3UMAA

Crystal structure of a hypothetical peroxiredoxin protein frm sinorhizobium meliloti
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
166
structure length
166
Chain Sequence
YFQSMMTIAVGDKLPNATFKEKTADGPVEVTTELLFKGKRVVLFAVPGAFTPTCSLNHLPGYLENRDAILARGVDDIAVVAVNDLHVMGAWATHSGGMGKIHFLSDWNAAFTKAIGMEIDLSAGTLGIRSKRYSMLVEDGVVKALNIEESPGQATASGAAAMLELL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical peroxiredoxin protein
publication title Crystal structure of a hypothetical peroxiredoxin protein from Sinorhizobium meliloti
rcsb
source organism Sinorhizobium meliloti
molecule tags Oxidoreductase
total genus 40
structure length 166
sequence length 166
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2011-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08534 Redoxin Redoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3umaA00
1K0DA 1SU9A 1EP7A 3DWVA 2WRTA 1M7TA 5CO3A 2IIYA 1B48A 3GKXA 4N30A 2L4QA 2PBJA 4HZ2A 3ME8A 5G5EA 1EV9A 2PN8A 1Y25A 1RW1A 3GURA 1M0UA 5EPFA 4IJ3A 2LJRA 3TJJA 5JCUA 2TRXA 1AW9A 4GQCA 2B3SA 4XRDA 3KD0A 2AJQB 3W6GA 2VCXA 4PQIA 3TJGA 4TR1B 3G9BA 4HU9A 2LQQA 2OA7A 4X1UA 2OBKA 4F9ZA 3VI5A 1DE1A 4MF5A 4G9HA 4WKWA 3IHQA 3ZIJA 3LORA 5JWQB 3ERFA 1S3DA 1FB6A 4KDUA 4JRRA 3QR6A 8GSSA 1A24A 3M9KA 1Z9HA 2CZ2A 2MBTA 1XOBA 1TK0B 3KH9A 4TXOB 1T4ZA 2R5GA 1O85A 3Q74A 2IL3A 2XBQA 3TOTA 5G30A 2XC2A 3LQ7A 2FD3A 2FA8A 1TK8B 1SJZA 5F8BA 4KDXA 3IK7A 2GQMA 5ENUA 1CQGA 5LNKe 5GZZB 1Z3EA 3IRAA 3HHVA 1T8EB 4WBRD 5ECPB 2R4VA 2P5RA 1PKWA 4E8HA 2YNXA 5D93A 3J7Yk 1U3AA 3QFBC 2H0IA 5JWOB 1THOA 1V9WA 2I9HA 4V2LA 1EP8A 4EE0A 1TKDB 2HI7A 2NBSA 4RUVA 3ZTLA 2P0GA 1PA3A 2JSZA 2VCTA 2FY6A 5J4UA 3SWLA 2O8VB 3GKKA 1QGVA 5INYA 5H5RA 2Z9SA 2VLTA 3UOMA 5CRGA 2YZHA 2GSSA 1GUKA 4P3YB 3NOFA 4POMA 4MDCA 2YZUA 2GZYA 3L9UA 4RI7A 2GSQA 4ILFA 4KSMA 4LMWA 1GULA 3BBYA 4XCSA 2IJYA 1NHOA 3HZ8A 3U5RE 3F63A 5EL8A 2OKAA 2ZUPA 1GL8A 3UBKA 4POBA 2VD1A 4HZ4A 5J3RA 3A2WA 5G1LA 1OC9A 2CT6A 1JLWA 3FY7A 4ZB8A 4ACSA 2HRFA 1T1VA 3TRXA 2GTUA 1RK4A 1GUMA 4FO5A 2X8CA 1WE0A 1K0CA 2B7JA 4OMVA 1EGOA 1K0BA 2IMFA 4OCEA 1UC7A 3EWLA 4F82A 4XS6A 4IJIA 3VWVA 4NPBA 1V57A 3UJ1A 4I97A 1O8WA 5J41A 1W89A 6GSTA 4TR1A 4IGJA 2QGVA 3F4SA 5B6MA 4POKA 4NWYA 3DVXA 4I2UA 2O89A 5G31A 4CW9A 1DE2A 2YWNA 4XIHA 3G7JA 1BJXA 2YOIA 3HVXA 3LEFA 2JU5A 2YJHA 1EGRA 1KEBA 1AXDA 2KLXA 4PURA 3VWWA 4GTUA 1K3LA 1PL2A 3FEUA 2C0EA 4I5QA 1F2EA 3HY2A 3ZVJD 3TJFA 1XVQA 5JCGA 2FWEA 3ZFLA 2YPMA 4K2DA 4L0UA 5F05A 17GSA 4G2EA 3DYRA 1FVKA 2FWFA 3DRNA 4IVFA 3C1SA 1XW5A 1M2BA 2C80A 5H5SA 2M72A 4MP4A 2LQOA 1SL1B 2KOKA 3DGQA 2H1DA 1M2DA 1U3IA 2H1GA 2AV4A 1MTCA 3EU3A 1H4OA 2PWJA 4WBJA 2VLUA 2K6VA 1B8XA 2FNOA 3UAPA 1QFNA 3FZ9A 3Q18A 4OO5A 3VI7A 10GSA 5DALB 2HRNA 2R37A 2PU9C 5J9CA 3RBTA 2IFQB 1B4QA 4OCFA 2OJLA 3GSSA 2CVKA 2MMNA 4ZIJA 1DBYA 3GHAA 3I6AA 4OFMA 3GL5A 2GQLA 4HOJA 3D4MA 2L6CA 3FKFA 5DAKA 1QK8A 4XRAA 2B5EA 1MD3A 3TKRA 3MSZA 2C3NA 3HZ4A 5ECNB 4WETA 1PGTA 2OE1A 2DMMA 4XS4A 2FHEA 2ALBA 1F37A 2VCVA 2OADA 1QXHA 3IK9A 4MF7A 1EOGA 2GT5A 5IMZA 2GVPA 2N5AA 4ZXGA 4PNFA 1DSBA 4KCEA 4HDEA 3APOA 3ZRDA 3RDWA 3ED3A 1ML6A 1K0AA 2H0GA 4MJCA 3W8SA 2MYGA 3VWUA 2A2RA 5HR1A 4QL9A 3KP9A 5ELGA 3KP8A 2OACA 4TR3A 1Q98A 1ST9A 4DSSA 1VF4A 2L4CA 1UA5A 4K7OA 4ML6A 2B5YA 3CSIA 2WB9A 1A8LA 4V2MA 1YF0A 4KDYA 2HZEA 3APSA 4TR4A 5IPHA 5FT3A 3DMLA 3BD2A 1ON4A 4KH7A 5KEJA 2GLRA 2HE3A 3EVIA 1XW9A 3TDGA 2DJJA 1XXUA 3TRQA 2H76A 2LEGA 5HQPA 2V41A 3LG6A 1O6JA 2HSHA 4F2IA 4GSTA 1VF1A 2L6DA 2ON5A 1X9WB 16GSA 2AAWA 4N0VA 3M3MA 2XHFA 3FR3A 1EEJA 5ECIB 2C0FA 2JSYA 3IDVA 3EYTA 1ACVA 2L59A 2C0GA 3WT1A 1FAAA 1SKWB 4IW9A 4DSQA 2GS3A 4I8BA 3GNJA 3F8UA 3VWXA 3DIEA 4HJMA 2H8LA 2YV9A 4HQZA 14GSA 3D5JA 2CZ3A 1OC3A 3IPZA 1TK5B 4V2NA 1B9XC 1YZXA 4WXTA 4XTSA 3KTLA 4MPGA 5HR2A 3C71A 1E6BA 1PSQA 2LS5A 5DQYA 1MDKA 1G6YA 2JZSA 5HFGA 4IELA 2NPBA 2AHEA 1AQVA 1PQNA 4KX4A 3FK8A 3A3TA 3DVWA 3F0IA 1O73A 2CA8A 2AUVA 5GAND 1T7PB 4EF0A 4QQ7A 3UL3A 2WCIA 1E2YA 2MBSA 2WJUA 5LCZA 4ZBBA 4ECIA 3RAZA 5H5QA 2GQKA 5J5NA 1GSSA 2CAIA 3QAVA 2HFDA 4LLRA 2NTOA 2WS2A 2ZCTA 3LXTA 3BJ5A 2LTKA 1OC9B 3PH9A 2I4AA 3HJOA 4EKZA 4MH2A 2F3MA 3KEBA 5IQYA 1B4PA 3A5WA 1YEPA 3KM6A 4K1FA 4K8MA 4WR5A 5GAPD 1OKDA 4MPFA 1TI1A 2M46A 5L71A 3APQA 1GRXA 2H0HA 4IBPA 1TW9A 3HD5A 2VL2C 1SJIA 3I43A 1GH2A 5IPGA 1BAYA 3F4TA 5HFKA 3DEXA 2LRCA 1V40A 1JLVA 4HEA2 5F07A 13GSA 2PVQA 2OBIA 3QFAC 6GSWA 12GSA 4F0CA 1JHBA 1B9YC 4J57E 3I69A 2LNSA 2VOCA 2GDRA 3DKSA 22GSA 5E59A 5DCGA 1ZYQB 2PUKC 1FG4A 5ID2A 4V1Ag 1GSUA 3D4TA 2PGTA 4BA7A 4MZBA 5ECKB 3DD3A 4KE3A 2PMTA 3GRXA 1IYIA 1O81A 1X9SB 6GSVA 2CAQA 3CXGA 1GNEA 4EDZA 3QAWA 1XBSA 3L0HA 4MZCA 4YAPA 5IMDA 1YQ1A 3HVSA 4MLYA 1SKRB 4MJEA 2P5QA 3C7MA 3EURA 3M1GA 2K8SA 2B1LA 2C3TA 2IMIA 3KH7A 4IQ1A 2H6YA 3P2AA 3P8WA 4IHUA 19GSA 1R5AA 4GXZA 5ELAA 1BQ7A 1F3AA 1QMVA 3F3QA 5CREA 2JZRA 3LXZA 1TP9A 3EE2A 2EIQA 3CRUA 1ZOFA 1R26A 2MZCA 3EC3A 1HQOA 2RM5A 3UVTA 1MDIA 5DAKB 2F8AA 1J9BA 2YWMA 3QOUA 2C0DA 2FGXA 1X5EA 3IA1A 4EO3A 4K7NA 5A5KA 1GWCA 4XS4B 3PR8A 4KCAA 1CQHA 3FR6A 5AIVA 2TRCP 5D9VA 1X9MB 4F03A 1R7HA 3KGKA 1U88A 2LSTA 4Q5QA 3G7IA 2I3YA 1WIKA 2DJ1A 2FWHA 1A23A 2V1MA 2LKUA 3F3RA 2GZPA 5ECQB 3FZ4A 4FYUA 2LV3A 4PUAA 3W8JA 3GX8A 2YJ7A 2EIRA 3GX0A 11GSA 3ERWA 2C4JA 4NHZA 1SK2A 2IWTA 3D22A 3R2QA 4DSSB 2DBCA 1XW6A 3N9JA 2K8VA 4I2TA 3RHCA 2WFCA 4O92A 2YWOA 2HZEB 4G19A 2EC4A 1V98A 3VPQA 2K18A 3O3TA 1A0RP 1N2AA 1JFUA 3CTFA 3NIVA 4RI6A 1SYRA 1HNBA 4ZB6A 1M99A 2TIRA 3DXBA 3MAKA 4FIWA 1K3OA 4D73A 3ZL5A 2VM2A 5KN2A 5COHA 4DSRA 1RQMA 1U6TA 3ZVJA 4LA1A 4N10A 4KAEA 1K0MA 4KW6A 18GSA 4IS0A 1NSWA 4NAXA 4K0NA 3C1RA 2LRTA 4NXIA 1HNAA 3CSHA 1Y6EA 2DIYA 3PGTA 3TKPA 2F51A 3ZIVA 1OAZA 2I1UA 1K0NA 1R4WA 1W4VA 5EVOA 3PINA 4DVCA 2JL4A 2L57A 3ERGA 3FHKA 1UN2A 5CRHA 1T00A 4EL1A 1BG5A 1KBNA 5E4WA 4MJBA 4I6XA 1EV4A 2H1AA 3EMPA 4MF6A 3US3A 5AN1A 4ZILA 3ZLPA 2C3QA 3LYKA 3D6IA 3Q19A 1XOAA 4YQUA 6GSUA 5B6NA 2YP6A 1ZCPA 3UBLA 5JCWA 1WPIA 4XHMA 3WD6A 4MCUA 3HJMA 2PVOC 5EY6A 4GSSA 5KN0A 1GTIA 1QQ2A 5FHIA 1ERWA 3AY8A 3TKSC 3TKSA 5CP1A 3ZYWA 4Z7XA 1A2LA 3L4NA 2H01A 5A4VA 5GSSA 2B7KA 2E7PA 4WF4A 4O32A 4MMMA 3ZITA 2RIIA 4J56E 2KP2A 1YKCA 2H72A 3LYPA 1GTUA 3KIJA 3VK9A 1USBA 3ZREA 4EVMA 4JBBA 2HNLA 3NZNA 1AAZA 7GSSA 3N5OA 4GQFA 3QMXA 1TOFA 1SL0B 1TI3A 4YAVA 2DJKA 1FB0A 1LU4A 5AGYA 2H6ZA 1TRVA 4KA0A 5DVBA 3E0UA 2LNTA 4HI7A 2LUSA 4K0GA 4L0WA 3ZFBA 4Q5RA 1OE7A 1A0FA 1FO5A 4AJ7A 3F9UA 1WRYA 2H1BA 3M8NA 3A2VA 4YQVA 2REMA 3GN3A 3IBHA 1C72A 1X5CA 3FYGA 5A4UA 3QCPA 1TRSA 1LJRA 5D8IA 4PGTA 2RUEA 1S3CA 3TCOA 4PNGA 1Z7PA 3IXRA 3TOUA 2HXKA 5CRWA 1V58A 2J23A 1N8JA 4JE1A 1WWJA 1PKZA 1K3YA 3GSTA 2BMXA 3BOAA 3IC4A 2IMKA 4G10A 5ID2B 1ABAA 3M0FA 5HFIA 2H30A 4MH3A 1Z6NA 1SK1A 1GSEA 3WGXA 1SYXA 2G0FA 4XS1A 5IMAA 3TUEA 1SENA 2CVBA 3TB2A 3EU4A 5KN3A 3F6FA 1NW2A 5B8AA 1G6WA 1J0FA 1XWGA 1GTAA 3TJKA 2KHPA 5JWRB 2B5XA 3ZMLA 3UVHA 2H71A 1YF1A 2C8UA 4GRFA 3RPNA 2V2GA 5D96A 4AF2A 3VFIA 1EEMA 1R5PA 2KUCA 1TXXA 2NVLA 5GSTA 3D21A 3EMXA 1BYEA 1WJKA 1Z6MA 2WULA 1MD4A 1TU7A 4K6XA 6GSSA 1XWCA 2GSTA 1GNWA 2BTOT 2CV4A 3C8EA 2O87A 2FCHA 4FH8A 4JR4A 3M9JA 3MWHA 2R3XA 2J9HA 2L5OA 2G2QA 1GSDA 2OE3A 3CBUA 4GSNA 4TW5A 2R6KA 2DLXA 3LGCA 5LD0A 3GA4A 1F9MA 3L9VA 2M80A 2HYXA 1OE8A 4K7IA 2JZTA 4TKYA 5G2ZA 5G1KA 5ECMB 5D9XA 2ES7A 4JZQA 1SKSB 1G7EA 1AQXA 2X8GA 4IN0A 2DJ3A 4OD7A 1X0RA 4YH2A 4V1Ap 1G7OA 4L5OA 3C73A 2O7KA 2OE0A 2VL2A 2PERA 4ECJA 5D9WA 2JACA 4O5RA 1XCCA 4DEJA 2BJXA 3HA9A 2GT6A 3J7Yb 1VF3A 2A4VA 3RPPA 5HR3A 2HT9A 4GF0A 1EWXA 2H66A 5IO2A 4OFNA 3WYWA 3CMIA 2H75A 5ECSA 1JZOA 2RLIA 4HS1A 1HNCA 4TXVA 3ZZXA 2ZNMA 4E8EA 2RM6A 4L5LA 4D73B 3HYPA 4BVXA 4PUFC 2DSAA 1FW1A 2V6KA 5B8BA 1NHYA 2CVDA 1AIUA 3H8QA 3GYKA 1JZRA 3LFLA 1I5GA 3VPTA 4PXOA 3D0ZA 2ON7A 2CX4A 2VD0A 4IP6A 4KNDA 2NDOA 4TR0A 2V32A 1TRUA 1WMJA 4F0BA 4FYCA 2XPEA 1ERUA 2HZFA 5D9TA 1ERTA 3UARA 3MDKA 4MZWA 4IQAA 1GLPA 3GTUA 3GMFA 4WEYA 1X5DA 1GSFA 1VRSD 3HCZA 1EZKA 4KSOA 5AIXA 5CNWA 3Q6OA 3E3EA 4O7HA 3GH6A 4MK3A 2VCQA 5C00A 4EC0A 3KZQA 1XWBA 5F06A 3S9FA 1M2AA 3FR9A 2WZ9A 2YV7A 1TU8A 3GIXA 3V1WA 1QUWA 3QDNA 3GFKA 3IV4A 3SBCA 2X99A 4WF5A 2D2ZA 3F6DA 6GSYA 1A2MA 5CRDA 1XZOA 2DJ0A 4ML1A 2FLSA 5DCHA 1OYJA 1EOHA 4ISDA 2AB6A 4ZBAA 4ZL9A 5B7CA 3P90A 1OC8A 5J9BA 1YY7A 5G5FA 2WDUA 1HD2A 2JADA 4PQ1A 1MEKA 4EDYA 1PMTA 4AGSA 1VGLA 2CQ9A 4KUNA 4GLTA 4TVEA 2DC5A 2KP1A 5DBQA 2N5BA 3JCML 3HVVA 3TJBA 4RQXA 2F9SA 4KGIA 2LJKA 1JZWA 5CYYA 1O8XA 1THXA 4NV5A 1LBKA 2DMLA 5IM9A 5C04A 2VUPA 2GSRA 4QL7A 4N11A 4JU5A 4OO4A 4MA9A 3WGDA 1WOUA 2QSIA 5DQSA 4POLA 4ULXA 5ECLB 5ABRA 3ME7A 3GL3A 4TN8A 5ECOB 2XPDA 2L5LA 4HU7A 3CYNA 5IIZA 2H6XA 4JR6A 3L9SA 1I9DA 4TXOA 5CAXA 3VURA 1YKAA 3LSZA 5IOXA 4ZBDA 5HR0A 1DUGA 4AJ6A 2A2SA 4EUYA 1TJDA 1GP1A 2YANA 1F6MC 1ZGNA 1ZZYA 2MMZA 3KXOA 1FOVA 1PD21 1IYHA 3UIWA 4MJAA 3IR4A 2H70A 1PX6A 2VO4A 3QAGA 1SJ6A 4Q5FA 4GCIA 3GKNA 3H79A 3QPMA 3CTGA 2B1KA 4IP1A 3L78A 2F8FA 2HLSA 4HQSA 1OVNA 3LJRA 3K8NA 5KN1A 2YWIA 3GKMA 1HYUA 1XIYA 3FRCA 4ZB9A 1Q4JA 2IN3A 2VM1A 4PQHA 1ERVA 2VIMA 1TRWA 3IAS2 4NV2A 1ZYEA 3VLNA 5DJLA 4NMUA 4OWYA 4ZL7A 2YN1A 1S3AA 2IMDA 4TRXA 5F0GA 2VLVA 2B6MA 4YQMA 3ZMKA 2IPAA 5ECRB 1PRXA 1A2JA 3WGEA 4L8EA 1GUHA 2LRNA 3CSJA 2E2MA 4J2FA 5IMVA 2H74A 3P7XA 3IOSA 1XFLA 2VL9A 1SD8A 2GZZA 1BEDA 1WP0A 3KMOA 2E0QA 4KB3A 4BPYA 2WGRA 1XWAA 3KJYA 2DJ2A 2XBIA 3E9JB 2VL3A 4ECCA 3CRTA 1T4YA 5DJMA 4FYBA 1T3BA 2HSYA 2CX3A 1ZMAA 2E2GA 2EIOA 1O7UA 1OKTA 2QC7A 1KTEA 3O76A 2P31A 2QKEA 1U87A 1M9AA 4MABA 4PX1A 3GV1A 1KNGA 3BCKA 4GWRA 2MMAA 3BCIA 3GH9A 2X8HA 4OFTA 3H1NA 3FZ5A 1XVWA 1FHEA 1GSYA 1GTBA 3H93A 4ID0A 2GGTA 2H73A 2RUFA 1VF2A 5FWGA 2O85A 1Z7RA 5IMFA 3UMAA 3RHBA 1PN9A 1PX7A 4X0XA 5AISA 2X64A 1YDKA 3UEMA 4BVYA 4EXJA 1V2AA 1NM3A 2VAFA 4WR4A 4ZL8A 3KTBA 1FVJA 4ECBA 5IMCA 1H75A 3TRPA 3H4KA 3U6VA 1JZDA 3HJPA 1XWKA 3F4RA 3A2XA 1SK0A 3I9V2 4BWSA 4LL4B 2N5FA 2DIZA 2FUG2 3TGZA 1F3BA 1M9BA 3FZAA 1G0TA 4IKHA 4HUAA 3GUSA 2MMOA 1Z5YE 3ISOA 1K0OA 3GTUB 2VCWA 5A4WA 5D73A 3G7YA 3HKRA 5DALA 1A8YA 3HXSA 4BWQA 2FWGA 2IFQA 2YCDA 4K9ZA 1GLQA 2AYTA 1GSQA 1AQWA 4AJ8A 4JEDA 1YEXA 4Q5NA 6GSXA 3HDCA 1UVZA 3TKSE 2PPTA 3MNGA 4NHWA 1MDJA 4TOPA 2R2JA 2VCZA 5IO0A 4HJ2A 1BX9A 20GSA 3O6TA 3OR5A 2V6OA 3KMNA 1YJ6A 2H19A 1SD9A 2IMEA 2I81A 3IE3A 1XPVA 2K9FA 9GSSA 1URMA 2C1YA 1TTZA 1AUCA 4CHSA 1J08A 2FA4A 4X43A 4LL1B 3EINA 3QD9A 5DDLA 4RQRA 5IOWA 1ZL9A 3TKQA 4CDOA 1AC1A 4N0ZA 5ECHB 4BL7A 1TDIA 3FW2A 2LJAA 1PL1A 3IAM2 4LMVA 3KCMA 3LWAA 3WT2A 1ILOA 1SL2B 4H86A
