NAXA 2VCXA 4JU5A 2DJ2A 2LNSA 4G9HA 2DC5A 4J56E 3F0IA 3ZREA 1EEJA 4ZL9A 3D22A 2PBJA 1KTEA 2QGVA 4IS0A 2YWOA 3ZLPA 4E8HA 5ECKB 3O3TA 2R5GA 4EKZA 2PPTA 3CRTA 3CXGA 5IMZA 2PGTA 1DE2A 1O8WA 1YZXA 1A0FA 1BX9A 1HQOA 5DJLA 1ZYQB 4TXOB 1EV9A 4NWYA 3J7Yk 3ZZXA 3FRCA 1S3CA 2N5BA 2KLXA 4IKHA 2MMOA 2CAIA 1TK0B 2QKEA 2HT9A 2WZ9A 1JZWA 4DSRA 3ERGA 2QSIA 3JCML 2GQLA 1H4OA 4ZL7A 1XVQA 3DD3A 3FW2A 3HZ8A 3N9JA 2H0IA 1GSFA 3IE3A 3VFIA 2X8GA 1USBA 3L9VA 3VI5A 3GIXA 2RLIA 3RPNA 1WMJA 4YQUA 4KA0A 3EINA 4EO3A 1NM3A 1MD4A 3NZNA 4PXOA 4XS4B 3DYRA 5HQPA 3QFAC 5JCGA 2H1GA 3P8WA 3FZ4A 3BD2A 4O92A 3D0ZA 1K0OA 4PURA 3LXZA 3A3TA 9GSSA 5ECLB 2A4VA 3CSIA 1TI1A 3N5OA 2VCZA 2DIYA 2C3QA 4YQMA 3VLNA 2OJLA 1UC7A 1SD9A 4MJCA 2YJHA 3TGZA 4HOJA 4ML6A 2CV4A 4CHSA 1FW1A 3S9FA 4AJ7A 3GURA 4PNGA 3FR6A 3EWLA 1J08A 3KTLA 4KH7A 2L5OA 1K3YA 2GZYA 1GULA 5ECHB 2B6MA 5D9TA 3FYGA 3APQA 3V1WA 3KMNA 1OE8A 6GSSA 2IJYA 4IN0A 1SK2A 2EIRA 3TCOA 1ST9A 4MZCA 1E2YA 2JADA 1AQXA 3GV1A 2IIYA 1A8YA 4IELA 3KGKA 2FGXA 5G5EA 4PQHA 4XS4A 1O8XA 2J23A 1G6WA 5CAXA 5CNWA 1YEPA 1E6BA 3IBHA 2PVQA 3QOUA 5G1KA 2KP1A 2REMA 1OC9A 3VWUA 4JE1A 1Q4JA 5G2ZA 3PGTA 6GSVA 5IMDA 4JBBA 4JEDA 5KN3A 3FK8A 2FWGA 4MPGA 2DIZA 5C00A 3F9UA 2MMAA 3EURA 1JLVA 1ZGNA 4F82A 5KEJA 4ZL8A 1XBSA 2IFQB 1MDKA 1VF2A 1TK5B 2C8UA 2P5QA 3GL5A 1XCCA 1TKDB 1DE1A 1EV4A 1F3AA 2FLSA 3MSZA 1S3AA 3QR6A 4K6XA 1M9AA 5J5NA 1SD8A 4XTSA 5ECMB 1XOAA 1EOGA 2K8SA 2HLSA 2CX3A 2GSSA 5D9WA 4KDYA 2YP6A 2EIQA 1GH2A 4GF0A 2GTUA 4K2DA 3DIEA 2YANA 3W8JA 5H5RA 3SBCA 5GSTA 4GSSA 1EP8A 4IBPA 1JZOA 1PA3A 3W8SA 2H8LA 2NPBA 2KUCA 4JZQA 2LRTA 3KXOA 3A2WA 3GRXA 5G5FA 2IFQA 3OR5A 4RUVA 2EC4A 3GH6A 2CT6A 3ZVJA 1YQ1A 2IL3A 1O85A 4TRXA 1FG4A 1PD21 1V98A 3FR9A 1TXXA 2ES7A 2A2RA 1KNGA 4KE3A 1NHYA 1WP0A 3KTBA 2HRFA 1XWGA 3M8NA 11GSA 1GSQA 2GVPA 6GSYA 4HJ2A 4NHWA 2X99A 2OE0A 5A4VA 5IMAA 3PH9A 2AV4A 3HVSA 2O87A 1Z9HA 3ZYWA 3APOA 5CREA 4MK3A 4IHUA 2NVLA 3TJGA 5DDLA 3H79A 5INYA 1V40A 4HQSA 3DVXA 3ZIJA 1XOBA 3TKQA 2GLRA 1XWKA 3IXRA 5A4WA 2VAFA 4TR1A 2ZUPA 2VL2C 3P2AA 2H73A 4HDEA 4ISDA 1OC3A 5GSSA 3CSHA 3EC3A 1YEXA 2YV9A 2XPEA 1WPIA 3GSSA 2JZTA 1WJKA 5HR1A 1G7EA 3BBYA 4POBA 4K1FA 3LORA 4KX4A 6GSTA 1IYIA 3IC4A 5DALA 4KCEA 3QAVA 3HZ4A 14GSA 1GSEA 3L9UA 4PGTA 5CRHA 3KH7A 2ZCTA 2LNTA 2KOKA 4DSSB 2MMZA 3QAGA 3HXSA 1SKWB 4WBRD 2H6XA 4XRDA 3TKSC 2E2MA 2K9FA 4IW9A 3FKFA 1T1VA 4LMWA 3I9V2 1TTZA 3UVHA 2VD1A 4F0BA 3GA4A 4ECIA 3FZ9A 3US3A 5FWGA 2H0GA 1YDKA 2IN3A 4OCFA 1XZOA 2RM5A 3ZFLA 1GL8A 2VL9A 4N30A 2H70A 4MZBA 1FAAA 5G1LA 4EDZA 1FO5A 4I6XA 3F3QA 1ACVA 5EPFA 4IJIA 4BWQA 3HA9A 4MCUA 2C3TA 1U6TA 2HZEB 3M9JA 1HYUA 3TOTA 3C8EA 2VM2A 2H74A 1DBYA 2VLVA 4ECBA 1ERVA 4ECCA 2CVBA 5D9XA 5GAPD 1QUWA 4FH8A 4OFNA 3EMPA 1RK4A 4DSSA 1OE7A 2GT5A 2YZUA 3BCKA 4KUNA 4E8EA 1Y25A 5B7CA 1PN9A 4TVEA 1MD3A 1U3IA 2H66A 1A23A 2DJKA 1TRVA 2GZPA 4KSMA 5AIXA 3Q74A 2L4CA 3VURA 3ZFBA 3UEMA 4MLYA 1TI3A 3O6TA 4BWSA 1PKZA 2CVKA 1JZDA 4LL1B 4I2UA 2AUVA 3I69A 1GNEA 1I5GA 1K0CA 5JWRB 4KGIA 4N11A 4MF7A 4MJEA 3WD6A 4F03A 4TN8A 3WGDA 4XS1A 3DXBA 4K7IA 2H1AA 3CTGA 2WS2A 1TJDA 4ZB8A 1XPVA 1B8XA 5ENUA 4OMVA 1ZZYA 2HZEA 1QK8A 4ZB9A 1FVKA 1WWJA 5AN1A 3IAS2 1FVJA 4Q5NA 3LWAA 3IK7A 3BCIA 3IHQA 4AJ6A 1SU9A 4CW9A 3M1GA 1PQNA 2WJUA 5DAKA 1B4PA 4KCAA 4Z7XA 1K3OA 3KP9A 8GSSA 5HFKA 1SYXA 5ID2A 5ECSA 3P7XA 3DWVA 4AGSA 1BAYA 4L8EA 2DMLA 2O85A 3F8UA 1X5EA 2C0DA 4PX1A 1U87A 3GKXA 5AISA 1A24A 1BJXA 4LL4B 2VL3A 2L59A 2RIIA 5IPGA 4EXJA 5KN2A 3KIJA 4ZB6A 3G7JA 2L57A 1F37A 4I97A 17GSA 1EGRA 4F2IA 2I9HA 1GSDA 22GSA 4ZBBA 4OFMA 3WT2A 2GQMA 2JSZA 1PX6A 4ULXA 3E0UA 4QQ7A 4POKA 3CTFA 3KP8A 1OC9B 4WR5A 2LQQA 1T4YA 3LQ7A 2PU9C 4F9ZA 1QXHA 2OBKA 3EVIA 1MDJA 4EDYA 2D2ZA 5LD0A 2GDRA 5FHIA 3L0HA 2YPMA 1ILOA 2P0GA 1YKAA 2HZFA 5ECQB 4XS6A 1GNWA 3ERFA 2C1YA 1PGTA 3LFLA 4PQ1A 2HI7A 4I5QA 4AF2A 5D96A 3GHAA 2RUFA 2FA8A 1SL1B 1M2BA 2A2SA 1TW9A 2CAQA 3L9SA 1FB0A 2N5AA 3R2QA 19GSA 2H30A 5CRWA 1Z6NA 2J9HA 2GSQA 2I1UA 1K0DA 3KD0A 5F05A 4LMVA 2YWMA 3HVXA 1MTCA 1WOUA 5DBQA 4X1UA 2NDOA 1X5CA 5IMVA 2BMXA 3HJOA 4NPBA 2FNOA 2PMTA 4MJAA 4MMMA 2XC2A 2LSTA 3M9KA 5E4WA 3EYTA 4PUAA 1RQMA 3E9JB 2YWNA 2G0FA 2B5EA 1G7OA 1PMTA 4OO5A 1SL0B 3QFBC 5G30A 5D8IA 1CQGA 4ZBAA 2PUKC 1NSWA 3P90A 3HYPA 4ZIJA 3HDCA 4EF0A 3M0FA 3NIVA 3G9BA 4EUYA 1VGLA 4N10A 1Z7PA 5JWOB 4FYBA 4MH2A 1XWBA 2V6OA 2C0EA 4DSQA 5JWQB 2MZCA 2I3YA 3ZL5A 4EE0A 2JU5A 4L5OA 5B6MA 3VI7A 5H5SA 2H0HA 1MDIA 2HYXA 2XPDA 4EVMA 4HI7A 2KHPA 5IM9A 3DMLA 4XHMA 3IV4A 4MABA 2P5RA 4G10A 2I4AA 3GFKA 1EGOA 4IQAA 3C1SA 3L78A 2AB6A 4Q5FA 1PX7A 3HY2A 2YZHA 5KN0A 4D73A 1BQ7A 5J3RA 1FB6A 5B8BA 2C3NA 3DGQA 1MEKA 5F06A 5IIZA 2DJ0A 1AC1A 2B1KA 2X8CA 1RW1A 5DQSA 3GMFA 3UVTA 1OKTA 2LJAA 4P3YB 3TRXA 3TKSE 3UARA 4K7OA 4TR1B 4GXZA 2CQ9A 1ABAA 1GSUA 3CSJA 3F6DA 3TB2A 3RDWA 2YOIA 5ECPB 3ZITA 5E59A 1VRSD 1KEBA 1K0AA 2WULA 1XIYA 1J9BA 2HE3A 2VL2A 1O6JA 2WB9A 3UIWA 1BG5A 2YWIA 2V41A 1JZRA 1A8LA 1K0BA 4POLA 5DCHA 1QQ2A 5DALB 1T7PB 1SKSB 2F51A 4IQ1A 5IQYA 4J2FA 2NTOA 1B48A 3DVWA 1LBKA 3D4TA 4MJBA 3TJKA 1OC8A 2AYTA 1SKRB 2R3XA 3A2VA 4FYCA 1V9WA 4GRFA 3HVVA 2H19A 1UVZA 2VCVA 1OKDA 2QC7A 4K0GA 3IRAA 3D5JA 1HNCA 1VF4A 3CRUA 3F6FA 2FD3A 2GS3A 2PVOC 3UBKA 1TP9A 5CYYA 3GN3A 3IR4A 4BA7A 3NOFA 2DMMA 2IMKA 4Q5QA 2ZNMA 1YF0A 2F3MA 2F8FA 2OE3A 2YCDA 3IOSA 1X9WB 2ALBA 1EP7A 5F0GA 5EVOA 3QCPA 1ERWA 3MWHA 1GRXA 2GQKA 4HZ2A 2L4QA 3GKNA 3UAPA 4FIWA 3ERWA 4HU9A 3FR3A 3APSA 3ISOA 1GSYA 2XHFA 2GZZA 1GTBA 2R6KA 2M80A 3TJJA 4JRRA 1UA5A 3EU3A 3LYPA 3F63A 4KAEA 1EOHA 4V2MA 3VK9A 3C73A 2FWHA 3FEUA 2OADA 1GUKA 1PRXA 1QGVA 1BEDA 5ECOB 1M0UA 2DJ3A 5CO3A 5CRGA 2GSTA 3GL3A 2H76A 1AIUA 3A5WA 4TOPA 2CA8A 3L4NA 1F9MA 2MYGA 1TU7A 3ZIVA 2JZRA 2R2JA 3UMAA 2L6CA 3H1NA 2DBCA 2XBIA 2BJXA 3IDVA 3M3MA 3U6VA 3H93A 1Z3EA 1DUGA 1A2LA 4KSOA 3LYKA 4MDCA 6GSWA 1OAZA 2IMEA 4GSNA 4LA1A 4WETA 2IMIA 4OWYA 2TRCP 3EE2A 4L0UA 3WT1A 1XWCA 4PNFA 4LLRA 4ILFA 3DKSA 2F9SA 2GSRA 4ECJA 2HXKA 4NXIA 2Z9SA 2K8VA 5HR3A 3HCZA 1ZMAA 5DAKB 6GSUA 5GZZB 3ME8A 2FA4A 3GKKA 4WEYA 2C4JA 4IJ3A 3DRNA 4J57E 2MMNA 4OO4A 2CVDA 2HSYA 4MF6A 1H75A 3TKRA 5GAND 5ID2B 1EWXA 4X0XA 2YV7A 4IGJA 3Q6OA 3FZ5A 3KCMA 3GTUA 1M99A 3GUSA 5DJMA 1M9BA 3GKMA 4MA9A 5LCZA 4KB3A 4TW5A 2C0FA 1J0FA 1LJRA 2TRXA 4RQXA 2VOCA 4YH2A 5IMFA 4HS1A 3Q19A 1V58A 2LUSA 1ZCPA 4L0WA 4OFTA 2LRNA 4YQVA 1BYEA 1K0NA 2F8AA 5L71A 2H75A 1OYJA 3TJBA 4HZ4A 1GLPA 3D6IA 3G7YA 2X64A 5A5KA 5HFGA 3DEXA 3VPQA 2R4VA 5IOXA 3VWWA 1K0MA 4WBJA 5D73A 5F8BA 4XRAA 3RHCA 3QAWA 4HEA2 3VWXA 4KNDA 3ZRDA 3HKRA 3GX0A 5JCWA 1T4ZA 1G0TA 1XWAA 5ELGA 4NHZA 2LTKA 1TRUA 3PR8A 4EL1A 3D21A 3WYWA 1YJ6A 1NW2A 4H86A 2FY6A 3ZMLA 2X8HA 1HNBA 1WRYA 2OA7A 3QDNA 1AUCA 5COHA 1QFNA 3D4MA 2VCTA 7GSSA 3LEFA 2V2GA 2L6DA 3TDGA 5AGYA 4BL7A 1THXA 1TOFA 5ECRB 4ACSA 1VF3A 3UJ1A 13GSA 4DEJA 1CQHA 2HFDA 4PUFC 2WGRA 2IMFA 1R4WA 2LV3A 3GSTA 2IMDA 2O8VB 1A0RP 3KH9A 2RM6A 3KMOA 4ID0A 3ZMKA 16GSA 3I6AA 4MH3A 1GTUA 3BJ5A 2YJ7A 3G7IA 1W4VA 3IA1A 3QMXA 2VLTA 4OD7A 4WKWA 2JSYA 5ECIB 4G2EA 5DVBA 2B3SA 4NV2A 2P31A 5ABRA 2DJJA 5B8AA 4ZILA 3LJRA 1EZKA 1M2AA 1R7HA 4TXOA 2JACA 1O81A 1A2JA 2B7KA 4HUAA 1YF1A 5B6NA 1T3BA 1GUHA 1OVNA 4MPFA 4K0NA 3TRQA 2WDUA 4Q5RA 2CZ3A 3RBTA 2M46A 3VWVA 4FO5A 1AAZA 2LRCA 2E7PA 4ML1A 3UOMA 2C0GA 1AQVA 3I43A 5HR2A 2HSHA 2MBTA 5IO2A 3ME7A 2LKUA 4V2LA 1EEMA 1XW5A 4K8MA 3UL3A 2PWJA 1TRWA 2VCWA 1Z5YE 3RAZA 4CDOA 1W89A 4D73B 4HQZA 1SJIA 1QMVA 1U88A 1O73A 3U5RE 4TXVA 3Q18A 3TJFA 3WGEA 2VIMA 2JL4A 2LS5A 4V2NA 1PL1A 3BOAA 3MNGA 1XFLA 4TKYA 1IYHA 2FCHA 1R5AA 2K18A 4BPYA 2LQOA 5EY6A 2VM1A 1AXDA 3HJPA 1JFUA 4K7NA 1B4QA 1URMA 2E0QA 2H01A 2GGTA 4TR0A 4EC0A 1T00A 5JCUA 3O76A 2H72A 2LJKA 4IP6A 4RI6A 1HD2A 1M2DA 4RI7A 2IWTA 3W6GA 4KW6A 1XW6A 1ERTA 4IP1A 5H5QA 1HNAA 2DJ1A 5KN1A 2LJRA 3KM6A 4HU7A 2OACA 3TOUA 1K3LA 3IPZA 2ON7A 2BTOT 2AAWA 5ELAA 5HR0A 1LU4A 2RUEA 2HNLA 4XCSA 1TK8B 3F4TA 4AJ8A 2LEGA 2G2QA 1X5DA 2VLUA 2E2GA 1ZYEA 4WR4A 1SJ6A 5CP1A 2AHEA 2MBSA 3FZAA 2H1DA 2PN8A 3HD5A 4GSTA 2V32A 1F3BA 1R5PA 1ON4A 1JHBA 3HHVA 3EMXA 1JLWA 2FHEA 3MAKA 3A2XA 3VPTA 5J9CA 1XVWA 3KEBA 3GH9A 1AW9A 4GLTA 4TR3A 1F6MC 5IPHA 3FY7A 4GTUA 2K6VA 1X9SB 3J7Yb 3LSZA 2I81A 3FHKA 1GTIA 4YAVA 4WF5A 3C71A 2B5YA 2FWEA 1B9XC 2CX4A 2H71A 1X9MB 5C04A 5F07A 4QL9A 5HFIA 3LGCA 2H6YA 2O89A 2OBIA 5ECNB 2NBSA 2VUPA 1SJZA 3K8NA 1TDIA 1FHEA 2YNXA 1FOVA 2VCQA 3IK9A 4HJMA 4JR6A 5IO0A 1C72A 5D93A 2VO4A 4GQCA 5D9VA 2V6KA 4NV5A 4I8BA 4TR4A 3QPMA 1B9YC 1T8EB 1O7UA 10GSA 5EL8A 4I2TA 4KDUA 3MDKA 2WRTA 4MF5A 5IMCA 2M72A 1X0RA 3TKSA 5DCGA 3ZVJD 5J4UA 4WXTA 1G6YA 2L5LA 3C1RA 2B5XA 5DQYA 3F3RA 4POMA 1YY7A 1S3DA 2H1BA 3F4RA 1THOA 1N2AA 4BVYA 3AY8A 1ERUA 2DLXA 4N0ZA 1SENA 4NMUA 1V57A 4BVXA 1SK0A 5J9BA 5G31A 18GSA 1I9DA 1ZL9A 1XXUA 1PKWA 3GX8A 3UBLA 4JR4A 5LNKe 1WIKA 1YKCA 1KBNA 2JZSA 2KP2A 1Q98A 2O7KA 2TIRA 1GSSA 2XBQA 5IOWA 1GUMA 2PERA 4RQRA 3QD9A 3IAM2 1GTAA 1UN2A 5A4UA 3F4SA 1TRSA 3GTUB 2FUG2 2GT6A 3C7MA 3H4KA 1ML6A 1WE0A 5J41A 4KDXA 2B7JA 3RPPA 3ED3A 1VF1A
chains in the Genus database with same CATH superfamily
