4DSSA

Crystal structure of peroxiredoxin ahp1 from saccharomyces cerevisiae in complex with thioredoxin trx2
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
174
structure length
174
Chain Sequence
DLVNKKFPAGDYKFQYIAISQSDADSESCKMPQTVEWSKLISENKKVIITGAPAAFSPTSTVSHIPGYINYLDELVKEKEVDQVIVVTVDNPFANQAWAKSLGVKDTTHIKFASDPGCAFTKSIGFELAVGDGVYWSGRWAMVVENGIVTYAAKETNPGTDVTVSSVESVLAHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peroxiredoxin type-2
publication title Structural Snapshots of Yeast Alkyl Hydroperoxide Reductase Ahp1 Peroxiredoxin Reveal a Novel Two-cysteine Mechanism of Electron Transfer to Eliminate Reactive Oxygen Species.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase/transport protein
total genus 50
structure length 174
sequence length 174
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2012-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08534 Redoxin Redoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4dssA00
1BQ7A 3JCML 3ZL5A 1FHEA 1X0RA 2XHFA 2N5BA 1PX6A 4D73A 5HR0A 2VCXA 3F63A 2O85A 1ML6A 5IIZA 2XBQA 3F4RA 3P90A 5GAND 3IK9A 3HZ8A 6GSYA 3HA9A 6GSVA 3CBUA 3D4TA 1OC8A 3HJOA 1ABAA 1Z6NA 4MZCA 3F3RA 3FW2A 5DBQA 3D4MA 4TR0A 1DE2A 2V2GA 4I8BA 4ECBA 2JZSA 2DMLA 4IP1A 3GTUB 4XIHA 5JWOB 3IAM2 4WF5A 2PGTA 5IQYA 1K0AA 3HDCA 3EMPA 3KCMA 3GX8A 1K3OA 1SU9A 2R4VA 4Q5NA 2X99A 1W89A 2KUCA 4N11A 1F3AA 2DLXA 3GKXA 1WE0A 3WT1A 4AGSA 1AW9A 5D9TA 2VCWA 2PMTA 1I5GA 3LXZA 4ECCA 1X5EA 2H1GA 2XBIA 5JCGA 3ZIJA 5G31A 2CVDA 4GCIA 3GNJA 2KLXA 2WULA 3ME7A 1F9MA 9GSSA 2N5FA 3FRCA 3VPQA 3CSHA 1GUHA 3GFKA 3NOFA 4NPBA 1PSQA 4L0WA 1T4ZA 5ECQB 1Q98A 2VL3A 1YQ1A 2FWEA 3KP8A 2LUSA 5CYYA 2B7JA 1JLWA 3E3EA 5GZZB 3VI5A 3O6TA 4DSSB 1TRUA 5KN2A 3KZQA 1TI3A 2YCDA 2LJKA 4K6XA 3FY7A 3IXRA 4IJ3A 3IR4A 2IPAA 1QMVA 2PN8A 1EEJA 2M72A 2LJRA 2LRCA 4J57E 4TR4A 5IOWA 2H6XA 2C0EA 1FW1A 2CV4A 3GH6A 5H5RA 3M9JA 2GZPA 4OCEA 1TOFA 4GSTA 1BX9A 2IN3A 3FYGA 3DWVA 5B6NA 3LXTA 1XFLA 1OE8A 1X9MB 4KDUA 2B1LA 4TW5A 2G0FA 2PU9C 2WS2A 4XCSA 6GSTA 2TRXA 1HD2A 4OFNA 19GSA 4WBRD 3VWWA 1YKAA 1XOAA 5D9VA 3FZ9A 3KEBA 1OE7A 4N10A 2Z9SA 1IYHA 1GTBA 2LJAA 4KSOA 5ECOB 4YQMA 4MJCA 8GSSA 3DVXA 3TDGA 1V98A 1ZL9A 1JZWA 1T3BA 1K0NA 2FWFA 4MH3A 4KSMA 2E7PA 3DIEA 4WR5A 3HVSA 1DBYA 1SYXA 3DEXA 4EE0A 1JZRA 1YEPA 4O92A 1K3LA 2FWHA 1GL8A 1A0RP 2VCTA 5IMCA 4MCUA 3EWLA 2YANA 1RW1A 1GSYA 2GZZA 2H0HA 4EVMA 2ZNMA 1B8XA 3GKMA 1TU8A 2OADA 4WETA 3TOTA 4RQRA 1MEKA 4O32A 4EDZA 3I43A 3EE2A 4PX1A 1F2EA 4CW9A 2GSTA 2PWJA 5CAXA 1NHYA 3QMXA 3LGCA 1AQWA 1UC7A 1W4VA 5C00A 4MPFA 1SK0A 1PX7A 1GUMA 3FR6A 2RM5A 1MD3A 3RAZA 2X8CA 4KB3A 5HFIA 4LA1A 3Q18A 5G5EA 2CX4A 1YKCA 2IJYA 4KX4A 2IIYA 1J0FA 2AHEA 5DJLA 3GN3A 2E0QA 1Z6MA 2V6OA 1JFUA 3QFBC 1G7OA 3GA4A 1R7HA 1GH2A 2R2JA 1GSEA 1F37A 2HSYA 2DJKA 2DIYA 3ZFBA 2PBJA 2VCVA 2OACA 3I69A 2FUG2 5D9XA 1FB0A 3L9UA 2FNOA 4PNFA 3CTFA 5LCZA 1A8YA 1QUWA 4BVXA 2IMKA 3HVXA 1TXXA 2V1MA 12GSA 3J7Yk 3GUSA 1EV9A 3TJBA 2DJ1A 3GHAA 2LKUA 2GVPA 3TOUA 4GLTA 1GTIA 5F0GA 1K3YA 2OBIA 1LU4A 4ZXGA 1AQVA 3CSJA 2H1DA 3D21A 4NV2A 2IMEA 4GF0A 1MDKA 5JWQB 2IFQA 4PNGA 2OBKA 4MABA 2GDRA 1A23A 1XVQA 3ERWA 3RDWA 1WPIA 1YY7A 2X8HA 2FY6A 5A4UA 3O3TA 2LRTA 2K8VA 3DMLA 2GSSA 2F9SA 5HR2A 1QFNA 2AAWA 1GTUA 5FHIA 1SYRA 1PRXA 3EU3A 1BJXA 1K0CA 1NHOA 1ZMAA 2K18A 2VLTA 3AY8A 3EURA 3TJGA 2O89A 4ZL9A 3CTGA 3GL5A 2X64A 5GAPD 2B5XA 14GSA 4IHUA 3PINA 3HZ4A 2G2QA 3P2AA 1PMTA 3MAKA 2LV3A 2BJXA 1YZXA 5DCGA 4MJEA 4TXOB 3TJJA 2R37A 3F6FA 3F8UA 4TR3A 5HQPA 3GMFA 4OWYA 4XTSA 1MD4A 1XWGA 1XWKA 3ZYWA 4LMWA 4DEJA 3D6IA 1IYIA 1B48A 3IA1A 4WF4A 3IPZA 1YEXA 1HYUA 3Q74A 3DKSA 5KEJA 1A0FA 2VUPA 4N0ZA 1YDKA 2NBSA 4JR6A 4L8EA 1XPVA 2L4CA 3LJRA 1KTEA 2CAQA 4TOPA 1V2AA 2OE1A 3UBKA 2CVKA 1ZOFA 1AAZA 1EV4A 2AUVA 3FHKA 5D73A 2YWNA 5JWRB 5JCUA 1O81A 5D93A 2WCIA 4IN0A 3UOMA 3ZRDA 4ULXA 2MYGA 4KUNA 4G2EA 1XW6A 1UA5A 2FCHA 3RPPA 16GSA 2HXKA 2QSIA 5JCWA 4TKYA 3F3QA 3RPNA 1WMJA 3P8WA 4J56E 2VD0A 3HKRA 4OO5A 4AJ6A 5KN3A 1URMA 3GTUA 2A2RA 4NHZA 2E2MA 4L5LA 6GSUA 3KH7A 4HS1A 1VGLA 1OAZA 4HQSA 3QAWA 2JSZA 4K8MA 4N30A 4JRRA 3I9V2 5G1KA 2L5OA 5J9BA 4V2NA 3UAPA 3TUEA 3ZREA 4PQHA 3VWVA 2ON7A 5ECRB 1SL1B 3C71A 1GTAA 1HNCA 4JBBA 4G10A 1PD21 3L4NA 4EF0A 2EIQA 4EDYA 3TJFA 4IS0A 4MZBA 3M3MA 2PVOC 1HNBA 4HU7A 2DSAA 1B9YC 4K7IA 2RUFA 1KEBA 1BAYA 4ACSA 3TKSC 5AISA 1F6MC 2L57A 1FAAA 3A2WA 4L0UA 5IMDA 1TTZA 1OC9B 3N5OA 3TKPA 3FK8A 3P7XA 3IAS2 2YWOA 1SL2B 3NIVA 2QKEA 1EP7A 2FA4A 5DJMA 4DSSA 2I81A 3SBCA 2BTOT 3UVTA 5F05A 4F0BA 3KJYA 4POMA 4LL4B 2YV7A 2GQKA 2OE0A 1SENA 2JACA 4FH8A 11GSA 1XZOA 2M46A 5COHA 5DVBA 3KMNA 2CZ2A 2O8VB 6GSXA 2FHEA 5IPHA 1GSUA 1XOBA 3ME8A 2GLRA 4PQ1A 1FB6A 5ECPB 3IBHA 4IQAA 4YQUA 1M9AA 5CNWA 3GX0A 5DAKB 4OD7A 5ID2B 1Q4JA 4LMVA 3G7JA 3HD5A 1K0BA 4TRXA 3S9FA 4Q5QA 1ERTA 4MP4A 4J2FA 1M2DA 2JSYA 4L5OA 3VPTA 2P5RA 3FR9A 5FT3A 2L6CA 3CRUA 2DJ3A 2N5AA 5HR1A 5D8IA 4RI6A 5B8AA 4GSSA 22GSA 4NMUA 5ELAA 5J4UA 2LNSA 2CAIA 2LEGA 4V2LA 4CHSA 5EVOA 1UN2A 1HQOA 2P0GA 5IMVA 5CO3A 1KBNA 4ZBBA 1O6JA 3LFLA 1G6YA 1V57A 1JZOA 4F9ZA 1GNEA 3L9SA 3KH9A 3QPMA 2L5LA 3NZNA 1OKDA 4CDOA 3U6VA 5IPGA 1EEMA 4QL7A 3E9JB 3LQ7A 4TR1B 1BYEA 4K1FA 4OCFA 3FZ5A 4ZB9A 2LSTA 2H19A 5DQSA 1RQMA 2JZRA 3TB2A 2CZ3A 1N2AA 1SJIA 2K8SA 4ML1A 5AIVA 1ZCPA 1OKTA 2VCZA 4OMVA 1TP9A 4KCEA 5DALB 4JU5A 4AF2A 1WIKA 4HZ2A 4JEDA 4N0VA 2H1BA 4YQVA 3CMIA 4LLRA 2AJQB 2DC5A 2GT6A 4BL7A 2LS5A 4DSQA 3UMAA 5E59A 2WDUA 1AC1A 3C7MA 4WR4A 4IQ1A 4EXJA 5DCHA 1U3IA 3TRQA 1GSDA 4E8EA 3IK7A 4EL1A 1TRWA 2AB6A 3W8JA 1XW9A 4XS4B 4HDEA 2LQOA 3J7Yb 2YWIA 4O7HA 2A2SA 4MDCA 5G30A 3A3TA 3KIJA 1GRXA 1G0TA 2YPMA 1EGRA 1OVNA 3ZVJD 3F4SA 4EUYA 2C0GA 1J9BA 2HYXA 4BVYA 2KOKA 5KN0A 1O85A 3W8SA 5J41A 5INYA 2OJLA 2JL4A 4H86A 3UEMA 1LJRA 2LRNA 4MJBA 4RQXA 3H79A 4V2MA 1TI1A 3H8QA 4IP6A 2HZEB 4KCAA 3M1GA 1K0DA 2KHPA 4RUVA 3BCIA 1FOVA 1PA3A 3GSSA 2C80A 3VI7A 1EP8A 3WGXA 2H1AA 1GULA 2OA7A 5HFKA 4X43A 3ISOA 3M9KA 18GSA 1EOHA 2X8GA 2H01A 5DDLA 3C1SA 1M7TA 2YZHA 3DVWA 3VLNA 1C72A 1GNWA 3UARA 1V40A 3K8NA 3VWXA 3GKNA 3TKSA 2XPDA 1NSWA 1QQ2A 1DSBA 2EIRA 4BWSA 3CYNA 3PH9A 5E4WA 4XS1A 1R26A 2L59A 3U5RE 4BWQA 2OKAA 1XWCA 5AIXA 5EPFA 4MPGA 4AJ8A 3F4TA 2HFDA 2VL9A 3EINA 2R5GA 1YF0A 2O87A 2MZCA 2YOIA 1X9SB 4F2IA 2K9FA 5IMZA 1O8WA 3G7IA 5FWGA 4TXOA 2H70A 4TN8A 3L9VA 4K9ZA 1S3DA 4IELA 2VIMA 4POKA 4O5RA 3E0UA 2QGVA 4XHMA 3OR5A 3FR3A 4GWRA 1GWCA 5A5KA 4FYBA 2H30A 4PURA 2IL3A 5CRWA 3HHVA 1O73A 4QQ7A 2AV4A 4IJIA 4G9HA 2VM1A 3APSA 1U3AA 1USBA 5ECNB 1DUGA 2L4QA 4KA0A 3HYPA 3GYKA 2MMOA 2GSQA 3H1NA 3TJKA 2ALBA 2JZTA 3CRTA 1WRYA 2F3MA 2H8LA 2IMDA 3L0HA 1VF1A 1XW5A 1SJ6A 2VAFA 2KP1A 4K0NA 2B1KA 2H0IA 1OYJA 1T7PB 2PUKC 4KE3A 5LD0A 2H6YA 3FZ4A 1T4YA 3CXGA 2FWGA 3QFAC 5L71A 2PERA 2GS3A 3APQA 1A2JA 2HE3A 4PUFC 1CQHA 4JZQA 1ZYQB 1TU7A 2JADA 2IMIA 3IOSA 1VRSD 3RHBA 3L78A 3W6GA 1XCCA 2FLSA 2BMXA 1N8JA 3C8EA 2GTUA 2CT6A 2MBTA 2MMZA 1GLPA 3IDVA 4NWYA 3HXSA 1V9WA 2IMFA 4I2UA 4DVCA 3N9JA 4Z7XA 2KP2A 5G2ZA 4EC0A 1U88A 1F3BA 3US3A 1PKZA 1J08A 2YJHA 1ZZYA 3WGEA 4BPYA 3TKQA 4MF7A 3GURA 3C1RA 2FA8A 1MDIA 1BG5A 1K0OA 2NPBA 3I6AA 2VLUA 3TGZA 1GP1A 1TKDB 1TJDA 4ZB6A 4TVEA 4KGIA 1UVZA 2VCQA 3EVIA 4RI7A 2LTKA 1OC9A 1ON4A 4MA9A 2VOCA 1AXDA 3H4KA 4FYUA 4KH7A 1SD9A 3TCOA 4EKZA 2YN1A 4P3YB 1TK5B 3DRNA 1XIYA 3ERFA 2PPTA 5ECLB 1CQGA 3ZIVA 2H0GA 5A4WA 4Q5FA 1XBSA 2J9HA 3WT2A 4WXTA 4IBPA 3FZAA 3DD3A 1TW9A 2MMAA 4WKWA 2H73A 2H71A 1X9WB 1VF3A 2FGXA 5IOXA 5IM9A 4GSNA 1VF4A 3QCPA 3KP9A 4KDYA 2RLIA 3LYPA 4ZILA 3LYKA 3HCZA 5CP1A 2WZ9A 1THOA 2GT5A 3KTLA 2MMNA 2YZUA 5DAKA 5ECMB 4TXVA 5IO2A 1EZKA 4X1UA 3ZTLA 5ID2A 2ES7A 1ERWA 2HSHA 3UIWA 2YWMA 2PVQA 3CSIA 3SWLA 4ISDA 1Y6EA 3A2XA 1JHBA 5F8BA 3QOUA 2QC7A 2GSRA 3M0FA 1S3CA 1M99A 5KN1A 4EO3A 2C1YA 2K6VA 1U87A 4IGJA 2O7KA 1OC3A 1R5PA 1AUCA 3VFIA 3GH9A 5C04A 4MZWA 4D73B 1WOUA 5AGYA 1Z5YE 3D22A 1WP0A 1ACVA 5CRHA 4WEYA 1H75A 2B6MA 3MNGA 3APOA 4TR1A 1AQXA 3KD0A 2H75A 5J9CA 2NTOA 2EIOA 2GGTA 2VO4A 2C0FA 3KM6A 2VL2C 2H6ZA 4HI7A 4NV5A 4V1Ap 5B6MA 2V32A 1E2YA 4JE1A 4NHWA 2WJUA 1YJ6A 5B8BA 4LL1B 2WB9A 2DJJA 4HEA2 5F07A 1FVJA 5DALA 2I4AA 4HUAA 3D5JA 1TRSA 3R2QA 4IVFA 1XWAA 2HLSA 1Z9HA 1WWJA 17GSA 5IO0A 4DSRA 4ZB8A 4ZIJA 3HJMA 4HZ4A 2M80A 3EMXA 3EU4A 2DJ0A 4X0XA 2B5EA 1ZYEA 3GSTA 1GLQA 1M0UA 4FYCA 4PGTA 4XS4A 1VF2A 2XPEA 7GSSA 2RM6A 4IKHA 3LG6A 4ZBAA 4K7NA 1R5AA 6GSSA 5H5SA 4MMMA 1SK1A 4ML6A 4GQCA 3TKRA 1O7UA 1SJZA 2DMMA 5A4VA 3UL3A 2RIIA 2P5QA 4K2DA 3Q19A 4MJAA 5DQYA 1X5DA 1Z7RA 5ENUA 2XC2A 3PR8A 5EY6A 4OO4A 4POBA 1XVWA 2HI7A 6GSWA 4OFMA 4I5QA 4BA7A 3F9UA 1JZDA 1A2MA 2WFCA 2NVLA 1TK0B 2HZEA 1RK4A 3MDKA 3VURA 2LQQA 3ZMKA 2ON5A 2ZUPA 2DJ2A 4YH2A 3EYTA 1SK2A 1MTCA 4PUAA 1R4WA 4YAPA 2I3YA 4FO5A 5GSTA 1GUKA 4GRFA 1SKWB 2H66A 2VM2A 2C8UA 1BEDA 4YAVA 5CRGA 1QGVA 4XRDA 4ID0A 1GSQA 3TKSE 3WYWA 4HQZA 1NM3A 5ECKB 1TDIA 4HJ2A 1KNGA 3BJ5A 2LNTA 4NXIA 3WGDA 2V41A 1PQNA 3LORA 1A24A 20GSA 3UVHA 1THXA 1M9BA 5G1LA 3ZFLA 3FEUA 1PL2A 2YV9A 2L6DA 3BOAA 3IHQA 1ILOA 2YP6A 3QD9A 2P31A 3HJPA 1ERVA 3LEFA 1T8EB 2CQ9A 2B3SA 3HY2A 1S3AA 3MSZA 3LWAA 3VK9A 4ILFA 2OE3A 2GZYA 2CA8A 1JLVA 4KW6A 3ZLPA 5ELGA 4I97A 3DYRA 1T1VA 2HRNA 4E8HA 5ECHB 1G6WA 3D0ZA 1YF1A 3F0IA 4K0GA 4XRAA 3G9BA 1TRVA 1M2BA 5J3RA 1FVKA 3A5WA 1B4PA 1AIUA 2IWTA 1WJKA 4QL9A 3MWHA 4HJMA 5GSSA 1SKRB 13GSA 3F6DA 3IC4A 1PL1A 5IMFA 4Q5RA 1V58A 5F06A 1ZGNA 3KTBA 3ZMLA 3QAVA 3LSZA 4MH2A 1HNAA 1EGOA 1SL0B 5G5FA 3ZVJA 1Y25A 4KDXA 1ST9A 2EC4A 4F03A 2F51A 3WD6A 1TK8B 1FG4A 4MLYA 2MBSA 2HZFA 3GV1A 1PKWA 4KNDA 1E6BA 2E2GA 4GXZA 2VD1A 3A2VA 3DXBA 4MK3A 2CVBA 2B7KA 3QR6A 1PGTA 2ZCTA 5J5NA 2AYTA 4HU9A 2R3XA 4XS6A 4F0CA 2VL2A 3ZITA 5B7CA 5H5QA 1FO5A 2C3QA 2J23A 3VWUA 5HR3A 3UBLA 3ERGA 4ZL7A 4ECJA 3V1WA 4I6XA 2REMA 1B4QA 2D2ZA 1O8XA 5ECIB 4OFTA 3IV4A 3EC3A 4NAXA 1GSFA 3BCKA 2R6KA 1MDJA 3GKKA 2DIZA 2HT9A 2I9HA 3DGQA 2HNLA 3BBYA 2IFQB 4MF6A 4MF5A 1PN9A 4ZBDA 3G7YA 1H4OA 4IW9A 2H76A 3PGTA 2CX3A 1K0MA 3QAGA 3KGKA 3ED3A 1T00A 2TIRA 3UJ1A 4AJ7A 3GRXA 3ZZXA 2A4VA 3Q6OA 3H93A 2DBCA 1U6TA 1LBKA 3GL3A 2H74A 2V6KA 4JR4A 3GIXA 5ABRA 3TRPA 4WBJA 2WGRA 2B5YA 4G19A 4I2TA 3M8NA 1G7EA 3HVVA 5D96A 3QDNA 5CREA 2F8FA 10GSA 4ZL8A 2F8AA 4PXOA 3BD2A 5AN1A 3C73A 1EOGA 1M2AA 2HRFA 4POLA 2GQMA 3TRXA 4GQFA 1QK8A 3IE3A 5IMAA 4KAEA 2TRCP 4ECIA 1ERUA 3FKFA 1XXUA 3KMOA 1A2LA 2C0DA 5HFGA 4F82A 2H72A 1SD8A 5CRDA 3RBTA 2FD3A 2RUEA 1EWXA 1NW2A 4PQIA 2I1UA 3KXOA 3IRAA 5ECSA 2C3NA 1B9XC 1Z3EA 1SKSB 1X5CA 2C3TA 4FIWA 2JU5A 4HOJA 5LNKe 2NDOA 1Z7PA 1I9DA 1QXHA 3O76A 2VLVA 2GQLA 4GTUA 5D9WA 1DE1A 1A8LA 2C4JA 2YNXA 1XWBA 2YJ7A 3RHCA 4K7OA 1GSSA 5EL8A 4V1Ag 2WRTA