chains in the Genus database with same CATH superfamily
1K0DA 1SU9A 1EP7A 3DWVA 2WRTA 1M7TA 5CO3A 2IIYA 1B48A 3GKXA 4N30A 2L4QA 2PBJA 4HZ2A 3ME8A 5G5EA 1EV9A 2PN8A 1Y25A 1RW1A 3GURA 1M0UA 5EPFA 4IJ3A 2LJRA 3TJJA 5JCUA 2TRXA 1AW9A 4GQCA 2B3SA 4XRDA 3KD0A 1XG8A 2AJQB 4CY6A 3W6GA 2VCXA 4PQIA 3TJGA 4TR1B 3G9BA 4HU9A 2LQQA 2OA7A 4X1UA 2OBKA 4F9ZA 3VI5A 1DE1A 4MF5A 4G9HA 4WKWA 3IHQA 3ZIJA 3LORA 5JWQB 3ERFA 1S3DA 1FB6A 4KDUA 4JRRA 3QR6A 8GSSA 1A24A 3M9KA 1Z9HA 2CZ2A 2MBTA 1XOBA 1TK0B 3KH9A 4TXOB 1T4ZA 2R5GA 1O85A 3Q74A 2IL3A 2XBQA 3TOTA 5G30A 2XC2A 3LQ7A 2FD3A 2FA8A 1TK8B 1SJZA 5F8BA 4KDXA 3IK7A 2GQMA 5ENUA 1CQGA 5LNKe 5GZZB 1Z3EA 4G0KA 3IRAA 3HHVA 4Z2UA 1T8EB 4WBRD 5ECPB 2R4VA 2P5RA 1PKWA 4E8HA 2YNXA 5D93A 3J7Yk 1U3AA 3QFBC 2H0IA 5JWOB 1THOA 1V9WA 2I9HA 4V2LA 1EP8A 4EE0A 1TKDB 2HI7A 2NBSA 4RUVA 3ZTLA 2P0GA 1PA3A 2JSZA 2VCTA 2FY6A 5J4UA 3SWLA 2O8VB 3GKKA 1QGVA 5INYA 5H5RA 2Z9SA 2VLTA 3UOMA 5CRGA 2YZHA 2GSSA 1GUKA 4P3YB 3NOFA 4POMA 4MDCA 2YZUA 2GZYA 3L9UA 4RI7A 2GSQA 4ILFA 4KSMA 4LMWA 1GULA 3BBYA 4XCSA 2IJYA 1NHOA 3HZ8A 3U5RE 3F63A 5EL8A 2OKAA 2ZUPA 1GL8A 3UBKA 4POBA 2VD1A 4HZ4A 5J3RA 3A2WA 5G1LA 1OC9A 2CT6A 1JLWA 3FY7A 4ZB8A 4ACSA 2HRFA 2QA1A 1T1VA 3TRXA 2GTUA 1RK4A 1GUMA 4FO5A 2X8CA 1WE0A 1K0CA 2B7JA 4OMVA 1EGOA 1K0BA 2IMFA 4OCEA 1UC7A 3EWLA 4F82A 4XS6A 4EIPA 4IJIA 3VWVA 4NPBA 1V57A 3UJ1A 4I97A 1O8WA 4O5QA 5J41A 1W89A 6GSTA 4TR1A 4IGJA 2QGVA 3F4SA 5B6MA 4POKA 4NWYA 3DVXA 4I2UA 2O89A 5G31A 4CW9A 1DE2A 2YWNA 4XIHA 3G7JA 1BJXA 2YOIA 3HVXA 3LEFA 2X4AA 2JU5A 2YJHA 1EGRA 1KEBA 1AXDA 2KLXA 4PURA 3VWWA 4GTUA 1K3LA 1PL2A 3FEUA 2C0EA 4I5QA 1F2EA 3HY2A 3ZVJD 3TJFA 4BVYB 1XVQA 5JCGA 2FWEA 3ZFLA 4K2DA 2YPMA 4L0UA 5F05A 17GSA 4G2EA 3DYRA 1FVKA 2FWFA 3DRNA 4IVFA 3C1SA 1XW5A 1M2BA 2C80A 5H5SA 2M72A 4MP4A 2LQOA 1SL1B 2KOKA 3DGQA 2H1DA 1M2DA 1U3IA 2H1GA 2AV4A 1MTCA 3EU3A 1H4OA 2PWJA 4WBJA 2VLUA 2K6VA 2A2PA 2R0CA 1B8XA 2FNOA 3UAPA 1QFNA 3FZ9A 3Q18A 4OO5A 3VI7A 10GSA 5DALB 2HRNA 2R37A 2PU9C 5J9CA 3RBTA 2IFQB 1B4QA 4OCFA 2OJLA 3GSSA 2CVKA 4Z2TA 2MMNA 4ZIJA 1DBYA 3GHAA 3I6AA 4OFMA 3GL5A 2GQLA 4HOJA 3D4MA 2L6CA 3FKFA 5DAKA 1QK8A 4XRAA 2B5EA 1MD3A 3TKRA 3MSZA 2C3NA 3HZ4A 5ECNB 4WETA 1PGTA 2OE1A 2DMMA 4XS4A 3R3EA 2FHEA 2ALBA 1F37A 2VCVA 2OADA 1QXHA 3IK9A 4MF7A 1EOGA 2GT5A 5IMZA 2GVPA 2N5AA 4ZXGA 4PNFA 1DSBA 4KCEA 4HDEA 3APOA 3ZRDA 3RDWA 3ED3A 1ML6A 1K0AA 2H0GA 4MJCA 3W8SA 2MYGA 3VWUA 2A2RA 5HR1A 4QL9A 3KP9A 5ELGA 3KP8A 2OACA 4TR3A 1Q98A 1ST9A 4DSSA 1VF4A 2L4CA 1UA5A 4K7OA 4ML6A 2B5YA 3CSIA 2WB9A 1A8LA 4V2MA 1YF0A 4KDYA 2HZEA 3APSA 4TR4A 5IPHA 5FT3A 3DMLA 3BD2A 1ON4A 4KH7A 5KEJA 2GLRA 2HE3A 3EVIA 1XW9A 3TDGA 2DJJA 1XXUA 3TRQA 4O5UA 2H76A 2LEGA 5HQPA 2V41A 3LG6A 1O6JA 2HSHA 4F2IA 4GSTA 1VF1A 2L6DA 2ON5A 1X9WB 16GSA 2AAWA 4N0VA 3M3MA 2XHFA 1M3IA 3FR3A 4K2XA 1EEJA 5ECIB 2C0FA 2JSYA 3IDVA 3EYTA 1ACVA 2L59A 2C0GA 3WT1A 1FAAA 1SKWB 4IW9A 4DSQA 2GS3A 4I8BA 3GNJA 3CQFA 3F8UA 3VWXA 3DIEA 4HJMA 2H8LA 2YV9A 4HQZA 14GSA 3D5JA 2CZ3A 1OC3A 3IPZA 1TK5B 4V2NA 1B9XC 1YZXA 4WXTA 4XTSA 3KTLA 4MPGA 5HR2A 3C71A 1E6BA 1PSQA 2LS5A 5DQYA 1MDKA 1G6YA 2JZSA 5HFGA 4IELA 2NPBA 2AHEA 1AQVA 1PQNA 3MIXA 4KX4A 3FK8A 3A3TA 3DVWA 3F0IA 1O73A 2CA8A 2AUVA 5GAND 1T7PB 4EF0A 4QQ7A 3UL3A 2WCIA 1E2YA 2MBSA 2WJUA 5LCZA 4ZBBA 4ECIA 3RAZA 5H5QA 2GQKA 5J5NA 1GSSA 2CAIA 3QAVA 2HFDA 4LLRA 2NTOA 2WS2A 2ZCTA 3LXTA 3BJ5A 2LTKA 1OC9B 3PH9A 2I4AA 3HJOA 4EKZA 4MH2A 2F3MA 3KEBA 5IQYA 1B4PA 3A5WA 1YEPA 3KM6A 4K1FA 4K8MA 4WR5A 5GAPD 1OKDA 4MPFA 1TI1A 2M46A 5L71A 3APQA 1GRXA 2H0HA 4IBPA 1TW9A 3HD5A 2VL2C 1SJIA 3I43A 1GH2A 5IPGA 1BAYA 3F4TA 5HFKA 3DEXA 2LRCA 1V40A 1JLVA 4HEA2 5F07A 13GSA 2PVQA 2OBIA 3QFAC 6GSWA 12GSA 4F0CA 1JHBA 1B9YC 4J57E 3I69A 2LNSA 2VOCA 4KF9A 2GDRA 3DKSA 22GSA 5E59A 5DCGA 1ZYQB 2PUKC 1FG4A 5ID2A 4V1Ag 1GSUA 3D4TA 2PGTA 4BA7A 4MZBA 5ECKB 3DD3A 4KE3A 2PMTA 3GRXA 1IYIA 1O81A 1X9SB 6GSVA 2CAQA 3CXGA 1GNEA 4EDZA 3QAWA 1XBSA 3L0HA 4MZCA 4YAPA 5IMDA 1YQ1A 3HVSA 4MLYA 1SKRB 4MJEA 2P5QA 3C7MA 3EURA 3M1GA 2K8SA 2B1LA 2C3TA 2IMIA 3KH7A 4IQ1A 2H6YA 3P2AA 3P8WA 4IHUA 19GSA 1R5AA 4GXZA 4A5PA 4USSA 1BQ7A 1F3AA 5ELAA 1QMVA 3F3QA 5CREA 2JZRA 3LXZA 1TP9A 3EE2A 2EIQA 3CRUA 1ZOFA 1R26A 2MZCA 3EC3A 1HQOA 2RM5A 3UVTA 1MDIA 5DAKB 2F8AA 1J9BA 2YWMA 3QOUA 2C0DA 2FGXA 1X5EA 3IA1A 4EO3A 4K7NA 5A5KA 1ZYPA 1GWCA 4XS4B 3PR8A 4KCAA 1CQHA 3FR6A 5AIVA 2TRCP 5D9VA 1X9MB 4F03A 1R7HA 3KGKA 1U88A 2LSTA 4Q5QA 3G7IA 2I3YA 1WIKA 2DJ1A 2FWHA 1A23A 2V1MA 2LKUA 3F3RA 2GZPA 5ECQB 3FZ4A 4FYUA 2LV3A 4PUAA 3W8JA 3GX8A 2YJ7A 2EIRA 3GX0A 11GSA 3ERWA 4Z2RA 2C4JA 4NHZA 1SK2A 2IWTA 3D22A 3R2QA 4DSSB 2DBCA 1XW6A 3N9JA 2K8VA 4I2TA 3RHCA 2WFCA 4O92A 2YWOA 4K5SA 3MYDA 2HZEB 4G19A 2EC4A 1V98A 3VPQA 3PPUA 2K18A 3O3TA 1A0RP 1N2AA 1JFUA 3CTFA 3NIVA 4RI6A 1SYRA 4MNNA 1HNBA 4ZB6A 1M99A 2TIRA 3DXBA 3MAKA 4FIWA 1K3OA 4D73A 3ZL5A 2VM2A 5KN2A 5COHA 4DSRA 1RQMA 1U6TA 3ZVJA 4LA1A 4N10A 4KAEA 1K0MA 4KW6A 18GSA 4IS0A 1NSWA 4NAXA 4K0NA 3C1RA 2LRTA 4NXIA 1HNAA 3CSHA 1Y6EA 2DIYA 3PGTA 3TKPA 2F51A 3ZIVA 1OAZA 2I1UA 1K0NA 1R4WA 1W4VA 5EVOA 3PINA 4DVCA 2JL4A 2L57A 3ERGA 3FHKA 1UN2A 5CRHA 1T00A 4EL1A 1BG5A 1KBNA 3IC8A 5E4WA 4MJBA 4I6XA 1EV4A 2H1AA 3EMPA 4MF6A 3US3A 5AN1A 4ZILA 3ZLPA 2C3QA 3LYKA 3D6IA 3Q19A 1XOAA 4YQUA 6GSUA 2R0GA 5B6NA 2YP6A 1ZCPA 3UBLA 5JCWA 1WPIA 4XHMA 3WD6A 4MCUA 3HJMA 2PVOC 5EY6A 4GSSA 5KN0A 1GTIA 1QQ2A 5FHIA 1ERWA 3AY8A 3TKSC 3TKSA 5CP1A 3ZYWA 4Z7XA 1A2LA 3L4NA 2H01A 5A4VA 5GSSA 2B7KA 2E7PA 4WF4A 4O32A 4MMMA 3ZITA 2RIIA 4J56E 2KP2A 1YKCA 2H72A 3LYPA 1GTUA 3KIJA 4HSCX 3VK9A 1USBA 3ZREA 4EVMA 4JBBA 2HNLA 3NZNA 1AAZA 7GSSA 3N5OA 3HVNA 4GQFA 3QMXA 1TOFA 1SL0B 1TI3A 4YAVA 2DJKA 1FB0A 1LU4A 5AGYA 2H6ZA 1TRVA 4KA0A 5DVBA 3E0UA 2LNTA 4HI7A 2LUSA 4K0GA 4L0WA 3ZFBA 4Q5RA 1OE7A 1A0FA 1FO5A 4AJ7A 3F9UA 1WRYA 2H1BA 3M8NA 3A2VA 4YQVA 2REMA 3GN3A 3IBHA 1C72A 1X5CA 3FYGA 5A4UA 3QCPA 1TRSA 1LJRA 5D8IA 4PGTA 2RUEA 1S3CA 3TCOA 4PNGA 1Z7PA 3IXRA 3TOUA 5BMUA 2HXKA 5CRWA 1V58A 2J23A 1N8JA 4JE1A 1WWJA 1PKZA 1K3YA 3GSTA 2BMXA 3BOAA 3IC4A 2IMKA 4G10A 5ID2B 1ABAA 3M0FA 5HFIA 2H30A 4MH3A 1Z6NA 1SK1A 1GSEA 3WGXA 1SYXA 2G0FA 4XS1A 5IMAA 3TUEA 5BRTA 1SENA 2CVBA 3TB2A 3EU4A 5KN3A 3F6FA 1NW2A 5B8AA 1G6WA 1J0FA 1XWGA 1GTAA 3TJKA 2KHPA 5JWRB 2B5XA 3ZMLA 3UVHA 2H71A 4X4JA 1YF1A 4YKGA 2C8UA 4GRFA 3RPNA 2V2GA 5D96A 4AF2A 3VFIA 1EEMA 1R5PA 1FOHA 2KUCA 1TXXA 2NVLA 5GSTA 3D21A 3EMXA 4YKFA 1BYEA 1WJKA 1Z6MA 2WULA 1MD4A 1TU7A 4K6XA 6GSSA 1XWCA 2GSTA 1GNWA 2BTOT 2CV4A 3C8EA 2O87A 2FCHA 4FH8A 4JR4A 3M9JA 3FMWA 2R3XA 3MWHA 2J9HA 2L5OA 2G2QA 1GSDA 2OE3A 3CBUA 4GSNA 4TW5A 2R6KA 2DLXA 3LGCA 5LD0A 3GA4A 1F9MA 3L9VA 2M80A 2HYXA 1OE8A 4K7IA 2JZTA 4TKYA 5G2ZA 5G1KA 2DKIA 5ECMB 5D9XA 4G0LA 2ES7A 4JZQA 1SKSB 1G7EA 1AQXA 2X8GA 4IN0A 2DJ3A 4OD7A 1X0RA 4YH2A 4V1Ap 1G7OA 4L5OA 4FQUA 3C73A 2O7KA 2OE0A 2VL2A 2PERA 4ECJA 5KOWA 5D9WA 2JACA 4O5RA 1XCCA 4DEJA 2BJXA 3HA9A 2GT6A 3J7Yb 1VF3A 2A4VA 3RPPA 5HR3A 2HT9A 4GF0A 1EWXA 2H66A 5IO2A 4OFNA 4BIKA 3WYWA 3CMIA 2H75A 5ECSA 1JZOA 2RLIA 4HS1A 1HNCA 4TXVA 3ZZXA 2ZNMA 4E8EA 2RM6A 4L5LA 4D73B 3HYPA 4BVXA 4PUFC 2DSAA 1FW1A 2V6KA 5B8BA 1NHYA 2CVDA 1AIUA 3H8QA 3GYKA 1JZRA 3EPTA 3LFLA 1I5GA 3VPTA 4PXOA 3D0ZA 2ON7A 2CX4A 2VD0A 4IP6A 4KNDA 2NDOA 4TR0A 2V32A 1TRUA 1WMJA 4F0BA 2DKHA 4FYCA 2XPEA 1ERUA 2HZFA 5D9TA 1ERTA 3UARA 3MDKA 4MZWA 4IQAA 1GLPA 3GTUA 3GMFA 4WEYA 2HRAA 1X5DA 1GSFA 1VRSD 3HCZA 1EZKA 4KSOA 5AIXA 5CNWA 3Q6OA 3E3EA 4O7HA 3GH6A 4MK3A 2VCQA 5C00A 4EC0A 3KZQA 1XWBA 5F06A 3S9FA 1M2AA 3FR9A 2WZ9A 2YV7A 1TU8A 3GIXA 3V1WA 1QUWA 3QDNA 3GFKA 3IV4A 3SBCA 2X99A 4WF5A 2D2ZA 3F6DA 6GSYA 1A2MA 5CRDA 1XZOA 2DJ0A 4ML1A 2FLSA 5DCHA 1OYJA 1EOHA 4ISDA 2AB6A 4ZBAA 4ZL9A 2HRKA 5B7CA 3P90A 1OC8A 5J9BA 1YY7A 5G5FA 2WDUA 1HD2A 2JADA 4PQ1A 1MEKA 2R0PA 4EDYA 1PMTA 2HSMA 4AGSA 1VGLA 2CQ9A 4KUNA 4GLTA 4TVEA 1M3JA 2DC5A 2KP1A 5DBQA 2N5BA 3JCML 3HVVA 3TJBA 4RQXA 2F9SA 4KGIA 2LJKA 1JZWA 5CYYA 1O8XA 1THXA 4NV5A 1LBKA 2DMLA 5IM9A 5C04A 4EIQA 2VUPA 2GSRA 3A5IA 4QL7A 4N11A 4JU5A 4OO4A 4MA9A 3WGDA 1WOUA 2QSIA 5DQSA 4POLA 4ULXA 5ECLB 5ABRA 3ME7A 3GL3A 4TN8A 1PFOA 5ECOB 2XPDA 2L5LA 4HU7A 3CYNA 5IIZA 2H6XA 4JR6A 3L9SA 1I9DA 4TXOA 5CAXA 3VURA 1YKAA 3LSZA 5IOXA 4ZBDA 5HR0A 1DUGA 4AJ6A 2A2SA 4EUYA 1TJDA 1GP1A 2YANA 1F6MC 1ZGNA 1ZZYA 2MMZA 3KXOA 1FOVA 1PD21 1IYHA 3UIWA 4MJAA 