3UMAA

Crystal structure of a hypothetical peroxiredoxin protein frm sinorhizobium meliloti
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
166
structure length
166
Chain Sequence
YFQSMMTIAVGDKLPNATFKEKTADGPVEVTTELLFKGKRVVLFAVPGAFTPTCSLNHLPGYLENRDAILARGVDDIAVVAVNDLHVMGAWATHSGGMGKIHFLSDWNAAFTKAIGMEIDLSAGTLGIRSKRYSMLVEDGVVKALNIEESPGQATASGAAAMLELL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Hypothetical peroxiredoxin protein
publication title Crystal structure of a hypothetical peroxiredoxin protein from Sinorhizobium meliloti
rcsb
source organism Sinorhizobium meliloti
total genus 40
structure length 166
sequence length 166
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2011-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08534 Redoxin Redoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3umaA00
4IP1A 2DJJA 2YPMA 4MA9A 5ECMB 5IMVA 1X9WB 3I43A 4Q5FA 5ECHB 1QQ2A 2C3QA 4Q5RA 3Q18A 5IPHA 2C3TA 3IAM2 3TJJA 1W89A 2VCTA 4PQ1A 1NSWA 1JZRA 1J0FA 3UEMA 1ZMAA 4HS1A 4NV2A 2IFQB 1EOGA 4FYBA 2C0DA 3FY7A 3N5OA 3C73A 4HUAA 3HKRA 4POBA 2VCWA 4DEJA 5D73A 5HR1A 1PD21 2GZYA 1R7HA 4MH3A 2YV7A 5CP1A 3WT2A 6GSWA 2H1AA 5HR3A 3TKSC 4I6XA 4HJ2A 1XOAA 5ECKB 3HJPA 1MDIA 4LMWA 1WP0A 2CAQA 3GL3A 2OJLA 2J23A 4I8BA 4ECBA 1SL1B 1G6WA 2LSTA 2H6XA 1K3LA 4OFTA 3CYNA 2J9HA 3AY8A 3UL3A 5DQYA 3FK8A 5J9CA 2LJRA 3M3MA 5EY6A 1IYIA 3FW2A 6GSYA 2GGTA 5KN1A 2G2QA 1XPVA 4XS4B 1PX6A 3HJOA 2O87A 4K6XA 1MTCA 2QKEA 5LNKe 3IHQA 5CNWA 1T4YA 2FWGA 1QGVA 1OE7A 4ACSA 4NMUA 2LQQA 3ZL5A 3O76A 4X43A 3KCMA 3TUEA 3W6GA 3GH9A 1A24A 1BQ7A 2H1BA 4IHUA 4EXJA 1VF1A 3GUSA 1TDIA 1GSEA 1GLPA 1HNCA 4GF0A 4KDYA 4NHZA 3KTLA 1M9BA 4PUFC 5IMAA 2NPBA 2RM5A 2DMLA 3BCKA 2H0IA 3ISOA 4NHWA 3HY2A 2PU9C 4PURA 4YQMA 4F0BA 1SJIA 4EDYA 1O7UA 2R2JA 3IPZA 5AGYA 4LL1B 3GTUA 1BX9A 3VLNA 1OC9A 3A2XA 1U88A 5CYYA 1YF1A 4Q5QA 2X8HA 3D6IA 4IBPA 3HVVA 5FWGA 4KDUA 4MCUA 3QD9A 4F0CA 3GX8A 1M99A 4MABA 1AIUA 1U3IA 2PERA 2YN1A 3FHKA 1WRYA 3DYRA 1GRXA 4I97A 3GFKA 1QUWA 4BVXA 4TKYA 1X9SB 1NHOA 5KN2A 3C8EA 2OADA 4KH7A 4TW5A 4JBBA 2FA4A 2LNTA 4KNDA 4DSSB 3IA1A 1R26A 2ALBA 3LGCA 3JCML 1TJDA 3ZMLA 2HXKA 3K8NA 5C00A 1TRWA 3J7Yk 1S3CA 3P2AA 1Z9HA 1T4ZA 4K0NA 2DLXA 2H72A 2E0QA 4EE0A 2B5EA 1GSFA 3KZQA 1KEBA 12GSA 1PKZA 1YEPA 3D4MA 3KH7A 5B6MA 2AB6A 3Q6OA 1V98A 4TOPA 4MZWA 5HFKA 1JZDA 2I3YA 2ON5A 1B8XA 1ZGNA 2FNOA 5FT3A 3EINA 3EMPA 1O85A 5DAKB 2HSYA 2XPDA 4ZL9A 4GLTA 4GWRA 4MJBA 3QFBC 1TRSA 1THXA 2H6ZA 4EO3A 4K2DA 3CRUA 2R37A 2B3SA 3DIEA 2B5YA 2V1MA 3F6DA 4DSQA 5HFIA 1GWCA 5G5FA 1PL1A 2DJ3A 6GSXA 2GT6A 3DKSA 2GVPA 2DJ2A 2GLRA 3H93A 5D9VA 4KDXA 1H4OA 1TK5B 5G30A 3E0UA 1FVJA 2FA8A 2VLUA 2FCHA 5GAPD 2JADA 5AN1A 2HSHA 2K8SA 3VURA 2PPTA 3KH9A 4CDOA 2VO4A 2I81A 2VM2A 4V1Ag 1E6BA 1BEDA 3MDKA 4MH2A 3O3TA 2HI7A 4P3YB 1JHBA 3GHAA 3KM6A 1FW1A 4OFNA 5ECSA 5EL8A 1SU9A 1K0NA 1DE2A 4ZB9A 4G10A 1M9AA 2JACA 3M9KA 5IMDA 1J9BA 5F06A 5GAND 1F6MC 3TJKA 1T7PB 3SWLA 2K9FA 1X5EA 7GSSA 5DCHA 2H6YA 2YANA 1FOVA 4KE3A 1TOFA 4K0GA 3DVXA 3Q19A 5G31A 1SL0B 4RI7A 3KP9A 4O5RA 2CA8A 2I9HA 1EEMA 4LA1A 3TRPA 2JZTA 2OKAA 3MSZA 4ZXGA 4RI6A 1SK0A 2L5OA 4G2EA 4BL7A 1YKAA 4WF4A 3I69A 1XVWA 1KBNA 2KOKA 3TRXA 3HCZA 1B9YC 4WEYA 3G7YA 2C0GA 18GSA 3A3TA 19GSA 4XS6A 1ZOFA 2GQLA 3EURA 1URMA 1LU4A 2XC2A 1M2BA 2KLXA 4IQ1A 5D8IA 2PVQA 2YCDA 2XPEA 3TDGA 1G6YA 4EVMA 2LTKA 4ZBBA 3TB2A 5JCUA 2L6CA 1W4VA 3GTUB 1FAAA 4D73A 3DXBA 1OC9B 2YJHA 3UJ1A 4IVFA 1XWCA 1R5AA 2IMIA 3A2VA 3BJ5A 4XHMA 3S9FA 1MD4A 2CAIA 3C71A 3L0HA 1F3AA 1SD9A 3GSSA 5CRHA 3GA4A 4XTSA 3ZMKA 4ZL8A 1HNBA 2F51A 3EE2A 3EU3A 1DBYA 4OFMA 1ZL9A 3GKXA 5E4WA 1U6TA 2VD1A 1K3YA 5H5RA 1EOHA 4OO5A 3KXOA 1PKWA 2WJUA 1TW9A 3GKKA 3DD3A 2VL3A 4MPGA 4BVYA 1PMTA 2H30A 5C04A 2EIRA 2FGXA 4FO5A 3EWLA 4KW6A 4F03A 4CW9A 2FWHA 5G1LA 4X1UA 1NW2A 1JFUA 4HU9A 3QAVA 2GTUA 2HFDA 5D96A 3VFIA 5AIXA 4PNFA 1U3AA 4GSNA 3FR9A 2FD3A 5D9TA 5J4UA 5CREA 1B4PA 4L0UA 3ME7A 2E2MA 3UOMA 3DEXA 1DE1A 3J7Yb 5JWRB 2H19A 4ILFA 1A8LA 4PXOA 3TRQA 1JLVA 2LEGA 3VWWA 1ML6A 3H79A 2E7PA 1FO5A 5G5EA 1SYXA 4HJMA 4EUYA 4QL9A 1GSUA 5A4WA 4PQHA 2I1UA 1BJXA 5CRWA 2V2GA 4TXVA 4ZL7A 1YY7A 1XW9A 4KB3A 2X8GA 4N0VA 2OBKA 4IQAA 4KUNA 1FHEA 4OCFA 5ELGA 5A4UA 3QOUA 1V57A 5AIVA 4NAXA 4PNGA 2KUCA 2LKUA 9GSSA 1K0AA 1RK4A 4MZBA 2GT5A 3CXGA 3FZ9A 4V2LA 4KX4A 1N2AA 3VPTA 1OVNA 2GZPA 2YOIA 2V6KA 3KD0A 2G0FA 4N30A 4XRAA 5JCWA 5CO3A 4WBJA 2HZEA 2VL2A 1O8XA 2CX4A 3D21A 1Z6MA 2DC5A 4L0WA 4MZCA 2B6MA 4HQZA 2C4JA 3L9UA 2YZHA 4OD7A 4MF6A 1QMVA 3LXTA 4KSOA 5KN0A 4G19A 4PX1A 4F9ZA 2YJ7A 3QR6A 4YQUA 1GNWA 1GSQA 2C1YA 2VCVA 5IOWA 4ZBDA 1F3BA 5F07A 6GSVA 4BWQA 3F8UA 1YZXA 5B8BA 2YV9A 4HZ4A 3QMXA 5B6NA 5HR2A 4KA0A 4MF5A 3EYTA 3GH6A 1GNEA 1USBA 3IBHA 2AYTA 3F3RA 4WBRD 4EDZA 4KGIA 1YF0A 2PVOC 5INYA 4J57E 1ZCPA 1TRUA 5J5NA 3IDVA 2BMXA 4NPBA 5ECLB 1RW1A 6GSSA 3IK7A 1PRXA 1TU8A 3U5RE 1DSBA 2WCIA 4OMVA 1VRSD 3DGQA 4HI7A 1YQ1A 4GSSA 2JZRA 6GSUA 2X99A 1YEXA 4XRDA 3OR5A 2HNLA 2ZNMA 2AV4A 3P90A 1BG5A 4JE1A 4WR4A 2GQMA 1M2AA 3IRAA 2H0GA 3TKSA 5GSSA 4JRRA 1PL2A 1Q98A 1TK8B 4K7IA 3KP8A 5CRGA 1EP8A 2R3XA 16GSA 3A2WA 2LS5A 2LJAA 5FHIA 5G1KA 3KMOA 5ID2A 3WD6A 3QFAC 1ERTA 5ENUA 2N5AA 2VAFA 1A2LA 4IN0A 2CQ9A 2BTOT 4FYCA 4PQIA 5DALA 3QAWA 3IK9A 4OO4A 2CVBA 2I4AA 2HT9A 5DDLA 3GNJA 4FH8A 2TRXA 3E3EA 4JEDA 1M0UA 4ML1A 2RLIA 4TXOA 1O8WA 2WULA 4EC0A 2H0HA 2CV4A 2DMMA 3F4RA 3F4SA 1FVKA 3ZVJD 4HDEA 2KP2A 1UVZA 2VM1A 3G7IA 1M2DA 5EPFA 4YH2A 4EL1A 1Z6NA 2JL4A 3KTBA 1G7OA 3DWVA 5ECQB 11GSA 2YWNA 4L5OA 4PUAA 1KNGA 2H70A 3H1NA 1JZOA 3UVHA 2AJQB 5AISA 3BCIA 3SBCA 1A0FA 1S3AA 3TJFA 1PA3A 1XWBA 1ZZYA 3NZNA 4K9ZA 2DJ0A 3ZIVA 5DCGA 2M46A 3ZYWA 1AQWA 2PWJA 1AAZA 5ABRA 4K7OA 1H75A 5J3RA 1TU7A 1T1VA 1GTUA 1EGRA 3RDWA 3HXSA 1QK8A 4GRFA 2NBSA 2FY6A 5IO0A 5ELAA 1EV4A 2KP1A 1JLWA 2YWIA 4TRXA 2GZZA 4MJAA 3LXZA 1GP1A 2MZCA 1GULA 2WB9A 4EKZA 3QAGA 3M9JA 1N8JA 4MMMA 2E2GA 2C0EA 4DVCA 2EC4A 2MMZA 4WR5A 2C3NA 3L4NA 2EIOA 2O89A 3H4KA 3I6AA 5IO2A 4CHSA 2HRFA 2HZEB 1Q4JA 2IFQA 5GSTA 1XWGA 4TR3A 2JZSA 4IW9A 4K1FA 4MF7A 5KN3A 1B4QA 3H8QA 3CTFA 2DSAA 1AUCA 2N5FA 4MDCA 2L59A 1XW6A 3FYGA 2YWOA 2LUSA 1THOA 2O8VB 2MMOA 4F82A 3HZ4A 1IYHA 2P31A 1GTIA 4EF0A 1PSQA 2RUEA 1FB0A 2IN3A 2L57A 2R6KA 5IMCA 5L71A 2CX3A 2JU5A 3E9JB 2IPAA 3R2QA 5H5SA 1K0MA 2CZ3A 1TI3A 1DUGA 17GSA 5D93A 1QFNA 2YZUA 1WPIA 3F3QA 1ACVA 1VF2A 3KIJA 1SYRA 1G0TA 3PGTA 1SENA 3MWHA 1E2YA 2H75A 3TOTA 2DBCA 1GSSA 3ZIJA 3KEBA 2VCXA 3RHBA 2C8UA 4AF2A 2F8AA 3TKQA 3VWVA 5IQYA 2LNSA 1XVQA 2H1DA 2K6VA 2OE0A 2P5QA 2X8CA 3LWAA 1VF3A 4MJEA 2PBJA 2KHPA 1SKSB 1B9XC 2GSSA 1A23A 2GDRA 3ED3A 4V2MA 5KEJA 1XOBA 4F2IA 4AJ8A 3RPPA 2VD0A 5E59A 4XCSA 2HRNA 3I9V2 3TKPA 5ID2B 2VL9A 2V41A 2NDOA 4MLYA 3GX0A 1V40A 4GQFA 5DALB 2H73A 1XBSA 1XFLA 3C7MA 1I5GA 3WGDA 3VI5A 1Y25A 3ZTLA 4HU7A 4Q5NA 3APQA 1K0CA 4E8EA 3FEUA 4IELA 3W8SA 2M72A 3TCOA 4TXOB 2WS2A 3HA9A 1X5CA 4K8MA 3IC4A 5IOXA 2ES7A 3M8NA 5DJLA 1ERVA 2B7KA 3G7JA 1MEKA 1MDKA 1QXHA 1XIYA 5F05A 2FHEA 1O73A 2B1KA 1T3BA 2IL3A 4QQ7A 3TJGA 2HE3A 3GKMA 4WF5A 3IR4A 3QDNA 1MDJA 1NHYA 3U6VA 1HNAA 1OKDA 4AJ7A 2FLSA 2VLTA 3UARA 2PN8A 3CTGA 3RHCA 3GN3A 4BWSA 3RPNA 3N9JA 3APOA 4KAEA 2L4CA 1PN9A 3CRTA 1SJZA 3TKSE 1GTBA 2QGVA 4DSSA 2GQKA 3KJYA 2H66A 5F8BA 3QCPA 3RAZA 3BOAA 1SL2B 4WKWA 3ZFLA 3LSZA 4Z7XA 5COHA 4ISDA 3L9SA 3F9UA 2PGTA 1K0DA 2TRCP 5D9XA 1SD8A 3D0ZA 2LQOA 1SKRB 1GLQA 4OWYA 1AQVA 1CQGA 1WWJA 3EC3A 3GMFA 5HR0A 3ZREA 3ERGA 4TR1A 2AUVA 4HQSA 2FUG2 5EVOA 3D22A 2F8FA 4DSRA 3IAS2 1NM3A 2L5LA 2VCQA 2V32A 4ECIA 3ZITA 5DQSA 5DAKA 1A2JA 1GTAA 2OE3A 2P0GA 2FWFA 4GCIA 2L4QA 1F9MA 2NTOA 4RQXA 4OCEA 2MBSA 3ERFA 3F4TA 4GSTA 2WFCA 2TIRA 4ZIJA 2VOCA 3HYPA 1SJ6A 4ECCA 1AW9A 1V2AA 1Z5YE 4V2NA 4YQVA 2IMEA 3EVIA 5ECNB 2OACA 4LL4B 1AQXA 4ML6A 3CBUA 4V1Ap 5JCGA 3ME8A 1B48A 1BYEA 5A4VA 1A0RP 2YP6A 4IJIA 5IMZA 3GURA 1XXUA 2LRNA 3GYKA 1XCCA 3CSJA 3LORA 2VUPA 1LBKA 3DVWA 4JZQA 4TN8A 3VI7A 10GSA 3V1WA 1OC3A 2PUKC 4FIWA 3BBYA 3US3A 4LLRA 2LV3A 1S3DA 2IMKA 3MAKA 4IJ3A 4N11A 2WZ9A 3GKNA 1R4WA 5IMFA 1FB6A 1EGOA 1I9DA 2LJKA 1ERWA 4JU5A 2WRTA 3C1SA 1ZYEA 1UC7A 5DJMA 4RUVA 4YAVA 4BPYA 3IV4A 4PGTA 3IE3A 1X9MB 3LYPA 4L5LA 3EMXA 1YDKA 2RM6A 1BAYA 3CMIA 3HHVA 3VK9A 2ZCTA 22GSA 4D73B 2N5BA 2K8VA 5IIZA 1GUHA 1YKCA 3UBKA 5JWOB 5G2ZA 2A2RA 1A8YA 1F37A 1GUKA 3LEFA 1V58A 2IMDA 3APSA 4NXIA 2H74A 4TVEA 1XWKA 2R4VA 1G7EA 1JZWA 1EP7A 5DBQA 5A5KA 1PGTA 4N10A 1HQOA 3FKFA 4ZBAA 4G9HA 5D9WA 1OE8A 1J08A 2O85A 4IS0A 1Z7RA 2HYXA 2WDUA 4I2TA 4XIHA 1XZOA 3ZVJA 4LMVA 4ECJA 3DMLA 4MK3A 2R5GA 2H1GA 4X0XA 2MMNA 3WGXA 1LJRA 1O81A 5J41A 3MNGA 1K0OA 1X5DA 3UMAA 3GIXA 5IM9A 2BJXA 1ILOA 1ON4A 4IGJA 1K3OA 3HVXA 2PMTA 2C0FA 4JR6A 4E8HA 2YWMA 3UVTA 2QSIA 2D2ZA 2XBQA 2IJYA 2H01A 3D5JA 4I2UA 5GZZB 2F9SA 3FRCA 2LRCA 4HOJA 4TR4A 1YJ6A 2P5RA 4GTUA 3LJRA 3GRXA 5H5QA 2CZ2A 4O7HA 1ST9A 1AXDA 3A5WA 3UIWA 2MMAA 1T00A 5ECRB 1WJKA 2MYGA 3M0FA 5ECOB 1XWAA 4ZB8A 3PH9A 3IXRA 4O32A 3VWUA 4TR1B 4NV5A 4I5QA 1Z7PA 5B8AA 1PX7A 2RIIA 3O6TA 3FZ4A 1A2MA 3P7XA 2C80A 1TTZA 5IPGA 4MPFA 5JWQB 2B5XA 3KGKA 2HLSA 3Q74A 2DJ1A 3TKRA 1F2EA 1CQHA 1OYJA 3TOUA 1C72A 4FYUA 1EWXA 3LG6A 3UBLA 4L8EA 2XHFA 4KSMA 2OBIA 2H76A 2FWEA 1OKTA 4H86A 3F63A 2A2SA 4ID0A 3HVSA 4N0ZA 1ABAA 3GL5A 4JR4A 2REMA 1WIKA 1HD2A 2X64A 3VWXA 2DIYA 1EEJA 4POLA 3DRNA 1Y6EA 2HZFA 2H71A 3HJMA 3CSIA 2M80A 2VCZA 1HYUA 2OA7A 4BA7A 2EIQA 1T8EB 13GSA 2MBTA 2AAWA 2JSZA 1GH2A 3FZAA 2VLVA 1GSDA 8GSSA 20GSA 3G9BA 3VPQA 1OC8A 3PINA 4GXZA 2DIZA 4K7NA 4O92A 3LYKA 2A4VA 3P8WA 2CVKA 1VGLA 1R5PA 5F0GA 3FR3A 4WXTA 3GSTA 4XS1A 1X0RA 3HDCA 3RBTA 2RUFA 2IIYA 1TRVA 1SK2A 4KCAA 1SK1A 2F3MA 3WGEA 1FG4A 4XS4A 3F6FA 5ECIB 6GSTA 2B7JA 1EZKA 2O7KA 1RQMA 3ERWA 4ULXA 1O6JA 1WMJA 4KCEA 3F0IA 5ECPB 4ZILA 2H8LA 3QPMA 1WE0A 2B1LA 5DVBA 1K0BA 5B7CA 3WYWA 1TKDB 5HQPA 3HZ8A 2ON7A 1EV9A 2GSQA 3C1RA 4QL7A 4POMA 1SKWB 4AGSA 3GV1A 1U87A 2DJKA 2JSYA 2Z9SA 3NOFA 4J2FA 1TXXA 1MD3A 3L9VA 1TI1A 4MJCA 2GSTA 3ZLPA 3LQ7A 5LD0A 2L6DA 3NIVA 2GS3A 1ERUA 3ZZXA 2QC7A 4HZ2A 2CT6A 4HEA2 3ZRDA 2NVLA 3TJBA 1WOUA 2GSRA 1TP9A 1UN2A 3IOSA 3WT1A 4MP4A 2YNXA 4ZB6A 2AHEA 3KMNA 1AC1A 1GUMA 4WETA 4AJ6A 1KTEA 1XW5A 1V9WA 2WGRA 1GL8A 3EU4A 2V6OA 1ZYQB 3HD5A 4RQRA 3TGZA 3UAPA 1M7TA 2XBIA 1Z3EA 3ZFBA 5CRDA 2VL2C 3LFLA 3PR8A 4IKHA 1PQNA 5LCZA 3D4TA 3FZ5A 3BD2A 1VF4A 2ZUPA 14GSA 1GSYA 4J56E 3CSHA 4YAPA 1UA5A 1OAZA 5J9BA 2OE1A 2IWTA 4IP6A 2LRTA 2CVDA 3M1GA 3L78A 3W8JA 5CAXA 2K18A 3FR6A 5HFGA 4POKA 4NWYA 4TR0A 2IMFA 2VIMA 1TK0B 4GQCA