chains in the Genus database with same CATH superfamily
1BQ7A 3JCML 3ZL5A 1FHEA 1X0RA 2XHFA 2N5BA 1PX6A 4D73A 5HR0A 2VCXA 3F63A 2O85A 1ML6A 5IIZA 2XBQA 3F4RA 3P90A 5GAND 3IK9A 3HZ8A 3A5IA 6GSYA 3HA9A 6GSVA 3CBUA 3D4TA 1OC8A 3HJOA 1ABAA 1Z6NA 4MZCA 3F3RA 3FW2A 5DBQA 3D4MA 4TR0A 1DE2A 2V2GA 4I8BA 4ECBA 2JZSA 2DMLA 4IP1A 3GTUB 4XIHA 5JWOB 3IAM2 4WF5A 2PGTA 5IQYA 1K0AA 3HDCA 3EMPA 3KCMA 4K2XA 3GX8A 1K3OA 1SU9A 2R4VA 4Q5NA 2X99A 1W89A 2KUCA 4N11A 1F3AA 2DLXA 3GKXA 1WE0A 3WT1A 4AGSA 1AW9A 5D9TA 2VCWA 4CY8A 2PMTA 1I5GA 3LXZA 4ECCA 1X5EA 2H1GA 2XBIA 5JCGA 3ZIJA 5G31A 2CVDA 4GCIA 3GNJA 2KLXA 2WULA 3ME7A 1F9MA 9GSSA 2N5FA 3FRCA 3VPQA 3CSHA 1GUHA 3GFKA 3NOFA 4NPBA 1PSQA 4L0WA 4O5UA 1T4ZA 5ECQB 1Q98A 2VL3A 1YQ1A 2FWEA 3KP8A 2LUSA 5CYYA 2B7JA 1JLWA 1M3IA 3E3EA 5GZZB 3LW9A 3VI5A 3O6TA 4Z2UA 4DSSB 1TRUA 5KN2A 3KZQA 1TI3A 2YCDA 2LJKA 4K6XA 3FY7A 3IXRA 4IJ3A 3IR4A 2IPAA 1QMVA 2PN8A 1EEJA 2M72A 2LJRA 2LRCA 4J57E 4TR4A 5IOWA 2H6XA 2C0EA 1FW1A 2CV4A 3GH6A 5BMUA 5H5RA 3M9JA 2GZPA 4OCEA 1TOFA 4GSTA 1BX9A 2IN3A 3FYGA 3DWVA 5B6NA 3LXTA 1XFLA 1OE8A 1X9MB 4KDUA 2B1LA 4TW5A 2G0FA 3CQFA 2PU9C 3MYDA 2WS2A 4XCSA 6GSTA 2TRXA 1HD2A 4OFNA 19GSA 4WBRD 3VWWA 1YKAA 1XOAA 5D9VA 3FZ9A 3KEBA 2QA2A 1OE7A 4N10A 2Z9SA 1IYHA 1GTBA 2LJAA 4KSOA 5ECOB 4YQMA 4MJCA 8GSSA 3DVXA 3TDGA 1V98A 1ZL9A 1JZWA 1T3BA 1K0NA 2FWFA 4MH3A 4KSMA 2E7PA 3DIEA 4WR5A 3HVSA 1DBYA 1SYXA 3DEXA 4EE0A 1JZRA 1YEPA 4O92A 1K3LA 2FWHA 1GL8A 1A0RP 2VCTA 5IMCA 4MCUA 3EWLA 2YANA 2DKIA 1RW1A 1GSYA 2GZZA 2H0HA 4EVMA 2ZNMA 1B8XA 3GKMA 1TU8A 2OADA 4WETA 3TOTA 4RQRA 1MEKA 4O32A 4EDZA 3I43A 3EE2A 4PX1A 1F2EA 4CW9A 2GSTA 2PWJA 5CAXA 1NHYA 3QMXA 3LGCA 1AQWA 1UC7A 1W4VA 5C00A 4BL7B 4MPFA 1SK0A 1PX7A 1GUMA 3FR6A 2RM5A 1MD3A 3RAZA 2X8CA 4KB3A 5HFIA 4LA1A 3Q18A 5G5EA 2CX4A 1YKCA 2IJYA 4KX4A 2IIYA 1J0FA 2AHEA 5DJLA 3GN3A 3R3EA 2E0QA 1Z6MA 2V6OA 1JFUA 3QFBC 1G7OA 3GA4A 1R7HA 1GH2A 2R2JA 1GSEA 1F37A 2HSYA 2DJKA 2DIYA 3ZFBA 2PBJA 2VCVA 2OACA 3I69A 2FUG2 5D9XA 1FB0A 3L9UA 2FNOA 4PNFA 4BVYB 3CTFA 5LCZA 1A8YA 1QUWA 4BVXA 2IMKA 3HVXA 1TXXA 2V1MA 12GSA 3J7Yk 3GUSA 1EV9A 3TJBA 2DJ1A 3GHAA 2LKUA 2GVPA 3TOUA 4GLTA 1GTIA 5F0GA 1K3YA 2OBIA 1LU4A 4ZXGA 1AQVA 3CSJA 2H1DA 3D21A 4NV2A 2IMEA 4GF0A 1MDKA 5JWQB 2IFQA 4PNGA 2OBKA 4MABA 2GDRA 1A23A 1XVQA 3ERWA 3RDWA 1WPIA 1YY7A 2X8HA 2FY6A 5A4UA 3O3TA 4G0LA 2LRTA 2K8VA 3DMLA 2GSSA 2F9SA 5HR2A 1QFNA 2AAWA 1GTUA 5FHIA 1SYRA 1PRXA 3EU3A 1BJXA 1K0CA 1NHOA 1ZMAA 2K18A 2VLTA 3AY8A 3EURA 3TJGA 2O89A 4ZL9A 3CTGA 3GL5A 2X64A 5GAPD 2B5XA 14GSA 4IHUA 3PINA 3HZ4A 2G2QA 3P2AA 1PMTA 3MAKA 2LV3A 2BJXA 1YZXA 5DCGA 4MJEA 4TXOB 3TJJA 2R37A 3F6FA 3F8UA 4TR3A 5HQPA 3GMFA 4OWYA 4XTSA 1MD4A 1XWGA 1XWKA 3ZYWA 4LMWA 4DEJA 3D6IA 1IYIA 1B48A 3IA1A 4WF4A 4X4JA 2QA1A 3IPZA 1YEXA 1HYUA 3Q74A 3DKSA 5KEJA 1A0FA 2VUPA 4N0ZA 1YDKA 3EPTA 2NBSA 4JR6A 4L8EA 1XPVA 2L4CA 3LJRA 3FMWA 1XG8A 1KTEA 2CAQA 4TOPA 1V2AA 2OE1A 3UBKA 2CVKA 1ZOFA 1AAZA 1EV4A 2AUVA 4O5QA 3FHKA 5D73A 2YWNA 5JWRB 5JCUA 1O81A 5D93A 2WCIA 4IN0A 3UOMA 3ZRDA 4ULXA 2MYGA 4EIQA 4KUNA 4G2EA 1XW6A 1UA5A 2FCHA 3RPPA 16GSA 2HXKA 2QSIA 5JCWA 4TKYA 3F3QA 3RPNA 1WMJA 3P8WA 4J56E 2VD0A 2X49A 3HKRA 4OO5A 4AJ6A 4EIPA 5KN3A 1URMA 3GTUA 2A2RA 4NHZA 2E2MA 4L5LA 6GSUA 3KH7A 4HS1A 1VGLA 1OAZA 4HQSA 3QAWA 2JSZA 4K8MA 4N30A 4JRRA 3I9V2 5G1KA 2L5OA 5J9BA 4V2NA 3UAPA 3TUEA 3ZREA 4PQHA 3VWVA 2ON7A 5ECRB 1SL1B 3C71A 1GTAA 1HNCA 4JBBA 4G10A 1PD21 3L4NA 2UZ8A 4EF0A 2EIQA 4EDYA 3TJFA 4IS0A 4MNNA 4MZBA 3M3MA 3MIXA 4HSCX 2PVOC 1HNBA 4HU7A 2DSAA 1B9YC 4K7IA 2RUFA 1KEBA 1BAYA 4ACSA 3TKSC 5AISA 1F6MC 2L57A 1FAAA 3A2WA 4L0UA 5IMDA 1TTZA 1OC9B 3N5OA 3TKPA 3FK8A 3P7XA 3IAS2 2YWOA 1SL2B 1M3JA 3NIVA 2QKEA 1EP7A 2FA4A 5DJMA 4DSSA 2I81A 3SBCA 2BTOT 3UVTA 5F05A 4F0BA 3KJYA 4POMA 4LL4B 2YV7A 2GQKA 2OE0A 1SENA 2JACA 4FH8A 11GSA 1XZOA 2M46A 5COHA 5DVBA 4Z2RA 3KMNA 2CZ2A 2O8VB 6GSXA 2FHEA 5IPHA 1GSUA 1XOBA 3ME8A 2GLRA 4PQ1A 1FB6A 5ECPB 3IBHA 4IQAA 4YQUA 1M9AA 5CNWA 3GX0A 5DAKB 4OD7A 5ID2B 1Q4JA 4LMVA 3G7JA 3HD5A 1K0BA 4TRXA 3S9FA 4Q5QA 1ERTA 5BRTA 4MP4A 4J2FA 1M2DA 2JSYA 4L5OA 3VPTA 2P5RA 3FR9A 5FT3A 2L6CA 3CRUA 2DJ3A 2N5AA 5HR1A 5D8IA 4RI6A 5B8AA 4GSSA 22GSA 4NMUA 5ELAA 5J4UA 2LNSA 2CAIA 2LEGA 4V2LA 4CHSA 5EVOA 1UN2A 1HQOA 2P0GA 5IMVA 5CO3A 1KBNA 4ZBBA 1O6JA 3LFLA 1G6YA 2R0PA 1V57A 1JZOA 3IC8A 4F9ZA 1GNEA 3L9SA 3KH9A 3QPMA 2L5LA 3NZNA 1OKDA 4CDOA 3U6VA 5IPGA 1EEMA 4QL7A 3E9JB 3LQ7A 4TR1B 1BYEA 4K1FA 4OCFA 3FZ5A 4ZB9A 2LSTA 2H19A 5DQSA 1RQMA 2JZRA 3TB2A 2CZ3A 1N2AA 1SJIA 2K8SA 4ML1A 5AIVA 1ZCPA 1OKTA 2VCZA 4OMVA 4G0KA 4PTSA 1TP9A 4KCEA 5DALB 4JU5A 4AF2A 1WIKA 4HZ2A 4JEDA 4N0VA 2H1BA 4YQVA 3CMIA 4LLRA 2AJQB 2DC5A 2GT6A 4BL7A 2LS5A 4DSQA 3UMAA 5E59A 2WDUA 1AC1A 3C7MA 4WR4A 4IQ1A 4EXJA 5DCHA 4USSA 1U3IA 3TRQA 1GSDA 4E8EA 3IK7A 4EL1A 1TRWA 2AB6A 3W8JA 1XW9A 4XS4B 4HDEA 2LQOA 3J7Yb 2YWIA 4ICYA 4O7HA 2A2SA 4MDCA 4Z2TA 5G30A 1ZYPA 3A3TA 3KIJA 1GRXA 1G0TA 2YPMA 1EGRA 1OVNA 3ZVJD 3F4SA 4EUYA 1ZYNA 2C0GA 1J9BA 2HSMA 2HYXA 4YKGA 4BVYA 2KOKA 5KN0A 1O85A 3W8SA 5J41A 5INYA 2OJLA 2JL4A 4H86A 3UEMA 1LJRA 2LRNA 4MJBA 4RQXA 3H79A 4V2MA 1TI1A 3H8QA 4IP6A 2HZEB 4KCAA 3M1GA 1K0DA 2KHPA 4RUVA 3BCIA 1FOVA 1PA3A 3GSSA 2C80A 3VI7A 1EP8A 3WGXA 2H1AA 1GULA 2OA7A 5HFKA 4X43A 3ISOA 3M9KA 18GSA 1EOHA 2X8GA 2H01A 5DDLA 3C1SA 1M7TA 2YZHA 3DVWA 3VLNA 1C72A 1GNWA 3UARA 1V40A 3K8NA 3VWXA 3GKNA 3TKSA 2XPDA 1NSWA 1QQ2A 1DSBA 2EIRA 4BWSA 3CYNA 3PH9A 5E4WA 4XS1A 1R26A 2L59A 3U5RE 4BWQA 2OKAA 1XWCA 5AIXA 5EPFA 4MPGA 4AJ8A 3F4TA 2HFDA 2VL9A 3EINA 2R5GA 1YF0A 2O87A 2MZCA 2YOIA 2DKHA 1X9SB 4F2IA 2K9FA 5IMZA 1O8WA 3G7IA 5FWGA 4TXOA 2H70A 4TN8A 3L9VA 4K9ZA 1S3DA 4IELA 2VIMA 4POKA 4O5RA 3E0UA 2QGVA 4XHMA 3OR5A 3FR3A 4GWRA 1GWCA 5A5KA 4FYBA 2H30A 4PURA 2IL3A 5CRWA 3HHVA 1O73A 4YKFA 4QQ7A 2AV4A 4IJIA 4G9HA 2VM1A 3APSA 1U3AA 1USBA 5ECNB 1DUGA 2L4QA 4KA0A 3HYPA 3GYKA 2MMOA 2GSQA 3H1NA 3TJKA 2ALBA 2JZTA 3CRTA 1WRYA 2F3MA 2H8LA 2IMDA 3L0HA 1VF1A 1XW5A 1SJ6A 2VAFA 2KP1A 4K0NA 2B1KA 2H0IA 1OYJA 1T7PB 2PUKC 4KE3A 5LD0A 2H6YA 3FZ4A 1T4YA 3CXGA 2FWGA 3QFAC 5L71A 2PERA 2GS3A 3APQA 1A2JA 2HE3A 4PUFC 1CQHA 4JZQA 1ZYQB 1TU7A 2JADA 2IMIA 3IOSA 1VRSD 3RHBA 3L78A 3W6GA 1XCCA 2FLSA 2BMXA 1N8JA 3C8EA 2GTUA 2CT6A 2MBTA 2MMZA 1GLPA 3IDVA 4NWYA 3HXSA 1V9WA 2IMFA 4I2UA 4DVCA 3N9JA 4Z7XA 2KP2A 5G2ZA 4EC0A 1U88A 1F3BA 3US3A 1PKZA 1J08A 2YJHA 1ZZYA 3WGEA 4BPYA 3TKQA 4MF7A 3GURA 3C1RA 2FA8A 1MDIA 1BG5A 1K0OA 2NPBA 3I6AA 2VLUA 3TGZA 1GP1A 4A5PA 1TKDB 1TJDA 4ZB6A 4TVEA 4KGIA 1UVZA 2VCQA 3EVIA 4RI7A 2LTKA 4G0IA 1OC9A 1ON4A 4MA9A 2VOCA 1AXDA 2HRKA 3H4KA 4FYUA 4KH7A 1SD9A 3TCOA 4EKZA 2YN1A 4P3YB 1TK5B 4KF9A 3DRNA 1XIYA 3ERFA 2PPTA 5ECLB 1CQGA 3ZIVA 2H0GA 5A4WA 4Q5FA 1XBSA 2J9HA 3WT2A 4WXTA 4IBPA 3FZAA 3DD3A 1TW9A 2MMAA 4WKWA 2H73A 2H71A 5KOWA 1X9WB 1VF3A 2FGXA 5IOXA 5IM9A 4GSNA 1VF4A 3QCPA 3KP9A 4KDYA 2RLIA 3LYPA 4ZILA 3LYKA 3HCZA 5CP1A 2WZ9A 1THOA 2GT5A 3KTLA 2MMNA 2YZUA 5DAKA 5ECMB 4TXVA 5IO2A 1EZKA 4X1UA 3ZTLA 5ID2A 2ES7A 1ERWA 2HSHA 3UIWA 1PN0A 2YWMA 2PVQA 3CSIA 3IHGA 3SWLA 4ISDA 1Y6EA 3A2XA 1JHBA 5F8BA 2A4HA 3QOUA 2QC7A 2GSRA 3M0FA 1S3CA 1M99A 5KN1A 4EO3A 2C1YA 2K6VA 1U87A 4IGJA 2O7KA 1OC3A 1R5PA 1AUCA 3VFIA 3GH9A 5C04A 4MZWA 4D73B 1WOUA 5AGYA 1Z5YE 3D22A 1WP0A 1ACVA 5CRHA 4CY6A 4WEYA 1H75A 2R0GA 2B6MA 3MNGA 3APOA 4TR1A 1AQXA 3KD0A 2H75A 5J9CA 2NTOA 2EIOA 2GGTA 2VO4A 2C0FA 3KM6A 2VL2C 2H6ZA 4HI7A 4NV5A 4V1Ap 5B6MA 2V32A 1E2YA 4JE1A 4NHWA 2WJUA 1YJ6A 5B8BA 4LL1B 2WB9A 2DJJA 4HEA2 5F07A 1FVJA 5DALA 2I4AA 4HUAA 3D5JA 1TRSA 3R2QA 4IVFA 1XWAA 2HLSA 1Z9HA 1WWJA 17GSA 5IO0A 4DSRA 4ZB8A 4ZIJA 3HJMA 4HZ4A 2M80A 3EMXA 3EU4A 2DJ0A 4X0XA 2B5EA 1ZYEA 3GSTA 1GLQA 1M0UA 4FYCA 4PGTA 4XS4A 1VF2A 2XPEA 7GSSA 2RM6A 4IKHA 3LG6A 4ZBAA 4K7NA 1R5AA 6GSSA 5H5SA 4MMMA 1SK1A 4ML6A 4GQCA 3TKRA 1O7UA 1SJZA 2DMMA 5A4VA 3UL3A 2RIIA 2P5QA 4K2DA 3Q19A 4MJAA 5DQYA 1X5DA 1Z7RA 5ENUA 2XC2A 3PR8A 5EY6A 4OO4A 4POBA 1XVWA 2HI7A 6GSWA 4OFMA 4I5QA 4BA7A 3F9UA 1JZDA 4FQUA 1A2MA 2WFCA 2NVLA 1TK0B 2HZEA 1RK4A 3MDKA 3VURA 2LQQA 3ZMKA 2ON5A 2ZUPA 2DJ2A 4YH2A 3EYTA 1FOHA 1SK2A 1MTCA 4PUAA 1R4WA 4YAPA 2I3YA 4FO5A 5GSTA 1GUKA 4GRFA 1SKWB 2H66A 2VM2A 2C8UA 1BEDA 4YAVA 5CRGA 1QGVA 4XRDA 4ID0A 1GSQA 3TKSE 3WYWA 4HQZA 