3IR4A 2H70A 1PX6A 2VO4A 3QAGA 1SJ6A 4Q5FA 4GCIA 3GKNA 3H79A 3QPMA 2QA2A 3CTGA 2B1KA 4IP1A 3L78A 2F8FA 2HLSA 4HQSA 1OVNA 3LJRA 3K8NA 5KN1A 4PTSA 2YWIA 3GKMA 1HYUA 1XIYA 3FRCA 4ZB9A 1Q4JA 2IN3A 2VM1A 4PQHA 4G0IA 1ERVA 2VIMA 1TRWA 3IAS2 4NV2A 1ZYEA 3VLNA 5DJLA 4NMUA 4OWYA 4ZL7A 2YN1A 1S3AA 2IMDA 4TRXA 5F0GA 2VLVA 2B6MA 4YQMA 3ZMKA 2IPAA 5ECRB 1PRXA 1A2JA 3WGEA 3IHGA 4L8EA 1GUHA 2LRNA 3CSJA 2E2MA 4J2FA 5IMVA 2H74A 3P7XA 3IOSA 1XFLA 2VL9A 1SD8A 2GZZA 1BEDA 1WP0A 3KMOA 2E0QA 4KB3A 4BPYA 2WGRA 1XWAA 3KJYA 2DJ2A 2XBIA 3E9JB 2VL3A 4BL7B 3CRTA 4ECCA 1T4YA 5DJMA 4FYBA 1T3BA 2HSYA 2CX3A 1ZMAA 2E2GA 2EIOA 1O7UA 1OKTA 2QC7A 1KTEA 2UZ8A 1PN0A 2X49A 3O76A 2P31A 2QKEA 1U87A 1M9AA 4MABA 4PX1A 3GV1A 1KNGA 3BCKA 4GWRA 2MMAA 3BCIA 3GH9A 2X8HA 4OFTA 3H1NA 3FZ5A 1XVWA 1FHEA 1GSYA 1GTBA 3H93A 4ID0A 2GGTA 2H73A 2RUFA 1VF2A 5FWGA 2O85A 1Z7RA 1S3RA 5IMFA 3UMAA 3RHBA 3LW9A 1PN9A 1PX7A 4X0XA 5AISA 2X64A 1YDKA 3UEMA 2A4HA 4BVYA 4EXJA 1V2AA 1NM3A 2VAFA 4ICYA 4WR4A 4ZL8A 1ZYNA 3KTBA 1FVJA 4ECBA 5IMCA 1H75A 4BVXB 3TRPA 3H4KA 3U6VA 1JZDA 3HJPA 1XWKA 3F4RA 3A2XA 1SK0A 3I9V2 4BWSA 4LL4B 2N5FA 2DIZA 2FUG2 3TGZA 1F3BA 1M9BA 3FZAA 1G0TA 5KOXA 4IKHA 4HUAA 3GUSA 2MMOA 1Z5YE 3ISOA 1K0OA 3GTUB 2VCWA 5A4WA 5D73A 3G7YA 3HKRA 5DALA 1A8YA 3HXSA 4BWQA 2FWGA 2IFQA 2YCDA 4K9ZA 1GLQA 2AYTA 1GSQA 1AQWA 4AJ8A 4JEDA 1YEXA 4Q5NA 6GSXA 3HDCA 1UVZA 3TKSE 2PPTA 3MNGA 4NHWA 1MDJA 4TOPA 2R2JA 2VCZA 5IO0A 4HJ2A 1BX9A 20GSA 3O6TA 3OR5A 2V6OA 3KMNA 1YJ6A 2H19A 1SD9A 2IMEA 2I81A 4CY8A 3IE3A 1XPVA 2K9FA 9GSSA 1URMA 2C1YA 1TTZA 1AUCA 4CHSA 1J08A 2FA4A 4X43A 4LL1B 3EINA 4K5RA 3QD9A 5DDLA 4RQRA 5IOWA 1ZL9A 3TKQA 4CDOA 1AC1A 4N0ZA 5ECHB 4BL7A 1TDIA 3FW2A 2LJAA 1PL1A 3IAM2 4LMVA 3KCMA 3LWAA 3WT2A 1ILOA 1SL2B 4H86A
chains in the Genus database with same CATH topology
1K0DA 1SU9A 1EP7A 3DWVA 2WRTA 1M7TA 5CO3A 2IIYA 1B48A 3GKXA 4N30A 2L4QA 2PBJA 4HZ2A 3ME8A 5G5EA 1EV9A 2PN8A 1Y25A 1RW1A 3GURA 1M0UA 5EPFA 4IJ3A 2LJRA 3TJJA 5JCUA 2TRXA 1AW9A 4GQCA 2B3SA 4XRDA 3KD0A 2AJQB 4CY6A 3W6GA 2VCXA 4PQIA 3TJGA 4TR1B 3G9BA 4HU9A 2LQQA 2OA7A 4X1UA 2OBKA 4F9ZA 3VI5A 1DE1A 4MF5A 4G9HA 4WKWA 3IHQA 3ZIJA 3LORA 5JWQB 3ERFA 1S3DA 1FB6A 4KDUA 4JRRA 3QR6A 8GSSA 1A24A 3M9KA 1Z9HA 2CZ2A 2MBTA 1XOBA 1TK0B 3KH9A 4TXOB 1T4ZA 2R5GA 1O85A 3Q74A 2IL3A 2XBQA 3TOTA 5G30A 2XC2A 3LQ7A 2FD3A 2FA8A 1TK8B 1SJZA 5F8BA 4KDXA 3IK7A 2GQMA 5ENUA 1CQGA 5LNKe 5GZZB 1Z3EA 4G0KA 3IRAA 3HHVA 4Z2UA 1T8EB 4WBRD 5ECPB 2R4VA 2P5RA 1PKWA 4E8HA 2YNXA 5D93A 3J7Yk 1U3AA 3QFBC 2H0IA 5JWOB 1THOA 1V9WA 2I9HA 4V2LA 1EP8A 4EE0A 1TKDB 2HI7A 2NBSA 4RUVA 3ZTLA 2P0GA 1PA3A 2JSZA 2VCTA 2FY6A 5J4UA 3SWLA 2O8VB 3GKKA 1QGVA 5INYA 5H5RA 2Z9SA 2VLTA 3UOMA 5CRGA 2YZHA 2GSSA 1GUKA 4P3YB 3NOFA 4POMA 4MDCA 2YZUA 2GZYA 3L9UA 4RI7A 2GSQA 4ILFA 4KSMA 4LMWA 1GULA 3BBYA 4XCSA 2IJYA 1NHOA 3HZ8A 3U5RE 3F63A 5EL8A 2OKAA 2ZUPA 1GL8A 3UBKA 4POBA 2VD1A 4HZ4A 5J3RA 3A2WA 5G1LA 1OC9A 2CT6A 1JLWA 3FY7A 4ZB8A 4ACSA 2HRFA 2QA1A 1T1VA 3TRXA 2GTUA 1RK4A 1GUMA 4FO5A 2X8CA 1WE0A 1K0CA 2B7JA 4OMVA 1EGOA 1K0BA 2IMFA 4OCEA 1UC7A 3EWLA 4F82A 4XS6A 4EIPA 4IJIA 3VWVA 4NPBA 1V57A 3UJ1A 4I97A 1O8WA 4O5QA 5J41A 1W89A 6GSTA 4TR1A 4IGJA 2QGVA 3F4SA 5B6MA 4POKA 4NWYA 3DVXA 4I2UA 2O89A 5G31A 4CW9A 1DE2A 2YWNA 4XIHA 3G7JA 1BJXA 2YOIA 3HVXA 3LEFA 2X4AA 2JU5A 2YJHA 1EGRA 1KEBA 1AXDA 2KLXA 4PURA 3VWWA 4GTUA 1K3LA 1PL2A 3FEUA 2C0EA 4I5QA 1F2EA 3HY2A 3ZVJD 3TJFA 4BVYB 1XVQA 5JCGA 2FWEA 3ZFLA 4K2DA 2YPMA 4L0UA 5F05A 17GSA 4G2EA 3DYRA 1FVKA 2FWFA 3DRNA 4IVFA 3C1SA 1XW5A 1M2BA 2C80A 5H5SA 2M72A 4MP4A 2LQOA 1SL1B 2KOKA 3DGQA 2H1DA 1M2DA 1U3IA 2H1GA 2AV4A 1MTCA 3EU3A 1H4OA 2PWJA 4WBJA 2VLUA 2K6VA 2A2PA 2R0CA 1B8XA 2FNOA 3UAPA 1QFNA 3FZ9A 3Q18A 4OO5A 3VI7A 10GSA 5DALB 2HRNA 2R37A 2PU9C 5J9CA 3RBTA 2IFQB 1B4QA 4OCFA 2OJLA 3GSSA 2CVKA 4Z2TA 2MMNA 4ZIJA 1DBYA 3GHAA 3I6AA 4OFMA 3GL5A 2GQLA 4HOJA 3D4MA 2L6CA 3FKFA 5DAKA 1QK8A 4XRAA 2B5EA 1MD3A 3TKRA 3MSZA 2C3NA 3HZ4A 5ECNB 4WETA 1PGTA 2OE1A 2DMMA 4XS4A 3R3EA 2FHEA 2ALBA 1F37A 2VCVA 2OADA 1QXHA 3IK9A 4MF7A 1EOGA 2GT5A 5IMZA 2GVPA 2N5AA 4ZXGA 4PNFA 1DSBA 4KCEA 4HDEA 3APOA 3ZRDA 3RDWA 3ED3A 1ML6A 1K0AA 2H0GA 4MJCA 3W8SA 2MYGA 3VWUA 2A2RA 5HR1A 4QL9A 3KP9A 5ELGA 3KP8A 2OACA 4TR3A 1Q98A 1ST9A 4DSSA 1VF4A 2L4CA 1UA5A 4K7OA 4ML6A 2B5YA 3CSIA 2WB9A 1A8LA 4V2MA 1YF0A 4KDYA 2HZEA 3APSA 4TR4A 5IPHA 5FT3A 3DMLA 3BD2A 1ON4A 4KH7A 5KEJA 2GLRA 2HE3A 3EVIA 1XW9A 3TDGA 2DJJA 1XXUA 3TRQA 4O5UA 2H76A 2LEGA 5HQPA 2V41A 3LG6A 1O6JA 2HSHA 4F2IA 4GSTA 1VF1A 2L6DA 2ON5A 1X9WB 16GSA 2AAWA 4N0VA 3M3MA 2XHFA 3FR3A 4K2XA 1EEJA 5ECIB 2C0FA 2JSYA 3IDVA 3EYTA 1ACVA 2L59A 2C0GA 3WT1A 1FAAA 1SKWB 4IW9A 4DSQA 2GS3A 4I8BA 3GNJA 3F8UA 3VWXA 3DIEA 4HJMA 2H8LA 2YV9A 4HQZA 14GSA 3D5JA 2CZ3A 1OC3A 3IPZA 1TK5B 4V2NA 1B9XC 1YZXA 4WXTA 4XTSA 3KTLA 4MPGA 5HR2A 3C71A 1E6BA 1PSQA 2LS5A 5DQYA 1MDKA 1G6YA 2JZSA 5HFGA 4IELA 2NPBA 2AHEA 1AQVA 1PQNA 3MIXA 4KX4A 3FK8A 3A3TA 3DVWA 3F0IA 1O73A 2CA8A 2AUVA 5GAND 1T7PB 4EF0A 4QQ7A 3UL3A 2WCIA 1E2YA 2MBSA 2WJUA 5LCZA 4ZBBA 4ECIA 3RAZA 5H5QA 2GQKA 5J5NA 1GSSA 2CAIA 3QAVA 2HFDA 4LLRA 2NTOA 2WS2A 2ZCTA 3LXTA 3BJ5A 2LTKA 1OC9B 3PH9A 2I4AA 3HJOA 4EKZA 4MH2A 2F3MA 3KEBA 5IQYA 1B4PA 3A5WA 1YEPA 3KM6A 4K1FA 4K8MA 4WR5A 5GAPD 1OKDA 4MPFA 1TI1A 2M46A 5L71A 3APQA 1GRXA 2H0HA 4IBPA 1TW9A 3HD5A 2VL2C 1SJIA 3I43A 1GH2A 5IPGA 1BAYA 3F4TA 5HFKA 3DEXA 2LRCA 1V40A 1JLVA 4HEA2 5F07A 13GSA 2PVQA 2OBIA 3QFAC 6GSWA 12GSA 4F0CA 1JHBA 1B9YC 4J57E 3I69A 2LNSA 2VOCA 4KF9A 2GDRA 3DKSA 22GSA 5E59A 5DCGA 1ZYQB 2PUKC 1FG4A 5ID2A 4V1Ag 1GSUA 3D4TA 2PGTA 4BA7A 4MZBA 5ECKB 3DD3A 4KE3A 2PMTA 3GRXA 1IYIA 1O81A 1X9SB 6GSVA 2CAQA 3CXGA 1GNEA 4EDZA 3QAWA 1XBSA 3L0HA 4MZCA 4YAPA 5IMDA 1YQ1A 3HVSA 4MLYA 1SKRB 4MJEA 2P5QA 3C7MA 3EURA 3M1GA 2K8SA 2B1LA 2C3TA 2IMIA 3KH7A 4IQ1A 2H6YA 3P2AA 3P8WA 4IHUA 19GSA 1R5AA 4GXZA 4A5PA 4USSA 1BQ7A 1F3AA 5ELAA 1QMVA 3F3QA 5CREA 2JZRA 3LXZA 1TP9A 3EE2A 2EIQA 3CRUA 1ZOFA 1R26A 2MZCA 3EC3A 1HQOA 2RM5A 3UVTA 1MDIA 5DAKB 2F8AA 1J9BA 2YWMA 3QOUA 2C0DA 2FGXA 1X5EA 3IA1A 4EO3A 4K7NA 5A5KA 1ZYPA 1GWCA 4XS4B 3PR8A 4KCAA 1CQHA 3FR6A 5AIVA 2TRCP 5D9VA 1X9MB 4F03A 1R7HA 3KGKA 1U88A 2LSTA 4Q5QA 3G7IA 2I3YA 1WIKA 2DJ1A 2FWHA 1A23A 2V1MA 2LKUA 3F3RA 2GZPA 5ECQB 3FZ4A 4FYUA 2LV3A 4PUAA 3W8JA 3GX8A 2YJ7A 2EIRA 3GX0A 11GSA 3ERWA 4Z2RA 2C4JA 4NHZA 1SK2A 2IWTA 3D22A 3R2QA 4DSSB 2DBCA 1XW6A 3N9JA 2K8VA 4I2TA 3RHCA 2WFCA 4O92A 2YWOA 4K5SA 3MYDA 2HZEB 4G19A 2EC4A 1V98A 3VPQA 3PPUA 2K18A 3O3TA 1A0RP 1N2AA 1JFUA 3CTFA 3NIVA 4RI6A 1SYRA 4MNNA 1HNBA 4ZB6A 1M99A 2TIRA 3DXBA 3MAKA 4FIWA 1K3OA 4D73A 3ZL5A 2VM2A 5KN2A 5COHA 4DSRA 1RQMA 1U6TA 3ZVJA 4LA1A 4N10A 4KAEA 1K0MA 4KW6A 18GSA 4IS0A 1NSWA 4NAXA 4K0NA 3C1RA 2LRTA 4NXIA 1HNAA 3CSHA 1Y6EA 2DIYA 3PGTA 3TKPA 2F51A 3ZIVA 1OAZA 2I1UA 1K0NA 1R4WA 1W4VA 5EVOA 3PINA 4DVCA 2JL4A 2L57A 3ERGA 3FHKA 1UN2A 5CRHA 1T00A 4EL1A 1BG5A 1KBNA 3IC8A 5E4WA 4MJBA 4I6XA 1EV4A 2H1AA 3EMPA 4MF6A 3US3A 5AN1A 4ZILA 3ZLPA 2C3QA 3LYKA 3D6IA 3Q19A 1XOAA 4YQUA 6GSUA 2R0GA 5B6NA 2YP6A 1ZCPA 3UBLA 5JCWA 1WPIA 4XHMA 3WD6A 4MCUA 3HJMA 2PVOC 5EY6A 4GSSA 5KN0A 1GTIA 1QQ2A 5FHIA 1ERWA 3AY8A 3TKSC 3TKSA 5CP1A 3ZYWA 4Z7XA 1A2LA 3L4NA 2H01A 5A4VA 5GSSA 2B7KA 2E7PA 4WF4A 4O32A 4MMMA 3ZITA 2RIIA 4J56E 2KP2A 1YKCA 2H72A 3LYPA 1GTUA 3KIJA 3VK9A 1USBA 3ZREA 4EVMA 4JBBA 2HNLA 3NZNA 1AAZA 7GSSA 3N5OA 4GQFA 3QMXA 1TOFA 1SL0B 1TI3A 4YAVA 2DJKA 1FB0A 1LU4A 5AGYA 2H6ZA 1TRVA 4KA0A 5DVBA 3E0UA 2LNTA 4HI7A 2LUSA 4K0GA 4L0WA 3ZFBA 4Q5RA 1OE7A 1A0FA 1FO5A 4AJ7A 3F9UA 1WRYA 2H1BA 3M8NA 3A2VA 4YQVA 2REMA 3GN3A 3IBHA 1C72A 1X5CA 3FYGA 5A4UA 3QCPA 1TRSA 1LJRA 5D8IA 4PGTA 2RUEA 1S3CA 3TCOA 4PNGA 1Z7PA 3IXRA 3TOUA 5BMUA 2HXKA 5CRWA 1V58A 2J23A 1N8JA 4JE1A 1WWJA 1PKZA 1K3YA 3GSTA 2BMXA 3BOAA 3IC4A 2IMKA 4G10A 5ID2B 1ABAA 3M0FA 5HFIA 2H30A 4MH3A 1Z6NA 1SK1A 1GSEA 3WGXA 1SYXA 2G0FA 4XS1A 5IMAA 3TUEA 5BRTA 1SENA 2CVBA 3TB2A 3EU4A 5KN3A 3F6FA 1NW2A 5B8AA 1G6WA 1J0FA 1XWGA 1GTAA 3TJKA 2KHPA 5JWRB 2B5XA 3ZMLA 3UVHA 2H71A 4X4JA 1YF1A 4YKGA 2C8UA 4GRFA 3RPNA 2V2GA 5D96A 4AF2A 3VFIA 1EEMA 1R5PA 1FOHA 2KUCA 1TXXA 2NVLA 5GSTA 3D21A 3EMXA 4YKFA 1BYEA 1WJKA 1Z6MA 2WULA 1MD4A 1TU7A 4K6XA 6GSSA 1XWCA 2GSTA 1GNWA 2BTOT 2CV4A 3C8EA 2O87A 2FCHA 4FH8A 4JR4A 3M9JA 3FMWA 2R3XA 3MWHA 2J9HA 2L5OA 2G2QA 1GSDA 2OE3A 3CBUA 4GSNA 4TW5A 2R6KA 2DLXA 3LGCA 5LD0A 3GA4A 1F9MA 3L9VA 2M80A 2HYXA 1OE8A 4K7IA 2JZTA 4TKYA 5G2ZA 5G1KA 2DKIA 5ECMB 5D9XA 4G0LA 2ES7A 4JZQA 1SKSB 1G7EA 1AQXA 2X8GA 4IN0A 2DJ3A 4OD7A 1X0RA 4YH2A 4V1Ap 1G7OA 4L5OA 4FQUA 3C73A 2O7KA 2OE0A 2VL2A 2PERA 4ECJA 5KOWA 5D9WA 2JACA 4O5RA 1XCCA 4DEJA 2BJXA 3HA9A 2GT6A 3J7Yb 1VF3A 2A4VA 3RPPA 5HR3A 2HT9A 4GF0A 1EWXA 2H66A 5IO2A 4OFNA 3WYWA 3CMIA 2H75A 5ECSA 1JZOA 2RLIA 4HS1A 1HNCA 4TXVA 3ZZXA 2ZNMA 4E8EA 2RM6A 4L5LA 4D73B 3HYPA 4BVXA 4PUFC 2DSAA 1FW1A 2V6KA 5B8BA 1NHYA 2CVDA 1AIUA 3H8QA 3GYKA 1JZRA 3EPTA 3LFLA 1I5GA 3VPTA 4PXOA 3D0ZA 2ON7A 2CX4A 2VD0A 4IP6A 4KNDA 2NDOA 4TR0A 2V32A 1TRUA 1WMJA 4F0BA 2DKHA 4FYCA 2XPEA 1ERUA 2HZFA 5D9TA 1ERTA 3UARA 3MDKA 4MZWA 4IQAA 1GLPA 3GTUA 3GMFA 4WEYA 2HRAA 1X5DA 1GSFA 1VRSD 3HCZA 1EZKA 4KSOA 5AIXA 5CNWA 3Q6OA 3E3EA 4O7HA 3GH6A 4MK3A 2VCQA 5C00A 4EC0A 3KZQA 1XWBA 5F06A 3S9FA 1M2AA 3FR9A 2WZ9A 2YV7A 1TU8A 3GIXA 3V1WA 1QUWA 3QDNA 3GFKA 3IV4A 3SBCA 2X99A 4WF5A 2D2ZA 3F6DA 6GSYA 1A2MA 5CRDA 1XZOA 2DJ0A 4ML1A 2FLSA 5DCHA 1OYJA 1EOHA 4ISDA 