chains in the Genus database with same CATH superfamily
4IP1A 2DJJA 2YPMA 4MA9A 5ECMB 5IMVA 1X9WB 3I43A 4Q5FA 5ECHB 1QQ2A 2C3QA 4Q5RA 3Q18A 2A2PA 5IPHA 2C3TA 3IAM2 1S3RA 3TJJA 1W89A 2VCTA 4PQ1A 1NSWA 1JZRA 1J0FA 3UEMA 1ZMAA 4HS1A 4NV2A 2IFQB 1EOGA 4FYBA 2C0DA 3FY7A 3N5OA 3C73A 4HUAA 3HKRA 4POBA 2VCWA 1XG8A 4DEJA 5D73A 5HR1A 1PD21 2GZYA 1R7HA 4MH3A 2YV7A 5CP1A 3WT2A 3EPTA 2H1AA 6GSWA 5HR3A 3TKSC 4I6XA 4HJ2A 1XOAA 5ECKB 3HJPA 1MDIA 4LMWA 1WP0A 2CAQA 3GL3A 2OJLA 2J23A 4I8BA 4ECBA 1SL1B 1G6WA 2LSTA 2H6XA 1K3LA 4OFTA 4USSA 3CYNA 2J9HA 3AY8A 3UL3A 5DQYA 4MNNA 3FK8A 5J9CA 4YKFA 2LJRA 3M3MA 2QA1A 1IYIA 5EY6A 3FW2A 6GSYA 2GGTA 5KN1A 2G2QA 1XPVA 4XS4B 1PX6A 3HJOA 2O87A 4K6XA 1MTCA 2QKEA 5LNKe 3IHQA 5CNWA 1T4YA 3IHGA 2FWGA 1QGVA 1OE7A 4ACSA 4NMUA 2LQQA 3ZL5A 3O76A 4X43A 3KCMA 3TUEA 3W6GA 3GH9A 1A24A 1BQ7A 2H1BA 4IHUA 4EXJA 1VF1A 3GUSA 1TDIA 1GSEA 1GLPA 1HNCA 4GF0A 4KDYA 4NHZA 3KTLA 1M9BA 4PUFC 5IMAA 2NPBA 2RM5A 2DMLA 3BCKA 2H0IA 3ISOA 4NHWA 3HY2A 2PU9C 4PURA 4YQMA 2A4HA 4F0BA 1SJIA 4EDYA 1O7UA 2R2JA 3IPZA 5AGYA 4LL1B 3GTUA 1BX9A 3VLNA 1OC9A 3A2XA 1U88A 5CYYA 1YF1A 4Q5QA 2X8HA 3D6IA 4IBPA 3HVVA 5FWGA 4KDUA 4MCUA 3QD9A 4F0CA 3GX8A 1M99A 4MABA 1AIUA 1U3IA 2PERA 2YN1A 3FHKA 1WRYA 3DYRA 1GRXA 4I97A 3GFKA 1QUWA 4BVXA 4TKYA 1X9SB 1NHOA 5KN2A 3C8EA 2OADA 4KH7A 4TW5A 4JBBA 2FA4A 2LNTA 4KNDA 4DSSB 3IA1A 1R26A 2ALBA 3LGCA 3JCML 1TJDA 3ZMLA 2R0GA 2HXKA 3K8NA 5C00A 1TRWA 3J7Yk 1S3CA 3P2AA 1Z9HA 1T4ZA 4K0NA 2DLXA 2H72A 2E0QA 4EE0A 2B5EA 1GSFA 3KZQA 1KEBA 12GSA 1PKZA 1YEPA 3D4MA 3KH7A 5B6MA 2AB6A 3Q6OA 1V98A 1M3IA 4O5QA 4TOPA 4MZWA 5HFKA 1JZDA 2I3YA 2ON5A 1B8XA 1ZGNA 2FNOA 5FT3A 3EINA 3EMPA 1O85A 5DAKB 2HSYA 2XPDA 4ZL9A 4GLTA 4GWRA 4ICYA 4MJBA 3QFBC 1TRSA 1THXA 2H6ZA 4EO3A 4K2DA 3CRUA 2R37A 2B3SA 3DIEA 2B5YA 2V1MA 3F6DA 4DSQA 5HFIA 1GWCA 5G5FA 1PL1A 2DJ3A 6GSXA 2GT6A 3DKSA 2GVPA 2DJ2A 2GLRA 3H93A 5D9VA 4KDXA 1H4OA 1TK5B 5G30A 3E0UA 1FVJA 2FA8A 2VLUA 2FCHA 5GAPD 2JADA 5AN1A 2HSHA 2K8SA 3VURA 2PPTA 3KH9A 4CDOA 2VO4A 2I81A 2VM2A 4V1Ag 1E6BA 1BEDA 3MDKA 4MH2A 3O3TA 2HI7A 4P3YB 1JHBA 3GHAA 3KM6A 1FW1A 4OFNA 5ECSA 5EL8A 4HSCX 1SU9A 1K0NA 1DE2A 4ZB9A 4G10A 1M9AA 2JACA 3M9KA 5IMDA 1J9BA 5F06A 5GAND 1F6MC 3TJKA 1T7PB 3SWLA 2K9FA 1X5EA 7GSSA 5DCHA 2H6YA 2YANA 1FOVA 4KE3A 1TOFA 4K0GA 3DVXA 3Q19A 5G31A 1SL0B 4RI7A 3KP9A 4O5RA 2CA8A 2I9HA 1EEMA 4LA1A 3TRPA 2JZTA 2OKAA 3MSZA 4ZXGA 4RI6A 1SK0A 2L5OA 4G2EA 4BL7A 1YKAA 4WF4A 3I69A 1XVWA 1KBNA 2KOKA 3TRXA 3HCZA 1B9YC 4WEYA 3G7YA 2C0GA 18GSA 3A3TA 19GSA 4XS6A 1ZOFA 2GQLA 3EURA 2DKHA 1URMA 1LU4A 2XC2A 1M2BA 2KLXA 4IQ1A 5D8IA 2PVQA 2YCDA 2XPEA 3TDGA 1G6YA 4EVMA 2LTKA 2HRKA 4ZBBA 3TB2A 5JCUA 2L6CA 1W4VA 3GTUB 1FAAA 4D73A 3DXBA 1OC9B 2YJHA 3UJ1A 4IVFA 1XWCA 1R5AA 2IMIA 3A2VA 3BJ5A 4XHMA 3S9FA 1MD4A 2CAIA 3C71A 3L0HA 1F3AA 1SD9A 3GSSA 5CRHA 3GA4A 4XTSA 3ZMKA 4ZL8A 1HNBA 2F51A 3EE2A 3EU3A 1DBYA 4OFMA 1ZL9A 3GKXA 5E4WA 1U6TA 2VD1A 1K3YA 5H5RA 1EOHA 4OO5A 3KXOA 2R0PA 1PKWA 2WJUA 1TW9A 3GKKA 3DD3A 2VL3A 4MPGA 4BVYA 1PMTA 2H30A 5C04A 2EIRA 2FGXA 4FO5A 3EWLA 4KW6A 4F03A 4CW9A 2FWHA 5G1LA 4X1UA 1NW2A 1JFUA 4HU9A 3QAVA 2GTUA 2HFDA 5D96A 4A5PA 3VFIA 5AIXA 4PNFA 1U3AA 4GSNA 3FR9A 2FD3A 5D9TA 5J4UA 5CREA 1B4PA 4L0UA 3ME7A 2E2MA 3UOMA 3DEXA 4G0LA 1DE1A 3J7Yb 5JWRB 2H19A 4ILFA 1A8LA 4PXOA 3TRQA 1JLVA 2LEGA 3VWWA 1ML6A 3H79A 2E7PA 1FO5A 5G5EA 1SYXA 4HJMA 4EUYA 4QL9A 1GSUA 5A4WA 4PQHA 2I1UA 1BJXA 5CRWA 2V2GA 4TXVA 4ZL7A 1YY7A 1XW9A 4KB3A 2X8GA 4N0VA 2OBKA 4IQAA 4KUNA 1FHEA 4OCFA 5ELGA 5A4UA 3QOUA 1V57A 5AIVA 4NAXA 4PNGA 2KUCA 2LKUA 9GSSA 1K0AA 1RK4A 4MZBA 2GT5A 3CXGA 3FZ9A 4V2LA 4KX4A 1N2AA 3VPTA 1OVNA 2GZPA 2YOIA 2V6KA 3KD0A 2G0FA 4N30A 4XRAA 5JCWA 5CO3A 4WBJA 2HZEA 2VL2A 1O8XA 4K2XA 3MIXA 2CX4A 3D21A 1Z6MA 2DC5A 4L0WA 4MZCA 2B6MA 4HQZA 2C4JA 3L9UA 2YZHA 4OD7A 4MF6A 1QMVA 3LXTA 4KSOA 5KN0A 4G19A 4PX1A 4F9ZA 2YJ7A 3QR6A 4YQUA 1GNWA 1GSQA 2C1YA 2VCVA 5IOWA 5KOXA 4ZBDA 1F3BA 5F07A 6GSVA 4BWQA 3F8UA 1YZXA 5B8BA 2YV9A 4HZ4A 3QMXA 5B6NA 3FMWA 5HR2A 4KA0A 4MF5A 3EYTA 3GH6A 1GNEA 1USBA 3IBHA 2AYTA 3F3RA 4WBRD 4EDZA 4KGIA 1YF0A 2PVOC 5INYA 4J57E 1ZCPA 1TRUA 5J5NA 3IDVA 2BMXA 4BL7B 4NPBA 5ECLB 1RW1A 6GSSA 3IK7A 1PRXA 1TU8A 3U5RE 1DSBA 2WCIA 4OMVA 1VRSD 3DGQA 4HI7A 1YQ1A 4GSSA 2JZRA 6GSUA 2X99A 1YEXA 4XRDA 3OR5A 2HNLA 2ZNMA 2AV4A 3P90A 1BG5A 4JE1A 4WR4A 2GQMA 1M2AA 3IRAA 2H0GA 3TKSA 5GSSA 4JRRA 1PL2A 1Q98A 1TK8B 4K7IA 3KP8A 5CRGA 1EP8A 2R3XA 16GSA 3A2WA 2LS5A 2LJAA 5FHIA 5G1KA 3KMOA 5ID2A 3WD6A 3QFAC 1ERTA 4Z2RA 5ENUA 2N5AA 2VAFA 1A2LA 4IN0A 2CQ9A 2BTOT 4FYCA 4PQIA 5DALA 3QAWA 3IK9A 4OO4A 2CVBA 2I4AA 2HT9A 5DDLA 3GNJA 4FH8A 2TRXA 3E3EA 4JEDA 1M0UA 5BRTA 4ML1A 2RLIA 4TXOA 1O8WA 4BVYB 2WULA 4EC0A 2H0HA 2CV4A 2DMMA 3F4RA 3F4SA 1FVKA 3ZVJD 4HDEA 2KP2A 1UVZA 4K5RA 2VM1A 3G7IA 1M2DA 5EPFA 4YH2A 4EL1A 1Z6NA 2JL4A 3KTBA 1G7OA 3DWVA 5ECQB 11GSA 2YWNA 4L5OA 4PUAA 1KNGA 2H70A 3H1NA 1JZOA 3UVHA 2AJQB 5AISA 3BCIA 3SBCA 1A0FA 1S3AA 3TJFA 1PA3A 3MYDA 1XWBA 1ZZYA 3NZNA 4K9ZA 2DJ0A 3ZIVA 5DCGA 2M46A 3ZYWA 1AQWA 2PWJA 1AAZA 5ABRA 4K7OA 1H75A 5J3RA 1TU7A 1T1VA 1GTUA 1EGRA 3RDWA 1M3JA 3HXSA 1PFOA 1QK8A 4GRFA 2NBSA 2FY6A 5IO0A 5ELAA 1EV4A 2KP1A 1JLWA 2YWIA 4TRXA 2GZZA 4MJAA 3LXZA 1GP1A 2MZCA 1GULA 2WB9A 4Z2UA 4EKZA 3QAGA 3M9JA 1N8JA 4MMMA 2E2GA 4G0IA 2C0EA 4DVCA 3PPUA 2EC4A 4PTSA 2MMZA 4WR5A 2C3NA 3L4NA 2EIOA 2O89A 3H4KA 3I6AA 5IO2A 4CHSA 2HRFA 2HZEB 1Q4JA 2IFQA 5GSTA 1XWGA 4TR3A 2JZSA 4IW9A 4K1FA 4MF7A 5KN3A 1B4QA 3H8QA 3CTFA 2DSAA 1AUCA 2N5FA 4MDCA 2L59A 1XW6A 3FYGA 2YWOA 2LUSA 1THOA 2O8VB 2MMOA 4F82A 3HZ4A 1IYHA 2P31A 1GTIA 4EF0A 1PSQA 2RUEA 1FB0A 5BMUA 2IN3A 2L57A 2R6KA 5IMCA 5L71A 2CX3A 2JU5A 3E9JB 2IPAA 3R2QA 5H5SA 1K0MA 2CZ3A 1TI3A 1DUGA 17GSA 5D93A 1QFNA 2YZUA 1WPIA 3F3QA 1ACVA 1VF2A 3KIJA 4K5SA 1SYRA 1G0TA 3PGTA 2DKIA 1SENA 3MWHA 1E2YA 2H75A 3TOTA 2DBCA 1GSSA 3ZIJA 3KEBA 2VCXA 3RHBA 2C8UA 4AF2A 2F8AA 3TKQA 3VWVA 5IQYA 2LNSA 1XVQA 2H1DA 2K6VA 2OE0A 2P5QA 2X8CA 3LWAA 1VF3A 4MJEA 2PBJA 2KHPA 1SKSB 1B9XC 2GSSA 1A23A 2QA2A 2GDRA 3ED3A 4V2MA 4EIPA 5KEJA 1XOBA 4F2IA 4AJ8A 3RPPA 2VD0A 5E59A 4XCSA 2HRNA 3I9V2 3TKPA 5ID2B 2VL9A 2V41A 2NDOA 3HVNA 4MLYA 3GX0A 1V40A 4GQFA 5DALB 2H73A 1XBSA 1XFLA 3C7MA 1I5GA 3WGDA 3VI5A 1Y25A 3ZTLA 4HU7A 4Q5NA 3APQA 1K0CA 4E8EA 3FEUA 4IELA 3W8SA 2M72A 3TCOA 4TXOB 2WS2A 3HA9A 1X5CA 4K8MA 3IC4A 5IOXA 4BVXB 2ES7A 3M8NA 5DJLA 1ERVA 4YKGA 2B7KA 3G7JA 1MEKA 1MDKA 1QXHA 1XIYA 2X4AA 5F05A 2FHEA 1O73A 2B1KA 1T3BA 2IL3A 4QQ7A 3TJGA 2HE3A 3GKMA 4WF5A 3IR4A 3QDNA 1MDJA 1NHYA 3U6VA 1HNAA 1OKDA 4AJ7A 2FLSA 2VLTA 3UARA 2PN8A 3CTGA 3RHCA 3GN3A 4BWSA 3IC8A 3RPNA 3N9JA 3APOA 4KAEA 2L4CA 1PN9A 3CRTA 1SJZA 3TKSE 1GTBA 2QGVA 3LW9A 4DSSA 2GQKA 3KJYA 2H66A 5F8BA 3QCPA 3RAZA 3BOAA 1SL2B 4WKWA 3ZFLA 3LSZA 4Z7XA 5COHA 4ISDA 3L9SA 3F9UA 2PGTA 1K0DA 2TRCP 5D9XA 1SD8A 3D0ZA 2LQOA 1SKRB 1GLQA 4OWYA 1AQVA 1CQGA 1WWJA 3EC3A 3GMFA 5HR0A 3ZREA 3ERGA 4KF9A 4TR1A 2AUVA 4HQSA 2FUG2 5EVOA 3D22A 2F8FA 4DSRA 3IAS2 1NM3A 2L5LA 2VCQA 2V32A 4ECIA 3ZITA 5DQSA 5DAKA 1A2JA 1GTAA 2OE3A 2P0GA 2FWFA 4GCIA 2L4QA 1F9MA 2NTOA 4RQXA 4OCEA 2MBSA 3ERFA 3F4TA 4GSTA 2WFCA 2TIRA 4ZIJA 2VOCA 3HYPA 1SJ6A 4ECCA 1AW9A 1V2AA 1Z5YE 4V2NA 4YQVA 2IMEA 3EVIA 5ECNB 2OACA 4LL4B 4X4JA 1AQXA 4ML6A 3CBUA 4V1Ap 5JCGA 3ME8A 1B48A 1BYEA 5A4VA 1A0RP 2YP6A 4IJIA 5IMZA 3GURA 1XXUA 2LRNA 3GYKA 1XCCA 3CSJA 3LORA 2VUPA 1LBKA 3DVWA 4JZQA 4TN8A 3VI7A 10GSA 3V1WA 1OC3A 2PUKC 4FIWA 3BBYA 3US3A 4LLRA 2LV3A 1S3DA 2IMKA 3MAKA 4IJ3A 4N11A 2WZ9A 3GKNA 1R4WA 5IMFA 1FB6A 1EGOA 1I9DA 2LJKA 1ERWA 4JU5A 2WRTA 3C1SA 1ZYEA 1UC7A 5DJMA 4RUVA 4YAVA 4BPYA 3IV4A 4PGTA 3IE3A 1X9MB 3LYPA 4L5LA 3EMXA 1YDKA 3A5IA 2RM6A 1BAYA 3CMIA 3HHVA 3VK9A 2ZCTA 22GSA 4D73B 2N5BA 2K8VA 5IIZA 1GUHA 1YKCA 3UBKA 5JWOB 5G2ZA 2A2RA 1A8YA 1F37A 1GUKA 3LEFA 2HRAA 2HSMA 1V58A 2IMDA 3APSA 4NXIA 2H74A 4TVEA 1XWKA 2R4VA 1G7EA 1JZWA 1EP7A 5DBQA 5A5KA 1PGTA 4N10A 1HQOA 3FKFA 4ZBAA 4G9HA 1PN0A 5D9WA 1OE8A 1J08A 2O85A 4IS0A 1Z7RA 2HYXA 2WDUA 4I2TA 4XIHA 1XZOA 3ZVJA 4LMVA 4ECJA 3DMLA 4MK3A 2R5GA 2H1GA 4X0XA 2MMNA 3WGXA 4BIKA 3R3EA 1LJRA 1O81A 5J41A 3MNGA 1K0OA 1X5DA 2R0CA 3UMAA 3GIXA 5IM9A 2BJXA 1ILOA 1ON4A 4IGJA 1K3OA 3HVXA 2PMTA 2C0FA 4JR6A 4E8HA 2YWMA 3UVTA 2QSIA 2D2ZA 2XBQA 2IJYA 2H01A 3D5JA 4I2UA 5GZZB 2F9SA 3FRCA 2LRCA 4HOJA 4TR4A 1YJ6A 2P5RA 4GTUA 3LJRA 