1ZYNA

Oxidized structure of the n-terminal domain of salmonella typhimurium ahpf
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
196
structure length
196
Chain Sequence
MLDTNMKTQLRAYLEKLTKPVELIATLDDSAKSAEIKELLAEIAELSDKVTFKEDNTLPVRKPSFLITNPGSQQGPRFAGSPLGHEFTSLVLALLWTGGHPSKEAQSLLEQIRDIDGDFEFETYYSLSCHNCPDVVQALNLMAVLNPRIKHTAIDGGTFQNEITERNVMGVPAVFVNGKEFGQGRMTLTEIVAKVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Alkyl hydroperoxide reductase subunit F
publication title Oxidized and synchrotron cleaved structures of the disulfide redox center in the N-terminal domain of Salmonella typhimurium AhpF
pubmed doi rcsb
source organism Salmonella typhimurium
total genus 63
structure length 196
sequence length 196
chains with identical sequence B
ec nomenclature ec 1.8.1.-:
pdb deposition date 2005-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13192 Thioredoxin_3 Thioredoxin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.80 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1zynA00
4YKFA 4MNNA 4O5UA 1ZYPA 4O5QA 4YKGA 1ZYNA
chains in the Genus database with same CATH superfamily
1XZOA 2R5GA 1SKRB 2A2PA 1SJ6A 4ZB8A 2DKIA 1ZYPA 4K7IA 2TRCP 3GKXA 4OMVA 2VLVA 4RQRA 4G2EA 2PERA 5JCGA 1PQNA 1HNAA 3CYNA 1QFNA 2QGVA 2UZ8A 2H70A 3BOAA 2B5YA 4O5RA 4EE0A 4L5OA 2YCDA 3IC8A 5ECOB 3C1RA 1K0DA 4RI6A 1M0UA 1USBA 1GTAA 3VPQA 1Z6MA 3HA9A 2C0GA 4ECCA 3MWHA 2M80A 1CQGA 4MPFA 2FD3A 12GSA 2YJHA 3UBLA 1A2MA 3CRTA 3VK9A 2HRKA 2CV4A 4MZWA 3FMWA 2FY6A 1H75A 4TR4A 3KM6A 2L4CA 2AB6A 2O8VB 2AJQB 4G19A 3ME7A 1PL2A 4KA0A 1VF4A 3V1WA 3DIEA 1SYRA 1WMJA 1NHOA 3GKKA 4ZL8A 4HQSA 2B1LA 4L5LA 4MZBA 4YAPA 4PUFC 3KZQA 5IOWA 3TOUA 2K9FA 3F4RA 3EMXA 2VL3A 4OO5A 3QPMA 1IYHA 4IBPA 3PPUA 1VF2A 2GGTA 4MJEA 2YJ7A 4ZB9A 1FB0A 4A5PA 4ECIA 4NXIA 3WGEA 3S9FA 3L78A 1S3DA 1AQWA 5JWQB 4WR5A 4XRAA 3M9JA 2HRFA 4K5SA 4IJIA 5D93A 1R5PA 3DGQA 2J23A 2E2GA 4I5QA 2K18A 2QA2A 6GSYA 5B7CA 2A2RA 1SK1A 3ZITA 5DAKB 2PU9C 1ST9A 1TI3A 1PRXA 5GSTA 3VI5A 1BG5A 3IR4A 4XS1A 4GLTA 5ECSA 4EVMA 3GH9A 3ZYWA 4D73A 20GSA 4DSQA 2OJLA 3TKSC 1VF3A 22GSA 2HZFA 4BPYA 2X64A 1AUCA 3FZ5A 5ECLB 3ERGA 1MEKA 2H0IA 2WRTA 2JACA 5HFIA 4E8HA 1T7PB 3ZZXA 1X5DA 2KUCA 1QUWA 2MZCA 4LMWA 4HJMA 3VWWA 4XS4B 2V32A 1BYEA 1DSBA 2C1YA 5D9TA 2HXKA 8GSSA 3EURA 1OVNA 4LL4B 3ISOA 3IXRA 2H1BA 3H93A 4O92A 4TXOB 1O7UA 3UL3A 5GAND 1Z9HA 3HYPA 1MTCA 3A5IA 3NIVA 1R4WA 1E2YA 4OFTA 2HLSA 4I97A 2V6OA 2GQKA 5HFGA 1F6MC 1T3BA 1F9MA 1XWAA 2GZPA 5F07A 2OBIA 4KGIA 3F63A 1SKSB 4FQUA 4K0NA 3KGKA 5IIZA 3DVXA 2RM6A 4DEJA 3N5OA 1ZCPA 4XS6A 4FYBA 4TN8A 4MH3A 2QA1A 2VOCA 1DE1A 4POMA 1GNEA 2V1MA 3EYTA 1MDKA 2FWEA 2GZZA 1NSWA 1PMTA 4X0XA 5H5QA 3ZVJA 2V6KA 3Q19A 5IQYA 2O85A 3IRAA 3GYKA 1RQMA 4NMUA 2VO4A 3M0FA 2TRXA 4N0ZA 11GSA 3UEMA 3H4KA 1FVJA 5G5EA 1TKDB 2GLRA 4CY6A 5KN2A 2HE3A 3L0HA 1GULA 5G30A 4PQ1A 1FG4A 3CQFA 4NPBA 3KTLA 5D9VA 3IC4A 2E7PA 5D9WA 3GUSA 5B6NA 5IMDA 2FCHA 1FOVA 4MLYA 3CSIA 1FW1A 1K0BA 4HUAA 2HNLA 2AUVA 2GVPA 1TRUA 4AJ8A 4G9HA 2H73A 3EWLA 3FKFA 4HEA2 1V9WA 5B8AA 5AN1A 2OKAA 2VCWA 5F06A 2D2ZA 2YP6A 3FR9A 4XHMA 3HZ4A 4HQZA 1WWJA 4MK3A 2R4VA 2N5BA 1B8XA 1EZKA 1QK8A 2C0DA 4KSOA 2K8VA 1Q4JA 3QR6A 2OE1A 3GFKA 1TRVA 4QQ7A 1W89A 1S3CA 3DWVA 2X8GA 1IYIA 5KOWA 3TKSE 3MSZA 3LYPA 4POKA 4PUAA 1XXUA 4MF7A 5IMFA 2CZ3A 3ZLPA 2H01A 3APSA 3QDNA 4RUVA 4Z2TA 1EGRA 1B48A 2IJYA 3TJJA 4I8BA 4Q5NA 4I6XA 5BMUA 2BTOT 3IBHA 2M46A 2FUG2 2L6CA 1K3OA 2VIMA 5D73A 3LEFA 1J9BA 4KX4A 3ED3A 3KP8A 4EIPA 3UIWA 2I1UA 4GQCA 6GSXA 3IK7A 1R26A 3QFBC 6GSWA 2JL4A 3ZMKA 3D21A 2B6MA 1BQ7A 5FHIA 1O73A 2ON5A 1LJRA 5CP1A 3J7Yb 4NAXA 1TI1A 1SKWB 4MCUA 5G31A 4PQHA 2PMTA 2YN1A 4ML1A 3FR6A 4OCEA 5CREA 3HD5A 2LSTA 4JE1A 1GP1A 3GKNA 1WP0A 4KB3A 2JZSA 2GZYA 1M7TA 2GT6A 3H1NA 4V2LA 5AIXA 1V57A 4IP1A 2PWJA 3C73A 4ZB6A 2IMEA 3ZIVA 3LW9A 3FR3A 3LGCA 1GUKA 5DALA 1JZDA 3ZVJD 3RDWA 2LKUA 2GS3A 2GQLA 5ECMB 1FB6A 4K5RA 1X9SB 4MH2A 3L9VA 4YAVA 4TR1B 1SD9A 4PTSA 3WYWA 4BL7A 4MJBA 1V98A 2IN3A 4GSNA 3LWAA 2KP2A 1F3AA 2XBQA 1YZXA 4ZILA 1G6WA 4GSTA 1T8EB 1YEPA 2CVBA 4IJ3A 3FW2A 1ABAA 1F3BA 1NW2A 17GSA 5AISA 4I2UA 2LJRA 4GSSA 1ERUA 4TVEA 1GSYA 5C04A 2AYTA 3OR5A 1Z5YE 1SENA 2YANA 1PL1A 2H1AA 5ECIB 4N30A 1N8JA 1X9WB 3BCIA 4K9ZA 5GAPD 1EP7A 3QFAC 3EPTA 5JWRB 1JLWA 2DMLA 3LSZA 1BX9A 1ZL9A 2XC2A 1OC9A 4DSRA 2HT9A 4Q5QA 1HYUA 4L0WA 5DJMA 2VL2C 1XFLA 3EMPA 2N5AA 1OAZA 4YQMA 1PN0A 2VUPA 4MJCA 5FWGA 1B4QA 2P31A 4KCEA 4WEYA 5AIVA 3VFIA 3ZIJA 2PVOC 3TKSA 1PGTA 1E6BA 4BVXB 1LU4A 2HFDA 4YH2A 1GRXA 4KNDA 2YZHA 3TJBA 18GSA 1SJIA 2I3YA 4OFNA 4EDZA 2EIQA 3ZRDA 3UJ1A 4BA7A 2R0PA 4IW9A 4PX1A 3O6TA 3TKQA 1X5EA 4F0BA 2LV3A 1JFUA 5GZZB 3ZREA 4PGTA 2OBKA 4IKHA 4YKGA 4KDYA 2B1KA 2KP1A 4KH7A 2FWHA 3KP9A 2RM5A 3APQA 1B9YC 1PA3A 1J0FA 1C72A 4LL1B 3UBKA 5J4UA 2YZUA 2VLUA 5G2ZA 2IWTA 3KXOA 4NHZA 3HVSA 1GWCA 3VI7A 4AGSA 1EOGA 2H74A 2VCQA 2RUFA 2JSYA 2WDUA 1ZMAA 5ECQB 4PNGA 2B3SA 1SL2B 1ERTA 4HZ4A 3M9KA 1M3JA 2ES7A 1U87A 3QCPA 4GXZA 1BJXA 4KDUA 2VL9A 1SK0A 1U6TA 3F3QA 3IHGA 2H71A 3W8SA 3PH9A 1X9MB 3I9V2 2C8UA 2AAWA 1MDJA 2VAFA 4EC0A 2IFQA 3EE2A 3R2QA 3WD6A 1UA5A 4OD7A 3IE3A 3VPTA 3HVVA 4KW6A 1I9DA 4IP6A 3KH7A 4YKFA 2K8SA 4ZXGA 4X4JA 1U88A 5ECRB 4YQUA 4HS1A 4LLRA 3ZFLA 3TKRA 2G0FA 4HDEA 4O5UA 3DRNA 5IO0A 1YKAA 2A4VA 2VM2A 3DVWA 1RW1A 3D22A 4P3YB 4X1UA 2B7KA 3U5RE 3SWLA 1QMVA 3G7IA 1MD4A 2NBSA 3RPPA 3GIXA 1SJZA 4N10A 2H6ZA 2WB9A 1AAZA 2CT6A 2I4AA 2GSQA 4LA1A 1EV4A 4NHWA 5KOXA 4HU7A 1K0OA 1M2BA 3RAZA 19GSA 4RI7A 1EEMA 3ME8A 4YQVA 3I69A 6GSTA 2LJKA 2HRAA 2WJUA 1ERVA 4NV2A 1O85A 2CVDA 2JZRA 3ZTLA 3GL5A 1HNCA 4HI7A 3BBYA 4F03A 5CRDA 1A0FA 2YV7A 1TRWA 3K8NA 2CA8A 2YOIA 3GTUB 1ERWA 5IMCA 5ID2B 2HRNA 5J9CA 3TJFA 3BD2A 3DMLA 1TOFA 1KEBA 5A5KA 3CXGA 4F9ZA 4JU5A 1SYXA 4FH8A 1ILOA 4BVYB 1XW5A 13GSA 5FT3A 3M3MA 1BEDA 2OE3A 4ZBAA 3Q6OA 3C1SA 2LEGA 2J9HA 2QKEA 2O89A 4XIHA 4POLA 1K0CA 4Z2RA 1OKDA 2YWMA 3US3A 1I5GA 5LCZA 2HZEB 2YWIA 4OO4A 1AC1A 2KHPA 1GSSA 1A23A 1TK5B 3VWUA 3EVIA 4PXOA 2CX4A 4OFMA 1FAAA 4GQFA 3VURA 4J57E 1G0TA 3IV4A 1Q98A 1Z3EA 2L57A 4ZL9A 1XCCA 4FYUA 1ZOFA 5A4UA 3HHVA 2WCIA 3QOUA 2FWFA 2FA4A 3L9SA 1A8YA 5JCWA 3U6VA 2FHEA 1SL0B 3FZAA 1FOHA 4JEDA 1JHBA 5LNKe 4KE3A 2YV9A 2E2MA 3MYDA 2WGRA 1TW9A 3A2XA 3TJKA 3ERWA 3HJPA 1AQVA 3F4TA 1FO5A 1B9XC 7GSSA 4EF0A 2R2JA 3Q18A 3F6DA 1TJDA 2I81A 2OA7A 1Y6EA 2GTUA 2C3TA 3UOMA 2F8FA 4EXJA 2YNXA 5CRGA 2R0GA 4EKZA 3MAKA 4FYCA 4K7OA 1XWBA 