2AB6A 4ZBAA 4ZL9A 2HRKA 5B7CA 3P90A 1OC8A 5J9BA 1YY7A 5G5FA 2WDUA 1HD2A 2JADA 4PQ1A 1MEKA 2R0PA 4EDYA 1PMTA 2HSMA 4AGSA 1VGLA 2CQ9A 4KUNA 4GLTA 4TVEA 2DC5A 2KP1A 5DBQA 2N5BA 3JCML 3HVVA 3TJBA 4RQXA 2F9SA 4KGIA 2LJKA 1JZWA 5CYYA 1O8XA 1THXA 4NV5A 1LBKA 2DMLA 5IM9A 5C04A 4EIQA 2VUPA 2GSRA 3A5IA 4QL7A 4N11A 4JU5A 4OO4A 4MA9A 3WGDA 1WOUA 2QSIA 5DQSA 4POLA 4ULXA 5ECLB 5ABRA 3ME7A 3GL3A 4TN8A 5ECOB 2XPDA 2L5LA 4HU7A 3CYNA 5IIZA 2H6XA 4JR6A 3L9SA 1I9DA 4TXOA 5CAXA 3VURA 1YKAA 3LSZA 5IOXA 4ZBDA 5HR0A 1DUGA 4AJ6A 2A2SA 4EUYA 1TJDA 1GP1A 2YANA 1F6MC 1ZGNA 1ZZYA 2MMZA 3KXOA 1FOVA 1PD21 1IYHA 3UIWA 4MJAA 3IR4A 2H70A 1PX6A 2VO4A 3QAGA 1SJ6A 4Q5FA 4GCIA 3GKNA 3H79A 3QPMA 2QA2A 3CTGA 2B1KA 4IP1A 3L78A 2F8FA 2HLSA 4HQSA 1OVNA 3LJRA 3K8NA 5KN1A 4PTSA 2YWIA 3GKMA 1HYUA 1XIYA 3FRCA 4ZB9A 1Q4JA 2IN3A 2VM1A 4PQHA 4G0IA 1ERVA 2VIMA 1TRWA 3IAS2 4NV2A 1ZYEA 3VLNA 5DJLA 4NMUA 4OWYA 4ZL7A 2YN1A 1S3AA 2IMDA 4TRXA 5F0GA 2VLVA 2B6MA 4YQMA 3ZMKA 2IPAA 5ECRB 1PRXA 1A2JA 3WGEA 3IHGA 4L8EA 1GUHA 2LRNA 3CSJA 2E2MA 4J2FA 5IMVA 2H74A 3P7XA 3IOSA 1XFLA 2VL9A 1SD8A 2GZZA 1BEDA 1WP0A 3KMOA 2E0QA 4KB3A 4BPYA 2WGRA 1XWAA 3KJYA 2DJ2A 2XBIA 3E9JB 2VL3A 4BL7B 3CRTA 4ECCA 1T4YA 5DJMA 4FYBA 1T3BA 2HSYA 2CX3A 1ZMAA 2E2GA 2EIOA 1O7UA 1OKTA 2QC7A 1KTEA 2UZ8A 1PN0A 2X49A 3O76A 2P31A 2QKEA 1U87A 1M9AA 4MABA 4PX1A 3GV1A 1KNGA 3BCKA 4GWRA 2MMAA 3BCIA 3GH9A 2X8HA 4OFTA 3H1NA 3FZ5A 1XVWA 1FHEA 1GSYA 1GTBA 3H93A 4ID0A 2GGTA 2H73A 2RUFA 1VF2A 5FWGA 2O85A 1Z7RA 5IMFA 3UMAA 3RHBA 3LW9A 1PN9A 1PX7A 4X0XA 5AISA 2X64A 1YDKA 3UEMA 2A4HA 4BVYA 4EXJA 1V2AA 1NM3A 2VAFA 4ICYA 4WR4A 4ZL8A 1ZYNA 3KTBA 1FVJA 4ECBA 5IMCA 1H75A 4BVXB 3TRPA 3H4KA 3U6VA 1JZDA 3HJPA 1XWKA 3F4RA 3A2XA 1SK0A 3I9V2 4BWSA 4LL4B 2N5FA 2DIZA 2FUG2 3TGZA 1F3BA 1M9BA 3FZAA 1G0TA 5KOXA 4IKHA 4HUAA 3GUSA 2MMOA 1Z5YE 3ISOA 1K0OA 3GTUB 2VCWA 5A4WA 5D73A 3G7YA 3HKRA 5DALA 1A8YA 3HXSA 4BWQA 2FWGA 2IFQA 2YCDA 4K9ZA 1GLQA 2AYTA 1GSQA 1AQWA 4AJ8A 4JEDA 1YEXA 4Q5NA 6GSXA 3HDCA 1UVZA 3TKSE 2PPTA 3MNGA 4NHWA 1MDJA 4TOPA 2R2JA 2VCZA 5IO0A 4HJ2A 1BX9A 20GSA 3O6TA 3OR5A 2V6OA 3KMNA 1YJ6A 2H19A 1SD9A 2IMEA 2I81A 4CY8A 3IE3A 1XPVA 2K9FA 9GSSA 1URMA 2C1YA 1TTZA 1AUCA 4CHSA 1J08A 2FA4A 4X43A 4LL1B 3EINA 4K5RA 3QD9A 5DDLA 4RQRA 5IOWA 1ZL9A 3TKQA 4CDOA 1AC1A 4N0ZA 5ECHB 4BL7A 1TDIA 3FW2A 2LJAA 1PL1A 3IAM2 4LMVA 3KCMA 3LWAA 3WT2A 1ILOA 1SL2B 4H86A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K0D A;  1SU9 A;  1EP7 A;  3DWV A;  2WRT A;  1M7T A;  5CO3 A;  2IIY A;  1B48 A;  3GKX A;  4N30 A;  2L4Q A;  2PBJ A;  4HZ2 A;  3ME8 A;  5G5E A;  1EV9 A;  2PN8 A;  1Y25 A;  1RW1 A;  3GUR A;  1M0U A;  5EPF A;  4IJ3 A;  2LJR A;  3TJJ A;  5JCU A;  2TRX A;  1AW9 A;  4GQC A;  2B3S A;  4XRD A;  3KD0 A;  2AJQ B;  3W6G A;  2VCX A;  4PQI A;  3TJG A;  4TR1 B;  3G9B A;  4HU9 A;  2LQQ A;  2OA7 A;  4X1U A;  2OBK A;  4F9Z A;  3VI5 A;  1DE1 A;  4MF5 A;  4G9H A;  4WKW A;  3IHQ A;  3ZIJ A;  3LOR A;  5JWQ B;  3ERF A;  1S3D A;  1FB6 A;  4KDU A;  4JRR A;  3QR6 A;  8GSS A;  1A24 A;  3M9K A;  1Z9H A;  2CZ2 A;  2MBT A;  1XOB A;  1TK0 B;  3KH9 A;  4TXO B;  1T4Z A;  2R5G A;  1O85 A;  3Q74 A;  2IL3 A;  2XBQ A;  3TOT A;  5G30 A;  2XC2 A;  3LQ7 A;  2FD3 A;  2FA8 A;  1TK8 B;  1SJZ A;  5F8B A;  4KDX A;  3IK7 A;  2GQM A;  5ENU A;  1CQG A;  5LNK e;  5GZZ B;  1Z3E A;  3IRA A;  3HHV A;  1T8E B;  4WBR D;  5ECP B;  2R4V A;  2P5R A;  1PKW A;  4E8H A;  2YNX A;  5D93 A;  3J7Y k;  1U3A A;  3QFB C;  2H0I A;  5JWO B;  1THO A;  1V9W A;  2I9H A;  4V2L A;  1EP8 A;  4EE0 A;  1TKD B;  2HI7 A;  2NBS A;  4RUV A;  3ZTL A;  2P0G A;  1PA3 A;  2JSZ A;  2VCT A;  2FY6 A;  5J4U A;  3SWL A;  2O8V B;  3GKK A;  1QGV A;  5INY A;  5H5R A;  2Z9S A;  2VLT A;  3UOM A;  5CRG A;  2YZH A;  2GSS A;  1GUK A;  4P3Y B;  3NOF A;  4POM A;  4MDC A;  2YZU A;  2GZY A;  3L9U A;  4RI7 A;  2GSQ A;  4ILF A;  4KSM A;  4LMW A;  1GUL A;  3BBY A;  4XCS A;  2IJY A;  1NHO A;  3HZ8 A;  3U5R E;  3F63 A;  5EL8 A;  2OKA A;  2ZUP A;  1GL8 A;  3UBK A;  4POB A;  2VD1 A;  4HZ4 A;  5J3R A;  3A2W A;  5G1L A;  1OC9 A;  2CT6 A;  1JLW A;  3FY7 A;  4ZB8 A;  4ACS A;  2HRF A;  1T1V A;  3TRX A;  2GTU A;  1RK4 A;  1GUM A;  4FO5 A;  2X8C A;  1WE0 A;  1K0C A;  2B7J A;  4OMV A;  1EGO A;  1K0B A;  2IMF A;  4OCE A;  1UC7 A;  3EWL A;  4F82 A;  4XS6 A;  4IJI A;  3VWV A;  4NPB A;  1V57 A;  3UJ1 A;  4I97 A;  1O8W A;  5J41 A;  1W89 A;  6GST A;  4TR1 A;  4IGJ A;  2QGV A;  3F4S A;  5B6M A;  4POK A;  4NWY A;  3DVX A;  4I2U A;  2O89 A;  5G31 A;  4CW9 A;  1DE2 A;  2YWN A;  4XIH A;  3G7J A;  1BJX A;  2YOI A;  3HVX A;  3LEF A;  2JU5 A;  2YJH A;  1EGR A;  1KEB A;  1AXD A;  2KLX A;  4PUR A;  3VWW A;  4GTU A;  1K3L A;  1PL2 A;  3FEU A;  2C0E A;  4I5Q A;  1F2E A;  3HY2 A;  3ZVJ D;  3TJF A;  1XVQ A;  5JCG A;  2FWE A;  3ZFL A;  2YPM A;  4K2D A;  4L0U A;  5F05 A;  17GS A;  4G2E A;  3DYR A;  1FVK A;  2FWF A;  3DRN A;  4IVF A;  3C1S A;  1XW5 A;  1M2B A;  2C80 A;  5H5S A;  2M72 A;  4MP4 A;  2LQO A;  1SL1 B;  2KOK A;  3DGQ A;  2H1D A;  1M2D A;  1U3I A;  2H1G A;  2AV4 A;  1MTC A;  3EU3 A;  1H4O A;  2PWJ A;  4WBJ A;  2VLU A;  2K6V A;  1B8X A;  2FNO A;  3UAP A;  1QFN A;  3FZ9 A;  3Q18 A;  4OO5 A;  3VI7 A;  10GS A;  5DAL B;  2HRN A;  2R37 A;  2PU9 C;  5J9C A;  3RBT A;  2IFQ B;  1B4Q A;  4OCF A;  2OJL A;  3GSS A;  2CVK A;  2MMN A;  4ZIJ A;  1DBY A;  3GHA A;  3I6A A;  4OFM A;  3GL5 A;  2GQL A;  4HOJ A;  3D4M A;  2L6C A;  3FKF A;  5DAK A;  1QK8 A;  4XRA A;  2B5E A;  1MD3 A;  3TKR A;  3MSZ A;  2C3N A;  3HZ4 A;  5ECN B;  4WET A;  1PGT A;  2OE1 A;  2DMM A;  4XS4 A;  2FHE A;  2ALB A;  1F37 A;  2VCV A;  2OAD A;  1QXH A;  3IK9 A;  4MF7 A;  1EOG A;  2GT5 A;  5IMZ A;  2GVP A;  2N5A A;  4ZXG A;  4PNF A;  1DSB A;  4KCE A;  4HDE A;  3APO A;  3ZRD A;  3RDW A;  3ED3 A;  1ML6 A;  1K0A A;  2H0G A;  4MJC A;  3W8S A;  2MYG A;  3VWU A;  2A2R A;  5HR1 A;  4QL9 A;  3KP9 A;  5ELG A;  3KP8 A;  2OAC A;  4TR3 A;  1Q98 A;  1ST9 A;  4DSS A;  1VF4 A;  2L4C A;  1UA5 A;  4K7O A;  4ML6 A;  2B5Y A;  3CSI A;  2WB9 A;  1A8L A;  4V2M A;  1YF0 A;  4KDY A;  2HZE A;  3APS A;  4TR4 A;  5IPH A;  5FT3 A;  3DML A;  3BD2 A;  1ON4 A;  4KH7 A;  5KEJ A;  2GLR A;  2HE3 A;  3EVI A;  1XW9 A;  3TDG A;  2DJJ A;  1XXU A;  3TRQ A;  2H76 A;  2LEG A;  5HQP A;  2V41 A;  3LG6 A;  1O6J A;  2HSH A;  4F2I A;  4GST A;  1VF1 A;  2L6D A;  2ON5 A;  1X9W B;  16GS A;  2AAW A;  4N0V A;  3M3M A;  2XHF A;  3FR3 A;  1EEJ A;  5ECI B;  2C0F A;  2JSY A;  3IDV A;  3EYT A;  1ACV A;  2L59 A;  2C0G A;  3WT1 A;  1FAA A;  1SKW B;  4IW9 A;  4DSQ A;  2GS3 A;  4I8B A;  3GNJ A;  3F8U A;  3VWX A;  3DIE A;  4HJM A;  2H8L A;  2YV9 A;  4HQZ A;  14GS A;  3D5J A;  2CZ3 A;  1OC3 A;  3IPZ A;  1TK5 B;  4V2N A;  1B9X C;  1YZX A;  4WXT A;  4XTS A;  3KTL A;  4MPG A;  5HR2 A;  3C71 A;  1E6B A;  1PSQ A;  2LS5 A;  5DQY A;  1MDK A;  1G6Y A;  2JZS A;  5HFG A;  4IEL A;  2NPB A;  2AHE A;  1AQV A;  1PQN A;  4KX4 A;  3FK8 A;  3A3T A;  3DVW A;  3F0I A;  1O73 A;  2CA8 A;  2AUV A;  5GAN D;  1T7P B;  4EF0 A;  4QQ7 A;  3UL3 A;  2WCI A;  1E2Y A;  2MBS A;  2WJU A;  5LCZ A;  4ZBB A;  4ECI A;  3RAZ A;  5H5Q A;  2GQK A;  5J5N A;  1GSS A;  2CAI A;  3QAV A;  2HFD A;  4LLR A;  2NTO A;  2WS2 A;  2ZCT A;  3LXT A;  3BJ5 A;  2LTK A;  1OC9 B;  3PH9 A;  2I4A A;  3HJO A;  4EKZ A;  4MH2 A;  2F3M A;  3KEB A;  5IQY A;  1B4P A;  3A5W A;  1YEP A;  3KM6 A;  4K1F A;  4K8M A;  4WR5 A;  5GAP D;  1OKD A;  4MPF A;  1TI1 A;  2M46 A;  5L71 A;  3APQ A;  1GRX A;  2H0H A;  4IBP A;  1TW9 A;  3HD5 A;  2VL2 C;  1SJI A;  3I43 A;  1GH2 A;  5IPG A;  1BAY A;  3F4T A;  5HFK A;  3DEX A;  2LRC A;  1V40 A;  1JLV A;  4HEA 2;  5F07 A;  13GS A;  2PVQ A;  2OBI A;  3QFA C;  6GSW A;  12GS A;  4F0C A;  1JHB A;  1B9Y C;  4J57 E;  3I69 A;  2LNS A;  2VOC A;  2GDR A;  3DKS A;  22GS A;  5E59 A;  5DCG A;  1ZYQ B;  2PUK C;  1FG4 A;  5ID2 A;  4V1A g;  1GSU A;  3D4T A;  2PGT A;  4BA7 A;  4MZB A;  5ECK B;  3DD3 A;  4KE3 A;  2PMT A;  3GRX A;  1IYI A;  1O81 A;  1X9S B;  6GSV A;  2CAQ A;  3CXG A;  1GNE A;  4EDZ A;  3QAW A;  1XBS A;  3L0H A;  4MZC A;  4YAP A;  5IMD A;  1YQ1 A;  3HVS A;  4MLY A;  1SKR B;  4MJE A;  2P5Q A;  3C7M A;  3EUR A;  3M1G A;  2K8S A;  2B1L A;  2C3T A;  2IMI A;  3KH7 A;  4IQ1 A;  2H6Y A;  3P2A A;  3P8W A;  4IHU A;  19GS A;  1R5A A;  4GXZ A;  5ELA A;  1BQ7 A;  1F3A A;  1QMV A;  3F3Q A;  5CRE A;  2JZR A;  3LXZ A;  1TP9 A;  3EE2 A;  2EIQ A;  3CRU A;  1ZOF A;  1R26 A;  2MZC A;  3EC3 A;  1HQO A;  2RM5 A;  3UVT A;  1MDI A;  5DAK B;  2F8A A;  1J9B A;  2YWM A;  3QOU A;  2C0D A;  2FGX A;  1X5E A;  3IA1 A;  4EO3 A;  4K7N A;  5A5K A;  1GWC A;  4XS4 B;  3PR8 A;  4KCA A;  1CQH A;  3FR6 A;  5AIV A;  2TRC P;  5D9V A;  1X9M B;  4F03 A;  1R7H A;  3KGK A;  1U88 A;  2LST A;  4Q5Q A;  3G7I A;  2I3Y A;  1WIK A;  2DJ1 A;  2FWH A;  1A23 A;  2V1M A;  2LKU A;  3F3R A;  2GZP A;  5ECQ B;  3FZ4 A;  4FYU A;  2LV3 A;  4PUA A;  3W8J A;  3GX8 A;  2YJ7 A;  2EIR A;  3GX0 A;  11GS A;  3ERW A;  2C4J A;  4NHZ A;  1SK2 A;  2IWT A;  3D22 A;  3R2Q A;  4DSS B;  2DBC A;  1XW6 A;  3N9J A;  2K8V A;  4I2T A;  3RHC A;  2WFC A;  4O92 A;  2YWO A;  2HZE B;  4G19 A;  2EC4 A;  1V98 A;  3VPQ A;  2K18 A;  3O3T A;  1A0R P;  1N2A A;  1JFU A;  3CTF A;  3NIV A;  4RI6 A;  1SYR A;  1HNB A;  4ZB6 A;  1M99 A;  2TIR A;  3DXB A;  3MAK A;  4FIW A;  1K3O A;  4D73 A;  3ZL5 A;  2VM2 