3GRXA 5H5QA 1ZYNA 2CZ2A 4O7HA 1ST9A 1AXDA 3A5WA 3UIWA 4CY6A 2MMAA 1T00A 5ECRB 1WJKA 2MYGA 3M0FA 5ECOB 1XWAA 4ZB8A 3PH9A 3IXRA 4O32A 3VWUA 4TR1B 4NV5A 4I5QA 1Z7PA 5B8AA 1PX7A 2RIIA 3O6TA 3FZ4A 1A2MA 2UZ8A 3P7XA 2C80A 1TTZA 5IPGA 4MPFA 5JWQB 2B5XA 1ZYPA 2HLSA 3KGKA 3Q74A 2DJ1A 3TKRA 1F2EA 1CQHA 1OYJA 3TOUA 1C72A 4FYUA 1EWXA 4EIQA 3LG6A 3UBLA 4L8EA 2XHFA 4KSMA 2OBIA 2H76A 2FWEA 1OKTA 4H86A 3F63A 2A2SA 4ID0A 3HVSA 4N0ZA 1ABAA 3GL5A 4JR4A 2REMA 1WIKA 1HD2A 2X64A 3VWXA 2DIYA 1EEJA 4POLA 3DRNA 4O5UA 1Y6EA 2HZFA 2H71A 3HJMA 3CSIA 2M80A 2VCZA 1HYUA 2OA7A 4BA7A 2EIQA 1T8EB 13GSA 2MBTA 2AAWA 2JSZA 1GH2A 3FZAA 2VLVA 1GSDA 1FOHA 8GSSA 20GSA 3G9BA 3VPQA 1OC8A 3PINA 4GXZA 2DIZA 4K7NA 4O92A 3LYKA 2A4VA 3P8WA 2CVKA 1VGLA 1R5PA 5F0GA 3FR3A 4WXTA 3GSTA 4XS1A 1X0RA 3HDCA 3RBTA 2RUFA 2IIYA 1TRVA 1SK2A 4KCAA 1SK1A 2F3MA 3WGEA 1FG4A 4XS4A 3F6FA 5ECIB 6GSTA 2B7JA 1EZKA 2O7KA 1RQMA 3ERWA 4ULXA 1O6JA 1WMJA 4KCEA 3F0IA 5ECPB 4ZILA 2H8LA 3QPMA 1WE0A 4G0KA 2B1LA 5DVBA 1K0BA 5B7CA 3WYWA 1TKDB 5HQPA 3HZ8A 2ON7A 1EV9A 2GSQA 3C1RA 4QL7A 4POMA 1SKWB 4AGSA 3GV1A 1U87A 2DJKA 2JSYA 2Z9SA 3NOFA 4J2FA 1TXXA 1MD3A 3L9VA 1TI1A 4MJCA 2GSTA 3ZLPA 3LQ7A 5LD0A 2L6DA 3NIVA 2GS3A 1ERUA 3ZZXA 2QC7A 4HZ2A 2CT6A 4HEA2 3ZRDA 2NVLA 3TJBA 1WOUA 2GSRA 1TP9A 1UN2A 3IOSA 3WT1A 4MP4A 2YNXA 4ZB6A 2AHEA 3KMNA 1AC1A 1GUMA 4WETA 4Z2TA 4AJ6A 1KTEA 1XW5A 1V9WA 2X49A 2WGRA 1GL8A 3EU4A 2V6OA 1ZYQB 3HD5A 4RQRA 3TGZA 3UAPA 1M7TA 2XBIA 1Z3EA 3ZFBA 5CRDA 2VL2C 3LFLA 3PR8A 4CY8A 4IKHA 1PQNA 5LCZA 5KOWA 3D4TA 3FZ5A 3BD2A 1VF4A 4FQUA 2ZUPA 14GSA 1GSYA 4J56E 3CSHA 4YAPA 1UA5A 1OAZA 5J9BA 2OE1A 2IWTA 4IP6A 2LRTA 2CVDA 3M1GA 3L78A 3W8JA 5CAXA 2K18A 3CQFA 3FR6A 5HFGA 4POKA 4NWYA 4TR0A 2IMFA 2VIMA 1TK0B 4GQCA
chains in the Genus database with same CATH topology
4IP1A 2DJJA 2YPMA 4MA9A 5ECMB 5IMVA 1X9WB 3I43A 4Q5FA 5ECHB 1QQ2A 2C3QA 4Q5RA 3Q18A 2A2PA 5IPHA 2C3TA 3IAM2 3TJJA 1W89A 2VCTA 4PQ1A 1NSWA 1JZRA 1J0FA 3UEMA 1ZMAA 4HS1A 4NV2A 2IFQB 1EOGA 4FYBA 2C0DA 3FY7A 3N5OA 3C73A 4HUAA 3HKRA 4POBA 2VCWA 4DEJA 5D73A 5HR1A 1PD21 2GZYA 1R7HA 4MH3A 2YV7A 5CP1A 3WT2A 3EPTA 2H1AA 6GSWA 5HR3A 3TKSC 4I6XA 4HJ2A 1XOAA 5ECKB 3HJPA 1MDIA 4LMWA 1WP0A 2CAQA 3GL3A 2OJLA 2J23A 4I8BA 4ECBA 1SL1B 1G6WA 2LSTA 2H6XA 1K3LA 4OFTA 4USSA 3CYNA 2J9HA 3AY8A 3UL3A 5DQYA 4MNNA 3FK8A 5J9CA 4YKFA 2LJRA 3M3MA 2QA1A 1IYIA 5EY6A 3FW2A 6GSYA 2GGTA 5KN1A 2G2QA 1XPVA 4XS4B 1PX6A 3HJOA 2O87A 4K6XA 1MTCA 2QKEA 5LNKe 3IHQA 5CNWA 1T4YA 3IHGA 2FWGA 1QGVA 1OE7A 4ACSA 4NMUA 2LQQA 3ZL5A 3O76A 4X43A 3KCMA 3TUEA 3W6GA 3GH9A 1A24A 1BQ7A 2H1BA 4IHUA 4EXJA 1VF1A 3GUSA 1TDIA 1GSEA 1GLPA 1HNCA 4GF0A 4KDYA 4NHZA 3KTLA 1M9BA 4PUFC 5IMAA 2NPBA 2RM5A 2DMLA 3BCKA 2H0IA 3ISOA 4NHWA 3HY2A 2PU9C 4PURA 4YQMA 2A4HA 4F0BA 1SJIA 4EDYA 1O7UA 2R2JA 3IPZA 5AGYA 4LL1B 3GTUA 1BX9A 3VLNA 1OC9A 3A2XA 1U88A 5CYYA 1YF1A 4Q5QA 2X8HA 3D6IA 4IBPA 3HVVA 5FWGA 4KDUA 4MCUA 3QD9A 4F0CA 3GX8A 1M99A 4MABA 1AIUA 1U3IA 2PERA 2YN1A 3FHKA 1WRYA 3DYRA 1GRXA 4I97A 3GFKA 1QUWA 4BVXA 4TKYA 1X9SB 1NHOA 5KN2A 3C8EA 2OADA 4KH7A 4TW5A 4JBBA 2FA4A 2LNTA 4KNDA 4DSSB 3IA1A 1R26A 2ALBA 3LGCA 3JCML 1TJDA 3ZMLA 2R0GA 2HXKA 3K8NA 5C00A 1TRWA 3J7Yk 1S3CA 3P2AA 1Z9HA 1T4ZA 4K0NA 2DLXA 2H72A 2E0QA 4EE0A 2B5EA 1GSFA 3KZQA 1KEBA 12GSA 1PKZA 1YEPA 3D4MA 3KH7A 5B6MA 2AB6A 3Q6OA 1V98A 4O5QA 4TOPA 4MZWA 5HFKA 1JZDA 2I3YA 2ON5A 1B8XA 1ZGNA 2FNOA 5FT3A 3EINA 3EMPA 1O85A 5DAKB 2HSYA 2XPDA 4ZL9A 4GLTA 4GWRA 4ICYA 4MJBA 3QFBC 1TRSA 1THXA 2H6ZA 4EO3A 4K2DA 3CRUA 2R37A 2B3SA 3DIEA 2B5YA 2V1MA 3F6DA 4DSQA 5HFIA 1GWCA 5G5FA 1PL1A 2DJ3A 6GSXA 2GT6A 3DKSA 2GVPA 2DJ2A 2GLRA 3H93A 5D9VA 4KDXA 1H4OA 1TK5B 5G30A 3E0UA 1FVJA 2FA8A 2VLUA 2FCHA 5GAPD 2JADA 5AN1A 2HSHA 2K8SA 3VURA 2PPTA 3KH9A 4CDOA 2VO4A 2I81A 2VM2A 4V1Ag 1E6BA 1BEDA 3MDKA 4MH2A 3O3TA 2HI7A 4P3YB 1JHBA 3GHAA 3KM6A 1FW1A 4OFNA 5ECSA 5EL8A 1SU9A 1K0NA 1DE2A 4ZB9A 4G10A 1M9AA 2JACA 3M9KA 5IMDA 1J9BA 5F06A 5GAND 1F6MC 3TJKA 1T7PB 3SWLA 2K9FA 1X5EA 7GSSA 5DCHA 2H6YA 2YANA 1FOVA 4KE3A 1TOFA 4K0GA 3DVXA 3Q19A 5G31A 1SL0B 4RI7A 3KP9A 4O5RA 2CA8A 2I9HA 1EEMA 4LA1A 3TRPA 2JZTA 2OKAA 3MSZA 4ZXGA 4RI6A 1SK0A 2L5OA 4G2EA 4BL7A 1YKAA 4WF4A 3I69A 1XVWA 1KBNA 2KOKA 3TRXA 3HCZA 1B9YC 4WEYA 3G7YA 2C0GA 18GSA 3A3TA 19GSA 4XS6A 1ZOFA 2GQLA 3EURA 2DKHA 1URMA 1LU4A 2XC2A 1M2BA 2KLXA 4IQ1A 5D8IA 2PVQA 2YCDA 2XPEA 3TDGA 1G6YA 4EVMA 2LTKA 2HRKA 4ZBBA 3TB2A 5JCUA 2L6CA 1W4VA 3GTUB 1FAAA 4D73A 3DXBA 1OC9B 2YJHA 3UJ1A 4IVFA 1XWCA 1R5AA 2IMIA 3A2VA 3BJ5A 4XHMA 3S9FA 1MD4A 2CAIA 3C71A 3L0HA 1F3AA 1SD9A 3GSSA 5CRHA 3GA4A 4XTSA 3ZMKA 4ZL8A 1HNBA 2F51A 3EE2A 3EU3A 1DBYA 4OFMA 1ZL9A 3GKXA 5E4WA 1U6TA 2VD1A 1K3YA 5H5RA 1EOHA 4OO5A 3KXOA 2R0PA 1PKWA 2WJUA 1TW9A 3GKKA 3DD3A 2VL3A 4MPGA 4BVYA 1PMTA 2H30A 5C04A 2EIRA 2FGXA 4FO5A 3EWLA 4KW6A 4F03A 4CW9A 2FWHA 5G1LA 4X1UA 1NW2A 1JFUA 4HU9A 3QAVA 2GTUA 2HFDA 5D96A 4A5PA 3VFIA 5AIXA 4PNFA 1U3AA 4GSNA 3FR9A 2FD3A 5D9TA 5J4UA 5CREA 1B4PA 4L0UA 3ME7A 2E2MA 3UOMA 3DEXA 4G0LA 1DE1A 3J7Yb 5JWRB 2H19A 4ILFA 1A8LA 4PXOA 3TRQA 1JLVA 2LEGA 3VWWA 1ML6A 3H79A 2E7PA 1FO5A 5G5EA 1SYXA 4HJMA 4EUYA 4QL9A 1GSUA 5A4WA 4PQHA 2I1UA 1BJXA 5CRWA 2V2GA 4TXVA 4ZL7A 1YY7A 1XW9A 4KB3A 2X8GA 4N0VA 2OBKA 4IQAA 4KUNA 1FHEA 4OCFA 5ELGA 5A4UA 3QOUA 1V57A 5AIVA 4NAXA 4PNGA 2KUCA 2LKUA 9GSSA 1K0AA 1RK4A 4MZBA 2GT5A 3CXGA 3FZ9A 4V2LA 4KX4A 1N2AA 3VPTA 1OVNA 2GZPA 2YOIA 2V6KA 3KD0A 2G0FA 4N30A 4XRAA 5JCWA 5CO3A 4WBJA 2HZEA 2VL2A 1O8XA 4K2XA 3MIXA 2CX4A 3D21A 1Z6MA 2DC5A 4L0WA 4MZCA 2B6MA 4HQZA 2C4JA 3L9UA 2YZHA 4OD7A 4MF6A 1QMVA 3LXTA 4KSOA 5KN0A 4G19A 4PX1A 4F9ZA 2YJ7A 3QR6A 4YQUA 1GNWA 1GSQA 2C1YA 2VCVA 5IOWA 5KOXA 4ZBDA 1F3BA 5F07A 6GSVA 4BWQA 3F8UA 1YZXA 5B8BA 2YV9A 4HZ4A 3QMXA 5B6NA 3FMWA 5HR2A 4KA0A 4MF5A 3EYTA 3GH6A 1GNEA 1USBA 3IBHA 2AYTA 3F3RA 4WBRD 4EDZA 4KGIA 1YF0A 2PVOC 5INYA 4J57E 1ZCPA 1TRUA 5J5NA 3IDVA 2BMXA 4BL7B 4NPBA 5ECLB 1RW1A 6GSSA 3IK7A 1PRXA 1TU8A 3U5RE 1DSBA 2WCIA 4OMVA 1VRSD 3DGQA 4HI7A 1YQ1A 4GSSA 2JZRA 6GSUA 2X99A 1YEXA 4XRDA 3OR5A 2HNLA 2ZNMA 2AV4A 3P90A 1BG5A 4JE1A 4WR4A 2GQMA 1M2AA 3IRAA 2H0GA 3TKSA 5GSSA 4JRRA 1PL2A 1Q98A 1TK8B 4K7IA 3KP8A 5CRGA 1EP8A 2R3XA 16GSA 3A2WA 2LS5A 2LJAA 5FHIA 5G1KA 3KMOA 5ID2A 3WD6A 3QFAC 1ERTA 4Z2RA 5ENUA 2N5AA 2VAFA 1A2LA 4IN0A 2CQ9A 2BTOT 4FYCA 4PQIA 5DALA 3QAWA 3IK9A 4OO4A 2CVBA 2I4AA 2HT9A 5DDLA 3GNJA 4FH8A 2TRXA 3E3EA 4JEDA 1M0UA 5BRTA 4ML1A 2RLIA 4TXOA 1O8WA 4BVYB 2WULA 4EC0A 2H0HA 2CV4A 2DMMA 3F4RA 3F4SA 1FVKA 3ZVJD 4HDEA 2KP2A 1UVZA 4K5RA 2VM1A 3G7IA 1M2DA 5EPFA 4YH2A 4EL1A 1Z6NA 2JL4A 3KTBA 1G7OA 3DWVA 5ECQB 11GSA 2YWNA 4L5OA 4PUAA 1KNGA 2H70A 3H1NA 1JZOA 3UVHA 2AJQB 5AISA 3BCIA 3SBCA 1A0FA 1S3AA 3TJFA 1PA3A 3MYDA 1XWBA 1ZZYA 3NZNA 4K9ZA 2DJ0A 3ZIVA 5DCGA 2M46A 3ZYWA 1AQWA 2PWJA 1AAZA 5ABRA 4K7OA 1H75A 5J3RA 1TU7A 1T1VA 1GTUA 1EGRA 3RDWA 3HXSA 1QK8A 4GRFA 2NBSA 2FY6A 5IO0A 5ELAA 1EV4A 2KP1A 1JLWA 2YWIA 4TRXA 2GZZA 4MJAA 3LXZA 1GP1A 2MZCA 1GULA 2WB9A 4Z2UA 4EKZA 3QAGA 3M9JA 1N8JA 4MMMA 2E2GA 4G0IA 2C0EA 4DVCA 3PPUA 2EC4A 4PTSA 2MMZA 4WR5A 2C3NA 3L4NA 2EIOA 2O89A 3H4KA 3I6AA 5IO2A 4CHSA 2HRFA 2HZEB 1Q4JA 2IFQA 5GSTA 1XWGA 4TR3A 2JZSA 4IW9A 4K1FA 4MF7A 5KN3A 1B4QA 3H8QA 3CTFA 2DSAA 1AUCA 2N5FA 4MDCA 2L59A 1XW6A 3FYGA 2YWOA 2LUSA 1THOA 2O8VB 2MMOA 4F82A 3HZ4A 1IYHA 2P31A 1GTIA 4EF0A 1PSQA 2RUEA 1FB0A 5BMUA 2IN3A 2L57A 2R6KA 5IMCA 5L71A 2CX3A 2JU5A 3E9JB 2IPAA 3R2QA 5H5SA 1K0MA 2CZ3A 1TI3A 1DUGA 17GSA 5D93A 1QFNA 2YZUA 1WPIA 3F3QA 1ACVA 1VF2A 3KIJA 4K5SA 1SYRA 1G0TA 3PGTA 2DKIA 1SENA 3MWHA 1E2YA 2H75A 3TOTA 2DBCA 1GSSA 3ZIJA 3KEBA 2VCXA 3RHBA 2C8UA 4AF2A 2F8AA 3TKQA 3VWVA 5IQYA 2LNSA 1XVQA 2H1DA 2K6VA 2OE0A 2P5QA 2X8CA 3LWAA 1VF3A 4MJEA 2PBJA 2KHPA 1SKSB 1B9XC 2GSSA 1A23A 2QA2A 2GDRA 3ED3A 4V2MA 4EIPA 5KEJA 1XOBA 4F2IA 4AJ8A 3RPPA 2VD0A 5E59A 4XCSA 2HRNA 3I9V2 3TKPA 5ID2B 2VL9A 2V41A 2NDOA 4MLYA 3GX0A 1V40A 4GQFA 5DALB 2H73A 1XBSA 1XFLA 3C7MA 1I5GA 3WGDA 3VI5A 1Y25A 3ZTLA 4HU7A 4Q5NA 3APQA 1K0CA 4E8EA 3FEUA 4IELA 3W8SA 2M72A 3TCOA 4TXOB 2WS2A 3HA9A 1X5CA 4K8MA 3IC4A 5IOXA 4BVXB 2ES7A 3M8NA 5DJLA 1ERVA 4YKGA 2B7KA 3G7JA 1MEKA 1MDKA 1QXHA 1XIYA 2X4AA 5F05A 2FHEA 1O73A 2B1KA 1T3BA 2IL3A 4QQ7A 3TJGA 2HE3A 3GKMA 4WF5A 3IR4A 3QDNA 1MDJA 1NHYA 3U6VA 1HNAA 1OKDA 4AJ7A 2FLSA 2VLTA 3UARA 2PN8A 3CTGA 3RHCA 3GN3A 4BWSA 3IC8A 3RPNA 3N9JA 3APOA 4KAEA 2L4CA 1PN9A 3CRTA 1SJZA 3TKSE 1GTBA 2QGVA 3LW9A 4DSSA 2GQKA 3KJYA 2H66A 5F8BA 3QCPA 3RAZA 3BOAA 1SL2B 4WKWA 3ZFLA 3LSZA 4Z7XA 5COHA 4ISDA 3L9SA 3F9UA 2PGTA 1K0DA 2TRCP 5D9XA 1SD8A 3D0ZA 2LQOA 1SKRB 1GLQA 4OWYA 1AQVA 1CQGA 1WWJA 3EC3A 3GMFA 5HR0A 3ZREA 3ERGA 4KF9A 4TR1A 2AUVA 4HQSA 2FUG2 5EVOA 3D22A 2F8FA 4DSRA 3IAS2 1NM3A 2L5LA 2VCQA 2V32A 4ECIA 3ZITA 5DQSA 5DAKA 1A2JA 1GTAA 2OE3A 2P0GA 2FWFA 4GCIA 2L4QA 1F9MA 2NTOA 4RQXA 4OCEA 2MBSA 3ERFA 3F4TA 4GSTA 2WFCA 2TIRA 4ZIJA 2VOCA 3HYPA 1SJ6A 4ECCA 1AW9A 1V2AA 1Z5YE 4V2NA 4YQVA 2IMEA 3EVIA 5ECNB 2OACA 4LL4B 4X4JA 1AQXA 4ML6A 3CBUA 4V1Ap 5JCGA 3ME8A 1B48A 1BYEA 5A4VA 1A0RP 2YP6A 4IJIA 5IMZA 3GURA 1XXUA 2LRNA 3GYKA 1XCCA 3CSJA 3LORA 2VUPA 1LBKA 3DVWA 4JZQA 4TN8A 3VI7A 10GSA 3V1WA 1OC3A 2PUKC 4FIWA 3BBYA 3US3A 4LLRA 2LV3A 1S3DA 2IMKA 3MAKA 4IJ3A 4N11A 2WZ9A 3GKNA 1R4WA 5IMFA 1FB6A 1EGOA 1I9DA 2LJKA 1ERWA 4JU5A 2WRTA 3C1SA 1ZYEA 1UC7A 5DJMA 4RUVA 4YAVA 4BPYA 3IV4A 4PGTA 3IE3A 1X9MB 3LYPA 4L5LA 3EMXA 1YDKA 3A5IA 2RM6A 1BAYA 3CMIA 3HHVA 