1NM3A 5ECKB 1TDIA 4HJ2A 1KNGA 3BJ5A 2LNTA 4NXIA 3WGDA 2V41A 1PQNA 3LORA 1A24A 20GSA 3UVHA 1THXA 1M9BA 5G1LA 3ZFLA 3FEUA 1PL2A 2YV9A 2L6DA 3BOAA 3IHQA 1ILOA 2YP6A 3QD9A 2P31A 3HJPA 4K5SA 1ERVA 3LEFA 1T8EB 2CQ9A 2B3SA 3HY2A 1S3AA 3MSZA 3LWAA 3VK9A 4ILFA 2OE3A 2GZYA 2X4AA 2CA8A 1JLVA 2A2PA 4KW6A 3ZLPA 5ELGA 4I97A 3DYRA 1T1VA 2HRNA 4E8HA 5ECHB 1G6WA 3D0ZA 1YF1A 3F0IA 4K0GA 4XRAA 3G9BA 1TRVA 5KOXA 1M2BA 5J3RA 4BIKA 1FVKA 3A5WA 1B4PA 1AIUA 2IWTA 1WJKA 4QL9A 1S3RA 3MWHA 4HJMA 5GSSA 1SKRB 13GSA 3F6DA 3IC4A 1PL1A 5IMFA 4Q5RA 1V58A 5F06A 1ZGNA 3KTBA 3ZMLA 3QAVA 3LSZA 4MH2A 1HNAA 1EGOA 1SL0B 5G5FA 3ZVJA 1Y25A 4K5RA 4KDXA 1ST9A 2EC4A 4F03A 2F51A 3WD6A 1TK8B 1FG4A 4MLYA 2MBSA 2HZFA 3GV1A 1PKWA 4KNDA 1E6BA 2E2GA 4GXZA 2VD1A 3A2VA 3DXBA 4MK3A 2CVBA 2HRAA 2B7KA 3QR6A 1PGTA 2ZCTA 5J5NA 2AYTA 4HU9A 2R3XA 4XS6A 4F0CA 2VL2A 3ZITA 5B7CA 5H5QA 1FO5A 2C3QA 2J23A 3VWUA 5HR3A 3UBLA 3ERGA 3HVNA 4ZL7A 4ECJA 3V1WA 4I6XA 2REMA 1B4QA 2D2ZA 1O8XA 5ECIB 4BVXB 4OFTA 3IV4A 3EC3A 4NAXA 1GSFA 3BCKA 3PPUA 2R6KA 1PFOA 1MDJA 3GKKA 2DIZA 2HT9A 2I9HA 3DGQA 2HNLA 3BBYA 2IFQB 4MF6A 4MF5A 1PN9A 4ZBDA 3G7YA 1H4OA 4IW9A 2H76A 3PGTA 2CX3A 1K0MA 3QAGA 3KGKA 3ED3A 1T00A 2TIRA 3UJ1A 4AJ7A 3GRXA 3ZZXA 2A4VA 3Q6OA 3H93A 2DBCA 1U6TA 1LBKA 3GL3A 2H74A 2V6KA 4JR4A 3GIXA 5ABRA 3TRPA 4WBJA 2WGRA 2B5YA 4G19A 4I2TA 3M8NA 1G7EA 3HVVA 5D96A 3QDNA 5CREA 2F8FA 10GSA 4ZL8A 2F8AA 4PXOA 3BD2A 5AN1A 3C73A 1EOGA 1M2AA 2HRFA 4POLA 2GQMA 3TRXA 4GQFA 1QK8A 3IE3A 5IMAA 4KAEA 2TRCP 4ECIA 1ERUA 3FKFA 1XXUA 3KMOA 1A2LA 2C0DA 5HFGA 4F82A 2H72A 1SD8A 5CRDA 3RBTA 2FD3A 2RUEA 1EWXA 1NW2A 4PQIA 2I1UA 3KXOA 3IRAA 5ECSA 2C3NA 1B9XC 1Z3EA 1SKSB 1X5CA 2C3TA 4FIWA 2JU5A 4HOJA 5LNKe 2NDOA 1Z7PA 1I9DA 1QXHA 2R0CA 3O76A 2VLVA 2GQLA 4GTUA 5D9WA 1DE1A 1A8LA 2C4JA 2YNXA 1XWBA 2YJ7A 3RHCA 4K7OA 1GSSA 5EL8A 4V1Ag 2WRTA
chains in the Genus database with same CATH topology
1BQ7A 3JCML 3ZL5A 1FHEA 1X0RA 2XHFA 2N5BA 1PX6A 4D73A 5HR0A 2VCXA 3F63A 2O85A 1ML6A 5IIZA 2XBQA 3F4RA 3P90A 5GAND 3IK9A 3HZ8A 3A5IA 6GSYA 3HA9A 6GSVA 3CBUA 3D4TA 1OC8A 3HJOA 1ABAA 1Z6NA 4MZCA 3F3RA 3FW2A 5DBQA 3D4MA 4TR0A 1DE2A 2V2GA 4I8BA 4ECBA 2JZSA 2DMLA 4IP1A 3GTUB 4XIHA 5JWOB 3IAM2 4WF5A 2PGTA 5IQYA 1K0AA 3HDCA 3EMPA 3KCMA 4K2XA 3GX8A 1K3OA 1SU9A 2R4VA 4Q5NA 2X99A 1W89A 2KUCA 4N11A 1F3AA 2DLXA 3GKXA 1WE0A 3WT1A 4AGSA 1AW9A 5D9TA 2VCWA 4CY8A 2PMTA 1I5GA 3LXZA 4ECCA 1X5EA 2H1GA 2XBIA 5JCGA 3ZIJA 5G31A 2CVDA 4GCIA 3GNJA 2KLXA 2WULA 3ME7A 1F9MA 9GSSA 2N5FA 3FRCA 3VPQA 3CSHA 1GUHA 3GFKA 3NOFA 4NPBA 1PSQA 4L0WA 4O5UA 1T4ZA 5ECQB 1Q98A 2VL3A 1YQ1A 2FWEA 3KP8A 2LUSA 5CYYA 2B7JA 1JLWA 3E3EA 5GZZB 3LW9A 3VI5A 3O6TA 4Z2UA 4DSSB 1TRUA 5KN2A 3KZQA 1TI3A 2YCDA 2LJKA 4K6XA 3FY7A 3IXRA 4IJ3A 3IR4A 2IPAA 1QMVA 2PN8A 1EEJA 2M72A 2LJRA 2LRCA 4J57E 4TR4A 5IOWA 2H6XA 2C0EA 1FW1A 2CV4A 3GH6A 5BMUA 5H5RA 3M9JA 2GZPA 4OCEA 1TOFA 4GSTA 1BX9A 2IN3A 3FYGA 3DWVA 5B6NA 3LXTA 1XFLA 1OE8A 1X9MB 4KDUA 2B1LA 4TW5A 2G0FA 2PU9C 3MYDA 2WS2A 4XCSA 6GSTA 2TRXA 1HD2A 4OFNA 19GSA 4WBRD 3VWWA 1YKAA 1XOAA 5D9VA 3FZ9A 3KEBA 2QA2A 1OE7A 4N10A 2Z9SA 1IYHA 1GTBA 2LJAA 4KSOA 5ECOB 4YQMA 4MJCA 8GSSA 3DVXA 3TDGA 1V98A 1ZL9A 1JZWA 1T3BA 1K0NA 2FWFA 4MH3A 4KSMA 2E7PA 3DIEA 4WR5A 3HVSA 1DBYA 1SYXA 3DEXA 4EE0A 1JZRA 1YEPA 4O92A 1K3LA 2FWHA 1GL8A 1A0RP 2VCTA 5IMCA 4MCUA 3EWLA 2YANA 2DKIA 1RW1A 1GSYA 2GZZA 2H0HA 4EVMA 2ZNMA 1B8XA 3GKMA 1TU8A 2OADA 4WETA 3TOTA 4RQRA 1MEKA 4O32A 4EDZA 3I43A 3EE2A 4PX1A 1F2EA 4CW9A 2GSTA 2PWJA 5CAXA 1NHYA 3QMXA 3LGCA 1AQWA 1UC7A 1W4VA 5C00A 4BL7B 4MPFA 1SK0A 1PX7A 1GUMA 3FR6A 2RM5A 1MD3A 3RAZA 2X8CA 4KB3A 5HFIA 4LA1A 3Q18A 5G5EA 2CX4A 1YKCA 2IJYA 4KX4A 2IIYA 1J0FA 2AHEA 5DJLA 3GN3A 3R3EA 2E0QA 1Z6MA 2V6OA 1JFUA 3QFBC 1G7OA 3GA4A 1R7HA 1GH2A 2R2JA 1GSEA 1F37A 2HSYA 2DJKA 2DIYA 3ZFBA 2PBJA 2VCVA 2OACA 3I69A 2FUG2 5D9XA 1FB0A 3L9UA 2FNOA 4PNFA 4BVYB 3CTFA 5LCZA 1A8YA 1QUWA 4BVXA 2IMKA 3HVXA 1TXXA 2V1MA 12GSA 3J7Yk 3GUSA 1EV9A 3TJBA 2DJ1A 3GHAA 2LKUA 2GVPA 3TOUA 4GLTA 1GTIA 5F0GA 1K3YA 2OBIA 1LU4A 4ZXGA 1AQVA 3CSJA 2H1DA 3D21A 4NV2A 2IMEA 4GF0A 1MDKA 5JWQB 2IFQA 4PNGA 2OBKA 4MABA 2GDRA 1A23A 1XVQA 3ERWA 3RDWA 1WPIA 1YY7A 2X8HA 2FY6A 5A4UA 3O3TA 4G0LA 2LRTA 2K8VA 3DMLA 2GSSA 2F9SA 5HR2A 1QFNA 2AAWA 1GTUA 5FHIA 1SYRA 1PRXA 3EU3A 1BJXA 1K0CA 1NHOA 1ZMAA 2K18A 2VLTA 3AY8A 3EURA 3TJGA 2O89A 4ZL9A 3CTGA 3GL5A 2X64A 5GAPD 2B5XA 14GSA 4IHUA 3PINA 3HZ4A 2G2QA 3P2AA 1PMTA 3MAKA 2LV3A 2BJXA 1YZXA 5DCGA 4MJEA 4TXOB 3TJJA 2R37A 3F6FA 3F8UA 4TR3A 5HQPA 3GMFA 4OWYA 4XTSA 1MD4A 1XWGA 1XWKA 3ZYWA 4LMWA 4DEJA 3D6IA 1IYIA 1B48A 3IA1A 4WF4A 4X4JA 2QA1A 3IPZA 1YEXA 1HYUA 3Q74A 3DKSA 5KEJA 1A0FA 2VUPA 4N0ZA 1YDKA 3EPTA 2NBSA 4JR6A 4L8EA 1XPVA 2L4CA 3LJRA 3FMWA 1KTEA 2CAQA 4TOPA 1V2AA 2OE1A 3UBKA 2CVKA 1ZOFA 1AAZA 1EV4A 2AUVA 4O5QA 3FHKA 5D73A 2YWNA 5JWRB 5JCUA 1O81A 5D93A 2WCIA 4IN0A 3UOMA 3ZRDA 4ULXA 2MYGA 4EIQA 4KUNA 4G2EA 1XW6A 1UA5A 2FCHA 3RPPA 16GSA 2HXKA 2QSIA 5JCWA 4TKYA 3F3QA 3RPNA 1WMJA 3P8WA 4J56E 2VD0A 2X49A 3HKRA 4OO5A 4AJ6A 4EIPA 5KN3A 1URMA 3GTUA 2A2RA 4NHZA 2E2MA 4L5LA 6GSUA 3KH7A 4HS1A 1VGLA 1OAZA 4HQSA 3QAWA 2JSZA 4K8MA 4N30A 4JRRA 3I9V2 5G1KA 2L5OA 5J9BA 4V2NA 3UAPA 3TUEA 3ZREA 4PQHA 3VWVA 2ON7A 5ECRB 1SL1B 3C71A 1GTAA 1HNCA 4JBBA 4G10A 1PD21 3L4NA 2UZ8A 4EF0A 2EIQA 4EDYA 3TJFA 4IS0A 4MNNA 4MZBA 3M3MA 3MIXA 2PVOC 1HNBA 4HU7A 2DSAA 1B9YC 4K7IA 2RUFA 1KEBA 1BAYA 4ACSA 3TKSC 5AISA 1F6MC 2L57A 1FAAA 3A2WA 4L0UA 5IMDA 1TTZA 1OC9B 3N5OA 3TKPA 3FK8A 3P7XA 3IAS2 2YWOA 1SL2B 3NIVA 2QKEA 1EP7A 2FA4A 5DJMA 4DSSA 2I81A 3SBCA 2BTOT 3UVTA 5F05A 4F0BA 3KJYA 4POMA 4LL4B 2YV7A 2GQKA 2OE0A 1SENA 2JACA 4FH8A 11GSA 1XZOA 2M46A 5COHA 5DVBA 4Z2RA 3KMNA 2CZ2A 2O8VB 6GSXA 2FHEA 5IPHA 1GSUA 1XOBA 3ME8A 2GLRA 4PQ1A 1FB6A 5ECPB 3IBHA 4IQAA 4YQUA 1M9AA 5CNWA 3GX0A 5DAKB 4OD7A 5ID2B 1Q4JA 4LMVA 3G7JA 3HD5A 1K0BA 4TRXA 3S9FA 4Q5QA 1ERTA 5BRTA 4MP4A 4J2FA 1M2DA 2JSYA 4L5OA 3VPTA 2P5RA 3FR9A 5FT3A 2L6CA 3CRUA 2DJ3A 2N5AA 5HR1A 5D8IA 4RI6A 5B8AA 4GSSA 22GSA 4NMUA 5ELAA 5J4UA 2LNSA 2CAIA 2LEGA 4V2LA 4CHSA 5EVOA 1UN2A 1HQOA 2P0GA 5IMVA 5CO3A 1KBNA 4ZBBA 1O6JA 3LFLA 1G6YA 2R0PA 1V57A 1JZOA 3IC8A 4F9ZA 1GNEA 3L9SA 3KH9A 3QPMA 2L5LA 3NZNA 1OKDA 4CDOA 3U6VA 5IPGA 1EEMA 4QL7A 3E9JB 3LQ7A 4TR1B 1BYEA 4K1FA 4OCFA 3FZ5A 4ZB9A 2LSTA 2H19A 5DQSA 1RQMA 2JZRA 3TB2A 2CZ3A 1N2AA 1SJIA 2K8SA 4ML1A 5AIVA 1ZCPA 1OKTA 2VCZA 4OMVA 4G0KA 4PTSA 1TP9A 4KCEA 5DALB 4JU5A 4AF2A 1WIKA 4HZ2A 4JEDA 4N0VA 2H1BA 4YQVA 3CMIA 4LLRA 2AJQB 2DC5A 2GT6A 4BL7A 2LS5A 4DSQA 3UMAA 5E59A 2WDUA 1AC1A 3C7MA 4WR4A 4IQ1A 4EXJA 5DCHA 4USSA 1U3IA 3TRQA 1GSDA 4E8EA 3IK7A 4EL1A 1TRWA 2AB6A 3W8JA 1XW9A 4XS4B 4HDEA 2LQOA 3J7Yb 2YWIA 4ICYA 4O7HA 2A2SA 4MDCA 4Z2TA 5G30A 1ZYPA 3A3TA 3KIJA 1GRXA 1G0TA 2YPMA 1EGRA 1OVNA 3ZVJD 3F4SA 4EUYA 1ZYNA 2C0GA 1J9BA 2HSMA 2HYXA 4YKGA 4BVYA 2KOKA 5KN0A 1O85A 3W8SA 5J41A 5INYA 2OJLA 2JL4A 4H86A 3UEMA 1LJRA 2LRNA 4MJBA 4RQXA 3H79A 4V2MA 1TI1A 3H8QA 4IP6A 2HZEB 4KCAA 3M1GA 1K0DA 2KHPA 4RUVA 3BCIA 1FOVA 1PA3A 3GSSA 2C80A 3VI7A 1EP8A 3WGXA 2H1AA 1GULA 2OA7A 5HFKA 4X43A 3ISOA 3M9KA 18GSA 1EOHA 2X8GA 2H01A 5DDLA 3C1SA 1M7TA 2YZHA 3DVWA 3VLNA 1C72A 1GNWA 3UARA 1V40A 3K8NA 3VWXA 3GKNA 3TKSA 2XPDA 1NSWA 1QQ2A 1DSBA 2EIRA 4BWSA 3CYNA 3PH9A 5E4WA 4XS1A 1R26A 2L59A 3U5RE 4BWQA 2OKAA 1XWCA 5AIXA 5EPFA 4MPGA 4AJ8A 3F4TA 2HFDA 2VL9A 3EINA 2R5GA 1YF0A 2O87A 2MZCA 2YOIA 2DKHA 1X9SB 4F2IA 2K9FA 5IMZA 1O8WA 3G7IA 5FWGA 4TXOA 2H70A 4TN8A 3L9VA 4K9ZA 1S3DA 4IELA 2VIMA 4POKA 4O5RA 3E0UA 2QGVA 4XHMA 3OR5A 3FR3A 4GWRA 1GWCA 5A5KA 4FYBA 2H30A 4PURA 2IL3A 5CRWA 3HHVA 1O73A 4YKFA 4QQ7A 2AV4A 4IJIA 4G9HA 2VM1A 3APSA 1U3AA 1USBA 5ECNB 1DUGA 2L4QA 4KA0A 3HYPA 3GYKA 2MMOA 2GSQA 3H1NA 3TJKA 2ALBA 2JZTA 3CRTA 1WRYA 2F3MA 2H8LA 2IMDA 3L0HA 1VF1A 1XW5A 1SJ6A 2VAFA 2KP1A 4K0NA 2B1KA 2H0IA 1OYJA 1T7PB 2PUKC 4KE3A 5LD0A 2H6YA 3FZ4A 1T4YA 3CXGA 2FWGA 3QFAC 5L71A 2PERA 2GS3A 3APQA 1A2JA 2HE3A 4PUFC 1CQHA 4JZQA 1ZYQB 1TU7A 2JADA 2IMIA 3IOSA 1VRSD 3RHBA 3L78A 3W6GA 1XCCA 2FLSA 2BMXA 1N8JA 3C8EA 2GTUA 2CT6A 2MBTA 2MMZA 1GLPA 3IDVA 4NWYA 3HXSA 1V9WA 2IMFA 4I2UA 4DVCA 3N9JA 4Z7XA 2KP2A 5G2ZA 4EC0A 1U88A 1F3BA 3US3A 1PKZA 1J08A 2YJHA 1ZZYA 3WGEA 4BPYA 3TKQA 4MF7A 3GURA 3C1RA 2FA8A 1MDIA 1BG5A 1K0OA 2NPBA 3I6AA 2VLUA 3TGZA 1GP1A 4A5PA 1TKDB 1TJDA 4ZB6A 4TVEA 4KGIA 1UVZA 2VCQA 3EVIA 4RI7A 2LTKA 4G0IA 1OC9A 1ON4A 4MA9A 2VOCA 1AXDA 2HRKA 3H4KA 4FYUA 4KH7A 1SD9A 3TCOA 4EKZA 2YN1A 4P3YB 1TK5B 4KF9A 3DRNA 1XIYA 3ERFA 2PPTA 5ECLB 1CQGA 3ZIVA 2H0GA 5A4WA 4Q5FA 1XBSA 2J9HA 3WT2A 4WXTA 4IBPA 3FZAA 3DD3A 1TW9A 2MMAA 4WKWA 2H73A 2H71A 5KOWA 1X9WB 1VF3A 2FGXA 5IOXA 5IM9A 4GSNA 1VF4A 3QCPA 3KP9A 4KDYA 2RLIA 3LYPA 4ZILA 3LYKA 3HCZA 5CP1A 2WZ9A 1THOA 2GT5A 3KTLA 2MMNA 2YZUA 5DAKA 5ECMB 4TXVA 5IO2A 1EZKA 4X1UA 3ZTLA 5ID2A 2ES7A 1ERWA 2HSHA 3UIWA 1PN0A 2YWMA 2PVQA 3CSIA 3IHGA 3SWLA 4ISDA 1Y6EA 3A2XA 1JHBA 5F8BA 2A4HA 3QOUA 2QC7A 2GSRA 3M0FA 1S3CA 1M99A 5KN1A 4EO3A 2C1YA 2K6VA 1U87A 4IGJA 2O7KA 1OC3A 1R5PA 1AUCA 3VFIA 3GH9A 5C04A 4MZWA 4D73B 1WOUA 5AGYA 1Z5YE 3D22A 1WP0A 1ACVA 5CRHA 4CY6A 4WEYA 1H75A 2R0GA 2B6MA 3MNGA 3APOA 4TR1A 1AQXA 3KD0A 2H75A 5J9CA 2NTOA 2EIOA 2GGTA 2VO4A 2C0FA 3KM6A 2VL2C 2H6ZA 4HI7A 4NV5A 4V1Ap 5B6MA 2V32A 1E2YA 4JE1A 4NHWA 2WJUA 1YJ6A 5B8BA 4LL1B 2WB9A 2DJJA 4HEA2 5F07A 1FVJA 5DALA 2I4AA 4HUAA 3D5JA 1TRSA 3R2QA 4IVFA 1XWAA 2HLSA 1Z9HA 1WWJA 17GSA 5IO0A 4DSRA 