1ZYNA

Oxidized structure of the n-terminal domain of salmonella typhimurium ahpf
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
196
structure length
196
Chain Sequence
MLDTNMKTQLRAYLEKLTKPVELIATLDDSAKSAEIKELLAEIAELSDKVTFKEDNTLPVRKPSFLITNPGSQQGPRFAGSPLGHEFTSLVLALLWTGGHPSKEAQSLLEQIRDIDGDFEFETYYSLSCHNCPDVVQALNLMAVLNPRIKHTAIDGGTFQNEITERNVMGVPAVFVNGKEFGQGRMTLTEIVAKVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alkyl hydroperoxide reductase subunit F
publication title Oxidized and synchrotron cleaved structures of the disulfide redox center in the N-terminal domain of Salmonella typhimurium AhpF
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Oxidoreductase
total genus 63
structure length 196
sequence length 196
chains with identical sequence B
ec nomenclature ec 1.8.1.-:
pdb deposition date 2005-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13192 Thioredoxin_3 Thioredoxin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.80 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1zynA00
4O5QA 4MNNA 4O5UA 1ZYNA 1ZYPA 4YKGA 4YKFA
chains in the Genus database with same CATH superfamily
4DVCA 4WKWA 1K0DA 2PGTA 1J08A 3HJMA 2VLVA 5AGYA 2IMIA 2LTKA 1M3IA 3QAWA 1U6TA 1JZWA 4ULXA 5JWRB 3IC8A 1PX6A 1A8YA 1Z7RA 2GQLA 4PNGA 2PBJA 1WJKA 4MJAA 4ML1A 4IW9A 2F8FA 3VLNA 3D4TA 3DWVA 1R26A 2A2PA 1FOHA 1T1VA 2HSMA 4EXJA 2YCDA 4X4JA 4O7HA 1F3BA 2VL2C 5ECKB 3KIJA 2JZTA 3BBYA 3TKRA 4EIQA 2X4AA 4RQRA 1J9BA 3AY8A 5ECHB 1GLQA 3LEFA 3M1GA 3KEBA 5J41A 5F06A 2KLXA 1MD4A 5ELAA 2H1DA 5KEJA 2H6YA 4MF5A 2DLXA 4ZBDA 3D6IA 3F3QA 1Z6NA 4MF7A 4BWQA 1AUCA 2O85A 2P0GA 4HQSA 2MMAA 1H75A 2C0FA 5DCHA 4XS4A 4OFNA 3GUSA 1ERUA 1VRSD 5HR1A 2K8SA 2O7KA 2GGTA 5LD0A 4K2XA 1T7PB 1UC7A 2NBSA 5ELGA 1U3IA 2FWHA 1LBKA 1VF3A 2R0CA 1K3OA 3MWHA 5A4VA 2HNLA 4NMUA 1A2LA 3MIXA 2X8HA 4OMVA 3UAPA 2VD1A 3FYGA 2H71A 1GTAA 1J0FA 1X9SB 1DSBA 3R3EA 1AQVA 2X8GA 3G7YA 4MA9A 4N11A 1MDJA 2X99A 3ZZXA 2I1UA 1Y25A 4MH2A 3N5OA 5B8AA 5CRHA 1OAZA 3L9VA 2GS3A 2H74A 2OE0A 5EPFA 1A0FA 1O8WA 1GH2A 5GSSA 2YN1A 1ACVA 5CP1A 3E0UA 5G2ZA 3E3EA 4AJ6A 2LJKA 3CXGA 4O5UA 4GF0A 4G10A 1JZDA 3TRPA 4KA0A 3TB2A 1SK1A 4MNNA 2PVOC 5F0GA 3I43A 3KJYA 2WRTA 4MJBA 1XG8A 1HYUA 2GT6A 1Z7PA 4TR0A 3KGKA 4N30A 4HZ4A 2WCIA 1GUKA 1V98A 4G0LA 22GSA 1AW9A 4K0GA 3J7Yk 4O92A 1U3AA 4XCSA 3F8UA 4LL1B 1ON4A 2V2GA 2FUG2 5IOWA 2VM2A 3HVXA 4HSCX 1TP9A 4RQXA 3S9FA 2I81A 1PN9A 1OC9A 1IYHA 1QUWA 4V1Ag 2HI7A 1O7UA 2I3YA 3G7IA 3KTLA 4GCIA 4Z2RA 1MD3A 1YEPA 4L0UA 2L6DA 1JLWA 4YAPA 4BL7A 4EF0A 1XOAA 2LJAA 2JACA 1GTUA 2FA8A 4V2NA 5GAPD 3FK8A 4BVYB 3ME7A 3EWLA 4EL1A 2IMEA 1SK2A 4H86A 2XPEA 1YY7A 3IHGA 3LGCA 4FO5A 1B4QA 2IMDA 2B3SA 2V6OA 1Z3EA 5BRTA 2E7PA 4KW6A 3IC4A 3ERWA 5INYA 3MSZA 1TI3A 1LU4A 3L78A 1HNBA 2CZ3A 2V1MA 4V2LA 4MMMA 1T4ZA 5IIZA 1SYXA 2N5AA 3GA4A 4TXOB 3F6FA 5AISA 4GSSA 2DJKA 3L9SA 1TTZA 5J9BA 1Z6MA 3DD3A 17GSA 5C00A 2B6MA 2AYTA 2FWEA 3VK9A 3LXZA 4GSTA 2H19A 4POBA 3KZQA 2JSZA 3EE2A 2IIYA 1SJZA 4MK3A 2K6VA 4IVFA 3U6VA 4WR4A 2DJ1A 1TU8A 2L4CA 3PGTA 4FH8A 4IQ1A 1SENA 3H1NA 1TRWA 3UJ1A 1BAYA 2EIRA 1X0RA 3GTUB 4EC0A 2KHPA 2LS5A 2GSRA 3GKMA 4Q5FA 2I9HA 2A2SA 3VFIA 4XRAA 4IKHA 2JZRA 4I2TA 2C8UA 1FOVA 4LMWA 2B7JA 6GSXA 3DXBA 2LEGA 1SJIA 4ZL8A 3VI5A 3H79A 1F9MA 2OBIA 3LQ7A 3GKNA 2CAQA 4PQ1A 4F03A 1BG5A 2DBCA 1SYRA 4KNDA 4YQVA 1UVZA 8GSSA 2VUPA 1XW5A 1YKAA 2BTOT 3ED3A 4TXVA 3SWLA 3DRNA 1WWJA 1PD21 5ECIB 4WBRD 5J3RA 2MBSA 3IR4A 4XS6A 1TI1A 4I6XA 2ZCTA 1TOFA 5JCGA 1X9WB 3IE3A 4K7IA 5IMFA 4K0NA 2PMTA 1GLPA 2R4VA 3NOFA 4ZBBA 2VAFA 4MPFA 2IMFA 5KN2A 3GYKA 1K0CA 2MZCA 3HKRA 3ZMLA 1WIKA 4KB3A 4I5QA 1PQNA 4TKYA 3C1SA 4KE3A 5CRGA 4NWYA 1X9MB 4ZILA 3IOSA 3GSTA 3F63A 3ERGA 4IP6A 2IFQB 1E2YA 4K7NA 5D9TA 4NV5A 2DJJA 3F6DA 5B6MA 2VCTA 5D9XA 1PX7A 4AJ8A 3HD5A 1K3YA 3MNGA 2YWIA 3TJFA 5DQSA 2CQ9A 2HRAA 1CQGA 2AV4A 2CA8A 3EVIA 1XCCA 1K0OA 1GSQA 5B7CA 2JU5A 3CQFA 1GUMA 5DAKB 3A2XA 4KDUA 1VF4A 4J57E 3HCZA 1DE1A 1SD8A 2ON7A 3IXRA 4TVEA 2J23A 4YKFA 3Q6OA 1H4OA 5KN0A 3FR6A 2WB9A 3GFKA 1GSFA 3DIEA 6GSYA 1ST9A 2H6XA 2DJ3A 1WE0A 3O6TA 2V6KA 1XWKA 3QR6A 5G5FA 3DMLA 4XS1A 2RIIA 2LRNA 4OCFA 2BMXA 5HQPA 1ILOA 1I5GA 4Q5QA 2Z9SA 2OA7A 4GWRA 3TOTA 4BVYA 4BL7B 1XW6A 2C0GA 2YNXA 4YQUA 5IMZA 3CSJA 4PQHA 3TKSE 1F2EA 2RLIA 2QC7A 3HA9A 1FG4A 2OE1A 3LORA 5A4UA 12GSA 2H72A 4O5QA 1BX9A 3VWUA 4ML6A 3P8WA 4MDCA 5ECMB 2MMZA 2O8VB 1K0AA 2DMMA 1OYJA 3GRXA 4TXOA 1UA5A 2JZSA 5B8BA 2H1AA 3VWVA 3DYRA 4PQIA 2H30A 2WDUA 2EIQA 5HFGA 5IMVA 4MLYA 1ZYEA 3FZ5A 1BEDA 4IBPA 4F2IA 4A5PA 2ES7A 1AXDA 2M72A 4IJIA 4GTUA 1MTCA 3VWXA 4V1Ap 1A8LA 3HDCA 4WBJA 4K2DA 1ZGNA 2WFCA 4IS0A 1VGLA 3GKKA 3IA1A 2FA4A 1SU9A 2GZPA 3KXOA 4L5OA 3GTUA 3HY2A 2C4JA 4KX4A 3BD2A 5IPGA 2EC4A 5D93A 3TJJA 2XBQA 3QDNA 4KSMA 3D4MA 1X5DA 1PFOA 2FD3A 2OBKA 3HVVA 1TJDA 3F4RA 4TOPA 2DMLA 2DJ2A 14GSA 2JADA 2GSTA 3F3RA 3GNJA 3ME8A 2IPAA 3LYKA 1RQMA 3KP9A 2OJLA 2GZZA 3CRUA 2YJHA 4NHWA 4PGTA 1GSSA 1EWXA 4EVMA 1M2BA 4WEYA 2ZNMA 3I69A 3UBKA 5HR0A 2HSHA 5HFKA 3TJGA 3EMXA 2XHFA 1M9BA 1PA3A 2G0FA 2FCHA 2YP6A 2M46A 2QA2A 1O6JA 2RM6A 2HRFA 3LXTA 1XWBA 1EOHA 2GQMA 5HFIA 3FR3A 2C3QA 5IM9A 5JCUA 4HUAA 3ZIJA 1F6MC 4PURA 1C72A 4FYBA 3DGQA 2L5OA 3F9UA 3ZYWA 2IFQA 2CX3A 1ZL9A 2H6ZA 5JCWA 1XWAA 3ZFLA 2X64A 4OWYA 4FYUA 1B9XC 1O8XA 4AGSA 2H01A 4DSRA 4IGJA 3CSHA 5G30A 2TIRA 2YPMA 2A4HA 4AJ7A 3FZ9A 2VCXA 9GSSA 4CDOA 4I8BA 1O81A 2HT9A 2VO4A 5H5RA 4JZQA 4MF6A 4HQZA 1XFLA 5CNWA 5DAKA 2VLUA 3PINA 3GH6A 5G1LA 3I6AA 3GX0A 2VCZA 5DDLA 1XPVA 2C0DA 3ZITA 3HZ4A 3HJOA 3ZRDA 4NV2A 3EC3A 4HU7A 7GSSA 3DVWA 2H75A 1S3AA 1QQ2A 3F4TA 11GSA 5J5NA 3UOMA 1ZZYA 4ISDA 2IJYA 5IOXA 1GSDA 1GSYA 5F05A 2QGVA 2H0IA 1PKWA 2CT6A 1SK0A 4ZL9A 4ZL7A 4PNFA 4KGIA 4MABA 4HOJA 5KOWA 1G7OA 4DSQA 4ECIA 1WP0A 3FHKA 2R2JA 1PL2A 5IMDA 4ECJA 1TKDB 3LJRA 2HE3A 3A3TA 3GX8A 3APOA 2PVQA 3HJPA 4EE0A 3N9JA 5E59A 4ZBAA 4F0BA 2KUCA 2NTOA 2C80A 4N10A 3WGDA 2HZEA 1M9AA 3IRAA 2OADA 4DSSA 1KEBA 2HYXA 5D8IA 4OCEA 13GSA 4IP1A 1TDIA 3WD6A 1THOA 3C71A 2VOCA 4WXTA 3FMWA 5ECRB 4OFTA 2GSQA 2GSSA 2XPDA 1QGVA 3GH9A 5A5KA 1EEJA 4O32A 1AIUA 4MCUA 2VCVA 1FB0A 2HLSA 4G0KA 3LW9A 4N0ZA 1USBA 1Y6EA 2REMA 1F37A 2H8LA 4JEDA 1MEKA 4TW5A 1N2AA 4LL4B 3FEUA 1KTEA 2L5LA 4PXOA 1QMVA 2H73A 2HXKA 1ML6A 3IK9A 1YZXA 2R3XA 2QSIA 1XW9A 2A4VA 3IPZA 3H93A 4Q5RA 3L4NA 4LA1A 1G6WA 3V1WA 3TKSA 3IHQA 1TRSA 3FW2A 2E0QA 5DVBA 2H0HA 2OACA 1WPIA 2P31A 3P90A 4MJEA 4L8EA 4POMA 1R5AA 