3VK9A 2ZCTA 22GSA 4D73B 2N5BA 2K8VA 5IIZA 1GUHA 1YKCA 3UBKA 5JWOB 5G2ZA 2A2RA 1A8YA 1F37A 1GUKA 3LEFA 2HRAA 2HSMA 1V58A 2IMDA 3APSA 4NXIA 2H74A 4TVEA 1XWKA 2R4VA 1G7EA 1JZWA 1EP7A 5DBQA 5A5KA 1PGTA 4N10A 1HQOA 3FKFA 4ZBAA 4G9HA 1PN0A 5D9WA 1OE8A 1J08A 2O85A 4IS0A 1Z7RA 2HYXA 2WDUA 4I2TA 4XIHA 1XZOA 3ZVJA 4LMVA 4ECJA 3DMLA 4MK3A 2R5GA 2H1GA 4X0XA 2MMNA 3WGXA 3R3EA 1LJRA 1O81A 5J41A 3MNGA 1K0OA 1X5DA 2R0CA 3UMAA 3GIXA 5IM9A 2BJXA 1ILOA 1ON4A 4IGJA 1K3OA 3HVXA 2PMTA 2C0FA 4JR6A 4E8HA 2YWMA 3UVTA 2QSIA 2D2ZA 2XBQA 2IJYA 2H01A 3D5JA 4I2UA 5GZZB 2F9SA 3FRCA 2LRCA 4HOJA 4TR4A 1YJ6A 2P5RA 4GTUA 3LJRA 3GRXA 5H5QA 1ZYNA 2CZ2A 4O7HA 1ST9A 1AXDA 3A5WA 3UIWA 4CY6A 2MMAA 1T00A 5ECRB 1WJKA 2MYGA 3M0FA 5ECOB 1XWAA 4ZB8A 3PH9A 3IXRA 4O32A 3VWUA 4TR1B 4NV5A 4I5QA 1Z7PA 5B8AA 1PX7A 2RIIA 3O6TA 3FZ4A 1A2MA 2UZ8A 3P7XA 2C80A 1TTZA 5IPGA 4MPFA 5JWQB 2B5XA 1ZYPA 2HLSA 3KGKA 3Q74A 2DJ1A 3TKRA 1F2EA 1CQHA 1OYJA 3TOUA 1C72A 4FYUA 1EWXA 4EIQA 3LG6A 3UBLA 4L8EA 2XHFA 4KSMA 2OBIA 2H76A 2FWEA 1OKTA 4H86A 3F63A 2A2SA 4ID0A 3HVSA 4N0ZA 1ABAA 3GL5A 4JR4A 2REMA 1WIKA 1HD2A 2X64A 3VWXA 2DIYA 1EEJA 4POLA 3DRNA 4O5UA 1Y6EA 2HZFA 2H71A 3HJMA 3CSIA 2M80A 2VCZA 1HYUA 2OA7A 4BA7A 2EIQA 1T8EB 13GSA 2MBTA 2AAWA 2JSZA 1GH2A 3FZAA 2VLVA 1GSDA 1FOHA 8GSSA 20GSA 3G9BA 3VPQA 1OC8A 3PINA 4GXZA 2DIZA 4K7NA 4O92A 3LYKA 2A4VA 3P8WA 2CVKA 1VGLA 1R5PA 5F0GA 3FR3A 4WXTA 3GSTA 4XS1A 1X0RA 3HDCA 3RBTA 2RUFA 2IIYA 1TRVA 1SK2A 4KCAA 1SK1A 2F3MA 3WGEA 1FG4A 4XS4A 3F6FA 5ECIB 6GSTA 2B7JA 1EZKA 2O7KA 1RQMA 3ERWA 4ULXA 1O6JA 1WMJA 4KCEA 3F0IA 5ECPB 4ZILA 2H8LA 3QPMA 1WE0A 4G0KA 2B1LA 5DVBA 1K0BA 5B7CA 3WYWA 1TKDB 5HQPA 3HZ8A 2ON7A 1EV9A 2GSQA 3C1RA 4QL7A 4POMA 1SKWB 4AGSA 3GV1A 1U87A 2DJKA 2JSYA 2Z9SA 3NOFA 4J2FA 1TXXA 1MD3A 3L9VA 1TI1A 4MJCA 2GSTA 3ZLPA 3LQ7A 5LD0A 2L6DA 3NIVA 2GS3A 1ERUA 3ZZXA 2QC7A 4HZ2A 2CT6A 4HEA2 3ZRDA 2NVLA 3TJBA 1WOUA 2GSRA 1TP9A 1UN2A 3IOSA 3WT1A 4MP4A 2YNXA 4ZB6A 2AHEA 3KMNA 1AC1A 1GUMA 4WETA 4Z2TA 4AJ6A 1KTEA 1XW5A 1V9WA 2X49A 2WGRA 1GL8A 3EU4A 2V6OA 1ZYQB 3HD5A 4RQRA 3TGZA 3UAPA 1M7TA 2XBIA 1Z3EA 3ZFBA 5CRDA 2VL2C 3LFLA 3PR8A 4CY8A 4IKHA 1PQNA 5LCZA 5KOWA 3D4TA 3FZ5A 3BD2A 1VF4A 4FQUA 2ZUPA 14GSA 1GSYA 4J56E 3CSHA 4YAPA 1UA5A 1OAZA 5J9BA 2OE1A 2IWTA 4IP6A 2LRTA 2CVDA 3M1GA 3L78A 3W8JA 5CAXA 2K18A 3FR6A 5HFGA 4POKA 4NWYA 4TR0A 2IMFA 2VIMA 1TK0B 4GQCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IP1 A;  2DJJ A;  2YPM A;  4MA9 A;  5ECM B;  5IMV A;  1X9W B;  3I43 A;  4Q5F A;  5ECH B;  1QQ2 A;  2C3Q A;  4Q5R A;  3Q18 A;  5IPH A;  2C3T A;  3IAM 2;  3TJJ A;  1W89 A;  2VCT A;  4PQ1 A;  1NSW A;  1JZR A;  1J0F A;  3UEM A;  1ZMA A;  4HS1 A;  4NV2 A;  2IFQ B;  1EOG A;  4FYB A;  2C0D A;  3FY7 A;  3N5O A;  3C73 A;  4HUA A;  3HKR A;  4POB A;  2VCW A;  4DEJ A;  5D73 A;  5HR1 A;  1PD2 1;  2GZY A;  1R7H A;  4MH3 A;  2YV7 A;  5CP1 A;  3WT2 A;  6GSW A;  2H1A A;  5HR3 A;  3TKS C;  4I6X A;  4HJ2 A;  1XOA A;  5ECK B;  3HJP A;  1MDI A;  4LMW A;  1WP0 A;  2CAQ A;  3GL3 A;  2OJL A;  2J23 A;  4I8B A;  4ECB A;  1SL1 B;  1G6W A;  2LST A;  2H6X A;  1K3L A;  4OFT A;  3CYN A;  2J9H A;  3AY8 A;  3UL3 A;  5DQY A;  3FK8 A;  5J9C A;  2LJR A;  3M3M A;  5EY6 A;  1IYI A;  3FW2 A;  6GSY A;  2GGT A;  5KN1 A;  2G2Q A;  1XPV A;  4XS4 B;  1PX6 A;  3HJO A;  2O87 A;  4K6X A;  1MTC A;  2QKE A;  5LNK e;  3IHQ A;  5CNW A;  1T4Y A;  2FWG A;  1QGV A;  1OE7 A;  4ACS A;  4NMU A;  2LQQ A;  3ZL5 A;  3O76 A;  4X43 A;  3KCM A;  3TUE A;  3W6G A;  3GH9 A;  1A24 A;  1BQ7 A;  2H1B A;  4IHU A;  4EXJ A;  1VF1 A;  3GUS A;  1TDI A;  1GSE A;  1GLP A;  1HNC A;  4GF0 A;  4KDY A;  4NHZ A;  3KTL A;  1M9B A;  4PUF C;  5IMA A;  2NPB A;  2RM5 A;  2DML A;  3BCK A;  2H0I A;  3ISO A;  4NHW A;  3HY2 A;  2PU9 C;  4PUR A;  4YQM A;  4F0B A;  1SJI A;  4EDY A;  1O7U A;  2R2J A;  3IPZ A;  5AGY A;  4LL1 B;  3GTU A;  1BX9 A;  3VLN A;  1OC9 A;  3A2X A;  1U88 A;  5CYY A;  1YF1 A;  4Q5Q A;  2X8H A;  3D6I A;  4IBP A;  3HVV A;  5FWG A;  4KDU A;  4MCU A;  3QD9 A;  4F0C A;  3GX8 A;  1M99 A;  4MAB A;  1AIU A;  1U3I A;  2PER A;  2YN1 A;  3FHK A;  1WRY A;  3DYR A;  1GRX A;  4I97 A;  3GFK A;  1QUW A;  4BVX A;  4TKY A;  1X9S B;  1NHO A;  5KN2 A;  3C8E A;  2OAD A;  4KH7 A;  4TW5 A;  4JBB A;  2FA4 A;  2LNT A;  4KND A;  4DSS B;  3IA1 A;  1R26 A;  2ALB A;  3LGC A;  3JCM L;  1TJD A;  3ZML A;  2HXK A;  3K8N A;  5C00 A;  1TRW A;  3J7Y k;  1S3C A;  3P2A A;  1Z9H A;  1T4Z A;  4K0N A;  2DLX A;  2H72 A;  2E0Q A;  4EE0 A;  2B5E A;  1GSF A;  3KZQ A;  1KEB A;  12GS A;  1PKZ A;  1YEP A;  3D4M A;  3KH7 A;  5B6M A;  2AB6 A;  3Q6O A;  1V98 A;  4TOP A;  4MZW A;  5HFK A;  1JZD A;  2I3Y A;  2ON5 A;  1B8X A;  1ZGN A;  2FNO A;  5FT3 A;  3EIN A;  3EMP A;  1O85 A;  5DAK B;  2HSY A;  2XPD A;  4ZL9 A;  4GLT A;  4GWR A;  4MJB A;  3QFB C;  1TRS A;  1THX A;  2H6Z A;  4EO3 A;  4K2D A;  3CRU A;  2R37 A;  2B3S A;  3DIE A;  2B5Y A;  2V1M A;  3F6D A;  4DSQ A;  5HFI A;  1GWC A;  5G5F A;  1PL1 A;  2DJ3 A;  6GSX A;  2GT6 A;  3DKS A;  2GVP A;  2DJ2 A;  2GLR A;  3H93 A;  5D9V A;  4KDX A;  1H4O A;  1TK5 B;  5G30 A;  3E0U A;  1FVJ A;  2FA8 A;  2VLU A;  2FCH A;  5GAP D;  2JAD A;  5AN1 A;  2HSH A;  2K8S A;  3VUR A;  2PPT A;  3KH9 A;  4CDO A;  2VO4 A;  2I81 A;  2VM2 A;  4V1A g;  1E6B A;  1BED A;  3MDK A;  4MH2 A;  3O3T A;  2HI7 A;  4P3Y B;  1JHB A;  3GHA A;  3KM6 A;  1FW1 A;  4OFN A;  5ECS A;  5EL8 A;  1SU9 A;  1K0N A;  1DE2 A;  4ZB9 A;  4G10 A;  1M9A A;  2JAC A;  3M9K A;  5IMD A;  1J9B A;  5F06 A;  5GAN D;  1F6M C;  3TJK A;  1T7P B;  3SWL A;  2K9F A;  1X5E A;  7GSS A;  5DCH A;  2H6Y A;  2YAN A;  1FOV A;  4KE3 A;  1TOF A;  4K0G A;  3DVX A;  3Q19 A;  5G31 A;  1SL0 B;  4RI7 A;  3KP9 A;  4O5R A;  2CA8 A;  2I9H A;  1EEM A;  4LA1 A;  3TRP A;  2JZT A;  2OKA A;  3MSZ A;  4ZXG A;  4RI6 A;  1SK0 A;  2L5O A;  4G2E A;  4BL7 A;  1YKA A;  4WF4 A;  3I69 A;  1XVW A;  1KBN A;  2KOK A;  3TRX A;  3HCZ A;  1B9Y C;  4WEY A;  3G7Y A;  2C0G A;  18GS A;  3A3T A;  19GS A;  4XS6 A;  1ZOF A;  2GQL A;  3EUR A;  1URM A;  1LU4 A;  2XC2 A;  1M2B A;  2KLX A;  4IQ1 A;  5D8I A;  2PVQ A;  2YCD A;  2XPE A;  3TDG A;  1G6Y A;  4EVM A;  2LTK A;  4ZBB A;  3TB2 A;  5JCU A;  2L6C A;  1W4V A;  3GTU B;  1FAA A;  4D73 A;  3DXB A;  1OC9 B;  2YJH A;  3UJ1 A;  4IVF A;  1XWC A;  1R5A A;  2IMI A;  3A2V A;  3BJ5 A;  4XHM A;  3S9F A;  1MD4 A;  2CAI A;  3C71 A;  3L0H A;  1F3A A;  1SD9 A;  3GSS A;  5CRH A;  3GA4 A;  4XTS A;  3ZMK A;  4ZL8 A;  1HNB A;  2F51 A;  3EE2 A;  3EU3 A;  1DBY A;  4OFM A;  1ZL9 A;  3GKX A;  5E4W A;  1U6T A;  2VD1 A;  1K3Y A;  5H5R A;  1EOH A;  4OO5 A;  3KXO A;  1PKW A;  2WJU A;  1TW9 A;  3GKK A;  3DD3 A;  2VL3 A;  4MPG A;  4BVY A;  1PMT A;  2H30 A;  5C04 A;  2EIR A;  2FGX A;  4FO5 A;  3EWL A;  4KW6 A;  4F03 A;  4CW9 A;  2FWH A;  5G1L A;  4X1U A;  1NW2 A;  1JFU A;  4HU9 A;  3QAV A;  2GTU A;  2HFD A;  5D96 A;  3VFI A;  5AIX A;  4PNF A;  1U3A A;  4GSN A;  3FR9 A;  2FD3 A;  5D9T A;  5J4U A;  5CRE A;  1B4P A;  4L0U A;  3ME7 A;  2E2M A;  3UOM A;  3DEX A;  1DE1 A;  3J7Y b;  5JWR B;  2H19 A;  4ILF A;  1A8L A;  4PXO A;  3TRQ A;  1JLV A;  2LEG A;  3VWW A;  1ML6 A;  3H79 A;  2E7P A;  1FO5 A;  5G5E A;  1SYX A;  4HJM A;  4EUY A;  4QL9 A;  1GSU A;  5A4W A;  4PQH A;  2I1U A;  1BJX A;  5CRW A;  2V2G A;  4TXV A;  4ZL7 A;  1YY7 A;  1XW9 A;  4KB3 A;  2X8G A;  4N0V A;  2OBK A;  4IQA A;  4KUN A;  1FHE A;  4OCF A;  5ELG A;  5A4U A;  3QOU A;  1V57 A;  5AIV A;  4NAX A;  4PNG A;  2KUC A;  2LKU A;  9GSS A;  1K0A A;  1RK4 A;  4MZB A;  2GT5 A;  3CXG A;  3FZ9 A;  4V2L A;  4KX4 A;  1N2A A;  3VPT A;  1OVN A;  2GZP A;  2YOI A;  2V6K A;  3KD0 A;  2G0F A;  4N30 A;  4XRA A;  5JCW A;  5CO3 A;  4WBJ A;  2HZE A;  2VL2 A;  1O8X A;  2CX4 A;  3D21 A;  1Z6M A;  2DC5 A;  4L0W A;  4MZC A;  2B6M A;  4HQZ A;  2C4J A;  3L9U A;  2YZH A;  4OD7 A;  4MF6 A;  1QMV A;  3LXT A;  4KSO A;  5KN0 A;  4G19 A;  4PX1 A;  4F9Z A;  2YJ7 A;  3QR6 A;  4YQU A;  1GNW A;  1GSQ A;  2C1Y A;  2VCV A;  5IOW A;  4ZBD A;  1F3B A;  5F07 A;  6GSV A;  4BWQ A;  3F8U A;  1YZX A;  5B8B A;  2YV9 A;  4HZ4 A;  3QMX A;  5B6N A;  5HR2 A;  4KA0 A;  4MF5 A;  3EYT A;  3GH6 A;  1GNE A;  1USB A;  3IBH A;  2AYT A;  3F3R A;  4WBR D;  4EDZ A;  4KGI A;  1YF0 A;  2PVO C;  5INY A;  4J57 E;  1ZCP A;  1TRU A;  5J5N A;  3IDV A;  2BMX A;  4NPB A;  5ECL B;  1RW1 A;  6GSS A;  3IK7 A;  1PRX A;  1TU8 A;  3U5R E;  1DSB A;  2WCI A;  4OMV A;  1VRS D;  3DGQ A;  4HI7 A;  1YQ1 A;  4GSS A;  2JZR A;  6GSU A;  2X99 A;  1YEX A;  4XRD A;  3OR5 A;  2HNL A;  2ZNM A;  2AV4 A;  3P90 A;  1BG5 A;  4JE1 A;  4WR4 A;  2GQM A;  1M2A A;  3IRA A;  2H0G A;  3TKS A;  5GSS A;  4JRR A;  1PL2 A;  1Q98 A;  1TK8 B;  4K7I A;  3KP8 A;  5CRG A;  1EP8 A;  2R3X A;  16GS A;  3A2W A;  2LS5 A;  2LJA A;  5FHI A;  5G1K A;  3KMO A;  5ID2 A;  3WD6 A;  3QFA C;  1ERT A;  5ENU A;  2N5A A;  2VAF A;  1A2L A;  4IN0 A;  2CQ9 A;  2BTO T;  4FYC A;  4PQI A;  5DAL A;  3QAW A;  3IK9 A;  4OO4 A;  2CVB A;  2I4A A;  2HT9 A;  5DDL A;  3GNJ A;  4FH8 A;  2TRX A;  3E3E A;  4JED A;  1M0U A;  4ML1 A;  2RLI A;  4TXO A;  1O8W A;  2WUL A;  4EC0 A;  2H0H A;  2CV4 A;  2DMM A;  3F4R A;  3F4S A;  1FVK A;  3ZVJ D;  4HDE A;  2KP2 A;  1UVZ A;  2VM1 A;  3G7I A;  1M2D A;  5EPF A;  4YH2 A;  4EL1 A;  1Z6N A;  2JL4 A;  3KTB A;  1G7O A;  3DWV A;  5ECQ B;  11GS A;  2YWN A;  4L5O