A;  5KN2 A;  5COH A;  4DSR A;  1RQM A;  1U6T A;  3ZVJ A;  4LA1 A;  4N10 A;  4KAE A;  1K0M A;  4KW6 A;  18GS A;  4IS0 A;  1NSW A;  4NAX A;  4K0N A;  3C1R A;  2LRT A;  4NXI A;  1HNA A;  3CSH A;  1Y6E A;  2DIY A;  3PGT A;  3TKP A;  2F51 A;  3ZIV A;  1OAZ A;  2I1U A;  1K0N A;  1R4W A;  1W4V A;  5EVO A;  3PIN A;  4DVC A;  2JL4 A;  2L57 A;  3ERG A;  3FHK A;  1UN2 A;  5CRH A;  1T00 A;  4EL1 A;  1BG5 A;  1KBN A;  5E4W A;  4MJB A;  4I6X A;  1EV4 A;  2H1A A;  3EMP A;  4MF6 A;  3US3 A;  5AN1 A;  4ZIL A;  3ZLP A;  2C3Q A;  3LYK A;  3D6I A;  3Q19 A;  1XOA A;  4YQU A;  6GSU A;  5B6N A;  2YP6 A;  1ZCP A;  3UBL A;  5JCW A;  1WPI A;  4XHM A;  3WD6 A;  4MCU A;  3HJM A;  2PVO C;  5EY6 A;  4GSS A;  5KN0 A;  1GTI A;  1QQ2 A;  5FHI A;  1ERW A;  3AY8 A;  3TKS C;  3TKS A;  5CP1 A;  3ZYW A;  4Z7X A;  1A2L A;  3L4N A;  2H01 A;  5A4V A;  5GSS A;  2B7K A;  2E7P A;  4WF4 A;  4O32 A;  4MMM A;  3ZIT A;  2RII A;  4J56 E;  2KP2 A;  1YKC A;  2H72 A;  3LYP A;  1GTU A;  3KIJ A;  3VK9 A;  1USB A;  3ZRE A;  4EVM A;  4JBB A;  2HNL A;  3NZN A;  1AAZ A;  7GSS A;  3N5O A;  4GQF A;  3QMX A;  1TOF A;  1SL0 B;  1TI3 A;  4YAV A;  2DJK A;  1FB0 A;  1LU4 A;  5AGY A;  2H6Z A;  1TRV A;  4KA0 A;  5DVB A;  3E0U A;  2LNT A;  4HI7 A;  2LUS A;  4K0G A;  4L0W A;  3ZFB A;  4Q5R A;  1OE7 A;  1A0F A;  1FO5 A;  4AJ7 A;  3F9U A;  1WRY A;  2H1B A;  3M8N A;  3A2V A;  4YQV A;  2REM A;  3GN3 A;  3IBH A;  1C72 A;  1X5C A;  3FYG A;  5A4U A;  3QCP A;  1TRS A;  1LJR A;  5D8I A;  4PGT A;  2RUE A;  1S3C A;  3TCO A;  4PNG A;  1Z7P A;  3IXR A;  3TOU A;  2HXK A;  5CRW A;  1V58 A;  2J23 A;  1N8J A;  4JE1 A;  1WWJ A;  1PKZ A;  1K3Y A;  3GST A;  2BMX A;  3BOA A;  3IC4 A;  2IMK A;  4G10 A;  5ID2 B;  1ABA A;  3M0F A;  5HFI A;  2H30 A;  4MH3 A;  1Z6N A;  1SK1 A;  1GSE A;  3WGX A;  1SYX A;  2G0F A;  4XS1 A;  5IMA A;  3TUE A;  1SEN A;  2CVB A;  3TB2 A;  3EU4 A;  5KN3 A;  3F6F A;  1NW2 A;  5B8A A;  1G6W A;  1J0F A;  1XWG A;  1GTA A;  3TJK A;  2KHP A;  5JWR B;  2B5X A;  3ZML A;  3UVH A;  2H71 A;  1YF1 A;  2C8U A;  4GRF A;  3RPN A;  2V2G A;  5D96 A;  4AF2 A;  3VFI A;  1EEM A;  1R5P A;  2KUC A;  1TXX A;  2NVL A;  5GST A;  3D21 A;  3EMX A;  1BYE A;  1WJK A;  1Z6M A;  2WUL A;  1MD4 A;  1TU7 A;  4K6X A;  6GSS A;  1XWC A;  2GST A;  1GNW A;  2BTO T;  2CV4 A;  3C8E A;  2O87 A;  2FCH A;  4FH8 A;  4JR4 A;  3M9J A;  3MWH A;  2R3X A;  2J9H A;  2L5O A;  2G2Q A;  1GSD A;  2OE3 A;  3CBU A;  4GSN A;  4TW5 A;  2R6K A;  2DLX A;  3LGC A;  5LD0 A;  3GA4 A;  1F9M A;  3L9V A;  2M80 A;  2HYX A;  1OE8 A;  4K7I A;  2JZT A;  4TKY A;  5G2Z A;  5G1K A;  5ECM B;  5D9X A;  2ES7 A;  4JZQ A;  1SKS B;  1G7E A;  1AQX A;  2X8G A;  4IN0 A;  2DJ3 A;  4OD7 A;  1X0R A;  4YH2 A;  4V1A p;  1G7O A;  4L5O A;  3C73 A;  2O7K A;  2OE0 A;  2VL2 A;  2PER A;  4ECJ A;  5D9W A;  2JAC A;  4O5R A;  1XCC A;  4DEJ A;  2BJX A;  3HA9 A;  2GT6 A;  3J7Y b;  1VF3 A;  2A4V A;  3RPP A;  5HR3 A;  2HT9 A;  4GF0 A;  1EWX A;  2H66 A;  5IO2 A;  4OFN A;  3WYW A;  3CMI A;  2H75 A;  5ECS A;  1JZO A;  2RLI A;  4HS1 A;  1HNC A;  4TXV A;  3ZZX A;  2ZNM A;  4E8E A;  2RM6 A;  4L5L A;  4D73 B;  3HYP A;  4BVX A;  4PUF C;  2DSA A;  1FW1 A;  2V6K A;  5B8B A;  1NHY A;  2CVD A;  1AIU A;  3H8Q A;  3GYK A;  1JZR A;  3LFL A;  1I5G A;  3VPT A;  4PXO A;  3D0Z A;  2ON7 A;  2CX4 A;  2VD0 A;  4IP6 A;  4KND A;  2NDO A;  4TR0 A;  2V32 A;  1TRU A;  1WMJ A;  4F0B A;  4FYC A;  2XPE A;  1ERU A;  2HZF A;  5D9T A;  1ERT A;  3UAR A;  3MDK A;  4MZW A;  4IQA A;  1GLP A;  3GTU A;  3GMF A;  4WEY A;  1X5D A;  1GSF A;  1VRS D;  3HCZ A;  1EZK A;  4KSO A;  5AIX A;  5CNW A;  3Q6O A;  3E3E A;  4O7H A;  3GH6 A;  4MK3 A;  2VCQ A;  5C00 A;  4EC0 A;  3KZQ A;  1XWB A;  5F06 A;  3S9F A;  1M2A A;  3FR9 A;  2WZ9 A;  2YV7 A;  1TU8 A;  3GIX A;  3V1W A;  1QUW A;  3QDN A;  3GFK A;  3IV4 A;  3SBC A;  2X99 A;  4WF5 A;  2D2Z A;  3F6D A;  6GSY A;  1A2M A;  5CRD A;  1XZO A;  2DJ0 A;  4ML1 A;  2FLS A;  5DCH A;  1OYJ A;  1EOH A;  4ISD A;  2AB6 A;  4ZBA A;  4ZL9 A;  5B7C A;  3P90 A;  1OC8 A;  5J9B A;  1YY7 A;  5G5F A;  2WDU A;  1HD2 A;  2JAD A;  4PQ1 A;  1MEK A;  4EDY A;  1PMT A;  4AGS A;  1VGL A;  2CQ9 A;  4KUN A;  4GLT A;  4TVE A;  2DC5 A;  2KP1 A;  5DBQ A;  2N5B A;  3JCM L;  3HVV A;  3TJB A;  4RQX A;  2F9S A;  4KGI A;  2LJK A;  1JZW A;  5CYY A;  1O8X A;  1THX A;  4NV5 A;  1LBK A;  2DML A;  5IM9 A;  5C04 A;  2VUP A;  2GSR A;  4QL7 A;  4N11 A;  4JU5 A;  4OO4 A;  4MA9 A;  3WGD A;  1WOU A;  2QSI A;  5DQS A;  4POL A;  4ULX A;  5ECL B;  5ABR A;  3ME7 A;  3GL3 A;  4TN8 A;  5ECO B;  2XPD A;  2L5L A;  4HU7 A;  3CYN A;  5IIZ A;  2H6X A;  4JR6 A;  3L9S A;  1I9D A;  4TXO A;  5CAX A;  3VUR A;  1YKA A;  3LSZ A;  5IOX A;  4ZBD A;  5HR0 A;  1DUG A;  4AJ6 A;  2A2S A;  4EUY A;  1TJD A;  1GP1 A;  2YAN A;  1F6M C;  1ZGN A;  1ZZY A;  2MMZ A;  3KXO A;  1FOV A;  1PD2 1;  1IYH A;  3UIW A;  4MJA A;  3IR4 A;  2H70 A;  1PX6 A;  2VO4 A;  3QAG A;  1SJ6 A;  4Q5F A;  4GCI A;  3GKN A;  3H79 A;  3QPM A;  3CTG A;  2B1K A;  4IP1 A;  3L78 A;  2F8F A;  2HLS A;  4HQS A;  1OVN A;  3LJR A;  3K8N A;  5KN1 A;  2YWI A;  3GKM A;  1HYU A;  1XIY A;  3FRC A;  4ZB9 A;  1Q4J A;  2IN3 A;  2VM1 A;  4PQH A;  1ERV A;  2VIM A;  1TRW A;  3IAS 2;  4NV2 A;  1ZYE A;  3VLN A;  5DJL A;  4NMU A;  4OWY A;  4ZL7 A;  2YN1 A;  1S3A A;  2IMD A;  4TRX A;  5F0G A;  2VLV A;  2B6M A;  4YQM A;  3ZMK A;  2IPA A;  5ECR B;  1PRX A;  1A2J A;  3WGE A;  4L8E A;  1GUH A;  2LRN A;  3CSJ A;  2E2M A;  4J2F A;  5IMV A;  2H74 A;  3P7X A;  3IOS A;  1XFL A;  2VL9 A;  1SD8 A;  2GZZ A;  1BED A;  1WP0 A;  3KMO A;  2E0Q A;  4KB3 A;  4BPY A;  2WGR A;  1XWA A;  3KJY A;  2DJ2 A;  2XBI A;  3E9J B;  2VL3 A;  4ECC A;  3CRT A;  1T4Y A;  5DJM A;  4FYB A;  1T3B A;  2HSY A;  2CX3 A;  1ZMA A;  2E2G A;  2EIO A;  1O7U A;  1OKT A;  2QC7 A;  1KTE A;  3O76 A;  2P31 A;  2QKE A;  1U87 A;  1M9A A;  4MAB A;  4PX1 A;  3GV1 A;  1KNG A;  3BCK A;  4GWR A;  2MMA A;  3BCI A;  3GH9 A;  2X8H A;  4OFT A;  3H1N A;  3FZ5 A;  1XVW A;  1FHE A;  1GSY A;  1GTB A;  3H93 A;  4ID0 A;  2GGT A;  2H73 A;  2RUF A;  1VF2 A;  5FWG A;  2O85 A;  1Z7R A;  5IMF A;  3UMA A;  3RHB A;  1PN9 A;  1PX7 A;  4X0X A;  5AIS A;  2X64 A;  1YDK A;  3UEM A;  4BVY A;  4EXJ A;  1V2A A;  1NM3 A;  2VAF A;  4WR4 A;  4ZL8 A;  3KTB A;  1FVJ A;  4ECB A;  5IMC A;  1H75 A;  3TRP A;  3H4K A;  3U6V A;  1JZD A;  3HJP A;  1XWK A;  3F4R A;  3A2X A;  1SK0 A;  3I9V 2;  4BWS A;  4LL4 B;  2N5F A;  2DIZ A;  2FUG 2;  3TGZ A;  1F3B A;  1M9B A;  3FZA A;  1G0T A;  4IKH A;  4HUA A;  3GUS A;  2MMO A;  1Z5Y E;  3ISO A;  1K0O A;  3GTU B;  2VCW A;  5A4W A;  5D73 A;  3G7Y A;  3HKR A;  5DAL A;  1A8Y A;  3HXS A;  4BWQ A;  2FWG A;  2IFQ A;  2YCD A;  4K9Z A;  1GLQ A;  2AYT A;  1GSQ A;  1AQW A;  4AJ8 A;  4JED A;  1YEX A;  4Q5N A;  6GSX A;  3HDC A;  1UVZ A;  3TKS E;  2PPT A;  3MNG A;  4NHW A;  1MDJ A;  4TOP A;  2R2J A;  2VCZ A;  5IO0 A;  4HJ2 A;  1BX9 A;  20GS A;  3O6T A;  3OR5 A;  2V6O A;  3KMN A;  1YJ6 A;  2H19 A;  1SD9 A;  2IME A;  2I81 A;  3IE3 A;  1XPV A;  2K9F A;  9GSS A;  1URM A;  2C1Y A;  1TTZ A;  1AUC A;  4CHS A;  1J08 A;  2FA4 A;  4X43 A;  4LL1 B;  3EIN A;  3QD9 A;  5DDL A;  4RQR A;  5IOW A;  1ZL9 A;  3TKQ A;  4CDO A;  1AC1 A;  4N0Z A;  5ECH B;  4BL7 A;  1TDI A;  3FW2 A;  2LJA A;  1PL1 A;  3IAM 2;  4LMV A;  3KCM A;  3LWA A;  3WT2 A;  1ILO A;  1SL2 B;  4H86 A; 
#chains in the Genus database with same CATH topology
 1K0D A;  1SU9 A;  1EP7 A;  3DWV A;  2WRT A;  1M7T A;  5CO3 A;  2IIY A;  1B48 A;  3GKX A;  4N30 A;  2L4Q A;  2PBJ A;  4HZ2 A;  3ME8 A;  5G5E A;  1EV9 A;  2PN8 A;  1Y25 A;  1RW1 A;  3GUR A;  1M0U A;  5EPF A;  4IJ3 A;  2LJR A;  3TJJ A;  5JCU A;  2TRX A;  1AW9 A;  4GQC A;  2B3S A;  4XRD A;  3KD0 A;  1XG8 A;  2AJQ B;  4CY6 A;  3W6G A;  2VCX A;  4PQI A;  3TJG A;  4TR1 B;  3G9B A;  4HU9 A;  2LQQ A;  2OA7 A;  4X1U A;  2OBK A;  4F9Z A;  3VI5 A;  1DE1 A;  4MF5 A;  4G9H A;  4WKW A;  3IHQ A;  3ZIJ A;  3LOR A;  5JWQ B;  3ERF A;  1S3D A;  1FB6 A;  4KDU A;  4JRR A;  3QR6 A;  8GSS A;  1A24 A;  3M9K A;  1Z9H A;  2CZ2 A;  2MBT A;  1XOB A;  1TK0 B;  3KH9 A;  4TXO B;  1T4Z A;  2R5G A;  1O85 A;  3Q74 A;  2IL3 A;  2XBQ A;  3TOT A;  5G30 A;  2XC2 A;  3LQ7 A;  2FD3 A;  2FA8 A;  1TK8 B;  1SJZ A;  5F8B A;  4KDX A;  3IK7 A;  2GQM A;  5ENU A;  1CQG A;  5LNK e;  5GZZ B;  1Z3E A;  4G0K A;  3IRA A;  3HHV A;  4Z2U A;  1T8E B;  4WBR D;  5ECP B;  2R4V A;  2P5R A;  1PKW A;  4E8H A;  2YNX A;  5D93 A;  3J7Y k;  1U3A A;  3QFB C;  2H0I A;  5JWO B;  1THO A;  1V9W A;  2I9H A;  4V2L A;  1EP8 A;  4EE0 A;  1TKD B;  2HI7 A;  2NBS A;  4RUV A;  3ZTL A;  2P0G A;  1PA3 A;  2JSZ A;  2VCT A;  2FY6 A;  5J4U A;  3SWL A;  2O8V B;  3GKK A;  1QGV A;  5INY A;  5H5R A;  2Z9S A;  2VLT A;  3UOM A;  5CRG A;  2YZH A;  2GSS A;  1GUK A;  4P3Y B;  3NOF A;  4POM A;  4MDC A;  2YZU A;  2GZY A;  3L9U A;  4RI7 A;  2GSQ A;  4ILF A;  4KSM A;  4LMW A;  1GUL A;  3BBY A;  4XCS A;  2IJY A;  1NHO A;  3HZ8 A;  3U5R E;  3F63 A;  5EL8 A;  2OKA A;  2ZUP A;  1GL8 A;  3UBK A;  4POB A;  2VD1 A;  4HZ4 A;  5J3R A;  3A2W A;  5G1L A;  1OC9 A;  2CT6 A;  1JLW A;  3FY7 A;  4ZB8 A;  4ACS A;  2HRF A;  2QA1 A;  1T1V A;  3TRX A;  2GTU A;  1RK4 A;  1GUM A;  4FO5 A;  2X8C A;  1WE0 A;  1K0C A;  2B7J A;  4OMV A;  1EGO A;  1K0B A;  2IMF A;  4OCE A;  1UC7 A;  3EWL A;  4F82 