5ELAA 5ECNB 4J2FA 4F2IA 5CO3A 1O8XA 4TR3A 1DBYA 3WT1A 1MDIA 1O6JA 4I2TA 1M9AA 3F8UA 2ZNMA 1HD2A 4XCSA 3IA1A 3GSSA 2F51A 5H5RA 3IHQA 1PFOA 1F2EA 5INYA 1Z7RA 3EC3A 1KNGA 5DCGA 5J5NA 3A3TA 2DJ0A 1EV9A 3GL3A 3CMIA 1NM3A 4EO3A 6GSSA 2F8AA 5HR0A 3UVHA 1WPIA 4J56E 3UVTA 1CQHA 5KN0A 1GTBA 1PN9A 2AV4A 4KDXA 2PVQA 4BWQA 3LYKA 1V40A 4MP4A 3VLNA 2X49A 2XHFA 3O3TA 2CZ2A 5HQPA 1X5CA 1XOAA 5CYYA 5ECPB 1KBNA 1AQXA 1WIKA 1RK4A 2L5LA 3LXZA 1GUHA 4TW5A 2CX3A 3SBCA 4WETA 1R7HA 1ZZYA 1M99A 2H8LA 1U3AA 1M2DA 4GCIA 1PSQA 5DAKA 1VRSD 4G10A 2VL2A 3UARA 4GTUA 4IHUA 1DE2A 3FZ4A 5AGYA 1GSQA 5HR3A 4DSSB 2MMAA 2IMKA 3F0IA 1JZWA 2HSHA 3GHAA 1MD3A 3A2VA 1ZGNA 2I9HA 4D73B 2DJ1A 1TXXA 3EU4A 2VCXA 2R6KA 4PQIA 2OADA 5CNWA 3TCOA 3E3EA 1G7EA 3TRQA 2GT5A 1Y25A 1URMA 1TP9A 4E8EA 1K0AA 1DUGA 2MBTA 2OACA 3KMOA 1S3RA 3TRPA 2VLTA 4XS4A 2PGTA 4JRRA 2P5RA 4IGJA 2R0CA 1U3IA 4RQXA 1VGLA 1B4PA 2BJXA 4JR4A 1GSFA 6GSVA 4TXOA 2C3QA 4JBBA 5HFKA 5ECHB 2K6VA 3FZ9A 1YQ1A 3IK9A 3P90A 1XWGA 2B5XA 3D4TA 2LJAA 5EY6A 1QGVA 2ALBA 4MABA 5A4VA 2DBCA 4XRDA 1YDKA 2L59A 3GKMA 4MJAA 2LUSA 4NWYA 5B6MA 5F8BA 3QAVA 3HY2A 5CRHA 4KCAA 3QAWA 3WGXA 3KEBA 1WE0A 4ML6A 3ERFA 2C0FA 2LRNA 5EVOA 2H1DA 5A4WA 2FWGA 4V2NA 4ZL7A 2Z9SA 3L9UA 4GF0A 5D96A 3RPNA 1JZOA 2R37A 3HDCA 2A2SA 5EL8A 2YWNA 3TUEA 2GDRA 2M72A 5G1LA 3KD0A 2H19A 2LNTA 4ECBA 4BIKA 3L4NA 2HSYA 2YPMA 3KJYA 2L4QA 5F0GA 5JCUA 1TRSA 9GSSA 4MF5A 5DJLA 3P2AA 3KIJA 1KTEA 3CTGA 5C00A 4WR4A 4N0VA 1YY7A 1GLQA 2OE0A 3Q74A 1ML6A 1GTUA 2VCTA 4MF6A 2REMA 1T4YA 2C80A 3CSJA 2NPBA 3HZ8A 3DKSA 5EPFA 3TKPA 2H75A 5JWOB 4MPGA 1XWCA 4WKWA 1XG8A 5IM9A 4BWSA 3HJOA 2MBSA 1TTZA 3VWXA 5GSSA 3H79A 4V1Ap 3GH6A 3LORA 3ZFBA 1ZYNA 4GWRA 3TGZA 3G7YA 3RHBA 2ZUPA 1UC7A 1EGOA 1PX6A 1K3YA 2NDOA 4O7HA 4V2MA 1H4OA 2F9SA 4ZBDA 4WXTA 4MA9A 4JZQA 2X99A 4TOPA 1XW9A 1X0RA 3IDVA 2AHEA 2DLXA 3ZL5A 1F37A 3GX8A 2KOKA 1HNBA 2DIYA 2DIZA 3PINA 2FA8A 4FIWA 1WOUA 2JZTA 3D4MA 1A2JA 4IN0A 1A0RP 5ECKB 3F9UA 2GSSA 2MMNA 1SU9A 2V2GA 3QAGA 4G0IA 4AJ7A 3KH9A 3PR8A 2GSRA 2RLIA 3E9JB 2LTKA 1R5AA 1TU7A 2H72A 3C7MA 4POBA 5CRWA 2WZ9A 5IPHA 2RIIA 2ON7A 2QSIA 3A5WA 2X4AA 4PNFA 3F3RA 2H0GA 1XVQA 3TRXA 4ISDA 2YWOA 4G0LA 1OC3A 1BAYA 3MIXA 5F05A 4K1FA 2GSTA 5KEJA 2IMFA 2PPTA 4AJ6A 2LS5A 2DJ2A 5H5SA 5KN3A 1GSEA 4ZIJA 4HZ2A 1XPVA 2PUKC 3LG6A 3FK8A 1A2LA 4KAEA 1M3IA 2B5EA 4DSSA 2L6DA 4K0GA 1FHEA 1HQOA 1V2AA 5D9XA 3C8EA 3D6IA 4HSCX 2DJ3A 4K2DA 3W6GA 2NVLA 1ZYQB 3IOSA 2IPAA 3KTBA 1QQ2A 2LQOA 4ACSA 3LFLA 1XWKA 5DDLA 4HU9A 1ACVA 4Q5FA 4K6XA 4TXVA 14GSA 4K2XA 3D0ZA 4KUNA 4CHSA 3TJGA 2DKHA 3M1GA 5DALB 4TR1A 1G7OA 4EL1A 4JR6A 1N2AA 1A24A 2PBJA 2IMIA 4F0CA 5J41A 1OC8A 3KCMA 1T4ZA 1M9BA 4KSMA 2GQMA 4O32A 4AF2A 3AY8A 4BL7B 4MMMA 3GURA 3GRXA 1OYJA 3E0UA 2EIOA 4FO5A 5ENUA 2H30A 2O7KA 2EC4A 1S3AA 1THOA 2PN8A 2V41A 3R3EA 5LD0A 4EIQA 4K7NA 2C0EA 4IQAA 2E0QA 2L5OA 5L71A 4PURA 4IELA 4CW9A 1V58A 1YKCA 2IMDA 2MMZA 4TR0A 3IAS2 3RBTA 2P5QA 1GTIA 2XPDA 3ZMLA 2MYGA 3WGDA 3MDKA 2VCVA 3IAM2 1YEXA 3HXSA 1QXHA 1UN2A 1JLVA 2R3XA 1PKZA 3P8WA 1W4VA 4L0UA 4XTSA 1LBKA 1ZYEA 4OWYA 4HJ2A 3QD9A 5BRTA 3IPZA 4K8MA 1OC9B 3HVXA 5ABRA 3D5JA 3VWVA 4N11A 3UAPA 3RHCA 2WULA 3C71A 4BVXA 2LRTA 1TU8A 1G6YA 4MZCA 5DBQA 4CY8A 5IPGA 2JU5A 2DJKA 3BJ5A 4TRXA 2P0GA 3LXTA 1AIUA 1PX7A 5IMVA 3WT2A 1XOBA 4ILFA 10GSA 2HI7A 16GSA 2X8CA 1AW9A 3HJMA 2DMMA 3CRUA 3KMNA 4EDYA 1OE7A 3TOTA 3DYRA 1EP8A 5CAXA 1XIYA 3G9BA 3P7XA 2H66A 1AXDA 3EINA 1OE8A 2C3NA 1UVZA 1SD8A 2HSMA 1T00A 3CTFA 3DEXA 3GNJA 1GL8A 4ULXA 1GNWA 2WFCA 1TDIA 3A2WA 2H76A 3LJRA 1YJ6A 3N9JA 1YF0A 5E59A 5DCHA 4MNNA 4ZBBA 2H6XA 3FEUA 4KF9A 3DXBA 4DVCA 3BCKA 4WF4A 2FGXA 1ON4A 3GMFA 3NZNA 1WRYA 2LQQA 3M8NA 1SL1B 1FVKA 2CVKA 2H0HA 4WBRD 3TB2A 5KN1A 2G2QA 3FYGA 1PD21 5B8BA 4QL9A 4ID0A 2IIYA 1GUMA 1PKWA 3MNGA 2XPEA 2CAIA 2O87A 3F6FA 4F82A 1JZRA 2IFQB 3HKRA 3O76A 5HR2A 1SK2A 1EOHA 2WS2A 2C4JA 1XW6A 1TK8B 3DD3A 1GSDA 2A4HA 2VD0A 3I6AA 4IQ1A 2LNSA 5HR1A 2XBIA 4H86A 2IL3A 5ELGA 6GSUA 5E4WA 4V1Ag 2NTOA 5IOXA 1O81A 4IS0A 1XBSA 2B7JA 1GSUA 3EU3A 2FLSA 2JADA 2DJJA 1M2AA 3LQ7A 4X43A 1T1VA 4HOJA 2N5FA 4Z2UA 1YF1A 2DSAA 2KLXA 3FHKA 2X8HA 1Z6NA 4ICYA 4MDCA 3UMAA 5DVBA 2CAQA 3GX0A 4O5QA 5G1KA 4EUYA 4GRFA 3FRCA 5COHA 3GV1A 1EWXA 2EIRA 4USSA 5IMAA 4WBJA 3FY7A 4LMVA 1K0NA 2BMXA 3GTUA 3NOFA 2TIRA 4CDOA 3G7JA 4OCFA 5ID2A 2FNOA 2JSZA 5IMZA 3PGTA 1K3LA 1XVWA 3J7Yk 2H1GA 4Z7XA 3HCZA 1EEJA 4IVFA 2H6YA 2CQ9A 4BVYA 2VM1A 2QC7A 1K0MA 2LRCA 2F3MA 4ECJA 4NV5A 1NHYA 2MMOA 1A8LA 3H8QA 4WF5A 4G0KA 4L8EA 5G5FA 3APOA 3F4SA 5J9BA 5DQSA 1J08A 3TDGA 1GH2A 4TKYA 2HZEA 5IO2A 2ZCTA 3GA4A 1OKTA 2VD1A 1THXA 3I43A 2DC5A 1Z7PA 3JCML 2RUEA 5DQYA 3W8JA 1GLPA 1O8WA 1TK0B 4QL7A 5J3RA 5D8IA 1WJKA 3CSHA 4Q5RA 3CBUA 2HYXA 3GN3A 1VF1A 3GSTA 2VCZA 3HVNA 3QMXA
chains in the Genus database with same CATH topology
1XZOA 2R5GA 1SKRB 2A2PA 1SJ6A 4ZB8A 2DKIA 1ZYPA 4K7IA 2TRCP 3GKXA 4OMVA 2VLVA 4RQRA 4G2EA 2PERA 5JCGA 1PQNA 1HNAA 3CYNA 1QFNA 2QGVA 2UZ8A 2H70A 3BOAA 2B5YA 4O5RA 4EE0A 4L5OA 2YCDA 3IC8A 5ECOB 3C1RA 1K0DA 4RI6A 1M0UA 1USBA 1GTAA 3VPQA 1Z6MA 3HA9A 2C0GA 4ECCA 3MWHA 2M80A 1CQGA 4MPFA 2FD3A 12GSA 2YJHA 3UBLA 1A2MA 3CRTA 3VK9A 2HRKA 2CV4A 4MZWA 3FMWA 2FY6A 1H75A 4TR4A 3KM6A 2L4CA 2AB6A 2O8VB 2AJQB 4G19A 3ME7A 1PL2A 4KA0A 1VF4A 3V1WA 3DIEA 1SYRA 1WMJA 1NHOA 3GKKA 4ZL8A 4HQSA 2B1LA 4L5LA 4MZBA 4YAPA 4PUFC 3KZQA 5IOWA 3TOUA 2K9FA 3F4RA 3EMXA 2VL3A 4OO5A 3QPMA 1IYHA 4IBPA 3PPUA 1VF2A 2GGTA 4MJEA 2YJ7A 4ZB9A 1FB0A 4A5PA 4ECIA 4NXIA 3WGEA 3S9FA 3L78A 1S3DA 1AQWA 5JWQB 4WR5A 4XRAA 3M9JA 2HRFA 4K5SA 4IJIA 5D93A 1R5PA 3DGQA 2J23A 2E2GA 4I5QA 2K18A 2QA2A 6GSYA 5B7CA 2A2RA 1SK1A 3ZITA 5DAKB 2PU9C 1ST9A 1TI3A 1PRXA 5GSTA 3VI5A 1BG5A 3IR4A 4XS1A 4GLTA 5ECSA 4EVMA 3GH9A 3ZYWA 4D73A 20GSA 4DSQA 2OJLA 3TKSC 1VF3A 22GSA 2HZFA 4BPYA 2X64A 1AUCA 3FZ5A 5ECLB 3ERGA 1MEKA 2H0IA 2WRTA 2JACA 5HFIA 4E8HA 1T7PB 3ZZXA 1X5DA 2KUCA 1QUWA 2MZCA 4LMWA 4HJMA 3VWWA 4XS4B 2V32A 1BYEA 1DSBA 2C1YA 5D9TA 2HXKA 8GSSA 3EURA 1OVNA 4LL4B 3ISOA 3IXRA 2H1BA 3H93A 4O92A 4TXOB 1O7UA 3UL3A 5GAND 1Z9HA 3HYPA 1MTCA 3A5IA 3NIVA 1R4WA 1E2YA 4OFTA 2HLSA 4I97A 2V6OA 2GQKA 5HFGA 1F6MC 1T3BA 1F9MA 1XWAA 2GZPA 5F07A 2OBIA 4KGIA 3F63A 1SKSB 4FQUA 4K0NA 3KGKA 5IIZA 3DVXA 2RM6A 4DEJA 3N5OA 1ZCPA 4XS6A 4FYBA 4TN8A 4MH3A 2QA1A 2VOCA 1DE1A 4POMA 1GNEA 2V1MA 3EYTA 1MDKA 2FWEA 2GZZA 1NSWA 1PMTA 4X0XA 5H5QA 3ZVJA 2V6KA 3Q19A 5IQYA 2O85A 3IRAA 3GYKA 1RQMA 4NMUA 2VO4A 3M0FA 