A;  4PUA A;  1KNG A;  2H70 A;  3H1N A;  1JZO A;  3UVH A;  2AJQ B;  5AIS A;  3BCI A;  3SBC A;  1A0F A;  1S3A A;  3TJF A;  1PA3 A;  1XWB A;  1ZZY A;  3NZN A;  4K9Z A;  2DJ0 A;  3ZIV A;  5DCG A;  2M46 A;  3ZYW A;  1AQW A;  2PWJ A;  1AAZ A;  5ABR A;  4K7O A;  1H75 A;  5J3R A;  1TU7 A;  1T1V A;  1GTU A;  1EGR A;  3RDW A;  3HXS A;  1QK8 A;  4GRF A;  2NBS A;  2FY6 A;  5IO0 A;  5ELA A;  1EV4 A;  2KP1 A;  1JLW A;  2YWI A;  4TRX A;  2GZZ A;  4MJA A;  3LXZ A;  1GP1 A;  2MZC A;  1GUL A;  2WB9 A;  4EKZ A;  3QAG A;  3M9J A;  1N8J A;  4MMM A;  2E2G A;  2C0E A;  4DVC A;  2EC4 A;  2MMZ A;  4WR5 A;  2C3N A;  3L4N A;  2EIO A;  2O89 A;  3H4K A;  3I6A A;  5IO2 A;  4CHS A;  2HRF A;  2HZE B;  1Q4J A;  2IFQ A;  5GST A;  1XWG A;  4TR3 A;  2JZS A;  4IW9 A;  4K1F A;  4MF7 A;  5KN3 A;  1B4Q A;  3H8Q A;  3CTF A;  2DSA A;  1AUC A;  2N5F A;  4MDC A;  2L59 A;  1XW6 A;  3FYG A;  2YWO A;  2LUS A;  1THO A;  2O8V B;  2MMO A;  4F82 A;  3HZ4 A;  1IYH A;  2P31 A;  1GTI A;  4EF0 A;  1PSQ A;  2RUE A;  1FB0 A;  2IN3 A;  2L57 A;  2R6K A;  5IMC A;  5L71 A;  2CX3 A;  2JU5 A;  3E9J B;  2IPA A;  3R2Q A;  5H5S A;  1K0M A;  2CZ3 A;  1TI3 A;  1DUG A;  17GS A;  5D93 A;  1QFN A;  2YZU A;  1WPI A;  3F3Q A;  1ACV A;  1VF2 A;  3KIJ A;  1SYR A;  1G0T A;  3PGT A;  1SEN A;  3MWH A;  1E2Y A;  2H75 A;  3TOT A;  2DBC A;  1GSS A;  3ZIJ A;  3KEB A;  2VCX A;  3RHB A;  2C8U A;  4AF2 A;  2F8A A;  3TKQ A;  3VWV A;  5IQY A;  2LNS A;  1XVQ A;  2H1D A;  2K6V A;  2OE0 A;  2P5Q A;  2X8C A;  3LWA A;  1VF3 A;  4MJE A;  2PBJ A;  2KHP A;  1SKS B;  1B9X C;  2GSS A;  1A23 A;  2GDR A;  3ED3 A;  4V2M A;  5KEJ A;  1XOB A;  4F2I A;  4AJ8 A;  3RPP A;  2VD0 A;  5E59 A;  4XCS A;  2HRN A;  3I9V 2;  3TKP A;  5ID2 B;  2VL9 A;  2V41 A;  2NDO A;  4MLY A;  3GX0 A;  1V40 A;  4GQF A;  5DAL B;  2H73 A;  1XBS A;  1XFL A;  3C7M A;  1I5G A;  3WGD A;  3VI5 A;  1Y25 A;  3ZTL A;  4HU7 A;  4Q5N A;  3APQ A;  1K0C A;  4E8E A;  3FEU A;  4IEL A;  3W8S A;  2M72 A;  3TCO A;  4TXO B;  2WS2 A;  3HA9 A;  1X5C A;  4K8M A;  3IC4 A;  5IOX A;  2ES7 A;  3M8N A;  5DJL A;  1ERV A;  2B7K A;  3G7J A;  1MEK A;  1MDK A;  1QXH A;  1XIY A;  5F05 A;  2FHE A;  1O73 A;  2B1K A;  1T3B A;  2IL3 A;  4QQ7 A;  3TJG A;  2HE3 A;  3GKM A;  4WF5 A;  3IR4 A;  3QDN A;  1MDJ A;  1NHY A;  3U6V A;  1HNA A;  1OKD A;  4AJ7 A;  2FLS A;  2VLT A;  3UAR A;  2PN8 A;  3CTG A;  3RHC A;  3GN3 A;  4BWS A;  3RPN A;  3N9J A;  3APO A;  4KAE A;  2L4C A;  1PN9 A;  3CRT A;  1SJZ A;  3TKS E;  1GTB A;  2QGV A;  4DSS A;  2GQK A;  3KJY A;  2H66 A;  5F8B A;  3QCP A;  3RAZ A;  3BOA A;  1SL2 B;  4WKW A;  3ZFL A;  3LSZ A;  4Z7X A;  5COH A;  4ISD A;  3L9S A;  3F9U A;  2PGT A;  1K0D A;  2TRC P;  5D9X A;  1SD8 A;  3D0Z A;  2LQO A;  1SKR B;  1GLQ A;  4OWY A;  1AQV A;  1CQG A;  1WWJ A;  3EC3 A;  3GMF A;  5HR0 A;  3ZRE A;  3ERG A;  4TR1 A;  2AUV A;  4HQS A;  2FUG 2;  5EVO A;  3D22 A;  2F8F A;  4DSR A;  3IAS 2;  1NM3 A;  2L5L A;  2VCQ A;  2V32 A;  4ECI A;  3ZIT A;  5DQS A;  5DAK A;  1A2J A;  1GTA A;  2OE3 A;  2P0G A;  2FWF A;  4GCI A;  2L4Q A;  1F9M A;  2NTO A;  4RQX A;  4OCE A;  2MBS A;  3ERF A;  3F4T A;  4GST A;  2WFC A;  2TIR A;  4ZIJ A;  2VOC A;  3HYP A;  1SJ6 A;  4ECC A;  1AW9 A;  1V2A A;  1Z5Y E;  4V2N A;  4YQV A;  2IME A;  3EVI A;  5ECN B;  2OAC A;  4LL4 B;  1AQX A;  4ML6 A;  3CBU A;  4V1A p;  5JCG A;  3ME8 A;  1B48 A;  1BYE A;  5A4V A;  1A0R P;  2YP6 A;  4IJI A;  5IMZ A;  3GUR A;  1XXU A;  2LRN A;  3GYK A;  1XCC A;  3CSJ A;  3LOR A;  2VUP A;  1LBK A;  3DVW A;  4JZQ A;  4TN8 A;  3VI7 A;  10GS A;  3V1W A;  1OC3 A;  2PUK C;  4FIW A;  3BBY A;  3US3 A;  4LLR A;  2LV3 A;  1S3D A;  2IMK A;  3MAK A;  4IJ3 A;  4N11 A;  2WZ9 A;  3GKN A;  1R4W A;  5IMF A;  1FB6 A;  1EGO A;  1I9D A;  2LJK A;  1ERW A;  4JU5 A;  2WRT A;  3C1S A;  1ZYE A;  1UC7 A;  5DJM A;  4RUV A;  4YAV A;  4BPY A;  3IV4 A;  4PGT A;  3IE3 A;  1X9M B;  3LYP A;  4L5L A;  3EMX A;  1YDK A;  2RM6 A;  1BAY A;  3CMI A;  3HHV A;  3VK9 A;  2ZCT A;  22GS A;  4D73 B;  2N5B A;  2K8V A;  5IIZ A;  1GUH A;  1YKC A;  3UBK A;  5JWO B;  5G2Z A;  2A2R A;  1A8Y A;  1F37 A;  1GUK A;  3LEF A;  1V58 A;  2IMD A;  3APS A;  4NXI A;  2H74 A;  4TVE A;  1XWK A;  2R4V A;  1G7E A;  1JZW A;  1EP7 A;  5DBQ A;  5A5K A;  1PGT A;  4N10 A;  1HQO A;  3FKF A;  4ZBA A;  4G9H A;  5D9W A;  1OE8 A;  1J08 A;  2O85 A;  4IS0 A;  1Z7R A;  2HYX A;  2WDU A;  4I2T A;  4XIH A;  1XZO A;  3ZVJ A;  4LMV A;  4ECJ A;  3DML A;  4MK3 A;  2R5G A;  2H1G A;  4X0X A;  2MMN A;  3WGX A;  1LJR A;  1O81 A;  5J41 A;  3MNG A;  1K0O A;  1X5D A;  3UMA A;  3GIX A;  5IM9 A;  2BJX A;  1ILO A;  1ON4 A;  4IGJ A;  1K3O A;  3HVX A;  2PMT A;  2C0F A;  4JR6 A;  4E8H A;  2YWM A;  3UVT A;  2QSI A;  2D2Z A;  2XBQ A;  2IJY A;  2H01 A;  3D5J A;  4I2U A;  5GZZ B;  2F9S A;  3FRC A;  2LRC A;  4HOJ A;  4TR4 A;  1YJ6 A;  2P5R A;  4GTU A;  3LJR A;  3GRX A;  5H5Q A;  2CZ2 A;  4O7H A;  1ST9 A;  1AXD A;  3A5W A;  3UIW A;  2MMA A;  1T00 A;  5ECR B;  1WJK A;  2MYG A;  3M0F A;  5ECO B;  1XWA A;  4ZB8 A;  3PH9 A;  3IXR A;  4O32 A;  3VWU A;  4TR1 B;  4NV5 A;  4I5Q A;  1Z7P A;  5B8A A;  1PX7 A;  2RII A;  3O6T A;  3FZ4 A;  1A2M A;  3P7X A;  2C80 A;  1TTZ A;  5IPG A;  4MPF A;  5JWQ B;  2B5X A;  3KGK A;  2HLS A;  3Q74 A;  2DJ1 A;  3TKR A;  1F2E A;  1CQH A;  1OYJ A;  3TOU A;  1C72 A;  4FYU A;  1EWX A;  3LG6 A;  3UBL A;  4L8E A;  2XHF A;  4KSM A;  2OBI A;  2H76 A;  2FWE A;  1OKT A;  4H86 A;  3F63 A;  2A2S A;  4ID0 A;  3HVS A;  4N0Z A;  1ABA A;  3GL5 A;  4JR4 A;  2REM A;  1WIK A;  1HD2 A;  2X64 A;  3VWX A;  2DIY A;  1EEJ A;  4POL A;  3DRN A;  1Y6E A;  2HZF A;  2H71 A;  3HJM A;  3CSI A;  2M80 A;  2VCZ A;  1HYU A;  2OA7 A;  4BA7 A;  2EIQ A;  1T8E B;  13GS A;  2MBT A;  2AAW A;  2JSZ A;  1GH2 A;  3FZA A;  2VLV A;  1GSD A;  8GSS A;  20GS A;  3G9B A;  3VPQ A;  1OC8 A;  3PIN A;  4GXZ A;  2DIZ A;  4K7N A;  4O92 A;  3LYK A;  2A4V A;  3P8W A;  2CVK A;  1VGL A;  1R5P A;  5F0G A;  3FR3 A;  4WXT A;  3GST A;  4XS1 A;  1X0R A;  3HDC A;  3RBT A;  2RUF A;  2IIY A;  1TRV A;  1SK2 A;  4KCA A;  1SK1 A;  2F3M A;  3WGE A;  1FG4 A;  4XS4 A;  3F6F A;  5ECI B;  6GST A;  2B7J A;  1EZK A;  2O7K A;  1RQM A;  3ERW A;  4ULX A;  1O6J A;  1WMJ A;  4KCE A;  3F0I A;  5ECP B;  4ZIL A;  2H8L A;  3QPM A;  1WE0 A;  2B1L A;  5DVB A;  1K0B A;  5B7C A;  3WYW A;  1TKD B;  5HQP A;  3HZ8 A;  2ON7 A;  1EV9 A;  2GSQ A;  3C1R A;  4QL7 A;  4POM A;  1SKW B;  4AGS A;  3GV1 A;  1U87 A;  2DJK A;  2JSY A;  2Z9S A;  3NOF A;  4J2F A;  1TXX A;  1MD3 A;  3L9V A;  1TI1 A;  4MJC A;  2GST A;  3ZLP A;  3LQ7 A;  5LD0 A;  2L6D A;  3NIV A;  2GS3 A;  1ERU A;  3ZZX A;  2QC7 A;  4HZ2 A;  2CT6 A;  4HEA 2;  3ZRD A;  2NVL A;  3TJB A;  1WOU A;  2GSR A;  1TP9 A;  1UN2 A;  3IOS A;  3WT1 A;  4MP4 A;  2YNX A;  4ZB6 A;  2AHE A;  3KMN A;  1AC1 A;  1GUM A;  4WET A;  4AJ6 A;  1KTE A;  1XW5 A;  1V9W A;  2WGR A;  1GL8 A;  3EU4 A;  2V6O A;  1ZYQ B;  3HD5 A;  4RQR A;  3TGZ A;  3UAP A;  1M7T A;  2XBI A;  1Z3E A;  3ZFB A;  5CRD A;  2VL2 C;  3LFL A;  3PR8 A;  4IKH A;  1PQN A;  5LCZ A;  3D4T A;  3FZ5 A;  3BD2 A;  1VF4 A;  2ZUP A;  14GS A;  1GSY A;  4J56 E;  3CSH A;  4YAP A;  1UA5 A;  1OAZ A;  5J9B A;  2OE1 A;  2IWT A;  4IP6 A;  2LRT A;  2CVD A;  3M1G A;  3L78 A;  3W8J A;  5CAX A;  2K18 A;  3FR6 A;  5HFG A;  4POK A;  4NWY A;  4TR0 A;  2IMF A;  2VIM A;  1TK0 B;  4GQC A; 
#chains in the Genus database with same CATH topology
 4IP1 A;  2DJJ A;  2YPM A;  4MA9 A;  5ECM B;  5IMV A;  1X9W B;  3I43 A;  4Q5F A;  5ECH B;  1QQ2 A;  2C3Q A;  4Q5R A;  3Q18 A;  2A2P A;  5IPH A;  2C3T A;  3IAM 2;  1S3R A;  3TJJ A;  1W89 A;  2VCT A;  4PQ1 A;  1NSW A;  1JZR A;  1J0F A;  3UEM A;  1ZMA A;  4HS1 A;  4NV2 A;  2IFQ B;  1EOG A;  4FYB A;  2C0D A;  3FY7 A;  3N5O A;  3C73 A;  4HUA A;  3HKR A;  4POB A;  2VCW A;  1XG8 A;  4DEJ A;  5D73 A;  5HR1 A;  1PD2 1;  2GZY A;  1R7H A;  4MH3 A;  2YV7 A;  5CP1 A;  3WT2 A;  3EPT A;  2H1A A;  6GSW A;  5HR3 A;  3TKS C;  4I6X A;  4HJ2 A;  1XOA A;  5ECK B;  3HJP A;  1MDI A;  4LMW A;  1WP0 A;  2CAQ A;  3GL3 A;  2OJL A;  2J23 A;  4I8B A;  4ECB A;  1SL1 B;  1G6W A;  2LST A;  2H6X A;  1K3L A;  4OFT A;  4USS A;  3CYN A;  2J9H A;  3AY8 A;  3UL3 A;  5DQY A;  4MNN A;  3FK8 A;  5J9C A;  4YKF A;  2LJR A;  3M3M A;  2QA1 A;  1IYI A;  5EY6 A;  3FW2 A;  6GSY A;  2GGT A;  5KN1 A;  2G2Q A;  1XPV A;  4XS4 B;  1PX6 A;  3HJO A;  2O87 A;  4K6X A;  1MTC A;  2QKE A;  5LNK e;  3IHQ A;  5CNW A;  1T4Y A;  3IHG A;  2FWG A;  1QGV A;  1OE7 A;  4ACS A;  4NMU A;  2LQQ A;  3ZL5 A;  3O76 A;  4X43 A;  3KCM A;  3TUE A;  3W6G A;  3GH9 A;  1A24 A;  1BQ7 A;  2H1B A;  4IHU A;  4EXJ A;  1VF1 A;  3GUS A;  1TDI A;  1GSE A;  1GLP A;  1HNC A;  4GF0 A;  4KDY A;  4NHZ A;  3KTL A;  1M9B A;  4PUF C;  5IMA A;  2NPB A;  2RM5 A;  2DML A;  3BCK A;  2H0I A;  3ISO A;  4NHW A;  3HY2 A;  2PU9 C;  4PUR A;  4YQM A;  2A4H A;  4F0B A;  1SJI A;  4EDY A;  1O7U A;  2R2J A;  3IPZ A;  5AGY A;  4LL1 B;  3GTU A;  1BX9 A;  3VLN A;  1OC9 A;  3A2X A;  1U88 A;  5CYY A;  1YF1 A;  4Q5Q A;  2X8H A;  3D6I A;  4IBP A;  3HVV A;  5FWG A;  4KDU A;  4MCU A;  3QD9 A;  4F0C A;  3GX8 A;  1M99 A;  4MAB A;  1AIU A;  1U3I A;  2PER A;  2YN1 A;  3FHK A;  1WRY A;  3DYR A;  1GRX A;  4I97 A;  3GFK A;  1QUW A;  4BVX A;  4TKY A;  1X9S B;  1NHO A;  5KN2 A;  3C8E A;  2OAD A;  4KH7 A;  4TW5 