A;  4XS6 A;  4EIP A;  4IJI A;  3VWV A;  4NPB A;  1V57 A;  3UJ1 A;  4I97 A;  1O8W A;  4O5Q A;  5J41 A;  1W89 A;  6GST A;  4TR1 A;  4IGJ A;  2QGV A;  3F4S A;  5B6M A;  4POK A;  4NWY A;  3DVX A;  4I2U A;  2O89 A;  5G31 A;  4CW9 A;  1DE2 A;  2YWN A;  4XIH A;  3G7J A;  1BJX A;  2YOI A;  3HVX A;  3LEF A;  2X4A A;  2JU5 A;  2YJH A;  1EGR A;  1KEB A;  1AXD A;  2KLX A;  4PUR A;  3VWW A;  4GTU A;  1K3L A;  1PL2 A;  3FEU A;  2C0E A;  4I5Q A;  1F2E A;  3HY2 A;  3ZVJ D;  3TJF A;  4BVY B;  1XVQ A;  5JCG A;  2FWE A;  3ZFL A;  4K2D A;  2YPM A;  4L0U A;  5F05 A;  17GS A;  4G2E A;  3DYR A;  1FVK A;  2FWF A;  3DRN A;  4IVF A;  3C1S A;  1XW5 A;  1M2B A;  2C80 A;  5H5S A;  2M72 A;  4MP4 A;  2LQO A;  1SL1 B;  2KOK A;  3DGQ A;  2H1D A;  1M2D A;  1U3I A;  2H1G A;  2AV4 A;  1MTC A;  3EU3 A;  1H4O A;  2PWJ A;  4WBJ A;  2VLU A;  2K6V A;  2A2P A;  2R0C A;  1B8X A;  2FNO A;  3UAP A;  1QFN A;  3FZ9 A;  3Q18 A;  4OO5 A;  3VI7 A;  10GS A;  5DAL B;  2HRN A;  2R37 A;  2PU9 C;  5J9C A;  3RBT A;  2IFQ B;  1B4Q A;  4OCF A;  2OJL A;  3GSS A;  2CVK A;  4Z2T A;  2MMN A;  4ZIJ A;  1DBY A;  3GHA A;  3I6A A;  4OFM A;  3GL5 A;  2GQL A;  4HOJ A;  3D4M A;  2L6C A;  3FKF A;  5DAK A;  1QK8 A;  4XRA A;  2B5E A;  1MD3 A;  3TKR A;  3MSZ A;  2C3N A;  3HZ4 A;  5ECN B;  4WET A;  1PGT A;  2OE1 A;  2DMM A;  4XS4 A;  3R3E A;  2FHE A;  2ALB A;  1F37 A;  2VCV A;  2OAD A;  1QXH A;  3IK9 A;  4MF7 A;  1EOG A;  2GT5 A;  5IMZ A;  2GVP A;  2N5A A;  4ZXG A;  4PNF A;  1DSB A;  4KCE A;  4HDE A;  3APO A;  3ZRD A;  3RDW A;  3ED3 A;  1ML6 A;  1K0A A;  2H0G A;  4MJC A;  3W8S A;  2MYG A;  3VWU A;  2A2R A;  5HR1 A;  4QL9 A;  3KP9 A;  5ELG A;  3KP8 A;  2OAC A;  4TR3 A;  1Q98 A;  1ST9 A;  4DSS A;  1VF4 A;  2L4C A;  1UA5 A;  4K7O A;  4ML6 A;  2B5Y A;  3CSI A;  2WB9 A;  1A8L A;  4V2M A;  1YF0 A;  4KDY A;  2HZE A;  3APS A;  4TR4 A;  5IPH A;  5FT3 A;  3DML A;  3BD2 A;  1ON4 A;  4KH7 A;  5KEJ A;  2GLR A;  2HE3 A;  3EVI A;  1XW9 A;  3TDG A;  2DJJ A;  1XXU A;  3TRQ A;  4O5U A;  2H76 A;  2LEG A;  5HQP A;  2V41 A;  3LG6 A;  1O6J A;  2HSH A;  4F2I A;  4GST A;  1VF1 A;  2L6D A;  2ON5 A;  1X9W B;  16GS A;  2AAW A;  4N0V A;  3M3M A;  2XHF A;  1M3I A;  3FR3 A;  4K2X A;  1EEJ A;  5ECI B;  2C0F A;  2JSY A;  3IDV A;  3EYT A;  1ACV A;  2L59 A;  2C0G A;  3WT1 A;  1FAA A;  1SKW B;  4IW9 A;  4DSQ A;  2GS3 A;  4I8B A;  3GNJ A;  3CQF A;  3F8U A;  3VWX A;  3DIE A;  4HJM A;  2H8L A;  2YV9 A;  4HQZ A;  14GS A;  3D5J A;  2CZ3 A;  1OC3 A;  3IPZ A;  1TK5 B;  4V2N A;  1B9X C;  1YZX A;  4WXT A;  4XTS A;  3KTL A;  4MPG A;  5HR2 A;  3C71 A;  1E6B A;  1PSQ A;  2LS5 A;  5DQY A;  1MDK A;  1G6Y A;  2JZS A;  5HFG A;  4IEL A;  2NPB A;  2AHE A;  1AQV A;  1PQN A;  3MIX A;  4KX4 A;  3FK8 A;  3A3T A;  3DVW A;  3F0I A;  1O73 A;  2CA8 A;  2AUV A;  5GAN D;  1T7P B;  4EF0 A;  4QQ7 A;  3UL3 A;  2WCI A;  1E2Y A;  2MBS A;  2WJU A;  5LCZ A;  4ZBB A;  4ECI A;  3RAZ A;  5H5Q A;  2GQK A;  5J5N A;  1GSS A;  2CAI A;  3QAV A;  2HFD A;  4LLR A;  2NTO A;  2WS2 A;  2ZCT A;  3LXT A;  3BJ5 A;  2LTK A;  1OC9 B;  3PH9 A;  2I4A A;  3HJO A;  4EKZ A;  4MH2 A;  2F3M A;  3KEB A;  5IQY A;  1B4P A;  3A5W A;  1YEP A;  3KM6 A;  4K1F A;  4K8M A;  4WR5 A;  5GAP D;  1OKD A;  4MPF A;  1TI1 A;  2M46 A;  5L71 A;  3APQ A;  1GRX A;  2H0H A;  4IBP A;  1TW9 A;  3HD5 A;  2VL2 C;  1SJI A;  3I43 A;  1GH2 A;  5IPG A;  1BAY A;  3F4T A;  5HFK A;  3DEX A;  2LRC A;  1V40 A;  1JLV A;  4HEA 2;  5F07 A;  13GS A;  2PVQ A;  2OBI A;  3QFA C;  6GSW A;  12GS A;  4F0C A;  1JHB A;  1B9Y C;  4J57 E;  3I69 A;  2LNS A;  2VOC A;  4KF9 A;  2GDR A;  3DKS A;  22GS A;  5E59 A;  5DCG A;  1ZYQ B;  2PUK C;  1FG4 A;  5ID2 A;  4V1A g;  1GSU A;  3D4T A;  2PGT A;  4BA7 A;  4MZB A;  5ECK B;  3DD3 A;  4KE3 A;  2PMT A;  3GRX A;  1IYI A;  1O81 A;  1X9S B;  6GSV A;  2CAQ A;  3CXG A;  1GNE A;  4EDZ A;  3QAW A;  1XBS A;  3L0H A;  4MZC A;  4YAP A;  5IMD A;  1YQ1 A;  3HVS A;  4MLY A;  1SKR B;  4MJE A;  2P5Q A;  3C7M A;  3EUR A;  3M1G A;  2K8S A;  2B1L A;  2C3T A;  2IMI A;  3KH7 A;  4IQ1 A;  2H6Y A;  3P2A A;  3P8W A;  4IHU A;  19GS A;  1R5A A;  4GXZ A;  4A5P A;  4USS A;  1BQ7 A;  1F3A A;  5ELA A;  1QMV A;  3F3Q A;  5CRE A;  2JZR A;  3LXZ A;  1TP9 A;  3EE2 A;  2EIQ A;  3CRU A;  1ZOF A;  1R26 A;  2MZC A;  3EC3 A;  1HQO A;  2RM5 A;  3UVT A;  1MDI A;  5DAK B;  2F8A A;  1J9B A;  2YWM A;  3QOU A;  2C0D A;  2FGX A;  1X5E A;  3IA1 A;  4EO3 A;  4K7N A;  5A5K A;  1ZYP A;  1GWC A;  4XS4 B;  3PR8 A;  4KCA A;  1CQH A;  3FR6 A;  5AIV A;  2TRC P;  5D9V A;  1X9M B;  4F03 A;  1R7H A;  3KGK A;  1U88 A;  2LST A;  4Q5Q A;  3G7I A;  2I3Y A;  1WIK A;  2DJ1 A;  2FWH A;  1A23 A;  2V1M A;  2LKU A;  3F3R A;  2GZP A;  5ECQ B;  3FZ4 A;  4FYU A;  2LV3 A;  4PUA A;  3W8J A;  3GX8 A;  2YJ7 A;  2EIR A;  3GX0 A;  11GS A;  3ERW A;  4Z2R A;  2C4J A;  4NHZ A;  1SK2 A;  2IWT A;  3D22 A;  3R2Q A;  4DSS B;  2DBC A;  1XW6 A;  3N9J A;  2K8V A;  4I2T A;  3RHC A;  2WFC A;  4O92 A;  2YWO A;  4K5S A;  3MYD A;  2HZE B;  4G19 A;  2EC4 A;  1V98 A;  3VPQ A;  3PPU A;  2K18 A;  3O3T A;  1A0R P;  1N2A A;  1JFU A;  3CTF A;  3NIV A;  4RI6 A;  1SYR A;  4MNN A;  1HNB A;  4ZB6 A;  1M99 A;  2TIR A;  3DXB A;  3MAK A;  4FIW A;  1K3O A;  4D73 A;  3ZL5 A;  2VM2 A;  5KN2 A;  5COH A;  4DSR A;  1RQM A;  1U6T A;  3ZVJ A;  4LA1 A;  4N10 A;  4KAE A;  1K0M A;  4KW6 A;  18GS A;  4IS0 A;  1NSW A;  4NAX A;  4K0N A;  3C1R A;  2LRT A;  4NXI A;  1HNA A;  3CSH A;  1Y6E A;  2DIY A;  3PGT A;  3TKP A;  2F51 A;  3ZIV A;  1OAZ A;  2I1U A;  1K0N A;  1R4W A;  1W4V A;  5EVO A;  3PIN A;  4DVC A;  2JL4 A;  2L57 A;  3ERG A;  3FHK A;  1UN2 A;  5CRH A;  1T00 A;  4EL1 A;  1BG5 A;  1KBN A;  3IC8 A;  5E4W A;  4MJB A;  4I6X A;  1EV4 A;  2H1A A;  3EMP A;  4MF6 A;  3US3 A;  5AN1 A;  4ZIL A;  3ZLP A;  2C3Q A;  3LYK A;  3D6I A;  3Q19 A;  1XOA A;  4YQU A;  6GSU A;  2R0G A;  5B6N A;  2YP6 A;  1ZCP A;  3UBL A;  5JCW A;  1WPI A;  4XHM A;  3WD6 A;  4MCU A;  3HJM A;  2PVO C;  5EY6 A;  4GSS A;  5KN0 A;  1GTI A;  1QQ2 A;  5FHI A;  1ERW A;  3AY8 A;  3TKS C;  3TKS A;  5CP1 A;  3ZYW A;  4Z7X A;  1A2L A;  3L4N A;  2H01 A;  5A4V A;  5GSS A;  2B7K A;  2E7P A;  4WF4 A;  4O32 A;  4MMM A;  3ZIT A;  2RII A;  4J56 E;  2KP2 A;  1YKC A;  2H72 A;  3LYP A;  1GTU A;  3KIJ A;  4HSC X;  3VK9 A;  1USB A;  3ZRE A;  4EVM A;  4JBB A;  2HNL A;  3NZN A;  1AAZ A;  7GSS A;  3N5O A;  3HVN A;  4GQF A;  3QMX A;  1TOF A;  1SL0 B;  1TI3 A;  4YAV A;  2DJK A;  1FB0 A;  1LU4 A;  5AGY A;  2H6Z A;  1TRV A;  4KA0 A;  5DVB A;  3E0U A;  2LNT A;  4HI7 A;  2LUS A;  4K0G A;  4L0W A;  3ZFB A;  4Q5R A;  1OE7 A;  1A0F A;  1FO5 A;  4AJ7 A;  3F9U A;  1WRY A;  2H1B A;  3M8N A;  3A2V A;  4YQV A;  2REM A;  3GN3 A;  3IBH A;  1C72 A;  1X5C A;  3FYG A;  5A4U A;  3QCP A;  1TRS A;  1LJR A;  5D8I A;  4PGT A;  2RUE A;  1S3C A;  3TCO A;  4PNG A;  1Z7P A;  3IXR A;  3TOU A;  5BMU A;  2HXK A;  5CRW A;  1V58 A;  2J23 A;  1N8J A;  4JE1 A;  1WWJ A;  1PKZ A;  1K3Y A;  3GST A;  2BMX A;  3BOA A;  3IC4 A;  2IMK A;  4G10 A;  5ID2 B;  1ABA A;  3M0F A;  5HFI A;  2H30 A;  4MH3 A;  1Z6N A;  1SK1 A;  1GSE A;  3WGX A;  1SYX A;  2G0F A;  4XS1 A;  5IMA A;  3TUE A;  5BRT A;  1SEN A;  2CVB A;  3TB2 A;  3EU4 A;  5KN3 A;  3F6F A;  1NW2 A;  5B8A A;  1G6W A;  1J0F A;  1XWG A;  1GTA A;  3TJK A;  2KHP A;  5JWR B;  2B5X A;  3ZML A;  3UVH A;  2H71 A;  4X4J A;  1YF1 A;  4YKG A;  2C8U A;  4GRF A;  3RPN A;  2V2G A;  5D96 A;  4AF2 A;  3VFI A;  1EEM A;  1R5P A;  1FOH A;  2KUC A;  1TXX A;  2NVL A;  5GST A;  3D21 A;  3EMX A;  4YKF A;  1BYE A;  1WJK A;  1Z6M A;  2WUL A;  1MD4 A;  1TU7 A;  4K6X A;  6GSS A;  1XWC A;  2GST A;  1GNW A;  2BTO T;  2CV4 A;  3C8E A;  2O87 A;  2FCH A;  4FH8 A;  4JR4 A;  3M9J A;  3FMW A;  2R3X A;  3MWH A;  2J9H A;  2L5O A;  2G2Q A;  1GSD A;  2OE3 A;  3CBU A;  4GSN A;  4TW5 A;  2R6K A;  2DLX A;  3LGC A;  5LD0 A;  3GA4 A;  1F9M A;  3L9V A;  2M80 A;  2HYX A;  1OE8 A;  4K7I A;  2JZT A;  4TKY A;  5G2Z A;  5G1K A;  2DKI A;  5ECM B;  5D9X A;  4G0L A;  2ES7 A;  4JZQ A;  1SKS B;  1G7E A;  1AQX A;  2X8G A;  4IN0 A;  2DJ3 A;  4OD7 A;  1X0R A;  4YH2 A;  4V1A p;  1G7O A;  4L5O A;  4FQU A;  3C73 A;  2O7K A;  2OE0 A;  2VL2 A;  2PER A;  4ECJ A;  5KOW A;  5D9W A;  2JAC A;  4O5R A;  1XCC A;  4DEJ A;  2BJX A;  3HA9 A;  2GT6 A;  3J7Y b;  1VF3 A;  2A4V A;  3RPP A;  5HR3 A;  2HT9 A;  4GF0 A;  1EWX A;  2H66 A;  5IO2 A;  4OFN A;  4BIK A;  3WYW A;  3CMI A;  2H75 A;  5ECS A;  1JZO A;  2RLI A;  4HS1 A;  1HNC A;  4TXV A;  3ZZX A;  2ZNM A;  4E8E A;  2RM6 A;  4L5L A;  4D73 B;  3HYP A;  4BVX A;  4PUF C;  2DSA A;  1FW1 A;  2V6K A;  5B8B A;  1NHY A;  2CVD A;  1AIU A;  3H8Q A;  3GYK A;  1JZR A;  3EPT A;  3LFL A;  1I5G A;  3VPT A;  4PXO A;  3D0Z A;  2ON7 A;  2CX4 A;  2VD0 A;  4IP6 A;  4KND A;  2NDO A;  4TR0 A;  2V32 A;  1TRU A;  1WMJ A;  4F0B A;  2DKH A;  4FYC A;  2XPE A;  1ERU A;  2HZF A;  5D9T A;  1ERT A;  3UAR A;  3MDK A;  4MZW A;  4IQA A;  1GLP A;  3GTU A;  3GMF A;  4WEY A;  2HRA A;  1X5D A;  1GSF A;  1VRS D;  3HCZ A;  1EZK A;  4KSO A;  5AIX A;  5CNW A;  3Q6O A;  3E3E A;  4O7H A;  3GH6 A;  4MK3 A;  2VCQ A;  5C00 A;  4EC0 A;  3KZQ A;  1XWB A;  5F06 A;  3S9F A;  1M2A A;  3FR9 A;  2WZ9 A;  2YV7 A;  1TU8 A;  3GIX A;  3V1W A;  1QUW A;  3QDN A;  3GFK A;  3IV4 A;  3SBC A;  2X99 A;  4WF5 A;  2D2Z A;  3F6D A;  6GSY