5G31A 1G6YA 3VPTA 5IPHA 3ZFBA 4GRFA 2ON5A 4WF4A 1NM3A 2O87A 3GIXA 4TR4A 1MDIA 2R0GA 4JR6A 16GSA 2D2ZA 2YJ7A 1G0TA 1AQWA 1EV9A 2M80A 1OKDA 2K9FA 1ZYNA 1TK8B 3FY7A 4LLRA 4ICYA 4XTSA 5ENUA 1K0BA 4K8MA 5ECLB 3A5IA 1FO5A 4RI7A 3TKPA 5ID2B 1XOBA 3FR9A 2RUEA 3QOUA 4J2FA 4V2MA 2B1LA 5LNKe 1NHYA 2C0EA 1FHEA 3LG6A 1PKZA 1SL2B 2PN8A 1M2DA 1U88A 4ID0A 3C73A 2OE3A 2NPBA 4HJMA 3KTBA 2WZ9A 1SJ6A 2LQOA 4O5RA 3M9KA 5D73A 1G7EA 3BCKA 4ILFA 4FQUA 3D22A 2YWNA 3G7JA 4EUYA 4NXIA 2LJRA 1QFNA 1VF2A 4K1FA 3ZLPA 1XWCA 4ZB9A 3VURA 1FB6A 4FYCA 2KP1A 1GP1A 2PUKC 1JZOA 1Z5YE 3UMAA 4IJ3A 1AAZA 1VF1A 2B7KA 1A2MA 3GURA 5J9CA 1O73A 3ZREA 3HYPA 2QKEA 3KMOA 1T00A 4MZBA 3LFLA 2FGXA 5E4WA 1T8EB 5KOXA 1ZOFA 1JZRA 1TRVA 1SKRB 2K8VA 3M3MA 3F0IA 5D9WA 4G0IA 5D96A 6GSWA 1GNWA 1XBSA 1GTIA 5COHA 4X43A 3ZMKA 2H66A 4AF2A 5ABRA 3LWAA 2VL9A 2CAIA 1V58A 3WYWA 1I9DA 2WS2A 3FKFA 3DEXA 3F4SA 2MYGA 1PRXA 3ZVJD 1WRYA 4OD7A 3C7MA 5CO3A 3RDWA 2YV9A 4OO5A 5GSTA 3VI7A 4F9ZA 3A5WA 3DKSA 2MMNA 1EEMA 4ZIJA 1ABAA 2B5EA 4D73B 3CTFA 1TU7A 3EMPA 5IO0A 2R6KA 3BJ5A 1OC8A 2QA1A 1SKSB 4N0VA 1SL1B 4MZCA 4EKZA 4Z2TA 2N5FA 1FW1A 2HZFA 4K6XA 1OVNA 2N5BA 3QAGA 3IAS2 19GSA 4QL7A 2AJQB 1YEXA 5IMAA 4XHMA 2HZEB 4RUVA 4L0WA 2LRCA 3QMXA 3NIVA 4DSSB 1ERTA 1ZCPA 1V40A 3R2QA 4KH7A 2V32A 4NHZA 4K5RA 2IN3A 5GZZB 4HDEA 4PUAA 4WR5A 1HNCA 3M0FA 3GV1A 4K5SA 5HR2A 4NAXA 1KBNA 3Q19A 4IHUA 4FIWA 2NVLA 2VCWA 3GL5A 1W89A 1GWCA 2P5QA 3TKSC 3EU3A 2CVKA 4EIPA 3J7Yb 2FLSA 3ISOA 2B5YA 4DEJA 5DALB 3Q18A 5EY6A 1NHOA 3EPTA 2R5GA 1M0UA 4PTSA 2GT5A 2FNOA 3KH7A 4JRRA 1EV4A 2FY6A 1XWGA 2WJUA 5D9VA 3G9BA 5J4UA 3O3TA 3APQA 1NW2A 5IMCA 3ZTLA 2YV7A 1N8JA 3LSZA 1GSEA 3WGXA 2AHEA 3D0ZA 18GSA 4KAEA 2GZYA 5CRWA 2LV3A 1TK0B 4YKGA 4RI6A 4KDXA 4WETA 2V41A 1Q98A 3H8QA 4F82A 5FHIA 1M3JA 3KD0A 5ID2A 5KN1A 2GTUA 2DKIA 2H76A 5ECQB 3IBHA 4HZ2A 1YF0A 3CTGA 1O85A 2MMOA 1DBYA 1GSUA 2B1KA 4ECBA 1SL0B 5H5SA 4EO3A 4TR1B 2HSYA 1ZYQB 2DSAA 2C3TA 3UIWA 3UEMA 3KP8A 1S3CA 3GN3A 4IQAA 3U5RE 2GLRA 3EU4A 4MZWA 4POKA 6GSVA 3MAKA 2DIZA 3IAM2 3PPUA 2OKAA 5ECNB 1ZYPA 2VD0A 3A2WA 4YQMA 2H70A 3RHCA 1GRXA 1T3BA 3QD9A 2PWJA 2X49A 3CRTA 2CVBA 2FWGA 4KF9A 1HD2A 3WT1A 1BJXA 1JLVA 3DVXA 4X0XA 5HR3A 3C8EA 3VPQA 3GKXA 1A2JA 1FAAA 1TXXA 6GSTA 3RPPA 1TRUA 3OR5A 5DQYA 1OKTA 2GQKA 4QQ7A 4K9ZA 4TRXA 1M7TA 1V57A 2AAWA 5EL8A 3RPNA 4L5LA 1YKCA 3D5JA 3Q74A 3HHVA 1QXHA 1R5PA 2YZUA 1E6BA 4Q5NA 1V2AA 4MH3A 2WGRA 1JFUA 1X5CA 2FWFA 2IMKA 6GSSA 3L9UA 4K7OA 5ECSA 1EP7A 3K8NA 1DE2A 2WULA 4TN8A 4D73A 2IWTA 1PSQA 2L59A 4BVXB 2AUVA 4LMVA 3RAZA 2DJ0A 4JBBA 4HJ2A 1YDKA 2CVDA 5AIVA 2CX4A 5KN3A 3WGEA 4KDYA 4PX1A 1OE7A 4EDYA 1EGOA 3KMNA 3CBUA 3WT2A 2F51A 1YJ6A 1GTBA 1XVWA 5CAXA 1ERWA 1YQ1A 3KCMA 2FHEA 1RW1A 1SD9A 4IELA 4XRDA 3C1RA 4E8EA 4ZXGA 4HU9A 3RBTA 1B8XA 3TUEA 4OFMA 4BIKA 5DCGA 4MP4A 2TRXA 3UL3A 1OE8A 2P5RA 1MDKA 2PPTA 4YH2A 2VM1A 2ZUPA 4GXZA 6GSUA 5AIXA 2X8CA 2LRTA 4HS1A 1QK8A 1SKWB 1HNAA 1K0MA 1RK4A 1EGRA 1FVKA 1WOUA 3FZ4A 2H0GA 1PMTA 2HFDA 5DJMA 3HXSA 3GSSA 1XVQA 2DKHA 5H5QA 4IN0A 3MDKA 2K18A 1HQOA 2NDOA 4CY8A 5DALA 2R37A 2JL4A 1XIYA 3O76A 1JHBA 4GSNA 3QCPA 3CSIA 3SBCA 3MYDA 1GULA 1M99A 4YAVA 4F0CA 5A4WA 2E2GA 3KM6A 3TJBA 3BCIA 2CV4A 3A2VA 2JSYA 3CMIA 4CHSA 3E9JB 1OC3A 4KUNA 3LYPA 4ACSA 3US3A 3HVNA 5B6NA 3PR8A 3QFAC 1GL8A 3ZL5A 2L4QA 5EVOA 5CREA 1R7HA 4P3YB 4JU5A 4KSOA 5L71A 2YWOA 5AN1A 1M2AA 2A2RA 3HVSA 5JWQB 4BWSA 1X5EA 3FZAA 3TGZA 3IK7A 4JR4A 2L6CA 1S3DA 4XIHA 4ZB6A 3VWWA 3ZVJA 20GSA 2C3NA 4GLTA 2DC5A 3EYTA 2TRCP 2J9HA 2VL2A 1BQ7A 5CRDA 1XXUA 4GQCA 2O89A 5C04A 3IV4A 1B9YC 4TR1A 2G2QA 4JE1A 1TW9A 2VL3A 1R4WA 1K3LA 1ERVA 3HZ8A 4POLA 5JWOB 1A24A 4GQFA 3NZNA 1WMJA 2HRNA 4Z2UA 3FRCA 3EURA 4BA7A 2IL3A 1EP8A 1DUGA 4XS4B 5FT3A 1K0NA 3TDGA 1T4YA 2YANA 4Z7XA 3P2AA 3QPMA 3W6GA 2ALBA 1THXA 3W8SA 3GMFA 3UVTA 2GVPA 1AC1A 2F3MA 3TOUA 2MBTA 3RHBA 2LUSA 1NSWA 5BMUA 1GNEA 1A0RP 2L57A 5ECPB 3UVHA 4NPBA 4PUFC 4TR3A 1V9WA 10GSA 4E8HA 2B5XA 1W4VA 2VIMA 4HEA2 2LKUA 5F8BA 2YZHA 3W8JA 1IYIA 1Q4JA 1EOGA 4OO4A 1Z9HA 3TCOA 1FVJA 4HI7A 3PH9A 4X1UA 1URMA 3QAVA 1PGTA 4BVXA 2C1YA 4G2EA 2DIYA 1F3AA 2BJXA 5GAND 1TK5B 4J56E 3TKQA 3TJKA 2RM5A 2XBIA 1B48A 2VLTA 2RUFA 2GDRA 4BPYA 4MPGA 2PERA 5LCZA 2F8AA 5F07A 3CYNA 4CW9A 2I4AA 3M9JA 1LJRA 4MJCA 5DBQA 1OC9B 2LNTA 4I2UA 2H1GA 4KCEA 3EINA 3IDVA 5FWGA 5IO2A 2VCQA 3L0HA 4I97A 1B4PA 2CZ2A 3UBLA 5ECOB 4G19A 2F9SA 2E2MA 1AQXA 2R0PA 1ZMAA 1PN0A 1S3RA 3H4KA 3UARA 5CYYA 3BOAA 1U87A 2AB6A 2H1BA 3TRXA 2YWMA 4G9HA 4ECCA 2YOIA 4QL9A 3QFBC 1EZKA 4WF5A 3ZIVA 2KP2A 2KOKA 5IQYA 2PU9C 4USSA 4ZB8A 1YF1A 1XZOA 3D21A 1PL1A 2LSTA 3APSA 2EIOA 1KNGA 5G1KA 3GL3A 1GUHA 3I9V2 1A23A 4KCAA 3ERFA 1UN2A 2UZ8A 3JCML 1BYEA 1CQHA 3GHAA 4CY6A 2LQQA 4EDZA 3KH9A 2HRKA 3P7XA 5G5EA 2LNSA 2XC2A 5DJLA 3TRQA 3M8NA
chains in the Genus database with same CATH topology
4DVCA 4WKWA 1K0DA 2PGTA 1J08A 3HJMA 2VLVA 5AGYA 2IMIA 2LTKA 3QAWA 1U6TA 1JZWA 4ULXA 5JWRB 3IC8A 1PX6A 1A8YA 1Z7RA 2GQLA 4PNGA 2PBJA 1WJKA 4MJAA 4ML1A 4IW9A 2F8FA 3VLNA 3D4TA 3DWVA 1R26A 2A2PA 1FOHA 1T1VA 2HSMA 4EXJA 2YCDA 4X4JA 4O7HA 1F3BA 2VL2C 5ECKB 3KIJA 2JZTA 3BBYA 3TKRA 4EIQA 2X4AA 4RQRA 1J9BA 3AY8A 5ECHB 1GLQA 3LEFA 3M1GA 3KEBA 5J41A 5F06A 2KLXA 1MD4A 5ELAA 2H1DA 5KEJA 2H6YA 4MF5A 2DLXA 4ZBDA 3D6IA 3F3QA 1Z6NA 4MF7A 4BWQA 1AUCA 2O85A 2P0GA 4HQSA 2MMAA 1H75A 2C0FA 5DCHA 4XS4A 4OFNA 3GUSA 1ERUA 1VRSD 5HR1A 2K8SA 2O7KA 2GGTA 5LD0A 4K2XA 1T7PB 1UC7A 2NBSA 5ELGA 1U3IA 2FWHA 1LBKA 1VF3A 2R0CA 1K3OA 3MWHA 5A4VA 2HNLA 4NMUA 1A2LA 3MIXA 2X8HA 4OMVA 3UAPA 2VD1A 3FYGA 2H71A 1GTAA 1J0FA 1X9SB 1DSBA 3R3EA 1AQVA 2X8GA 3G7YA 4MA9A 4N11A 1MDJA 2X99A 3ZZXA 2I1UA 1Y25A 4MH2A 3N5OA 5B8AA 5CRHA 1OAZA 3L9VA 2GS3A 2H74A 2OE0A 5EPFA 1A0FA 1O8WA 1GH2A 5GSSA 2YN1A 1ACVA 5CP1A 3E0UA 5G2ZA 3E3EA 4AJ6A 2LJKA 3CXGA 4O5UA 4GF0A 4G10A 1JZDA 3TRPA 4KA0A 3TB2A 1SK1A 4MNNA 2PVOC 5F0GA 3I43A 3KJYA 2WRTA 4MJBA 1HYUA 2GT6A 1Z7PA 4TR0A 3KGKA 4N30A 4HZ4A 2WCIA 1GUKA 1V98A 4G0LA 22GSA 1AW9A 4K0GA 3J7Yk 4O92A 1U3AA 4XCSA 3F8UA 4LL1B 1ON4A 2V2GA 2FUG2 5IOWA 2VM2A 3HVXA 1TP9A 4RQXA 3S9FA 2I81A 1PN9A 1OC9A 1IYHA 1QUWA 4V1Ag 2HI7A 1O7UA 2I3YA 3G7IA 3KTLA 4GCIA 4Z2RA 1MD3A 1YEPA 4L0UA 2L6DA 1JLWA 4YAPA 4BL7A 4EF0A 1XOAA 2LJAA 2JACA 1GTUA 2FA8A 4V2NA 5GAPD 3FK8A 4BVYB 3ME7A 3EWLA 4EL1A 2IMEA 1SK2A 4H86A 2XPEA 1YY7A 3IHGA 3LGCA 4FO5A 1B4QA 2IMDA 2B3SA 2V6OA 1Z3EA 5BRTA 2E7PA 4KW6A 3IC4A 3ERWA 5INYA 3MSZA 1TI3A 1LU4A 3L78A 1HNBA 2CZ3A 