A;  4JBB A;  2FA4 A;  2LNT A;  4KND A;  4DSS B;  3IA1 A;  1R26 A;  2ALB A;  3LGC A;  3JCM L;  1TJD A;  3ZML A;  2R0G A;  2HXK A;  3K8N A;  5C00 A;  1TRW A;  3J7Y k;  1S3C A;  3P2A A;  1Z9H A;  1T4Z A;  4K0N A;  2DLX A;  2H72 A;  2E0Q A;  4EE0 A;  2B5E A;  1GSF A;  3KZQ A;  1KEB A;  12GS A;  1PKZ A;  1YEP A;  3D4M A;  3KH7 A;  5B6M A;  2AB6 A;  3Q6O A;  1V98 A;  1M3I A;  4O5Q A;  4TOP A;  4MZW A;  5HFK A;  1JZD A;  2I3Y A;  2ON5 A;  1B8X A;  1ZGN A;  2FNO A;  5FT3 A;  3EIN A;  3EMP A;  1O85 A;  5DAK B;  2HSY A;  2XPD A;  4ZL9 A;  4GLT A;  4GWR A;  4ICY A;  4MJB A;  3QFB C;  1TRS A;  1THX A;  2H6Z A;  4EO3 A;  4K2D A;  3CRU A;  2R37 A;  2B3S A;  3DIE A;  2B5Y A;  2V1M A;  3F6D A;  4DSQ A;  5HFI A;  1GWC A;  5G5F A;  1PL1 A;  2DJ3 A;  6GSX A;  2GT6 A;  3DKS A;  2GVP A;  2DJ2 A;  2GLR A;  3H93 A;  5D9V A;  4KDX A;  1H4O A;  1TK5 B;  5G30 A;  3E0U A;  1FVJ A;  2FA8 A;  2VLU A;  2FCH A;  5GAP D;  2JAD A;  5AN1 A;  2HSH A;  2K8S A;  3VUR A;  2PPT A;  3KH9 A;  4CDO A;  2VO4 A;  2I81 A;  2VM2 A;  4V1A g;  1E6B A;  1BED A;  3MDK A;  4MH2 A;  3O3T A;  2HI7 A;  4P3Y B;  1JHB A;  3GHA A;  3KM6 A;  1FW1 A;  4OFN A;  5ECS A;  5EL8 A;  4HSC X;  1SU9 A;  1K0N A;  1DE2 A;  4ZB9 A;  4G10 A;  1M9A A;  2JAC A;  3M9K A;  5IMD A;  1J9B A;  5F06 A;  5GAN D;  1F6M C;  3TJK A;  1T7P B;  3SWL A;  2K9F A;  1X5E A;  7GSS A;  5DCH A;  2H6Y A;  2YAN A;  1FOV A;  4KE3 A;  1TOF A;  4K0G A;  3DVX A;  3Q19 A;  5G31 A;  1SL0 B;  4RI7 A;  3KP9 A;  4O5R A;  2CA8 A;  2I9H A;  1EEM A;  4LA1 A;  3TRP A;  2JZT A;  2OKA A;  3MSZ A;  4ZXG A;  4RI6 A;  1SK0 A;  2L5O A;  4G2E A;  4BL7 A;  1YKA A;  4WF4 A;  3I69 A;  1XVW A;  1KBN A;  2KOK A;  3TRX A;  3HCZ A;  1B9Y C;  4WEY A;  3G7Y A;  2C0G A;  18GS A;  3A3T A;  19GS A;  4XS6 A;  1ZOF A;  2GQL A;  3EUR A;  2DKH A;  1URM A;  1LU4 A;  2XC2 A;  1M2B A;  2KLX A;  4IQ1 A;  5D8I A;  2PVQ A;  2YCD A;  2XPE A;  3TDG A;  1G6Y A;  4EVM A;  2LTK A;  2HRK A;  4ZBB A;  3TB2 A;  5JCU A;  2L6C A;  1W4V A;  3GTU B;  1FAA A;  4D73 A;  3DXB A;  1OC9 B;  2YJH A;  3UJ1 A;  4IVF A;  1XWC A;  1R5A A;  2IMI A;  3A2V A;  3BJ5 A;  4XHM A;  3S9F A;  1MD4 A;  2CAI A;  3C71 A;  3L0H A;  1F3A A;  1SD9 A;  3GSS A;  5CRH A;  3GA4 A;  4XTS A;  3ZMK A;  4ZL8 A;  1HNB A;  2F51 A;  3EE2 A;  3EU3 A;  1DBY A;  4OFM A;  1ZL9 A;  3GKX A;  5E4W A;  1U6T A;  2VD1 A;  1K3Y A;  5H5R A;  1EOH A;  4OO5 A;  3KXO A;  2R0P A;  1PKW A;  2WJU A;  1TW9 A;  3GKK A;  3DD3 A;  2VL3 A;  4MPG A;  4BVY A;  1PMT A;  2H30 A;  5C04 A;  2EIR A;  2FGX A;  4FO5 A;  3EWL A;  4KW6 A;  4F03 A;  4CW9 A;  2FWH A;  5G1L A;  4X1U A;  1NW2 A;  1JFU A;  4HU9 A;  3QAV A;  2GTU A;  2HFD A;  5D96 A;  4A5P A;  3VFI A;  5AIX A;  4PNF A;  1U3A A;  4GSN A;  3FR9 A;  2FD3 A;  5D9T A;  5J4U A;  5CRE A;  1B4P A;  4L0U A;  3ME7 A;  2E2M A;  3UOM A;  3DEX A;  4G0L A;  1DE1 A;  3J7Y b;  5JWR B;  2H19 A;  4ILF A;  1A8L A;  4PXO A;  3TRQ A;  1JLV A;  2LEG A;  3VWW A;  1ML6 A;  3H79 A;  2E7P A;  1FO5 A;  5G5E A;  1SYX A;  4HJM A;  4EUY A;  4QL9 A;  1GSU A;  5A4W A;  4PQH A;  2I1U A;  1BJX A;  5CRW A;  2V2G A;  4TXV A;  4ZL7 A;  1YY7 A;  1XW9 A;  4KB3 A;  2X8G A;  4N0V A;  2OBK A;  4IQA A;  4KUN A;  1FHE A;  4OCF A;  5ELG A;  5A4U A;  3QOU A;  1V57 A;  5AIV A;  4NAX A;  4PNG A;  2KUC A;  2LKU A;  9GSS A;  1K0A A;  1RK4 A;  4MZB A;  2GT5 A;  3CXG A;  3FZ9 A;  4V2L A;  4KX4 A;  1N2A A;  3VPT A;  1OVN A;  2GZP A;  2YOI A;  2V6K A;  3KD0 A;  2G0F A;  4N30 A;  4XRA A;  5JCW A;  5CO3 A;  4WBJ A;  2HZE A;  2VL2 A;  1O8X A;  4K2X A;  3MIX A;  2CX4 A;  3D21 A;  1Z6M A;  2DC5 A;  4L0W A;  4MZC A;  2B6M A;  4HQZ A;  2C4J A;  3L9U A;  2YZH A;  4OD7 A;  4MF6 A;  1QMV A;  3LXT A;  4KSO A;  5KN0 A;  4G19 A;  4PX1 A;  4F9Z A;  2YJ7 A;  3QR6 A;  4YQU A;  1GNW A;  1GSQ A;  2C1Y A;  2VCV A;  5IOW A;  5KOX A;  4ZBD A;  1F3B A;  5F07 A;  6GSV A;  4BWQ A;  3F8U A;  1YZX A;  5B8B A;  2YV9 A;  4HZ4 A;  3QMX A;  5B6N A;  3FMW A;  5HR2 A;  4KA0 A;  4MF5 A;  3EYT A;  3GH6 A;  1GNE A;  1USB A;  3IBH A;  2AYT A;  3F3R A;  4WBR D;  4EDZ A;  4KGI A;  1YF0 A;  2PVO C;  5INY A;  4J57 E;  1ZCP A;  1TRU A;  5J5N A;  3IDV A;  2BMX A;  4BL7 B;  4NPB A;  5ECL B;  1RW1 A;  6GSS A;  3IK7 A;  1PRX A;  1TU8 A;  3U5R E;  1DSB A;  2WCI A;  4OMV A;  1VRS D;  3DGQ A;  4HI7 A;  1YQ1 A;  4GSS A;  2JZR A;  6GSU A;  2X99 A;  1YEX A;  4XRD A;  3OR5 A;  2HNL A;  2ZNM A;  2AV4 A;  3P90 A;  1BG5 A;  4JE1 A;  4WR4 A;  2GQM A;  1M2A A;  3IRA A;  2H0G A;  3TKS A;  5GSS A;  4JRR A;  1PL2 A;  1Q98 A;  1TK8 B;  4K7I A;  3KP8 A;  5CRG A;  1EP8 A;  2R3X A;  16GS A;  3A2W A;  2LS5 A;  2LJA A;  5FHI A;  5G1K A;  3KMO A;  5ID2 A;  3WD6 A;  3QFA C;  1ERT A;  4Z2R A;  5ENU A;  2N5A A;  2VAF A;  1A2L A;  4IN0 A;  2CQ9 A;  2BTO T;  4FYC A;  4PQI A;  5DAL A;  3QAW A;  3IK9 A;  4OO4 A;  2CVB A;  2I4A A;  2HT9 A;  5DDL A;  3GNJ A;  4FH8 A;  2TRX A;  3E3E A;  4JED A;  1M0U A;  5BRT A;  4ML1 A;  2RLI A;  4TXO A;  1O8W A;  4BVY B;  2WUL A;  4EC0 A;  2H0H A;  2CV4 A;  2DMM A;  3F4R A;  3F4S A;  1FVK A;  3ZVJ D;  4HDE A;  2KP2 A;  1UVZ A;  4K5R A;  2VM1 A;  3G7I A;  1M2D A;  5EPF A;  4YH2 A;  4EL1 A;  1Z6N A;  2JL4 A;  3KTB A;  1G7O A;  3DWV A;  5ECQ B;  11GS A;  2YWN A;  4L5O A;  4PUA A;  1KNG A;  2H70 A;  3H1N A;  1JZO A;  3UVH A;  2AJQ B;  5AIS A;  3BCI A;  3SBC A;  1A0F A;  1S3A A;  3TJF A;  1PA3 A;  3MYD A;  1XWB A;  1ZZY A;  3NZN A;  4K9Z A;  2DJ0 A;  3ZIV A;  5DCG A;  2M46 A;  3ZYW A;  1AQW A;  2PWJ A;  1AAZ A;  5ABR A;  4K7O A;  1H75 A;  5J3R A;  1TU7 A;  1T1V A;  1GTU A;  1EGR A;  3RDW A;  1M3J A;  3HXS A;  1PFO A;  1QK8 A;  4GRF A;  2NBS A;  2FY6 A;  5IO0 A;  5ELA A;  1EV4 A;  2KP1 A;  1JLW A;  2YWI A;  4TRX A;  2GZZ A;  4MJA A;  3LXZ A;  1GP1 A;  2MZC A;  1GUL A;  2WB9 A;  4Z2U A;  4EKZ A;  3QAG A;  3M9J A;  1N8J A;  4MMM A;  2E2G A;  4G0I A;  2C0E A;  4DVC A;  3PPU A;  2EC4 A;  4PTS A;  2MMZ A;  4WR5 A;  2C3N A;  3L4N A;  2EIO A;  2O89 A;  3H4K A;  3I6A A;  5IO2 A;  4CHS A;  2HRF A;  2HZE B;  1Q4J A;  2IFQ A;  5GST A;  1XWG A;  4TR3 A;  2JZS A;  4IW9 A;  4K1F A;  4MF7 A;  5KN3 A;  1B4Q A;  3H8Q A;  3CTF A;  2DSA A;  1AUC A;  2N5F A;  4MDC A;  2L59 A;  1XW6 A;  3FYG A;  2YWO A;  2LUS A;  1THO A;  2O8V B;  2MMO A;  4F82 A;  3HZ4 A;  1IYH A;  2P31 A;  1GTI A;  4EF0 A;  1PSQ A;  2RUE A;  1FB0 A;  5BMU A;  2IN3 A;  2L57 A;  2R6K A;  5IMC A;  5L71 A;  2CX3 A;  2JU5 A;  3E9J B;  2IPA A;  3R2Q A;  5H5S A;  1K0M A;  2CZ3 A;  1TI3 A;  1DUG A;  17GS A;  5D93 A;  1QFN A;  2YZU A;  1WPI A;  3F3Q A;  1ACV A;  1VF2 A;  3KIJ A;  4K5S A;  1SYR A;  1G0T A;  3PGT A;  2DKI A;  1SEN A;  3MWH A;  1E2Y A;  2H75 A;  3TOT A;  2DBC A;  1GSS A;  3ZIJ A;  3KEB A;  2VCX A;  3RHB A;  2C8U A;  4AF2 A;  2F8A A;  3TKQ A;  3VWV A;  5IQY A;  2LNS A;  1XVQ A;  2H1D A;  2K6V A;  2OE0 A;  2P5Q A;  2X8C A;  3LWA A;  1VF3 A;  4MJE A;  2PBJ A;  2KHP A;  1SKS B;  1B9X C;  2GSS A;  1A23 A;  2QA2 A;  2GDR A;  3ED3 A;  4V2M A;  4EIP A;  5KEJ A;  1XOB A;  4F2I A;  4AJ8 A;  3RPP A;  2VD0 A;  5E59 A;  4XCS A;  2HRN A;  3I9V 2;  3TKP A;  5ID2 B;  2VL9 A;  2V41 A;  2NDO A;  3HVN A;  4MLY A;  3GX0 A;  1V40 A;  4GQF A;  5DAL B;  2H73 A;  1XBS A;  1XFL A;  3C7M A;  1I5G A;  3WGD A;  3VI5 A;  1Y25 A;  3ZTL A;  4HU7 A;  4Q5N A;  3APQ A;  1K0C A;  4E8E A;  3FEU A;  4IEL A;  3W8S A;  2M72 A;  3TCO A;  4TXO B;  2WS2 A;  3HA9 A;  1X5C A;  4K8M A;  3IC4 A;  5IOX A;  4BVX B;  2ES7 A;  3M8N A;  5DJL A;  1ERV A;  4YKG A;  2B7K A;  3G7J A;  1MEK A;  1MDK A;  1QXH A;  1XIY A;  2X4A A;  5F05 A;  2FHE A;  1O73 A;  2B1K A;  1T3B A;  2IL3 A;  4QQ7 A;  3TJG A;  2HE3 A;  3GKM A;  4WF5 A;  3IR4 A;  3QDN A;  1MDJ A;  1NHY A;  3U6V A;  1HNA A;  1OKD A;  4AJ7 A;  2FLS A;  2VLT A;  3UAR A;  2PN8 A;  3CTG A;  3RHC A;  3GN3 A;  4BWS A;  3IC8 A;  3RPN A;  3N9J A;  3APO A;  4KAE A;  2L4C A;  1PN9 A;  3CRT A;  1SJZ A;  3TKS E;  1GTB A;  2QGV A;  3LW9 A;  4DSS A;  2GQK A;  3KJY A;  2H66 A;  5F8B A;  3QCP A;  3RAZ A;  3BOA A;  1SL2 B;  4WKW A;  3ZFL A;  3LSZ A;  4Z7X A;  5COH A;  4ISD A;  3L9S A;  3F9U A;  2PGT A;  1K0D A;  2TRC P;  5D9X A;  1SD8 A;  3D0Z A;  2LQO A;  1SKR B;  1GLQ A;  4OWY A;  1AQV A;  1CQG A;  1WWJ A;  3EC3 A;  3GMF A;  5HR0 A;  3ZRE A;  3ERG A;  4KF9 A;  4TR1 A;  2AUV A;  4HQS A;  2FUG 2;  5EVO A;  3D22 A;  2F8F A;  4DSR A;  3IAS 2;  1NM3 A;  2L5L A;  2VCQ A;  2V32 A;  4ECI A;  3ZIT A;  5DQS A;  5DAK A;  1A2J A;  1GTA A;  2OE3 A;  2P0G A;  2FWF A;  4GCI A;  2L4Q A;  1F9M A;  2NTO A;  4RQX A;  4OCE A;  2MBS A;  3ERF A;  3F4T A;  4GST A;  2WFC A;  2TIR A;  4ZIJ A;  2VOC A;  3HYP A;  1SJ6 A;  4ECC A;  1AW9 A;  1V2A A;  1Z5Y E;  4V2N A;  4YQV A;  2IME A;  3EVI A;  5ECN B;  2OAC A;  4LL4 B;  4X4J A;  1AQX A;  4ML6 A;  3CBU A;  4V1A p;  5JCG A;  3ME8 A;  1B48 A;  1BYE A;  5A4V A;  1A0R P;  2YP6 A;  4IJI A;  5IMZ A;  3GUR A;  1XXU A;  2LRN A;  3GYK A;  1XCC A;  3CSJ A;  3LOR A;  2VUP A;  1LBK A;  3DVW A;  4JZQ A;  4TN8 A;  3VI7 A;  10GS A;  3V1W A;  1OC3 A;  2PUK C;  4FIW A;  3BBY A;  3US3 A;  4LLR A;  2LV3 A;  1S3D A;  2IMK A;  3MAK A;  4IJ3 A;  4N11 A;  2WZ9 A;  3GKN A;  1R4W A;  5IMF A;  1FB6 A;  1EGO A;  1I9D A;  2LJK A;  1ERW A;  4JU5 A;  2WRT A;  3C1S A;  1ZYE A;  1UC7 A;  5DJM A;  4RUV A;  4YAV A;  4BPY A;  3IV4 A;  4PGT A;  3IE3 A;  1X9M B;  3LYP A;  4L5L A;  3EMX A;  1YDK A;  3A5I A;  2RM6 A;  1BAY A;  3CMI A;  3HHV A;  3VK9 A;  2ZCT A;  22GS A;  4D73 B;  2N5B A;  2K8V A;  5IIZ A;  1GUH A;  1YKC A;  3UBK A;  5JWO B;  5G2Z A;  2A2R A;  1A8Y A;  1F37 A;  1GUK A;  3LEF A;  2HRA A;  2HSM A;  1V58 A;  2IMD A;  3APS A;  4NXI A;  2H74 A;  4TVE A;  1XWK A;  2R4V A;  1G7E A;  1JZW A;  1EP7 A;  5DBQ A;  5A5K A;  1PGT A;  4N10 A;  1HQO A;  3FKF A;  4ZBA A;  4G9H A;  1PN0 A;  5D9W A;  1OE8 A;  1J08 A;  2O85 A;  4IS0 A;  1Z7R A;  2HYX A;  2WDU A;  4I2T A;  4XIH A;  1XZO A;  3ZVJ A;  4LMV A;  4ECJ A;  3DML A;  4MK3 A;  2R5G A;  2H1G A;  4X0X A;  2MMN A;  3WGX A;  4BIK A;  3R3E A;  1LJR A;  1O81 A;  5J41 A;  3MNG A;  1K0O A;  1X5D A;  2R0C A;  3UMA A;  3GIX A;  5IM9 A;  2BJX A;  1ILO A;  1ON4 A;  4IGJ A;  1K3O A;  3HVX A;  2PMT A;  2C0F A;  4JR6 A;  4E8H A;  2YWM A;  3UVT A;  2QSI A;  2D2Z A;  2XBQ A;  2IJY A;  2H01 A;  3D5J A;  4I2U A;  5GZZ B;  2F9S A;  3FRC A;  2LRC A;  4HOJ A;  4TR4 A;  1YJ6 A;  2P5R A;  4GTU A;  3LJR A;  3GRX A;  5H5Q A;  1ZYN A;  2CZ2 A;  4O7H A;  1ST9 A;  1AXD A;  3A5W A;  3UIW A;  4CY6 A;  2MMA A;  1T00 A;  5ECR B;  1WJK A;  2MYG A;  3M0F A;  5ECO B;  1XWA A;  4ZB8 A;  3PH9 A;  3IXR A;  4O32 A;  3VWU A;  4TR1 B;  4NV5 A;  4I5Q A;  1Z7P A;  5B8A A;  1PX7 A;  2RII A;  3O6T A;  3FZ4 A;  1A2M A;  2UZ8 A;  3P7X A;  2C80 A;  1TTZ A;  5IPG A;  4MPF A;  5JWQ B;  2B5X A;  1ZYP A;  2HLS A;  3KGK A;  3Q74 A;  2DJ1 A;  3TKR A;  1F2E A;  1CQH A;  1OYJ A;  3TOU A;  1C72 A;  4FYU A;  1EWX A;  4EIQ A;  3LG6 A;  3UBL A;  4L8E A;  2XHF A;  4KSM A;  2OBI A;  2H76 A;  2FWE A;  1OKT A;  4H86 A;  3F63 A;  2A2S A;  4ID0 A;  3HVS A;  4N0Z A;  1ABA A;  3GL5 A;  4JR4 A;  2REM A;  1WIK A;  1HD2 A;  2X64 A;  3VWX A;  2DIY A;  1EEJ A;  4POL A;  3DRN A;  4O5U A;  1Y6E A;  2HZF A;  2H71 A;  3HJM A;  3CSI A;  2M80 A;  2VCZ A;  1HYU A;  2OA7 A;  4BA7 A;  2EIQ A;  1T8E B;  13GS A;  2MBT A;  2AAW A;  2JSZ A;  1GH2 A;  3FZA A;  2VLV A;  1GSD A;  1FOH A;  8GSS A;  20GS A;  3G9B A;  3VPQ A;  1OC8 A;  3PIN A;  4GXZ A;  2DIZ A;  4K7N A;  4O92 A;  3LYK A;  2A4V A;  3P8W A;  2CVK A;  1VGL A;  1R5P A;  5F0G A;  3FR3 A;  4WXT A;  3GST A;  4XS1 A;  1X0R A;  3HDC A;  3RBT A;  2RUF A;  2IIY A;  1TRV A;  1SK2 A;  4KCA A;  1SK1 A;  2F3M A;  3WGE A;  1FG4 A;  4XS4 A;  3F6F A;  5ECI B;  6GST A;  2B7J A;  1EZK A;  2O7K A;  1RQM A;  3ERW A;  4ULX A;  1O6J A;  1WMJ A;  4KCE A;  3F0I A;  5ECP B;  4ZIL A;  2H8L A;  3QPM A;  1WE0 A;  4G0K A;  2B1L A;  5DVB A;  1K0B A;  5B7C A;  3WYW A;  1TKD B;  5HQP A;  3HZ8 A;  2ON7 A;  1EV9 A;  2GSQ A;  3C1R A;  4QL7 A;  4POM A;  1SKW B;  4AGS A;  3GV1 A;  1U87 A;  2DJK A;  2JSY A;  2Z9S A;  3NOF A;  4J2F A;  1TXX A;  1MD3 A;  3L9V A;  1TI1 A;  4MJC A;  2GST A;  3ZLP A;  3LQ7 A;  5LD0 A;  2L6D A;  3NIV A;  2GS3 A;  1ERU A;  3ZZX A;  2QC7 A;  4HZ2 A;  2CT6 A;  4HEA 2;  3ZRD A;  2NVL A;  3TJB A;  1WOU A;  2GSR A;  1TP9 A;  1UN2 A;  3IOS A;  3WT1 A;  4MP4 A;  2YNX A;  4ZB6 A;  2AHE A;  3KMN A;  1AC1 A;  1GUM A;  4WET A;  4Z2T A;  4AJ6 A;  1KTE A;  1XW5 A;  1V9W A;  2X49 A;  2WGR A;  1GL8 A;  3EU4 A;  2V6O A;  1ZYQ B;  3HD5 A;  4RQR A;  3TGZ A;  3UAP A;  1M7T A;  2XBI A;  1Z3E A;  3ZFB A;  5CRD A;  2VL2 C;  3LFL A;  3PR8 A;  4CY8 A;  4IKH A;  1PQN A;  5LCZ A;  5KOW A;  3D4T A;  3FZ5 A;  3BD2 A;  1VF4 A;  4FQU A;  2ZUP A;  14GS A;  1GSY A;  4J56 E;  3CSH A;  4YAP A;  1UA5 A;  1OAZ A;  5J9B A;  2OE1 A;  2IWT A;  4IP6 A;  2LRT A;  2CVD A;  3M1G A;  3L78 A;  3W8J A;  5CAX A;  2K18 A;  3CQF A;  3FR6 A;  5HFG A;  4POK A;  4NWY A;  4TR0 A;  2IMF A;  2VIM A;  1TK0 B;  4GQC A; 
#chains in the Genus database with same CATH homology
 4IP1 A;  2DJJ A;  2YPM A;  4MA9 A;  5ECM B;  5IMV A;  1X9W B;  3I43 A;  4Q5F A;  5ECH B;  1QQ2 A;  2C3Q A;  4Q5R A;  3Q18 A;  2A2P A;  5IPH A;  2C3T A;  3IAM 2;  3TJJ A;  1W89 A;  2VCT A;  4PQ1 A;  1NSW A;  1JZR A;  1J0F A;  3UEM A;  1ZMA A;  4HS1 A;  4NV2 A;  2IFQ B;  1EOG A;  4FYB A;  2C0D A;  3FY7 A;  3N5O A;  3C73 A;  4HUA A;  3HKR A;  4POB A;  2VCW A;  4DEJ A;  5D73 A;  5HR1 A;  1PD2 1;  2GZY A;  1R7H A;  4MH3 A;  2YV7 A;  5CP1 A;  3WT2 A;  3EPT A;  2H1A A;  6GSW A;  5HR3 A;  3TKS C;  4I6X A;  4HJ2 A;  1XOA A;  5ECK B;  3HJP A;  1MDI A;  4LMW A;  1WP0 A;  2CAQ A;  3GL3 A;  2OJL A;  2J23 A;  4I8B A;  4ECB A;  1SL1 B;  1G6W A;  2LST A;  2H6X A;  1K3L A;  4OFT A;  4USS A;  3CYN A;  2J9H A;  3AY8 A;  3UL3 A;  5DQY A;  4MNN A;  3FK8 A;  5J9C A;  4YKF A;  2LJR A;  3M3M A;  2QA1 A;  1IYI A;  5EY6 A;  3FW2 A;  6GSY A;  2GGT A;  5KN1 A;  2G2Q A;  1XPV A;  4XS4 B;  1PX6 A;  3HJO A;  2O87 A;  4K6X A;  1MTC A;  2QKE A;  5LNK e;  3IHQ A;  5CNW A;  1T4Y A;  3IHG A;  2FWG A;  1QGV A;  1OE7 A;  4ACS A;  4NMU A;  2LQQ A;  3ZL5 A;  3O76 A;  4X43 A;  3KCM A;  3TUE A;  3W6G A;  3GH9 A;  1A24 A;  1BQ7 A;  2H1B A;  4IHU A;  4EXJ A;  1VF1 A;  3GUS A;  1TDI A;  1GSE A;  1GLP A;  1HNC A;  4GF0 A;  4KDY A;  4NHZ A;  3KTL A;  1M9B A;  4PUF C;  5IMA A;  2NPB A;  2RM5 A;  2DML A;  3BCK A;  2H0I A;  3ISO A;  4NHW A;  3HY2 A;  2PU9 C;  4PUR A;  4YQM A;  2A4H A;  4F0B A;  1SJI A;  4EDY A;  1O7U A;  2R2J A;  3IPZ A;  5AGY A;  4LL1 B;  3GTU A;  1BX9 A;  3VLN A;  1OC9 A;  3A2X A;  1U88 A;  5CYY A;  1YF1 A;  4Q5Q A;  2X8H A;  3D6I A;  4IBP A;  3HVV A;  5FWG A;  4KDU A;  4MCU A;  3QD9 A;  4F0C A;  3GX8 A;  1M99 A;  4MAB A;  1AIU A;  1U3I A;  2PER A;  2YN1 A;  3FHK A;  1WRY A;  3DYR A;  1GRX A;  4I97 A;  3GFK A;  1QUW A;  4BVX A;  4TKY A;  1X9S B;  1NHO A;  5KN2 A;  3C8E A;  2OAD A;  4KH7 A;  4TW5 A;  4JBB A;  2FA4 A;  2LNT A;  4KND A;  4DSS B;  3IA1 A;  1R26 A;  2ALB A;  3LGC A;  3JCM L;  1TJD A;  3ZML A;  2R0G A;  2HXK A;  3K8N A;  5C00 A;  1TRW A;  3J7Y k;  1S3C A;  3P2A A;  1Z9H A;  1T4Z A;  4K0N A;  2DLX A;  2H72 A;  2E0Q A;  4EE0 A;  2B5E A;  1GSF A;  3KZQ A;  1KEB A;  12GS A;  1PKZ A;  1YEP A;  3D4M A;  3KH7 A;  5B6M A;  2AB6 A;  3Q6O A;  1V98 A;  4O5Q A;  4TOP A;  4MZW A;  5HFK A;  1JZD A;  2I3Y A;  2ON5 A;  1B8X A;  1ZGN A;  2FNO A;  5FT3 A;  3EIN A;  3EMP A;  1O85 A;  5DAK B;  2HSY A;  2XPD A;  4ZL9 A;  4GLT A;  4GWR A;  4ICY A;  4MJB A;  3QFB C;  1TRS A;  1THX A;  2H6Z A;  4EO3 A;  4K2D A;  3CRU A;  2R37 A;  2B3S A;  3DIE A;  2B5Y A;  2V1M A;  3F6D A;  4DSQ A;  5HFI A;  1GWC A;  5G5F A;  1PL1 A;  2DJ3 A;  6GSX A;  2GT6 A;  3DKS A;  2GVP A;  2DJ2 A;  2GLR A;  3H93 A;  5D9V A;  4KDX A;  1H4O A;  1TK5 B;  5G30 A;  3E0U A;  1FVJ A;  2FA8 A;  2VLU A;  2FCH A;  5GAP D;  2JAD A;  5AN1 A;  2HSH A;  2K8S A;  3VUR A;  2PPT A;  3KH9 A;  4CDO A;  2VO4 A;  2I81 A;  2VM2 A;  4V1A g;  1E6B A;  1BED A;  3MDK A;  4MH2 A;  3O3T A;  2HI7 A;  4P3Y B;  1JHB A;  3GHA A;  3KM6 A;  1FW1 A;  4OFN A;  5ECS A;  5EL8 A;  1SU9 A;  1K0N A;  1DE2 A;  4ZB9 A;  4G10 A;  1M9A A;  2JAC A;  3M9K A;  5IMD A;  1J9B A;  5F06 A;  5GAN D;  1F6M C;  3TJK A;  1T7P B;  3SWL A;  2K9F A;  1X5E A;  7GSS A;  5DCH A;  2H6Y A;  2YAN A;  1FOV A;  4KE3 A;  1TOF A;  4K0G A;  3DVX A;  3Q19 A;  5G31 A;  1SL0 B;  4RI7 A;  3KP9 A;  4O5R A;  2CA8 A;  2I9H A;  1EEM A;  4LA1 A;  3TRP A;  2JZT A;  2OKA A;  3MSZ A;  4ZXG A;  4RI6 A;  1SK0 A;  2L5O A;  4G2E A;  4BL7 A;  1YKA A;  4WF4 A;  3I69 A;  1XVW A;  1KBN A;  2KOK A;  3TRX A;  3HCZ A;  1B9Y C;  4WEY A;  3G7Y A;  2C0G A;  18GS A;  3A3T A;  19GS A;  4XS6 A;  1ZOF A;  2GQL A;  3EUR A;  2DKH A;  1URM A;  1LU4 A;  2XC2 A;  1M2B A;  2KLX A;  4IQ1 A;  5D8I A;  2PVQ A;  2YCD A;  2XPE A;  3TDG A;  1G6Y A;  4EVM A;  2LTK A;  2HRK A;  4ZBB A;  3TB2 A;  5JCU A;  2L6C A;  1W4V A;  3GTU B;  1FAA A;  4D73 A;  3DXB A;  1OC9 B;  2YJH A;  3UJ1 A;  4IVF A;  1XWC A;  1R5A A;  2IMI A;  3A2V A;  3BJ5 A;  4XHM A;  3S9F A;  1MD4 A;  2CAI A;  3C71 A;  3L0H A;  1F3A A;  1SD9 A;  3GSS A;  5CRH A;  3GA4 A;  4XTS A;  3ZMK A;  4ZL8 A;  1HNB A;  2F51 A;  3EE2 A;  3EU3 A;  1DBY A;  4OFM A;  1ZL9 A;  3GKX A;  5E4W A;  1U6T A;  2VD1 A;  1K3Y A;  5H5R A;  1EOH A;  4OO5 A;  3KXO A;  2R0P A;  1PKW A;  2WJU A;  1TW9 A;  3GKK A;  3DD3 A;  2VL3 A;  4MPG A;  4BVY A;  1PMT A;  2H30 A;  5C04 A;  2EIR A;  2FGX A;  4FO5 A;  3EWL A;  4KW6 A;  4F03 A;  4CW9 A;  2FWH A;  5G1L A;  4X1U A;  1NW2 A;  1JFU A;  4HU9 A;  3QAV A;  2GTU A;  2HFD A;  5D96 A;  4A5P A;  3VFI A;  5AIX A;  4PNF A;  1U3A A;  4GSN A;  3FR9 A;  2FD3 A;  5D9T A;  5J4U A;  5CRE A;  1B4P A;  4L0U A;  3ME7 A;  2E2M A;  3UOM A;  3DEX A;  4G0L A;  1DE1 A;  3J7Y b;  5JWR B;  2H19 A;  4ILF A;  1A8L A;  4PXO A;  3TRQ A;  1JLV A;  2LEG A;  3VWW A;  1ML6 A;  3H79 A;  2E7P A;  1FO5 A;  5G5E A;  1SYX A;  4HJM A;  4EUY A;  4QL9 A;  1GSU A;  5A4W A;  4PQH A;  2I1U A;  1BJX A;  5CRW A;  2V2G A;  4TXV A;  4ZL7 A;  1YY7 A;  1XW9 A;  4KB3 A;  2X8G A;  4N0V A;  2OBK A;  4IQA A;  4KUN A;  1FHE A;  4OCF A;  5ELG A;  5A4U A;  3QOU A;  1V57 A;  5AIV A;  4NAX A;  4PNG A;  2KUC A;  2LKU A;  9GSS A;  1K0A A;  1RK4 A;  4MZB A;  2GT5 A;  3CXG A;  3FZ9 A;  4V2L A;  4KX4 A;  1N2A A;  3VPT A;  1OVN A;  2GZP A;  2YOI A;  2V6K A;  3KD0 A;  2G0F A;  4N30 A;  4XRA A;  5JCW A;  5CO3 A;  4WBJ A;  2HZE A;  2VL2 A;  1O8X A;  4K2X A;  3MIX A;  2CX4 A;  3D21 A;  1Z6M A;  2DC5 A;  4L0W A;  4MZC A;  2B6M A;  4HQZ A;  2C4J A;  3L9U A;  2YZH A;  4OD7 A;  