3KZQA 3LG6A 3SWLA 4ZXGA 4FYUA 3TKPA 2IPAA 12GSA 1Z7RA 4MP4A 4QL7A 4WF4A 1SK1A 3LXTA 3GNJA 4X4JA 6GSXA 4F0CA 2FWFA 3CMIA 3H8QA 3PINA 2WFCA 3CBUA 2YN1A 4ZBDA 4V1Ap 4X43A 2VD0A 2B1LA 2V1MA 2OE1A 1Y6EA 4O5RA 2CZ2A 1Z6MA 2AJQB 4PQIA 2WCIA 1GWCA 1M7TA 3LW9A 1F2EA 4L5LA 1N8JA 1GP1A 1DSBA 3KJYA 5CRDA 1XW9A 4GQFA 5FT3A 4O7HA 1PSQA 4YAPA 4O32A 2N5FA 1A2MA 4XIHA 4IVFA 1ZOFA 2QA1A 3EU4A 5AIVA 1PL2A 3E3EA 4DVCA 4K9ZA 4G19A 4GCIA 4MZWA 4OCEA 2EIOA 2C80A 2R37A 3GYKA 3RHBA 4V1Ag 1U3AA 1TU8A 4K5RA 3HJMA 4N0VA 3TRPA 1SL2B 2DSAA 1GLQA 3CYNA 3WGXA 3ZTLA 20GSA 1R26A 2HRNA 1SYRA 1NHOA 2H6ZA 1AQWA 1V2AA 2ON5A 4GWRA 2OKAA 3TUEA 4NAXA 2VCXA 4JU5A 2DJ2A 2LNSA 4G9HA 2DC5A 4J56E 3F0IA 3ZREA 1EEJA 2R0CA 4ZL9A 3D22A 2PBJA 1KTEA 2QGVA 4IS0A 2YWOA 3ZLPA 4E8HA 5ECKB 3O3TA 2R5GA 4EKZA 2PPTA 3CRTA 3CXGA 5IMZA 4O5UA 2PGTA 1DE2A 1O8WA 1YZXA 1A0FA 1BX9A 1HQOA 5DJLA 1ZYQB 4TXOB 1EV9A 4NWYA 3J7Yk 3ZZXA 3FRCA 1S3CA 2N5BA 2KLXA 4IKHA 2MMOA 2CAIA 1TK0B 2QKEA 2HT9A 2WZ9A 1JZWA 4DSRA 3ERGA 2QSIA 3JCML 2GQLA 1H4OA 3HVNA 4ZL7A 1XVQA 3DD3A 3FW2A 3HZ8A 3N9JA 2H0IA 1GSFA 3IE3A 3VFIA 2X8GA 1USBA 3L9VA 3VI5A 3GIXA 4O5QA 2RLIA 3RPNA 1WMJA 4YQUA 4KA0A 3EINA 4EO3A 1NM3A 1MD4A 3NZNA 4PXOA 4XS4B 3DYRA 5HQPA 3QFAC 5JCGA 2H1GA 3P8WA 3FZ4A 3BD2A 4O92A 3D0ZA 1K0OA 4PURA 3LXZA 3A3TA 9GSSA 5ECLB 2A4VA 3CSIA 1TI1A 3N5OA 2VCZA 2DIYA 2C3QA 4YQMA 3VLNA 2OJLA 1UC7A 1SD9A 4MJCA 2YJHA 3TGZA 4HOJA 4ML6A 2CV4A 4CHSA 1FW1A 3S9FA 4AJ7A 3GURA 4PNGA 3FR6A 3EWLA 1J08A 3KTLA 4KH7A 2L5OA 1K3YA 2GZYA 1GULA 5ECHB 2B6MA 5D9TA 3FYGA 3APQA 3V1WA 3KMNA 1OE8A 6GSSA 2IJYA 4IN0A 4ICYA 1SK2A 2EIRA 3TCOA 1ST9A 4MZCA 1E2YA 2JADA 1AQXA 3GV1A 2IIYA 1A8YA 4IELA 3KGKA 2FGXA 5G5EA 4PQHA 4XS4A 1O8XA 2J23A 1G6WA 5CAXA 5CNWA 1E6BA 1YEPA 3IBHA 2PVQA 3QOUA 5G1KA 2KP1A 2REMA 1OC9A 3VWUA 4JE1A 1Q4JA 5G2ZA 3PGTA 6GSVA 5IMDA 4JBBA 4JEDA 5KN3A 3FK8A 2FWGA 4Z2UA 4MPGA 2DIZA 5C00A 3F9UA 2MMAA 3EURA 1JLVA 1ZGNA 4F82A 5KEJA 4ZL8A 1XBSA 2IFQB 1MDKA 1VF2A 1TK5B 2C8UA 2P5QA 3GL5A 3CQFA 1XCCA 1TKDB 1DE1A 1EV4A 1F3AA 2FLSA 3MSZA 1S3AA 3QR6A 4K6XA 1M9AA 5J5NA 1SD8A 4XTSA 5ECMB 1XOAA 1EOGA 2K8SA 2HLSA 2CX3A 2GSSA 5D9WA 4KDYA 2YP6A 2EIQA 1GH2A 4GF0A 2GTUA 4K2DA 3DIEA 2YANA 3W8JA 5H5RA 3SBCA 5GSTA 4GSSA 1EP8A 4IBPA 4Z2TA 1JZOA 1PA3A 3W8SA 2H8LA 2NPBA 4BVYB 2KUCA 4JZQA 2LRTA 3KXOA 3A2WA 3GRXA 5G5FA 2IFQA 3OR5A 4RUVA 4BVXB 2EC4A 3GH6A 2CT6A 3ZVJA 1YQ1A 1FOHA 2IL3A 1O85A 4TRXA 1FG4A 1PD21 1V98A 3FR9A 1TXXA 2ES7A 2A2RA 1KNGA 4KE3A 1NHYA 2HRAA 1WP0A 3KTBA 2HRFA 1XWGA 3M8NA 11GSA 1GSQA 2GVPA 6GSYA 4HJ2A 4NHWA 2X99A 2OE0A 5A4VA 5IMAA 3PH9A 2AV4A 3HVSA 2O87A 1Z9HA 3ZYWA 3APOA 5CREA 4MK3A 4IHUA 2NVLA 3TJGA 4G0IA 5DDLA 3H79A 5INYA 1V40A 4HQSA 3DVXA 3ZIJA 1XOBA 3TKQA 2GLRA 1XWKA 3IXRA 5A4WA 2VAFA 2R0PA 4TR1A 2ZUPA 2VL2C 3P2AA 2H73A 4HDEA 4ISDA 1OC3A 5GSSA 3CSHA 3EC3A 1YEXA 5KOXA 2YV9A 2XPEA 2DKHA 1WPIA 3GSSA 2JZTA 1WJKA 5HR1A 1G7EA 3BBYA 4POBA 2A2PA 4K1FA 3LORA 4KX4A 6GSTA 1IYIA 3IC4A 5DALA 4KCEA 3QAVA 3HZ4A 14GSA 1GSEA 3L9UA 4PGTA 5CRHA 3KH7A 2ZCTA 2LNTA 2KOKA 4DSSB 2MMZA 3QAGA 3HXSA 1SKWB 4WBRD 2H6XA 4XRDA 3TKSC 2E2MA 2K9FA 4IW9A 3FKFA 1T1VA 4LMWA 3I9V2 1TTZA 3UVHA 2VD1A 4F0BA 3GA4A 4ECIA 3FZ9A 3MYDA 3US3A 5FWGA 2H0GA 1YDKA 2IN3A 4OCFA 1XZOA 2RM5A 3ZFLA 1GL8A 2VL9A 4N30A 2H70A 4MZBA 1FAAA 5G1LA 4EDZA 1FO5A 4I6XA 3F3QA 1ACVA 4CY8A 5EPFA 4IJIA 4BWQA 3HA9A 4MCUA 2C3TA 1U6TA 2HZEB 3M9JA 1HYUA 3TOTA 3C8EA 2VM2A 2X49A 2H74A 1DBYA 2VLVA 1ZYNA 4ECBA 1ERVA 4ECCA 2CVBA 5D9XA 5GAPD 1QUWA 4FH8A 4OFNA 3EMPA 1RK4A 4DSSA 1OE7A 2GT5A 2YZUA 3BCKA 4KUNA 4E8EA 1Y25A 5B7CA 1PN9A 4TVEA 1MD3A 1U3IA 2H66A 1A23A 2DJKA 1TRVA 2GZPA 4KSMA 5AIXA 3Q74A 2L4CA 3VURA 3ZFBA 3UEMA 4MLYA 1TI3A 3O6TA 4BWSA 1PKZA 2CVKA 1JZDA 4LL1B 4I2UA 2AUVA 3I69A 1GNEA 1I5GA 1K0CA 5JWRB 4KGIA 4N11A 4MF7A 4MJEA 3WD6A 4F03A 3A5IA 4TN8A 3WGDA 4XS1A 3DXBA 4K7IA 2H1AA 3CTGA 1PFOA 2WS2A 1TJDA 4ZB8A 1XPVA 1B8XA 5ENUA 4OMVA 1ZZYA 2HZEA 1QK8A 4ZB9A 1FVKA 1WWJA 5AN1A 3IAS2 1FVJA 4Q5NA 3LWAA 3IK7A 3BCIA 4PTSA 3IHQA 4AJ6A 1SU9A 4CW9A 3M1GA 1PQNA 2WJUA 5DAKA 1B4PA 4KCAA 4Z7XA 1K3OA 3KP9A 8GSSA 5HFKA 1SYXA 5ID2A 5ECSA 3P7XA 3DWVA 4AGSA 1BAYA 4L8EA 2DMLA 2O85A 3F8UA 3FMWA 1X5EA 2C0DA 3MIXA 4PX1A 1U87A 3GKXA 5AISA 1A24A 1BJXA 4LL4B 2VL3A 2L59A 2RIIA 5IPGA 4EXJA 5KN2A 3KIJA 4ZB6A 3G7JA 2L57A 1F37A 5BMUA 4I97A 17GSA 1EGRA 4F2IA 2I9HA 1GSDA 22GSA 4ZBBA 4OFMA 3WT2A 2GQMA 2JSZA 1PX6A 4ULXA 3E0UA 4QQ7A 4POKA 3CTFA 3KP8A 1OC9B 4WR5A 2LQQA 1T4YA 3LQ7A 2PU9C 4F9ZA 1QXHA 2OBKA 3EVIA 1MDJA 4EDYA 2D2ZA 5LD0A 2GDRA 5FHIA 3L0HA 2YPMA 1M3IA 1ILOA 2P0GA 1YKAA 2HZFA 5ECQB 4XS6A 1GNWA 3ERFA 2QA2A 2C1YA 1PGTA 3LFLA 4PQ1A 2HI7A 4HSCX 4I5QA 4AF2A 5D96A 3GHAA 2RUFA 2FA8A 1SL1B 1M2BA 2A2SA 1TW9A 2CAQA 3L9SA 1FB0A 2N5AA 3R2QA 19GSA 2H30A 5CRWA 1Z6NA 2J9HA 2GSQA 2I1UA 1K0DA 3KD0A 5F05A 4LMVA 2YWMA 3HVXA 1MTCA 1WOUA 5DBQA 4X1UA 2NDOA 1X5CA 5IMVA 2BMXA 3HJOA 4NPBA 2FNOA 2PMTA 4MJAA 4MMMA 2XC2A 2LSTA 3M9KA 5E4WA 3EYTA 4PUAA 1RQMA 3E9JB 2YWNA 2G0FA 2B5EA 1G7OA 1PMTA 4OO5A 1SL0B 3QFBC 5G30A 5D8IA 1CQGA 4ZBAA 2PUKC 1NSWA 3P90A 3HYPA 4ZIJA 3HDCA 4EF0A 3M0FA 5BRTA 3NIVA 3G9BA 4EUYA 1VGLA 4N10A 1Z7PA 5JWOB 4Z2RA 4FYBA 4MH2A 1XWBA 2V6OA 2C0EA 4DSQA 5JWQB 2MZCA 2I3YA 3ZL5A 4EE0A 2JU5A 4L5OA 5B6MA 3VI7A 5H5SA 2H0HA 1MDIA 4KF9A 4BIKA 2HYXA 2XPDA 4EVMA 4HI7A 2KHPA 5IM9A 3DMLA 4XHMA 3IV4A 4MABA 2P5RA 4G10A 2I4AA 3PPUA 3GFKA 1EGOA 4IQAA 3C1SA 3L78A 2AB6A 4Q5FA 1S3RA 1PX7A 3HY2A 2YZHA 5KN0A 4D73A 1BQ7A 5J3RA 1FB6A 5B8BA 2C3NA 3DGQA 1MEKA 5F06A 5IIZA 2DJ0A 1AC1A 2B1KA 2X8CA 1RW1A 5DQSA 3GMFA 3UVTA 1OKTA 2LJAA 4P3YB 3TRXA 3TKSE 3UARA 4K7OA 4TR1B 4GXZA 2CQ9A 1ABAA 1GSUA 4EIPA 3CSJA 3F6DA 4G0LA 3TB2A 3RDWA 2YOIA 5ECPB 4CY6A 3ZITA 5E59A 1VRSD 1KEBA 1K0AA 2WULA 1XIYA 1J9BA 2HE3A 2VL2A 1O6JA 2WB9A 3UIWA 1BG5A 2YWIA 2V41A 1JZRA 1A8LA 1K0BA 4POLA 3R3EA 5DCHA 1QQ2A 5DALB 1T7PB 1SKSB 2F51A 4IQ1A 5IQYA 4J2FA 2NTOA 1B48A 3DVWA 1LBKA 3D4TA 3IHGA 4MJBA 3TJKA 1OC8A 2AYTA 1SKRB 2R3XA 3A2VA 4FYCA 1V9WA 4GRFA 3HVVA 2H19A 1UVZA 2VCVA 1OKDA 2QC7A 4K0GA 3IRAA 3D5JA 1HNCA 1VF4A 3CRUA 3F6FA 2FD3A 2GS3A 2PVOC 3UBKA 1TP9A 5CYYA 3GN3A 3IR4A 4BA7A 3NOFA 2DMMA 2IMKA 4Q5QA 2ZNMA 1YF0A 2F3MA 2F8FA 2OE3A 2YCDA 3IOSA 1X9WB 2ALBA 1EP7A 5F0GA 5EVOA 3QCPA 1ERWA 3MWHA 1GRXA 2GQKA 3EPTA 4HZ2A 2L4QA 3GKNA 3UAPA 4FIWA 3ERWA 4HU9A 3FR3A 3APSA 3ISOA 1GSYA 2XHFA 2GZZA 1GTBA 2R0GA 2R6KA 2M80A 3TJJA 4JRRA 1UA5A 3EU3A 3LYPA 3F63A 4KAEA 1EOHA 4V2MA 3VK9A 3C73A 2FWHA 3FEUA 2OADA 1GUKA 1PRXA 1QGVA 1BEDA 5ECOB 1M0UA 2DJ3A 5CO3A 5CRGA 2GSTA 3GL3A 2H76A 1AIUA 3A5WA 4TOPA 2CA8A 3L4NA 1F9MA 2MYGA 1TU7A 3ZIVA 2JZRA 2R2JA 3UMAA 2L6CA 3H1NA 2DBCA 2XBIA 2BJXA 3IDVA 3M3MA 3U6VA 3H93A 1Z3EA 1DUGA 1A2LA 4KSOA 3LYKA 4MDCA 4A5PA 6GSWA 1OAZA 2IMEA 4GSNA 3IC8A 4LA1A 4WETA 2IMIA 4OWYA 2TRCP 3EE2A 4L0UA 3WT1A 1XWCA 4PNFA 4LLRA 4ILFA 3DKSA 2F9SA 2GSRA 4ECJA 2HXKA 4NXIA 2Z9SA 2X4AA 2K8VA 4YKGA 5HR3A 3HCZA 1ZMAA 5DAKB 2HSMA 6GSUA 5GZZB 3ME8A 2FA4A 3GKKA 4WEYA 2C4JA 4IJ3A 3DRNA 4J57E 2MMNA 4OO4A 2CVDA 2HSYA 4MF6A 1H75A 3TKRA 5GAND 5ID2B 1EWXA 4X0XA 5KOWA 4FQUA 2YV7A 4IGJA 3Q6OA 3FZ5A 3KCMA 3GTUA 1M99A 3GUSA 1ZYPA 5DJMA 1M9BA 3GKMA 4MA9A 5LCZA 2UZ8A 4KB3A 4TW5A 2C0FA 1J0FA 4BL7B 1LJRA 2TRXA 4RQXA 2VOCA 4YH2A 5IMFA 4HS1A 3Q19A 1V58A 2LUSA 1ZCPA 4L0WA 4OFTA 2LRNA 4YQVA 1BYEA 1K0NA 2F8AA 5L71A 2H75A 1OYJA 3TJBA 1XG8A 4HZ4A 2DKIA 1GLPA 3D6IA 2A4HA 3G7YA 2X64A 5A5KA 1PN0A 5HFGA 3DEXA 3VPQA 2R4VA 5IOXA 3VWWA 1K0MA 4WBJA 5D73A 5F8BA 4XRAA 3RHCA 3QAWA 4HEA2 3VWXA 4KNDA 3ZRDA 3HKRA 3GX0A 5JCWA 1T4ZA 1G0TA 1XWAA 5ELGA 4NHZA 2LTKA 1TRUA 3PR8A 4EL1A 3D21A 3WYWA 1YJ6A 1NW2A 4H86A 2FY6A 3ZMLA 2X8HA 1HNBA 1WRYA 2OA7A 3QDNA 1AUCA 5COHA 1QFNA 3D4MA 2VCTA 7GSSA 3LEFA 2V2GA 2L6DA 3TDGA 5AGYA 4BL7A 1THXA 1TOFA 5ECRB 4ACSA 1VF3A 3UJ1A 13GSA 4DEJA 1CQHA 2HFDA 4PUFC 4MNNA 2WGRA 2IMFA 1R4WA 2LV3A 3GSTA 2IMDA 2O8VB 1A0RP 3KH9A 4K2XA 2RM6A 3KMOA 4ID0A 3ZMKA 16GSA 3I6AA 4MH3A 1GTUA 3BJ5A 2YJ7A 3G7IA 1W4VA 3IA1A 3QMXA 2VLTA 4OD7A 4WKWA 2JSYA 4YKFA 5ECIB 4G2EA 5DVBA 2B3SA 4EIQA 4NV2A 2P31A 5ABRA 2DJJA 5B8AA 4ZILA 3LJRA 1EZKA 1M2AA 1R7HA 4TXOA 2JACA 1O81A 1A2JA 2B7KA 4HUAA 1YF1A 5B6NA 1T3BA 1GUHA 1OVNA 4MPFA 4K0NA 3TRQA 2WDUA 4Q5RA 2CZ3A 3RBTA 2M46A 3VWVA 4FO5A 1AAZA 2LRCA 2E7PA 4ML1A 3UOMA 1M3JA 2C0GA 1AQVA 3I43A 5HR2A 2HSHA 2MBTA 5IO2A 3ME7A 2LKUA 4V2LA 1EEMA 1XW5A 4K8MA 3UL3A 2PWJA 1TRWA 2VCWA 1Z5YE 3RAZA 4CDOA 1W89A 4D73B 4HQZA 1SJIA 1QMVA 1U88A 1O73A 3U5RE 4TXVA 3Q18A 4K5SA 3TJFA 3WGEA 2VIMA 2JL4A 2LS5A 4V2NA 1PL1A 3BOAA 3MNGA 1XFLA 4TKYA 1IYHA 2FCHA 1R5AA 2K18A 4BPYA 2LQOA 5EY6A 2VM1A 1AXDA 3HJPA 1JFUA 4K7NA 1B4QA 1URMA 2E0QA 2H01A 2GGTA 4TR0A 4EC0A 1T00A 5JCUA 3O76A 2H72A 2LJKA 4RI6A 4IP6A 1HD2A 1M2DA 4RI7A 2IWTA 3W6GA 4KW6A 1XW6A 1ERTA 4IP1A 5H5QA 1HNAA 2DJ1A 5KN1A 2LJRA 3KM6A 4HU7A 2OACA 3TOUA 1K3LA 3IPZA 2ON7A 2BTOT 2AAWA 5ELAA 5HR0A 1LU4A 2RUEA 2HNLA 4XCSA 1TK8B 3F4TA 4USSA 4AJ8A 2LEGA 2G2QA 1X5DA 2VLUA 2E2GA 1ZYEA 4WR4A 1SJ6A 5CP1A 2AHEA 2MBSA 3FZAA 2H1DA 2PN8A 3HD5A 4GSTA 2V32A 1F3BA 1R5PA 1ON4A 1JHBA 3HHVA 3EMXA 1JLWA 2FHEA 3MAKA 3A2XA 3VPTA 5J9CA 1XVWA 3KEBA 3GH9A 1AW9A 4GLTA 4TR3A 1F6MC 5IPHA 2HRKA 3FY7A 4GTUA 2K6VA 1X9SB 3J7Yb 3LSZA 2I81A 3FHKA 1GTIA 4YAVA 4WF5A 3C71A 2B5YA 2FWEA 1B9XC 2CX4A 2H71A 1X9MB 5C04A 5F07A 4QL9A 5HFIA 3LGCA 2H6YA 2O89A 2OBIA 5ECNB 2NBSA 2VUPA 1SJZA 3K8NA 1TDIA 1FHEA 2YNXA 1FOVA 2VCQA 3IK9A 4HJMA 4JR6A 5IO0A 1C72A 4G0KA 5D93A 2VO4A 4GQCA 5D9VA 2V6KA 4NV5A 4I8BA 4TR4A 3QPMA 1B9YC 1T8EB 1O7UA 10GSA 5EL8A 4I2TA 4KDUA 3MDKA 2WRTA 4MF5A 5IMCA 2M72A 1X0RA 3TKSA 5DCGA 3ZVJD 5J4UA 4WXTA 1G6YA 2L5LA 3C1RA 2B5XA 5DQYA 3F3RA 4POMA 1YY7A 1S3DA 2H1BA 3F4RA 1THOA 1N2AA 4BVYA 3AY8A 1ERUA 2DLXA 4N0ZA 1SENA 4NMUA 1V57A 4BVXA 1SK0A 5J9BA 5G31A 18GSA 1I9DA 1ZL9A 1XXUA 1PKWA 3GX8A 3UBLA 4JR4A 5LNKe 1WIKA 1YKCA 1KBNA 2JZSA 2KP2A 1Q98A 2O7KA 2TIRA 1GSSA 2XBQA 5IOWA 1GUMA 2PERA 4RQRA 3QD9A 3IAM2 1GTAA 1UN2A 5A4UA 3F4SA 1TRSA 3GTUB 2FUG2 2GT6A 3C7MA 3H4KA 1ML6A 1WE0A 5J41A 4KDXA 2B7JA 3RPPA 3ED3A 1VF1A