2V1MA 4V2LA 4MMMA 1T4ZA 5IIZA 1SYXA 2N5AA 3GA4A 4TXOB 3F6FA 5AISA 4GSSA 2DJKA 3L9SA 1TTZA 5J9BA 1Z6MA 3DD3A 17GSA 5C00A 2B6MA 2AYTA 2FWEA 3VK9A 3LXZA 4GSTA 2H19A 4POBA 3KZQA 2JSZA 3EE2A 2IIYA 1SJZA 4MK3A 2K6VA 4IVFA 3U6VA 4WR4A 2DJ1A 1TU8A 2L4CA 3PGTA 4FH8A 4IQ1A 1SENA 3H1NA 1TRWA 3UJ1A 1BAYA 2EIRA 1X0RA 3GTUB 4EC0A 2KHPA 2LS5A 2GSRA 3GKMA 4Q5FA 2I9HA 2A2SA 3VFIA 4XRAA 4IKHA 2JZRA 4I2TA 2C8UA 1FOVA 4LMWA 2B7JA 6GSXA 3DXBA 2LEGA 1SJIA 4ZL8A 3VI5A 3H79A 1F9MA 2OBIA 3LQ7A 3GKNA 2CAQA 4PQ1A 4F03A 1BG5A 2DBCA 1SYRA 4KNDA 4YQVA 1UVZA 8GSSA 2VUPA 1XW5A 1YKAA 2BTOT 3ED3A 4TXVA 3SWLA 3DRNA 1WWJA 1PD21 5ECIB 4WBRD 5J3RA 2MBSA 3IR4A 4XS6A 1TI1A 4I6XA 2ZCTA 1TOFA 5JCGA 1X9WB 3IE3A 4K7IA 5IMFA 4K0NA 2PMTA 1GLPA 2R4VA 3NOFA 4ZBBA 2VAFA 4MPFA 2IMFA 5KN2A 3GYKA 1K0CA 2MZCA 3HKRA 3ZMLA 1WIKA 4KB3A 4I5QA 1PQNA 4TKYA 3C1SA 4KE3A 5CRGA 4NWYA 1X9MB 4ZILA 3IOSA 3GSTA 3F63A 3ERGA 4IP6A 2IFQB 1E2YA 4K7NA 5D9TA 4NV5A 2DJJA 3F6DA 5B6MA 2VCTA 5D9XA 1PX7A 4AJ8A 3HD5A 1K3YA 3MNGA 2YWIA 3TJFA 5DQSA 2CQ9A 2HRAA 1CQGA 2AV4A 2CA8A 3EVIA 1XCCA 1K0OA 1GSQA 5B7CA 2JU5A 1GUMA 5DAKB 3A2XA 4KDUA 1VF4A 4J57E 3HCZA 1DE1A 1SD8A 2ON7A 3IXRA 4TVEA 2J23A 4YKFA 3Q6OA 1H4OA 5KN0A 3FR6A 2WB9A 3GFKA 1GSFA 3DIEA 6GSYA 1ST9A 2H6XA 2DJ3A 1WE0A 3O6TA 2V6KA 1XWKA 3QR6A 5G5FA 3DMLA 4XS1A 2RIIA 2LRNA 4OCFA 2BMXA 5HQPA 1ILOA 1I5GA 4Q5QA 2Z9SA 2OA7A 4GWRA 3TOTA 4BVYA 4BL7B 1XW6A 2C0GA 2YNXA 4YQUA 5IMZA 3CSJA 4PQHA 3TKSE 1F2EA 2RLIA 2QC7A 3HA9A 1FG4A 2OE1A 3LORA 5A4UA 12GSA 2H72A 4O5QA 1BX9A 3VWUA 4ML6A 3P8WA 4MDCA 5ECMB 2MMZA 2O8VB 1K0AA 2DMMA 1OYJA 3GRXA 4TXOA 1UA5A 2JZSA 5B8BA 2H1AA 3VWVA 3DYRA 4PQIA 2H30A 2WDUA 2EIQA 5HFGA 5IMVA 4MLYA 1ZYEA 3FZ5A 1BEDA 4IBPA 4F2IA 4A5PA 2ES7A 1AXDA 2M72A 4IJIA 4GTUA 1MTCA 3VWXA 4V1Ap 1A8LA 3HDCA 4WBJA 4K2DA 1ZGNA 2WFCA 4IS0A 1VGLA 3GKKA 3IA1A 2FA4A 1SU9A 2GZPA 3KXOA 4L5OA 3GTUA 3HY2A 2C4JA 4KX4A 3BD2A 5IPGA 2EC4A 5D93A 3TJJA 2XBQA 3QDNA 4KSMA 3D4MA 1X5DA 2FD3A 2OBKA 3HVVA 1TJDA 3F4RA 4TOPA 2DMLA 2DJ2A 14GSA 2JADA 2GSTA 3F3RA 3GNJA 3ME8A 2IPAA 3LYKA 1RQMA 3KP9A 2OJLA 2GZZA 3CRUA 2YJHA 4NHWA 4PGTA 1GSSA 1EWXA 4EVMA 1M2BA 4WEYA 2ZNMA 3I69A 3UBKA 5HR0A 2HSHA 5HFKA 3TJGA 3EMXA 2XHFA 1M9BA 1PA3A 2G0FA 2FCHA 2YP6A 2M46A 2QA2A 1O6JA 2RM6A 2HRFA 3LXTA 1XWBA 1EOHA 2GQMA 5HFIA 3FR3A 2C3QA 5IM9A 5JCUA 4HUAA 3ZIJA 1F6MC 4PURA 1C72A 4FYBA 3DGQA 2L5OA 3F9UA 3ZYWA 2IFQA 2CX3A 1ZL9A 2H6ZA 5JCWA 1XWAA 3ZFLA 2X64A 4OWYA 4FYUA 1B9XC 1O8XA 4AGSA 2H01A 4DSRA 4IGJA 3CSHA 5G30A 2TIRA 2YPMA 2A4HA 4AJ7A 3FZ9A 2VCXA 9GSSA 4CDOA 4I8BA 1O81A 2HT9A 2VO4A 5H5RA 4JZQA 4MF6A 4HQZA 1XFLA 5CNWA 5DAKA 2VLUA 3PINA 3GH6A 5G1LA 3I6AA 3GX0A 2VCZA 5DDLA 1XPVA 2C0DA 3ZITA 3HZ4A 3HJOA 3ZRDA 4NV2A 3EC3A 4HU7A 7GSSA 3DVWA 2H75A 1S3AA 1QQ2A 3F4TA 11GSA 5J5NA 3UOMA 1ZZYA 4ISDA 2IJYA 5IOXA 1GSDA 1GSYA 5F05A 2QGVA 2H0IA 1PKWA 2CT6A 1SK0A 4ZL9A 4ZL7A 4PNFA 4KGIA 4MABA 4HOJA 5KOWA 1G7OA 4DSQA 4ECIA 1WP0A 3FHKA 2R2JA 1PL2A 5IMDA 4ECJA 1TKDB 3LJRA 2HE3A 3A3TA 3GX8A 3APOA 2PVQA 3HJPA 4EE0A 3N9JA 5E59A 4ZBAA 4F0BA 2KUCA 2NTOA 2C80A 4N10A 3WGDA 2HZEA 1M9AA 3IRAA 2OADA 4DSSA 1KEBA 2HYXA 5D8IA 4OCEA 13GSA 4IP1A 1TDIA 3WD6A 1THOA 3C71A 2VOCA 4WXTA 3FMWA 5ECRB 4OFTA 2GSQA 2GSSA 2XPDA 1QGVA 3GH9A 5A5KA 1EEJA 4O32A 1AIUA 4MCUA 2VCVA 1FB0A 2HLSA 4G0KA 3LW9A 4N0ZA 1USBA 1Y6EA 2REMA 1F37A 2H8LA 4JEDA 1MEKA 4TW5A 1N2AA 4LL4B 3FEUA 1KTEA 2L5LA 4PXOA 1QMVA 2H73A 2HXKA 1ML6A 3IK9A 1YZXA 2R3XA 2QSIA 1XW9A 2A4VA 3IPZA 3H93A 4Q5RA 3L4NA 4LA1A 1G6WA 3V1WA 3TKSA 3IHQA 1TRSA 3FW2A 2E0QA 5DVBA 2H0HA 2OACA 1WPIA 2P31A 3P90A 4MJEA 4L8EA 4POMA 1R5AA 5G31A 1G6YA 3VPTA 5IPHA 3ZFBA 4GRFA 2ON5A 4WF4A 1NM3A 2O87A 3GIXA 4TR4A 1MDIA 2R0GA 4JR6A 16GSA 2D2ZA 2YJ7A 1G0TA 1AQWA 1EV9A 2M80A 1OKDA 2K9FA 1ZYNA 1TK8B 3FY7A 4LLRA 4ICYA 4XTSA 5ENUA 1K0BA 4K8MA 5ECLB 3A5IA 1FO5A 4RI7A 3TKPA 5ID2B 1XOBA 3FR9A 2RUEA 3QOUA 4J2FA 4V2MA 2B1LA 5LNKe 1NHYA 2C0EA 1FHEA 3LG6A 1PKZA 1SL2B 2PN8A 1M2DA 1U88A 4ID0A 3C73A 2OE3A 2NPBA 4HJMA 3KTBA 2WZ9A 1SJ6A 2LQOA 4O5RA 3M9KA 5D73A 1G7EA 3BCKA 4ILFA 4FQUA 3D22A 2YWNA 3G7JA 4EUYA 4NXIA 2LJRA 1QFNA 1VF2A 4K1FA 3ZLPA 1XWCA 4ZB9A 3VURA 1FB6A 4FYCA 2KP1A 1GP1A 2PUKC 1JZOA 1Z5YE 3UMAA 4IJ3A 1AAZA 1VF1A 2B7KA 1A2MA 3GURA 5J9CA 1O73A 3ZREA 3HYPA 2QKEA 3KMOA 1T00A 4MZBA 3LFLA 2FGXA 5E4WA 1T8EB 5KOXA 1ZOFA 1JZRA 1TRVA 1SKRB 2K8VA 3M3MA 3F0IA 5D9WA 4G0IA 5D96A 6GSWA 1GNWA 1XBSA 1GTIA 5COHA 4X43A 3ZMKA 2H66A 4AF2A 5ABRA 3LWAA 2VL9A 2CAIA 1V58A 3WYWA 1I9DA 2WS2A 3FKFA 3DEXA 3F4SA 2MYGA 1PRXA 3ZVJD 1WRYA 4OD7A 3C7MA 5CO3A 3RDWA 2YV9A 4OO5A 5GSTA 3VI7A 4F9ZA 3A5WA 3DKSA 2MMNA 1EEMA 4ZIJA 1ABAA 2B5EA 4D73B 3CTFA 1TU7A 3EMPA 5IO0A 2R6KA 3BJ5A 1OC8A 2QA1A 1SKSB 4N0VA 1SL1B 4MZCA 4EKZA 4Z2TA 2N5FA 1FW1A 2HZFA 4K6XA 1OVNA 2N5BA 3QAGA 3IAS2 19GSA 4QL7A 2AJQB 1YEXA 5IMAA 4XHMA 2HZEB 4RUVA 4L0WA 2LRCA 3QMXA 3NIVA 4DSSB 1ERTA 1ZCPA 1V40A 3R2QA 4KH7A 2V32A 4NHZA 4K5RA 2IN3A 5GZZB 4HDEA 4PUAA 4WR5A 1HNCA 3M0FA 3GV1A 4K5SA 5HR2A 4NAXA 1KBNA 3Q19A 4IHUA 4FIWA 2NVLA 2VCWA 3GL5A 1W89A 1GWCA 2P5QA 3TKSC 3EU3A 2CVKA 4EIPA 3J7Yb 2FLSA 3ISOA 2B5YA 4DEJA 5DALB 3Q18A 5EY6A 1NHOA 3EPTA 2R5GA 1M0UA 4PTSA 2GT5A 2FNOA 3KH7A 4JRRA 1EV4A 2FY6A 1XWGA 2WJUA 5D9VA 3G9BA 5J4UA 3O3TA 3APQA 1NW2A 5IMCA 3ZTLA 2YV7A 1N8JA 3LSZA 1GSEA 3WGXA 2AHEA 3D0ZA 18GSA 4KAEA 2GZYA 5CRWA 2LV3A 1TK0B 4YKGA 4RI6A 4KDXA 4WETA 2V41A 1Q98A 3H8QA 4F82A 5FHIA 3KD0A 5ID2A 5KN1A 2GTUA 2DKIA 2H76A 5ECQB 3IBHA 4HZ2A 1YF0A 3CTGA 1O85A 2MMOA 1DBYA 1GSUA 2B1KA 4ECBA 1SL0B 5H5SA 4EO3A 4TR1B 2HSYA 1ZYQB 2DSAA 2C3TA 3UIWA 3UEMA 3KP8A 1S3CA 3GN3A 4IQAA 3U5RE 2GLRA 3EU4A 4MZWA 4POKA 6GSVA 3MAKA 2DIZA 3IAM2 3PPUA 2OKAA 5ECNB 1ZYPA 2VD0A 3A2WA 4YQMA 2H70A 3RHCA 1GRXA 1T3BA 3QD9A 2PWJA 2X49A 3CRTA 2CVBA 2FWGA 4KF9A 1HD2A 3WT1A 1BJXA 1JLVA 3DVXA 4X0XA 5HR3A 3C8EA 3VPQA 3GKXA 1A2JA 1FAAA 1TXXA 6GSTA 3RPPA 1TRUA 3OR5A 5DQYA 1OKTA 2GQKA 4QQ7A 4K9ZA 4TRXA 1M7TA 1V57A 2AAWA 5EL8A 3RPNA 4L5LA 1YKCA 3D5JA 3Q74A 3HHVA 1QXHA 1R5PA 2YZUA 1E6BA 4Q5NA 1V2AA 4MH3A 2WGRA 1JFUA 1X5CA 2FWFA 2IMKA 6GSSA 3L9UA 4K7OA 5ECSA 1EP7A 3K8NA 1DE2A 2WULA 4TN8A 4D73A 2IWTA 1PSQA 2L59A 4BVXB 2AUVA 4LMVA 3RAZA 2DJ0A 4JBBA 4HJ2A 1YDKA 2CVDA 5AIVA 2CX4A 5KN3A 3WGEA 4KDYA 4PX1A 1OE7A 4EDYA 1EGOA 3KMNA 3CBUA 3WT2A 2F51A 1YJ6A 1GTBA 1XVWA 5CAXA 1ERWA 1YQ1A 3KCMA 2FHEA 1RW1A 1SD9A 4IELA 4XRDA 3C1RA 4E8EA 4ZXGA 4HU9A 3RBTA 1B8XA 3TUEA 4OFMA 5DCGA 4MP4A 2TRXA 3UL3A 1OE8A 