4ZB8A 4ZIJA 3HJMA 4HZ4A 2M80A 3EMXA 3EU4A 2DJ0A 4X0XA 2B5EA 1ZYEA 3GSTA 1GLQA 1M0UA 4FYCA 4PGTA 4XS4A 1VF2A 2XPEA 7GSSA 2RM6A 4IKHA 3LG6A 4ZBAA 4K7NA 1R5AA 6GSSA 5H5SA 4MMMA 1SK1A 4ML6A 4GQCA 3TKRA 1O7UA 1SJZA 2DMMA 5A4VA 3UL3A 2RIIA 2P5QA 4K2DA 3Q19A 4MJAA 5DQYA 1X5DA 1Z7RA 5ENUA 2XC2A 3PR8A 5EY6A 4OO4A 4POBA 1XVWA 2HI7A 6GSWA 4OFMA 4I5QA 4BA7A 3F9UA 1JZDA 4FQUA 1A2MA 2WFCA 2NVLA 1TK0B 2HZEA 1RK4A 3MDKA 3VURA 2LQQA 3ZMKA 2ON5A 2ZUPA 2DJ2A 4YH2A 3EYTA 1FOHA 1SK2A 1MTCA 4PUAA 1R4WA 4YAPA 2I3YA 4FO5A 5GSTA 1GUKA 4GRFA 1SKWB 2H66A 2VM2A 2C8UA 1BEDA 4YAVA 5CRGA 1QGVA 4XRDA 4ID0A 1GSQA 3TKSE 3WYWA 4HQZA 1NM3A 5ECKB 1TDIA 4HJ2A 1KNGA 3BJ5A 2LNTA 4NXIA 3WGDA 2V41A 1PQNA 3LORA 1A24A 20GSA 3UVHA 1THXA 1M9BA 5G1LA 3ZFLA 3FEUA 1PL2A 2YV9A 2L6DA 3BOAA 3IHQA 1ILOA 2YP6A 3QD9A 2P31A 3HJPA 4K5SA 1ERVA 3LEFA 1T8EB 2CQ9A 2B3SA 3HY2A 1S3AA 3MSZA 3LWAA 3VK9A 4ILFA 2OE3A 2GZYA 2X4AA 2CA8A 1JLVA 2A2PA 4KW6A 3ZLPA 5ELGA 4I97A 3DYRA 1T1VA 2HRNA 4E8HA 5ECHB 1G6WA 3D0ZA 1YF1A 3F0IA 4K0GA 4XRAA 3G9BA 1TRVA 5KOXA 1M2BA 5J3RA 1FVKA 3A5WA 1B4PA 1AIUA 2IWTA 1WJKA 4QL9A 3MWHA 4HJMA 5GSSA 1SKRB 13GSA 3F6DA 3IC4A 1PL1A 5IMFA 4Q5RA 1V58A 5F06A 1ZGNA 3KTBA 3ZMLA 3QAVA 3LSZA 4MH2A 1HNAA 1EGOA 1SL0B 5G5FA 3ZVJA 1Y25A 4K5RA 4KDXA 1ST9A 2EC4A 4F03A 2F51A 3WD6A 1TK8B 1FG4A 4MLYA 2MBSA 2HZFA 3GV1A 1PKWA 4KNDA 1E6BA 2E2GA 4GXZA 2VD1A 3A2VA 3DXBA 4MK3A 2CVBA 2HRAA 2B7KA 3QR6A 1PGTA 2ZCTA 5J5NA 2AYTA 4HU9A 2R3XA 4XS6A 4F0CA 2VL2A 3ZITA 5B7CA 5H5QA 1FO5A 2C3QA 2J23A 3VWUA 5HR3A 3UBLA 3ERGA 4ZL7A 4ECJA 3V1WA 4I6XA 2REMA 1B4QA 2D2ZA 1O8XA 5ECIB 4BVXB 4OFTA 3IV4A 3EC3A 4NAXA 1GSFA 3BCKA 3PPUA 2R6KA 1MDJA 3GKKA 2DIZA 2HT9A 2I9HA 3DGQA 2HNLA 3BBYA 2IFQB 4MF6A 4MF5A 1PN9A 4ZBDA 3G7YA 1H4OA 4IW9A 2H76A 3PGTA 2CX3A 1K0MA 3QAGA 3KGKA 3ED3A 1T00A 2TIRA 3UJ1A 4AJ7A 3GRXA 3ZZXA 2A4VA 3Q6OA 3H93A 2DBCA 1U6TA 1LBKA 3GL3A 2H74A 2V6KA 4JR4A 3GIXA 5ABRA 3TRPA 4WBJA 2WGRA 2B5YA 4G19A 4I2TA 3M8NA 1G7EA 3HVVA 5D96A 3QDNA 5CREA 2F8FA 10GSA 4ZL8A 2F8AA 4PXOA 3BD2A 5AN1A 3C73A 1EOGA 1M2AA 2HRFA 4POLA 2GQMA 3TRXA 4GQFA 1QK8A 3IE3A 5IMAA 4KAEA 2TRCP 4ECIA 1ERUA 3FKFA 1XXUA 3KMOA 1A2LA 2C0DA 5HFGA 4F82A 2H72A 1SD8A 5CRDA 3RBTA 2FD3A 2RUEA 1EWXA 1NW2A 4PQIA 2I1UA 3KXOA 3IRAA 5ECSA 2C3NA 1B9XC 1Z3EA 1SKSB 1X5CA 2C3TA 4FIWA 2JU5A 4HOJA 5LNKe 2NDOA 1Z7PA 1I9DA 1QXHA 2R0CA 3O76A 2VLVA 2GQLA 4GTUA 5D9WA 1DE1A 1A8LA 2C4JA 2YNXA 1XWBA 2YJ7A 3RHCA 4K7OA 1GSSA 5EL8A 4V1Ag 2WRTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BQ7 A;  3JCM L;  3ZL5 A;  1FHE A;  1X0R A;  2XHF A;  2N5B A;  1PX6 A;  4D73 A;  5HR0 A;  2VCX A;  3F63 A;  2O85 A;  1ML6 A;  5IIZ A;  2XBQ A;  3F4R A;  3P90 A;  5GAN D;  3IK9 A;  3HZ8 A;  6GSY A;  3HA9 A;  6GSV A;  3CBU A;  3D4T A;  1OC8 A;  3HJO A;  1ABA A;  1Z6N A;  4MZC A;  3F3R A;  3FW2 A;  5DBQ A;  3D4M A;  4TR0 A;  1DE2 A;  2V2G A;  4I8B A;  4ECB A;  2JZS A;  2DML A;  4IP1 A;  3GTU B;  4XIH A;  5JWO B;  3IAM 2;  4WF5 A;  2PGT A;  5IQY A;  1K0A A;  3HDC A;  3EMP A;  3KCM A;  3GX8 A;  1K3O A;  1SU9 A;  2R4V A;  4Q5N A;  2X99 A;  1W89 A;  2KUC A;  4N11 A;  1F3A A;  2DLX A;  3GKX A;  1WE0 A;  3WT1 A;  4AGS A;  1AW9 A;  5D9T A;  2VCW A;  2PMT A;  1I5G A;  3LXZ A;  4ECC A;  1X5E A;  2H1G A;  2XBI A;  5JCG A;  3ZIJ A;  5G31 A;  2CVD A;  4GCI A;  3GNJ A;  2KLX A;  2WUL A;  3ME7 A;  1F9M A;  9GSS A;  2N5F A;  3FRC A;  3VPQ A;  3CSH A;  1GUH A;  3GFK A;  3NOF A;  4NPB A;  1PSQ A;  4L0W A;  1T4Z A;  5ECQ B;  1Q98 A;  2VL3 A;  1YQ1 A;  2FWE A;  3KP8 A;  2LUS A;  5CYY A;  2B7J A;  1JLW A;  3E3E A;  5GZZ B;  3VI5 A;  3O6T A;  4DSS B;  1TRU A;  5KN2 A;  3KZQ A;  1TI3 A;  2YCD A;  2LJK A;  4K6X A;  3FY7 A;  3IXR A;  4IJ3 A;  3IR4 A;  2IPA A;  1QMV A;  2PN8 A;  1EEJ A;  2M72 A;  2LJR A;  2LRC A;  4J57 E;  4TR4 A;  5IOW A;  2H6X A;  2C0E A;  1FW1 A;  2CV4 A;  3GH6 A;  5H5R A;  3M9J A;  2GZP A;  4OCE A;  1TOF A;  4GST A;  1BX9 A;  2IN3 A;  3FYG A;  3DWV A;  5B6N A;  3LXT A;  1XFL A;  1OE8 A;  1X9M B;  4KDU A;  2B1L A;  4TW5 A;  2G0F A;  2PU9 C;  2WS2 A;  4XCS A;  6GST A;  2TRX A;  1HD2 A;  4OFN A;  19GS A;  4WBR D;  3VWW A;  1YKA A;  1XOA A;  5D9V A;  3FZ9 A;  3KEB A;  1OE7 A;  4N10 A;  2Z9S A;  1IYH A;  1GTB A;  2LJA A;  4KSO A;  5ECO B;  4YQM A;  4MJC A;  8GSS A;  3DVX A;  3TDG A;  1V98 A;  1ZL9 A;  1JZW A;  1T3B A;  1K0N A;  2FWF A;  4MH3 A;  4KSM A;  2E7P A;  3DIE A;  4WR5 A;  3HVS A;  1DBY A;  1SYX A;  3DEX A;  4EE0 A;  1JZR A;  1YEP A;  4O92 A;  1K3L A;  2FWH A;  1GL8 A;  1A0R P;  2VCT A;  5IMC A;  4MCU A;  3EWL A;  2YAN A;  1RW1 A;  1GSY A;  2GZZ A;  2H0H A;  4EVM A;  2ZNM A;  1B8X A;  3GKM A;  1TU8 A;  2OAD A;  4WET A;  3TOT A;  4RQR A;  1MEK A;  4O32 A;  4EDZ A;  3I43 A;  3EE2 A;  4PX1 A;  1F2E A;  4CW9 A;  2GST A;  2PWJ A;  5CAX A;  1NHY A;  3QMX A;  3LGC A;  1AQW A;  1UC7 A;  1W4V A;  5C00 A;  4MPF A;  1SK0 A;  1PX7 A;  1GUM A;  3FR6 A;  2RM5 A;  1MD3 A;  3RAZ A;  2X8C A;  4KB3 A;  5HFI A;  4LA1 A;  3Q18 A;  5G5E A;  2CX4 A;  1YKC A;  2IJY A;  4KX4 A;  2IIY A;  1J0F A;  2AHE A;  5DJL A;  3GN3 A;  2E0Q A;  1Z6M A;  2V6O A;  1JFU A;  3QFB C;  1G7O A;  3GA4 A;  1R7H A;  1GH2 A;  2R2J A;  1GSE A;  1F37 A;  2HSY A;  2DJK A;  2DIY A;  3ZFB A;  2PBJ A;  2VCV A;  2OAC A;  3I69 A;  2FUG 2;  5D9X A;  1FB0 A;  3L9U A;  2FNO A;  4PNF A;  3CTF A;  5LCZ A;  1A8Y A;  1QUW A;  4BVX A;  2IMK A;  3HVX A;  1TXX A;  2V1M A;  12GS A;  3J7Y k;  3GUS A;  1EV9 A;  3TJB A;  2DJ1 A;  3GHA A;  2LKU A;  2GVP A;  3TOU A;  4GLT A;  1GTI A;  5F0G A;  1K3Y A;  2OBI A;  1LU4 A;  4ZXG A;  1AQV A;  3CSJ A;  2H1D A;  3D21 A;  4NV2 A;  2IME A;  4GF0 A;  1MDK A;  5JWQ B;  2IFQ A;  4PNG A;  2OBK A;  4MAB A;  2GDR A;  1A23 A;  1XVQ A;  3ERW A;  3RDW A;  1WPI A;  1YY7 A;  2X8H A;  2FY6 A;  5A4U A;  3O3T A;  2LRT A;  2K8V A;  3DML A;  2GSS A;  2F9S A;  5HR2 A;  1QFN A;  2AAW A;  1GTU A;  5FHI A;  1SYR A;  1PRX A;  3EU3 A;  1BJX A;  1K0C A;  1NHO A;  1ZMA A;  2K18 A;  2VLT A;  3AY8 A;  3EUR A;  3TJG A;  2O89 A;  4ZL9 A;  3CTG A;  3GL5 A;  2X64 A;  5GAP D;  2B5X A;  14GS A;  4IHU A;  3PIN A;  3HZ4 A;  2G2Q A;  3P2A A;  1PMT A;  3MAK A;  2LV3 A;  2BJX A;  1YZX A;  5DCG A;  4MJE A;  4TXO B;  3TJJ A;  2R37 A;  3F6F A;  3F8U A;  4TR3 A;  5HQP A;  3GMF A;  4OWY A;  4XTS A;  1MD4 A;  1XWG A;  1XWK A;  3ZYW A;  4LMW A;  4DEJ A;  3D6I A;  1IYI A;  1B48 A;  3IA1 A;  4WF4 A;  3IPZ A;  1YEX A;  1HYU A;  3Q74 A;  3DKS A;  5KEJ A;  1A0F A;  2VUP A;  4N0Z A;  1YDK A;  2NBS A;  4JR6 A;  4L8E A;  1XPV A;  2L4C A;  3LJR A;  1KTE A;  2CAQ A;  4TOP A;  1V2A A;  2OE1 A;  3UBK A;  2CVK A;  1ZOF A;  1AAZ A;  1EV4 A;  2AUV A;  3FHK A;  5D73 A;  2YWN A;  5JWR B;  5JCU A;  1O81 A;  5D93 A;  2WCI A;  4IN0 A;  3UOM A;  3ZRD A;  4ULX A;  2MYG A;  4KUN A;  4G2E A;  1XW6 A;  1UA5 A;  2FCH A;  3RPP A;  16GS A;  2HXK A;  2QSI A;  5JCW A;  4TKY A;  3F3Q A;  3RPN A;  1WMJ A;  3P8W A;  4J56 E;  2VD0 A;  3HKR A;  4OO5 A;  4AJ6 A;  5KN3 A;  1URM A;  3GTU A;  2A2R A;  4NHZ A;  2E2M A;  4L5L A;  6GSU A;  3KH7 A;  4HS1 A;  1VGL A;  1OAZ A;  4HQS A;  3QAW A;  2JSZ A;  4K8M A;  4N30 A;  4JRR A;  3I9V 2;  5G1K A;  2L5O A;  5J9B A;  4V2N A;  3UAP A;  3TUE A;  3ZRE A;  4PQH A;  3VWV A;  2ON7 A;  5ECR B;  1SL1 B;  3C71 A;  1GTA A;  1HNC A;  4JBB A;  4G10 A;  1PD2 1;  3L4N A;  4EF0 A;  2EIQ A;  4EDY A;  3TJF A;  4IS0 A;  4MZB A;  3M3M A;  2PVO C;  1HNB A;  4HU7 A;  2DSA A;  1B9Y C;  4K7I A;  2RUF A;  1KEB A;  1BAY A;  4ACS A;  3TKS C;  5AIS A;  1F6M C;  2L57 A;  1FAA A;  3A2W A;  4L0U A;  5IMD A;  1TTZ A;  1OC9 B;  3N5O A;  3TKP A;  3FK8 A;  3P7X A;  3IAS 2;  2YWO A;  1SL2 B;  3NIV A;  2QKE A;  1EP7 A;  2FA4 A;  5DJM A;  4DSS A;  2I81 A;  3SBC A;  2BTO T;  3UVT A;  5F05 A;  4F0B A;  3KJY A;  4POM A;  4LL4 B;  2YV7 A;  2GQK A;  2OE0 A;  1SEN A;  2JAC A;  4FH8 A;  11GS A;  1XZO A;  2M46 A;  5COH A;  5DVB A;  3KMN A;  2CZ2 A;  2O8V B;  6GSX A;  2FHE A;  5IPH A;  1GSU A;  1XOB A;  3ME8 A;  2GLR A;  4PQ1 A;  1FB6 A;  5ECP B;  3IBH A;  4IQA A;  4YQU A;  1M9A A;  5CNW A;  3GX0 A;  5DAK B;  4OD7 A;  5ID2 B;  1Q4J A;  4LMV A;  3G7J A;  3HD5 A;  1K0B A;  4TRX A;  3S9F A;  4Q5Q A;  1ERT A;  4MP4 A;  4J2F A;  1M2D A;  2JSY A;  4L5O A;  3VPT A;  2P5R A;  3FR9 A;  5FT3 A;  2L6C A;  3CRU A;  2DJ3 A;  2N5A A;  5HR1 A;  5D8I A;  4RI6 A;  5B8A A;  4GSS A;  22GS A;  4NMU A;  5ELA A;  5J4U A;  2LNS A;  2CAI A;  2LEG A;  4V2L A;  4CHS A;  5EVO A;  1UN2 A;  1HQO A;  2P0G A;  5IMV A;  5CO3 A;  1KBN A;  4ZBB A;  1O6J A;  3LFL A;  1G6Y A;  1V57 A;  1JZO A;  4F9Z A;  1GNE A;  3L9S A;  3KH9 A;  3QPM A;  2L5L A;  3NZN A;  1OKD A;  4CDO A;  3U6V A;  5IPG A;  1EEM A;  4QL7 A;  3E9J B;  3LQ7 A;  4TR1 B;  1BYE A;  4K1F A;  4OCF A;  3FZ5 A;  4ZB9 A;  2LST A;  2H19 A;  5DQS A;  1RQM A;  2JZR A;  3TB2 A;  2CZ3 A;  1N2A A;  1SJI A;  2K8S A;  4ML1 A;  5AIV A;  1ZCP A;  1OKT A;  2VCZ A;  4OMV A;  1TP9 A;  4KCE A;  5DAL B;  4JU5 A;  4AF2 A;  1WIK A;  4HZ2 A;  4JED A;  4N0V A;  2H1B A;  4YQV A;  3CMI A;  4LLR A;  2AJQ B;  2DC5 A;  2GT6 A;  4BL7 A;  2LS5 A;  4DSQ A;  3UMA A;  5E59 A;  2WDU A;  1AC1 A;  3C7M A;  4WR4 A;  4IQ1 A;  4EXJ A;  5DCH A;  1U3I A;  3TRQ A;  1GSD A;  4E8E A;  3IK7 A;  4EL1 A;  1TRW A;  2AB6 A;  3W8J A;  1XW9 A;  4XS4 B;  4HDE A;  2LQO A;  3J7Y b;  2YWI A;  4O7H A;  2A2S A;  4MDC A;  5G30 