chains in the Genus database with same CATH topology
3KZQA 3LG6A 3SWLA 4ZXGA 4FYUA 3TKPA 2IPAA 12GSA 1Z7RA 4MP4A 4QL7A 4WF4A 1SK1A 3LXTA 3GNJA 4X4JA 6GSXA 4F0CA 2FWFA 3CMIA 3H8QA 3PINA 2WFCA 3CBUA 2YN1A 4ZBDA 4V1Ap 4X43A 2VD0A 2B1LA 2V1MA 2OE1A 1Y6EA 4O5RA 2CZ2A 1Z6MA 2AJQB 4PQIA 2WCIA 1GWCA 1M7TA 3LW9A 1F2EA 4L5LA 1N8JA 1GP1A 1DSBA 3KJYA 5CRDA 1XW9A 4GQFA 5FT3A 4O7HA 1PSQA 4YAPA 4O32A 2N5FA 1A2MA 4XIHA 4IVFA 1ZOFA 2QA1A 3EU4A 5AIVA 1PL2A 3E3EA 4DVCA 4K9ZA 4G19A 4GCIA 4MZWA 4OCEA 2EIOA 2C80A 2R37A 3GYKA 3RHBA 4V1Ag 1U3AA 1TU8A 4K5RA 3HJMA 4N0VA 3TRPA 1SL2B 2DSAA 1GLQA 3CYNA 3WGXA 3ZTLA 20GSA 1R26A 2HRNA 1SYRA 1NHOA 2H6ZA 1AQWA 1V2AA 2ON5A 4GWRA 2OKAA 3TUEA 4NAXA 2VCXA 4JU5A 2DJ2A 2LNSA 4G9HA 2DC5A 4J56E 3F0IA 3ZREA 1EEJA 2R0CA 4ZL9A 3D22A 2PBJA 1KTEA 2QGVA 4IS0A 2YWOA 3ZLPA 4E8HA 5ECKB 3O3TA 2R5GA 4EKZA 2PPTA 3CRTA 3CXGA 5IMZA 4O5UA 2PGTA 1DE2A 1O8WA 1YZXA 1A0FA 1BX9A 1HQOA 5DJLA 1ZYQB 4TXOB 1EV9A 4NWYA 3J7Yk 3ZZXA 3FRCA 1S3CA 2N5BA 2KLXA 4IKHA 2MMOA 2CAIA 1TK0B 2QKEA 2HT9A 2WZ9A 1JZWA 4DSRA 3ERGA 2QSIA 3JCML 2GQLA 1H4OA 4ZL7A 1XVQA 3DD3A 3FW2A 3HZ8A 3N9JA 2H0IA 1GSFA 3IE3A 3VFIA 2X8GA 1USBA 3L9VA 3VI5A 3GIXA 4O5QA 2RLIA 3RPNA 1WMJA 4YQUA 4KA0A 3EINA 4EO3A 1NM3A 1MD4A 3NZNA 4PXOA 4XS4B 3DYRA 5HQPA 3QFAC 5JCGA 2H1GA 3P8WA 3FZ4A 3BD2A 4O92A 3D0ZA 1K0OA 4PURA 3LXZA 3A3TA 9GSSA 5ECLB 2A4VA 3CSIA 1TI1A 3N5OA 2VCZA 2DIYA 2C3QA 4YQMA 3VLNA 2OJLA 1UC7A 1SD9A 4MJCA 2YJHA 3TGZA 4HOJA 4ML6A 2CV4A 4CHSA 1FW1A 3S9FA 4AJ7A 3GURA 4PNGA 3FR6A 3EWLA 1J08A 3KTLA 4KH7A 2L5OA 1K3YA 2GZYA 1GULA 5ECHB 2B6MA 5D9TA 3FYGA 3APQA 3V1WA 3KMNA 1OE8A 6GSSA 2IJYA 4IN0A 4ICYA 1SK2A 2EIRA 3TCOA 1ST9A 4MZCA 1E2YA 2JADA 1AQXA 3GV1A 2IIYA 1A8YA 4IELA 3KGKA 2FGXA 5G5EA 4PQHA 4XS4A 1O8XA 2J23A 1G6WA 5CAXA 5CNWA 1E6BA 1YEPA 3IBHA 2PVQA 3QOUA 5G1KA 2KP1A 2REMA 1OC9A 3VWUA 4JE1A 1Q4JA 5G2ZA 3PGTA 6GSVA 5IMDA 4JBBA 4JEDA 5KN3A 3FK8A 2FWGA 4Z2UA 4MPGA 2DIZA 5C00A 3F9UA 2MMAA 3EURA 1JLVA 1ZGNA 4F82A 5KEJA 4ZL8A 1XBSA 2IFQB 1MDKA 1VF2A 1TK5B 2C8UA 2P5QA 3GL5A 1XCCA 1TKDB 1DE1A 1EV4A 1F3AA 2FLSA 3MSZA 1S3AA 3QR6A 4K6XA 1M9AA 5J5NA 1SD8A 4XTSA 5ECMB 1XOAA 1EOGA 2K8SA 2HLSA 2CX3A 2GSSA 5D9WA 4KDYA 2YP6A 2EIQA 1GH2A 4GF0A 2GTUA 4K2DA 3DIEA 2YANA 3W8JA 5H5RA 3SBCA 5GSTA 4GSSA 1EP8A 4IBPA 4Z2TA 1JZOA 1PA3A 3W8SA 2H8LA 2NPBA 4BVYB 2KUCA 4JZQA 2LRTA 3KXOA 3A2WA 3GRXA 5G5FA 2IFQA 3OR5A 4RUVA 4BVXB 2EC4A 3GH6A 2CT6A 3ZVJA 1YQ1A 1FOHA 2IL3A 1O85A 4TRXA 1FG4A 1PD21 1V98A 3FR9A 1TXXA 2ES7A 2A2RA 1KNGA 4KE3A 1NHYA 2HRAA 1WP0A 3KTBA 2HRFA 1XWGA 3M8NA 11GSA 1GSQA 2GVPA 6GSYA 4HJ2A 4NHWA 2X99A 2OE0A 5A4VA 5IMAA 3PH9A 2AV4A 3HVSA 2O87A 1Z9HA 3ZYWA 3APOA 5CREA 4MK3A 4IHUA 2NVLA 3TJGA 4G0IA 5DDLA 3H79A 5INYA 1V40A 4HQSA 3DVXA 3ZIJA 1XOBA 3TKQA 2GLRA 1XWKA 3IXRA 5A4WA 2VAFA 2R0PA 4TR1A 2ZUPA 2VL2C 3P2AA 2H73A 4HDEA 4ISDA 1OC3A 5GSSA 3CSHA 3EC3A 1YEXA 5KOXA 2YV9A 2XPEA 2DKHA 1WPIA 3GSSA 2JZTA 1WJKA 5HR1A 1G7EA 3BBYA 4POBA 2A2PA 4K1FA 3LORA 4KX4A 6GSTA 1IYIA 3IC4A 5DALA 4KCEA 3QAVA 3HZ4A 14GSA 1GSEA 3L9UA 4PGTA 5CRHA 3KH7A 2ZCTA 2LNTA 2KOKA 4DSSB 2MMZA 3QAGA 3HXSA 1SKWB 4WBRD 2H6XA 4XRDA 3TKSC 2E2MA 2K9FA 4IW9A 3FKFA 1T1VA 4LMWA 3I9V2 1TTZA 3UVHA 2VD1A 4F0BA 3GA4A 4ECIA 3FZ9A 3MYDA 3US3A 5FWGA 2H0GA 1YDKA 2IN3A 4OCFA 1XZOA 2RM5A 3ZFLA 1GL8A 2VL9A 4N30A 2H70A 4MZBA 1FAAA 5G1LA 4EDZA 1FO5A 4I6XA 3F3QA 1ACVA 4CY8A 5EPFA 4IJIA 4BWQA 3HA9A 4MCUA 2C3TA 1U6TA 2HZEB 3M9JA 1HYUA 3TOTA 3C8EA 2VM2A 2X49A 2H74A 1DBYA 2VLVA 1ZYNA 4ECBA 1ERVA 4ECCA 2CVBA 5D9XA 5GAPD 1QUWA 4FH8A 4OFNA 3EMPA 1RK4A 4DSSA 1OE7A 2GT5A 2YZUA 3BCKA 4KUNA 4E8EA 1Y25A 5B7CA 1PN9A 4TVEA 1MD3A 1U3IA 2H66A 1A23A 2DJKA 1TRVA 2GZPA 4KSMA 5AIXA 3Q74A 2L4CA 3VURA 3ZFBA 3UEMA 4MLYA 1TI3A 3O6TA 4BWSA 1PKZA 2CVKA 1JZDA 4LL1B 4I2UA 2AUVA 3I69A 1GNEA 1I5GA 1K0CA 5JWRB 4KGIA 4N11A 4MF7A 4MJEA 3WD6A 4F03A 3A5IA 4TN8A 3WGDA 4XS1A 3DXBA 4K7IA 2H1AA 3CTGA 2WS2A 1TJDA 4ZB8A 1XPVA 1B8XA 5ENUA 4OMVA 1ZZYA 2HZEA 1QK8A 4ZB9A 1FVKA 1WWJA 5AN1A 3IAS2 1FVJA 4Q5NA 3LWAA 3IK7A 3BCIA 4PTSA 3IHQA 4AJ6A 1SU9A 4CW9A 3M1GA 1PQNA 2WJUA 5DAKA 1B4PA 4KCAA 4Z7XA 1K3OA 3KP9A 8GSSA 5HFKA 1SYXA 5ID2A 5ECSA 3P7XA 3DWVA 4AGSA 1BAYA 4L8EA 2DMLA 2O85A 3F8UA 3FMWA 1X5EA 2C0DA 3MIXA 4PX1A 1U87A 3GKXA 5AISA 1A24A 1BJXA 4LL4B 2VL3A 2L59A 2RIIA 5IPGA 4EXJA 5KN2A 3KIJA 4ZB6A 3G7JA 2L57A 1F37A 5BMUA 4I97A 17GSA 1EGRA 4F2IA 2I9HA 1GSDA 22GSA 4ZBBA 4OFMA 3WT2A 2GQMA 2JSZA 1PX6A 4ULXA 3E0UA 4QQ7A 4POKA 3CTFA 3KP8A 1OC9B 4WR5A 2LQQA 1T4YA 3LQ7A 2PU9C 4F9ZA 1QXHA 2OBKA 3EVIA 1MDJA 4EDYA 2D2ZA 5LD0A 2GDRA 5FHIA 3L0HA 2YPMA 1ILOA 2P0GA 1YKAA 2HZFA 5ECQB 4XS6A 1GNWA 3ERFA 2QA2A 2C1YA 1PGTA 3LFLA 4PQ1A 2HI7A 4I5QA 4AF2A 5D96A 3GHAA 2RUFA 2FA8A 1SL1B 1M2BA 2A2SA 1TW9A 2CAQA 3L9SA 1FB0A 2N5AA 3R2QA 19GSA 2H30A 5CRWA 1Z6NA 2J9HA 2GSQA 2I1UA 1K0DA 3KD0A 5F05A 4LMVA 2YWMA 3HVXA 1MTCA 1WOUA 5DBQA 4X1UA 2NDOA 1X5CA 5IMVA 2BMXA 3HJOA 4NPBA 2FNOA 2PMTA 4MJAA 4MMMA 2XC2A 2LSTA 3M9KA 5E4WA 3EYTA 4PUAA 1RQMA 3E9JB 2YWNA 2G0FA 2B5EA 1G7OA 1PMTA 4OO5A 1SL0B 3QFBC 5G30A 5D8IA 1CQGA 4ZBAA 2PUKC 1NSWA 3P90A 3HYPA 4ZIJA 3HDCA 4EF0A 3M0FA 5BRTA 3NIVA 3G9BA 4EUYA 1VGLA 4N10A 1Z7PA 5JWOB 4Z2RA 4FYBA 4MH2A 1XWBA 2V6OA 2C0EA 4DSQA 5JWQB 2MZCA 2I3YA 3ZL5A 4EE0A 2JU5A 4L5OA 5B6MA 3VI7A 5H5SA 2H0HA 1MDIA 4KF9A 2HYXA 2XPDA 4EVMA 4HI7A 2KHPA 5IM9A 3DMLA 4XHMA 3IV4A 4MABA 2P5RA 4G10A 2I4AA 3PPUA 3GFKA 1EGOA 4IQAA 3C1SA 3L78A 2AB6A 4Q5FA 1PX7A 3HY2A 2YZHA 5KN0A 4D73A 1BQ7A 5J3RA 1FB6A 5B8BA 2C3NA 3DGQA 1MEKA 5F06A 5IIZA 2DJ0A 1AC1A 2B1KA 2X8CA 1RW1A 5DQSA 3GMFA 3UVTA 1OKTA 2LJAA 4P3YB 3TRXA 3TKSE 3UARA 4K7OA 4TR1B 4GXZA 2CQ9A 1ABAA 1GSUA 4EIPA 3CSJA 3F6DA 4G0LA 3TB2A 3RDWA 2YOIA 5ECPB 4CY6A 3ZITA 5E59A 1VRSD 1KEBA 1K0AA 2WULA 1XIYA 1J9BA 2HE3A 2VL2A 1O6JA 2WB9A 3UIWA 1BG5A 2YWIA 2V41A 1JZRA 1A8LA 1K0BA 4POLA 3R3EA 5DCHA 1QQ2A 5DALB 1T7PB 1SKSB 2F51A 4IQ1A 5IQYA 4J2FA 2NTOA 1B48A 3DVWA 1LBKA 3D4TA 3IHGA 4MJBA 3TJKA 1OC8A 2AYTA 1SKRB 2R3XA 3A2VA 4FYCA 1V9WA 4GRFA 3HVVA 2H19A 1UVZA 2VCVA 1OKDA 2QC7A 4K0GA 3IRAA 3D5JA 1HNCA 1VF4A 3CRUA 3F6FA 2FD3A 2GS3A 2PVOC 3UBKA 1TP9A 5CYYA 3GN3A 3IR4A 4BA7A 3NOFA 2DMMA 2IMKA 4Q5QA 2ZNMA 1YF0A 2F3MA 2F8FA 2OE3A 2YCDA 3IOSA 1X9WB 2ALBA 1EP7A 5F0GA 5EVOA 3QCPA 1ERWA 3MWHA 1GRXA 2GQKA 3EPTA 4HZ2A 2L4QA 3GKNA 3UAPA 4FIWA 3ERWA 4HU9A 3FR3A 3APSA 3ISOA 1GSYA 2XHFA 2GZZA 1GTBA 2R0GA 2R6KA 2M80A 3TJJA 4JRRA 1UA5A 3EU3A 3LYPA 3F63A 4KAEA 1EOHA 4V2MA 3VK9A 3C73A 2FWHA 3FEUA 2OADA 1GUKA 1PRXA 1QGVA 1BEDA 5ECOB 1M0UA 2DJ3A 5CO3A 5CRGA 2GSTA 3GL3A 2H76A 1AIUA 3A5WA 4TOPA 2CA8A 3L4NA 1F9MA 2MYGA 1TU7A 3ZIVA 2JZRA 2R2JA 3UMAA 2L6CA 3H1NA 2DBCA 2XBIA 2BJXA 3IDVA 3M3MA 3U6VA 3H93A 1Z3EA 1DUGA 1A2LA 4KSOA 3LYKA 4MDCA 4A5PA 6GSWA 1OAZA 2IMEA 4GSNA 3IC8A 4LA1A 4WETA 2IMIA 4OWYA 2TRCP 3EE2A 4L0UA 3WT1A 1XWCA 4PNFA 4LLRA 4ILFA 3DKSA 2F9SA 2GSRA 4ECJA 2HXKA 4NXIA 2Z9SA 2X4AA 2K8VA 4YKGA 5HR3A 3HCZA 1ZMAA 5DAKB 2HSMA 6GSUA 5GZZB 3ME8A 2FA4A 3GKKA 4WEYA 2C4JA 4IJ3A 3DRNA 4J57E 2MMNA 4OO4A 2CVDA 2HSYA 4MF6A 1H75A 3TKRA 5GAND 5ID2B 1EWXA 4X0XA 5KOWA 4FQUA 2YV7A 4IGJA 3Q6OA 3FZ5A 3KCMA 3GTUA 1M99A 3GUSA 1ZYPA 5DJMA 1M9BA 3GKMA 4MA9A 5LCZA 2UZ8A 4KB3A 4TW5A 2C0FA 1J0FA 4BL7B 1LJRA 2TRXA 4RQXA 2VOCA 4YH2A 5IMFA 4HS1A 3Q19A 1V58A 2LUSA 1ZCPA 4L0WA 4OFTA 2LRNA 4YQVA 1BYEA 1K0NA 2F8AA 5L71A 2H75A 1OYJA 3TJBA 4HZ4A 2DKIA 1GLPA 3D6IA 2A4HA 3G7YA 2X64A 5A5KA 1PN0A 5HFGA 3DEXA 3VPQA 2R4VA 5IOXA 3VWWA 1K0MA 4WBJA 5D73A 5F8BA 4XRAA 3RHCA 3QAWA 4HEA2 3VWXA 4KNDA 3ZRDA 3HKRA 3GX0A 5JCWA 1T4ZA 1G0TA 1XWAA 5ELGA 4NHZA 2LTKA 1TRUA 3PR8A 4EL1A 3D21A 3WYWA 1YJ6A 1NW2A 4H86A 2FY6A 3ZMLA 2X8HA 1HNBA 1WRYA 2OA7A 3QDNA 1AUCA 5COHA 1QFNA 3D4MA 2VCTA 7GSSA 3LEFA 2V2GA 2L6DA 3TDGA 5AGYA 4BL7A 1THXA 1TOFA 5ECRB 4ACSA 1VF3A 3UJ1A 13GSA 4DEJA 1CQHA 2HFDA 4PUFC 4MNNA 2WGRA 2IMFA 1R4WA 2LV3A 3GSTA 2IMDA 2O8VB 1A0RP 3KH9A 4K2XA 2RM6A 3KMOA 4ID0A 3ZMKA 16GSA 3I6AA 4MH3A 1GTUA 3BJ5A 2YJ7A 3G7IA 1W4VA 3IA1A 3QMXA 2VLTA 4OD7A 4WKWA 2JSYA 4YKFA 5ECIB 4G2EA 5DVBA 2B3SA 4EIQA 4NV2A 2P31A 5ABRA 2DJJA 5B8AA 4ZILA 3LJRA 1EZKA 1M2AA 1R7HA 4TXOA 2JACA 1O81A 1A2JA 2B7KA 4HUAA 1YF1A 5B6NA 1T3BA 1GUHA 1OVNA 4MPFA 4K0NA 3TRQA 2WDUA 4Q5RA 2CZ3A 3RBTA 2M46A 3VWVA 4FO5A 1AAZA 2LRCA 2E7PA 4ML1A 3UOMA 2C0GA 1AQVA 3I43A 5HR2A 2HSHA 2MBTA 5IO2A 3ME7A 2LKUA 4V2LA 1EEMA 1XW5A 4K8MA 3UL3A 2PWJA 1TRWA 2VCWA 1Z5YE 3RAZA 4CDOA 1W89A 4D73B 4HQZA 1SJIA 1QMVA 1U88A 1O73A 3U5RE 4TXVA 3Q18A 4K5SA 3TJFA 3WGEA 2VIMA 2JL4A 2LS5A 4V2NA 1PL1A 3BOAA 3MNGA 1XFLA 4TKYA 1IYHA 2FCHA 1R5AA 2K18A 4BPYA 2LQOA 