2P5RA 1MDKA 2PPTA 4YH2A 2VM1A 2ZUPA 4GXZA 6GSUA 5AIXA 2X8CA 2LRTA 4HS1A 1QK8A 1SKWB 1HNAA 1K0MA 1RK4A 1EGRA 1FVKA 1WOUA 3FZ4A 2H0GA 1PMTA 2HFDA 5DJMA 3HXSA 3GSSA 1XVQA 2DKHA 5H5QA 4IN0A 3MDKA 2K18A 1HQOA 2NDOA 4CY8A 5DALA 2R37A 2JL4A 1XIYA 3O76A 1JHBA 4GSNA 3QCPA 3CSIA 3SBCA 3MYDA 1GULA 1M99A 4YAVA 4F0CA 5A4WA 2E2GA 3KM6A 3TJBA 3BCIA 2CV4A 3A2VA 2JSYA 3CMIA 4CHSA 3E9JB 1OC3A 4KUNA 3LYPA 4ACSA 3US3A 5B6NA 3PR8A 3QFAC 1GL8A 3ZL5A 2L4QA 5EVOA 5CREA 1R7HA 4P3YB 4JU5A 4KSOA 5L71A 2YWOA 5AN1A 1M2AA 2A2RA 3HVSA 5JWQB 4BWSA 1X5EA 3FZAA 3TGZA 3IK7A 4JR4A 2L6CA 1S3DA 4XIHA 4ZB6A 3VWWA 3ZVJA 20GSA 2C3NA 4GLTA 2DC5A 3EYTA 2TRCP 2J9HA 2VL2A 1BQ7A 5CRDA 1XXUA 4GQCA 2O89A 5C04A 3IV4A 1B9YC 4TR1A 2G2QA 4JE1A 1TW9A 2VL3A 1R4WA 1K3LA 1ERVA 3HZ8A 4POLA 5JWOB 1A24A 4GQFA 3NZNA 1WMJA 2HRNA 4Z2UA 3FRCA 3EURA 4BA7A 2IL3A 1EP8A 1DUGA 4XS4B 5FT3A 1K0NA 3TDGA 1T4YA 2YANA 4Z7XA 3P2AA 3QPMA 3W6GA 2ALBA 1THXA 3W8SA 3GMFA 3UVTA 2GVPA 1AC1A 2F3MA 3TOUA 2MBTA 3RHBA 2LUSA 1NSWA 5BMUA 1GNEA 1A0RP 2L57A 5ECPB 3UVHA 4NPBA 4PUFC 4TR3A 1V9WA 10GSA 4E8HA 2B5XA 1W4VA 2VIMA 4HEA2 2LKUA 5F8BA 2YZHA 3W8JA 1IYIA 1Q4JA 1EOGA 4OO4A 1Z9HA 3TCOA 1FVJA 4HI7A 3PH9A 4X1UA 1URMA 3QAVA 1PGTA 4BVXA 2C1YA 4G2EA 2DIYA 1F3AA 2BJXA 5GAND 1TK5B 4J56E 3TKQA 3TJKA 2RM5A 2XBIA 1B48A 2VLTA 2RUFA 2GDRA 4BPYA 4MPGA 2PERA 5LCZA 2F8AA 5F07A 3CYNA 4CW9A 2I4AA 3M9JA 1LJRA 4MJCA 5DBQA 1OC9B 2LNTA 4I2UA 2H1GA 4KCEA 3EINA 3IDVA 5FWGA 5IO2A 2VCQA 3L0HA 4I97A 1B4PA 2CZ2A 3UBLA 5ECOB 4G19A 2F9SA 2E2MA 1AQXA 2R0PA 1ZMAA 1PN0A 3H4KA 3UARA 5CYYA 3BOAA 1U87A 2AB6A 2H1BA 3TRXA 2YWMA 4G9HA 4ECCA 2YOIA 4QL9A 3QFBC 1EZKA 4WF5A 3ZIVA 2KP2A 2KOKA 5IQYA 2PU9C 4USSA 4ZB8A 1YF1A 1XZOA 3D21A 1PL1A 2LSTA 3APSA 2EIOA 1KNGA 5G1KA 3GL3A 1GUHA 3I9V2 1A23A 4KCAA 3ERFA 1UN2A 2UZ8A 3JCML 1BYEA 1CQHA 3GHAA 4CY6A 2LQQA 4EDZA 3KH9A 2HRKA 3P7XA 5G5EA 2LNSA 2XC2A 5DJLA 3TRQA 3M8NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O5Q A;  4MNN A;  4O5U A;  1ZYN A;  1ZYP A;  4YKG A;  4YKF A; 
#chains in the Genus database with same CATH topology
 4DVC A;  4WKW A;  1K0D A;  2PGT A;  1J08 A;  3HJM A;  2VLV A;  5AGY A;  2IMI A;  2LTK A;  1M3I A;  3QAW A;  1U6T A;  1JZW A;  4ULX A;  5JWR B;  3IC8 A;  1PX6 A;  1A8Y A;  1Z7R A;  2GQL A;  4PNG A;  2PBJ A;  1WJK A;  4MJA A;  4ML1 A;  4IW9 A;  2F8F A;  3VLN A;  3D4T A;  3DWV A;  1R26 A;  2A2P A;  1FOH A;  1T1V A;  2HSM A;  4EXJ A;  2YCD A;  4X4J A;  4O7H A;  1F3B A;  2VL2 C;  5ECK B;  3KIJ A;  2JZT A;  3BBY A;  3TKR A;  4EIQ A;  2X4A A;  4RQR A;  1J9B A;  3AY8 A;  5ECH B;  1GLQ A;  3LEF A;  3M1G A;  3KEB A;  5J41 A;  5F06 A;  2KLX A;  1MD4 A;  5ELA A;  2H1D A;  5KEJ A;  2H6Y A;  4MF5 A;  2DLX A;  4ZBD A;  3D6I A;  3F3Q A;  1Z6N A;  4MF7 A;  4BWQ A;  1AUC A;  2O85 A;  2P0G A;  4HQS A;  2MMA A;  1H75 A;  2C0F A;  5DCH A;  4XS4 A;  4OFN A;  3GUS A;  1ERU A;  1VRS D;  5HR1 A;  2K8S A;  2O7K A;  2GGT A;  5LD0 A;  4K2X A;  1T7P B;  1UC7 A;  2NBS A;  5ELG A;  1U3I A;  2FWH A;  1LBK A;  1VF3 A;  2R0C A;  1K3O A;  3MWH A;  5A4V A;  2HNL A;  4NMU A;  1A2L A;  3MIX A;  2X8H A;  4OMV A;  3UAP A;  2VD1 A;  3FYG A;  2H71 A;  1GTA A;  1J0F A;  1X9S B;  1DSB A;  3R3E A;  1AQV A;  2X8G A;  3G7Y A;  4MA9 A;  4N11 A;  1MDJ A;  2X99 A;  3ZZX A;  2I1U A;  1Y25 A;  4MH2 A;  3N5O A;  5B8A A;  5CRH A;  1OAZ A;  3L9V A;  2GS3 A;  2H74 A;  2OE0 A;  5EPF A;  1A0F A;  1O8W A;  1GH2 A;  5GSS A;  2YN1 A;  1ACV A;  5CP1 A;  3E0U A;  5G2Z A;  3E3E A;  4AJ6 A;  2LJK A;  3CXG A;  4O5U A;  4GF0 A;  4G10 A;  1JZD A;  3TRP A;  4KA0 A;  3TB2 A;  1SK1 A;  4MNN A;  2PVO C;  5F0G A;  3I43 A;  3KJY A;  2WRT A;  4MJB A;  1XG8 A;  1HYU A;  2GT6 A;  1Z7P A;  4TR0 A;  3KGK A;  4N30 A;  4HZ4 A;  2WCI A;  1GUK A;  1V98 A;  4G0L A;  22GS A;  1AW9 A;  4K0G A;  3J7Y k;  4O92 A;  1U3A A;  4XCS A;  3F8U A;  4LL1 B;  1ON4 A;  2V2G A;  2FUG 2;  5IOW A;  2VM2 A;  3HVX A;  4HSC X;  1TP9 A;  4RQX A;  3S9F A;  2I81 A;  1PN9 A;  1OC9 A;  1IYH A;  1QUW A;  4V1A g;  2HI7 A;  1O7U A;  2I3Y A;  3G7I A;  3KTL A;  4GCI A;  4Z2R A;  1MD3 A;  1YEP A;  4L0U A;  2L6D A;  1JLW A;  4YAP A;  4BL7 A;  4EF0 A;  1XOA A;  2LJA A;  2JAC A;  1GTU A;  2FA8 A;  4V2N A;  5GAP D;  3FK8 A;  4BVY B;  3ME7 A;  3EWL A;  4EL1 A;  2IME A;  1SK2 A;  4H86 A;  2XPE A;  1YY7 A;  3IHG A;  3LGC A;  4FO5 A;  1B4Q A;  2IMD A;  2B3S A;  2V6O A;  1Z3E A;  5BRT A;  2E7P A;  4KW6 A;  3IC4 A;  3ERW A;  5INY A;  3MSZ A;  1TI3 A;  1LU4 A;  3L78 A;  1HNB A;  2CZ3 A;  2V1M A;  4V2L A;  4MMM A;  1T4Z A;  5IIZ A;  1SYX A;  2N5A A;  3GA4 A;  4TXO B;  3F6F A;  5AIS A;  4GSS A;  2DJK A;  3L9S A;  1TTZ A;  5J9B A;  1Z6M A;  3DD3 A;  17GS A;  5C00 A;  2B6M A;  2AYT A;  2FWE A;  3VK9 A;  3LXZ A;  4GST A;  2H19 A;  4POB A;  3KZQ A;  2JSZ A;  3EE2 A;  2IIY A;  1SJZ A;  4MK3 A;  2K6V A;  4IVF A;  3U6V A;  4WR4 A;  2DJ1 A;  1TU8 A;  2L4C A;  3PGT A;  4FH8 A;  4IQ1 A;  1SEN A;  3H1N A;  1TRW A;  3UJ1 A;  1BAY A;  2EIR A;  1X0R A;  3GTU B;  4EC0 A;  2KHP A;  2LS5 A;  2GSR A;  3GKM A;  4Q5F A;  2I9H A;  2A2S A;  3VFI A;  4XRA A;  4IKH A;  2JZR A;  4I2T A;  2C8U A;  1FOV A;  4LMW A;  2B7J A;  6GSX A;  3DXB A;  2LEG A;  1SJI A;  4ZL8 A;  3VI5 A;  3H79 A;  1F9M A;  2OBI A;  3LQ7 A;  3GKN A;  2CAQ A;  4PQ1 A;  4F03 A;  1BG5 A;  2DBC A;  1SYR A;  4KND A;  4YQV A;  1UVZ A;  8GSS A;  2VUP A;  1XW5 A;  1YKA A;  2BTO T;  3ED3 A;  4TXV A;  3SWL A;  3DRN A;  1WWJ A;  1PD2 1;  5ECI B;  4WBR D;  5J3R A;  2MBS A;  3IR4 A;  4XS6 A;  1TI1 A;  4I6X A;  2ZCT A;  1TOF A;  5JCG A;  1X9W B;  3IE3 A;  4K7I A;  5IMF A;  4K0N A;  2PMT A;  1GLP A;  2R4V A;  3NOF A;  4ZBB A;  2VAF A;  4MPF A;  2IMF A;  5KN2 A;  3GYK A;  1K0C A;  2MZC A;  3HKR A;  3ZML A;  1WIK A;  4KB3 A;  4I5Q A;  1PQN A;  4TKY A;  3C1S A;  4KE3 A;  5CRG A;  4NWY A;  1X9M B;  4ZIL A;  3IOS A;  3GST A;  3F63 A;  3ERG A;  4IP6 A;  2IFQ B;  1E2Y A;  4K7N A;  5D9T A;  4NV5 A;  2DJJ A;  3F6D A;  5B6M A;  2VCT A;  5D9X A;  1PX7 A;  4AJ8 A;  3HD5 A;  1K3Y A;  3MNG A;  2YWI A;  3TJF A;  5DQS A;  2CQ9 A;  2HRA A;  1CQG A;  2AV4 A;  2CA8 A;  3EVI A;  1XCC A;  1K0O A;  1GSQ A;  5B7C A;  2JU5 A;  3CQF A;  1GUM A;  5DAK B;  3A2X A;  4KDU A;  1VF4 A;  4J57 E;  3HCZ A;  1DE1 A;  1SD8 A;  2ON7 A;  3IXR A;  4TVE A;  2J23 A;  4YKF A;  3Q6O A;  1H4O A;  5KN0 A;  3FR6 A;  2WB9 A;  3GFK A;  1GSF A;  3DIE A;  6GSY A;  1ST9 