A;  3A3T A;  3KIJ A;  1GRX A;  1G0T A;  2YPM A;  1EGR A;  1OVN A;  3ZVJ D;  3F4S A;  4EUY A;  2C0G A;  1J9B A;  2HYX A;  4BVY A;  2KOK A;  5KN0 A;  1O85 A;  3W8S A;  5J41 A;  5INY A;  2OJL A;  2JL4 A;  4H86 A;  3UEM A;  1LJR A;  2LRN A;  4MJB A;  4RQX A;  3H79 A;  4V2M A;  1TI1 A;  3H8Q A;  4IP6 A;  2HZE B;  4KCA A;  3M1G A;  1K0D A;  2KHP A;  4RUV A;  3BCI A;  1FOV A;  1PA3 A;  3GSS A;  2C80 A;  3VI7 A;  1EP8 A;  3WGX A;  2H1A A;  1GUL A;  2OA7 A;  5HFK A;  4X43 A;  3ISO A;  3M9K A;  18GS A;  1EOH A;  2X8G A;  2H01 A;  5DDL A;  3C1S A;  1M7T A;  2YZH A;  3DVW A;  3VLN A;  1C72 A;  1GNW A;  3UAR A;  1V40 A;  3K8N A;  3VWX A;  3GKN A;  3TKS A;  2XPD A;  1NSW A;  1QQ2 A;  1DSB A;  2EIR A;  4BWS A;  3CYN A;  3PH9 A;  5E4W A;  4XS1 A;  1R26 A;  2L59 A;  3U5R E;  4BWQ A;  2OKA A;  1XWC A;  5AIX A;  5EPF A;  4MPG A;  4AJ8 A;  3F4T A;  2HFD A;  2VL9 A;  3EIN A;  2R5G A;  1YF0 A;  2O87 A;  2MZC A;  2YOI A;  1X9S B;  4F2I A;  2K9F A;  5IMZ A;  1O8W A;  3G7I A;  5FWG A;  4TXO A;  2H70 A;  4TN8 A;  3L9V A;  4K9Z A;  1S3D A;  4IEL A;  2VIM A;  4POK A;  4O5R A;  3E0U A;  2QGV A;  4XHM A;  3OR5 A;  3FR3 A;  4GWR A;  1GWC A;  5A5K A;  4FYB A;  2H30 A;  4PUR A;  2IL3 A;  5CRW A;  3HHV A;  1O73 A;  4QQ7 A;  2AV4 A;  4IJI A;  4G9H A;  2VM1 A;  3APS A;  1U3A A;  1USB A;  5ECN B;  1DUG A;  2L4Q A;  4KA0 A;  3HYP A;  3GYK A;  2MMO A;  2GSQ A;  3H1N A;  3TJK A;  2ALB A;  2JZT A;  3CRT A;  1WRY A;  2F3M A;  2H8L A;  2IMD A;  3L0H A;  1VF1 A;  1XW5 A;  1SJ6 A;  2VAF A;  2KP1 A;  4K0N A;  2B1K A;  2H0I A;  1OYJ A;  1T7P B;  2PUK C;  4KE3 A;  5LD0 A;  2H6Y A;  3FZ4 A;  1T4Y A;  3CXG A;  2FWG A;  3QFA C;  5L71 A;  2PER A;  2GS3 A;  3APQ A;  1A2J A;  2HE3 A;  4PUF C;  1CQH A;  4JZQ A;  1ZYQ B;  1TU7 A;  2JAD A;  2IMI A;  3IOS A;  1VRS D;  3RHB A;  3L78 A;  3W6G A;  1XCC A;  2FLS A;  2BMX A;  1N8J A;  3C8E A;  2GTU A;  2CT6 A;  2MBT A;  2MMZ A;  1GLP A;  3IDV A;  4NWY A;  3HXS A;  1V9W A;  2IMF A;  4I2U A;  4DVC A;  3N9J A;  4Z7X A;  2KP2 A;  5G2Z A;  4EC0 A;  1U88 A;  1F3B A;  3US3 A;  1PKZ A;  1J08 A;  2YJH A;  1ZZY A;  3WGE A;  4BPY A;  3TKQ A;  4MF7 A;  3GUR A;  3C1R A;  2FA8 A;  1MDI A;  1BG5 A;  1K0O A;  2NPB A;  3I6A A;  2VLU A;  3TGZ A;  1GP1 A;  1TKD B;  1TJD A;  4ZB6 A;  4TVE A;  4KGI A;  1UVZ A;  2VCQ A;  3EVI A;  4RI7 A;  2LTK A;  1OC9 A;  1ON4 A;  4MA9 A;  2VOC A;  1AXD A;  3H4K A;  4FYU A;  4KH7 A;  1SD9 A;  3TCO A;  4EKZ A;  2YN1 A;  4P3Y B;  1TK5 B;  3DRN A;  1XIY A;  3ERF A;  2PPT A;  5ECL B;  1CQG A;  3ZIV A;  2H0G A;  5A4W A;  4Q5F A;  1XBS A;  2J9H A;  3WT2 A;  4WXT A;  4IBP A;  3FZA A;  3DD3 A;  1TW9 A;  2MMA A;  4WKW A;  2H73 A;  2H71 A;  1X9W B;  1VF3 A;  2FGX A;  5IOX A;  5IM9 A;  4GSN A;  1VF4 A;  3QCP A;  3KP9 A;  4KDY A;  2RLI A;  3LYP A;  4ZIL A;  3LYK A;  3HCZ A;  5CP1 A;  2WZ9 A;  1THO A;  2GT5 A;  3KTL A;  2MMN A;  2YZU A;  5DAK A;  5ECM B;  4TXV A;  5IO2 A;  1EZK A;  4X1U A;  3ZTL A;  5ID2 A;  2ES7 A;  1ERW A;  2HSH A;  3UIW A;  2YWM A;  2PVQ A;  3CSI A;  3SWL A;  4ISD A;  1Y6E A;  3A2X A;  1JHB A;  5F8B A;  3QOU A;  2QC7 A;  2GSR A;  3M0F A;  1S3C A;  1M99 A;  5KN1 A;  4EO3 A;  2C1Y A;  2K6V A;  1U87 A;  4IGJ A;  2O7K A;  1OC3 A;  1R5P A;  1AUC A;  3VFI A;  3GH9 A;  5C04 A;  4MZW A;  4D73 B;  1WOU A;  5AGY A;  1Z5Y E;  3D22 A;  1WP0 A;  1ACV A;  5CRH A;  4WEY A;  1H75 A;  2B6M A;  3MNG A;  3APO A;  4TR1 A;  1AQX A;  3KD0 A;  2H75 A;  5J9C A;  2NTO A;  2EIO A;  2GGT A;  2VO4 A;  2C0F A;  3KM6 A;  2VL2 C;  2H6Z A;  4HI7 A;  4NV5 A;  4V1A p;  5B6M A;  2V32 A;  1E2Y A;  4JE1 A;  4NHW A;  2WJU A;  1YJ6 A;  5B8B A;  4LL1 B;  2WB9 A;  2DJJ A;  4HEA 2;  5F07 A;  1FVJ A;  5DAL A;  2I4A A;  4HUA A;  3D5J A;  1TRS A;  3R2Q A;  4IVF A;  1XWA A;  2HLS A;  1Z9H A;  1WWJ A;  17GS A;  5IO0 A;  4DSR A;  4ZB8 A;  4ZIJ A;  3HJM A;  4HZ4 A;  2M80 A;  3EMX A;  3EU4 A;  2DJ0 A;  4X0X A;  2B5E A;  1ZYE A;  3GST A;  1GLQ A;  1M0U A;  4FYC A;  4PGT A;  4XS4 A;  1VF2 A;  2XPE A;  7GSS A;  2RM6 A;  4IKH A;  3LG6 A;  4ZBA A;  4K7N A;  1R5A A;  6GSS A;  5H5S A;  4MMM A;  1SK1 A;  4ML6 A;  4GQC A;  3TKR A;  1O7U A;  1SJZ A;  2DMM A;  5A4V A;  3UL3 A;  2RII A;  2P5Q A;  4K2D A;  3Q19 A;  4MJA A;  5DQY A;  1X5D A;  1Z7R A;  5ENU A;  2XC2 A;  3PR8 A;  5EY6 A;  4OO4 A;  4POB A;  1XVW A;  2HI7 A;  6GSW A;  4OFM A;  4I5Q A;  4BA7 A;  3F9U A;  1JZD A;  1A2M A;  2WFC A;  2NVL A;  1TK0 B;  2HZE A;  1RK4 A;  3MDK A;  3VUR A;  2LQQ A;  3ZMK A;  2ON5 A;  2ZUP A;  2DJ2 A;  4YH2 A;  3EYT A;  1SK2 A;  1MTC A;  4PUA A;  1R4W A;  4YAP A;  2I3Y A;  4FO5 A;  5GST A;  1GUK A;  4GRF A;  1SKW B;  2H66 A;  2VM2 A;  2C8U A;  1BED A;  4YAV A;  5CRG A;  1QGV A;  4XRD A;  4ID0 A;  1GSQ A;  3TKS E;  3WYW A;  4HQZ A;  1NM3 A;  5ECK B;  1TDI A;  4HJ2 A;  1KNG A;  3BJ5 A;  2LNT A;  4NXI A;  3WGD A;  2V41 A;  1PQN A;  3LOR A;  1A24 A;  20GS A;  3UVH A;  1THX A;  1M9B A;  5G1L A;  3ZFL A;  3FEU A;  1PL2 A;  2YV9 A;  2L6D A;  3BOA A;  3IHQ A;  1ILO A;  2YP6 A;  3QD9 A;  2P31 A;  3HJP A;  1ERV A;  3LEF A;  1T8E B;  2CQ9 A;  2B3S A;  3HY2 A;  1S3A A;  3MSZ A;  3LWA A;  3VK9 A;  4ILF A;  2OE3 A;  2GZY A;  2CA8 A;  1JLV A;  4KW6 A;  3ZLP A;  5ELG A;  4I97 A;  3DYR A;  1T1V A;  2HRN A;  4E8H A;  5ECH B;  1G6W A;  3D0Z A;  1YF1 A;  3F0I A;  4K0G A;  4XRA A;  3G9B A;  1TRV A;  1M2B A;  5J3R A;  1FVK A;  3A5W A;  1B4P A;  1AIU A;  2IWT A;  1WJK A;  4QL9 A;  3MWH A;  4HJM A;  5GSS A;  1SKR B;  13GS A;  3F6D A;  3IC4 A;  1PL1 A;  5IMF A;  4Q5R A;  1V58 A;  5F06 A;  1ZGN A;  3KTB A;  3ZML A;  3QAV A;  3LSZ A;  4MH2 A;  1HNA A;  1EGO A;  1SL0 B;  5G5F A;  3ZVJ A;  1Y25 A;  4KDX A;  1ST9 A;  2EC4 A;  4F03 A;  2F51 A;  3WD6 A;  1TK8 B;  1FG4 A;  4MLY A;  2MBS A;  2HZF A;  3GV1 A;  1PKW A;  4KND A;  1E6B A;  2E2G A;  4GXZ A;  2VD1 A;  3A2V A;  3DXB A;  4MK3 A;  2CVB A;  2B7K A;  3QR6 A;  1PGT A;  2ZCT A;  5J5N A;  2AYT A;  4HU9 A;  2R3X A;  4XS6 A;  4F0C A;  2VL2 A;  3ZIT A;  5B7C A;  5H5Q A;  1FO5 A;  2C3Q A;  2J23 A;  3VWU A;  5HR3 A;  3UBL A;  3ERG A;  4ZL7 A;  4ECJ A;  3V1W A;  4I6X A;  2REM A;  1B4Q A;  2D2Z A;  1O8X A;  5ECI B;  4OFT A;  3IV4 A;  3EC3 A;  4NAX A;  1GSF A;  3BCK A;  2R6K A;  1MDJ A;  3GKK A;  2DIZ A;  2HT9 A;  2I9H A;  3DGQ A;  2HNL A;  3BBY A;  2IFQ B;  4MF6 A;  4MF5 A;  1PN9 A;  4ZBD A;  3G7Y A;  1H4O A;  4IW9 A;  2H76 A;  3PGT A;  2CX3 A;  1K0M A;  3QAG A;  3KGK A;  3ED3 A;  1T00 A;  2TIR A;  3UJ1 A;  4AJ7 A;  3GRX A;  3ZZX A;  2A4V A;  3Q6O A;  3H93 A;  2DBC A;  1U6T A;  1LBK A;  3GL3 A;  2H74 A;  2V6K A;  4JR4 A;  3GIX A;  5ABR A;  3TRP A;  4WBJ A;  2WGR A;  2B5Y A;  4G19 A;  4I2T A;  3M8N A;  1G7E A;  3HVV A;  5D96 A;  3QDN A;  5CRE A;  2F8F A;  10GS A;  4ZL8 A;  2F8A A;  4PXO A;  3BD2 A;  5AN1 A;  3C73 A;  1EOG A;  1M2A A;  2HRF A;  4POL A;  2GQM A;  3TRX A;  4GQF A;  1QK8 A;  3IE3 A;  5IMA A;  4KAE A;  2TRC P;  4ECI A;  1ERU A;  3FKF A;  1XXU A;  3KMO A;  1A2L A;  2C0D A;  5HFG A;  4F82 A;  2H72 A;  1SD8 A;  5CRD A;  3RBT A;  2FD3 A;  2RUE A;  1EWX A;  1NW2 A;  4PQI A;  2I1U A;  3KXO A;  3IRA A;  5ECS A;  2C3N A;  1B9X C;  1Z3E A;  1SKS B;  1X5C A;  2C3T A;  4FIW A;  2JU5 A;  4HOJ A;  5LNK e;  2NDO A;  1Z7P A;  1I9D A;  1QXH A;  3O76 A;  2VLV A;  2GQL A;  4GTU A;  5D9W A;  1DE1 A;  1A8L A;  2C4J A;  2YNX A;  1XWB A;  2YJ7 A;  3RHC A;  4K7O A;  1GSS A;  5EL8 A;  4V1A g;  2WRT A; 
#chains in the Genus database with same CATH topology
 1BQ7 A;  3JCM L;  3ZL5 A;  1FHE A;  1X0R A;  2XHF A;  2N5B A;  1PX6 A;  4D73 A;  5HR0 A;  2VCX A;  3F63 A;  2O85 A;  1ML6 A;  5IIZ A;  2XBQ A;  3F4R A;  3P90 A;  5GAN D;  3IK9 A;  3HZ8 A;  3A5I A;  6GSY A;  3HA9 A;  6GSV A;  3CBU A;  3D4T A;  1OC8 A;  3HJO A;  1ABA A;  1Z6N A;  4MZC A;  3F3R A;  3FW2 A;  5DBQ A;  3D4M A;  4TR0 A;  1DE2 A;  2V2G A;  4I8B A;  4ECB A;  2JZS A;  2DML A;  4IP1 A;  3GTU B;  4XIH A;  5JWO B;  3IAM 2;  4WF5 A;  2PGT A;  5IQY A;  1K0A A;  3HDC A;  3EMP A;  3KCM A;  4K2X A;  3GX8 A;  1K3O A;  1SU9 A;  2R4V A;  4Q5N A;  2X99 A;  1W89 A;  2KUC A;  4N11 A;  1F3A A;  2DLX A;  3GKX A;  1WE0 A;  3WT1 A;  4AGS A;  1AW9 A;  5D9T A;  2VCW A;  4CY8 A;  2PMT A;  1I5G A;  3LXZ A;  4ECC A;  1X5E A;  2H1G A;  2XBI A;  5JCG A;  3ZIJ A;  5G31 A;  2CVD A;  4GCI A;  3GNJ A;  2KLX A;  2WUL A;  3ME7 A;  1F9M A;  9GSS A;  2N5F A;  3FRC A;  3VPQ A;  3CSH A;  1GUH A;  3GFK A;  3NOF A;  4NPB A;  1PSQ A;  4L0W A;  4O5U A;  1T4Z A;  5ECQ B;  1Q98 A;  2VL3 A;  1YQ1 A;  2FWE A;  3KP8 A;  2LUS A;  5CYY A;  2B7J A;  1JLW A;  1M3I A;  3E3E A;  5GZZ B;  3LW9 A;  3VI5 A;  3O6T A;  4Z2U A;  4DSS B;  1TRU A;  5KN2 A;  3KZQ A;  1TI3 A;  2YCD A;  2LJK A;  4K6X A;  3FY7 A;  3IXR A;  4IJ3 A;  3IR4 A;  2IPA A;  1QMV A;  2PN8 A;  1EEJ A;  2M72 A;  2LJR A;  2LRC A;  4J57 E;  4TR4 A;  5IOW A;  2H6X A;  2C0E A;  1FW1 A;  2CV4 A;  3GH6 A;  5BMU A;  5H5R A;  3M9J A;  2GZP A;  4OCE A;  1TOF A;  4GST A;  1BX9 A;  2IN3 A;  3FYG A;  3DWV A;  5B6N A;  3LXT A;  1XFL A;  1OE8 A;  1X9M B;  4KDU A;  2B1L A;  4TW5 A;  2G0F A;  3CQF A;  2PU9 C;  3MYD A;  2WS2 A;  4XCS A;  6GST A;  2TRX A;  1HD2 A;  4OFN A;  19GS A;  4WBR D;  3VWW A;  1YKA A;  1XOA A;  5D9V A;  3FZ9 A;  3KEB A;  2QA2 A;  1OE7 A;  4N10 A;  2Z9S A;  1IYH A;  1GTB A;  2LJA A;  4KSO A;  5ECO B;  4YQM A;  