5EY6A 2VM1A 1AXDA 3HJPA 1JFUA 4K7NA 1B4QA 1URMA 2E0QA 2H01A 2GGTA 4TR0A 4EC0A 1T00A 5JCUA 3O76A 2H72A 2LJKA 4RI6A 4IP6A 1HD2A 1M2DA 4RI7A 2IWTA 3W6GA 4KW6A 1XW6A 1ERTA 4IP1A 5H5QA 1HNAA 2DJ1A 5KN1A 2LJRA 3KM6A 4HU7A 2OACA 3TOUA 1K3LA 3IPZA 2ON7A 2BTOT 2AAWA 5ELAA 5HR0A 1LU4A 2RUEA 2HNLA 4XCSA 1TK8B 3F4TA 4USSA 4AJ8A 2LEGA 2G2QA 1X5DA 2VLUA 2E2GA 1ZYEA 4WR4A 1SJ6A 5CP1A 2AHEA 2MBSA 3FZAA 2H1DA 2PN8A 3HD5A 4GSTA 2V32A 1F3BA 1R5PA 1ON4A 1JHBA 3HHVA 3EMXA 1JLWA 2FHEA 3MAKA 3A2XA 3VPTA 5J9CA 1XVWA 3KEBA 3GH9A 1AW9A 4GLTA 4TR3A 1F6MC 5IPHA 2HRKA 3FY7A 4GTUA 2K6VA 1X9SB 3J7Yb 3LSZA 2I81A 3FHKA 1GTIA 4YAVA 4WF5A 3C71A 2B5YA 2FWEA 1B9XC 2CX4A 2H71A 1X9MB 5C04A 5F07A 4QL9A 5HFIA 3LGCA 2H6YA 2O89A 2OBIA 5ECNB 2NBSA 2VUPA 1SJZA 3K8NA 1TDIA 1FHEA 2YNXA 1FOVA 2VCQA 3IK9A 4HJMA 4JR6A 5IO0A 1C72A 4G0KA 5D93A 2VO4A 4GQCA 5D9VA 2V6KA 4NV5A 4I8BA 4TR4A 3QPMA 1B9YC 1T8EB 1O7UA 10GSA 5EL8A 4I2TA 4KDUA 3MDKA 2WRTA 4MF5A 5IMCA 2M72A 1X0RA 3TKSA 5DCGA 3ZVJD 5J4UA 4WXTA 1G6YA 2L5LA 3C1RA 2B5XA 5DQYA 3F3RA 4POMA 1YY7A 1S3DA 2H1BA 3F4RA 1THOA 1N2AA 4BVYA 3AY8A 1ERUA 2DLXA 4N0ZA 1SENA 4NMUA 1V57A 4BVXA 1SK0A 5J9BA 5G31A 18GSA 1I9DA 1ZL9A 1XXUA 1PKWA 3GX8A 3UBLA 4JR4A 5LNKe 1WIKA 1YKCA 1KBNA 2JZSA 2KP2A 1Q98A 2O7KA 2TIRA 1GSSA 2XBQA 5IOWA 1GUMA 2PERA 4RQRA 3QD9A 3IAM2 1GTAA 1UN2A 5A4UA 3F4SA 1TRSA 3GTUB 2FUG2 2GT6A 3C7MA 3H4KA 1ML6A 1WE0A 5J41A 4KDXA 2B7JA 3RPPA 3ED3A 1VF1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KZQ A;  3LG6 A;  3SWL A;  4ZXG A;  4FYU A;  3TKP A;  2IPA A;  12GS A;  1Z7R A;  4MP4 A;  4QL7 A;  4WF4 A;  1SK1 A;  3LXT A;  3GNJ A;  6GSX A;  4F0C A;  2FWF A;  3CMI A;  3H8Q A;  3PIN A;  2WFC A;  3CBU A;  2YN1 A;  4ZBD A;  4V1A p;  4X43 A;  2VD0 A;  2B1L A;  2V1M A;  2OE1 A;  1Y6E A;  4O5R A;  2CZ2 A;  1Z6M A;  2AJQ B;  4PQI A;  2WCI A;  1GWC A;  1M7T A;  1F2E A;  4L5L A;  1N8J A;  1GP1 A;  1DSB A;  3KJY A;  5CRD A;  1XW9 A;  4GQF A;  5FT3 A;  4O7H A;  1PSQ A;  4YAP A;  4O32 A;  2N5F A;  1A2M A;  4XIH A;  4IVF A;  1ZOF A;  3EU4 A;  5AIV A;  1PL2 A;  3E3E A;  4DVC A;  4K9Z A;  4G19 A;  4GCI A;  4MZW A;  4OCE A;  2EIO A;  2C80 A;  2R37 A;  3GYK A;  3RHB A;  4V1A g;  1U3A A;  1TU8 A;  3HJM A;  4N0V A;  3TRP A;  1SL2 B;  2DSA A;  1GLQ A;  3CYN A;  3WGX A;  3ZTL A;  20GS A;  1R26 A;  2HRN A;  1SYR A;  1NHO A;  2H6Z A;  1AQW A;  1V2A A;  2ON5 A;  4GWR A;  2OKA A;  3TUE A;  4NAX A;  2VCX A;  4JU5 A;  2DJ2 A;  2LNS A;  4G9H A;  2DC5 A;  4J56 E;  3F0I A;  3ZRE A;  1EEJ A;  4ZL9 A;  3D22 A;  2PBJ A;  1KTE A;  2QGV A;  4IS0 A;  2YWO A;  3ZLP A;  4E8H A;  5ECK B;  3O3T A;  2R5G A;  4EKZ A;  2PPT A;  3CRT A;  3CXG A;  5IMZ A;  2PGT A;  1DE2 A;  1O8W A;  1YZX A;  1A0F A;  1BX9 A;  1HQO A;  5DJL A;  1ZYQ B;  4TXO B;  1EV9 A;  4NWY A;  3J7Y k;  3ZZX A;  3FRC A;  1S3C A;  2N5B A;  2KLX A;  4IKH A;  2MMO A;  2CAI A;  1TK0 B;  2QKE A;  2HT9 A;  2WZ9 A;  1JZW A;  4DSR A;  3ERG A;  2QSI A;  3JCM L;  2GQL A;  1H4O A;  4ZL7 A;  1XVQ A;  3DD3 A;  3FW2 A;  3HZ8 A;  3N9J A;  2H0I A;  1GSF A;  3IE3 A;  3VFI A;  2X8G A;  1USB A;  3L9V A;  3VI5 A;  3GIX A;  2RLI A;  3RPN A;  1WMJ A;  4YQU A;  4KA0 A;  3EIN A;  4EO3 A;  1NM3 A;  1MD4 A;  3NZN A;  4PXO A;  4XS4 B;  3DYR A;  5HQP A;  3QFA C;  5JCG A;  2H1G A;  3P8W A;  3FZ4 A;  3BD2 A;  4O92 A;  3D0Z A;  1K0O A;  4PUR A;  3LXZ A;  3A3T A;  9GSS A;  5ECL B;  2A4V A;  3CSI A;  1TI1 A;  3N5O A;  2VCZ A;  2DIY A;  2C3Q A;  4YQM A;  3VLN A;  2OJL A;  1UC7 A;  1SD9 A;  4MJC A;  2YJH A;  3TGZ A;  4HOJ A;  4ML6 A;  2CV4 A;  4CHS A;  1FW1 A;  3S9F A;  4AJ7 A;  3GUR A;  4PNG A;  3FR6 A;  3EWL A;  1J08 A;  3KTL A;  4KH7 A;  2L5O A;  1K3Y A;  2GZY A;  1GUL A;  5ECH B;  2B6M A;  5D9T A;  3FYG A;  3APQ A;  3V1W A;  3KMN A;  1OE8 A;  6GSS A;  2IJY A;  4IN0 A;  1SK2 A;  2EIR A;  3TCO A;  1ST9 A;  4MZC A;  1E2Y A;  2JAD A;  1AQX A;  3GV1 A;  2IIY A;  1A8Y A;  4IEL A;  3KGK A;  2FGX A;  5G5E A;  4PQH A;  4XS4 A;  1O8X A;  2J23 A;  1G6W A;  5CAX A;  5CNW A;  1YEP A;  1E6B A;  3IBH A;  2PVQ A;  3QOU A;  5G1K A;  2KP1 A;  2REM A;  1OC9 A;  3VWU A;  4JE1 A;  1Q4J A;  5G2Z A;  3PGT A;  6GSV A;  5IMD A;  4JBB A;  4JED A;  5KN3 A;  3FK8 A;  2FWG A;  4MPG A;  2DIZ A;  5C00 A;  3F9U A;  2MMA A;  3EUR A;  1JLV A;  1ZGN A;  4F82 A;  5KEJ A;  4ZL8 A;  1XBS A;  2IFQ B;  1MDK A;  1VF2 A;  1TK5 B;  2C8U A;  2P5Q A;  3GL5 A;  1XCC A;  1TKD B;  1DE1 A;  1EV4 A;  1F3A A;  2FLS A;  3MSZ A;  1S3A A;  3QR6 A;  4K6X A;  1M9A A;  5J5N A;  1SD8 A;  4XTS A;  5ECM B;  1XOA A;  1EOG A;  2K8S A;  2HLS A;  2CX3 A;  2GSS A;  5D9W A;  4KDY A;  2YP6 A;  2EIQ A;  1GH2 A;  4GF0 A;  2GTU A;  4K2D A;  3DIE A;  2YAN A;  3W8J A;  5H5R A;  3SBC A;  5GST A;  4GSS A;  1EP8 A;  4IBP A;  1JZO A;  1PA3 A;  3W8S A;  2H8L A;  2NPB A;  2KUC A;  4JZQ A;  2LRT A;  3KXO A;  3A2W A;  3GRX A;  5G5F A;  2IFQ A;  3OR5 A;  4RUV A;  2EC4 A;  3GH6 A;  2CT6 A;  3ZVJ A;  1YQ1 A;  2IL3 A;  1O85 A;  4TRX A;  1FG4 A;  1PD2 1;  1V98 A;  3FR9 A;  1TXX A;  2ES7 A;  2A2R A;  1KNG A;  4KE3 A;  1NHY A;  1WP0 A;  3KTB A;  2HRF A;  1XWG A;  3M8N A;  11GS A;  1GSQ A;  2GVP A;  6GSY A;  4HJ2 A;  4NHW A;  2X99 A;  2OE0 A;  5A4V A;  5IMA A;  3PH9 A;  2AV4 A;  3HVS A;  2O87 A;  1Z9H A;  3ZYW A;  3APO A;  5CRE A;  4MK3 A;  4IHU A;  2NVL A;  3TJG A;  5DDL A;  3H79 A;  5INY A;  1V40 A;  4HQS A;  3DVX A;  3ZIJ A;  1XOB A;  3TKQ A;  2GLR A;  1XWK A;  3IXR A;  5A4W A;  2VAF A;  4TR1 A;  2ZUP A;  2VL2 C;  3P2A A;  2H73 A;  4HDE A;  4ISD A;  1OC3 A;  5GSS A;  3CSH A;  3EC3 A;  1YEX A;  2YV9 A;  2XPE A;  1WPI A;  3GSS A;  2JZT A;  1WJK A;  5HR1 A;  1G7E A;  3BBY A;  4POB A;  4K1F A;  3LOR A;  4KX4 A;  6GST A;  1IYI A;  3IC4 A;  5DAL A;  4KCE A;  3QAV A;  3HZ4 A;  14GS A;  1GSE A;  3L9U A;  4PGT A;  5CRH A;  3KH7 A;  2ZCT A;  2LNT A;  2KOK A;  4DSS B;  2MMZ A;  3QAG A;  3HXS A;  1SKW B;  4WBR D;  2H6X A;  4XRD A;  3TKS C;  2E2M A;  2K9F A;  4IW9 A;  3FKF A;  1T1V A;  4LMW A;  3I9V 2;  1TTZ A;  3UVH A;  2VD1 A;  4F0B A;  3GA4 A;  4ECI A;  3FZ9 A;  3US3 A;  5FWG A;  2H0G A;  1YDK A;  2IN3 A;  4OCF A;  1XZO A;  2RM5 A;  3ZFL A;  1GL8 A;  2VL9 A;  4N30 A;  2H70 A;  4MZB A;  1FAA A;  5G1L A;  4EDZ A;  1FO5 A;  4I6X A;  3F3Q A;  1ACV A;  5EPF A;  4IJI A;  4BWQ A;  3HA9 A;  4MCU A;  2C3T A;  1U6T A;  2HZE B;  3M9J A;  1HYU A;  3TOT A;  3C8E A;  2VM2 A;  2H74 A;  1DBY A;  2VLV A;  4ECB A;  1ERV A;  4ECC A;  2CVB A;  5D9X A;  5GAP D;  1QUW A;  4FH8 A;  4OFN A;  3EMP A;  1RK4 A;  4DSS A;  1OE7 A;  2GT5 A;  2YZU A;  3BCK A;  4KUN A;  4E8E A;  1Y25 A;  5B7C A;  1PN9 A;  4TVE A;  1MD3 A;  1U3I A;  2H66 A;  1A23 A;  2DJK A;  1TRV A;  2GZP A;  4KSM A;  5AIX A;  3Q74 A;  2L4C A;  3VUR A;  3ZFB A;  3UEM A;  4MLY A;  1TI3 A;  3O6T A;  4BWS A;  1PKZ A;  2CVK A;  1JZD A;  4LL1 B;  4I2U A;  2AUV A;  3I69 A;  1GNE A;  1I5G A;  1K0C A;  5JWR B;  4KGI A;  4N11 A;  4MF7 A;  4MJE A;  3WD6 A;  4F03 A;  4TN8 A;  3WGD A;  4XS1 A;  3DXB A;  4K7I A;  2H1A A;  3CTG A;  2WS2 A;  1TJD A;  4ZB8 A;  1XPV A;  1B8X A;  5ENU A;  4OMV A;  1ZZY A;  2HZE A;  1QK8 A;  4ZB9 A;  1FVK A;  1WWJ A;  5AN1 A;  3IAS 2;  1FVJ A;  4Q5N A;  3LWA A;  3IK7 A;  3BCI A;  3IHQ A;  4AJ6 A;  1SU9 A;  4CW9 A;  3M1G A;  1PQN A;  2WJU A;  5DAK A;  1B4P A;  4KCA A;  4Z7X A;  1K3O A;  3KP9 A;  8GSS A;  5HFK A;  1SYX A;  5ID2 A;  5ECS A;  3P7X A;  3DWV A;  4AGS A;  1BAY A;  4L8E A;  2DML A;  2O85 A;  3F8U A;  1X5E A;  2C0D A;  4PX1 A;  1U87 A;  3GKX A;  5AIS A;  1A24 A;  1BJX A;  4LL4 B;  2VL3 A;  2L59 A;  2RII A;  5IPG A;  4EXJ A;  5KN2 A;  3KIJ A;  4ZB6 A;  3G7J A;  2L57 A;  1F37 A;  4I97 A;  17GS A;  1EGR A;  4F2I A;  2I9H A;  1GSD A;  22GS A;  4ZBB A;  4OFM A;  3WT2 A;  2GQM A;  2JSZ A;  1PX6 A;  4ULX A;  3E0U A;  4QQ7 A;  4POK A;  3CTF A;  3KP8 A;  1OC9 B;  4WR5 A;  2LQQ A;  1T4Y A;  3LQ7 A;  2PU9 C;  4F9Z A;  1QXH A;  2OBK A;  3EVI A;  1MDJ A;  4EDY A;  2D2Z A;  5LD0 A;  2GDR A;  5FHI A;  3L0H A;  2YPM A;  1ILO A;  2P0G A;  1YKA A;  2HZF A;  5ECQ B;  4XS6 A;  1GNW A;  3ERF A;  2C1Y A;  1PGT A;  3LFL A;  4PQ1 A;  2HI7 A;  4I5Q A;  4AF2 A;  5D96 A;  3GHA A;  2RUF A;  2FA8 A;  1SL1 B;  1M2B A;  2A2S A;  1TW9 A;  2CAQ A;  3L9S A;  1FB0 A;  2N5A A;  3R2Q A;  19GS A;  2H30 A;  5CRW A;  1Z6N A;  2J9H A;  2GSQ A;  2I1U A;  1K0D A;  3KD0 A;  5F05 A;  4LMV A;  2YWM A;  3HVX A;  1MTC A;  1WOU A;  5DBQ A;  4X1U A;  2NDO A;  1X5C A;  5IMV A;  2BMX A;  3HJO A;  4NPB A;  2FNO A;  2PMT A;  4MJA A;  4MMM A;  2XC2 A;  2LST A;  3M9K A;  5E4W A;  3EYT A;  4PUA A;  1RQM A;  3E9J B;  2YWN A;  2G0F A;  2B5E A;  1G7O A;  1PMT A;  4OO5 A;  1SL0 B;  3QFB C;  5G30 A;  5D8I A;  1CQG A;  4ZBA A;  2PUK C;  1NSW A;  3P90 A;  3HYP A;  4ZIJ A;  3HDC A;  4EF0 A;  3M0F A;  3NIV A;  3G9B A;  4EUY A;  1VGL A;  4N10 A;  1Z7P A;  5JWO B;  4FYB A;  4MH2 A;  1XWB A;  2V6O A;  2C0E A;  4DSQ A;  5JWQ B;  2MZC A;  2I3Y A;  3ZL5 A;  4EE0 A;  2JU5 A;  4L5O A;  5B6M A;  3VI7 A;  5H5S A;  2H0H A;  1MDI A;  2HYX A;  2XPD A;  4EVM A;  4HI7 A;  2KHP A;  5IM9 A;  3DML A;  4XHM A;  3IV4 A;  4MAB A;  2P5R A;  4G10 A;  2I4A A;  3GFK