A;  2H6X A;  2DJ3 A;  1WE0 A;  3O6T A;  2V6K A;  1XWK A;  3QR6 A;  5G5F A;  3DML A;  4XS1 A;  2RII A;  2LRN A;  4OCF A;  2BMX A;  5HQP A;  1ILO A;  1I5G A;  4Q5Q A;  2Z9S A;  2OA7 A;  4GWR A;  3TOT A;  4BVY A;  4BL7 B;  1XW6 A;  2C0G A;  2YNX A;  4YQU A;  5IMZ A;  3CSJ A;  4PQH A;  3TKS E;  1F2E A;  2RLI A;  2QC7 A;  3HA9 A;  1FG4 A;  2OE1 A;  3LOR A;  5A4U A;  12GS A;  2H72 A;  4O5Q A;  1BX9 A;  3VWU A;  4ML6 A;  3P8W A;  4MDC A;  5ECM B;  2MMZ A;  2O8V B;  1K0A A;  2DMM A;  1OYJ A;  3GRX A;  4TXO A;  1UA5 A;  2JZS A;  5B8B A;  2H1A A;  3VWV A;  3DYR A;  4PQI A;  2H30 A;  2WDU A;  2EIQ A;  5HFG A;  5IMV A;  4MLY A;  1ZYE A;  3FZ5 A;  1BED A;  4IBP A;  4F2I A;  4A5P A;  2ES7 A;  1AXD A;  2M72 A;  4IJI A;  4GTU A;  1MTC A;  3VWX A;  4V1A p;  1A8L A;  3HDC A;  4WBJ A;  4K2D A;  1ZGN A;  2WFC A;  4IS0 A;  1VGL A;  3GKK A;  3IA1 A;  2FA4 A;  1SU9 A;  2GZP A;  3KXO A;  4L5O A;  3GTU A;  3HY2 A;  2C4J A;  4KX4 A;  3BD2 A;  5IPG A;  2EC4 A;  5D93 A;  3TJJ A;  2XBQ A;  3QDN A;  4KSM A;  3D4M A;  1X5D A;  1PFO A;  2FD3 A;  2OBK A;  3HVV A;  1TJD A;  3F4R A;  4TOP A;  2DML A;  2DJ2 A;  14GS A;  2JAD A;  2GST A;  3F3R A;  3GNJ A;  3ME8 A;  2IPA A;  3LYK A;  1RQM A;  3KP9 A;  2OJL A;  2GZZ A;  3CRU A;  2YJH A;  4NHW A;  4PGT A;  1GSS A;  1EWX A;  4EVM A;  1M2B A;  4WEY A;  2ZNM A;  3I69 A;  3UBK A;  5HR0 A;  2HSH A;  5HFK A;  3TJG A;  3EMX A;  2XHF A;  1M9B A;  1PA3 A;  2G0F A;  2FCH A;  2YP6 A;  2M46 A;  2QA2 A;  1O6J A;  2RM6 A;  2HRF A;  3LXT A;  1XWB A;  1EOH A;  2GQM A;  5HFI A;  3FR3 A;  2C3Q A;  5IM9 A;  5JCU A;  4HUA A;  3ZIJ A;  1F6M C;  4PUR A;  1C72 A;  4FYB A;  3DGQ A;  2L5O A;  3F9U A;  3ZYW A;  2IFQ A;  2CX3 A;  1ZL9 A;  2H6Z A;  5JCW A;  1XWA A;  3ZFL A;  2X64 A;  4OWY A;  4FYU A;  1B9X C;  1O8X A;  4AGS A;  2H01 A;  4DSR A;  4IGJ A;  3CSH A;  5G30 A;  2TIR A;  2YPM A;  2A4H A;  4AJ7 A;  3FZ9 A;  2VCX A;  9GSS A;  4CDO A;  4I8B A;  1O81 A;  2HT9 A;  2VO4 A;  5H5R A;  4JZQ A;  4MF6 A;  4HQZ A;  1XFL A;  5CNW A;  5DAK A;  2VLU A;  3PIN A;  3GH6 A;  5G1L A;  3I6A A;  3GX0 A;  2VCZ A;  5DDL A;  1XPV A;  2C0D A;  3ZIT A;  3HZ4 A;  3HJO A;  3ZRD A;  4NV2 A;  3EC3 A;  4HU7 A;  7GSS A;  3DVW A;  2H75 A;  1S3A A;  1QQ2 A;  3F4T A;  11GS A;  5J5N A;  3UOM A;  1ZZY A;  4ISD A;  2IJY A;  5IOX A;  1GSD A;  1GSY A;  5F05 A;  2QGV A;  2H0I A;  1PKW A;  2CT6 A;  1SK0 A;  4ZL9 A;  4ZL7 A;  4PNF A;  4KGI A;  4MAB A;  4HOJ A;  5KOW A;  1G7O A;  4DSQ A;  4ECI A;  1WP0 A;  3FHK A;  2R2J A;  1PL2 A;  5IMD A;  4ECJ A;  1TKD B;  3LJR A;  2HE3 A;  3A3T A;  3GX8 A;  3APO A;  2PVQ A;  3HJP A;  4EE0 A;  3N9J A;  5E59 A;  4ZBA A;  4F0B A;  2KUC A;  2NTO A;  2C80 A;  4N10 A;  3WGD A;  2HZE A;  1M9A A;  3IRA A;  2OAD A;  4DSS A;  1KEB A;  2HYX A;  5D8I A;  4OCE A;  13GS A;  4IP1 A;  1TDI A;  3WD6 A;  1THO A;  3C71 A;  2VOC A;  4WXT A;  3FMW A;  5ECR B;  4OFT A;  2GSQ A;  2GSS A;  2XPD A;  1QGV A;  3GH9 A;  5A5K A;  1EEJ A;  4O32 A;  1AIU A;  4MCU A;  2VCV A;  1FB0 A;  2HLS A;  4G0K A;  3LW9 A;  4N0Z A;  1USB A;  1Y6E A;  2REM A;  1F37 A;  2H8L A;  4JED A;  1MEK A;  4TW5 A;  1N2A A;  4LL4 B;  3FEU A;  1KTE A;  2L5L A;  4PXO A;  1QMV A;  2H73 A;  2HXK A;  1ML6 A;  3IK9 A;  1YZX A;  2R3X A;  2QSI A;  1XW9 A;  2A4V A;  3IPZ A;  3H93 A;  4Q5R A;  3L4N A;  4LA1 A;  1G6W A;  3V1W A;  3TKS A;  3IHQ A;  1TRS A;  3FW2 A;  2E0Q A;  5DVB A;  2H0H A;  2OAC A;  1WPI A;  2P31 A;  3P90 A;  4MJE A;  4L8E A;  4POM A;  1R5A A;  5G31 A;  1G6Y A;  3VPT A;  5IPH A;  3ZFB A;  4GRF A;  2ON5 A;  4WF4 A;  1NM3 A;  2O87 A;  3GIX A;  4TR4 A;  1MDI A;  2R0G A;  4JR6 A;  16GS A;  2D2Z A;  2YJ7 A;  1G0T A;  1AQW A;  1EV9 A;  2M80 A;  1OKD A;  2K9F A;  1ZYN A;  1TK8 B;  3FY7 A;  4LLR A;  4ICY A;  4XTS A;  5ENU A;  1K0B A;  4K8M A;  5ECL B;  3A5I A;  1FO5 A;  4RI7 A;  3TKP A;  5ID2 B;  1XOB A;  3FR9 A;  2RUE A;  3QOU A;  4J2F A;  4V2M A;  2B1L A;  5LNK e;  1NHY A;  2C0E A;  1FHE A;  3LG6 A;  1PKZ A;  1SL2 B;  2PN8 A;  1M2D A;  1U88 A;  4ID0 A;  3C73 A;  2OE3 A;  2NPB A;  4HJM A;  3KTB A;  2WZ9 A;  1SJ6 A;  2LQO A;  4O5R A;  3M9K A;  5D73 A;  1G7E A;  3BCK A;  4ILF A;  4FQU A;  3D22 A;  2YWN A;  3G7J A;  4EUY A;  4NXI A;  2LJR A;  1QFN A;  1VF2 A;  4K1F A;  3ZLP A;  1XWC A;  4ZB9 A;  3VUR A;  1FB6 A;  4FYC A;  2KP1 A;  1GP1 A;  2PUK C;  1JZO A;  1Z5Y E;  3UMA A;  4IJ3 A;  1AAZ A;  1VF1 A;  2B7K A;  1A2M A;  3GUR A;  5J9C A;  1O73 A;  3ZRE A;  3HYP A;  2QKE A;  3KMO A;  1T00 A;  4MZB A;  3LFL A;  2FGX A;  5E4W A;  1T8E B;  5KOX A;  1ZOF A;  1JZR A;  1TRV A;  1SKR B;  2K8V A;  3M3M A;  3F0I A;  5D9W A;  4G0I A;  5D96 A;  6GSW A;  1GNW A;  1XBS A;  1GTI A;  5COH A;  4X43 A;  3ZMK A;  2H66 A;  4AF2 A;  5ABR A;  3LWA A;  2VL9 A;  2CAI A;  1V58 A;  3WYW A;  1I9D A;  2WS2 A;  3FKF A;  3DEX A;  3F4S A;  2MYG A;  1PRX A;  3ZVJ D;  1WRY A;  4OD7 A;  3C7M A;  5CO3 A;  3RDW A;  2YV9 A;  4OO5 A;  5GST A;  3VI7 A;  4F9Z A;  3A5W A;  3DKS A;  2MMN A;  1EEM A;  4ZIJ A;  1ABA A;  2B5E A;  4D73 B;  3CTF A;  1TU7 A;  3EMP A;  5IO0 A;  2R6K A;  3BJ5 A;  1OC8 A;  2QA1 A;  1SKS B;  4N0V A;  1SL1 B;  4MZC A;  4EKZ A;  4Z2T A;  2N5F A;  1FW1 A;  2HZF A;  4K6X A;  1OVN A;  2N5B A;  3QAG A;  3IAS 2;  19GS A;  4QL7 A;  2AJQ B;  1YEX A;  5IMA A;  4XHM A;  2HZE B;  4RUV A;  4L0W A;  2LRC A;  3QMX A;  3NIV A;  4DSS B;  1ERT A;  1ZCP A;  1V40 A;  3R2Q A;  4KH7 A;  2V32 A;  4NHZ A;  4K5R A;  2IN3 A;  5GZZ B;  4HDE A;  4PUA A;  4WR5 A;  1HNC A;  3M0F A;  3GV1 A;  4K5S A;  5HR2 A;  4NAX A;  1KBN A;  3Q19 A;  4IHU A;  4FIW A;  2NVL A;  2VCW A;  3GL5 A;  1W89 A;  1GWC A;  2P5Q A;  3TKS C;  3EU3 A;  2CVK A;  4EIP A;  3J7Y b;  2FLS A;  3ISO A;  2B5Y A;  4DEJ A;  5DAL B;  3Q18 A;  5EY6 A;  1NHO A;  3EPT A;  2R5G A;  1M0U A;  4PTS A;  2GT5 A;  2FNO A;  3KH7 A;  4JRR A;  1EV4 A;  2FY6 A;  1XWG A;  2WJU A;  5D9V A;  3G9B A;  5J4U A;  3O3T A;  3APQ A;  1NW2 A;  5IMC A;  3ZTL A;  2YV7 A;  1N8J A;  3LSZ A;  1GSE A;  3WGX A;  2AHE A;  3D0Z A;  18GS A;  4KAE A;  2GZY A;  5CRW A;  2LV3 A;  1TK0 B;  4YKG A;  4RI6 A;  4KDX A;  4WET A;  2V41 A;  1Q98 A;  3H8Q A;  4F82 A;  5FHI A;  1M3J A;  3KD0 A;  5ID2 A;  5KN1 A;  2GTU A;  2DKI A;  2H76 A;  5ECQ B;  3IBH A;  4HZ2 A;  1YF0 A;  3CTG A;  1O85 A;  2MMO A;  1DBY A;  1GSU A;  2B1K A;  4ECB A;  1SL0 B;  5H5S A;  4EO3 A;  4TR1 B;  2HSY A;  1ZYQ B;  2DSA A;  2C3T A;  3UIW A;  3UEM A;  3KP8 A;  1S3C A;  3GN3 A;  4IQA A;  3U5R E;  2GLR A;  3EU4 A;  4MZW A;  4POK A;  6GSV A;  3MAK A;  2DIZ A;  3IAM 2;  3PPU A;  2OKA A;  5ECN B;  1ZYP A;  2VD0 A;  3A2W A;  4YQM A;  2H70 A;  3RHC A;  1GRX A;  1T3B A;  3QD9 A;  2PWJ A;  2X49 A;  3CRT A;  2CVB A;  2FWG A;  4KF9 A;  1HD2 A;  3WT1 A;  1BJX A;  1JLV A;  3DVX A;  4X0X A;  5HR3 A;  3C8E A;  3VPQ A;  3GKX A;  1A2J A;  1FAA A;  1TXX A;  6GST A;  3RPP A;  1TRU A;  3OR5 A;  5DQY A;  1OKT A;  2GQK A;  4QQ7 A;  4K9Z A;  4TRX A;  1M7T A;  1V57 A;  2AAW A;  5EL8 A;  3RPN A;  4L5L A;  1YKC A;  3D5J A;  3Q74 A;  3HHV A;  1QXH A;  1R5P A;  2YZU A;  1E6B A;  4Q5N A;  1V2A A;  4MH3 A;  2WGR A;  1JFU A;  1X5C A;  2FWF A;  2IMK A;  6GSS A;  3L9U A;  4K7O A;  5ECS A;  1EP7 A;  3K8N A;  1DE2 A;  2WUL A;  4TN8 A;  4D73 A;  2IWT A;  1PSQ A;  2L59 A;  4BVX B;  2AUV A;  4LMV A;  3RAZ A;  2DJ0 A;  4JBB A;  4HJ2 A;  1YDK A;  2CVD A;  5AIV A;  2CX4 A;  5KN3 A;  3WGE A;  4KDY A;  4PX1 A;  1OE7 A;  4EDY A;  1EGO A;  3KMN A;  3CBU A;  3WT2 A;  2F51 A;  1YJ6 A;  1GTB A;  1XVW A;  5CAX A;  1ERW A;  1YQ1 A;  3KCM A;  2FHE A;  1RW1 A;  1SD9 A;  4IEL A;  4XRD A;  3C1R A;  4E8E A;  4ZXG A;  4HU9 A;  3RBT A;  1B8X A;  3TUE A;  4OFM A;  4BIK A;  5DCG A;  4MP4 A;  2TRX A;  3UL3 A;  1OE8 A;  2P5R A;  1MDK A;  2PPT A;  4YH2 A;  2VM1 A;  2ZUP A;  4GXZ A;  6GSU A;  5AIX A;  2X8C A;  2LRT A;  4HS1 A;  1QK8 A;  1SKW B;  1HNA A;  1K0M A;  1RK4 A;  1EGR A;  1FVK A;  1WOU A;  3FZ4 A;  2H0G A;  1PMT A;  2HFD A;  5DJM A;  3HXS A;  3GSS A;  1XVQ A;  2DKH A;  5H5Q A;  4IN0 A;  3MDK A;  2K18 A;  1HQO A;  2NDO A;  4CY8 A;  5DAL A;  2R37 A;  2JL4 A;  1XIY A;  3O76 A;  1JHB A;  4GSN A;  3QCP A;  3CSI A;  3SBC A;  3MYD A;  1GUL A;  1M99 A;  4YAV A;  4F0C A;  5A4W A;  2E2G A;  3KM6 A;  3TJB A;  3BCI A;  2CV4 A;  3A2V A;  2JSY A;  3CMI A;  4CHS A;  3E9J B;  1OC3 A;  4KUN A;  3LYP A;  4ACS A;  3US3 A;  3HVN A;  5B6N A;  3PR8 A;  3QFA C;  1GL8 A;  3ZL5 A;  2L4Q A;  5EVO A;  5CRE A;  1R7H A;  4P3Y B;  4JU5 A;  4KSO A;  5L71 A;  2YWO A;  5AN1 A;  1M2A A;  2A2R A;  3HVS A;  5JWQ B;  4BWS A;  1X5E A;  3FZA A;  3TGZ A;  3IK7 A;  4JR4 A;  2L6C A;  1S3D A;  4XIH A;  4ZB6 A;  3VWW A;  3ZVJ A;  20GS A;  2C3N A;  4GLT A;  2DC5 A;  3EYT A;  2TRC P;  2J9H A;  2VL2 A;  1BQ7 A;  5CRD A;  1XXU A;  4GQC A;  2O89 A;  5C04 A;  3IV4 A;  1B9Y C;  4TR1 A;  2G2Q A;  4JE1 A;  1TW9 A;  2VL3 A;  1R4W A;  1K3L A;  1ERV A;  3HZ8 A;  4POL A;  5JWO B;  1A24 A;  4GQF A;  3NZN A;  1WMJ A;  2HRN A;  4Z2U A;  3FRC A;  3EUR A;  4BA7 A;  2IL3 A;  1EP8 A;  1DUG A;  4XS4 B;  5FT3 A;  1K0N A;  3TDG A;  1T4Y A;  2YAN A;  4Z7X A;  3P2A A;  3QPM A;  3W6G A;  2ALB A;  1THX A;  3W8S A;  3GMF A;  3UVT A;  2GVP A;  1AC1 A;  2F3M A;  3TOU A;  2MBT A;  3RHB A;  2LUS A;  1NSW A;  5BMU A;  1GNE A;  1A0R P;  2L57 A;  5ECP B;  3UVH A;  4NPB A;  4PUF C;  4TR3 A;  1V9W A;  10GS A;  4E8H A;  2B5X A;  1W4V A;  2VIM A;  4HEA 2;  2LKU A;  5F8B A;  2YZH A;  3W8J A;  1IYI A;  1Q4J A;  1EOG A;  4OO4 A;  1Z9H A;  3TCO A;  1FVJ A;  4HI7 A;  3PH9 A;  4X1U A;  1URM A;  3QAV A;  1PGT A;  4BVX A;  2C1Y A;  4G2E A;  2DIY A;  1F3A A;  2BJX A;  5GAN D;  1TK5 B;  4J56 E;  3TKQ A;  3TJK A;  2RM5 A;  2XBI A;  1B48 A;  2VLT A;  2RUF A;  2GDR A;  4BPY A;  4MPG A;  2PER A;  5LCZ A;  2F8A A;  5F07 A;  3CYN A;  4CW9 A;  2I4A A;  3M9J A;  1LJR A;  4MJC A;  5DBQ A;  1OC9 B;  2LNT A;  4I2U A;  2H1G A;  4KCE A;  3EIN A;  3IDV A;  5FWG A;  5IO2 A;  2VCQ A;  3L0H A;  4I97 A;  1B4P A;  2CZ2 A;  3UBL A;  5ECO B;  4G19 A;  2F9S A;  2E2M A;  1AQX A;  2R0P A;  1ZMA A;  1PN0 A;  1S3R A;  3H4K A;  3UAR A;  5CYY A;  3BOA A;  1U87 A;  2AB6 A;  2H1B A;  3TRX A;  2YWM A;  4G9H A;  4ECC A;  2YOI A;  4QL9 A;  3QFB C;  1EZK A;  4WF5 A;  3ZIV A;  2KP2 A;  2KOK A;  5IQY A;  2PU9 C;  4USS A;  4ZB8 A;  1YF1 A;  1XZO A;  3D21 A;  1PL1 A;  2LST A;  3APS A;  2EIO A;  1KNG A;  5G1K A;  3GL3 A;  1GUH A;  3I9V 2;  1A23 A;  4KCA A;  3ERF A;  1UN2 A;  2UZ8 A;  3JCM L;  1BYE A;  1CQH A;  3GHA A;  4CY6 A;  2LQQ A;  4EDZ A;  3KH9 A;  2HRK A;  3P7X A;  5G5E A;  2LNS A;  2XC2 A;  5DJL A;  3TRQ A;  3M8N A; 
#chains in the Genus database with same CATH homology
 4DVC A;  4WKW A;  1K0D A;  2PGT A;  1J08 A;  3HJM A;  2VLV A;  5AGY A;  2IMI A;  2LTK A;  3QAW A;  1U6T A;  1JZW A;  4ULX A;  5JWR B;  3IC8 A;  1PX6 A;  1A8Y A;  1Z7R A;  2GQL A;  4PNG A;  2PBJ A;  1WJK A;  4MJA A;  4ML1 A;  4IW9 A;  2F8F A;  3VLN A;  3D4T A;  3DWV A;  1R26 A;  2A2P A;  1FOH A;  1T1V A;  2HSM A;  4EXJ A;  2YCD A;  4X4J A;  4O7H A;  1F3B A;  2VL2 C;  5ECK B;  3KIJ A;  2JZT A;  3BBY A;  3TKR A;  4EIQ A;  2X4A A;  4RQR A;  1J9B A;  3AY8 A;  5ECH B;  1GLQ A;  3LEF A;  3M1G A;  3KEB A;  5J41 A;  5F06 A;  2KLX A;  1MD4 A;  5ELA A;  2H1D A;  5KEJ A;  2H6Y A;  4MF5 A;  2DLX A;  4ZBD A;  3D6I A;  3F3Q A;  1Z6N A;  4MF7 A;  4BWQ A;  1AUC A;  2O85 A;  2P0G A;  4HQS A;  2MMA A;  1H75 A;  2C0F A;  5DCH A;  4XS4 A;  4OFN A;  3GUS A;  1ERU A;  1VRS D;  5HR1 A;  2K8S A;  2O7K A;  2GGT A;  5LD0 A;  4K2X A;  1T7P B;  1UC7 A;  2NBS A;  5ELG A;  1U3I A;  2FWH A;  1LBK A;  1VF3 A;  2R0C A;  1K3O A;  3MWH A;  5A4V A;  2HNL A;  4NMU A;  1A2L A;  3MIX A;  2X8H A;  4OMV A;  3UAP A;  2VD1 A;  3FYG A;  2H71 A;  1GTA A;  1J0F A;  1X9S B;  1DSB A;  3R3E A;  1AQV A;  2X8G A;  3G7Y A;  4MA9 A;  4N11 A;  1MDJ A;  2X99 A;  3ZZX A;  2I1U A;  1Y25 A;  4MH2 A;  3N5O A;  5B8A A;  5CRH A;  1OAZ A;  3L9V A;  2GS3 A;  2H74 A;  2OE0 A;  5EPF A;  1A0F A;  1O8W A;  1GH2 A;  5GSS A;  2YN1 A;  1ACV A;  5CP1 A;  3E0U A;  5G2Z A;  3E3E A;  4AJ6 A;  2LJK A;  3CXG A;  4O5U A;  4GF0 A;  4G10 A;  1JZD A;  3TRP A;  4KA0 A;  3TB2 A;  1SK1 A;  4MNN A;  2PVO C;  5F0G A;  3I43 A;  3KJY A;  2WRT A;  4MJB A;  1HYU A;  2GT6 A;  1Z7P A;  4TR0 A;  3KGK A;  4N30 A;  4HZ4 A;  2WCI A;  1GUK A;  1V98 A;  4G0L A;  22GS A;  1AW9 A;  4K0G A;  3J7Y k;  4O92 A;  1U3A A;  4XCS A;  3F8U A;  4LL1 B;  1ON4 A;  2V2G A;  2FUG 2;  5IOW A;  2VM2 A;  3HVX A;  1TP9 A;  4RQX A;  3S9F A;  2I81 A;  1PN9 A;  1OC9 A;  1IYH A;  1QUW A;  4V1A g;  2HI7 A;  1O7U A;  2I3Y A;  3G7I A;  3KTL A;  4GCI A;  4Z2R A;  1MD3 A;  1YEP A;  4L0U A;  2L6D A;  1JLW A;  4YAP A;  4BL7 A;  4EF0 A;  1XOA A;  2LJA A;  2JAC A;  1GTU A;  2FA8 A;  4V2N A;  5GAP D;  