4MJC A;  8GSS A;  3DVX A;  3TDG A;  1V98 A;  1ZL9 A;  1JZW A;  1T3B A;  1K0N A;  2FWF A;  4MH3 A;  4KSM A;  2E7P A;  3DIE A;  4WR5 A;  3HVS A;  1DBY A;  1SYX A;  3DEX A;  4EE0 A;  1JZR A;  1YEP A;  4O92 A;  1K3L A;  2FWH A;  1GL8 A;  1A0R P;  2VCT A;  5IMC A;  4MCU A;  3EWL A;  2YAN A;  2DKI A;  1RW1 A;  1GSY A;  2GZZ A;  2H0H A;  4EVM A;  2ZNM A;  1B8X A;  3GKM A;  1TU8 A;  2OAD A;  4WET A;  3TOT A;  4RQR A;  1MEK A;  4O32 A;  4EDZ A;  3I43 A;  3EE2 A;  4PX1 A;  1F2E A;  4CW9 A;  2GST A;  2PWJ A;  5CAX A;  1NHY A;  3QMX A;  3LGC A;  1AQW A;  1UC7 A;  1W4V A;  5C00 A;  4BL7 B;  4MPF A;  1SK0 A;  1PX7 A;  1GUM A;  3FR6 A;  2RM5 A;  1MD3 A;  3RAZ A;  2X8C A;  4KB3 A;  5HFI A;  4LA1 A;  3Q18 A;  5G5E A;  2CX4 A;  1YKC A;  2IJY A;  4KX4 A;  2IIY A;  1J0F A;  2AHE A;  5DJL A;  3GN3 A;  3R3E A;  2E0Q A;  1Z6M A;  2V6O A;  1JFU A;  3QFB C;  1G7O A;  3GA4 A;  1R7H A;  1GH2 A;  2R2J A;  1GSE A;  1F37 A;  2HSY A;  2DJK A;  2DIY A;  3ZFB A;  2PBJ A;  2VCV A;  2OAC A;  3I69 A;  2FUG 2;  5D9X A;  1FB0 A;  3L9U A;  2FNO A;  4PNF A;  4BVY B;  3CTF A;  5LCZ A;  1A8Y A;  1QUW A;  4BVX A;  2IMK A;  3HVX A;  1TXX A;  2V1M A;  12GS A;  3J7Y k;  3GUS A;  1EV9 A;  3TJB A;  2DJ1 A;  3GHA A;  2LKU A;  2GVP A;  3TOU A;  4GLT A;  1GTI A;  5F0G A;  1K3Y A;  2OBI A;  1LU4 A;  4ZXG A;  1AQV A;  3CSJ A;  2H1D A;  3D21 A;  4NV2 A;  2IME A;  4GF0 A;  1MDK A;  5JWQ B;  2IFQ A;  4PNG A;  2OBK A;  4MAB A;  2GDR A;  1A23 A;  1XVQ A;  3ERW A;  3RDW A;  1WPI A;  1YY7 A;  2X8H A;  2FY6 A;  5A4U A;  3O3T A;  4G0L A;  2LRT A;  2K8V A;  3DML A;  2GSS A;  2F9S A;  5HR2 A;  1QFN A;  2AAW A;  1GTU A;  5FHI A;  1SYR A;  1PRX A;  3EU3 A;  1BJX A;  1K0C A;  1NHO A;  1ZMA A;  2K18 A;  2VLT A;  3AY8 A;  3EUR A;  3TJG A;  2O89 A;  4ZL9 A;  3CTG A;  3GL5 A;  2X64 A;  5GAP D;  2B5X A;  14GS A;  4IHU A;  3PIN A;  3HZ4 A;  2G2Q A;  3P2A A;  1PMT A;  3MAK A;  2LV3 A;  2BJX A;  1YZX A;  5DCG A;  4MJE A;  4TXO B;  3TJJ A;  2R37 A;  3F6F A;  3F8U A;  4TR3 A;  5HQP A;  3GMF A;  4OWY A;  4XTS A;  1MD4 A;  1XWG A;  1XWK A;  3ZYW A;  4LMW A;  4DEJ A;  3D6I A;  1IYI A;  1B48 A;  3IA1 A;  4WF4 A;  4X4J A;  2QA1 A;  3IPZ A;  1YEX A;  1HYU A;  3Q74 A;  3DKS A;  5KEJ A;  1A0F A;  2VUP A;  4N0Z A;  1YDK A;  3EPT A;  2NBS A;  4JR6 A;  4L8E A;  1XPV A;  2L4C A;  3LJR A;  3FMW A;  1XG8 A;  1KTE A;  2CAQ A;  4TOP A;  1V2A A;  2OE1 A;  3UBK A;  2CVK A;  1ZOF A;  1AAZ A;  1EV4 A;  2AUV A;  4O5Q A;  3FHK A;  5D73 A;  2YWN A;  5JWR B;  5JCU A;  1O81 A;  5D93 A;  2WCI A;  4IN0 A;  3UOM A;  3ZRD A;  4ULX A;  2MYG A;  4EIQ A;  4KUN A;  4G2E A;  1XW6 A;  1UA5 A;  2FCH A;  3RPP A;  16GS A;  2HXK A;  2QSI A;  5JCW A;  4TKY A;  3F3Q A;  3RPN A;  1WMJ A;  3P8W A;  4J56 E;  2VD0 A;  2X49 A;  3HKR A;  4OO5 A;  4AJ6 A;  4EIP A;  5KN3 A;  1URM A;  3GTU A;  2A2R A;  4NHZ A;  2E2M A;  4L5L A;  6GSU A;  3KH7 A;  4HS1 A;  1VGL A;  1OAZ A;  4HQS A;  3QAW A;  2JSZ A;  4K8M A;  4N30 A;  4JRR A;  3I9V 2;  5G1K A;  2L5O A;  5J9B A;  4V2N A;  3UAP A;  3TUE A;  3ZRE A;  4PQH A;  3VWV A;  2ON7 A;  5ECR B;  1SL1 B;  3C71 A;  1GTA A;  1HNC A;  4JBB A;  4G10 A;  1PD2 1;  3L4N A;  2UZ8 A;  4EF0 A;  2EIQ A;  4EDY A;  3TJF A;  4IS0 A;  4MNN A;  4MZB A;  3M3M A;  3MIX A;  4HSC X;  2PVO C;  1HNB A;  4HU7 A;  2DSA A;  1B9Y C;  4K7I A;  2RUF A;  1KEB A;  1BAY A;  4ACS A;  3TKS C;  5AIS A;  1F6M C;  2L57 A;  1FAA A;  3A2W A;  4L0U A;  5IMD A;  1TTZ A;  1OC9 B;  3N5O A;  3TKP A;  3FK8 A;  3P7X A;  3IAS 2;  2YWO A;  1SL2 B;  1M3J A;  3NIV A;  2QKE A;  1EP7 A;  2FA4 A;  5DJM A;  4DSS A;  2I81 A;  3SBC A;  2BTO T;  3UVT A;  5F05 A;  4F0B A;  3KJY A;  4POM A;  4LL4 B;  2YV7 A;  2GQK A;  2OE0 A;  1SEN A;  2JAC A;  4FH8 A;  11GS A;  1XZO A;  2M46 A;  5COH A;  5DVB A;  4Z2R A;  3KMN A;  2CZ2 A;  2O8V B;  6GSX A;  2FHE A;  5IPH A;  1GSU A;  1XOB A;  3ME8 A;  2GLR A;  4PQ1 A;  1FB6 A;  5ECP B;  3IBH A;  4IQA A;  4YQU A;  1M9A A;  5CNW A;  3GX0 A;  5DAK B;  4OD7 A;  5ID2 B;  1Q4J A;  4LMV A;  3G7J A;  3HD5 A;  1K0B A;  4TRX A;  3S9F A;  4Q5Q A;  1ERT A;  5BRT A;  4MP4 A;  4J2F A;  1M2D A;  2JSY A;  4L5O A;  3VPT A;  2P5R A;  3FR9 A;  5FT3 A;  2L6C A;  3CRU A;  2DJ3 A;  2N5A A;  5HR1 A;  5D8I A;  4RI6 A;  5B8A A;  4GSS A;  22GS A;  4NMU A;  5ELA A;  5J4U A;  2LNS A;  2CAI A;  2LEG A;  4V2L A;  4CHS A;  5EVO A;  1UN2 A;  1HQO A;  2P0G A;  5IMV A;  5CO3 A;  1KBN A;  4ZBB A;  1O6J A;  3LFL A;  1G6Y A;  2R0P A;  1V57 A;  1JZO A;  3IC8 A;  4F9Z A;  1GNE A;  3L9S A;  3KH9 A;  3QPM A;  2L5L A;  3NZN A;  1OKD A;  4CDO A;  3U6V A;  5IPG A;  1EEM A;  4QL7 A;  3E9J B;  3LQ7 A;  4TR1 B;  1BYE A;  4K1F A;  4OCF A;  3FZ5 A;  4ZB9 A;  2LST A;  2H19 A;  5DQS A;  1RQM A;  2JZR A;  3TB2 A;  2CZ3 A;  1N2A A;  1SJI A;  2K8S A;  4ML1 A;  5AIV A;  1ZCP A;  1OKT A;  2VCZ A;  4OMV A;  4G0K A;  4PTS A;  1TP9 A;  4KCE A;  5DAL B;  4JU5 A;  4AF2 A;  1WIK A;  4HZ2 A;  4JED A;  4N0V A;  2H1B A;  4YQV A;  3CMI A;  4LLR A;  2AJQ B;  2DC5 A;  2GT6 A;  4BL7 A;  2LS5 A;  4DSQ A;  3UMA A;  5E59 A;  2WDU A;  1AC1 A;  3C7M A;  4WR4 A;  4IQ1 A;  4EXJ A;  5DCH A;  4USS A;  1U3I A;  3TRQ A;  1GSD A;  4E8E A;  3IK7 A;  4EL1 A;  1TRW A;  2AB6 A;  3W8J A;  1XW9 A;  4XS4 B;  4HDE A;  2LQO A;  3J7Y b;  2YWI A;  4ICY A;  4O7H A;  2A2S A;  4MDC A;  4Z2T A;  5G30 A;  1ZYP A;  3A3T A;  3KIJ A;  1GRX A;  1G0T A;  2YPM A;  1EGR A;  1OVN A;  3ZVJ D;  3F4S A;  4EUY A;  1ZYN A;  2C0G A;  1J9B A;  2HSM A;  2HYX A;  4YKG A;  4BVY A;  2KOK A;  5KN0 A;  1O85 A;  3W8S A;  5J41 A;  5INY A;  2OJL A;  2JL4 A;  4H86 A;  3UEM A;  1LJR A;  2LRN A;  4MJB A;  4RQX A;  3H79 A;  4V2M A;  1TI1 A;  3H8Q A;  4IP6 A;  2HZE B;  4KCA A;  3M1G A;  1K0D A;  2KHP A;  4RUV A;  3BCI A;  1FOV A;  1PA3 A;  3GSS A;  2C80 A;  3VI7 A;  1EP8 A;  3WGX A;  2H1A A;  1GUL A;  2OA7 A;  5HFK A;  4X43 A;  3ISO A;  3M9K A;  18GS A;  1EOH A;  2X8G A;  2H01 A;  5DDL A;  3C1S A;  1M7T A;  2YZH A;  3DVW A;  3VLN A;  1C72 A;  1GNW A;  3UAR A;  1V40 A;  3K8N A;  3VWX A;  3GKN A;  3TKS A;  2XPD A;  1NSW A;  1QQ2 A;  1DSB A;  2EIR A;  4BWS A;  3CYN A;  3PH9 A;  5E4W A;  4XS1 A;  1R26 A;  2L59 A;  3U5R E;  4BWQ A;  2OKA A;  1XWC A;  5AIX A;  5EPF A;  4MPG A;  4AJ8 A;  3F4T A;  2HFD A;  2VL9 A;  3EIN A;  2R5G A;  1YF0 A;  2O87 A;  2MZC A;  2YOI A;  2DKH A;  1X9S B;  4F2I A;  2K9F A;  5IMZ A;  1O8W A;  3G7I A;  5FWG A;  4TXO A;  2H70 A;  4TN8 A;  3L9V A;  4K9Z A;  1S3D A;  4IEL A;  2VIM A;  4POK A;  4O5R A;  3E0U A;  2QGV A;  4XHM A;  3OR5 A;  3FR3 A;  4GWR A;  1GWC A;  5A5K A;  4FYB A;  2H30 A;  4PUR A;  2IL3 A;  5CRW A;  3HHV A;  1O73 A;  4YKF A;  4QQ7 A;  2AV4 A;  4IJI A;  4G9H A;  2VM1 A;  3APS A;  1U3A A;  1USB A;  5ECN B;  1DUG A;  2L4Q A;  4KA0 A;  3HYP A;  3GYK A;  2MMO A;  2GSQ A;  3H1N A;  3TJK A;  2ALB A;  2JZT A;  3CRT A;  1WRY A;  2F3M A;  2H8L A;  2IMD A;  3L0H A;  1VF1 A;  1XW5 A;  1SJ6 A;  2VAF A;  2KP1 A;  4K0N A;  2B1K A;  2H0I A;  1OYJ A;  1T7P B;  2PUK C;  4KE3 A;  5LD0 A;  2H6Y A;  3FZ4 A;  1T4Y A;  3CXG A;  2FWG A;  3QFA C;  5L71 A;  2PER A;  2GS3 A;  3APQ A;  1A2J A;  2HE3 A;  4PUF C;  1CQH A;  4JZQ A;  1ZYQ B;  1TU7 A;  2JAD A;  2IMI A;  3IOS A;  1VRS D;  3RHB A;  3L78 A;  3W6G A;  1XCC A;  2FLS A;  2BMX A;  1N8J A;  3C8E A;  2GTU A;  2CT6 A;  2MBT A;  2MMZ A;  1GLP A;  3IDV A;  4NWY A;  3HXS A;  1V9W A;  2IMF A;  4I2U A;  4DVC A;  3N9J A;  4Z7X A;  2KP2 A;  5G2Z A;  4EC0 A;  1U88 A;  1F3B A;  3US3 A;  1PKZ A;  1J08 A;  2YJH A;  1ZZY A;  3WGE A;  4BPY A;  3TKQ A;  4MF7 A;  3GUR A;  3C1R A;  2FA8 A;  1MDI A;  1BG5 A;  1K0O A;  2NPB A;  3I6A A;  2VLU A;  3TGZ A;  1GP1 A;  4A5P A;  1TKD B;  1TJD A;  4ZB6 A;  4TVE A;  4KGI A;  1UVZ A;  2VCQ A;  3EVI A;  4RI7 A;  2LTK A;  4G0I A;  1OC9 A;  1ON4 A;  4MA9 A;  2VOC A;  1AXD A;  2HRK A;  3H4K A;  4FYU A;  4KH7 A;  1SD9 A;  3TCO A;  4EKZ A;  2YN1 A;  4P3Y B;  1TK5 B;  4KF9 A;  3DRN A;  1XIY A;  3ERF A;  2PPT A;  5ECL B;  1CQG A;  3ZIV A;  2H0G A;  5A4W A;  4Q5F A;  1XBS A;  2J9H A;  3WT2 A;  4WXT A;  4IBP A;  3FZA A;  3DD3 A;  1TW9 A;  2MMA A;  4WKW A;  2H73 A;  2H71 A;  5KOW A;  1X9W B;  1VF3 A;  2FGX A;  5IOX A;  5IM9 A;  4GSN A;  1VF4 A;  3QCP A;  3KP9 A;  4KDY A;  2RLI A;  3LYP A;  4ZIL A;  3LYK A;  3HCZ A;  5CP1 A;  2WZ9 A;  1THO A;  2GT5 A;  3KTL A;  2MMN A;  2YZU A;  5DAK A;  5ECM B;  4TXV A;  5IO2 A;  1EZK A;  4X1U A;  3ZTL A;  5ID2 A;  2ES7 A;  1ERW A;  2HSH A;  3UIW A;  1PN0 A;  2YWM A;  2PVQ A;  3CSI A;  3IHG A;  3SWL A;  4ISD A;  1Y6E A;  3A2X A;  1JHB A;  5F8B A;  2A4H A;  3QOU A;  2QC7 A;  2GSR A;  3M0F A;  1S3C A;  1M99 A;  5KN1 A;  4EO3 A;  2C1Y A;  2K6V A;  1U87 A;  4IGJ A;  2O7K A;  1OC3 A;  1R5P A;  1AUC A;  3VFI A;  3GH9 A;  5C04 A;  4MZW A;  4D73 B;  1WOU A;  5AGY A;  1Z5Y E;  3D22 A;  1WP0 A;  1ACV A;  5CRH A;  4CY6 A;  4WEY A;  1H75 A;  2R0G A;  2B6M A;  3MNG A;  3APO A;  4TR1 A;  1AQX A;  3KD0 A;  2H75 A;  5J9C A;  2NTO A;  2EIO A;  2GGT A;  2VO4 A;  2C0F A;  3KM6 A;  2VL2 C;  2H6Z A;  4HI7 A;  4NV5 A;  4V1A p;  5B6M A;  2V32 A;  1E2Y A;  4JE1 A;  4NHW A;  2WJU A;  1YJ6 A;  5B8B A;  4LL1 B;  2WB9 A;  2DJJ A;  4HEA 2;  5F07 A;  1FVJ A;  5DAL A;  2I4A A;  4HUA A;  3D5J A;  1TRS A;  3R2Q A;  4IVF A;  1XWA A;  2HLS A;  1Z9H A;  1WWJ A;  17GS A;  5IO0 A;  4DSR