A;  1EGO A;  4IQA A;  3C1S A;  3L78 A;  2AB6 A;  4Q5F A;  1PX7 A;  3HY2 A;  2YZH A;  5KN0 A;  4D73 A;  1BQ7 A;  5J3R A;  1FB6 A;  5B8B A;  2C3N A;  3DGQ A;  1MEK A;  5F06 A;  5IIZ A;  2DJ0 A;  1AC1 A;  2B1K A;  2X8C A;  1RW1 A;  5DQS A;  3GMF A;  3UVT A;  1OKT A;  2LJA A;  4P3Y B;  3TRX A;  3TKS E;  3UAR A;  4K7O A;  4TR1 B;  4GXZ A;  2CQ9 A;  1ABA A;  1GSU A;  3CSJ A;  3F6D A;  3TB2 A;  3RDW A;  2YOI A;  5ECP B;  3ZIT A;  5E59 A;  1VRS D;  1KEB A;  1K0A A;  2WUL A;  1XIY A;  1J9B A;  2HE3 A;  2VL2 A;  1O6J A;  2WB9 A;  3UIW A;  1BG5 A;  2YWI A;  2V41 A;  1JZR A;  1A8L A;  1K0B A;  4POL A;  5DCH A;  1QQ2 A;  5DAL B;  1T7P B;  1SKS B;  2F51 A;  4IQ1 A;  5IQY A;  4J2F A;  2NTO A;  1B48 A;  3DVW A;  1LBK A;  3D4T A;  4MJB A;  3TJK A;  1OC8 A;  2AYT A;  1SKR B;  2R3X A;  3A2V A;  4FYC A;  1V9W A;  4GRF A;  3HVV A;  2H19 A;  1UVZ A;  2VCV A;  1OKD A;  2QC7 A;  4K0G A;  3IRA A;  3D5J A;  1HNC A;  1VF4 A;  3CRU A;  3F6F A;  2FD3 A;  2GS3 A;  2PVO C;  3UBK A;  1TP9 A;  5CYY A;  3GN3 A;  3IR4 A;  4BA7 A;  3NOF A;  2DMM A;  2IMK A;  4Q5Q A;  2ZNM A;  1YF0 A;  2F3M A;  2F8F A;  2OE3 A;  2YCD A;  3IOS A;  1X9W B;  2ALB A;  1EP7 A;  5F0G A;  5EVO A;  3QCP A;  1ERW A;  3MWH A;  1GRX A;  2GQK A;  4HZ2 A;  2L4Q A;  3GKN A;  3UAP A;  4FIW A;  3ERW A;  4HU9 A;  3FR3 A;  3APS A;  3ISO A;  1GSY A;  2XHF A;  2GZZ A;  1GTB A;  2R6K A;  2M80 A;  3TJJ A;  4JRR A;  1UA5 A;  3EU3 A;  3LYP A;  3F63 A;  4KAE A;  1EOH A;  4V2M A;  3VK9 A;  3C73 A;  2FWH A;  3FEU A;  2OAD A;  1GUK A;  1PRX A;  1QGV A;  1BED A;  5ECO B;  1M0U A;  2DJ3 A;  5CO3 A;  5CRG A;  2GST A;  3GL3 A;  2H76 A;  1AIU A;  3A5W A;  4TOP A;  2CA8 A;  3L4N A;  1F9M A;  2MYG A;  1TU7 A;  3ZIV A;  2JZR A;  2R2J A;  3UMA A;  2L6C A;  3H1N A;  2DBC A;  2XBI A;  2BJX A;  3IDV A;  3M3M A;  3U6V A;  3H93 A;  1Z3E A;  1DUG A;  1A2L A;  4KSO A;  3LYK A;  4MDC A;  6GSW A;  1OAZ A;  2IME A;  4GSN A;  4LA1 A;  4WET A;  2IMI A;  4OWY A;  2TRC P;  3EE2 A;  4L0U A;  3WT1 A;  1XWC A;  4PNF A;  4LLR A;  4ILF A;  3DKS A;  2F9S A;  2GSR A;  4ECJ A;  2HXK A;  4NXI A;  2Z9S A;  2K8V A;  5HR3 A;  3HCZ A;  1ZMA A;  5DAK B;  6GSU A;  5GZZ B;  3ME8 A;  2FA4 A;  3GKK A;  4WEY A;  2C4J A;  4IJ3 A;  3DRN A;  4J57 E;  2MMN A;  4OO4 A;  2CVD A;  2HSY A;  4MF6 A;  1H75 A;  3TKR A;  5GAN D;  5ID2 B;  1EWX A;  4X0X A;  2YV7 A;  4IGJ A;  3Q6O A;  3FZ5 A;  3KCM A;  3GTU A;  1M99 A;  3GUS A;  5DJM A;  1M9B A;  3GKM A;  4MA9 A;  5LCZ A;  4KB3 A;  4TW5 A;  2C0F A;  1J0F A;  1LJR A;  2TRX A;  4RQX A;  2VOC A;  4YH2 A;  5IMF A;  4HS1 A;  3Q19 A;  1V58 A;  2LUS A;  1ZCP A;  4L0W A;  4OFT A;  2LRN A;  4YQV A;  1BYE A;  1K0N A;  2F8A A;  5L71 A;  2H75 A;  1OYJ A;  3TJB A;  4HZ4 A;  1GLP A;  3D6I A;  3G7Y A;  2X64 A;  5A5K A;  5HFG A;  3DEX A;  3VPQ A;  2R4V A;  5IOX A;  3VWW A;  1K0M A;  4WBJ A;  5D73 A;  5F8B A;  4XRA A;  3RHC A;  3QAW A;  4HEA 2;  3VWX A;  4KND A;  3ZRD A;  3HKR A;  3GX0 A;  5JCW A;  1T4Z A;  1G0T A;  1XWA A;  5ELG A;  4NHZ A;  2LTK A;  1TRU A;  3PR8 A;  4EL1 A;  3D21 A;  3WYW A;  1YJ6 A;  1NW2 A;  4H86 A;  2FY6 A;  3ZML A;  2X8H A;  1HNB A;  1WRY A;  2OA7 A;  3QDN A;  1AUC A;  5COH A;  1QFN A;  3D4M A;  2VCT A;  7GSS A;  3LEF A;  2V2G A;  2L6D A;  3TDG A;  5AGY A;  4BL7 A;  1THX A;  1TOF A;  5ECR B;  4ACS A;  1VF3 A;  3UJ1 A;  13GS A;  4DEJ A;  1CQH A;  2HFD A;  4PUF C;  2WGR A;  2IMF A;  1R4W A;  2LV3 A;  3GST A;  2IMD A;  2O8V B;  1A0R P;  3KH9 A;  2RM6 A;  3KMO A;  4ID0 A;  3ZMK A;  16GS A;  3I6A A;  4MH3 A;  1GTU A;  3BJ5 A;  2YJ7 A;  3G7I A;  1W4V A;  3IA1 A;  3QMX A;  2VLT A;  4OD7 A;  4WKW A;  2JSY A;  5ECI B;  4G2E A;  5DVB A;  2B3S A;  4NV2 A;  2P31 A;  5ABR A;  2DJJ A;  5B8A A;  4ZIL A;  3LJR A;  1EZK A;  1M2A A;  1R7H A;  4TXO A;  2JAC A;  1O81 A;  1A2J A;  2B7K A;  4HUA A;  1YF1 A;  5B6N A;  1T3B A;  1GUH A;  1OVN A;  4MPF A;  4K0N A;  3TRQ A;  2WDU A;  4Q5R A;  2CZ3 A;  3RBT A;  2M46 A;  3VWV A;  4FO5 A;  1AAZ A;  2LRC A;  2E7P A;  4ML1 A;  3UOM A;  2C0G A;  1AQV A;  3I43 A;  5HR2 A;  2HSH A;  2MBT A;  5IO2 A;  3ME7 A;  2LKU A;  4V2L A;  1EEM A;  1XW5 A;  4K8M A;  3UL3 A;  2PWJ A;  1TRW A;  2VCW A;  1Z5Y E;  3RAZ A;  4CDO A;  1W89 A;  4D73 B;  4HQZ A;  1SJI A;  1QMV A;  1U88 A;  1O73 A;  3U5R E;  4TXV A;  3Q18 A;  3TJF A;  3WGE A;  2VIM A;  2JL4 A;  2LS5 A;  4V2N A;  1PL1 A;  3BOA A;  3MNG A;  1XFL A;  4TKY A;  1IYH A;  2FCH A;  1R5A A;  2K18 A;  4BPY A;  2LQO A;  5EY6 A;  2VM1 A;  1AXD A;  3HJP A;  1JFU A;  4K7N A;  1B4Q A;  1URM A;  2E0Q A;  2H01 A;  2GGT A;  4TR0 A;  4EC0 A;  1T00 A;  5JCU A;  3O76 A;  2H72 A;  2LJK A;  4IP6 A;  4RI6 A;  1HD2 A;  1M2D A;  4RI7 A;  2IWT A;  3W6G A;  4KW6 A;  1XW6 A;  1ERT A;  4IP1 A;  5H5Q A;  1HNA A;  2DJ1 A;  5KN1 A;  2LJR A;  3KM6 A;  4HU7 A;  2OAC A;  3TOU A;  1K3L A;  3IPZ A;  2ON7 A;  2BTO T;  2AAW A;  5ELA A;  5HR0 A;  1LU4 A;  2RUE A;  2HNL A;  4XCS A;  1TK8 B;  3F4T A;  4AJ8 A;  2LEG A;  2G2Q A;  1X5D A;  2VLU A;  2E2G A;  1ZYE A;  4WR4 A;  1SJ6 A;  5CP1 A;  2AHE A;  2MBS A;  3FZA A;  2H1D A;  2PN8 A;  3HD5 A;  4GST A;  2V32 A;  1F3B A;  1R5P A;  1ON4 A;  1JHB A;  3HHV A;  3EMX A;  1JLW A;  2FHE A;  3MAK A;  3A2X A;  3VPT A;  5J9C A;  1XVW A;  3KEB A;  3GH9 A;  1AW9 A;  4GLT A;  4TR3 A;  1F6M C;  5IPH A;  3FY7 A;  4GTU A;  2K6V A;  1X9S B;  3J7Y b;  3LSZ A;  2I81 A;  3FHK A;  1GTI A;  4YAV A;  4WF5 A;  3C71 A;  2B5Y A;  2FWE A;  1B9X C;  2CX4 A;  2H71 A;  1X9M B;  5C04 A;  5F07 A;  4QL9 A;  5HFI A;  3LGC A;  2H6Y A;  2O89 A;  2OBI A;  5ECN B;  2NBS A;  2VUP A;  1SJZ A;  3K8N A;  1TDI A;  1FHE A;  2YNX A;  1FOV A;  2VCQ A;  3IK9 A;  4HJM A;  4JR6 A;  5IO0 A;  1C72 A;  5D93 A;  2VO4 A;  4GQC A;  5D9V A;  2V6K A;  4NV5 A;  4I8B A;  4TR4 A;  3QPM A;  1B9Y C;  1T8E B;  1O7U A;  10GS A;  5EL8 A;  4I2T A;  4KDU A;  3MDK A;  2WRT A;  4MF5 A;  5IMC A;  2M72 A;  1X0R A;  3TKS A;  5DCG A;  3ZVJ D;  5J4U A;  4WXT A;  1G6Y A;  2L5L A;  3C1R A;  2B5X A;  5DQY A;  3F3R A;  4POM A;  1YY7 A;  1S3D A;  2H1B A;  3F4R A;  1THO A;  1N2A A;  4BVY A;  3AY8 A;  1ERU A;  2DLX A;  4N0Z A;  1SEN A;  4NMU A;  1V57 A;  4BVX A;  1SK0 A;  5J9B A;  5G31 A;  18GS A;  1I9D A;  1ZL9 A;  1XXU A;  1PKW A;  3GX8 A;  3UBL A;  4JR4 A;  5LNK e;  1WIK A;  1YKC A;  1KBN A;  2JZS A;  2KP2 A;  1Q98 A;  2O7K A;  2TIR A;  1GSS A;  2XBQ A;  5IOW A;  1GUM A;  2PER A;  4RQR A;  3QD9 A;  3IAM 2;  1GTA A;  1UN2 A;  5A4U A;  3F4S A;  1TRS A;  3GTU B;  2FUG 2;  2GT6 A;  3C7M A;  3H4K A;  1ML6 A;  1WE0 A;  5J41 A;  4KDX A;  2B7J A;  3RPP A;  3ED3 A;  1VF1 A; 
#chains in the Genus database with same CATH topology
 3KZQ A;  3LG6 A;  3SWL A;  4ZXG A;  4FYU A;  3TKP A;  2IPA A;  12GS A;  1Z7R A;  4MP4 A;  4QL7 A;  4WF4 A;  1SK1 A;  3LXT A;  3GNJ A;  4X4J A;  6GSX A;  4F0C A;  2FWF A;  3CMI A;  3H8Q A;  3PIN A;  2WFC A;  3CBU A;  2YN1 A;  4ZBD A;  4V1A p;  4X43 A;  2VD0 A;  2B1L A;  2V1M A;  2OE1 A;  1Y6E A;  4O5R A;  2CZ2 A;  1Z6M A;  2AJQ B;  4PQI A;  2WCI A;  1GWC A;  1M7T A;  3LW9 A;  1F2E A;  4L5L A;  1N8J A;  1GP1 A;  1DSB A;  3KJY A;  5CRD A;  1XW9 A;  4GQF A;  5FT3 A;  4O7H A;  1PSQ A;  4YAP A;  4O32 A;  2N5F A;  1A2M A;  4XIH A;  4IVF A;  1ZOF A;  2QA1 A;  3EU4 A;  5AIV A;  1PL2 A;  3E3E A;  4DVC A;  4K9Z A;  4G19 A;  4GCI A;  4MZW A;  4OCE A;  2EIO A;  2C80 A;  2R37 A;  3GYK A;  3RHB A;  4V1A g;  1U3A A;  1TU8 A;  4K5R A;  3HJM A;  4N0V A;  3TRP A;  1SL2 B;  2DSA A;  1GLQ A;  3CYN A;  3WGX A;  3ZTL A;  20GS A;  1R26 A;  2HRN A;  1SYR A;  1NHO A;  2H6Z A;  1AQW A;  1V2A A;  2ON5 A;  4GWR A;  2OKA A;  3TUE A;  4NAX A;  2VCX A;  4JU5 A;  2DJ2 A;  2LNS A;  4G9H A;  2DC5 A;  4J56 E;  3F0I A;  3ZRE A;  1EEJ A;  2R0C A;  4ZL9 A;  3D22 A;  2PBJ A;  1KTE A;  2QGV A;  4IS0 A;  2YWO A;  3ZLP A;  4E8H A;  5ECK B;  3O3T A;  2R5G A;  4EKZ A;  2PPT A;  3CRT A;  3CXG A;  5IMZ A;  4O5U A;  2PGT A;  1DE2 A;  1O8W A;  1YZX A;  1A0F A;  1BX9 A;  1HQO A;  5DJL A;  1ZYQ B;  4TXO B;  1EV9 A;  4NWY A;  3J7Y k;  3ZZX A;  3FRC A;  1S3C A;  2N5B A;  2KLX A;  4IKH A;  2MMO A;  2CAI A;  1TK0 B;  2QKE A;  2HT9 A;  2WZ9 A;  1JZW A;  4DSR A;  3ERG A;  2QSI A;  3JCM L;  2GQL A;  1H4O A;  3HVN A;  4ZL7 A;  1XVQ A;  3DD3 A;  3FW2 A;  3HZ8 A;  3N9J A;  2H0I A;  1GSF A;  3IE3 A;  3VFI A;  2X8G A;  1USB A;  3L9V A;  3VI5 A;  3GIX A;  4O5Q A;  2RLI A;  3RPN A;  1WMJ A;  4YQU A;  4KA0 A;  3EIN A;  4EO3 A;  1NM3 A;  1MD4 A;  3NZN A;  4PXO A;  4XS4 B;  3DYR A;  5HQP A;  3QFA C;  5JCG A;  2H1G A;  3P8W A;  3FZ4 A;  3BD2 A;  4O92 A;  3D0Z A;  1K0O A;  4PUR A;  3LXZ A;  3A3T A;  9GSS A;  5ECL B;  2A4V A;  3CSI A;  1TI1 A;  3N5O A;  2VCZ A;  2DIY A;  2C3Q A;  4YQM A;  3VLN A;  2OJL A;  1UC7 A;  1SD9 A;  4MJC A;  2YJH A;  3TGZ A;  4HOJ A;  4ML6 A;  2CV4 A;  4CHS A;  1FW1 A;  3S9F A;  4AJ7 A;  3GUR A;  4PNG A;  3FR6 A;  3EWL A;  1J08 A;  3KTL A;  4KH7 A;  2L5O A;  1K3Y A;  2GZY A;  1GUL A;  5ECH B;  2B6M A;  5D9T A;  3FYG A;  3APQ A;  3V1W A;  3KMN A;  1OE8 A;  6GSS A;  2IJY A;  4IN0 A;  4ICY A;  1SK2 A;  2EIR A;  3TCO A;  1ST9 A;  4MZC A;  1E2Y A;  2JAD