2TRXA 4N0ZA 11GSA 3UEMA 3H4KA 1FVJA 5G5EA 1TKDB 2GLRA 4CY6A 5KN2A 2HE3A 3L0HA 1GULA 5G30A 4PQ1A 1FG4A 4NPBA 3KTLA 5D9VA 3IC4A 2E7PA 5D9WA 3GUSA 5B6NA 5IMDA 2FCHA 1FOVA 4MLYA 3CSIA 1FW1A 1K0BA 4HUAA 2HNLA 2AUVA 2GVPA 1TRUA 4AJ8A 4G9HA 2H73A 3EWLA 3FKFA 4HEA2 1V9WA 5B8AA 5AN1A 2OKAA 2VCWA 5F06A 2D2ZA 2YP6A 3FR9A 4XHMA 3HZ4A 4HQZA 1WWJA 4MK3A 2R4VA 2N5BA 1B8XA 1EZKA 1QK8A 2C0DA 4KSOA 2K8VA 1Q4JA 3QR6A 2OE1A 3GFKA 1TRVA 4QQ7A 1W89A 1S3CA 3DWVA 2X8GA 1IYIA 5KOWA 3TKSE 3MSZA 3LYPA 4POKA 4PUAA 1XXUA 4MF7A 5IMFA 2CZ3A 3ZLPA 2H01A 3APSA 3QDNA 4RUVA 4Z2TA 1EGRA 1B48A 2IJYA 3TJJA 4I8BA 4Q5NA 4I6XA 5BMUA 2BTOT 3IBHA 2M46A 2FUG2 2L6CA 1K3OA 2VIMA 5D73A 3LEFA 1J9BA 4KX4A 3ED3A 3KP8A 4EIPA 3UIWA 2I1UA 4GQCA 6GSXA 3IK7A 1R26A 3QFBC 6GSWA 2JL4A 3ZMKA 3D21A 2B6MA 1BQ7A 5FHIA 1O73A 2ON5A 1LJRA 5CP1A 3J7Yb 4NAXA 1TI1A 1SKWB 4MCUA 5G31A 4PQHA 2PMTA 2YN1A 4ML1A 3FR6A 4OCEA 5CREA 3HD5A 2LSTA 4JE1A 1GP1A 3GKNA 1WP0A 4KB3A 2JZSA 2GZYA 1M7TA 2GT6A 3H1NA 4V2LA 5AIXA 1V57A 4IP1A 2PWJA 3C73A 4ZB6A 2IMEA 3ZIVA 3LW9A 3FR3A 3LGCA 1GUKA 5DALA 1JZDA 3ZVJD 3RDWA 2LKUA 2GS3A 2GQLA 5ECMB 1FB6A 4K5RA 1X9SB 4MH2A 3L9VA 4YAVA 4TR1B 1SD9A 4PTSA 3WYWA 4BL7A 4MJBA 1V98A 2IN3A 4GSNA 3LWAA 2KP2A 1F3AA 2XBQA 1YZXA 4ZILA 1G6WA 4GSTA 1T8EB 1YEPA 2CVBA 4IJ3A 3FW2A 1ABAA 1F3BA 1NW2A 17GSA 5AISA 4I2UA 2LJRA 4GSSA 1ERUA 4TVEA 1GSYA 5C04A 2AYTA 3OR5A 1Z5YE 1SENA 2YANA 1PL1A 2H1AA 5ECIB 4N30A 1N8JA 1X9WB 3BCIA 4K9ZA 5GAPD 1EP7A 3QFAC 3EPTA 5JWRB 1JLWA 2DMLA 3LSZA 1BX9A 1ZL9A 2XC2A 1OC9A 4DSRA 2HT9A 4Q5QA 1HYUA 4L0WA 5DJMA 2VL2C 1XFLA 3EMPA 2N5AA 1OAZA 4YQMA 1PN0A 2VUPA 4MJCA 5FWGA 1B4QA 2P31A 4KCEA 4WEYA 5AIVA 3VFIA 3ZIJA 2PVOC 3TKSA 1PGTA 1E6BA 4BVXB 1LU4A 2HFDA 4YH2A 1GRXA 4KNDA 2YZHA 3TJBA 18GSA 1SJIA 2I3YA 4OFNA 4EDZA 2EIQA 3ZRDA 3UJ1A 4BA7A 2R0PA 4IW9A 4PX1A 3O6TA 3TKQA 1X5EA 4F0BA 2LV3A 1JFUA 5GZZB 3ZREA 4PGTA 2OBKA 4IKHA 4YKGA 4KDYA 2B1KA 2KP1A 4KH7A 2FWHA 3KP9A 2RM5A 3APQA 1B9YC 1PA3A 1J0FA 1C72A 4LL1B 3UBKA 5J4UA 2YZUA 2VLUA 5G2ZA 2IWTA 3KXOA 4NHZA 3HVSA 1GWCA 3VI7A 4AGSA 1EOGA 2H74A 2VCQA 2RUFA 2JSYA 2WDUA 1ZMAA 5ECQB 4PNGA 2B3SA 1SL2B 1ERTA 4HZ4A 3M9KA 2ES7A 1U87A 3QCPA 4GXZA 1BJXA 4KDUA 2VL9A 1SK0A 1U6TA 3F3QA 3IHGA 2H71A 3W8SA 3PH9A 1X9MB 3I9V2 2C8UA 2AAWA 1MDJA 2VAFA 4EC0A 2IFQA 3EE2A 3R2QA 3WD6A 1UA5A 4OD7A 3IE3A 3VPTA 3HVVA 4KW6A 1I9DA 4IP6A 3KH7A 4YKFA 2K8SA 4ZXGA 4X4JA 1U88A 5ECRB 4YQUA 4HS1A 4LLRA 3ZFLA 3TKRA 2G0FA 4HDEA 4O5UA 3DRNA 5IO0A 1YKAA 2A4VA 2VM2A 3DVWA 1RW1A 3D22A 4P3YB 4X1UA 2B7KA 3U5RE 3SWLA 1QMVA 3G7IA 1MD4A 2NBSA 3RPPA 3GIXA 1SJZA 4N10A 2H6ZA 2WB9A 1AAZA 2CT6A 2I4AA 2GSQA 4LA1A 1EV4A 4NHWA 5KOXA 4HU7A 1K0OA 1M2BA 3RAZA 19GSA 4RI7A 1EEMA 3ME8A 4YQVA 3I69A 6GSTA 2LJKA 2HRAA 2WJUA 1ERVA 4NV2A 1O85A 2CVDA 2JZRA 3ZTLA 3GL5A 1HNCA 4HI7A 3BBYA 4F03A 5CRDA 1A0FA 2YV7A 1TRWA 3K8NA 2CA8A 2YOIA 3GTUB 1ERWA 5IMCA 5ID2B 2HRNA 5J9CA 3TJFA 3BD2A 3DMLA 1TOFA 1KEBA 5A5KA 3CXGA 4F9ZA 4JU5A 1SYXA 4FH8A 1ILOA 4BVYB 1XW5A 13GSA 5FT3A 3M3MA 1BEDA 2OE3A 4ZBAA 3Q6OA 3C1SA 2LEGA 2J9HA 2QKEA 2O89A 4XIHA 4POLA 1K0CA 4Z2RA 1OKDA 2YWMA 3US3A 1I5GA 5LCZA 2HZEB 2YWIA 4OO4A 1AC1A 2KHPA 1GSSA 1A23A 1TK5B 3VWUA 3EVIA 4PXOA 2CX4A 4OFMA 1FAAA 4GQFA 3VURA 4J57E 1G0TA 3IV4A 1Q98A 1Z3EA 2L57A 4ZL9A 1XCCA 4FYUA 1ZOFA 5A4UA 3HHVA 2WCIA 3QOUA 2FWFA 2FA4A 3L9SA 1A8YA 5JCWA 3U6VA 2FHEA 1SL0B 3FZAA 1FOHA 4JEDA 1JHBA 5LNKe 4KE3A 2YV9A 2E2MA 3MYDA 2WGRA 1TW9A 3A2XA 3TJKA 3ERWA 3HJPA 1AQVA 3F4TA 1FO5A 1B9XC 7GSSA 4EF0A 2R2JA 3Q18A 3F6DA 1TJDA 2I81A 2OA7A 1Y6EA 2GTUA 2C3TA 3UOMA 2F8FA 4EXJA 2YNXA 5CRGA 2R0GA 4EKZA 3MAKA 4FYCA 4K7OA 1XWBA 5ELAA 5ECNB 4J2FA 4F2IA 5CO3A 1O8XA 4TR3A 1DBYA 3WT1A 1MDIA 1O6JA 4I2TA 1M9AA 3F8UA 2ZNMA 1HD2A 4XCSA 3IA1A 3GSSA 2F51A 5H5RA 3IHQA 1F2EA 5INYA 1Z7RA 3EC3A 1KNGA 5DCGA 5J5NA 3A3TA 2DJ0A 1EV9A 3GL3A 3CMIA 1NM3A 4EO3A 6GSSA 2F8AA 5HR0A 3UVHA 1WPIA 4J56E 3UVTA 1CQHA 5KN0A 1GTBA 1PN9A 2AV4A 4KDXA 2PVQA 4BWQA 3LYKA 1V40A 4MP4A 3VLNA 2X49A 2XHFA 3O3TA 2CZ2A 5HQPA 1X5CA 1XOAA 5CYYA 5ECPB 1KBNA 1AQXA 1WIKA 1RK4A 2L5LA 3LXZA 1GUHA 4TW5A 2CX3A 3SBCA 4WETA 1R7HA 1ZZYA 1M99A 2H8LA 1U3AA 1M2DA 4GCIA 1PSQA 5DAKA 1VRSD 4G10A 2VL2A 3UARA 4GTUA 4IHUA 1DE2A 3FZ4A 5AGYA 1GSQA 5HR3A 4DSSB 2MMAA 2IMKA 3F0IA 1JZWA 2HSHA 3GHAA 1MD3A 3A2VA 1ZGNA 2I9HA 4D73B 2DJ1A 1TXXA 3EU4A 2VCXA 2R6KA 4PQIA 2OADA 5CNWA 3TCOA 3E3EA 1G7EA 3TRQA 2GT5A 1Y25A 1URMA 1TP9A 4E8EA 1K0AA 1DUGA 2MBTA 2OACA 3KMOA 3TRPA 2VLTA 4XS4A 2PGTA 4JRRA 2P5RA 4IGJA 2R0CA 1U3IA 4RQXA 1VGLA 1B4PA 2BJXA 4JR4A 1GSFA 6GSVA 4TXOA 2C3QA 4JBBA 5HFKA 5ECHB 2K6VA 3FZ9A 1YQ1A 3IK9A 3P90A 1XWGA 2B5XA 3D4TA 2LJAA 5EY6A 1QGVA 2ALBA 4MABA 5A4VA 2DBCA 4XRDA 1YDKA 2L59A 3GKMA 4MJAA 2LUSA 4NWYA 5B6MA 5F8BA 3QAVA 3HY2A 5CRHA 4KCAA 3QAWA 3WGXA 3KEBA 1WE0A 4ML6A 3ERFA 2C0FA 2LRNA 5EVOA 2H1DA 5A4WA 2FWGA 4V2NA 4ZL7A 2Z9SA 3L9UA 4GF0A 5D96A 3RPNA 1JZOA 2R37A 3HDCA 2A2SA 5EL8A 2YWNA 3TUEA 2GDRA 2M72A 5G1LA 3KD0A 2H19A 2LNTA 4ECBA 3L4NA 2HSYA 2YPMA 3KJYA 2L4QA 5F0GA 5JCUA 1TRSA 9GSSA 4MF5A 5DJLA 3P2AA 3KIJA 1KTEA 3CTGA 5C00A 4WR4A 4N0VA 1YY7A 1GLQA 2OE0A 3Q74A 1ML6A 1GTUA 2VCTA 4MF6A 2REMA 1T4YA 2C80A 3CSJA 2NPBA 3HZ8A 3DKSA 5EPFA 3TKPA 2H75A 5JWOB 4MPGA 1XWCA 4WKWA 5IM9A 4BWSA 3HJOA 2MBSA 1TTZA 3VWXA 5GSSA 3H79A 4V1Ap 3GH6A 3LORA 3ZFBA 1ZYNA 4GWRA 3TGZA 3G7YA 3RHBA 2ZUPA 1UC7A 1EGOA 1PX6A 1K3YA 2NDOA 4O7HA 4V2MA 1H4OA 2F9SA 4ZBDA 4WXTA 4MA9A 4JZQA 2X99A 4TOPA 1XW9A 1X0RA 3IDVA 2AHEA 2DLXA 3ZL5A 1F37A 3GX8A 2KOKA 1HNBA 2DIYA 2DIZA 3PINA 2FA8A 4FIWA 1WOUA 2JZTA 3D4MA 1A2JA 4IN0A 1A0RP 5ECKB 3F9UA 2GSSA 2MMNA 1SU9A 2V2GA 3QAGA 4G0IA 4AJ7A 3KH9A 3PR8A 2GSRA 2RLIA 3E9JB 2LTKA 1R5AA 1TU7A 2H72A 3C7MA 4POBA 5CRWA 2WZ9A 5IPHA 2RIIA 2ON7A 2QSIA 3A5WA 2X4AA 4PNFA 3F3RA 2H0GA 1XVQA 3TRXA 4ISDA 2YWOA 4G0LA 1OC3A 1BAYA 3MIXA 5F05A 4K1FA 2GSTA 5KEJA 2IMFA 2PPTA 4AJ6A 2LS5A 2DJ2A 5H5SA 5KN3A 1GSEA 4ZIJA 4HZ2A 1XPVA 2PUKC 3LG6A 3FK8A 1A2LA 4KAEA 2B5EA 4DSSA 2L6DA 4K0GA 1FHEA 1HQOA 1V2AA 5D9XA 3C8EA 3D6IA 2DJ3A 4K2DA 3W6GA 2NVLA 1ZYQB 3IOSA 2IPAA 3KTBA 1QQ2A 2LQOA 4ACSA 3LFLA 1XWKA 5DDLA 4HU9A 1ACVA 4Q5FA 4K6XA 4TXVA 14GSA 4K2XA 3D0ZA 4KUNA 4CHSA 3TJGA 2DKHA 3M1GA 5DALB 4TR1A 1G7OA 4EL1A 4JR6A 1N2AA 1A24A 2PBJA 2IMIA 4F0CA 5J41A 1OC8A 3KCMA 1T4ZA 1M9BA 4KSMA 2GQMA 4O32A 4AF2A 3AY8A 4BL7B 4MMMA 3GURA 3GRXA 1OYJA 3E0UA 2EIOA 4FO5A 5ENUA 2H30A 2O7KA 2EC4A 1S3AA 1THOA 2PN8A 2V41A 3R3EA 5LD0A 4EIQA 4K7NA 