A;  4ZB8 A;  4ZIJ A;  3HJM A;  4HZ4 A;  2M80 A;  3EMX A;  3EU4 A;  2DJ0 A;  4X0X A;  2B5E A;  1ZYE A;  3GST A;  1GLQ A;  1M0U A;  4FYC A;  4PGT A;  4XS4 A;  1VF2 A;  2XPE A;  7GSS A;  2RM6 A;  4IKH A;  3LG6 A;  4ZBA A;  4K7N A;  1R5A A;  6GSS A;  5H5S A;  4MMM A;  1SK1 A;  4ML6 A;  4GQC A;  3TKR A;  1O7U A;  1SJZ A;  2DMM A;  5A4V A;  3UL3 A;  2RII A;  2P5Q A;  4K2D A;  3Q19 A;  4MJA A;  5DQY A;  1X5D A;  1Z7R A;  5ENU A;  2XC2 A;  3PR8 A;  5EY6 A;  4OO4 A;  4POB A;  1XVW A;  2HI7 A;  6GSW A;  4OFM A;  4I5Q A;  4BA7 A;  3F9U A;  1JZD A;  4FQU A;  1A2M A;  2WFC A;  2NVL A;  1TK0 B;  2HZE A;  1RK4 A;  3MDK A;  3VUR A;  2LQQ A;  3ZMK A;  2ON5 A;  2ZUP A;  2DJ2 A;  4YH2 A;  3EYT A;  1FOH A;  1SK2 A;  1MTC A;  4PUA A;  1R4W A;  4YAP A;  2I3Y A;  4FO5 A;  5GST A;  1GUK A;  4GRF A;  1SKW B;  2H66 A;  2VM2 A;  2C8U A;  1BED A;  4YAV A;  5CRG A;  1QGV A;  4XRD A;  4ID0 A;  1GSQ A;  3TKS E;  3WYW A;  4HQZ A;  1NM3 A;  5ECK B;  1TDI A;  4HJ2 A;  1KNG A;  3BJ5 A;  2LNT A;  4NXI A;  3WGD A;  2V41 A;  1PQN A;  3LOR A;  1A24 A;  20GS A;  3UVH A;  1THX A;  1M9B A;  5G1L A;  3ZFL A;  3FEU A;  1PL2 A;  2YV9 A;  2L6D A;  3BOA A;  3IHQ A;  1ILO A;  2YP6 A;  3QD9 A;  2P31 A;  3HJP A;  4K5S A;  1ERV A;  3LEF A;  1T8E B;  2CQ9 A;  2B3S A;  3HY2 A;  1S3A A;  3MSZ A;  3LWA A;  3VK9 A;  4ILF A;  2OE3 A;  2GZY A;  2X4A A;  2CA8 A;  1JLV A;  2A2P A;  4KW6 A;  3ZLP A;  5ELG A;  4I97 A;  3DYR A;  1T1V A;  2HRN A;  4E8H A;  5ECH B;  1G6W A;  3D0Z A;  1YF1 A;  3F0I A;  4K0G A;  4XRA A;  3G9B A;  1TRV A;  5KOX A;  1M2B A;  5J3R A;  4BIK A;  1FVK A;  3A5W A;  1B4P A;  1AIU A;  2IWT A;  1WJK A;  4QL9 A;  1S3R A;  3MWH A;  4HJM A;  5GSS A;  1SKR B;  13GS A;  3F6D A;  3IC4 A;  1PL1 A;  5IMF A;  4Q5R A;  1V58 A;  5F06 A;  1ZGN A;  3KTB A;  3ZML A;  3QAV A;  3LSZ A;  4MH2 A;  1HNA A;  1EGO A;  1SL0 B;  5G5F A;  3ZVJ A;  1Y25 A;  4K5R A;  4KDX A;  1ST9 A;  2EC4 A;  4F03 A;  2F51 A;  3WD6 A;  1TK8 B;  1FG4 A;  4MLY A;  2MBS A;  2HZF A;  3GV1 A;  1PKW A;  4KND A;  1E6B A;  2E2G A;  4GXZ A;  2VD1 A;  3A2V A;  3DXB A;  4MK3 A;  2CVB A;  2HRA A;  2B7K A;  3QR6 A;  1PGT A;  2ZCT A;  5J5N A;  2AYT A;  4HU9 A;  2R3X A;  4XS6 A;  4F0C A;  2VL2 A;  3ZIT A;  5B7C A;  5H5Q A;  1FO5 A;  2C3Q A;  2J23 A;  3VWU A;  5HR3 A;  3UBL A;  3ERG A;  3HVN A;  4ZL7 A;  4ECJ A;  3V1W A;  4I6X A;  2REM A;  1B4Q A;  2D2Z A;  1O8X A;  5ECI B;  4BVX B;  4OFT A;  3IV4 A;  3EC3 A;  4NAX A;  1GSF A;  3BCK A;  3PPU A;  2R6K A;  1PFO A;  1MDJ A;  3GKK A;  2DIZ A;  2HT9 A;  2I9H A;  3DGQ A;  2HNL A;  3BBY A;  2IFQ B;  4MF6 A;  4MF5 A;  1PN9 A;  4ZBD A;  3G7Y A;  1H4O A;  4IW9 A;  2H76 A;  3PGT A;  2CX3 A;  1K0M A;  3QAG A;  3KGK A;  3ED3 A;  1T00 A;  2TIR A;  3UJ1 A;  4AJ7 A;  3GRX A;  3ZZX A;  2A4V A;  3Q6O A;  3H93 A;  2DBC A;  1U6T A;  1LBK A;  3GL3 A;  2H74 A;  2V6K A;  4JR4 A;  3GIX A;  5ABR A;  3TRP A;  4WBJ A;  2WGR A;  2B5Y A;  4G19 A;  4I2T A;  3M8N A;  1G7E A;  3HVV A;  5D96 A;  3QDN A;  5CRE A;  2F8F A;  10GS A;  4ZL8 A;  2F8A A;  4PXO A;  3BD2 A;  5AN1 A;  3C73 A;  1EOG A;  1M2A A;  2HRF A;  4POL A;  2GQM A;  3TRX A;  4GQF A;  1QK8 A;  3IE3 A;  5IMA A;  4KAE A;  2TRC P;  4ECI A;  1ERU A;  3FKF A;  1XXU A;  3KMO A;  1A2L A;  2C0D A;  5HFG A;  4F82 A;  2H72 A;  1SD8 A;  5CRD A;  3RBT A;  2FD3 A;  2RUE A;  1EWX A;  1NW2 A;  4PQI A;  2I1U A;  3KXO A;  3IRA A;  5ECS A;  2C3N A;  1B9X C;  1Z3E A;  1SKS B;  1X5C A;  2C3T A;  4FIW A;  2JU5 A;  4HOJ A;  5LNK e;  2NDO A;  1Z7P A;  1I9D A;  1QXH A;  2R0C A;  3O76 A;  2VLV A;  2GQL A;  4GTU A;  5D9W A;  1DE1 A;  1A8L A;  2C4J A;  2YNX A;  1XWB A;  2YJ7 A;  3RHC A;  4K7O A;  1GSS A;  5EL8 A;  4V1A g;  2WRT A; 
#chains in the Genus database with same CATH homology
 1BQ7 A;  3JCM L;  3ZL5 A;  1FHE A;  1X0R A;  2XHF A;  2N5B A;  1PX6 A;  4D73 A;  5HR0 A;  2VCX A;  3F63 A;  2O85 A;  1ML6 A;  5IIZ A;  2XBQ A;  3F4R A;  3P90 A;  5GAN D;  3IK9 A;  3HZ8 A;  3A5I A;  6GSY A;  3HA9 A;  6GSV A;  3CBU A;  3D4T A;  1OC8 A;  3HJO A;  1ABA A;  1Z6N A;  4MZC A;  3F3R A;  3FW2 A;  5DBQ A;  3D4M A;  4TR0 A;  1DE2 A;  2V2G A;  4I8B A;  4ECB A;  2JZS A;  2DML A;  4IP1 A;  3GTU B;  4XIH A;  5JWO B;  3IAM 2;  4WF5 A;  2PGT A;  5IQY A;  1K0A A;  3HDC A;  3EMP A;  3KCM A;  4K2X A;  3GX8 A;  1K3O A;  1SU9 A;  2R4V A;  4Q5N A;  2X99 A;  1W89 A;  2KUC A;  4N11 A;  1F3A A;  2DLX A;  3GKX A;  1WE0 A;  3WT1 A;  4AGS A;  1AW9 A;  5D9T A;  2VCW A;  4CY8 A;  2PMT A;  1I5G A;  3LXZ A;  4ECC A;  1X5E A;  2H1G A;  2XBI A;  5JCG A;  3ZIJ A;  5G31 A;  2CVD A;  4GCI A;  3GNJ A;  2KLX A;  2WUL A;  3ME7 A;  1F9M A;  9GSS A;  2N5F A;  3FRC A;  3VPQ A;  3CSH A;  1GUH A;  3GFK A;  3NOF A;  4NPB A;  1PSQ A;  4L0W A;  4O5U A;  1T4Z A;  5ECQ B;  1Q98 A;  2VL3 A;  1YQ1 A;  2FWE A;  3KP8 A;  2LUS A;  5CYY A;  2B7J A;  1JLW A;  3E3E A;  5GZZ B;  3LW9 A;  3VI5 A;  3O6T A;  4Z2U A;  4DSS B;  1TRU A;  5KN2 A;  3KZQ A;  1TI3 A;  2YCD A;  2LJK A;  4K6X A;  3FY7 A;  3IXR A;  4IJ3 A;  3IR4 A;  2IPA A;  1QMV A;  2PN8 A;  1EEJ A;  2M72 A;  2LJR A;  2LRC A;  4J57 E;  4TR4 A;  5IOW A;  2H6X A;  2C0E A;  1FW1 A;  2CV4 A;  3GH6 A;  5BMU A;  5H5R A;  3M9J A;  2GZP A;  4OCE A;  1TOF A;  4GST A;  1BX9 A;  2IN3 A;  3FYG A;  3DWV A;  5B6N A;  3LXT A;  1XFL A;  1OE8 A;  1X9M B;  4KDU A;  2B1L A;  4TW5 A;  2G0F A;  2PU9 C;  3MYD A;  2WS2 A;  4XCS A;  6GST A;  2TRX A;  1HD2 A;  4OFN A;  19GS A;  4WBR D;  3VWW A;  1YKA A;  1XOA A;  5D9V A;  3FZ9 A;  3KEB A;  2QA2 A;  1OE7 A;  4N10 A;  2Z9S A;  1IYH A;  1GTB A;  2LJA A;  4KSO A;  5ECO B;  4YQM A;  4MJC A;  8GSS A;  3DVX A;  3TDG A;  1V98 A;  1ZL9 A;  1JZW A;  1T3B A;  1K0N A;  2FWF A;  4MH3 A;  4KSM A;  2E7P A;  3DIE A;  4WR5 A;  3HVS A;  1DBY A;  1SYX A;  3DEX A;  4EE0 A;  1JZR A;  1YEP A;  4O92 A;  1K3L A;  2FWH A;  1GL8 A;  1A0R P;  2VCT A;  5IMC A;  4MCU A;  3EWL A;  2YAN A;  2DKI A;  1RW1 A;  1GSY A;  2GZZ A;  2H0H A;  4EVM A;  2ZNM A;  1B8X A;  3GKM A;  1TU8 A;  2OAD A;  4WET A;  3TOT A;  4RQR A;  1MEK A;  4O32 A;  4EDZ A;  3I43 A;  3EE2 A;  4PX1 A;  1F2E A;  4CW9 A;  2GST A;  2PWJ A;  5CAX A;  1NHY A;  3QMX A;  3LGC A;  1AQW A;  1UC7 A;  1W4V A;  5C00 A;  4BL7 B;  4MPF A;  1SK0 A;  1PX7 A;  1GUM A;  3FR6 A;  2RM5 A;  1MD3 A;  3RAZ A;  2X8C A;  4KB3 A;  5HFI A;  4LA1 A;  3Q18 A;  5G5E A;  2CX4 A;  1YKC A;  2IJY A;  4KX4 A;  2IIY A;  1J0F A;  2AHE A;  5DJL A;  3GN3 A;  3R3E A;  2E0Q A;  1Z6M A;  2V6O A;  1JFU A;  3QFB C;  1G7O A;  3GA4 A;  1R7H A;  1GH2 A;  2R2J A;  1GSE A;  1F37 A;  2HSY A;  2DJK A;  2DIY A;  3ZFB A;  2PBJ A;  2VCV A;  2OAC A;  3I69 A;  2FUG 2;  5D9X A;  1FB0 A;  3L9U A;  2FNO A;  4PNF A;  4BVY B;  3CTF A;  5LCZ A;  1A8Y A;  1QUW A;  4BVX A;  2IMK A;  3HVX A;  1TXX A;  2V1M A;  12GS A;  3J7Y k;  3GUS A;  1EV9 A;  3TJB A;  2DJ1 A;  3GHA A;  2LKU A;  2GVP A;  3TOU A;  4GLT A;  1GTI A;  5F0G A;  1K3Y A;  2OBI A;  1LU4 A;  4ZXG A;  1AQV A;  3CSJ A;  2H1D A;  3D21 A;  4NV2 A;  2IME A;  4GF0 A;  1MDK A;  5JWQ B;  2IFQ A;  4PNG A;  2OBK A;  4MAB A;  2GDR A;  1A23 A;  1XVQ A;  3ERW A;  3RDW A;  1WPI A;  1YY7 A;  2X8H A;  2FY6 A;  5A4U A;  3O3T A;  4G0L A;  2LRT A;  2K8V A;  3DML A;  2GSS A;  2F9S A;  5HR2 A;  1QFN A;  2AAW A;  1GTU A;  5FHI A;  1SYR A;  1PRX A;  3EU3 A;  1BJX A;  1K0C A;  1NHO A;  1ZMA A;  2K18 A;  2VLT A;  3AY8 A;  3EUR A;  3TJG A;  2O89 A;  4ZL9 A;  3CTG A;  3GL5 A;  2X64 A;  5GAP D;  2B5X A;  14GS A;  4IHU A;  3PIN A;  3HZ4 A;  2G2Q A;  3P2A A;  1PMT A;  3MAK A;  2LV3 A;  2BJX A;  1YZX A;  5DCG A;  4MJE A;  4TXO B;  3TJJ A;  2R37 A;  3F6F A;  3F8U A;  4TR3 A;  5HQP A;  3GMF A;  4OWY A;  4XTS A;  1MD4 A;  1XWG A;  1XWK A;  3ZYW A;  4LMW A;  4DEJ A;  3D6I A;  1IYI A;  1B48 A;  3IA1 A;  4WF4 A;  4X4J A;  2QA1 A;  3IPZ A;  1YEX A;  1HYU A;  3Q74 A;  3DKS A;  5KEJ A;  1A0F A;  2VUP A;  4N0Z A;  1YDK A;  3EPT A;  2NBS A;  4JR6 A;  4L8E A;  1XPV A;  2L4C A;  3LJR A;  3FMW A;  1KTE A;  2CAQ A;  4TOP A;  1V2A A;  2OE1 A;  3UBK A;  2CVK A;  1ZOF A;  1AAZ A;  1EV4 A;  2AUV A;  4O5Q A;  3FHK A;  5D73 A;  2YWN A;  5JWR B;  5JCU A;  1O81 A;  5D93 A;  2WCI A;  4IN0 A;  3UOM A;  3ZRD A;  4ULX A;  2MYG A;  4EIQ A;  4KUN A;  4G2E A;  1XW6 A;  1UA5 A;  2FCH A;  3RPP A;  16GS A;  2HXK A;  2QSI A;  5JCW A;  4TKY A;  3F3Q A;  3RPN A;  1WMJ A;  3P8W A;  4J56 E;  2VD0 A;  2X49 A;  3HKR A;  4OO5 A;  4AJ6 A;  4EIP A;  5KN3 A;  1URM A;  3GTU A;  2A2R A;  4NHZ A;  2E2M A;  4L5L A;  6GSU A;  3KH7 A;  4HS1 A;  1VGL A;  1OAZ A;  4HQS A;  3QAW A;  2JSZ A;  4K8M A;  4N30 A;  4JRR A;  3I9V 2;  5G1K A;  2L5O A;  5J9B A;  4V2N A;  3UAP A;  3TUE A;  3ZRE A;  4PQH A;  3VWV A;  2ON7 A;  5ECR B;  1SL1 B;  3C71 A;  1GTA A;  1HNC A;  4JBB A;  4G10 A;  1PD2 1;  3L4N A;  2UZ8 A;  4EF0 A;  2EIQ A;  4EDY A;  3TJF A;  4IS0 A;  4MNN A;  4MZB A;  3M3M A;  3MIX A;  2PVO C;  1HNB A;  4HU7 A;  2DSA A;  1B9Y C;  4K7I A;  2RUF A;  1KEB A;  1BAY A;  4ACS A;  3TKS C;  5AIS A;  1F6M C;  2L57 A;  1FAA A;  3A2W A;  4L0U A;  5IMD A;  1TTZ A;  1OC9 B;  3N5O A;  3TKP A;  3FK8 A;  3P7X A;  3IAS 2;  2YWO A;  1SL2 B;  3NIV A;  2QKE A;  1EP7 A;  2FA4 A;  5DJM A;  4DSS A;  2I81 A;  3SBC A;  2BTO T;  3UVT A;  5F05 A;  4F0B A;  3KJY A;  4POM A;  4LL4 B;  2YV7 A;  2GQK A;  2OE0 A;  1SEN A;  2JAC A;  