A;  1AQX A;  3GV1 A;  2IIY A;  1A8Y A;  4IEL A;  3KGK A;  2FGX A;  5G5E A;  4PQH A;  4XS4 A;  1O8X A;  2J23 A;  1G6W A;  5CAX A;  5CNW A;  1E6B A;  1YEP A;  3IBH A;  2PVQ A;  3QOU A;  5G1K A;  2KP1 A;  2REM A;  1OC9 A;  3VWU A;  4JE1 A;  1Q4J A;  5G2Z A;  3PGT A;  6GSV A;  5IMD A;  4JBB A;  4JED A;  5KN3 A;  3FK8 A;  2FWG A;  4Z2U A;  4MPG A;  2DIZ A;  5C00 A;  3F9U A;  2MMA A;  3EUR A;  1JLV A;  1ZGN A;  4F82 A;  5KEJ A;  4ZL8 A;  1XBS A;  2IFQ B;  1MDK A;  1VF2 A;  1TK5 B;  2C8U A;  2P5Q A;  3GL5 A;  3CQF A;  1XCC A;  1TKD B;  1DE1 A;  1EV4 A;  1F3A A;  2FLS A;  3MSZ A;  1S3A A;  3QR6 A;  4K6X A;  1M9A A;  5J5N A;  1SD8 A;  4XTS A;  5ECM B;  1XOA A;  1EOG A;  2K8S A;  2HLS A;  2CX3 A;  2GSS A;  5D9W A;  4KDY A;  2YP6 A;  2EIQ A;  1GH2 A;  4GF0 A;  2GTU A;  4K2D A;  3DIE A;  2YAN A;  3W8J A;  5H5R A;  3SBC A;  5GST A;  4GSS A;  1EP8 A;  4IBP A;  4Z2T A;  1JZO A;  1PA3 A;  3W8S A;  2H8L A;  2NPB A;  4BVY B;  2KUC A;  4JZQ A;  2LRT A;  3KXO A;  3A2W A;  3GRX A;  5G5F A;  2IFQ A;  3OR5 A;  4RUV A;  4BVX B;  2EC4 A;  3GH6 A;  2CT6 A;  3ZVJ A;  1YQ1 A;  1FOH A;  2IL3 A;  1O85 A;  4TRX A;  1FG4 A;  1PD2 1;  1V98 A;  3FR9 A;  1TXX A;  2ES7 A;  2A2R A;  1KNG A;  4KE3 A;  1NHY A;  2HRA A;  1WP0 A;  3KTB A;  2HRF A;  1XWG A;  3M8N A;  11GS A;  1GSQ A;  2GVP A;  6GSY A;  4HJ2 A;  4NHW A;  2X99 A;  2OE0 A;  5A4V A;  5IMA A;  3PH9 A;  2AV4 A;  3HVS A;  2O87 A;  1Z9H A;  3ZYW A;  3APO A;  5CRE A;  4MK3 A;  4IHU A;  2NVL A;  3TJG A;  4G0I A;  5DDL A;  3H79 A;  5INY A;  1V40 A;  4HQS A;  3DVX A;  3ZIJ A;  1XOB A;  3TKQ A;  2GLR A;  1XWK A;  3IXR A;  5A4W A;  2VAF A;  2R0P A;  4TR1 A;  2ZUP A;  2VL2 C;  3P2A A;  2H73 A;  4HDE A;  4ISD A;  1OC3 A;  5GSS A;  3CSH A;  3EC3 A;  1YEX A;  5KOX A;  2YV9 A;  2XPE A;  2DKH A;  1WPI A;  3GSS A;  2JZT A;  1WJK A;  5HR1 A;  1G7E A;  3BBY A;  4POB A;  2A2P A;  4K1F A;  3LOR A;  4KX4 A;  6GST A;  1IYI A;  3IC4 A;  5DAL A;  4KCE A;  3QAV A;  3HZ4 A;  14GS A;  1GSE A;  3L9U A;  4PGT A;  5CRH A;  3KH7 A;  2ZCT A;  2LNT A;  2KOK A;  4DSS B;  2MMZ A;  3QAG A;  3HXS A;  1SKW B;  4WBR D;  2H6X A;  4XRD A;  3TKS C;  2E2M A;  2K9F A;  4IW9 A;  3FKF A;  1T1V A;  4LMW A;  3I9V 2;  1TTZ A;  3UVH A;  2VD1 A;  4F0B A;  3GA4 A;  4ECI A;  3FZ9 A;  3MYD A;  3US3 A;  5FWG A;  2H0G A;  1YDK A;  2IN3 A;  4OCF A;  1XZO A;  2RM5 A;  3ZFL A;  1GL8 A;  2VL9 A;  4N30 A;  2H70 A;  4MZB A;  1FAA A;  5G1L A;  4EDZ A;  1FO5 A;  4I6X A;  3F3Q A;  1ACV A;  4CY8 A;  5EPF A;  4IJI A;  4BWQ A;  3HA9 A;  4MCU A;  2C3T A;  1U6T A;  2HZE B;  3M9J A;  1HYU A;  3TOT A;  3C8E A;  2VM2 A;  2X49 A;  2H74 A;  1DBY A;  2VLV A;  1ZYN A;  4ECB A;  1ERV A;  4ECC A;  2CVB A;  5D9X A;  5GAP D;  1QUW A;  4FH8 A;  4OFN A;  3EMP A;  1RK4 A;  4DSS A;  1OE7 A;  2GT5 A;  2YZU A;  3BCK A;  4KUN A;  4E8E A;  1Y25 A;  5B7C A;  1PN9 A;  4TVE A;  1MD3 A;  1U3I A;  2H66 A;  1A23 A;  2DJK A;  1TRV A;  2GZP A;  4KSM A;  5AIX A;  3Q74 A;  2L4C A;  3VUR A;  3ZFB A;  3UEM A;  4MLY A;  1TI3 A;  3O6T A;  4BWS A;  1PKZ A;  2CVK A;  1JZD A;  4LL1 B;  4I2U A;  2AUV A;  3I69 A;  1GNE A;  1I5G A;  1K0C A;  5JWR B;  4KGI A;  4N11 A;  4MF7 A;  4MJE A;  3WD6 A;  4F03 A;  3A5I A;  4TN8 A;  3WGD A;  4XS1 A;  3DXB A;  4K7I A;  2H1A A;  3CTG A;  1PFO A;  2WS2 A;  1TJD A;  4ZB8 A;  1XPV A;  1B8X A;  5ENU A;  4OMV A;  1ZZY A;  2HZE A;  1QK8 A;  4ZB9 A;  1FVK A;  1WWJ A;  5AN1 A;  3IAS 2;  1FVJ A;  4Q5N A;  3LWA A;  3IK7 A;  3BCI A;  4PTS A;  3IHQ A;  4AJ6 A;  1SU9 A;  4CW9 A;  3M1G A;  1PQN A;  2WJU A;  5DAK A;  1B4P A;  4KCA A;  4Z7X A;  1K3O A;  3KP9 A;  8GSS A;  5HFK A;  1SYX A;  5ID2 A;  5ECS A;  3P7X A;  3DWV A;  4AGS A;  1BAY A;  4L8E A;  2DML A;  2O85 A;  3F8U A;  3FMW A;  1X5E A;  2C0D A;  3MIX A;  4PX1 A;  1U87 A;  3GKX A;  5AIS A;  1A24 A;  1BJX A;  4LL4 B;  2VL3 A;  2L59 A;  2RII A;  5IPG A;  4EXJ A;  5KN2 A;  3KIJ A;  4ZB6 A;  3G7J A;  2L57 A;  1F37 A;  5BMU A;  4I97 A;  17GS A;  1EGR A;  4F2I A;  2I9H A;  1GSD A;  22GS A;  4ZBB A;  4OFM A;  3WT2 A;  2GQM A;  2JSZ A;  1PX6 A;  4ULX A;  3E0U A;  4QQ7 A;  4POK A;  3CTF A;  3KP8 A;  1OC9 B;  4WR5 A;  2LQQ A;  1T4Y A;  3LQ7 A;  2PU9 C;  4F9Z A;  1QXH A;  2OBK A;  3EVI A;  1MDJ A;  4EDY A;  2D2Z A;  5LD0 A;  2GDR A;  5FHI A;  3L0H A;  2YPM A;  1M3I A;  1ILO A;  2P0G A;  1YKA A;  2HZF A;  5ECQ B;  4XS6 A;  1GNW A;  3ERF A;  2QA2 A;  2C1Y A;  1PGT A;  3LFL A;  4PQ1 A;  2HI7 A;  4HSC X;  4I5Q A;  4AF2 A;  5D96 A;  3GHA A;  2RUF A;  2FA8 A;  1SL1 B;  1M2B A;  2A2S A;  1TW9 A;  2CAQ A;  3L9S A;  1FB0 A;  2N5A A;  3R2Q A;  19GS A;  2H30 A;  5CRW A;  1Z6N A;  2J9H A;  2GSQ A;  2I1U A;  1K0D A;  3KD0 A;  5F05 A;  4LMV A;  2YWM A;  3HVX A;  1MTC A;  1WOU A;  5DBQ A;  4X1U A;  2NDO A;  1X5C A;  5IMV A;  2BMX A;  3HJO A;  4NPB A;  2FNO A;  2PMT A;  4MJA A;  4MMM A;  2XC2 A;  2LST A;  3M9K A;  5E4W A;  3EYT A;  4PUA A;  1RQM A;  3E9J B;  2YWN A;  2G0F A;  2B5E A;  1G7O A;  1PMT A;  4OO5 A;  1SL0 B;  3QFB C;  5G30 A;  5D8I A;  1CQG A;  4ZBA A;  2PUK C;  1NSW A;  3P90 A;  3HYP A;  4ZIJ A;  3HDC A;  4EF0 A;  3M0F A;  5BRT A;  3NIV A;  3G9B A;  4EUY A;  1VGL A;  4N10 A;  1Z7P A;  5JWO B;  4Z2R A;  4FYB A;  4MH2 A;  1XWB A;  2V6O A;  2C0E A;  4DSQ A;  5JWQ B;  2MZC A;  2I3Y A;  3ZL5 A;  4EE0 A;  2JU5 A;  4L5O A;  5B6M A;  3VI7 A;  5H5S A;  2H0H A;  1MDI A;  4KF9 A;  4BIK A;  2HYX A;  2XPD A;  4EVM A;  4HI7 A;  2KHP A;  5IM9 A;  3DML A;  4XHM A;  3IV4 A;  4MAB A;  2P5R A;  4G10 A;  2I4A A;  3PPU A;  3GFK A;  1EGO A;  4IQA A;  3C1S A;  3L78 A;  2AB6 A;  4Q5F A;  1S3R A;  1PX7 A;  3HY2 A;  2YZH A;  5KN0 A;  4D73 A;  1BQ7 A;  5J3R A;  1FB6 A;  5B8B A;  2C3N A;  3DGQ A;  1MEK A;  5F06 A;  5IIZ A;  2DJ0 A;  1AC1 A;  2B1K A;  2X8C A;  1RW1 A;  5DQS A;  3GMF A;  3UVT A;  1OKT A;  2LJA A;  4P3Y B;  3TRX A;  3TKS E;  3UAR A;  4K7O A;  4TR1 B;  4GXZ A;  2CQ9 A;  1ABA A;  1GSU A;  4EIP A;  3CSJ A;  3F6D A;  4G0L A;  3TB2 A;  3RDW A;  2YOI A;  5ECP B;  4CY6 A;  3ZIT A;  5E59 A;  1VRS D;  1KEB A;  1K0A A;  2WUL A;  1XIY A;  1J9B A;  2HE3 A;  2VL2 A;  1O6J A;  2WB9 A;  3UIW A;  1BG5 A;  2YWI A;  2V41 A;  1JZR A;  1A8L A;  1K0B A;  4POL A;  3R3E A;  5DCH A;  1QQ2 A;  5DAL B;  1T7P B;  1SKS B;  2F51 A;  4IQ1 A;  5IQY A;  4J2F A;  2NTO A;  1B48 A;  3DVW A;  1LBK A;  3D4T A;  3IHG A;  4MJB A;  3TJK A;  1OC8 A;  2AYT A;  1SKR B;  2R3X A;  3A2V A;  4FYC A;  1V9W A;  4GRF A;  3HVV A;  2H19 A;  1UVZ A;  2VCV A;  1OKD A;  2QC7 A;  4K0G A;  3IRA A;  3D5J A;  1HNC A;  1VF4 A;  3CRU A;  3F6F A;  2FD3 A;  2GS3 A;  2PVO C;  3UBK A;  1TP9 A;  5CYY A;  3GN3 A;  3IR4 A;  4BA7 A;  3NOF A;  2DMM A;  2IMK A;  4Q5Q A;  2ZNM A;  1YF0 A;  2F3M A;  2F8F A;  2OE3 A;  2YCD A;  3IOS A;  1X9W B;  2ALB A;  1EP7 A;  5F0G A;  5EVO A;  3QCP A;  1ERW A;  3MWH A;  1GRX A;  2GQK A;  3EPT A;  4HZ2 A;  2L4Q A;  3GKN A;  3UAP A;  4FIW A;  3ERW A;  4HU9 A;  3FR3 A;  3APS A;  3ISO A;  1GSY A;  2XHF A;  2GZZ A;  1GTB A;  2R0G A;  2R6K A;  2M80 A;  3TJJ A;  4JRR A;  1UA5 A;  3EU3 A;  3LYP A;  3F63 A;  4KAE A;  1EOH A;  4V2M A;  3VK9 A;  3C73 A;  2FWH A;  3FEU A;  2OAD A;  1GUK A;  1PRX A;  1QGV A;  1BED A;  5ECO B;  1M0U A;  2DJ3 A;  5CO3 A;  5CRG A;  2GST A;  3GL3 A;  2H76 A;  1AIU A;  3A5W A;  4TOP A;  2CA8 A;  3L4N A;  1F9M A;  2MYG A;  1TU7 A;  3ZIV A;  2JZR A;  2R2J A;  3UMA A;  2L6C A;  3H1N A;  2DBC A;  2XBI A;  2BJX A;  3IDV A;  3M3M A;  3U6V A;  3H93 A;  1Z3E A;  1DUG A;  1A2L A;  4KSO A;  3LYK A;  4MDC A;  4A5P A;  6GSW A;  1OAZ A;  2IME A;  4GSN A;  3IC8 A;  4LA1 A;  4WET A;  2IMI A;  4OWY A;  2TRC P;  3EE2 A;  4L0U A;  3WT1 A;  1XWC A;  4PNF A;  4LLR A;  4ILF A;  3DKS A;  2F9S A;  2GSR A;  4ECJ A;  2HXK A;  4NXI A;  2Z9S A;  2X4A A;  2K8V A;  4YKG A;  5HR3 A;  3HCZ A;  1ZMA A;  5DAK B;  2HSM A;  6GSU A;  5GZZ B;  3ME8 A;  2FA4 A;  3GKK A;  4WEY A;  2C4J A;  4IJ3 A;  3DRN A;  4J57 E;  2MMN A;  4OO4 A;  2CVD A;  2HSY A;  4MF6 A;  1H75 A;  3TKR A;  5GAN D;  5ID2 B;  1EWX A;  4X0X A;  5KOW A;  4FQU A;  2YV7 A;  4IGJ A;  3Q6O A;  3FZ5 A;  3KCM A;  3GTU A;  1M99 A;  3GUS A;  1ZYP A;  5DJM A;  1M9B A;  3GKM A;  4MA9 A;  5LCZ A;  2UZ8 A;  4KB3 A;  4TW5 A;  2C0F A;  1J0F A;  4BL7 B;  1LJR A;  2TRX A;  4RQX A;  2VOC A;  4YH2 A;  5IMF A;  4HS1 A;  3Q19 A;  1V58 A;  2LUS A;  1ZCP A;  4L0W A;  4OFT A;  2LRN A;  4YQV A;  1BYE A;  1K0N A;  2F8A A;  5L71 A;  2H75 A;  1OYJ A;  3TJB A;  1XG8 A;  4HZ4 A;  2DKI A;  1GLP A;  3D6I A;  2A4H A;  3G7Y A;  2X64 A;  5A5K A;  1PN0 A;  5HFG A;  3DEX A;  3VPQ A;  2R4V A;  5IOX A;  3VWW A;  1K0M A;  4WBJ A;  5D73 A;  5F8B A;  4XRA A;  3RHC A;  3QAW A;  4HEA 2;  3VWX A;  4KND A;  3ZRD A;  3HKR A;  3GX0 A;  5JCW A;  1T4Z A;  1G0T A;  1XWA A;  5ELG A;  4NHZ A;  2LTK A;  1TRU A;  3PR8 A;  4EL1 A;  3D21 A;  3WYW A;  1YJ6 A;  1NW2 A;  4H86 A;  2FY6 A;  3ZML A;  2X8H A;  1HNB A;  1WRY A;  2OA7 A;  3QDN A;  1AUC A;  5COH A;  1QFN A;  3D4M A;  2VCT A;  7GSS A;  3LEF A;  2V2G A;  2L6D A;  3TDG A;  5AGY A;  4BL7 A;  1THX A;  1TOF A;  5ECR B;  4ACS A;  1VF3 A;  3UJ1 A;  13GS A;  4DEJ A;  1CQH A;  2HFD A;  4PUF C;  4MNN A;  2WGR A;  2IMF A;  1R4W A;  2LV3 A;  3GST A;  2IMD A;  2O8V B;  1A0R P;  3KH9 A;  4K2X A;  2RM6 A;  3KMO A;  4ID0 A;  3ZMK A;  16GS A;  3I6A A;  4MH3 A;  1GTU A;  3BJ5 A;  2YJ7 A;  3G7I A;  1W4V A;  3IA1 A;  3QMX A;  2VLT A;  4OD7 A;  4WKW A;  2JSY A;  4YKF A;  5ECI B;  4G2E A;  5DVB A;  2B3S A;  4EIQ A;  4NV2 A;  2P31 A;  5ABR A;  2DJJ A;  5B8A A;  4ZIL A;  3LJR A;  1EZK A;  1M2A A;  1R7H A;  4TXO A;  2JAC A;  1O81 A;  1A2J A;  2B7K A;  4HUA A;  1YF1 A;  5B6N A;  1T3B A;  1GUH A;  1OVN A;  4MPF A;  4K0N A;  3TRQ A;  2WDU A;  4Q5R A;  2CZ3 A;  3RBT A;  2M46 A;  3VWV A;  4FO5 A;  1AAZ A;  2LRC A;  2E7P A;  4ML1 A;  3UOM A;  1M3J A;  2C0G A;  1AQV A;  3I43 A;  5HR2 A;  2HSH A;  2MBT A;  5IO2 A;  3ME7 A;  2LKU A;  4V2L A;  1EEM A;  1XW5 A;  4K8M A;  3UL3 A;  2PWJ A;  1TRW A;  2VCW A;  1Z5Y E;  3RAZ A;  4CDO A;  1W89 A;  4D73 B;  4HQZ A;  1SJI A;  1QMV A;  1U88 A;  1O73 A;  3U5R E;  4TXV A;  3Q18 A;  4K5S A;  3TJF A;  3WGE A;  2VIM A;  2JL4 A;  2LS5 A;  4V2N A;  1PL1 A;  3BOA A;  3MNG A;  1XFL A;  4TKY A;  1IYH A;  2FCH A;  1R5A A;  2K18 A;  4BPY A;  2LQO A;  5EY6 A;  2VM1 A;  1AXD A;  3HJP A;  1JFU A;  4K7N A;  1B4Q A;  1URM A;  2E0Q A;  2H01 A;  2GGT A;  4TR0 A;  4EC0 A;  1T00 A;  5JCU A;  3O76 A;  2H72 A;  2LJK A;  4RI6 A;  4IP6 A;  1HD2 A;  1M2D A;  4RI7 A;  2IWT A;  3W6G A;  4KW6 A;  1XW6 A;  1ERT A;  4IP1 A;  5H5Q A;  1HNA A;  2DJ1 A;  5KN1 A;  2LJR A;  3KM6 A;  4HU7 A;  2OAC A;  3TOU A;  1K3L A;  3IPZ A;  2ON7 A;  2BTO T;  2AAW A;  5ELA A;  5HR0 A;  1LU4 A;  2RUE A;  2HNL A;  4XCS A;  1TK8 B;  3F4T A;  4USS A;  4AJ8 A;  2LEG A;  2G2Q A;  1X5D A;  2VLU A;  2E2G A;  1ZYE A;  4WR4 A;  1SJ6 A;  5CP1 A;  2AHE A;  2MBS A;  3FZA A;  2H1D A;  2PN8 A;  3HD5 A;  4GST A;  2V32 A;  1F3B A;  1R5P A;  1ON4 A;  1JHB A;  3HHV A;  3EMX A;  1JLW A;  2FHE A;  3MAK A;  3A2X A;  3VPT A;  5J9C A;  1XVW A;  3KEB A;  3GH9 A;  1AW9 A;  4GLT A;  4TR3 A;  1F6M C;  5IPH A;  2HRK A;  3FY7 A;  4GTU A;  2K6V A;  1X9S B;  3J7Y b;  3LSZ A;  2I81 A;  3FHK A;  1GTI A;  4YAV A;  4WF5 A;  3C71 A;  2B5Y A;  2FWE A;  1B9X C;  2CX4 A;  2H71 A;  1X9M B;  5C04 A;  5F07 A;  4QL9 A;  5HFI A;  3LGC A;  2H6Y A;  2O89 A;  2OBI A;  5ECN B;  2NBS A;  2VUP A;  1SJZ A;  3K8N A;  1TDI A;  1FHE A;  2YNX A;  1FOV A;  2VCQ A;  3IK9 A;  4HJM A;  4JR6 A;  5IO0 A;  1C72 A;  4G0K A;  5D93 A;  2VO4 A;  4GQC A;  5D9V A;  2V6K A;  4NV5 A;  4I8B A;  4TR4 A;  3QPM A;  1B9Y C;  1T8E B;  1O7U A;  10GS A;  5EL8 A;  4I2T A;  4KDU A;  3MDK A;  2WRT A;  4MF5 A;  5IMC A;  2M72 A;  1X0R A;  3TKS A;  5DCG A;  3ZVJ D;  5J4U A;  4WXT A;  1G6Y A;  2L5L A;  3C1R A;  2B5X A;  5DQY A;  3F3R A;  4POM A;  1YY7 A;  1S3D A;  2H1B A;  3F4R A;  1THO A;  1N2A A;  4BVY A;  3AY8 A;  1ERU A;  2DLX A;  4N0Z A;  1SEN A;  4NMU A;  1V57 A;  4BVX A;  1SK0 A;  5J9B A;  5G31 A;  18GS A;  1I9D A;  1ZL9 A;  1XXU A;  1PKW A;  3GX8 A;  3UBL A;  4JR4 A;  5LNK e;  1WIK A;  1YKC A;  1KBN A;  2JZS A;  2KP2 A;  1Q98 A;  2O7K A;  2TIR A;  1GSS A;  2XBQ A;  5IOW A;  1GUM A;  2PER A;  4RQR A;  3QD9 A;  3IAM 2;  1GTA A;  1UN2 A;  5A4U A;  3F4S A;  1TRS A;  3GTU B;  2FUG 2;  2GT6 A;  3C7M A;  3H4K A;  1ML6 A;  1WE0 A;  5J41 A;  4KDX A;  2B7J A;  3RPP A;  3ED3 A;  1VF1 A; 
#chains in the Genus database with same CATH homology
 3KZQ A;  3LG6 A;  3SWL A;  4ZXG A;  4FYU A;  3TKP A;  2IPA A;  12GS A;  1Z7R A;  4MP4 A;  4QL7 A;  4WF4 A;  1SK1 A;  3LXT A;  3GNJ A;  4X4J A;  6GSX A;  4F0C A;  2FWF A;  3CMI A;  3H8Q A;  3PIN A;  2WFC A;  3CBU A;  2YN1 A;  4ZBD A;  4V1A p;  4X43 A;  2VD0 A;  2B1L A;  2V1M A;  2OE1 A;  1Y6E A;  4O5R A;  2CZ2 A;  1Z6M A;  2AJQ B;  4PQI A;  2WCI A;  1GWC A;  1M7T A;  3LW9 A;  1F2E A;  4L5L A;  1N8J A;  1GP1 A;  1DSB A;  3KJY A;  5CRD A;  1XW9 A;  4GQF A;  5FT3 A;  4O7H A;  1PSQ A;  4YAP A;  4O32 A;  2N5F A;  1A2M A;  4XIH A;  4IVF A;  1ZOF A;  2QA1 A;  3EU4 A;  5AIV A;  1PL2 A;  3E3E A;  4DVC A;  4K9Z A;  4G19 A;  4GCI A;  4MZW A;  4OCE A;  2EIO A;  2C80 A;  2R37 A;  3GYK A;  3RHB A;  4V1A g;  1U3A A;  1TU8 A;  4K5R A;  3HJM A;  4N0V A;  3TRP A;  1SL2 B;  2DSA A;  1GLQ A;  3CYN A;  3WGX A;  3ZTL A;  20GS A;  1R26 A;  2HRN A;  1SYR A;  1NHO A;  2H6Z A;  1AQW A;  1V2A A;  2ON5 A;  4GWR A;  2OKA A;  3TUE A;  4NAX A;  2VCX A;  4JU5 A;  2DJ2 A;  2LNS A;  4G9H A;  2DC5 A;  4J56 E;  3F0I A;  3ZRE A;  1EEJ A;  2R0C A;  4ZL9 A;  3D22 A;  2PBJ A;  1KTE A;  2QGV A;  4IS0 A;  2YWO A;  3ZLP A;  4E8H A;  5ECK B;  3O3T A;  2R5G A;  4EKZ A;  2PPT A;  3CRT A;  3CXG A;  5IMZ A;  4O5U A;  2PGT A;  1DE2 A;  1O8W A;  1YZX A;  1A0F A;  1BX9 A;  1HQO A;  5DJL A;  1ZYQ B;  4TXO B;  1EV9 A;  4NWY A;  3J7Y k;  3ZZX A;  3FRC A;  1S3C A;  2N5B A;  2KLX A;  4IKH A;  2MMO A;  2CAI A;  1TK0 B;  2QKE A;  2HT9 A;  2WZ9 A;  1JZW A;  4DSR A;  3ERG A;  2QSI A;  3JCM L;  2GQL A;  1H4O A;  4ZL7 A;  1XVQ A;  3DD3 A;  3FW2 A;  3HZ8 A;  3N9J A;  2H0I A;  1GSF A;  3IE3 A;  3VFI A;  2X8G A;  1USB A;  3L9V A;  3VI5 A;  3GIX A;  4O5Q A;  2RLI A;  3RPN A;  1WMJ A;  4YQU A;  4KA0 A;  3EIN A;  4EO3 A;  1NM3 A;  1MD4 A;  3NZN A;  4PXO A;  4XS4 B;  3DYR A;  5HQP A;  3QFA C;  5JCG A;  2H1G A;  3P8W A;  3FZ4 A;  3BD2 A;  4O92 A;  3D0Z A;  1K0O A;  4PUR A;  3LXZ A;  3A3T A;  9GSS A;  5ECL B;  2A4V A;  3CSI A;  1TI1 A;  3N5O A;  2VCZ A;  2DIY A;  2C3Q A;  4YQM A;  3VLN A;  2OJL A;  1UC7 A;  1SD9 A;  4MJC A;  2YJH A;  3TGZ A;  4HOJ A;  4ML6 A;  2CV4 A;  4CHS A;  1FW1 A;  3S9F A;  4AJ7 A;  3GUR A;  4PNG A;  3FR6 A;  3EWL A;  1J08 A;  3KTL A;  4KH7 A;  2L5O A;  1K3Y A;  2GZY A;  1GUL A;  5ECH B;  2B6M A;  5D9T A;  3FYG A;  3APQ A;  3V1W A;  3KMN A;  1OE8 A;  6GSS A;  2IJY A;  4IN0 A;  4ICY A;  1SK2 A;  2EIR A;  3TCO A;  1ST9 A;  4MZC A;  1E2Y A;  2JAD A;  1AQX A;  3GV1 A;  2IIY A;  1A8Y A;  4IEL A;  3KGK A;  2FGX A;  5G5E A;  4PQH A;  4XS4 A;  1O8X A;  2J23 A;  1G6W A;  5CAX A;  5CNW A;  1E6B A;  1YEP A;  3IBH A;  2PVQ A;  3QOU A;  5G1K A;  2KP1 A;  2REM A;  1OC9 A;  3VWU A;  4JE1 A;  1Q4J A;  5G2Z A;  3PGT A;  6GSV A;  5IMD A;  4JBB A;  4JED A;  5KN3 A;  3FK8 A;  2FWG A;  4Z2U A;  4MPG A;  2DIZ A;  5C00 A;  3F9U A;  2MMA A;  3EUR A;  1JLV A;  1ZGN A;  4F82 A;  5KEJ A;  4ZL8 A;  1XBS A;  2IFQ B;  1MDK A;  1VF2 A;  1TK5 B;  2C8U A;  2P5Q A;  3GL5 A;  1XCC A;  1TKD B;  1DE1 A;  1EV4 A;  1F3A A;  2FLS A;  3MSZ A;  1S3A A;  3QR6 A;  4K6X A;  1M9A A;  5J5N A;  1SD8 A;  4XTS A;  5ECM B;  1XOA A;  1EOG A;  2K8S A;  2HLS A;  2CX3 A;  2GSS A;  5D9W A;  4KDY A;  2YP6 A;  2EIQ A;  1GH2 A;  4GF0 A;  2GTU A;  4K2D A;  3DIE A;  2YAN A;  3W8J A;  5H5R A;  3SBC A;  5GST A;  4GSS A;  1EP8 A;  4IBP A;  4Z2T A;  1JZO A;  1PA3 A;  3W8S A;  2H8L A;  2NPB A;  4BVY B;  2KUC A;  4JZQ A;  2LRT A;  3KXO A;  3A2W A;  3GRX A;  5G5F A;  2IFQ A;  3OR5 A;  4RUV A;  4BVX B;  2EC4 A;  3GH6 A;  2CT6 A;  3ZVJ A;  1YQ1 A;  1FOH A;  2IL3 A;  1O85 A;  4TRX A;  1FG4 A;  1PD2 1;  1V98 A;  3FR9 A;  1TXX A;  2ES7 A;  2A2R A;  1KNG A;  4KE3 A;  1NHY A;  2HRA A;  1WP0 A;  3KTB A;  2HRF A;  1XWG A;  3M8N A;  11GS A;  1GSQ A;  2GVP A;  6GSY A;  4HJ2 A;  4NHW A;  2X99 A;  2OE0 A;  5A4V A;  5IMA A;  3PH9 A;  2AV4 A;  3HVS A;  2O87 A;  1Z9H A;  3ZYW A;  3APO A;  5CRE A;  4MK3 A;  4IHU A;  2NVL A;  3TJG A;  4G0I A;  5DDL A;  3H79 A;  5INY A;  1V40 A;  4HQS A;  3DVX A;  3ZIJ A;  1XOB A;  3TKQ A;  2GLR A;  1XWK A;  3IXR A;  5A4W A;  2VAF A;  2R0P A;  4TR1 A;  2ZUP A;  2VL2 C;  3P2A A;  2H73 A;  4HDE A;  4ISD A;  1OC3 A;  5GSS A;  3CSH A;  3EC3 A;  1YEX A;  5KOX A;  2YV9 A;  2XPE A;  2DKH A;  1WPI A;  3GSS A;  2JZT A;  1WJK A;  5HR1 A;  1G7E A;  3BBY A;  4POB A;  2A2P A;  4K1F A;  3LOR A;  4KX4 A;  6GST A;  1IYI A;  3IC4 A;  5DAL A;  4KCE A;  3QAV A;  3HZ4 A;  14GS A;  1GSE A;  3L9U A;  4PGT A;  5CRH A;  3KH7 A;  2ZCT A;  2LNT A;  2KOK A;  4DSS B;  2MMZ A;  3QAG A;  3HXS A;  1SKW B;  4WBR D;  2H6X A;  4XRD A;  3TKS C;  2E2M A;  2K9F A;  4IW9 A;  3FKF A;  1T1V A;  4LMW A;  3I9V 2;  1TTZ A;  3UVH A;  2VD1 A;  4F0B A;  3GA4 A;  4ECI A;  3FZ9 A;  3MYD A;  3US3 A;  5FWG A;  2H0G A;  1YDK A;  2IN3 A;  4OCF A;  1XZO A;  2RM5 A;  3ZFL A;  1GL8 A;  2VL9 A;  4N30 A;  2H70 A;  4MZB A;  1FAA A;  5G1L A;  4EDZ A;  1FO5 A;  4I6X A;  3F3Q A;  1ACV A;  4CY8 A;  5EPF A;  4IJI A;  4BWQ A;  3HA9 A;  4MCU A;  2C3T A;  1U6T A;  2HZE B;  3M9J A;  1HYU A;  3TOT A;  3C8E A;  2VM2 A;  2X49 A;  2H74 A;  1DBY A;  2VLV A;  1ZYN A;  4ECB A;  1ERV A;  4ECC A;  2CVB A;  5D9X A;  5GAP D;  1QUW A;  4FH8 A;  4OFN A;  3EMP A;  1RK4 A;  4DSS A;  1OE7 A;  2GT5 A;  2YZU A;  3BCK A;  4KUN A;  4E8E A;  1Y25 A;  5B7C A;  1PN9 A;  4TVE A;  1MD3 A;  1U3I A;  2H66 A;  1A23 A;  2DJK A;  1TRV A;  2GZP A;  4KSM A;  5AIX A;  3Q74 A;  2L4C A;  3VUR A;  3ZFB A;  3UEM A;  4MLY A;  1TI3 A;  3O6T A;  4BWS A;  1PKZ A;  2CVK A;  1JZD A;  4LL1 B;  4I2U A;  2AUV A;  3I69 A;  1GNE A;  1I5G A;  1K0C A;  5JWR B;  4KGI A;  4N11 A;  4MF7 A;  4MJE A;  3WD6 A;  4F03 A;  3A5I A;  4TN8 A;  3WGD A;  4XS1 A;  3DXB A;  4K7I A;  2H1A A;  3CTG A;  2WS2 