2C0EA 4IQAA 2E0QA 2L5OA 5L71A 4PURA 4IELA 4CW9A 1V58A 1YKCA 2IMDA 2MMZA 4TR0A 3IAS2 3RBTA 2P5QA 1GTIA 2XPDA 3ZMLA 2MYGA 3WGDA 3MDKA 2VCVA 3IAM2 1YEXA 3HXSA 1QXHA 1UN2A 1JLVA 2R3XA 1PKZA 3P8WA 1W4VA 4L0UA 4XTSA 1LBKA 1ZYEA 4OWYA 4HJ2A 3QD9A 5BRTA 3IPZA 4K8MA 1OC9B 3HVXA 5ABRA 3D5JA 3VWVA 4N11A 3UAPA 3RHCA 2WULA 3C71A 4BVXA 2LRTA 1TU8A 1G6YA 4MZCA 5DBQA 4CY8A 5IPGA 2JU5A 2DJKA 3BJ5A 4TRXA 2P0GA 3LXTA 1AIUA 1PX7A 5IMVA 3WT2A 1XOBA 4ILFA 10GSA 2HI7A 16GSA 2X8CA 1AW9A 3HJMA 2DMMA 3CRUA 3KMNA 4EDYA 1OE7A 3TOTA 3DYRA 1EP8A 5CAXA 1XIYA 3G9BA 3P7XA 2H66A 1AXDA 3EINA 1OE8A 2C3NA 1UVZA 1SD8A 2HSMA 1T00A 3CTFA 3DEXA 3GNJA 1GL8A 4ULXA 1GNWA 2WFCA 1TDIA 3A2WA 2H76A 3LJRA 1YJ6A 3N9JA 1YF0A 5E59A 5DCHA 4MNNA 4ZBBA 2H6XA 3FEUA 4KF9A 3DXBA 4DVCA 3BCKA 4WF4A 2FGXA 1ON4A 3GMFA 3NZNA 1WRYA 2LQQA 3M8NA 1SL1B 1FVKA 2CVKA 2H0HA 4WBRD 3TB2A 5KN1A 2G2QA 3FYGA 1PD21 5B8BA 4QL9A 4ID0A 2IIYA 1GUMA 1PKWA 3MNGA 2XPEA 2CAIA 2O87A 3F6FA 4F82A 1JZRA 2IFQB 3HKRA 3O76A 5HR2A 1SK2A 1EOHA 2WS2A 2C4JA 1XW6A 1TK8B 3DD3A 1GSDA 2A4HA 2VD0A 3I6AA 4IQ1A 2LNSA 5HR1A 2XBIA 4H86A 2IL3A 5ELGA 6GSUA 5E4WA 4V1Ag 2NTOA 5IOXA 1O81A 4IS0A 1XBSA 2B7JA 1GSUA 3EU3A 2FLSA 2JADA 2DJJA 1M2AA 3LQ7A 4X43A 1T1VA 4HOJA 2N5FA 4Z2UA 1YF1A 2DSAA 2KLXA 3FHKA 2X8HA 1Z6NA 4ICYA 4MDCA 3UMAA 5DVBA 2CAQA 3GX0A 4O5QA 5G1KA 4EUYA 4GRFA 3FRCA 5COHA 3GV1A 1EWXA 2EIRA 4USSA 5IMAA 4WBJA 3FY7A 4LMVA 1K0NA 2BMXA 3GTUA 3NOFA 2TIRA 4CDOA 3G7JA 4OCFA 5ID2A 2FNOA 2JSZA 5IMZA 3PGTA 1K3LA 1XVWA 3J7Yk 2H1GA 4Z7XA 3HCZA 1EEJA 4IVFA 2H6YA 2CQ9A 4BVYA 2VM1A 2QC7A 1K0MA 2LRCA 2F3MA 4ECJA 4NV5A 1NHYA 2MMOA 1A8LA 3H8QA 4WF5A 4G0KA 4L8EA 5G5FA 3APOA 3F4SA 5J9BA 5DQSA 1J08A 3TDGA 1GH2A 4TKYA 2HZEA 5IO2A 2ZCTA 3GA4A 1OKTA 2VD1A 1THXA 3I43A 2DC5A 1Z7PA 3JCML 2RUEA 5DQYA 3W8JA 1GLPA 1O8WA 1TK0B 4QL7A 5J3RA 5D8IA 1WJKA 3CSHA 4Q5RA 3CBUA 2HYXA 3GN3A 1VF1A 3GSTA 2VCZA 3QMXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YKF A;  4MNN A;  4O5U A;  1ZYP A;  4O5Q A;  4YKG A;  1ZYN A; 
#chains in the Genus database with same CATH topology
 1XZO A;  2R5G A;  1SKR B;  2A2P A;  1SJ6 A;  4ZB8 A;  2DKI A;  1ZYP A;  4K7I A;  2TRC P;  3GKX A;  4OMV A;  2VLV A;  4RQR A;  4G2E A;  2PER A;  5JCG A;  1PQN A;  1HNA A;  3CYN A;  1QFN A;  2QGV A;  2UZ8 A;  2H70 A;  3BOA A;  2B5Y A;  4O5R A;  4EE0 A;  4L5O A;  2YCD A;  3IC8 A;  5ECO B;  3C1R A;  1K0D A;  4RI6 A;  1M0U A;  1USB A;  1GTA A;  3VPQ A;  1Z6M A;  3HA9 A;  2C0G A;  4ECC A;  3MWH A;  2M80 A;  1CQG A;  4MPF A;  2FD3 A;  12GS A;  2YJH A;  3UBL A;  1A2M A;  3CRT A;  3VK9 A;  2HRK A;  2CV4 A;  4MZW A;  3FMW A;  2FY6 A;  1H75 A;  4TR4 A;  3KM6 A;  2L4C A;  2AB6 A;  2O8V B;  2AJQ B;  4G19 A;  3ME7 A;  1PL2 A;  4KA0 A;  1VF4 A;  3V1W A;  3DIE A;  1SYR A;  1WMJ A;  1NHO A;  3GKK A;  4ZL8 A;  4HQS A;  2B1L A;  4L5L A;  4MZB A;  4YAP A;  4PUF C;  3KZQ A;  5IOW A;  3TOU A;  2K9F A;  3F4R A;  3EMX A;  2VL3 A;  4OO5 A;  3QPM A;  1IYH A;  4IBP A;  3PPU A;  1VF2 A;  2GGT A;  4MJE A;  2YJ7 A;  4ZB9 A;  1FB0 A;  4A5P A;  4ECI A;  4NXI A;  3WGE A;  3S9F A;  3L78 A;  1S3D A;  1AQW A;  5JWQ B;  4WR5 A;  4XRA A;  3M9J A;  2HRF A;  4K5S A;  4IJI A;  5D93 A;  1R5P A;  3DGQ A;  2J23 A;  2E2G A;  4I5Q A;  2K18 A;  2QA2 A;  6GSY A;  5B7C A;  2A2R A;  1SK1 A;  3ZIT A;  5DAK B;  2PU9 C;  1ST9 A;  1TI3 A;  1PRX A;  5GST A;  3VI5 A;  1BG5 A;  3IR4 A;  4XS1 A;  4GLT A;  5ECS A;  4EVM A;  3GH9 A;  3ZYW A;  4D73 A;  20GS A;  4DSQ A;  2OJL A;  3TKS C;  1VF3 A;  22GS A;  2HZF A;  4BPY A;  2X64 A;  1AUC A;  3FZ5 A;  5ECL B;  3ERG A;  1MEK A;  2H0I A;  2WRT A;  2JAC A;  5HFI A;  4E8H A;  1T7P B;  3ZZX A;  1X5D A;  2KUC A;  1QUW A;  2MZC A;  4LMW A;  4HJM A;  3VWW A;  4XS4 B;  2V32 A;  1BYE A;  1DSB A;  2C1Y A;  5D9T A;  2HXK A;  8GSS A;  3EUR A;  1OVN A;  4LL4 B;  3ISO A;  3IXR A;  2H1B A;  3H93 A;  4O92 A;  4TXO B;  1O7U A;  3UL3 A;  5GAN D;  1Z9H A;  3HYP A;  1MTC A;  3A5I A;  3NIV A;  1R4W A;  1E2Y A;  4OFT A;  2HLS A;  4I97 A;  2V6O A;  2GQK A;  5HFG A;  1F6M C;  1T3B A;  1F9M A;  1XWA A;  2GZP A;  5F07 A;  2OBI A;  4KGI A;  3F63 A;  1SKS B;  4FQU A;  4K0N A;  3KGK A;  5IIZ A;  3DVX A;  2RM6 A;  4DEJ A;  3N5O A;  1ZCP A;  4XS6 A;  4FYB A;  4TN8 A;  4MH3 A;  2QA1 A;  2VOC A;  1DE1 A;  4POM A;  1GNE A;  2V1M A;  3EYT A;  1MDK A;  2FWE A;  2GZZ A;  1NSW A;  1PMT A;  4X0X A;  5H5Q A;  3ZVJ A;  2V6K A;  3Q19 A;  5IQY A;  2O85 A;  3IRA A;  3GYK A;  1RQM A;  4NMU A;  2VO4 A;  3M0F A;  2TRX A;  4N0Z A;  11GS A;  3UEM A;  3H4K A;  1FVJ A;  5G5E A;  1TKD B;  2GLR A;  4CY6 A;  5KN2 A;  2HE3 A;  3L0H A;  1GUL A;  5G30 A;  4PQ1 A;  1FG4 A;  3CQF A;  4NPB A;  3KTL A;  5D9V A;  3IC4 A;  2E7P A;  5D9W A;  3GUS A;  5B6N A;  5IMD A;  2FCH A;  1FOV A;  4MLY A;  3CSI A;  1FW1 A;  1K0B A;  4HUA A;  2HNL A;  2AUV A;  2GVP A;  1TRU A;  4AJ8 A;  4G9H A;  2H73 A;  3EWL A;  3FKF A;  4HEA 2;  1V9W A;  5B8A A;  5AN1 A;  2OKA A;  2VCW A;  5F06 A;  2D2Z A;  2YP6 A;  3FR9 A;  4XHM A;  3HZ4 A;  4HQZ A;  1WWJ A;  4MK3 A;  2R4V A;  2N5B A;  1B8X A;  1EZK A;  1QK8 A;  2C0D A;  4KSO A;  2K8V A;  1Q4J A;  3QR6 A;  2OE1 A;  3GFK A;  1TRV A;  4QQ7 A;  1W89 A;  1S3C A;  3DWV A;  2X8G A;  1IYI A;  5KOW A;  3TKS E;  3MSZ A;  3LYP A;  4POK A;  4PUA A;  1XXU A;  4MF7 A;  5IMF A;  2CZ3 A;  3ZLP A;  2H01 A;  3APS A;  3QDN A;  4RUV A;  4Z2T A;  1EGR A;  1B48 A;  2IJY A;  3TJJ A;  4I8B A;  4Q5N A;  4I6X A;  5BMU A;  2BTO T;  3IBH A;  2M46 A;  2FUG 2;  2L6C A;  1K3O A;  2VIM A;  5D73 A;  3LEF A;  1J9B A;  4KX4 A;  3ED3 A;  3KP8 A;  4EIP A;  3UIW A;  2I1U A;  4GQC A;  6GSX A;  3IK7 A;  1R26 A;  3QFB C;  6GSW A;  2JL4 A;  3ZMK A;  3D21 A;  2B6M A;  1BQ7 A;  5FHI A;  1O73 A;  2ON5 A;  1LJR A;  5CP1 A;  3J7Y b;  4NAX A;  1TI1 A;  1SKW B;  4MCU A;  5G31 A;  4PQH A;  2PMT A;  2YN1 A;  4ML1 A;  3FR6 A;  4OCE A;  5CRE A;  3HD5 A;  2LST A;  4JE1 A;  1GP1 A;  3GKN A;  1WP0 A;  4KB3 A;  2JZS A;  2GZY A;  1M7T A;  2GT6 A;  3H1N A;  4V2L A;  5AIX A;  1V57 A;  4IP1 A;  2PWJ A;  3C73 A;  4ZB6 A;  2IME A;  3ZIV A;  3LW9 A;  3FR3 A;  3LGC A;  1GUK A;  5DAL A;  1JZD A;  3ZVJ D;  3RDW A;  2LKU A;  2GS3 A;  2GQL A;  5ECM B;  1FB6 A;  4K5R A;  1X9S B;  4MH2 A;  3L9V A;  4YAV A;  4TR1 B;  1SD9 A;  4PTS A;  3WYW A;  4BL7 A;  4MJB A;  1V98 A;  2IN3 A;  4GSN A;  3LWA A;  2KP2 A;  1F3A A;  2XBQ A;  1YZX A;  4ZIL A;  1G6W A;  4GST