A;  1A2M A;  5CRD A;  1XZO A;  2DJ0 A;  4ML1 A;  2FLS A;  5DCH A;  1OYJ A;  1EOH A;  4ISD A;  2AB6 A;  4ZBA A;  4ZL9 A;  2HRK A;  5B7C A;  3P90 A;  1OC8 A;  5J9B A;  1YY7 A;  5G5F A;  2WDU A;  1HD2 A;  2JAD A;  4PQ1 A;  1MEK A;  2R0P A;  4EDY A;  1PMT A;  2HSM A;  4AGS A;  1VGL A;  2CQ9 A;  4KUN A;  4GLT A;  4TVE A;  1M3J A;  2DC5 A;  2KP1 A;  5DBQ A;  2N5B A;  3JCM L;  3HVV A;  3TJB A;  4RQX A;  2F9S A;  4KGI A;  2LJK A;  1JZW A;  5CYY A;  1O8X A;  1THX A;  4NV5 A;  1LBK A;  2DML A;  5IM9 A;  5C04 A;  4EIQ A;  2VUP A;  2GSR A;  3A5I A;  4QL7 A;  4N11 A;  4JU5 A;  4OO4 A;  4MA9 A;  3WGD A;  1WOU A;  2QSI A;  5DQS A;  4POL A;  4ULX A;  5ECL B;  5ABR A;  3ME7 A;  3GL3 A;  4TN8 A;  1PFO A;  5ECO B;  2XPD A;  2L5L A;  4HU7 A;  3CYN A;  5IIZ A;  2H6X A;  4JR6 A;  3L9S A;  1I9D A;  4TXO A;  5CAX A;  3VUR A;  1YKA A;  3LSZ A;  5IOX A;  4ZBD A;  5HR0 A;  1DUG A;  4AJ6 A;  2A2S A;  4EUY A;  1TJD A;  1GP1 A;  2YAN A;  1F6M C;  1ZGN A;  1ZZY A;  2MMZ A;  3KXO A;  1FOV A;  1PD2 1;  1IYH A;  3UIW A;  4MJA A;  3IR4 A;  2H70 A;  1PX6 A;  2VO4 A;  3QAG A;  1SJ6 A;  4Q5F A;  4GCI A;  3GKN A;  3H79 A;  3QPM A;  2QA2 A;  3CTG A;  2B1K A;  4IP1 A;  3L78 A;  2F8F A;  2HLS A;  4HQS A;  1OVN A;  3LJR A;  3K8N A;  5KN1 A;  4PTS A;  2YWI A;  3GKM A;  1HYU A;  1XIY A;  3FRC A;  4ZB9 A;  1Q4J A;  2IN3 A;  2VM1 A;  4PQH A;  4G0I A;  1ERV A;  2VIM A;  1TRW A;  3IAS 2;  4NV2 A;  1ZYE A;  3VLN A;  5DJL A;  4NMU A;  4OWY A;  4ZL7 A;  2YN1 A;  1S3A A;  2IMD A;  4TRX A;  5F0G A;  2VLV A;  2B6M A;  4YQM A;  3ZMK A;  2IPA A;  5ECR B;  1PRX A;  1A2J A;  3WGE A;  3IHG A;  4L8E A;  1GUH A;  2LRN A;  3CSJ A;  2E2M A;  4J2F A;  5IMV A;  2H74 A;  3P7X A;  3IOS A;  1XFL A;  2VL9 A;  1SD8 A;  2GZZ A;  1BED A;  1WP0 A;  3KMO A;  2E0Q A;  4KB3 A;  4BPY A;  2WGR A;  1XWA A;  3KJY A;  2DJ2 A;  2XBI A;  3E9J B;  2VL3 A;  4BL7 B;  3CRT A;  4ECC A;  1T4Y A;  5DJM A;  4FYB A;  1T3B A;  2HSY A;  2CX3 A;  1ZMA A;  2E2G A;  2EIO A;  1O7U A;  1OKT A;  2QC7 A;  1KTE A;  2UZ8 A;  1PN0 A;  2X49 A;  3O76 A;  2P31 A;  2QKE A;  1U87 A;  1M9A A;  4MAB A;  4PX1 A;  3GV1 A;  1KNG A;  3BCK A;  4GWR A;  2MMA A;  3BCI A;  3GH9 A;  2X8H A;  4OFT A;  3H1N A;  3FZ5 A;  1XVW A;  1FHE A;  1GSY A;  1GTB A;  3H93 A;  4ID0 A;  2GGT A;  2H73 A;  2RUF A;  1VF2 A;  5FWG A;  2O85 A;  1Z7R A;  1S3R A;  5IMF A;  3UMA A;  3RHB A;  3LW9 A;  1PN9 A;  1PX7 A;  4X0X A;  5AIS A;  2X64 A;  1YDK A;  3UEM A;  2A4H A;  4BVY A;  4EXJ A;  1V2A A;  1NM3 A;  2VAF A;  4ICY A;  4WR4 A;  4ZL8 A;  1ZYN A;  3KTB A;  1FVJ A;  4ECB A;  5IMC A;  1H75 A;  4BVX B;  3TRP A;  3H4K A;  3U6V A;  1JZD A;  3HJP A;  1XWK A;  3F4R A;  3A2X A;  1SK0 A;  3I9V 2;  4BWS A;  4LL4 B;  2N5F A;  2DIZ A;  2FUG 2;  3TGZ A;  1F3B A;  1M9B A;  3FZA A;  1G0T A;  5KOX A;  4IKH A;  4HUA A;  3GUS A;  2MMO A;  1Z5Y E;  3ISO A;  1K0O A;  3GTU B;  2VCW A;  5A4W A;  5D73 A;  3G7Y A;  3HKR A;  5DAL A;  1A8Y A;  3HXS A;  4BWQ A;  2FWG A;  2IFQ A;  2YCD A;  4K9Z A;  1GLQ A;  2AYT A;  1GSQ A;  1AQW A;  4AJ8 A;  4JED A;  1YEX A;  4Q5N A;  6GSX A;  3HDC A;  1UVZ A;  3TKS E;  2PPT A;  3MNG A;  4NHW A;  1MDJ A;  4TOP A;  2R2J A;  2VCZ A;  5IO0 A;  4HJ2 A;  1BX9 A;  20GS A;  3O6T A;  3OR5 A;  2V6O A;  3KMN A;  1YJ6 A;  2H19 A;  1SD9 A;  2IME A;  2I81 A;  4CY8 A;  3IE3 A;  1XPV A;  2K9F A;  9GSS A;  1URM A;  2C1Y A;  1TTZ A;  1AUC A;  4CHS A;  1J08 A;  2FA4 A;  4X43 A;  4LL1 B;  3EIN A;  4K5R A;  3QD9 A;  5DDL A;  4RQR A;  5IOW A;  1ZL9 A;  3TKQ A;  4CDO A;  1AC1 A;  4N0Z A;  5ECH B;  4BL7 A;  1TDI A;  3FW2 A;  2LJA A;  1PL1 A;  3IAM 2;  4LMV A;  3KCM A;  3LWA A;  3WT2 A;  1ILO A;  1SL2 B;  4H86 A; 
#chains in the Genus database with same CATH homology
 1K0D A;  1SU9 A;  1EP7 A;  3DWV A;  2WRT A;  1M7T A;  5CO3 A;  2IIY A;  1B48 A;  3GKX A;  4N30 A;  2L4Q A;  2PBJ A;  4HZ2 A;  3ME8 A;  5G5E A;  1EV9 A;  2PN8 A;  1Y25 A;  1RW1 A;  3GUR A;  1M0U A;  5EPF A;  4IJ3 A;  2LJR A;  3TJJ A;  5JCU A;  2TRX A;  1AW9 A;  4GQC A;  2B3S A;  4XRD A;  3KD0 A;  2AJQ B;  4CY6 A;  3W6G A;  2VCX A;  4PQI A;  3TJG A;  4TR1 B;  3G9B A;  4HU9 A;  2LQQ A;  2OA7 A;  4X1U A;  2OBK A;  4F9Z A;  3VI5 A;  1DE1 A;  4MF5 A;  4G9H A;  4WKW A;  3IHQ A;  3ZIJ A;  3LOR A;  5JWQ B;  3ERF A;  1S3D A;  1FB6 A;  4KDU A;  4JRR A;  3QR6 A;  8GSS A;  1A24 A;  3M9K A;  1Z9H A;  2CZ2 A;  2MBT A;  1XOB A;  1TK0 B;  3KH9 A;  4TXO B;  1T4Z A;  2R5G A;  1O85 A;  3Q74 A;  2IL3 A;  2XBQ A;  3TOT A;  5G30 A;  2XC2 A;  3LQ7 A;  2FD3 A;  2FA8 A;  1TK8 B;  1SJZ A;  5F8B A;  4KDX A;  3IK7 A;  2GQM A;  5ENU A;  1CQG A;  5LNK e;  5GZZ B;  1Z3E A;  4G0K A;  3IRA A;  3HHV A;  4Z2U A;  1T8E B;  4WBR D;  5ECP B;  2R4V A;  2P5R A;  1PKW A;  4E8H A;  2YNX A;  5D93 A;  3J7Y k;  1U3A A;  3QFB C;  2H0I A;  5JWO B;  1THO A;  1V9W A;  2I9H A;  4V2L A;  1EP8 A;  4EE0 A;  1TKD B;  2HI7 A;  2NBS A;  4RUV A;  3ZTL A;  2P0G A;  1PA3 A;  2JSZ A;  2VCT A;  2FY6 A;  5J4U A;  3SWL A;  2O8V B;  3GKK A;  1QGV A;  5INY A;  5H5R A;  2Z9S A;  2VLT A;  3UOM A;  5CRG A;  2YZH A;  2GSS A;  1GUK A;  4P3Y B;  3NOF A;  4POM A;  4MDC A;  2YZU A;  2GZY A;  3L9U A;  4RI7 A;  2GSQ A;  4ILF A;  4KSM A;  4LMW A;  1GUL A;  3BBY A;  4XCS A;  2IJY A;  1NHO A;  3HZ8 A;  3U5R E;  3F63 A;  5EL8 A;  2OKA A;  2ZUP A;  1GL8 A;  3UBK A;  4POB A;  2VD1 A;  4HZ4 A;  5J3R A;  3A2W A;  5G1L A;  1OC9 A;  2CT6 A;  1JLW A;  3FY7 A;  4ZB8 A;  4ACS A;  2HRF A;  2QA1 A;  1T1V A;  3TRX A;  2GTU A;  1RK4 A;  1GUM A;  4FO5 A;  2X8C A;  1WE0 A;  1K0C A;  2B7J A;  4OMV A;  1EGO A;  1K0B A;  2IMF A;  4OCE A;  1UC7 A;  3EWL A;  4F82 A;  4XS6 A;  4EIP A;  4IJI A;  3VWV A;  4NPB A;  1V57 A;  3UJ1 A;  4I97 A;  1O8W A;  4O5Q A;  5J41 A;  1W89 A;  6GST A;  4TR1 A;  4IGJ A;  2QGV A;  3F4S A;  5B6M A;  4POK A;  4NWY A;  3DVX A;  4I2U A;  2O89 A;  5G31 A;  4CW9 A;  1DE2 A;  2YWN A;  4XIH A;  3G7J A;  1BJX A;  2YOI A;  3HVX A;  3LEF A;  2X4A A;  2JU5 A;  2YJH A;  1EGR A;  1KEB A;  1AXD A;  2KLX A;  4PUR A;  3VWW A;  4GTU A;  1K3L A;  1PL2 A;  3FEU A;  2C0E A;  4I5Q A;  1F2E A;  3HY2 A;  3ZVJ D;  3TJF A;  4BVY B;  1XVQ A;  5JCG A;  2FWE A;  3ZFL A;  4K2D A;  2YPM A;  4L0U A;  5F05 A;  17GS A;  4G2E A;  3DYR A;  1FVK A;  2FWF A;  3DRN A;  4IVF A;  3C1S A;  1XW5 A;  1M2B A;  2C80 A;  5H5S A;  2M72 A;  4MP4 A;  2LQO A;  1SL1 B;  2KOK A;  3DGQ A;  2H1D A;  1M2D A;  1U3I A;  2H1G A;  2AV4 A;  1MTC A;  3EU3 A;  1H4O A;  2PWJ A;  4WBJ A;  2VLU A;  2K6V A;  2A2P A;  2R0C A;  1B8X A;  2FNO A;  3UAP A;  1QFN A;  3FZ9 A;  3Q18 A;  4OO5 A;  3VI7 A;  10GS A;  5DAL B;  2HRN A;  2R37 A;  2PU9 C;  5J9C A;  3RBT A;  2IFQ B;  1B4Q A;  4OCF A;  2OJL A;  3GSS A;  2CVK A;  4Z2T A;  2MMN A;  4ZIJ A;  1DBY A;  3GHA A;  3I6A A;  4OFM A;  3GL5 A;  2GQL A;  4HOJ A;  3D4M A;  2L6C A;  3FKF A;  5DAK A;  1QK8 A;  4XRA A;  2B5E A;  1MD3 A;  3TKR A;  3MSZ A;  2C3N A;  3HZ4 A;  5ECN B;  4WET A;  1PGT A;  2OE1 A;  2DMM A;  4XS4 A;  3R3E A;  2FHE A;  2ALB A;  1F37 A;  2VCV A;  2OAD A;  1QXH A;  3IK9 A;  4MF7 A;  1EOG A;  2GT5 A;  5IMZ A;  2GVP A;  2N5A A;  4ZXG A;  4PNF A;  1DSB A;  4KCE A;  4HDE A;  3APO A;  3ZRD A;  3RDW A;  3ED3 A;  1ML6 A;  1K0A A;  2H0G A;  4MJC A;  3W8S A;  2MYG A;  3VWU A;  2A2R A;  5HR1 A;  4QL9 A;  3KP9 A;  5ELG A;  3KP8 A;  2OAC A;  4TR3 A;  1Q98 A;  1ST9 A;  4DSS A;  1VF4 A;  2L4C A;  1UA5 A;  4K7O A;  4ML6 A;  2B5Y A;  3CSI A;  2WB9 A;  1A8L A;  4V2M A;  1YF0 A;  4KDY A;  2HZE A;  3APS A;  4TR4 A;  5IPH A;  5FT3 A;  3DML A;  3BD2 A;  1ON4 A;  4KH7 A;  5KEJ A;  2GLR A;  2HE3 A;  3EVI A;  1XW9 A;  3TDG A;  2DJJ A;  1XXU A;  3TRQ A;  4O5U A;  2H76 A;  2LEG A;  5HQP A;  2V41 A;  3LG6 A;  1O6J A;  2HSH A;  4F2I A;  4GST A;  1VF1 A;  2L6D A;  2ON5 A;  1X9W B;  16GS A;  2AAW A;  4N0V A;  3M3M A;  2XHF A;  3FR3 A;  4K2X A;  1EEJ A;  5ECI B;  2C0F A;  2JSY A;  3IDV A;  3EYT A;  1ACV A;  2L59 A;  2C0G A;  3WT1 A;  1FAA A;  1SKW B;  4IW9 A;  4DSQ A;  2GS3 A;  4I8B A;  3GNJ A;  3F8U A;  3VWX A;  3DIE A;  4HJM A;  2H8L A;  2YV9 A;  4HQZ A;  14GS A;  3D5J A;  2CZ3 A;  1OC3 A;  3IPZ A;  1TK5 B;  4V2N A;  1B9X C;  1YZX A;  4WXT A;  4XTS A;  3KTL A;  4MPG A;  5HR2 A;  3C71 A;  1E6B A;  1PSQ A;  2LS5 A;  5DQY A;  1MDK A;  1G6Y A;  2JZS A;  5HFG A;  4IEL A;  2NPB A;  2AHE A;  1AQV A;  1PQN A;  3MIX A;  4KX4 A;  3FK8 A;  3A3T A;  3DVW A;  3F0I A;  1O73 A;  2CA8 A;  2AUV A;  5GAN D;  1T7P B;  4EF0 A;  4QQ7 A;  3UL3 A;  2WCI A;  1E2Y A;  2MBS A;  2WJU A;  5LCZ A;  4ZBB A;  4ECI A;  3RAZ A;  5H5Q A;  2GQK A;  5J5N A;  1GSS A;  2CAI A;  3QAV A;  2HFD A;  4LLR A;  2NTO A;  2WS2 A;  2ZCT A;  3LXT A;  3BJ5 A;  2LTK A;  1OC9 B;  3PH9 A;  2I4A A;  3HJO A;  4EKZ A;  4MH2 A;  2F3M A;  3KEB A;  5IQY A;  1B4P A;  3A5W A;  1YEP A;  3KM6 A;  4K1F A;  4K8M A;  4WR5 A;  5GAP D;  1OKD A;  4MPF A;  1TI1 A;  2M46 A;  5L71 A;  3APQ A;  1GRX A;  2H0H A;  4IBP A;  1TW9 A;  3HD5 A;  2VL2 C;  1SJI A;  3I43 A;  1GH2 A;  5IPG A;  1BAY A;  3F4T A;  5HFK A;  3DEX A;  2LRC A;  1V40 A;  1JLV A;  4HEA 2;  5F07 A;  13GS A;  2PVQ A;  2OBI A;  3QFA C;  6GSW A;  12GS A;  4F0C A;  1JHB A;  1B9Y C;  4J57 E;  3I69 A;  2LNS A;  2VOC A;  4KF9 A;  2GDR A;  3DKS A;  22GS A;  5E59 A;  5DCG A;  1ZYQ B;  2PUK C;  1FG4 A;  5ID2 A;  4V1A g;  1GSU