A;  1TJD A;  4ZB8 A;  1XPV A;  1B8X A;  5ENU A;  4OMV A;  1ZZY A;  2HZE A;  1QK8 A;  4ZB9 A;  1FVK A;  1WWJ A;  5AN1 A;  3IAS 2;  1FVJ A;  4Q5N A;  3LWA A;  3IK7 A;  3BCI A;  4PTS A;  3IHQ A;  4AJ6 A;  1SU9 A;  4CW9 A;  3M1G A;  1PQN A;  2WJU A;  5DAK A;  1B4P A;  4KCA A;  4Z7X A;  1K3O A;  3KP9 A;  8GSS A;  5HFK A;  1SYX A;  5ID2 A;  5ECS A;  3P7X A;  3DWV A;  4AGS A;  1BAY A;  4L8E A;  2DML A;  2O85 A;  3F8U A;  3FMW A;  1X5E A;  2C0D A;  3MIX A;  4PX1 A;  1U87 A;  3GKX A;  5AIS A;  1A24 A;  1BJX A;  4LL4 B;  2VL3 A;  2L59 A;  2RII A;  5IPG A;  4EXJ A;  5KN2 A;  3KIJ A;  4ZB6 A;  3G7J A;  2L57 A;  1F37 A;  5BMU A;  4I97 A;  17GS A;  1EGR A;  4F2I A;  2I9H A;  1GSD A;  22GS A;  4ZBB A;  4OFM A;  3WT2 A;  2GQM A;  2JSZ A;  1PX6 A;  4ULX A;  3E0U A;  4QQ7 A;  4POK A;  3CTF A;  3KP8 A;  1OC9 B;  4WR5 A;  2LQQ A;  1T4Y A;  3LQ7 A;  2PU9 C;  4F9Z A;  1QXH A;  2OBK A;  3EVI A;  1MDJ A;  4EDY A;  2D2Z A;  5LD0 A;  2GDR A;  5FHI A;  3L0H A;  2YPM A;  1ILO A;  2P0G A;  1YKA A;  2HZF A;  5ECQ B;  4XS6 A;  1GNW A;  3ERF A;  2QA2 A;  2C1Y A;  1PGT A;  3LFL A;  4PQ1 A;  2HI7 A;  4I5Q A;  4AF2 A;  5D96 A;  3GHA A;  2RUF A;  2FA8 A;  1SL1 B;  1M2B A;  2A2S A;  1TW9 A;  2CAQ A;  3L9S A;  1FB0 A;  2N5A A;  3R2Q A;  19GS A;  2H30 A;  5CRW A;  1Z6N A;  2J9H A;  2GSQ A;  2I1U A;  1K0D A;  3KD0 A;  5F05 A;  4LMV A;  2YWM A;  3HVX A;  1MTC A;  1WOU A;  5DBQ A;  4X1U A;  2NDO A;  1X5C A;  5IMV A;  2BMX A;  3HJO A;  4NPB A;  2FNO A;  2PMT A;  4MJA A;  4MMM A;  2XC2 A;  2LST A;  3M9K A;  5E4W A;  3EYT A;  4PUA A;  1RQM A;  3E9J B;  2YWN A;  2G0F A;  2B5E A;  1G7O A;  1PMT A;  4OO5 A;  1SL0 B;  3QFB C;  5G30 A;  5D8I A;  1CQG A;  4ZBA A;  2PUK C;  1NSW A;  3P90 A;  3HYP A;  4ZIJ A;  3HDC A;  4EF0 A;  3M0F A;  5BRT A;  3NIV A;  3G9B A;  4EUY A;  1VGL A;  4N10 A;  1Z7P A;  5JWO B;  4Z2R A;  4FYB A;  4MH2 A;  1XWB A;  2V6O A;  2C0E A;  4DSQ A;  5JWQ B;  2MZC A;  2I3Y A;  3ZL5 A;  4EE0 A;  2JU5 A;  4L5O A;  5B6M A;  3VI7 A;  5H5S A;  2H0H A;  1MDI A;  4KF9 A;  2HYX A;  2XPD A;  4EVM A;  4HI7 A;  2KHP A;  5IM9 A;  3DML A;  4XHM A;  3IV4 A;  4MAB A;  2P5R A;  4G10 A;  2I4A A;  3PPU A;  3GFK A;  1EGO A;  4IQA A;  3C1S A;  3L78 A;  2AB6 A;  4Q5F A;  1PX7 A;  3HY2 A;  2YZH A;  5KN0 A;  4D73 A;  1BQ7 A;  5J3R A;  1FB6 A;  5B8B A;  2C3N A;  3DGQ A;  1MEK A;  5F06 A;  5IIZ A;  2DJ0 A;  1AC1 A;  2B1K A;  2X8C A;  1RW1 A;  5DQS A;  3GMF A;  3UVT A;  1OKT A;  2LJA A;  4P3Y B;  3TRX A;  3TKS E;  3UAR A;  4K7O A;  4TR1 B;  4GXZ A;  2CQ9 A;  1ABA A;  1GSU A;  4EIP A;  3CSJ A;  3F6D A;  4G0L A;  3TB2 A;  3RDW A;  2YOI A;  5ECP B;  4CY6 A;  3ZIT A;  5E59 A;  1VRS D;  1KEB A;  1K0A A;  2WUL A;  1XIY A;  1J9B A;  2HE3 A;  2VL2 A;  1O6J A;  2WB9 A;  3UIW A;  1BG5 A;  2YWI A;  2V41 A;  1JZR A;  1A8L A;  1K0B A;  4POL A;  3R3E A;  5DCH A;  1QQ2 A;  5DAL B;  1T7P B;  1SKS B;  2F51 A;  4IQ1 A;  5IQY A;  4J2F A;  2NTO A;  1B48 A;  3DVW A;  1LBK A;  3D4T A;  3IHG A;  4MJB A;  3TJK A;  1OC8 A;  2AYT A;  1SKR B;  2R3X A;  3A2V A;  4FYC A;  1V9W A;  4GRF A;  3HVV A;  2H19 A;  1UVZ A;  2VCV A;  1OKD A;  2QC7 A;  4K0G A;  3IRA A;  3D5J A;  1HNC A;  1VF4 A;  3CRU A;  3F6F A;  2FD3 A;  2GS3 A;  2PVO C;  3UBK A;  1TP9 A;  5CYY A;  3GN3 A;  3IR4 A;  4BA7 A;  3NOF A;  2DMM A;  2IMK A;  4Q5Q A;  2ZNM A;  1YF0 A;  2F3M A;  2F8F A;  2OE3 A;  2YCD A;  3IOS A;  1X9W B;  2ALB A;  1EP7 A;  5F0G A;  5EVO A;  3QCP A;  1ERW A;  3MWH A;  1GRX A;  2GQK A;  3EPT A;  4HZ2 A;  2L4Q A;  3GKN A;  3UAP A;  4FIW A;  3ERW A;  4HU9 A;  3FR3 A;  3APS A;  3ISO A;  1GSY A;  2XHF A;  2GZZ A;  1GTB A;  2R0G A;  2R6K A;  2M80 A;  3TJJ A;  4JRR A;  1UA5 A;  3EU3 A;  3LYP A;  3F63 A;  4KAE A;  1EOH A;  4V2M A;  3VK9 A;  3C73 A;  2FWH A;  3FEU A;  2OAD A;  1GUK A;  1PRX A;  1QGV A;  1BED A;  5ECO B;  1M0U A;  2DJ3 A;  5CO3 A;  5CRG A;  2GST A;  3GL3 A;  2H76 A;  1AIU A;  3A5W A;  4TOP A;  2CA8 A;  3L4N A;  1F9M A;  2MYG A;  1TU7 A;  3ZIV A;  2JZR A;  2R2J A;  3UMA A;  2L6C A;  3H1N A;  2DBC A;  2XBI A;  2BJX A;  3IDV A;  3M3M A;  3U6V A;  3H93 A;  1Z3E A;  1DUG A;  1A2L A;  4KSO A;  3LYK A;  4MDC A;  4A5P A;  6GSW A;  1OAZ A;  2IME A;  4GSN A;  3IC8 A;  4LA1 A;  4WET A;  2IMI A;  4OWY A;  2TRC P;  3EE2 A;  4L0U A;  3WT1 A;  1XWC A;  4PNF A;  4LLR A;  4ILF A;  3DKS A;  2F9S A;  2GSR A;  4ECJ A;  2HXK A;  4NXI A;  2Z9S A;  2X4A A;  2K8V A;  4YKG A;  5HR3 A;  3HCZ A;  1ZMA A;  5DAK B;  2HSM A;  6GSU A;  5GZZ B;  3ME8 A;  2FA4 A;  3GKK A;  4WEY A;  2C4J A;  4IJ3 A;  3DRN A;  4J57 E;  2MMN A;  4OO4 A;  2CVD A;  2HSY A;  4MF6 A;  1H75 A;  3TKR A;  5GAN D;  5ID2 B;  1EWX A;  4X0X A;  5KOW A;  4FQU A;  2YV7 A;  4IGJ A;  3Q6O A;  3FZ5 A;  3KCM A;  3GTU A;  1M99 A;  3GUS A;  1ZYP A;  5DJM A;  1M9B A;  3GKM A;  4MA9 A;  5LCZ A;  2UZ8 A;  4KB3 A;  4TW5 A;  2C0F A;  1J0F A;  4BL7 B;  1LJR A;  2TRX A;  4RQX A;  2VOC A;  4YH2 A;  5IMF A;  4HS1 A;  3Q19 A;  1V58 A;  2LUS A;  1ZCP A;  4L0W A;  4OFT A;  2LRN A;  4YQV A;  1BYE A;  1K0N A;  2F8A A;  5L71 A;  2H75 A;  1OYJ A;  3TJB A;  4HZ4 A;  2DKI A;  1GLP A;  3D6I A;  2A4H A;  3G7Y A;  2X64 A;  5A5K A;  1PN0 A;  5HFG A;  3DEX A;  3VPQ A;  2R4V A;  5IOX A;  3VWW A;  1K0M A;  4WBJ A;  5D73 A;  5F8B A;  4XRA A;  3RHC A;  3QAW A;  4HEA 2;  3VWX A;  4KND A;  3ZRD A;  3HKR A;  3GX0 A;  5JCW A;  1T4Z A;  1G0T A;  1XWA A;  5ELG A;  4NHZ A;  2LTK A;  1TRU A;  3PR8 A;  4EL1 A;  3D21 A;  3WYW A;  1YJ6 A;  1NW2 A;  4H86 A;  2FY6 A;  3ZML A;  2X8H A;  1HNB A;  1WRY A;  2OA7 A;  3QDN A;  1AUC A;  5COH A;  1QFN A;  3D4M A;  2VCT A;  7GSS A;  3LEF A;  2V2G A;  2L6D A;  3TDG A;  5AGY A;  4BL7 A;  1THX A;  1TOF A;  5ECR B;  4ACS A;  1VF3 A;  3UJ1 A;  13GS A;  4DEJ A;  1CQH A;  2HFD A;  4PUF C;  4MNN A;  2WGR A;  2IMF A;  1R4W A;  2LV3 A;  3GST A;  2IMD A;  2O8V B;  1A0R P;  3KH9 A;  4K2X A;  2RM6 A;  3KMO A;  4ID0 A;  3ZMK A;  16GS A;  3I6A A;  4MH3 A;  1GTU A;  3BJ5 A;  2YJ7 A;  3G7I A;  1W4V A;  3IA1 A;  3QMX A;  2VLT A;  4OD7 A;  4WKW A;  2JSY A;  4YKF A;  5ECI B;  4G2E A;  5DVB A;  2B3S A;  4EIQ A;  4NV2 A;  2P31 A;  5ABR A;  2DJJ A;  5B8A A;  4ZIL A;  3LJR A;  1EZK A;  1M2A A;  1R7H A;  4TXO A;  2JAC A;  1O81 A;  1A2J A;  2B7K A;  4HUA A;  1YF1 A;  5B6N A;  1T3B A;  1GUH A;  1OVN A;  4MPF A;  4K0N A;  3TRQ A;  2WDU A;  4Q5R A;  2CZ3 A;  3RBT A;  2M46 A;  3VWV A;  4FO5 A;  1AAZ A;  2LRC A;  2E7P A;  4ML1 A;  3UOM A;  2C0G A;  1AQV A;  3I43 A;  5HR2 A;  2HSH A;  2MBT A;  5IO2 A;  3ME7 A;  2LKU A;  4V2L A;  1EEM A;  1XW5 A;  4K8M A;  3UL3 A;  2PWJ A;  1TRW A;  2VCW A;  1Z5Y E;  3RAZ A;  4CDO A;  1W89 A;  4D73 B;  4HQZ A;  1SJI A;  1QMV A;  1U88 A;  1O73 A;  3U5R E;  4TXV A;  3Q18 A;  4K5S A;  3TJF A;  3WGE A;  2VIM A;  2JL4 A;  2LS5 A;  4V2N A;  1PL1 A;  3BOA A;  3MNG A;  1XFL A;  4TKY A;  1IYH A;  2FCH A;  1R5A A;  2K18 A;  4BPY A;  2LQO A;  5EY6 A;  2VM1 A;  1AXD A;  3HJP A;  1JFU A;  4K7N A;  1B4Q A;  1URM A;  2E0Q A;  2H01 A;  2GGT A;  4TR0 A;  4EC0 A;  1T00 A;  5JCU A;  3O76 A;  2H72 A;  2LJK A;  4RI6 A;  4IP6 A;  1HD2 A;  1M2D A;  4RI7 A;  2IWT A;  3W6G A;  4KW6 A;  1XW6 A;  1ERT A;  4IP1 A;  5H5Q A;  1HNA A;  2DJ1 A;  5KN1 A;  2LJR A;  3KM6 A;  4HU7 A;  2OAC A;  3TOU A;  1K3L A;  3IPZ A;  2ON7 A;  2BTO T;  2AAW A;  5ELA A;  5HR0 A;  1LU4 A;  2RUE A;  2HNL A;  4XCS A;  1TK8 B;  3F4T A;  4USS A;  4AJ8 A;  2LEG A;  2G2Q A;  1X5D A;  2VLU A;  2E2G A;  1ZYE A;  4WR4 A;  1SJ6 A;  5CP1 A;  2AHE A;  2MBS A;  3FZA A;  2H1D A;  2PN8 A;  3HD5 A;  4GST A;  2V32 A;  1F3B A;  1R5P A;  1ON4 A;  1JHB A;  3HHV A;  3EMX A;  1JLW A;  2FHE A;  3MAK A;  3A2X A;  3VPT A;  5J9C A;  1XVW A;  3KEB A;  3GH9 A;  1AW9 A;  4GLT A;  4TR3 A;  1F6M C;  5IPH A;  2HRK A;  3FY7 A;  4GTU A;  2K6V A;  1X9S B;  3J7Y b;  3LSZ A;  2I81 A;  3FHK A;  1GTI A;  4YAV A;  4WF5 A;  3C71 A;  2B5Y A;  2FWE A;  1B9X C;  2CX4 A;  2H71 A;  1X9M B;  5C04 A;  5F07 A;  4QL9 A;  5HFI A;  3LGC A;  2H6Y A;  2O89 A;  2OBI A;  5ECN B;  2NBS A;  2VUP A;  1SJZ A;  3K8N A;  1TDI A;  1FHE A;  2YNX A;  1FOV A;  2VCQ A;  3IK9 A;  4HJM A;  4JR6 A;  5IO0 A;  1C72 A;  4G0K A;  5D93 A;  2VO4 A;  4GQC A;  5D9V A;  2V6K A;  4NV5 A;  4I8B A;  4TR4 A;  3QPM A;  1B9Y C;  1T8E B;  1O7U A;  10GS A;  5EL8 A;  4I2T A;  4KDU A;  3MDK A;  2WRT A;  4MF5 A;  5IMC A;  2M72 A;  1X0R A;  3TKS A;  5DCG A;  3ZVJ D;  5J4U A;  4WXT A;  1G6Y A;  2L5L A;  3C1R A;  2B5X A;  5DQY A;  3F3R A;  4POM A;  1YY7 A;  1S3D A;  2H1B A;  3F4R A;  1THO A;  1N2A A;  4BVY A;  3AY8 A;  1ERU A;  2DLX A;  4N0Z A;  1SEN A;  4NMU A;  1V57 A;  4BVX A;  1SK0 A;  5J9B A;  5G31 A;  18GS A;  1I9D A;  1ZL9 A;  1XXU A;  1PKW A;  3GX8 A;  3UBL A;  4JR4 A;  5LNK e;  1WIK A;  1YKC A;  1KBN A;  2JZS A;  2KP2 A;  1Q98 A;  2O7K A;  2TIR A;  1GSS A;  2XBQ A;  5IOW A;  1GUM A;  2PER A;  4RQR A;  3QD9 A;  3IAM 2;  1GTA A;  1UN2 A;  5A4U A;  3F4S A;  1TRS A;  3GTU B;  2FUG 2;  2GT6 A;  3C7M A;  3H4K A;  1ML6 A;  1WE0 A;  5J41 A;  4KDX A;  2B7J A;  3RPP A;  3ED3 A;  1VF1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...