A;  1T8E B;  1YEP A;  2CVB A;  4IJ3 A;  3FW2 A;  1ABA A;  1F3B A;  1NW2 A;  17GS A;  5AIS A;  4I2U A;  2LJR A;  4GSS A;  1ERU A;  4TVE A;  1GSY A;  5C04 A;  2AYT A;  3OR5 A;  1Z5Y E;  1SEN A;  2YAN A;  1PL1 A;  2H1A A;  5ECI B;  4N30 A;  1N8J A;  1X9W B;  3BCI A;  4K9Z A;  5GAP D;  1EP7 A;  3QFA C;  3EPT A;  5JWR B;  1JLW A;  2DML A;  3LSZ A;  1BX9 A;  1ZL9 A;  2XC2 A;  1OC9 A;  4DSR A;  2HT9 A;  4Q5Q A;  1HYU A;  4L0W A;  5DJM A;  2VL2 C;  1XFL A;  3EMP A;  2N5A A;  1OAZ A;  4YQM A;  1PN0 A;  2VUP A;  4MJC A;  5FWG A;  1B4Q A;  2P31 A;  4KCE A;  4WEY A;  5AIV A;  3VFI A;  3ZIJ A;  2PVO C;  3TKS A;  1PGT A;  1E6B A;  4BVX B;  1LU4 A;  2HFD A;  4YH2 A;  1GRX A;  4KND A;  2YZH A;  3TJB A;  18GS A;  1SJI A;  2I3Y A;  4OFN A;  4EDZ A;  2EIQ A;  3ZRD A;  3UJ1 A;  4BA7 A;  2R0P A;  4IW9 A;  4PX1 A;  3O6T A;  3TKQ A;  1X5E A;  4F0B A;  2LV3 A;  1JFU A;  5GZZ B;  3ZRE A;  4PGT A;  2OBK A;  4IKH A;  4YKG A;  4KDY A;  2B1K A;  2KP1 A;  4KH7 A;  2FWH A;  3KP9 A;  2RM5 A;  3APQ A;  1B9Y C;  1PA3 A;  1J0F A;  1C72 A;  4LL1 B;  3UBK A;  5J4U A;  2YZU A;  2VLU A;  5G2Z A;  2IWT A;  3KXO A;  4NHZ A;  3HVS A;  1GWC A;  3VI7 A;  4AGS A;  1EOG A;  2H74 A;  2VCQ A;  2RUF A;  2JSY A;  2WDU A;  1ZMA A;  5ECQ B;  4PNG A;  2B3S A;  1SL2 B;  1ERT A;  4HZ4 A;  3M9K A;  1M3J A;  2ES7 A;  1U87 A;  3QCP A;  4GXZ A;  1BJX A;  4KDU A;  2VL9 A;  1SK0 A;  1U6T A;  3F3Q A;  3IHG A;  2H71 A;  3W8S A;  3PH9 A;  1X9M B;  3I9V 2;  2C8U A;  2AAW A;  1MDJ A;  2VAF A;  4EC0 A;  2IFQ A;  3EE2 A;  3R2Q A;  3WD6 A;  1UA5 A;  4OD7 A;  3IE3 A;  3VPT A;  3HVV A;  4KW6 A;  1I9D A;  4IP6 A;  3KH7 A;  4YKF A;  2K8S A;  4ZXG A;  4X4J A;  1U88 A;  5ECR B;  4YQU A;  4HS1 A;  4LLR A;  3ZFL A;  3TKR A;  2G0F A;  4HDE A;  4O5U A;  3DRN A;  5IO0 A;  1YKA A;  2A4V A;  2VM2 A;  3DVW A;  1RW1 A;  3D22 A;  4P3Y B;  4X1U A;  2B7K A;  3U5R E;  3SWL A;  1QMV A;  3G7I A;  1MD4 A;  2NBS A;  3RPP A;  3GIX A;  1SJZ A;  4N10 A;  2H6Z A;  2WB9 A;  1AAZ A;  2CT6 A;  2I4A A;  2GSQ A;  4LA1 A;  1EV4 A;  4NHW A;  5KOX A;  4HU7 A;  1K0O A;  1M2B A;  3RAZ A;  19GS A;  4RI7 A;  1EEM A;  3ME8 A;  4YQV A;  3I69 A;  6GST A;  2LJK A;  2HRA A;  2WJU A;  1ERV A;  4NV2 A;  1O85 A;  2CVD A;  2JZR A;  3ZTL A;  3GL5 A;  1HNC A;  4HI7 A;  3BBY A;  4F03 A;  5CRD A;  1A0F A;  2YV7 A;  1TRW A;  3K8N A;  2CA8 A;  2YOI A;  3GTU B;  1ERW A;  5IMC A;  5ID2 B;  2HRN A;  5J9C A;  3TJF A;  3BD2 A;  3DML A;  1TOF A;  1KEB A;  5A5K A;  3CXG A;  4F9Z A;  4JU5 A;  1SYX A;  4FH8 A;  1ILO A;  4BVY B;  1XW5 A;  13GS A;  5FT3 A;  3M3M A;  1BED A;  2OE3 A;  4ZBA A;  3Q6O A;  3C1S A;  2LEG A;  2J9H A;  2QKE A;  2O89 A;  4XIH A;  4POL A;  1K0C A;  4Z2R A;  1OKD A;  2YWM A;  3US3 A;  1I5G A;  5LCZ A;  2HZE B;  2YWI A;  4OO4 A;  1AC1 A;  2KHP A;  1GSS A;  1A23 A;  1TK5 B;  3VWU A;  3EVI A;  4PXO A;  2CX4 A;  4OFM A;  1FAA A;  4GQF A;  3VUR A;  4J57 E;  1G0T A;  3IV4 A;  1Q98 A;  1Z3E A;  2L57 A;  4ZL9 A;  1XCC A;  4FYU A;  1ZOF A;  5A4U A;  3HHV A;  2WCI A;  3QOU A;  2FWF A;  2FA4 A;  3L9S A;  1A8Y A;  5JCW A;  3U6V A;  2FHE A;  1SL0 B;  3FZA A;  1FOH A;  4JED A;  1JHB A;  5LNK e;  4KE3 A;  2YV9 A;  2E2M A;  3MYD A;  2WGR A;  1TW9 A;  3A2X A;  3TJK A;  3ERW A;  3HJP A;  1AQV A;  3F4T A;  1FO5 A;  1B9X C;  7GSS A;  4EF0 A;  2R2J A;  3Q18 A;  3F6D A;  1TJD A;  2I81 A;  2OA7 A;  1Y6E A;  2GTU A;  2C3T A;  3UOM A;  2F8F A;  4EXJ A;  2YNX A;  5CRG A;  2R0G A;  4EKZ A;  3MAK A;  4FYC A;  4K7O A;  1XWB A;  5ELA A;  5ECN B;  4J2F A;  4F2I A;  5CO3 A;  1O8X A;  4TR3 A;  1DBY A;  3WT1 A;  1MDI A;  1O6J A;  4I2T A;  1M9A A;  3F8U A;  2ZNM A;  1HD2 A;  4XCS A;  3IA1 A;  3GSS A;  2F51 A;  5H5R A;  3IHQ A;  1PFO A;  1F2E A;  5INY A;  1Z7R A;  3EC3 A;  1KNG A;  5DCG A;  5J5N A;  3A3T A;  2DJ0 A;  1EV9 A;  3GL3 A;  3CMI A;  1NM3 A;  4EO3 A;  6GSS A;  2F8A A;  5HR0 A;  3UVH A;  1WPI A;  4J56 E;  3UVT A;  1CQH A;  5KN0 A;  1GTB A;  1PN9 A;  2AV4 A;  4KDX A;  2PVQ A;  4BWQ A;  3LYK A;  1V40 A;  4MP4 A;  3VLN A;  2X49 A;  2XHF A;  3O3T A;  2CZ2 A;  5HQP A;  1X5C A;  1XOA A;  5CYY A;  5ECP B;  1KBN A;  1AQX A;  1WIK A;  1RK4 A;  2L5L A;  3LXZ A;  1GUH A;  4TW5 A;  2CX3 A;  3SBC A;  4WET A;  1R7H A;  1ZZY A;  1M99 A;  2H8L A;  1U3A A;  1M2D A;  4GCI A;  1PSQ A;  5DAK A;  1VRS D;  4G10 A;  2VL2 A;  3UAR A;  4GTU A;  4IHU A;  1DE2 A;  3FZ4 A;  5AGY A;  1GSQ A;  5HR3 A;  4DSS B;  2MMA A;  2IMK A;  3F0I A;  1JZW A;  2HSH A;  3GHA A;  1MD3 A;  3A2V A;  1ZGN A;  2I9H A;  4D73 B;  2DJ1 A;  1TXX A;  3EU4 A;  2VCX A;  2R6K A;  4PQI A;  2OAD A;  5CNW A;  3TCO A;  3E3E A;  1G7E A;  3TRQ A;  2GT5 A;  1Y25 A;  1URM A;  1TP9 A;  4E8E A;  1K0A A;  1DUG A;  2MBT A;  2OAC A;  3KMO A;  1S3R A;  3TRP A;  2VLT A;  4XS4 A;  2PGT A;  4JRR A;  2P5R A;  4IGJ A;  2R0C A;  1U3I A;  4RQX A;  1VGL A;  1B4P A;  2BJX A;  4JR4 A;  1GSF A;  6GSV A;  4TXO A;  2C3Q A;  4JBB A;  5HFK A;  5ECH B;  2K6V A;  3FZ9 A;  1YQ1 A;  3IK9 A;  3P90 A;  1XWG A;  2B5X A;  3D4T A;  2LJA A;  5EY6 A;  1QGV A;  2ALB A;  4MAB A;  5A4V A;  2DBC A;  4XRD A;  1YDK A;  2L59 A;  3GKM A;  4MJA A;  2LUS A;  4NWY A;  5B6M A;  5F8B A;  3QAV A;  3HY2 A;  5CRH A;  4KCA A;  3QAW A;  3WGX A;  3KEB A;  1WE0 A;  4ML6 A;  3ERF A;  2C0F A;  2LRN A;  5EVO A;  2H1D A;  5A4W A;  2FWG A;  4V2N A;  4ZL7 A;  2Z9S A;  3L9U A;  4GF0 A;  5D96 A;  3RPN A;  1JZO A;  2R37 A;  3HDC A;  2A2S A;  5EL8 A;  2YWN A;  3TUE A;  2GDR A;  2M72 A;  5G1L A;  3KD0 A;  2H19 A;  2LNT A;  4ECB A;  4BIK A;  3L4N A;  2HSY A;  2YPM A;  3KJY A;  2L4Q A;  5F0G A;  5JCU A;  1TRS A;  9GSS A;  4MF5 A;  5DJL A;  3P2A A;  3KIJ A;  1KTE A;  3CTG A;  5C00 A;  4WR4 A;  4N0V A;  1YY7 A;  1GLQ A;  2OE0 A;  3Q74 A;  1ML6 A;  1GTU A;  2VCT A;  4MF6 A;  2REM A;  1T4Y A;  2C80 A;  3CSJ A;  2NPB A;  3HZ8 A;  3DKS A;  5EPF A;  3TKP A;  2H75 A;  5JWO B;  4MPG A;  1XWC A;  4WKW A;  1XG8 A;  5IM9 A;  4BWS A;  3HJO A;  2MBS A;  1TTZ A;  3VWX A;  5GSS A;  3H79 A;  4V1A p;  3GH6 A;  3LOR A;  3ZFB A;  1ZYN A;  4GWR A;  3TGZ A;  3G7Y A;  3RHB A;  2ZUP A;  1UC7 A;  1EGO A;  1PX6 A;  1K3Y A;  2NDO A;  4O7H A;  4V2M A;  1H4O A;  2F9S A;  4ZBD A;  4WXT A;  4MA9 A;  4JZQ A;  2X99 A;  4TOP A;  1XW9 A;  1X0R A;  3IDV A;  2AHE A;  2DLX A;  3ZL5 A;  1F37 A;  3GX8 A;  2KOK A;  1HNB A;  2DIY A;  2DIZ A;  3PIN A;  2FA8 A;  4FIW A;  