3FK8 A;  4BVY B;  3ME7 A;  3EWL A;  4EL1 A;  2IME A;  1SK2 A;  4H86 A;  2XPE A;  1YY7 A;  3IHG A;  3LGC A;  4FO5 A;  1B4Q A;  2IMD A;  2B3S A;  2V6O A;  1Z3E A;  5BRT A;  2E7P A;  4KW6 A;  3IC4 A;  3ERW A;  5INY A;  3MSZ A;  1TI3 A;  1LU4 A;  3L78 A;  1HNB A;  2CZ3 A;  2V1M A;  4V2L A;  4MMM A;  1T4Z A;  5IIZ A;  1SYX A;  2N5A A;  3GA4 A;  4TXO B;  3F6F A;  5AIS A;  4GSS A;  2DJK A;  3L9S A;  1TTZ A;  5J9B A;  1Z6M A;  3DD3 A;  17GS A;  5C00 A;  2B6M A;  2AYT A;  2FWE A;  3VK9 A;  3LXZ A;  4GST A;  2H19 A;  4POB A;  3KZQ A;  2JSZ A;  3EE2 A;  2IIY A;  1SJZ A;  4MK3 A;  2K6V A;  4IVF A;  3U6V A;  4WR4 A;  2DJ1 A;  1TU8 A;  2L4C A;  3PGT A;  4FH8 A;  4IQ1 A;  1SEN A;  3H1N A;  1TRW A;  3UJ1 A;  1BAY A;  2EIR A;  1X0R A;  3GTU B;  4EC0 A;  2KHP A;  2LS5 A;  2GSR A;  3GKM A;  4Q5F A;  2I9H A;  2A2S A;  3VFI A;  4XRA A;  4IKH A;  2JZR A;  4I2T A;  2C8U A;  1FOV A;  4LMW A;  2B7J A;  6GSX A;  3DXB A;  2LEG A;  1SJI A;  4ZL8 A;  3VI5 A;  3H79 A;  1F9M A;  2OBI A;  3LQ7 A;  3GKN A;  2CAQ A;  4PQ1 A;  4F03 A;  1BG5 A;  2DBC A;  1SYR A;  4KND A;  4YQV A;  1UVZ A;  8GSS A;  2VUP A;  1XW5 A;  1YKA A;  2BTO T;  3ED3 A;  4TXV A;  3SWL A;  3DRN A;  1WWJ A;  1PD2 1;  5ECI B;  4WBR D;  5J3R A;  2MBS A;  3IR4 A;  4XS6 A;  1TI1 A;  4I6X A;  2ZCT A;  1TOF A;  5JCG A;  1X9W B;  3IE3 A;  4K7I A;  5IMF A;  4K0N A;  2PMT A;  1GLP A;  2R4V A;  3NOF A;  4ZBB A;  2VAF A;  4MPF A;  2IMF A;  5KN2 A;  3GYK A;  1K0C A;  2MZC A;  3HKR A;  3ZML A;  1WIK A;  4KB3 A;  4I5Q A;  1PQN A;  4TKY A;  3C1S A;  4KE3 A;  5CRG A;  4NWY A;  1X9M B;  4ZIL A;  3IOS A;  3GST A;  3F63 A;  3ERG A;  4IP6 A;  2IFQ B;  1E2Y A;  4K7N A;  5D9T A;  4NV5 A;  2DJJ A;  3F6D A;  5B6M A;  2VCT A;  5D9X A;  1PX7 A;  4AJ8 A;  3HD5 A;  1K3Y A;  3MNG A;  2YWI A;  3TJF A;  5DQS A;  2CQ9 A;  2HRA A;  1CQG A;  2AV4 A;  2CA8 A;  3EVI A;  1XCC A;  1K0O A;  1GSQ A;  5B7C A;  2JU5 A;  1GUM A;  5DAK B;  3A2X A;  4KDU A;  1VF4 A;  4J57 E;  3HCZ A;  1DE1 A;  1SD8 A;  2ON7 A;  3IXR A;  4TVE A;  2J23 A;  4YKF A;  3Q6O A;  1H4O A;  5KN0 A;  3FR6 A;  2WB9 A;  3GFK A;  1GSF A;  3DIE A;  6GSY A;  1ST9 A;  2H6X A;  2DJ3 A;  1WE0 A;  3O6T A;  2V6K A;  1XWK A;  3QR6 A;  5G5F A;  3DML A;  4XS1 A;  2RII A;  2LRN A;  4OCF A;  2BMX A;  5HQP A;  1ILO A;  1I5G A;  4Q5Q A;  2Z9S A;  2OA7 A;  4GWR A;  3TOT A;  4BVY A;  4BL7 B;  1XW6 A;  2C0G A;  2YNX A;  4YQU A;  5IMZ A;  3CSJ A;  4PQH A;  3TKS E;  1F2E A;  2RLI A;  2QC7 A;  3HA9 A;  1FG4 A;  2OE1 A;  3LOR A;  5A4U A;  12GS A;  2H72 A;  4O5Q A;  1BX9 A;  3VWU A;  4ML6 A;  3P8W A;  4MDC A;  5ECM B;  2MMZ A;  2O8V B;  1K0A A;  2DMM A;  1OYJ A;  3GRX A;  4TXO A;  1UA5 A;  2JZS A;  5B8B A;  2H1A A;  3VWV A;  3DYR A;  4PQI A;  2H30 A;  2WDU A;  2EIQ A;  5HFG A;  5IMV A;  4MLY A;  1ZYE A;  3FZ5 A;  1BED A;  4IBP A;  4F2I A;  4A5P A;  2ES7 A;  1AXD A;  2M72 A;  4IJI A;  4GTU A;  1MTC A;  3VWX A;  4V1A p;  1A8L A;  3HDC A;  4WBJ A;  4K2D A;  1ZGN A;  2WFC A;  4IS0 A;  1VGL A;  3GKK A;  3IA1 A;  2FA4 A;  1SU9 A;  2GZP A;  3KXO A;  4L5O A;  3GTU A;  3HY2 A;  2C4J A;  4KX4 A;  3BD2 A;  5IPG A;  2EC4 A;  5D93 A;  3TJJ A;  2XBQ A;  3QDN A;  4KSM A;  3D4M A;  1X5D A;  2FD3 A;  2OBK A;  3HVV A;  1TJD A;  3F4R A;  4TOP A;  2DML A;  2DJ2 A;  14GS A;  2JAD A;  2GST A;  3F3R A;  3GNJ A;  3ME8 A;  2IPA A;  3LYK A;  1RQM A;  3KP9 A;  2OJL A;  2GZZ A;  3CRU A;  2YJH A;  4NHW A;  4PGT A;  1GSS A;  1EWX A;  4EVM A;  1M2B A;  4WEY A;  2ZNM A;  3I69 A;  3UBK A;  5HR0 A;  2HSH A;  5HFK A;  3TJG A;  3EMX A;  2XHF A;  1M9B A;  1PA3 A;  2G0F A;  2FCH A;  2YP6 A;  2M46 A;  2QA2 A;  1O6J A;  2RM6 A;  2HRF A;  3LXT A;  1XWB A;  1EOH A;  2GQM A;  5HFI A;  3FR3 A;  2C3Q A;  5IM9 A;  5JCU A;  4HUA A;  3ZIJ A;  1F6M C;  4PUR A;  1C72 A;  4FYB A;  3DGQ A;  2L5O A;  3F9U A;  3ZYW A;  2IFQ A;  2CX3 A;  1ZL9 A;  2H6Z A;  5JCW A;  1XWA A;  3ZFL A;  2X64 A;  4OWY A;  4FYU A;  1B9X C;  1O8X A;  4AGS A;  2H01 A;  4DSR A;  4IGJ A;  3CSH A;  5G30 A;  2TIR A;  2YPM A;  2A4H A;  4AJ7 A;  3FZ9 A;  2VCX A;  9GSS A;  4CDO A;  4I8B A;  1O81 A;  2HT9 A;  2VO4 A;  5H5R A;  4JZQ A;  4MF6 A;  4HQZ A;  1XFL A;  5CNW A;  5DAK A;  2VLU A;  3PIN A;  3GH6 A;  5G1L A;  3I6A A;  3GX0 A;  2VCZ A;  5DDL A;  1XPV A;  2C0D A;  3ZIT A;  3HZ4 A;  3HJO A;  3ZRD A;  4NV2 A;  3EC3 A;  4HU7 A;  7GSS A;  3DVW A;  2H75 A;  1S3A A;  1QQ2 A;  3F4T A;  11GS A;  5J5N A;  3UOM A;  1ZZY A;  4ISD A;  2IJY A;  5IOX A;  1GSD A;  1GSY A;  5F05 A;  2QGV A;  2H0I A;  1PKW A;  2CT6 A;  1SK0 A;  4ZL9 A;  4ZL7 A;  4PNF A;  4KGI A;  4MAB A;  4HOJ A;  5KOW A;  1G7O A;  4DSQ A;  4ECI A;  1WP0 A;  3FHK A;  2R2J A;  1PL2 A;  5IMD A;  4ECJ A;  1TKD B;  3LJR A;  2HE3 A;  3A3T A;  3GX8 A;  3APO A;  2PVQ A;  3HJP A;  4EE0 A;  3N9J A;  5E59 A;  4ZBA A;  4F0B A;  2KUC A;  2NTO A;  2C80 A;  4N10 A;  3WGD A;  2HZE A;  1M9A A;  3IRA A;  2OAD A;  4DSS A;  1KEB A;  2HYX A;  5D8I A;  4OCE A;  13GS A;  4IP1 A;  1TDI A;  3WD6 A;  1THO A;  3C71 A;  2VOC A;  4WXT A;  3FMW A;  5ECR B;  4OFT A;  2GSQ A;  2GSS A;  2XPD A;  1QGV A;  3GH9 A;  5A5K A;  1EEJ A;  4O32 A;  1AIU A;  4MCU A;  2VCV A;  1FB0 A;  2HLS A;  4G0K A;  3LW9 A;  4N0Z A;  1USB A;  1Y6E A;  2REM A;  1F37 A;  2H8L A;  4JED A;  1MEK A;  4TW5 A;  1N2A A;  4LL4 B;  3FEU A;  1KTE A;  2L5L A;  4PXO A;  1QMV A;  2H73 A;  2HXK A;  1ML6 A;  3IK9 A;  1YZX A;  2R3X A;  2QSI A;  1XW9 A;  2A4V A;  3IPZ A;  3H93 A;  4Q5R A;  3L4N A;  4LA1 A;  1G6W A;  3V1W A;  3TKS A;  3IHQ A;  1TRS A;  3FW2 A;  2E0Q A;  5DVB A;  2H0H A;  2OAC A;  1WPI A;  2P31 A;  3P90 A;  4MJE A;  4L8E A;  4POM A;  1R5A A;  5G31 A;  1G6Y A;  3VPT A;  5IPH A;  3ZFB A;  4GRF A;  2ON5 A;  4WF4 A;  1NM3 A;  2O87 A;  3GIX A;  4TR4 A;  1MDI A;  2R0G A;  4JR6 A;  16GS A;  2D2Z A;  2YJ7 A;  1G0T A;  1AQW A;  1EV9 A;  2M80 A;  1OKD A;  2K9F A;  1ZYN A;  1TK8 B;  3FY7 A;  4LLR A;  4ICY A;  4XTS A;  5ENU A;  1K0B A;  4K8M A;  5ECL B;  3A5I A;  1FO5 A;  4RI7 A;  3TKP A;  5ID2 B;  1XOB A;  3FR9 A;  2RUE A;  3QOU A;  4J2F A;  4V2M A;  2B1L A;  5LNK e;  1NHY A;  2C0E A;  1FHE A;  3LG6 A;  1PKZ A;  1SL2 B;  2PN8 A;  1M2D A;  1U88 A;  4ID0 A;  3C73 A;  2OE3 A;  2NPB A;  4HJM A;  3KTB A;  2WZ9 A;  1SJ6 A;  2LQO A;  4O5R A;  3M9K A;  5D73 A;  1G7E A;  3BCK A;  4ILF A;  4FQU A;  3D22 A;  2YWN A;  3G7J A;  4EUY A;  4NXI A;  