4FH8 A;  11GS A;  1XZO A;  2M46 A;  5COH A;  5DVB A;  4Z2R A;  3KMN A;  2CZ2 A;  2O8V B;  6GSX A;  2FHE A;  5IPH A;  1GSU A;  1XOB A;  3ME8 A;  2GLR A;  4PQ1 A;  1FB6 A;  5ECP B;  3IBH A;  4IQA A;  4YQU A;  1M9A A;  5CNW A;  3GX0 A;  5DAK B;  4OD7 A;  5ID2 B;  1Q4J A;  4LMV A;  3G7J A;  3HD5 A;  1K0B A;  4TRX A;  3S9F A;  4Q5Q A;  1ERT A;  5BRT A;  4MP4 A;  4J2F A;  1M2D A;  2JSY A;  4L5O A;  3VPT A;  2P5R A;  3FR9 A;  5FT3 A;  2L6C A;  3CRU A;  2DJ3 A;  2N5A A;  5HR1 A;  5D8I A;  4RI6 A;  5B8A A;  4GSS A;  22GS A;  4NMU A;  5ELA A;  5J4U A;  2LNS A;  2CAI A;  2LEG A;  4V2L A;  4CHS A;  5EVO A;  1UN2 A;  1HQO A;  2P0G A;  5IMV A;  5CO3 A;  1KBN A;  4ZBB A;  1O6J A;  3LFL A;  1G6Y A;  2R0P A;  1V57 A;  1JZO A;  3IC8 A;  4F9Z A;  1GNE A;  3L9S A;  3KH9 A;  3QPM A;  2L5L A;  3NZN A;  1OKD A;  4CDO A;  3U6V A;  5IPG A;  1EEM A;  4QL7 A;  3E9J B;  3LQ7 A;  4TR1 B;  1BYE A;  4K1F A;  4OCF A;  3FZ5 A;  4ZB9 A;  2LST A;  2H19 A;  5DQS A;  1RQM A;  2JZR A;  3TB2 A;  2CZ3 A;  1N2A A;  1SJI A;  2K8S A;  4ML1 A;  5AIV A;  1ZCP A;  1OKT A;  2VCZ A;  4OMV A;  4G0K A;  4PTS A;  1TP9 A;  4KCE A;  5DAL B;  4JU5 A;  4AF2 A;  1WIK A;  4HZ2 A;  4JED A;  4N0V A;  2H1B A;  4YQV A;  3CMI A;  4LLR A;  2AJQ B;  2DC5 A;  2GT6 A;  4BL7 A;  2LS5 A;  4DSQ A;  3UMA A;  5E59 A;  2WDU A;  1AC1 A;  3C7M A;  4WR4 A;  4IQ1 A;  4EXJ A;  5DCH A;  4USS A;  1U3I A;  3TRQ A;  1GSD A;  4E8E A;  3IK7 A;  4EL1 A;  1TRW A;  2AB6 A;  3W8J A;  1XW9 A;  4XS4 B;  4HDE A;  2LQO A;  3J7Y b;  2YWI A;  4ICY A;  4O7H A;  2A2S A;  4MDC A;  4Z2T A;  5G30 A;  1ZYP A;  3A3T A;  3KIJ A;  1GRX A;  1G0T A;  2YPM A;  1EGR A;  1OVN A;  3ZVJ D;  3F4S A;  4EUY A;  1ZYN A;  2C0G A;  1J9B A;  2HSM A;  2HYX A;  4YKG A;  4BVY A;  2KOK A;  5KN0 A;  1O85 A;  3W8S A;  5J41 A;  5INY A;  2OJL A;  2JL4 A;  4H86 A;  3UEM A;  1LJR A;  2LRN A;  4MJB A;  4RQX A;  3H79 A;  4V2M A;  1TI1 A;  3H8Q A;  4IP6 A;  2HZE B;  4KCA A;  3M1G A;  1K0D A;  2KHP A;  4RUV A;  3BCI A;  1FOV A;  1PA3 A;  3GSS A;  2C80 A;  3VI7 A;  1EP8 A;  3WGX A;  2H1A A;  1GUL A;  2OA7 A;  5HFK A;  4X43 A;  3ISO A;  3M9K A;  18GS A;  1EOH A;  2X8G A;  2H01 A;  5DDL A;  3C1S A;  1M7T A;  2YZH A;  3DVW A;  3VLN A;  1C72 A;  1GNW A;  3UAR A;  1V40 A;  3K8N A;  3VWX A;  3GKN A;  3TKS A;  2XPD A;  1NSW A;  1QQ2 A;  1DSB A;  2EIR A;  4BWS A;  3CYN A;  3PH9 A;  5E4W A;  4XS1 A;  1R26 A;  2L59 A;  3U5R E;  4BWQ A;  2OKA A;  1XWC A;  5AIX A;  5EPF A;  4MPG A;  4AJ8 A;  3F4T A;  2HFD A;  2VL9 A;  3EIN A;  2R5G A;  1YF0 A;  2O87 A;  2MZC A;  2YOI A;  2DKH A;  1X9S B;  4F2I A;  2K9F A;  5IMZ A;  1O8W A;  3G7I A;  5FWG A;  4TXO A;  2H70 A;  4TN8 A;  3L9V A;  4K9Z A;  1S3D A;  4IEL A;  2VIM A;  4POK A;  4O5R A;  3E0U A;  2QGV A;  4XHM A;  3OR5 A;  3FR3 A;  4GWR A;  1GWC A;  5A5K A;  4FYB A;  2H30 A;  4PUR A;  2IL3 A;  5CRW A;  3HHV A;  1O73 A;  4YKF A;  4QQ7 A;  2AV4 A;  4IJI A;  4G9H A;  2VM1 A;  3APS A;  1U3A A;  1USB A;  5ECN B;  1DUG A;  2L4Q A;  4KA0 A;  3HYP A;  3GYK A;  2MMO A;  2GSQ A;  3H1N A;  3TJK A;  2ALB A;  2JZT A;  3CRT A;  1WRY A;  2F3M A;  2H8L A;  2IMD A;  3L0H A;  1VF1 A;  1XW5 A;  1SJ6 A;  2VAF A;  2KP1 A;  4K0N A;  2B1K A;  2H0I A;  1OYJ A;  1T7P B;  2PUK C;  4KE3 A;  5LD0 A;  2H6Y A;  3FZ4 A;  1T4Y A;  3CXG A;  2FWG A;  3QFA C;  5L71 A;  2PER A;  2GS3 A;  3APQ A;  1A2J A;  2HE3 A;  4PUF C;  1CQH A;  4JZQ A;  1ZYQ B;  1TU7 A;  2JAD A;  2IMI A;  3IOS A;  1VRS D;  3RHB A;  3L78 A;  3W6G A;  1XCC A;  2FLS A;  2BMX A;  1N8J A;  3C8E A;  2GTU A;  2CT6 A;  2MBT A;  2MMZ A;  1GLP A;  3IDV A;  4NWY A;  3HXS A;  1V9W A;  2IMF A;  4I2U A;  4DVC A;  3N9J A;  4Z7X A;  2KP2 A;  5G2Z A;  4EC0 A;  1U88 A;  1F3B A;  3US3 A;  1PKZ A;  1J08 A;  2YJH A;  1ZZY A;  3WGE A;  4BPY A;  3TKQ A;  4MF7 A;  3GUR A;  3C1R A;  2FA8 A;  1MDI A;  1BG5 A;  1K0O A;  2NPB A;  3I6A A;  2VLU A;  3TGZ A;  1GP1 A;  4A5P A;  1TKD B;  1TJD A;  4ZB6 A;  4TVE A;  4KGI A;  1UVZ A;  2VCQ A;  3EVI A;  4RI7 A;  2LTK A;  4G0I A;  1OC9 A;  1ON4 A;  4MA9 A;  2VOC A;  1AXD A;  2HRK A;  3H4K A;  4FYU A;  4KH7 A;  1SD9 A;  3TCO A;  4EKZ A;  2YN1 A;  4P3Y B;  1TK5 B;  4KF9 A;  3DRN A;  1XIY A;  3ERF A;  2PPT A;  5ECL B;  1CQG A;  3ZIV A;  2H0G A;  5A4W A;  4Q5F A;  1XBS A;  2J9H A;  3WT2 A;  4WXT A;  4IBP A;  3FZA A;  3DD3 A;  1TW9 A;  2MMA A;  4WKW A;  2H73 A;  2H71 A;  5KOW A;  1X9W B;  1VF3 A;  2FGX A;  5IOX A;  5IM9 A;  4GSN A;  1VF4 A;  3QCP A;  3KP9 A;  4KDY A;  2RLI A;  3LYP A;  4ZIL A;  3LYK A;  3HCZ A;  5CP1 A;  2WZ9 A;  1THO A;  2GT5 A;  3KTL A;  2MMN A;  2YZU A;  5DAK A;  5ECM B;  4TXV A;  5IO2 A;  1EZK A;  4X1U A;  3ZTL A;  5ID2 A;  2ES7 A;  1ERW A;  2HSH A;  3UIW A;  1PN0 A;  2YWM A;  2PVQ A;  3CSI A;  3IHG A;  3SWL A;  4ISD A;  1Y6E A;  3A2X A;  1JHB A;  5F8B A;  2A4H A;  3QOU A;  2QC7 A;  2GSR A;  3M0F A;  1S3C A;  1M99 A;  5KN1 A;  4EO3 A;  2C1Y A;  2K6V A;  1U87 A;  4IGJ A;  2O7K A;  1OC3 A;  1R5P A;  1AUC A;  3VFI A;  3GH9 A;  5C04 A;  4MZW A;  4D73 B;  1WOU A;  5AGY A;  1Z5Y E;  3D22 A;  1WP0 A;  1ACV A;  5CRH A;  4CY6 A;  4WEY A;  1H75 A;  2R0G A;  2B6M A;  3MNG A;  3APO A;  4TR1 A;  1AQX A;  3KD0 A;  2H75 A;  5J9C A;  2NTO A;  2EIO A;  2GGT A;  2VO4 A;  2C0F A;  3KM6 A;  2VL2 C;  2H6Z A;  4HI7 A;  4NV5 A;  4V1A p;  5B6M A;  2V32 A;  1E2Y A;  4JE1 A;  4NHW A;  2WJU A;  1YJ6 A;  5B8B A;  4LL1 B;  2WB9 A;  2DJJ A;  4HEA 2;  5F07 A;  1FVJ A;  5DAL A;  2I4A A;  4HUA A;  3D5J A;  1TRS A;  3R2Q A;  4IVF A;  1XWA A;  2HLS A;  1Z9H A;  1WWJ A;  17GS A;  5IO0 A;  4DSR A;  4ZB8 A;  4ZIJ A;  3HJM A;  4HZ4 A;  2M80 A;  3EMX A;  3EU4 A;  2DJ0 A;  4X0X A;  2B5E A;  1ZYE A;  3GST A;  1GLQ A;  1M0U A;  4FYC A;  4PGT A;  4XS4 A;  1VF2 A;  2XPE A;  7GSS A;  2RM6 A;  4IKH A;  3LG6 A;  4ZBA A;  4K7N A;  1R5A A;  6GSS A;  5H5S A;  4MMM A;  1SK1 A;  4ML6 A;  4GQC A;  3TKR A;  1O7U A;  1SJZ A;  2DMM A;  5A4V A;  3UL3 A;  2RII A;  2P5Q A;  4K2D A;  3Q19 A;  4MJA A;  5DQY A;  1X5D A;  1Z7R A;  5ENU A;  2XC2 A;  3PR8 A;  5EY6 A;  4OO4 A;  4POB A;  1XVW A;  2HI7 A;  6GSW A;  4OFM A;  4I5Q A;  4BA7 A;  3F9U A;  1JZD A;  4FQU A;  1A2M A;  2WFC A;  2NVL A;  1TK0 B;  2HZE A;  1RK4 A;  3MDK A;  3VUR A;  2LQQ A;  3ZMK A;  2ON5 A;  2ZUP A;  2DJ2 A;  4YH2 A;  3EYT A;  1FOH A;  1SK2 A;  1MTC A;  4PUA A;  1R4W A;  4YAP A;  2I3Y A;  4FO5 A;  5GST A;  1GUK A;  4GRF A;  1SKW B;  2H66 A;  2VM2 A;  2C8U A;  1BED A;  4YAV A;  5CRG A;  1QGV A;  4XRD A;  4ID0 A;  1GSQ A;  3TKS E;  3WYW A;  4HQZ A;  1NM3 A;  5ECK B;  1TDI A;  4HJ2 A;  1KNG A;  3BJ5 A;  2LNT A;  4NXI A;  3WGD A;  2V41 A;  1PQN A;  3LOR A;  1A24 A;  20GS A;  3UVH A;  1THX A;  1M9B A;  5G1L A;  3ZFL A;  3FEU A;  1PL2 A;  2YV9 A;  2L6D A;  3BOA A;  3IHQ A;  1ILO A;  2YP6 A;  3QD9 A;  2P31 A;  3HJP A;  4K5S A;  1ERV A;  3LEF A;  1T8E B;  2CQ9 A;  2B3S A;  3HY2 A;  1S3A A;  3MSZ A;  3LWA A;  3VK9 A;  4ILF A;  2OE3 A;  2GZY A;  2X4A A;  2CA8 A;  1JLV A;  2A2P A;  4KW6 A;  3ZLP A;  5ELG A;  4I97 A;  3DYR A;  1T1V A;  2HRN A;  4E8H A;  5ECH B;  1G6W A;  3D0Z A;  1YF1 A;  3F0I A;  4K0G A;  4XRA A;  3G9B A;  1TRV A;  5KOX A;  1M2B A;  5J3R A;  1FVK A;  3A5W A;  1B4P A;  1AIU A;  2IWT A;  1WJK A;  4QL9 A;  3MWH A;  4HJM A;  5GSS A;  1SKR B;  13GS A;  3F6D A;  3IC4 A;  1PL1 A;  5IMF A;  4Q5R A;  1V58 A;  5F06 A;  1ZGN A;  3KTB A;  3ZML A;  3QAV A;  3LSZ A;  4MH2 A;  1HNA A;  1EGO A;  1SL0 B;  5G5F A;  3ZVJ A;  1Y25 A;  4K5R A;  4KDX A;  1ST9 A;  2EC4 A;  4F03 A;  2F51 A;  3WD6 A;  1TK8 B;  1FG4 A;  4MLY A;  2MBS A;  2HZF A;  3GV1 A;  1PKW A;  4KND A;  1E6B A;  2E2G A;  4GXZ A;  2VD1 A;  3A2V A;  3DXB A;  4MK3 A;  2CVB A;  2HRA A;  2B7K A;  3QR6 A;  1PGT A;  2ZCT A;  5J5N A;  2AYT A;  4HU9 A;  2R3X A;  4XS6 A;  4F0C A;  2VL2 A;  3ZIT A;  5B7C A;  5H5Q A;  1FO5 A;  2C3Q A;  2J23 A;  3VWU A;  5HR3 A;  3UBL A;  3ERG A;  4ZL7 A;  4ECJ A;  3V1W A;  4I6X A;  2REM A;  1B4Q A;  2D2Z A;  1O8X A;  5ECI B;  4BVX B;  4OFT A;  3IV4 A;  3EC3 A;  4NAX A;  1GSF A;  3BCK A;  3PPU A;  2R6K A;  1MDJ A;  3GKK A;  2DIZ A;  2HT9 A;  2I9H A;  3DGQ A;  2HNL A;  3BBY A;  2IFQ B;  4MF6 A;  4MF5 A;  1PN9 A;  4ZBD A;  3G7Y A;  1H4O A;  4IW9 A;  2H76 A;  3PGT A;  2CX3 A;  1K0M A;  3QAG A;  3KGK A;  3ED3 A;  1T00 A;  2TIR A;  3UJ1 A;  4AJ7 A;  3GRX A;  3ZZX A;  2A4V A;  3Q6O A;  3H93 A;  2DBC A;  1U6T A;  1LBK A;  3GL3 A;  2H74 A;  2V6K A;  4JR4 A;  3GIX A;  5ABR A;  3TRP A;  4WBJ A;  2WGR A;  2B5Y A;  4G19 A;  4I2T A;  3M8N A;  1G7E A;  3HVV A;  5D96 A;  3QDN A;  5CRE A;  2F8F A;  10GS A;  4ZL8 A;  2F8A A;  4PXO A;  3BD2 A;  5AN1 A;  3C73 A;  1EOG A;  1M2A A;  2HRF A;  4POL A;  2GQM A;  3TRX A;  4GQF A;  1QK8 A;  3IE3 A;  5IMA A;  4KAE A;  2TRC P;  4ECI A;  1ERU A;  3FKF A;  1XXU A;  3KMO A;  1A2L A;  2C0D A;  5HFG A;  4F82 A;  2H72 A;  1SD8 A;  5CRD A;  3RBT A;  2FD3 A;  2RUE A;  1EWX A;  1NW2 A;  4PQI A;  2I1U A;  3KXO A;  3IRA A;  5ECS A;  2C3N A;  1B9X C;  1Z3E A;  1SKS B;  1X5C A;  2C3T A;  4FIW A;  2JU5 A;  4HOJ A;  5LNK e;  2NDO A;  1Z7P A;  1I9D A;  1QXH A;  2R0C A;  3O76 A;  2VLV A;  2GQL A;  4GTU A;  5D9W A;  1DE1 A;  1A8L A;  2C4J A;  2YNX A;  1XWB A;  2YJ7 A;  3RHC A;  4K7O A;  1GSS A;  5EL8 A;  4V1A g;  2WRT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...