4MF6 A;  1QMV A;  3LXT A;  4KSO A;  5KN0 A;  4G19 A;  4PX1 A;  4F9Z A;  2YJ7 A;  3QR6 A;  4YQU A;  1GNW A;  1GSQ A;  2C1Y A;  2VCV A;  5IOW A;  5KOX A;  4ZBD A;  1F3B A;  5F07 A;  6GSV A;  4BWQ A;  3F8U A;  1YZX A;  5B8B A;  2YV9 A;  4HZ4 A;  3QMX A;  5B6N A;  3FMW A;  5HR2 A;  4KA0 A;  4MF5 A;  3EYT A;  3GH6 A;  1GNE A;  1USB A;  3IBH A;  2AYT A;  3F3R A;  4WBR D;  4EDZ A;  4KGI A;  1YF0 A;  2PVO C;  5INY A;  4J57 E;  1ZCP A;  1TRU A;  5J5N A;  3IDV A;  2BMX A;  4BL7 B;  4NPB A;  5ECL B;  1RW1 A;  6GSS A;  3IK7 A;  1PRX A;  1TU8 A;  3U5R E;  1DSB A;  2WCI A;  4OMV A;  1VRS D;  3DGQ A;  4HI7 A;  1YQ1 A;  4GSS A;  2JZR A;  6GSU A;  2X99 A;  1YEX A;  4XRD A;  3OR5 A;  2HNL A;  2ZNM A;  2AV4 A;  3P90 A;  1BG5 A;  4JE1 A;  4WR4 A;  2GQM A;  1M2A A;  3IRA A;  2H0G A;  3TKS A;  5GSS A;  4JRR A;  1PL2 A;  1Q98 A;  1TK8 B;  4K7I A;  3KP8 A;  5CRG A;  1EP8 A;  2R3X A;  16GS A;  3A2W A;  2LS5 A;  2LJA A;  5FHI A;  5G1K A;  3KMO A;  5ID2 A;  3WD6 A;  3QFA C;  1ERT A;  4Z2R A;  5ENU A;  2N5A A;  2VAF A;  1A2L A;  4IN0 A;  2CQ9 A;  2BTO T;  4FYC A;  4PQI A;  5DAL A;  3QAW A;  3IK9 A;  4OO4 A;  2CVB A;  2I4A A;  2HT9 A;  5DDL A;  3GNJ A;  4FH8 A;  2TRX A;  3E3E A;  4JED A;  1M0U A;  5BRT A;  4ML1 A;  2RLI A;  4TXO A;  1O8W A;  4BVY B;  2WUL A;  4EC0 A;  2H0H A;  2CV4 A;  2DMM A;  3F4R A;  3F4S A;  1FVK A;  3ZVJ D;  4HDE A;  2KP2 A;  1UVZ A;  4K5R A;  2VM1 A;  3G7I A;  1M2D A;  5EPF A;  4YH2 A;  4EL1 A;  1Z6N A;  2JL4 A;  3KTB A;  1G7O A;  3DWV A;  5ECQ B;  11GS A;  2YWN A;  4L5O A;  4PUA A;  1KNG A;  2H70 A;  3H1N A;  1JZO A;  3UVH A;  2AJQ B;  5AIS A;  3BCI A;  3SBC A;  1A0F A;  1S3A A;  3TJF A;  1PA3 A;  3MYD A;  1XWB A;  1ZZY A;  3NZN A;  4K9Z A;  2DJ0 A;  3ZIV A;  5DCG A;  2M46 A;  3ZYW A;  1AQW A;  2PWJ A;  1AAZ A;  5ABR A;  4K7O A;  1H75 A;  5J3R A;  1TU7 A;  1T1V A;  1GTU A;  1EGR A;  3RDW A;  3HXS A;  1QK8 A;  4GRF A;  2NBS A;  2FY6 A;  5IO0 A;  5ELA A;  1EV4 A;  2KP1 A;  1JLW A;  2YWI A;  4TRX A;  2GZZ A;  4MJA A;  3LXZ A;  1GP1 A;  2MZC A;  1GUL A;  2WB9 A;  4Z2U A;  4EKZ A;  3QAG A;  3M9J A;  1N8J A;  4MMM A;  2E2G A;  4G0I A;  2C0E A;  4DVC A;  3PPU A;  2EC4 A;  4PTS A;  2MMZ A;  4WR5 A;  2C3N A;  3L4N A;  2EIO A;  2O89 A;  3H4K A;  3I6A A;  5IO2 A;  4CHS A;  2HRF A;  2HZE B;  1Q4J A;  2IFQ A;  5GST A;  1XWG A;  4TR3 A;  2JZS A;  4IW9 A;  4K1F A;  4MF7 A;  5KN3 A;  1B4Q A;  3H8Q A;  3CTF A;  2DSA A;  1AUC A;  2N5F A;  4MDC A;  2L59 A;  1XW6 A;  3FYG A;  2YWO A;  2LUS A;  1THO A;  2O8V B;  2MMO A;  4F82 A;  3HZ4 A;  1IYH A;  2P31 A;  1GTI A;  4EF0 A;  1PSQ A;  2RUE A;  1FB0 A;  5BMU A;  2IN3 A;  2L57 A;  2R6K A;  5IMC A;  5L71 A;  2CX3 A;  2JU5 A;  3E9J B;  2IPA A;  3R2Q A;  5H5S A;  1K0M A;  2CZ3 A;  1TI3 A;  1DUG A;  17GS A;  5D93 A;  1QFN A;  2YZU A;  1WPI A;  3F3Q A;  1ACV A;  1VF2 A;  3KIJ A;  4K5S A;  1SYR A;  1G0T A;  3PGT A;  2DKI A;  1SEN A;  3MWH A;  1E2Y A;  2H75 A;  3TOT A;  2DBC A;  1GSS A;  3ZIJ A;  3KEB A;  2VCX A;  3RHB A;  2C8U A;  4AF2 A;  2F8A A;  3TKQ A;  3VWV A;  5IQY A;  2LNS A;  1XVQ A;  2H1D A;  2K6V A;  2OE0 A;  2P5Q A;  2X8C A;  3LWA A;  1VF3 A;  4MJE A;  2PBJ A;  2KHP A;  1SKS B;  1B9X C;  2GSS A;  1A23 A;  2QA2 A;  2GDR A;  3ED3 A;  4V2M A;  4EIP A;  5KEJ A;  1XOB A;  4F2I A;  4AJ8 A;  3RPP A;  2VD0 A;  5E59 A;  4XCS A;  2HRN A;  3I9V 2;  3TKP A;  5ID2 B;  2VL9 A;  2V41 A;  2NDO A;  4MLY A;  3GX0 A;  1V40 A;  4GQF A;  5DAL B;  2H73 A;  1XBS A;  1XFL A;  3C7M A;  1I5G A;  3WGD A;  3VI5 A;  1Y25 A;  3ZTL A;  4HU7 A;  4Q5N A;  3APQ A;  1K0C A;  4E8E A;  3FEU A;  4IEL A;  3W8S A;  2M72 A;  3TCO A;  4TXO B;  2WS2 A;  3HA9 A;  1X5C A;  4K8M A;  3IC4 A;  5IOX A;  4BVX B;  2ES7 A;  3M8N A;  5DJL A;  1ERV A;  4YKG A;  2B7K A;  3G7J A;  1MEK A;  1MDK A;  1QXH A;  1XIY A;  2X4A A;  5F05 A;  2FHE A;  1O73 A;  2B1K A;  1T3B A;  2IL3 A;  4QQ7 A;  3TJG A;  2HE3 A;  3GKM A;  4WF5 A;  3IR4 A;  3QDN A;  1MDJ A;  1NHY A;  3U6V A;  1HNA A;  1OKD A;  4AJ7 A;  2FLS A;  2VLT A;  3UAR A;  2PN8 A;  3CTG A;  3RHC A;  3GN3 A;  4BWS A;  3IC8 A;  3RPN A;  3N9J A;  3APO A;  4KAE A;  2L4C A;  1PN9 A;  3CRT A;  1SJZ A;  3TKS E;  1GTB A;  2QGV A;  3LW9 A;  4DSS A;  2GQK A;  3KJY A;  2H66 A;  5F8B A;  3QCP A;  3RAZ A;  3BOA A;  1SL2 B;  4WKW A;  3ZFL A;  3LSZ A;  4Z7X A;  5COH A;  4ISD A;  3L9S A;  3F9U A;  2PGT A;  1K0D A;  2TRC P;  5D9X A;  1SD8 A;  3D0Z A;  2LQO A;  1SKR B;  1GLQ A;  4OWY A;  1AQV A;  1CQG A;  1WWJ A;  3EC3 A;  3GMF A;  5HR0 A;  3ZRE A;  3ERG A;  4KF9 A;  4TR1 A;  2AUV A;  4HQS A;  2FUG 2;  5EVO A;  3D22 A;  2F8F A;  4DSR A;  3IAS 2;  1NM3 A;  2L5L A;  2VCQ A;  2V32 A;  4ECI A;  3ZIT A;  5DQS A;  5DAK A;  1A2J A;  1GTA A;  2OE3 A;  2P0G A;  2FWF A;  4GCI A;  2L4Q A;  1F9M A;  2NTO A;  4RQX A;  4OCE A;  2MBS A;  3ERF A;  3F4T A;  4GST A;  2WFC A;  2TIR A;  4ZIJ A;  2VOC A;  3HYP A;  1SJ6 A;  4ECC A;  1AW9 A;  1V2A A;  1Z5Y E;  4V2N A;  4YQV A;  2IME A;  3EVI A;  5ECN B;  2OAC A;  4LL4 B;  4X4J A;  1AQX A;  4ML6 A;  3CBU A;  4V1A p;  5JCG A;  3ME8 A;  1B48 A;  1BYE A;  5A4V A;  1A0R P;  2YP6 A;  4IJI A;  5IMZ A;  3GUR A;  1XXU A;  2LRN A;  3GYK A;  1XCC A;  3CSJ A;  3LOR A;  2VUP A;  1LBK A;  3DVW A;  4JZQ A;  4TN8 A;  3VI7 A;  10GS A;  3V1W A;  1OC3 A;  2PUK C;  4FIW A;  3BBY A;  3US3 A;  4LLR A;  2LV3 A;  1S3D A;  2IMK A;  3MAK A;  4IJ3 A;  4N11 A;  2WZ9 A;  3GKN A;  1R4W A;  5IMF A;  1FB6 A;  1EGO A;  1I9D A;  2LJK A;  1ERW A;  4JU5 A;  2WRT A;  3C1S A;  1ZYE A;  1UC7 A;  5DJM A;  4RUV A;  4YAV A;  4BPY A;  3IV4 A;  4PGT A;  3IE3 A;  1X9M B;  3LYP A;  4L5L A;  3EMX A;  1YDK A;  3A5I A;  2RM6 A;  1BAY A;  3CMI A;  3HHV A;  3VK9 A;  2ZCT A;  22GS A;  4D73 B;  2N5B A;  2K8V A;  5IIZ A;  1GUH A;  1YKC A;  3UBK A;  5JWO B;  5G2Z A;  2A2R A;  1A8Y A;  1F37 A;  1GUK A;  3LEF A;  2HRA A;  2HSM A;  1V58 A;  2IMD A;  3APS A;  4NXI A;  2H74 A;  4TVE A;  1XWK A;  2R4V A;  1G7E A;  1JZW A;  1EP7 A;  5DBQ A;  5A5K A;  1PGT A;  4N10 A;  1HQO A;  3FKF A;  4ZBA A;  4G9H A;  1PN0 A;  5D9W A;  1OE8 A;  1J08 A;  2O85 A;  4IS0 A;  1Z7R A;  2HYX A;  2WDU A;  4I2T A;  4XIH A;  1XZO A;  3ZVJ A;  4LMV A;  4ECJ A;  3DML A;  4MK3 A;  2R5G A;  2H1G A;  4X0X A;  2MMN A;  3WGX A;  3R3E A;  1LJR A;  1O81 A;  5J41 A;  3MNG A;  1K0O A;  1X5D A;  2R0C A;  3UMA A;  3GIX A;  5IM9 A;  2BJX A;  1ILO A;  1ON4 A;  4IGJ A;  1K3O A;  3HVX A;  2PMT A;  2C0F A;  4JR6 A;  4E8H A;  2YWM A;  3UVT A;  2QSI A;  2D2Z A;  2XBQ A;  2IJY A;  2H01 A;  3D5J A;  4I2U A;  5GZZ B;  2F9S A;  3FRC A;  2LRC A;  4HOJ A;  4TR4 A;  1YJ6 A;  2P5R A;  4GTU A;  3LJR A;  3GRX A;  5H5Q A;  1ZYN A;  2CZ2 A;  4O7H A;  1ST9 A;  1AXD A;  3A5W A;  3UIW A;  4CY6 A;  2MMA A;  1T00 A;  5ECR B;  1WJK A;  2MYG A;  3M0F A;  5ECO B;  1XWA A;  4ZB8 A;  3PH9 A;  3IXR A;  4O32 A;  3VWU A;  4TR1 B;  4NV5 A;  4I5Q A;  1Z7P A;  5B8A A;  1PX7 A;  2RII A;  3O6T A;  3FZ4 A;  1A2M A;  2UZ8 A;  3P7X A;  2C80 A;  1TTZ A;  5IPG A;  4MPF A;  5JWQ B;  2B5X A;  1ZYP A;  2HLS A;  3KGK A;  3Q74 A;  2DJ1 A;  3TKR A;  1F2E A;  1CQH A;  1OYJ A;  3TOU A;  1C72 A;  4FYU A;  1EWX A;  4EIQ A;  3LG6 A;  3UBL A;  4L8E A;  2XHF A;  4KSM A;  2OBI A;  2H76 A;  2FWE A;  1OKT A;  4H86 A;  3F63 A;  2A2S A;  4ID0 A;  3HVS A;  4N0Z A;  1ABA A;  3GL5 A;  4JR4 A;  2REM A;  1WIK A;  1HD2 A;  2X64 A;  3VWX A;  2DIY A;  1EEJ A;  4POL A;  3DRN A;  4O5U A;  1Y6E A;  2HZF A;  2H71 A;  3HJM A;  3CSI A;  2M80 A;  2VCZ A;  1HYU A;  2OA7 A;  4BA7 A;  2EIQ A;  1T8E B;  13GS A;  2MBT A;  2AAW A;  2JSZ A;  1GH2 A;  3FZA A;  2VLV A;  1GSD A;  1FOH A;  8GSS A;  20GS A;  3G9B A;  3VPQ A;  1OC8 A;  3PIN A;  4GXZ A;  2DIZ A;  4K7N A;  4O92 A;  3LYK A;  2A4V A;  3P8W A;  2CVK A;  1VGL A;  1R5P A;  5F0G A;  3FR3 A;  4WXT A;  3GST A;  4XS1 A;  1X0R A;  3HDC A;  3RBT A;  2RUF A;  2IIY A;  1TRV A;  1SK2 A;  4KCA A;  1SK1 A;  2F3M A;  3WGE A;  1FG4 A;  4XS4 A;  3F6F A;  5ECI B;  6GST A;  2B7J A;  1EZK A;  2O7K A;  1RQM A;  3ERW A;  4ULX A;  1O6J A;  1WMJ A;  4KCE A;  3F0I A;  5ECP B;  4ZIL A;  2H8L A;  3QPM A;  1WE0 A;  4G0K A;  2B1L A;  5DVB A;  1K0B A;  5B7C A;  3WYW A;  1TKD B;  5HQP A;  3HZ8 A;  2ON7 A;  1EV9 A;  2GSQ A;  3C1R A;  4QL7 A;  4POM A;  1SKW B;  4AGS A;  3GV1 A;  1U87 A;  2DJK A;  2JSY A;  2Z9S A;  3NOF A;  4J2F A;  1TXX A;  1MD3 A;  3L9V A;  1TI1 A;  4MJC A;  2GST A;  3ZLP A;  3LQ7 A;  5LD0 A;  2L6D A;  3NIV A;  2GS3 A;  1ERU A;  3ZZX A;  2QC7 A;  4HZ2 A;  2CT6 A;  4HEA 2;  3ZRD A;  2NVL A;  3TJB A;  1WOU A;  2GSR A;  1TP9 A;  1UN2 A;  3IOS A;  3WT1 A;  4MP4 A;  2YNX A;  4ZB6 A;  2AHE A;  3KMN A;  1AC1 A;  1GUM A;  4WET A;  4Z2T A;  4AJ6 A;  1KTE A;  1XW5 A;  1V9W A;  2X49 A;  2WGR A;  1GL8 A;  3EU4 A;  2V6O A;  1ZYQ B;  3HD5 A;  4RQR A;  3TGZ A;  3UAP A;  1M7T A;  2XBI A;  1Z3E A;  3ZFB A;  5CRD A;  2VL2 C;  3LFL A;  3PR8 A;  4CY8 A;  4IKH A;  1PQN A;  5LCZ A;  5KOW A;  3D4T A;  3FZ5 A;  3BD2 A;  1VF4 A;  4FQU A;  2ZUP A;  14GS A;  1GSY A;  4J56 E;  3CSH A;  4YAP A;  1UA5 A;  1OAZ A;  5J9B A;  2OE1 A;  2IWT A;  4IP6 A;  2LRT A;  2CVD A;  3M1G A;  3L78 A;  3W8J A;  5CAX A;  2K18 A;  3FR6 A;  5HFG A;  4POK A;  4NWY A;  4TR0 A;  2IMF A;  2VIM A;  1TK0 B;  4GQC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...