A;  3D4T A;  2PGT A;  4BA7 A;  4MZB A;  5ECK B;  3DD3 A;  4KE3 A;  2PMT A;  3GRX A;  1IYI A;  1O81 A;  1X9S B;  6GSV A;  2CAQ A;  3CXG A;  1GNE A;  4EDZ A;  3QAW A;  1XBS A;  3L0H A;  4MZC A;  4YAP A;  5IMD A;  1YQ1 A;  3HVS A;  4MLY A;  1SKR B;  4MJE A;  2P5Q A;  3C7M A;  3EUR A;  3M1G A;  2K8S A;  2B1L A;  2C3T A;  2IMI A;  3KH7 A;  4IQ1 A;  2H6Y A;  3P2A A;  3P8W A;  4IHU A;  19GS A;  1R5A A;  4GXZ A;  4A5P A;  4USS A;  1BQ7 A;  1F3A A;  5ELA A;  1QMV A;  3F3Q A;  5CRE A;  2JZR A;  3LXZ A;  1TP9 A;  3EE2 A;  2EIQ A;  3CRU A;  1ZOF A;  1R26 A;  2MZC A;  3EC3 A;  1HQO A;  2RM5 A;  3UVT A;  1MDI A;  5DAK B;  2F8A A;  1J9B A;  2YWM A;  3QOU A;  2C0D A;  2FGX A;  1X5E A;  3IA1 A;  4EO3 A;  4K7N A;  5A5K A;  1ZYP A;  1GWC A;  4XS4 B;  3PR8 A;  4KCA A;  1CQH A;  3FR6 A;  5AIV A;  2TRC P;  5D9V A;  1X9M B;  4F03 A;  1R7H A;  3KGK A;  1U88 A;  2LST A;  4Q5Q A;  3G7I A;  2I3Y A;  1WIK A;  2DJ1 A;  2FWH A;  1A23 A;  2V1M A;  2LKU A;  3F3R A;  2GZP A;  5ECQ B;  3FZ4 A;  4FYU A;  2LV3 A;  4PUA A;  3W8J A;  3GX8 A;  2YJ7 A;  2EIR A;  3GX0 A;  11GS A;  3ERW A;  4Z2R A;  2C4J A;  4NHZ A;  1SK2 A;  2IWT A;  3D22 A;  3R2Q A;  4DSS B;  2DBC A;  1XW6 A;  3N9J A;  2K8V A;  4I2T A;  3RHC A;  2WFC A;  4O92 A;  2YWO A;  4K5S A;  3MYD A;  2HZE B;  4G19 A;  2EC4 A;  1V98 A;  3VPQ A;  3PPU A;  2K18 A;  3O3T A;  1A0R P;  1N2A A;  1JFU A;  3CTF A;  3NIV A;  4RI6 A;  1SYR A;  4MNN A;  1HNB A;  4ZB6 A;  1M99 A;  2TIR A;  3DXB A;  3MAK A;  4FIW A;  1K3O A;  4D73 A;  3ZL5 A;  2VM2 A;  5KN2 A;  5COH A;  4DSR A;  1RQM A;  1U6T A;  3ZVJ A;  4LA1 A;  4N10 A;  4KAE A;  1K0M A;  4KW6 A;  18GS A;  4IS0 A;  1NSW A;  4NAX A;  4K0N A;  3C1R A;  2LRT A;  4NXI A;  1HNA A;  3CSH A;  1Y6E A;  2DIY A;  3PGT A;  3TKP A;  2F51 A;  3ZIV A;  1OAZ A;  2I1U A;  1K0N A;  1R4W A;  1W4V A;  5EVO A;  3PIN A;  4DVC A;  2JL4 A;  2L57 A;  3ERG A;  3FHK A;  1UN2 A;  5CRH A;  1T00 A;  4EL1 A;  1BG5 A;  1KBN A;  3IC8 A;  5E4W A;  4MJB A;  4I6X A;  1EV4 A;  2H1A A;  3EMP A;  4MF6 A;  3US3 A;  5AN1 A;  4ZIL A;  3ZLP A;  2C3Q A;  3LYK A;  3D6I A;  3Q19 A;  1XOA A;  4YQU A;  6GSU A;  2R0G A;  5B6N A;  2YP6 A;  1ZCP A;  3UBL A;  5JCW A;  1WPI A;  4XHM A;  3WD6 A;  4MCU A;  3HJM A;  2PVO C;  5EY6 A;  4GSS A;  5KN0 A;  1GTI A;  1QQ2 A;  5FHI A;  1ERW A;  3AY8 A;  3TKS C;  3TKS A;  5CP1 A;  3ZYW A;  4Z7X A;  1A2L A;  3L4N A;  2H01 A;  5A4V A;  5GSS A;  2B7K A;  2E7P A;  4WF4 A;  4O32 A;  4MMM A;  3ZIT A;  2RII A;  4J56 E;  2KP2 A;  1YKC A;  2H72 A;  3LYP A;  1GTU A;  3KIJ A;  3VK9 A;  1USB A;  3ZRE A;  4EVM A;  4JBB A;  2HNL A;  3NZN A;  1AAZ A;  7GSS A;  3N5O A;  4GQF A;  3QMX A;  1TOF A;  1SL0 B;  1TI3 A;  4YAV A;  2DJK A;  1FB0 A;  1LU4 A;  5AGY A;  2H6Z A;  1TRV A;  4KA0 A;  5DVB A;  3E0U A;  2LNT A;  4HI7 A;  2LUS A;  4K0G A;  4L0W A;  3ZFB A;  4Q5R A;  1OE7 A;  1A0F A;  1FO5 A;  4AJ7 A;  3F9U A;  1WRY A;  2H1B A;  3M8N A;  3A2V A;  4YQV A;  2REM A;  3GN3 A;  3IBH A;  1C72 A;  1X5C A;  3FYG A;  5A4U A;  3QCP A;  1TRS A;  1LJR A;  5D8I A;  4PGT A;  2RUE A;  1S3C A;  3TCO A;  4PNG A;  1Z7P A;  3IXR A;  3TOU A;  5BMU A;  2HXK A;  5CRW A;  1V58 A;  2J23 A;  1N8J A;  4JE1 A;  1WWJ A;  1PKZ A;  1K3Y A;  3GST A;  2BMX A;  3BOA A;  3IC4 A;  2IMK A;  4G10 A;  5ID2 B;  1ABA A;  3M0F A;  5HFI A;  2H30 A;  4MH3 A;  1Z6N A;  1SK1 A;  1GSE A;  3WGX A;  1SYX A;  2G0F A;  4XS1 A;  5IMA A;  3TUE A;  5BRT A;  1SEN A;  2CVB A;  3TB2 A;  3EU4 A;  5KN3 A;  3F6F A;  1NW2 A;  5B8A A;  1G6W A;  1J0F A;  1XWG A;  1GTA A;  3TJK A;  2KHP A;  5JWR B;  2B5X A;  3ZML A;  3UVH A;  2H71 A;  4X4J A;  1YF1 A;  4YKG A;  2C8U A;  4GRF A;  3RPN A;  2V2G A;  5D96 A;  4AF2 A;  3VFI A;  1EEM A;  1R5P A;  1FOH A;  2KUC A;  1TXX A;  2NVL A;  5GST A;  3D21 A;  3EMX A;  4YKF A;  1BYE A;  1WJK A;  1Z6M A;  2WUL A;  1MD4 A;  1TU7 A;  4K6X A;  6GSS A;  1XWC A;  2GST A;  1GNW A;  2BTO T;  2CV4 A;  3C8E A;  2O87 A;  2FCH A;  4FH8 A;  4JR4 A;  3M9J A;  3FMW A;  2R3X A;  3MWH A;  2J9H A;  2L5O A;  2G2Q A;  1GSD A;  2OE3 A;  3CBU A;  4GSN A;  4TW5 A;  2R6K A;  2DLX A;  3LGC A;  5LD0 A;  3GA4 A;  1F9M A;  3L9V A;  2M80 A;  2HYX A;  1OE8 A;  4K7I A;  2JZT A;  4TKY A;  5G2Z A;  5G1K A;  2DKI A;  5ECM B;  5D9X A;  4G0L A;  2ES7 A;  4JZQ A;  1SKS B;  1G7E A;  1AQX A;  2X8G A;  4IN0 A;  2DJ3 A;  4OD7 A;  1X0R A;  4YH2 A;  4V1A p;  1G7O A;  4L5O A;  4FQU A;  3C73 A;  2O7K A;  2OE0 A;  2VL2 A;  2PER A;  4ECJ A;  5KOW A;  5D9W A;  2JAC A;  4O5R A;  1XCC A;  4DEJ A;  2BJX A;  3HA9 A;  2GT6 A;  3J7Y b;  1VF3 A;  2A4V A;  3RPP A;  5HR3 A;  2HT9 A;  4GF0 A;  1EWX A;  2H66 A;  5IO2 A;  4OFN A;  3WYW A;  3CMI A;  2H75 A;  5ECS A;  1JZO A;  2RLI A;  4HS1 A;  1HNC A;  4TXV A;  3ZZX A;  2ZNM A;  4E8E A;  2RM6 A;  4L5L A;  4D73 B;  3HYP A;  4BVX A;  4PUF C;  2DSA A;  1FW1 A;  2V6K A;  5B8B A;  1NHY A;  2CVD A;  1AIU A;  3H8Q A;  3GYK A;  1JZR A;  3EPT A;  3LFL A;  1I5G A;  3VPT A;  4PXO A;  3D0Z A;  2ON7 A;  2CX4 A;  2VD0 A;  4IP6 A;  4KND A;  2NDO A;  4TR0 A;  2V32 A;  1TRU A;  1WMJ A;  4F0B A;  2DKH A;  4FYC A;  2XPE A;  1ERU A;  2HZF A;  5D9T A;  1ERT A;  3UAR A;  3MDK A;  4MZW A;  4IQA A;  1GLP A;  3GTU A;  3GMF A;  4WEY A;  2HRA A;  1X5D A;  1GSF A;  1VRS D;  3HCZ A;  1EZK A;  4KSO A;  5AIX A;  5CNW A;  3Q6O A;  3E3E A;  4O7H A;  3GH6 A;  4MK3 A;  2VCQ A;  5C00 A;  4EC0 A;  3KZQ A;  1XWB A;  5F06 A;  3S9F A;  1M2A A;  3FR9 A;  2WZ9 A;  2YV7 A;  1TU8 A;  3GIX A;  3V1W A;  1QUW A;  3QDN A;  3GFK A;  3IV4 A;  3SBC A;  2X99 A;  4WF5 A;  2D2Z A;  3F6D A;  6GSY A;  1A2M A;  5CRD A;  1XZO A;  2DJ0 A;  4ML1 A;  2FLS A;  5DCH A;  1OYJ A;  1EOH A;  4ISD A;  2AB6 A;  4ZBA A;  4ZL9 A;  2HRK A;  5B7C A;  3P90 A;  1OC8 A;  5J9B A;  1YY7 A;  5G5F A;  2WDU A;  1HD2 A;  2JAD A;  4PQ1 A;  1MEK A;  2R0P A;  4EDY A;  1PMT A;  2HSM A;  4AGS A;  1VGL A;  2CQ9 A;  4KUN A;  4GLT A;  4TVE A;  2DC5 A;  2KP1 A;  5DBQ A;  2N5B A;  3JCM L;  3HVV A;  3TJB A;  4RQX A;  2F9S A;  4KGI A;  2LJK A;  1JZW A;  5CYY A;  1O8X A;  1THX A;  4NV5 A;  1LBK A;  2DML A;  5IM9 A;  5C04 A;  4EIQ A;  2VUP A;  2GSR A;  3A5I A;  4QL7 A;  4N11 A;  4JU5 A;  4OO4 A;  4MA9 A;  3WGD A;  1WOU A;  2QSI A;  5DQS A;  4POL A;  4ULX A;  5ECL B;  5ABR A;  3ME7 A;  3GL3 A;  4TN8 A;  5ECO B;  2XPD A;  2L5L A;  4HU7 A;  3CYN A;  5IIZ A;  2H6X A;  4JR6 A;  3L9S A;  1I9D A;  4TXO A;  5CAX A;  3VUR A;  1YKA A;  3LSZ A;  5IOX A;  4ZBD A;  5HR0 A;  1DUG A;  4AJ6 A;  2A2S A;  4EUY A;  1TJD A;  1GP1 A;  2YAN A;  1F6M C;  1ZGN A;  1ZZY A;  2MMZ A;  3KXO A;  1FOV A;  1PD2 1;  1IYH A;  3UIW A;  4MJA A;  3IR4 A;  2H70 A;  1PX6 A;  2VO4 A;  3QAG A;  1SJ6 A;  4Q5F A;  4GCI A;  3GKN A;  3H79 A;  3QPM A;  2QA2 A;  3CTG A;  2B1K A;  4IP1 A;  3L78 A;  2F8F A;  2HLS A;  4HQS A;  1OVN A;  3LJR A;  3K8N A;  5KN1 A;  4PTS A;  2YWI A;  3GKM A;  1HYU A;  1XIY A;  3FRC A;  4ZB9 A;  1Q4J A;  2IN3 A;  2VM1 A;  4PQH A;  4G0I A;  1ERV A;  2VIM A;  1TRW A;  3IAS 2;  4NV2 A;  1ZYE A;  3VLN A;  5DJL A;  4NMU A;  4OWY A;  4ZL7 A;  2YN1 A;  1S3A A;  2IMD A;  4TRX A;  5F0G A;  2VLV A;  2B6M A;  4YQM A;  3ZMK A;  2IPA A;  5ECR B;  1PRX A;  1A2J A;  3WGE A;  3IHG A;  4L8E A;  1GUH A;  2LRN A;  3CSJ A;  2E2M A;  4J2F A;  5IMV A;  2H74 A;  3P7X A;  3IOS A;  1XFL A;  2VL9 A;  1SD8 A;  2GZZ A;  1BED A;  1WP0 A;  3KMO A;  2E0Q A;  4KB3 A;  4BPY A;  2WGR A;  1XWA A;  3KJY A;  2DJ2 A;  2XBI A;  3E9J B;  2VL3 A;  4BL7 B;  3CRT A;  4ECC A;  1T4Y A;  5DJM A;  4FYB A;  1T3B A;  2HSY A;  2CX3 A;  1ZMA A;  2E2G A;  2EIO A;  1O7U A;  1OKT A;  2QC7 A;  1KTE A;  2UZ8 A;  1PN0 A;  2X49 A;  3O76 A;  2P31 A;  2QKE A;  1U87 A;  1M9A A;  4MAB A;  4PX1 A;  3GV1 A;  1KNG A;  3BCK A;  4GWR A;  2MMA A;  3BCI A;  3GH9 A;  2X8H A;  4OFT A;  3H1N A;  3FZ5 A;  1XVW A;  1FHE A;  1GSY A;  1GTB A;  3H93 A;  4ID0 A;  2GGT A;  2H73 A;  2RUF A;  1VF2 A;  5FWG A;  2O85 A;  1Z7R A;  5IMF A;  3UMA A;  3RHB A;  3LW9 A;  1PN9 A;  1PX7 A;  4X0X A;  5AIS A;  2X64 A;  1YDK A;  3UEM A;  2A4H A;  4BVY A;  4EXJ A;  1V2A A;  1NM3 A;  2VAF A;  4ICY A;  4WR4 A;  4ZL8 A;  1ZYN A;  3KTB A;  1FVJ A;  4ECB A;  5IMC A;  1H75 A;  4BVX B;  3TRP A;  3H4K A;  3U6V A;  1JZD A;  3HJP A;  1XWK A;  3F4R A;  3A2X A;  1SK0 A;  3I9V 2;  4BWS A;  4LL4 B;  2N5F A;  2DIZ A;  2FUG 2;  3TGZ A;  1F3B A;  1M9B A;  3FZA A;  1G0T A;  5KOX A;  4IKH A;  4HUA A;  3GUS A;  2MMO A;  1Z5Y E;  3ISO A;  1K0O A;  3GTU B;  2VCW A;  5A4W A;  5D73 A;  3G7Y A;  3HKR A;  5DAL A;  1A8Y A;  3HXS A;  4BWQ A;  2FWG A;  2IFQ A;  2YCD A;  4K9Z A;  1GLQ A;  2AYT A;  1GSQ A;  1AQW A;  4AJ8 A;  4JED A;  1YEX A;  4Q5N A;  6GSX A;  3HDC A;  1UVZ A;  3TKS E;  2PPT A;  3MNG A;  4NHW A;  1MDJ A;  4TOP A;  2R2J A;  2VCZ A;  5IO0 A;  4HJ2 A;  1BX9 A;  20GS A;  3O6T A;  3OR5 A;  2V6O A;  3KMN A;  1YJ6 A;  2H19 A;  1SD9 A;  2IME A;  2I81 A;  4CY8 A;  3IE3 A;  1XPV A;  2K9F A;  9GSS A;  1URM A;  2C1Y A;  1TTZ A;  1AUC A;  4CHS A;  1J08 A;  2FA4 A;  4X43 A;  4LL1 B;  3EIN A;  4K5R A;  3QD9 A;  5DDL A;  4RQR A;  5IOW A;  1ZL9 A;  3TKQ A;  4CDO A;  1AC1 A;  4N0Z A;  5ECH B;  4BL7 A;  1TDI A;  3FW2 A;  2LJA A;  1PL1 A;  3IAM 2;  4LMV A;  3KCM A;  3LWA A;  3WT2 A;  1ILO A;  1SL2 B;  4H86 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...