1WOU A;  2JZT A;  3D4M A;  1A2J A;  4IN0 A;  1A0R P;  5ECK B;  3F9U A;  2GSS A;  2MMN A;  1SU9 A;  2V2G A;  3QAG A;  4G0I A;  4AJ7 A;  3KH9 A;  3PR8 A;  2GSR A;  2RLI A;  3E9J B;  2LTK A;  1R5A A;  1TU7 A;  2H72 A;  3C7M A;  4POB A;  5CRW A;  2WZ9 A;  5IPH A;  2RII A;  2ON7 A;  2QSI A;  3A5W A;  2X4A A;  4PNF A;  3F3R A;  2H0G A;  1XVQ A;  3TRX A;  4ISD A;  2YWO A;  4G0L A;  1OC3 A;  1BAY A;  3MIX A;  5F05 A;  4K1F A;  2GST A;  5KEJ A;  2IMF A;  2PPT A;  4AJ6 A;  2LS5 A;  2DJ2 A;  5H5S A;  5KN3 A;  1GSE A;  4ZIJ A;  4HZ2 A;  1XPV A;  2PUK C;  3LG6 A;  3FK8 A;  1A2L A;  4KAE A;  1M3I A;  2B5E A;  4DSS A;  2L6D A;  4K0G A;  1FHE A;  1HQO A;  1V2A A;  5D9X A;  3C8E A;  3D6I A;  4HSC X;  2DJ3 A;  4K2D A;  3W6G A;  2NVL A;  1ZYQ B;  3IOS A;  2IPA A;  3KTB A;  1QQ2 A;  2LQO A;  4ACS A;  3LFL A;  1XWK A;  5DDL A;  4HU9 A;  1ACV A;  4Q5F A;  4K6X A;  4TXV A;  14GS A;  4K2X A;  3D0Z A;  4KUN A;  4CHS A;  3TJG A;  2DKH A;  3M1G A;  5DAL B;  4TR1 A;  1G7O A;  4EL1 A;  4JR6 A;  1N2A A;  1A24 A;  2PBJ A;  2IMI A;  4F0C A;  5J41 A;  1OC8 A;  3KCM A;  1T4Z A;  1M9B A;  4KSM A;  2GQM A;  4O32 A;  4AF2 A;  3AY8 A;  4BL7 B;  4MMM A;  3GUR A;  3GRX A;  1OYJ A;  3E0U A;  2EIO A;  4FO5 A;  5ENU A;  2H30 A;  2O7K A;  2EC4 A;  1S3A A;  1THO A;  2PN8 A;  2V41 A;  3R3E A;  5LD0 A;  4EIQ A;  4K7N A;  2C0E A;  4IQA A;  2E0Q A;  2L5O A;  5L71 A;  4PUR A;  4IEL A;  4CW9 A;  1V58 A;  1YKC A;  2IMD A;  2MMZ A;  4TR0 A;  3IAS 2;  3RBT A;  2P5Q A;  1GTI A;  2XPD A;  3ZML A;  2MYG A;  3WGD A;  3MDK A;  2VCV A;  3IAM 2;  1YEX A;  3HXS A;  1QXH A;  1UN2 A;  1JLV A;  2R3X A;  1PKZ A;  3P8W A;  1W4V A;  4L0U A;  4XTS A;  1LBK A;  1ZYE A;  4OWY A;  4HJ2 A;  3QD9 A;  5BRT A;  3IPZ A;  4K8M A;  1OC9 B;  3HVX A;  5ABR A;  3D5J A;  3VWV A;  4N11 A;  3UAP A;  3RHC A;  2WUL A;  3C71 A;  4BVX A;  2LRT A;  1TU8 A;  1G6Y A;  4MZC A;  5DBQ A;  4CY8 A;  5IPG A;  2JU5 A;  2DJK A;  3BJ5 A;  4TRX A;  2P0G A;  3LXT A;  1AIU A;  1PX7 A;  5IMV A;  3WT2 A;  1XOB A;  4ILF A;  10GS A;  2HI7 A;  16GS A;  2X8C A;  1AW9 A;  3HJM A;  2DMM A;  3CRU A;  3KMN A;  4EDY A;  1OE7 A;  3TOT A;  3DYR A;  1EP8 A;  5CAX A;  1XIY A;  3G9B A;  3P7X A;  2H66 A;  1AXD A;  3EIN A;  1OE8 A;  2C3N A;  1UVZ A;  1SD8 A;  2HSM A;  1T00 A;  3CTF A;  3DEX A;  3GNJ A;  1GL8 A;  4ULX A;  1GNW A;  2WFC A;  1TDI A;  3A2W A;  2H76 A;  3LJR A;  1YJ6 A;  3N9J A;  1YF0 A;  5E59 A;  5DCH A;  4MNN A;  4ZBB A;  2H6X A;  3FEU A;  4KF9 A;  3DXB A;  4DVC A;  3BCK A;  4WF4 A;  2FGX A;  1ON4 A;  3GMF A;  3NZN A;  1WRY A;  2LQQ A;  3M8N A;  1SL1 B;  1FVK A;  2CVK A;  2H0H A;  4WBR D;  3TB2 A;  5KN1 A;  2G2Q A;  3FYG A;  1PD2 1;  5B8B A;  4QL9 A;  4ID0 A;  2IIY A;  1GUM A;  1PKW A;  3MNG A;  2XPE A;  2CAI A;  2O87 A;  3F6F A;  4F82 A;  1JZR A;  2IFQ B;  3HKR A;  3O76 A;  5HR2 A;  1SK2 A;  1EOH A;  2WS2 A;  2C4J A;  1XW6 A;  1TK8 B;  3DD3 A;  1GSD A;  2A4H A;  2VD0 A;  3I6A A;  4IQ1 A;  2LNS A;  5HR1 A;  2XBI A;  4H86 A;  2IL3 A;  5ELG A;  6GSU A;  5E4W A;  4V1A g;  2NTO A;  5IOX A;  1O81 A;  4IS0 A;  1XBS A;  2B7J A;  1GSU A;  3EU3 A;  2FLS A;  2JAD A;  2DJJ A;  1M2A A;  3LQ7 A;  4X43 A;  1T1V A;  4HOJ A;  2N5F A;  4Z2U A;  1YF1 A;  2DSA A;  2KLX A;  3FHK A;  2X8H A;  1Z6N A;  4ICY A;  4MDC A;  3UMA A;  5DVB A;  2CAQ A;  3GX0 A;  4O5Q A;  5G1K A;  4EUY A;  4GRF A;  3FRC A;  5COH A;  3GV1 A;  1EWX A;  2EIR A;  4USS A;  5IMA A;  4WBJ A;  3FY7 A;  4LMV A;  1K0N A;  2BMX A;  3GTU A;  3NOF A;  2TIR A;  4CDO A;  3G7J A;  4OCF A;  5ID2 A;  2FNO A;  2JSZ A;  5IMZ A;  3PGT A;  1K3L A;  1XVW A;  3J7Y k;  2H1G A;  4Z7X A;  3HCZ A;  1EEJ A;  4IVF A;  2H6Y A;  2CQ9 A;  4BVY A;  2VM1 A;  2QC7 A;  1K0M A;  2LRC A;  2F3M A;  4ECJ A;  4NV5 A;  1NHY A;  2MMO A;  1A8L A;  3H8Q A;  4WF5 A;  4G0K A;  4L8E A;  5G5F A;  3APO A;  3F4S A;  5J9B A;  5DQS A;  1J08 A;  3TDG A;  1GH2 A;  4TKY A;  2HZE A;  5IO2 A;  2ZCT A;  3GA4 A;  1OKT A;  2VD1 A;  1THX A;  3I43 A;  2DC5 A;  1Z7P A;  3JCM L;  2RUE A;  5DQY A;  3W8J A;  1GLP A;  1O8W A;  1TK0 B;  4QL7 A;  5J3R A;  5D8I A;  1WJK A;  3CSH A;  4Q5R A;  3CBU A;  2HYX A;  3GN3 A;  1VF1 A;  3GST A;  2VCZ A;  3HVN A;  3QMX A; 
#chains in the Genus database with same CATH homology
 1XZO A;  2R5G A;  1SKR B;  2A2P A;  1SJ6 A;  4ZB8 A;  2DKI A;  1ZYP A;  4K7I A;  2TRC P;  3GKX A;  4OMV A;  2VLV A;  4RQR A;  4G2E A;  2PER A;  5JCG A;  1PQN A;  1HNA A;  3CYN A;  1QFN A;  2QGV A;  2UZ8 A;  2H70 A;  3BOA A;  2B5Y A;  4O5R A;  4EE0 A;  4L5O A;  2YCD A;  3IC8 A;  5ECO B;  3C1R A;  1K0D A;  4RI6 A;  1M0U A;  1USB A;  1GTA A;  3VPQ A;  1Z6M A;  3HA9 A;  2C0G A;  4ECC A;  3MWH A;  2M80 A;  1CQG A;  4MPF A;  2FD3 A;  12GS A;  2YJH A;  3UBL A;  1A2M A;  3CRT A;  3VK9 A;  2HRK A;  2CV4 A;  4MZW A;  3FMW A;  2FY6 A;  1H75 A;  4TR4 A;  3KM6 A;  2L4C A;  2AB6 A;  2O8V B;  2AJQ B;  4G19 A;  3ME7 A;  1PL2 A;  4KA0 A;  1VF4 A;  3V1W A;  3DIE A;  1SYR A;  1WMJ A;  1NHO A;  3GKK A;  4ZL8 A;  4HQS A;  2B1L A;  4L5L A;  4MZB A;  4YAP A;  4PUF C;  3KZQ A;  5IOW A;  3TOU A;  2K9F A;  3F4R A;  3EMX A;  2VL3 A;  4OO5 A;  3QPM A;  1IYH A;  4IBP A;  3PPU A;  1VF2 A;  2GGT A;  4MJE A;  2YJ7 A;  4ZB9 A;  1FB0 A;  4A5P A;  4ECI A;  4NXI A;  3WGE A;  3S9F A;  3L78 A;  1S3D A;  1AQW A;  5JWQ B;  4WR5 A;  4XRA A;  3M9J A;  2HRF A;  4K5S A;  4IJI A;  5D93 A;  1R5P A;  3DGQ A;  2J23 A;  2E2G A;  4I5Q A;  2K18 A;  2QA2 A;  6GSY A;  5B7C A;  2A2R A;  1SK1 A;  3ZIT A;  5DAK B;  2PU9 C;  1ST9 A;  1TI3 A;  1PRX A;  5GST A;  3VI5 A;  1BG5 A;  3IR4 A;  4XS1 A;  4GLT A;  5ECS A;  4EVM A;  3GH9 A;  3ZYW A;  4D73 A;  20GS A;  4DSQ A;  2OJL A;  3TKS C;  1VF3 A;  22GS A;  2HZF A;  4BPY A;  2X64 A;  1AUC A;  3FZ5 A;  5ECL B;  3ERG A;  1MEK A;  2H0I A;  2WRT A;  2JAC A;  5HFI A;  4E8H A;  1T7P B;  3ZZX A;  1X5D A;  2KUC A;  1QUW A;  2MZC A;  4LMW A;  4HJM A;  3VWW A;  4XS4 B;  2V32 A;  1BYE A;  1DSB A;  2C1Y A;  5D9T A;  2HXK A;  8GSS A;  3EUR A;  1OVN A;  4LL4 B;  3ISO A;  3IXR A;  2H1B A;  3H93 A;  4O92 A;  4TXO B;  1O7U A;  3UL3 A;  5GAN D;  1Z9H A;  3HYP A;  1MTC A;  3A5I A;  3NIV A;  1R4W A;  1E2Y A;  4OFT A;  2HLS A;  4I97 A;  2V6O A;  2GQK A;  5HFG A;  1F6M C;  1T3B A;  1F9M A;  1XWA A;  2GZP A;  5F07 A;  2OBI A;  4KGI A;  3F63 A;  1SKS B;  4FQU A;  4K0N A;  3KGK A;  5IIZ A;  3DVX A;  2RM6 A;  4DEJ A;  3N5O A;  1ZCP A;  4XS6 A;  4FYB A;  4TN8 A;  4MH3 A;  2QA1 A;  2VOC A;  1DE1 A;  4POM A;  1GNE A;  2V1M A;  3EYT A;  1MDK A;  2FWE A;  2GZZ A;  1NSW A;  1PMT A;  4X0X A;  5H5Q A;  3ZVJ A;  2V6K A;  3Q19 A;  5IQY A;  2O85 A;  3IRA A;  3GYK A;  1RQM A;  4NMU A;  2VO4 A;  3M0F A;  2TRX A;  4N0Z A;  11GS A;  3UEM A;  3H4K A;  1FVJ A;  5G5E A;  1TKD B;  2GLR A;  4CY6 A;  5KN2 A;  2HE3 A;  3L0H A;  1GUL A;  5G30 A;  4PQ1 A;  1FG4 A;  4NPB A;  3KTL A;  5D9V A;  3IC4 A;  2E7P A;  5D9W A;  3GUS A;  5B6N A;  5IMD A;  2FCH A;  1FOV A;  4MLY A;  3CSI A;  1FW1 A;  1K0B A;  4HUA A;  2HNL A;  2AUV A;  2GVP A;  1TRU A;  4AJ8 A;  4G9H A;  2H73 A;  3EWL A;  3FKF A;  4HEA 2;  1V9W A;  5B8A A;  5AN1 A;  2OKA A;  2VCW A;  5F06 A;  2D2Z A;  2YP6 A;  3FR9 A;  4XHM A;  3HZ4 A;  4HQZ A;  1WWJ A;  4MK3 A;  2R4V A;  2N5B A;  1B8X A;  1EZK A;  1QK8 A;  2C0D A;  4KSO A;  2K8V A;  1Q4J A;  3QR6 A;  2OE1 A;  3GFK A;  1TRV A;  4QQ7 A;  1W89 A;  1S3C A;  3DWV A;  2X8G A;  1IYI A;  5KOW A;  3TKS E;  3MSZ A;  3LYP A;  4POK A;  4PUA A;  1XXU A;  4MF7 A;  5IMF A;  2CZ3 A;  3ZLP A;  2H01 A;  3APS A;  3QDN A;  4RUV A;  4Z2T A;  1EGR A;  1B48 A;  2IJY A;  3TJJ A;  4I8B A;  4Q5N A;  4I6X A;  5BMU A;  2BTO T;  3IBH A;  2M46 A;  2FUG 2;  2L6C A;  1K3O A;  2VIM A;  5D73 A;  3LEF A;  1J9B A;  4KX4 A;  3ED3 A;  3KP8 A;  4EIP A;  3UIW A;  2I1U A;  4GQC A;  6GSX A;  3IK7 A;  1R26 A;  3QFB C;  6GSW A;  2JL4 A;  3ZMK A;  3D21 A;  2B6M A;  1BQ7 A;  5FHI A;  1O73 A;  2ON5 A;  1LJR A;  5CP1 A;  3J7Y b;  4NAX A;  1TI1 A;  1SKW B;  4MCU A;  5G31 A;  4PQH A;  2PMT A;  2YN1 A;  4ML1 A;  3FR6 A;  4OCE A;  5CRE A;  3HD5 A;  2LST A;  4JE1 A;  1GP1 A;  3GKN A;  1WP0 A;  4KB3 A;  2JZS A;  2GZY A;  1M7T A;  2GT6 A;  3H1N A;  4V2L A;  5AIX A;  1V57 A;  4IP1 A;  2PWJ A;  3C73 A;  4ZB6 A;  2IME A;  3ZIV A;  3LW9 A;  3FR3 A;  3LGC A;  1GUK A;  5DAL A;  1JZD A;  3ZVJ D;  3RDW A;  2LKU A;  2GS3 A;  2GQL A;  5ECM B;  1FB6 A;  4K5R A;  1X9S B;  4MH2 A;  3L9V A;  4YAV A;  4TR1 B;  1SD9 A;  4PTS A;  3WYW A;  4BL7 A;  4MJB A;  1V98 A;  2IN3 A;  4GSN A;  3LWA A;  2KP2 A;  1F3A A;  2XBQ A;  1YZX A;  4ZIL A;  1G6W A;  4GST A;  1T8E B;  1YEP A;  2CVB A;  4IJ3 A;  3FW2 A;  1ABA A;  1F3B A;  1NW2 A;  17GS A;  5AIS A;  4I2U A;  2LJR A;  4GSS A;  1ERU A;  4TVE A;  1GSY A;  5C04 A;  2AYT A;  3OR5 A;  1Z5Y E;  1SEN A;  2YAN A;  1PL1 A;  2H1A A;  5ECI B;  4N30 A;  1N8J A;  1X9W B;  3BCI A;  4K9Z A;  5GAP D;  1EP7 A;  3QFA C;  3EPT A;  5JWR B;  1JLW A;  2DML A;  3LSZ A;  1BX9 A;  1ZL9 A;  2XC2 A;  1OC9 A;  4DSR A;  2HT9 A;  4Q5Q A;  1HYU A;  4L0W A;  5DJM A;  2VL2 C;  1XFL A;  3EMP A;  2N5A A;  1OAZ A;  4YQM A;  1PN0 A;  2VUP A;  4MJC A;  5FWG A;  1B4Q A;  2P31 A;  4KCE A;  4WEY A;  5AIV A;  3VFI A;  3ZIJ A;  2PVO C;  3TKS A;  1PGT A;  1E6B A;  4BVX B;  1LU4 A;  2HFD A;  4YH2 A;  1GRX A;  4KND A;  2YZH A;  3TJB A;  18GS A;  1SJI A;  2I3Y A;  4OFN A;  4EDZ A;  2EIQ A;  3ZRD A;  3UJ1 A;  4BA7 A;  2R0P A;  4IW9 A;  4PX1 A;  3O6T A;  3TKQ A;  1X5E A;  4F0B A;  2LV3 A;  1JFU A;  5GZZ B;  3ZRE A;  4PGT A;  2OBK A;  4IKH A;  4YKG A;  4KDY A;  2B1K A;  2KP1 A;  4KH7 A;  2FWH A;  3KP9 A;  2RM5 A;  3APQ A;  1B9Y C;  1PA3 A;  1J0F A;  1C72 A;  4LL1 B;  3UBK A;  5J4U A;  2YZU A;  2VLU A;  5G2Z A;  2IWT A;  3KXO A;  4NHZ A;  3HVS A;  1GWC A;  3VI7 A;  4AGS A;  1EOG A;  2H74 A;  2VCQ A;  2RUF A;  2JSY A;  2WDU A;  1ZMA A;  5ECQ B;  4PNG A;  2B3S A;  1SL2 B;  1ERT A;  4HZ4 A;  3M9K A;  2ES7 A;  1U87 A;  3QCP A;  4GXZ A;  1BJX A;  4KDU A;  2VL9 A;  1SK0 A;  1U6T A;  3F3Q A;  3IHG A;  2H71 A;  3W8S A;  3PH9 A;  1X9M B;  3I9V 2;  2C8U A;  2AAW A;  1MDJ A;  2VAF A;  4EC0 A;  2IFQ A;  3EE2 A;  3R2Q A;  3WD6 A;  1UA5 A;  4OD7 A;  3IE3 A;  3VPT A;  3HVV A;  4KW6 A;  1I9D A;  4IP6 A;  3KH7 A;  4YKF A;  2K8S A;  4ZXG A;  4X4J A;  1U88 A;  5ECR B;  4YQU A;  4HS1 A;  4LLR A;  3ZFL A;  3TKR A;  2G0F A;  4HDE A;  4O5U A;  3DRN A;  5IO0 A;  1YKA A;  2A4V A;  2VM2 A;  3DVW A;  1RW1 A;  3D22 A;  4P3Y B;  4X1U A;  2B7K A;  3U5R E;  3SWL A;  1QMV A;  3G7I A;  1MD4 A;  2NBS A;  3RPP A;  3GIX A;  1SJZ A;  4N10 A;  2H6Z A;  2WB9 A;  1AAZ A;  2CT6 A;  2I4A A;  2GSQ A;  4LA1 A;  1EV4 A;  4NHW A;  5KOX A;  4HU7 A;  1K0O A;  1M2B A;  3RAZ A;  19GS A;  4RI7 A;  1EEM A;  3ME8 A;  4YQV A;  3I69 A;  6GST A;  2LJK A;  2HRA A;  2WJU A;  1ERV A;  4NV2 A;  1O85 A;  2CVD A;  2JZR A;  3ZTL A;  3GL5 A;  1HNC A;  4HI7 A;  3BBY A;  4F03 A;  5CRD A;  1A0F A;  2YV7 A;  1TRW A;  3K8N A;  2CA8 A;  2YOI A;  3GTU B;  1ERW A;  5IMC A;  5ID2 B;  2HRN A;  5J9C A;  3TJF A;  3BD2 A;  3DML A;  1TOF A;  1KEB A;  5A5K A;  3CXG A;  4F9Z A;  4JU5 A;  1SYX A;  4FH8 A;  1ILO A;  4BVY B;  1XW5 A;  13GS A;  5FT3 A;  3M3M A;  1BED A;  2OE3 A;  4ZBA A;  3Q6O A;  3C1S A;  2LEG A;  2J9H A;  2QKE A;  2O89 A;  4XIH A;  4POL A;  1K0C A;  4Z2R A;  1OKD A;  2YWM A;  3US3 A;  1I5G A;  5LCZ A;  2HZE B;  2YWI A;  4OO4 A;  1AC1 A;  2KHP A;  1GSS A;  1A23 A;  1TK5 B;  3VWU A;  3EVI A;  4PXO A;  2CX4 A;  4OFM A;  1FAA A;  4GQF A;  3VUR A;  4J57 E;  1G0T A;  3IV4 A;  1Q98 A;  1Z3E A;  2L57 A;  4ZL9 A;  1XCC A;  4FYU A;  1ZOF A;  5A4U A;  3HHV A;  2WCI A;  3QOU A;  2FWF A;  2FA4 A;  3L9S A;  1A8Y A;  5JCW A;  3U6V A;  2FHE A;  1SL0 B;  3FZA A;  1FOH A;  4JED A;  1JHB A;  5LNK e;  4KE3 A;  2YV9 A;  2E2M A;  3MYD A;  2WGR A;  1TW9 A;  3A2X A;  3TJK A;  3ERW A;  3HJP A;  1AQV A;  3F4T A;  1FO5 A;  1B9X C;  7GSS A;  4EF0 A;  2R2J A;  3Q18 A;  3F6D A;  1TJD A;  2I81 A;  2OA7 A;  1Y6E A;  2GTU A;  2C3T A;  3UOM A;  2F8F A;  4EXJ A;  2YNX A;  5CRG A;  2R0G A;  4EKZ A;  3MAK A;  4FYC A;  4K7O A;  1XWB A;  5ELA A;  5ECN B;  4J2F A;  4F2I A;  5CO3 A;  1O8X A;  4TR3 A;  1DBY A;  3WT1 A;  1MDI A;  1O6J A;  4I2T A;  1M9A A;  3F8U A;  2ZNM A;  1HD2 A;  4XCS A;  3IA1 A;  3GSS A;  2F51 A;  5H5R A;  3IHQ A;  1F2E A;  5INY A;  1Z7R A;  3EC3 A;  1KNG A;  5DCG A;  5J5N A;  3A3T A;  2DJ0 A;  1EV9 A;  3GL3 A;  3CMI A;  1NM3 A;  4EO3 A;  6GSS A;  2F8A A;  5HR0 A;  3UVH A;  1WPI A;  4J56 E;  3UVT A;  1CQH A;  5KN0 A;  1GTB A;  1PN9 A;  2AV4 A;  4KDX A;  2PVQ A;  4BWQ A;  3LYK A;  1V40 A;  4MP4 A;  3VLN A;  2X49 A;  2XHF A;  3O3T A;  2CZ2 A;  5HQP A;  1X5C A;  1XOA A;  5CYY A;  5ECP B;  1KBN A;  1AQX A;  1WIK A;  1RK4 A;  2L5L A;  3LXZ A;  1GUH A;  4TW5 A;  