2LJR A;  1QFN A;  1VF2 A;  4K1F A;  3ZLP A;  1XWC A;  4ZB9 A;  3VUR A;  1FB6 A;  4FYC A;  2KP1 A;  1GP1 A;  2PUK C;  1JZO A;  1Z5Y E;  3UMA A;  4IJ3 A;  1AAZ A;  1VF1 A;  2B7K A;  1A2M A;  3GUR A;  5J9C A;  1O73 A;  3ZRE A;  3HYP A;  2QKE A;  3KMO A;  1T00 A;  4MZB A;  3LFL A;  2FGX A;  5E4W A;  1T8E B;  5KOX A;  1ZOF A;  1JZR A;  1TRV A;  1SKR B;  2K8V A;  3M3M A;  3F0I A;  5D9W A;  4G0I A;  5D96 A;  6GSW A;  1GNW A;  1XBS A;  1GTI A;  5COH A;  4X43 A;  3ZMK A;  2H66 A;  4AF2 A;  5ABR A;  3LWA A;  2VL9 A;  2CAI A;  1V58 A;  3WYW A;  1I9D A;  2WS2 A;  3FKF A;  3DEX A;  3F4S A;  2MYG A;  1PRX A;  3ZVJ D;  1WRY A;  4OD7 A;  3C7M A;  5CO3 A;  3RDW A;  2YV9 A;  4OO5 A;  5GST A;  3VI7 A;  4F9Z A;  3A5W A;  3DKS A;  2MMN A;  1EEM A;  4ZIJ A;  1ABA A;  2B5E A;  4D73 B;  3CTF A;  1TU7 A;  3EMP A;  5IO0 A;  2R6K A;  3BJ5 A;  1OC8 A;  2QA1 A;  1SKS B;  4N0V A;  1SL1 B;  4MZC A;  4EKZ A;  4Z2T A;  2N5F A;  1FW1 A;  2HZF A;  4K6X A;  1OVN A;  2N5B A;  3QAG A;  3IAS 2;  19GS A;  4QL7 A;  2AJQ B;  1YEX A;  5IMA A;  4XHM A;  2HZE B;  4RUV A;  4L0W A;  2LRC A;  3QMX A;  3NIV A;  4DSS B;  1ERT A;  1ZCP A;  1V40 A;  3R2Q A;  4KH7 A;  2V32 A;  4NHZ A;  4K5R A;  2IN3 A;  5GZZ B;  4HDE A;  4PUA A;  4WR5 A;  1HNC A;  3M0F A;  3GV1 A;  4K5S A;  5HR2 A;  4NAX A;  1KBN A;  3Q19 A;  4IHU A;  4FIW A;  2NVL A;  2VCW A;  3GL5 A;  1W89 A;  1GWC A;  2P5Q A;  3TKS C;  3EU3 A;  2CVK A;  4EIP A;  3J7Y b;  2FLS A;  3ISO A;  2B5Y A;  4DEJ A;  5DAL B;  3Q18 A;  5EY6 A;  1NHO A;  3EPT A;  2R5G A;  1M0U A;  4PTS A;  2GT5 A;  2FNO A;  3KH7 A;  4JRR A;  1EV4 A;  2FY6 A;  1XWG A;  2WJU A;  5D9V A;  3G9B A;  5J4U A;  3O3T A;  3APQ A;  1NW2 A;  5IMC A;  3ZTL A;  2YV7 A;  1N8J A;  3LSZ A;  1GSE A;  3WGX A;  2AHE A;  3D0Z A;  18GS A;  4KAE A;  2GZY A;  5CRW A;  2LV3 A;  1TK0 B;  4YKG A;  4RI6 A;  4KDX A;  4WET A;  2V41 A;  1Q98 A;  3H8Q A;  4F82 A;  5FHI A;  3KD0 A;  5ID2 A;  5KN1 A;  2GTU A;  2DKI A;  2H76 A;  5ECQ B;  3IBH A;  4HZ2 A;  1YF0 A;  3CTG A;  1O85 A;  2MMO A;  1DBY A;  1GSU A;  2B1K A;  4ECB A;  1SL0 B;  5H5S A;  4EO3 A;  4TR1 B;  2HSY A;  1ZYQ B;  2DSA A;  2C3T A;  3UIW A;  3UEM A;  3KP8 A;  1S3C A;  3GN3 A;  4IQA A;  3U5R E;  2GLR A;  3EU4 A;  4MZW A;  4POK A;  6GSV A;  3MAK A;  2DIZ A;  3IAM 2;  3PPU A;  2OKA A;  5ECN B;  1ZYP A;  2VD0 A;  3A2W A;  4YQM A;  2H70 A;  3RHC A;  1GRX A;  1T3B A;  3QD9 A;  2PWJ A;  2X49 A;  3CRT A;  2CVB A;  2FWG A;  4KF9 A;  1HD2 A;  3WT1 A;  1BJX A;  1JLV A;  3DVX A;  4X0X A;  5HR3 A;  3C8E A;  3VPQ A;  3GKX A;  1A2J A;  1FAA A;  1TXX A;  6GST A;  3RPP A;  1TRU A;  3OR5 A;  5DQY A;  1OKT A;  2GQK A;  4QQ7 A;  4K9Z A;  4TRX A;  1M7T A;  1V57 A;  2AAW A;  5EL8 A;  3RPN A;  4L5L A;  1YKC A;  3D5J A;  3Q74 A;  3HHV A;  1QXH A;  1R5P A;  2YZU A;  1E6B A;  4Q5N A;  1V2A A;  4MH3 A;  2WGR A;  1JFU A;  1X5C A;  2FWF A;  2IMK A;  6GSS A;  3L9U A;  4K7O A;  5ECS A;  1EP7 A;  3K8N A;  1DE2 A;  2WUL A;  4TN8 A;  4D73 A;  2IWT A;  1PSQ A;  2L59 A;  4BVX B;  2AUV A;  4LMV A;  3RAZ A;  2DJ0 A;  4JBB A;  4HJ2 A;  1YDK A;  2CVD A;  5AIV A;  2CX4 A;  5KN3 A;  3WGE A;  4KDY A;  4PX1 A;  1OE7 A;  4EDY A;  1EGO A;  3KMN A;  3CBU A;  3WT2 A;  2F51 A;  1YJ6 A;  1GTB A;  1XVW A;  5CAX A;  1ERW A;  1YQ1 A;  3KCM A;  2FHE A;  1RW1 A;  1SD9 A;  4IEL A;  4XRD A;  3C1R A;  4E8E A;  4ZXG A;  4HU9 A;  3RBT A;  1B8X A;  3TUE A;  4OFM A;  5DCG A;  4MP4 A;  2TRX A;  3UL3 A;  1OE8 A;  2P5R A;  1MDK A;  2PPT A;  4YH2 A;  2VM1 A;  2ZUP A;  4GXZ A;  6GSU A;  5AIX A;  2X8C A;  2LRT A;  4HS1 A;  1QK8 A;  1SKW B;  1HNA A;  1K0M A;  1RK4 A;  1EGR A;  1FVK A;  1WOU A;  3FZ4 A;  2H0G A;  1PMT A;  2HFD A;  5DJM A;  3HXS A;  3GSS A;  1XVQ A;  2DKH A;  5H5Q A;  4IN0 A;  3MDK A;  2K18 A;  1HQO A;  2NDO A;  4CY8 A;  5DAL A;  2R37 A;  2JL4 A;  1XIY A;  3O76 A;  1JHB A;  4GSN A;  3QCP A;  3CSI A;  3SBC A;  3MYD A;  1GUL A;  1M99 A;  4YAV A;  4F0C A;  5A4W A;  2E2G A;  3KM6 A;  3TJB A;  3BCI A;  2CV4 A;  3A2V A;  2JSY A;  3CMI A;  4CHS A;  3E9J B;  1OC3 A;  4KUN A;  3LYP A;  4ACS A;  3US3 A;  5B6N A;  3PR8 A;  3QFA C;  1GL8 A;  3ZL5 A;  2L4Q A;  5EVO A;  5CRE A;  1R7H A;  4P3Y B;  4JU5 A;  4KSO A;  5L71 A;  2YWO A;  5AN1 A;  1M2A A;  2A2R A;  3HVS A;  5JWQ B;  4BWS A;  1X5E A;  3FZA A;  3TGZ A;  3IK7 A;  4JR4 A;  2L6C A;  1S3D A;  4XIH A;  4ZB6 A;  3VWW A;  3ZVJ A;  20GS A;  2C3N A;  4GLT A;  2DC5 A;  3EYT A;  2TRC P;  2J9H A;  2VL2 A;  1BQ7 A;  5CRD A;  1XXU A;  4GQC A;  2O89 A;  5C04 A;  3IV4 A;  1B9Y C;  4TR1 A;  2G2Q A;  4JE1 A;  1TW9 A;  2VL3 A;  1R4W A;  1K3L A;  1ERV A;  3HZ8 A;  4POL A;  5JWO B;  1A24 A;  4GQF A;  3NZN A;  1WMJ A;  2HRN A;  4Z2U A;  3FRC A;  3EUR A;  4BA7 A;  2IL3 A;  1EP8 A;  1DUG A;  4XS4 B;  5FT3 A;  1K0N A;  3TDG A;  1T4Y A;  2YAN A;  4Z7X A;  3P2A A;  3QPM A;  3W6G A;  2ALB A;  1THX A;  3W8S A;  3GMF A;  3UVT A;  2GVP A;  1AC1 A;  2F3M A;  3TOU A;  2MBT A;  3RHB A;  2LUS A;  1NSW A;  5BMU A;  1GNE A;  1A0R P;  2L57 A;  5ECP B;  3UVH A;  4NPB A;  4PUF C;  4TR3 A;  1V9W A;  10GS A;  4E8H A;  2B5X A;  1W4V A;  2VIM A;  4HEA 2;  2LKU A;  5F8B A;  2YZH A;  3W8J A;  1IYI A;  1Q4J A;  1EOG A;  4OO4 A;  1Z9H A;  3TCO A;  1FVJ A;  4HI7 A;  3PH9 A;  4X1U A;  1URM A;  3QAV A;  1PGT A;  4BVX A;  2C1Y A;  4G2E A;  2DIY A;  1F3A A;  2BJX A;  5GAN D;  1TK5 B;  4J56 E;  3TKQ A;  3TJK A;  2RM5 A;  2XBI A;  1B48 A;  2VLT A;  2RUF A;  2GDR A;  4BPY A;  4MPG A;  2PER A;  5LCZ A;  2F8A A;  5F07 A;  3CYN A;  4CW9 A;  2I4A A;  3M9J A;  1LJR A;  4MJC A;  5DBQ A;  1OC9 B;  2LNT A;  4I2U A;  2H1G A;  4KCE A;  3EIN A;  3IDV A;  5FWG A;  5IO2 A;  2VCQ A;  3L0H A;  4I97 A;  1B4P A;  2CZ2 A;  3UBL A;  5ECO B;  4G19 A;  2F9S A;  2E2M A;  1AQX A;  2R0P A;  1ZMA A;  1PN0 A;  3H4K A;  3UAR A;  5CYY A;  3BOA A;  1U87 A;  2AB6 A;  2H1B A;  3TRX A;  2YWM A;  4G9H A;  4ECC A;  2YOI A;  4QL9 A;  3QFB C;  1EZK A;  4WF5 A;  3ZIV A;  2KP2 A;  2KOK A;  5IQY A;  2PU9 C;  4USS A;  4ZB8 A;  1YF1 A;  1XZO A;  3D21 A;  1PL1 A;  2LST A;  3APS A;  2EIO A;  1KNG A;  5G1K A;  3GL3 A;  1GUH A;  3I9V 2;  1A23 A;  4KCA A;  3ERF A;  1UN2 A;  2UZ8 A;  3JCM L;  1BYE A;  1CQH A;  3GHA A;  4CY6 A;  2LQQ A;  4EDZ A;  3KH9 A;  2HRK A;  3P7X A;  5G5E A;  2LNS A;  2XC2 A;  5DJL A;  3TRQ A;  3M8N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...