2CX3 A;  3SBC A;  4WET A;  1R7H A;  1ZZY A;  1M99 A;  2H8L A;  1U3A A;  1M2D A;  4GCI A;  1PSQ A;  5DAK A;  1VRS D;  4G10 A;  2VL2 A;  3UAR A;  4GTU A;  4IHU A;  1DE2 A;  3FZ4 A;  5AGY A;  1GSQ A;  5HR3 A;  4DSS B;  2MMA A;  2IMK A;  3F0I A;  1JZW A;  2HSH A;  3GHA A;  1MD3 A;  3A2V A;  1ZGN A;  2I9H A;  4D73 B;  2DJ1 A;  1TXX A;  3EU4 A;  2VCX A;  2R6K A;  4PQI A;  2OAD A;  5CNW A;  3TCO A;  3E3E A;  1G7E A;  3TRQ A;  2GT5 A;  1Y25 A;  1URM A;  1TP9 A;  4E8E A;  1K0A A;  1DUG A;  2MBT A;  2OAC A;  3KMO A;  3TRP A;  2VLT A;  4XS4 A;  2PGT A;  4JRR A;  2P5R A;  4IGJ A;  2R0C A;  1U3I A;  4RQX A;  1VGL A;  1B4P A;  2BJX A;  4JR4 A;  1GSF A;  6GSV A;  4TXO A;  2C3Q A;  4JBB A;  5HFK A;  5ECH B;  2K6V A;  3FZ9 A;  1YQ1 A;  3IK9 A;  3P90 A;  1XWG A;  2B5X A;  3D4T A;  2LJA A;  5EY6 A;  1QGV A;  2ALB A;  4MAB A;  5A4V A;  2DBC A;  4XRD A;  1YDK A;  2L59 A;  3GKM A;  4MJA A;  2LUS A;  4NWY A;  5B6M A;  5F8B A;  3QAV A;  3HY2 A;  5CRH A;  4KCA A;  3QAW A;  3WGX A;  3KEB A;  1WE0 A;  4ML6 A;  3ERF A;  2C0F A;  2LRN A;  5EVO A;  2H1D A;  5A4W A;  2FWG A;  4V2N A;  4ZL7 A;  2Z9S A;  3L9U A;  4GF0 A;  5D96 A;  3RPN A;  1JZO A;  2R37 A;  3HDC A;  2A2S A;  5EL8 A;  2YWN A;  3TUE A;  2GDR A;  2M72 A;  5G1L A;  3KD0 A;  2H19 A;  2LNT A;  4ECB A;  3L4N A;  2HSY A;  2YPM A;  3KJY A;  2L4Q A;  5F0G A;  5JCU A;  1TRS A;  9GSS A;  4MF5 A;  5DJL A;  3P2A A;  3KIJ A;  1KTE A;  3CTG A;  5C00 A;  4WR4 A;  4N0V A;  1YY7 A;  1GLQ A;  2OE0 A;  3Q74 A;  1ML6 A;  1GTU A;  2VCT A;  4MF6 A;  2REM A;  1T4Y A;  2C80 A;  3CSJ A;  2NPB A;  3HZ8 A;  3DKS A;  5EPF A;  3TKP A;  2H75 A;  5JWO B;  4MPG A;  1XWC A;  4WKW A;  5IM9 A;  4BWS A;  3HJO A;  2MBS A;  1TTZ A;  3VWX A;  5GSS A;  3H79 A;  4V1A p;  3GH6 A;  3LOR A;  3ZFB A;  1ZYN A;  4GWR A;  3TGZ A;  3G7Y A;  3RHB A;  2ZUP A;  1UC7 A;  1EGO A;  1PX6 A;  1K3Y A;  2NDO A;  4O7H A;  4V2M A;  1H4O A;  2F9S A;  4ZBD A;  4WXT A;  4MA9 A;  4JZQ A;  2X99 A;  4TOP A;  1XW9 A;  1X0R A;  3IDV A;  2AHE A;  2DLX A;  3ZL5 A;  1F37 A;  3GX8 A;  2KOK A;  1HNB A;  2DIY A;  2DIZ A;  3PIN A;  2FA8 A;  4FIW A;  1WOU A;  2JZT A;  3D4M A;  1A2J A;  4IN0 A;  1A0R P;  5ECK B;  3F9U A;  2GSS A;  2MMN A;  1SU9 A;  2V2G A;  3QAG A;  4G0I A;  4AJ7 A;  3KH9 A;  3PR8 A;  2GSR A;  2RLI A;  3E9J B;  2LTK A;  1R5A A;  1TU7 A;  2H72 A;  3C7M A;  4POB A;  5CRW A;  2WZ9 A;  5IPH A;  2RII A;  2ON7 A;  2QSI A;  3A5W A;  2X4A A;  4PNF A;  3F3R A;  2H0G A;  1XVQ A;  3TRX A;  4ISD A;  2YWO A;  4G0L A;  1OC3 A;  1BAY A;  3MIX A;  5F05 A;  4K1F A;  2GST A;  5KEJ A;  2IMF A;  2PPT A;  4AJ6 A;  2LS5 A;  2DJ2 A;  5H5S A;  5KN3 A;  1GSE A;  4ZIJ A;  4HZ2 A;  1XPV A;  2PUK C;  3LG6 A;  3FK8 A;  1A2L A;  4KAE A;  2B5E A;  4DSS A;  2L6D A;  4K0G A;  1FHE A;  1HQO A;  1V2A A;  5D9X A;  3C8E A;  3D6I A;  2DJ3 A;  4K2D A;  3W6G A;  2NVL A;  1ZYQ B;  3IOS A;  2IPA A;  3KTB A;  1QQ2 A;  2LQO A;  4ACS A;  3LFL A;  1XWK A;  5DDL A;  4HU9 A;  1ACV A;  4Q5F A;  4K6X A;  4TXV A;  14GS A;  4K2X A;  3D0Z A;  4KUN A;  4CHS A;  3TJG A;  2DKH A;  3M1G A;  5DAL B;  4TR1 A;  1G7O A;  4EL1 A;  4JR6 A;  1N2A A;  1A24 A;  2PBJ A;  2IMI A;  4F0C A;  5J41 A;  1OC8 A;  3KCM A;  1T4Z A;  1M9B A;  4KSM A;  2GQM A;  4O32 A;  4AF2 A;  3AY8 A;  4BL7 B;  4MMM A;  3GUR A;  3GRX A;  1OYJ A;  3E0U A;  2EIO A;  4FO5 A;  5ENU A;  2H30 A;  2O7K A;  2EC4 A;  1S3A A;  1THO A;  2PN8 A;  2V41 A;  3R3E A;  5LD0 A;  4EIQ A;  4K7N A;  2C0E A;  4IQA A;  2E0Q A;  2L5O A;  5L71 A;  4PUR A;  4IEL A;  4CW9 A;  1V58 A;  1YKC A;  2IMD A;  2MMZ A;  4TR0 A;  3IAS 2;  3RBT A;  2P5Q A;  1GTI A;  2XPD A;  3ZML A;  2MYG A;  3WGD A;  3MDK A;  2VCV A;  3IAM 2;  1YEX A;  3HXS A;  1QXH A;  1UN2 A;  1JLV A;  2R3X A;  1PKZ A;  3P8W A;  1W4V A;  4L0U A;  4XTS A;  1LBK A;  1ZYE A;  4OWY A;  4HJ2 A;  3QD9 A;  5BRT A;  3IPZ A;  4K8M A;  1OC9 B;  3HVX A;  5ABR A;  3D5J A;  3VWV A;  4N11 A;  3UAP A;  3RHC A;  2WUL A;  3C71 A;  4BVX A;  2LRT A;  1TU8 A;  1G6Y A;  4MZC A;  5DBQ A;  4CY8 A;  5IPG A;  2JU5 A;  2DJK A;  3BJ5 A;  4TRX A;  2P0G A;  3LXT A;  1AIU A;  1PX7 A;  5IMV A;  3WT2 A;  1XOB A;  4ILF A;  10GS A;  2HI7 A;  16GS A;  2X8C A;  1AW9 A;  3HJM A;  2DMM A;  3CRU A;  3KMN A;  4EDY A;  1OE7 A;  3TOT A;  3DYR A;  1EP8 A;  5CAX A;  1XIY A;  3G9B A;  3P7X A;  2H66 A;  1AXD A;  3EIN A;  1OE8 A;  2C3N A;  1UVZ A;  1SD8 A;  2HSM A;  1T00 A;  3CTF A;  3DEX A;  3GNJ A;  1GL8 A;  4ULX A;  1GNW A;  2WFC A;  1TDI A;  3A2W A;  2H76 A;  3LJR A;  1YJ6 A;  3N9J A;  1YF0 A;  5E59 A;  5DCH A;  4MNN A;  4ZBB A;  2H6X A;  3FEU A;  4KF9 A;  3DXB A;  4DVC A;  3BCK A;  4WF4 A;  2FGX A;  1ON4 A;  3GMF A;  3NZN A;  1WRY A;  2LQQ A;  3M8N A;  1SL1 B;  1FVK A;  2CVK A;  2H0H A;  4WBR D;  3TB2 A;  5KN1 A;  2G2Q A;  3FYG A;  1PD2 1;  5B8B A;  4QL9 A;  4ID0 A;  2IIY A;  1GUM A;  1PKW A;  3MNG A;  2XPE A;  2CAI A;  2O87 A;  3F6F A;  4F82 A;  1JZR A;  2IFQ B;  3HKR A;  3O76 A;  5HR2 A;  1SK2 A;  1EOH A;  2WS2 A;  2C4J A;  1XW6 A;  1TK8 B;  3DD3 A;  1GSD A;  2A4H A;  2VD0 A;  3I6A A;  4IQ1 A;  2LNS A;  5HR1 A;  2XBI A;  4H86 A;  2IL3 A;  5ELG A;  6GSU A;  5E4W A;  4V1A g;  2NTO A;  5IOX A;  1O81 A;  4IS0 A;  1XBS A;  2B7J A;  1GSU A;  3EU3 A;  2FLS A;  2JAD A;  2DJJ A;  1M2A A;  3LQ7 A;  4X43 A;  1T1V A;  4HOJ A;  2N5F A;  4Z2U A;  1YF1 A;  2DSA A;  2KLX A;  3FHK A;  2X8H A;  1Z6N A;  4ICY A;  4MDC A;  3UMA A;  5DVB A;  2CAQ A;  3GX0 A;  4O5Q A;  5G1K A;  4EUY A;  4GRF A;  3FRC A;  5COH A;  3GV1 A;  1EWX A;  2EIR A;  4USS A;  5IMA A;  4WBJ A;  3FY7 A;  4LMV A;  1K0N A;  2BMX A;  3GTU A;  3NOF A;  2TIR A;  4CDO A;  3G7J A;  4OCF A;  5ID2 A;  2FNO A;  2JSZ A;  5IMZ A;  3PGT A;  1K3L A;  1XVW A;  3J7Y k;  2H1G A;  4Z7X A;  3HCZ A;  1EEJ A;  4IVF A;  2H6Y A;  2CQ9 A;  4BVY A;  2VM1 A;  2QC7 A;  1K0M A;  2LRC A;  2F3M A;  4ECJ A;  4NV5 A;  1NHY A;  2MMO A;  1A8L A;  3H8Q A;  4WF5 A;  4G0K A;  4L8E A;  5G5F A;  3APO A;  3F4S A;  5J9B A;  5DQS A;  1J08 A;  3TDG A;  1GH2 A;  4TKY A;  2HZE A;  5IO2 A;  2ZCT A;  3GA4 A;  1OKT A;  2VD1 A;  1THX A;  3I43 A;  2DC5 A;  1Z7P A;  3JCM L;  2RUE A;  5DQY A;  3W8J A;  1GLP A;  1O8W A;  1TK0 B;  4QL7 A;  5J3R A;  5D8I A;  1WJK A;  3CSH A;  4Q5R A;  3CBU A;  2HYX A;  3GN3 A;  1VF1 A;  3GST A;  2VCZ A;  3QMX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...