4DSSA

Crystal structure of peroxiredoxin ahp1 from saccharomyces cerevisiae in complex with thioredoxin trx2
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
174
structure length
174
Chain Sequence
b'DLVNKKFPAGDYKFQYIAISQSDADSESCKMPQTVEWSKLISENKKVIITGAPAAFSPTSTVSHIPGYINYLDELVKEKEVDQVIVVTVDNPFANQAWAKSLGVKDTTHIKFASDPGCAFTKSIGFELAVGDGVYWSGRWAMVVENGIVTYAAKETNPGTDVTVSSVESVLAHL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peroxiredoxin type-2
publication title Structural Snapshots of Yeast Alkyl Hydroperoxide Reductase Ahp1 Peroxiredoxin Reveal a Novel Two-cysteine Mechanism of Electron Transfer to Eliminate Reactive Oxygen Species.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase/transport protein
total genus 50
structure length 174
sequence length 174
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2012-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08534 Redoxin Redoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4dssA00
3DD3A 4HDEA 1XXUA 2VCWA 3IAS2 3KXOA 4QQ7A 4O32A 1X5EA 4OFNA 5DAKB 5IOXA 4X43A 5DALB 1Z6MA 4Q5QA 4TVEA 2HI7A 1GL8A 1G6WA 3HXSA 2MZCA 3F6FA 2QGVA 3UEMA 2IMKA 5IMDA 2FLSA 3HJOA 1AQWA 3L4NA 2H66A 4DSRA 4IJIA 1NW2A 1T7PB 1ZZYA 1EV9A 4HU7A 3EE2A 3H4KA 1SL1B 3N5OA 1X0RA 3KEBA 2JACA 1MDIA 3D4MA 4LLRA 3BCIA 2EIOA 2F8AA 2O7KA 1TOFA 1A0RP 5A5KA 5CRDA 1LU4A 3LWAA 3UMAA 3GRXA 4JEDA 2H0GA 5E59A 3CXGA 4NXIA 4G10A 2VOCA 3GIXA 1H4OA 2CAIA 1XIYA 4F03A 1SENA 4RI7A 2OE1A 1AIUA 1SK2A 6GSVA 4BVYA 3GURA 4ML6A 5DDLA 1VF2A 4K2DA 13GSA 2H75A 1Y6EA 4POBA 1K0OA 4TW5A 1FG4A 2WDUA 3GUSA 3KIJA 1XPVA 1G6YA 1F2EA 3VPTA 5A4VA 1B4PA 1EOGA 5H5RA 3EVIA 3ZITA 4N0VA 4BPYA 3GKKA 1GNEA 2DBCA 3IXRA 4AJ7A 1TDIA 3FW2A 1K0MA 1M9AA 4EVMA 2LJAA 2LNSA 1NSWA 4HUAA 3HJMA 4EDYA 2AAWA 1JZOA 1ZCPA 2HZFA 1S3DA 5AISA 1T4YA 3FRCA 5F06A 4YAVA 2IMIA 4KCEA 2L5LA 1XCCA 2YZUA 2HE3A 3UAPA 1PA3A 1JZRA 2IWTA 2AJQB 2L4CA 2CVKA 1TRVA 3A3TA 5IPHA 3IDVA 5DBQA 1YKCA 3DYRA 4ECIA 4TKYA 2I1UA 1FVJA 1ERUA 2PUKC 4P3YB 3FR6A 2GQKA 2OADA 3MAKA 4CHSA 1O8XA 4GSSA 2X99A 3EWLA 1XOAA 4OWYA 3M0FA 3QFAC 1PX7A 2B5XA 1M0UA 5HFGA 3FY7A 5COHA 3TKSA 1TTZA 2ON5A 4Q5NA 2O85A 4J56E 2HXKA 5CP1A 2VL2C 4IVFA 1KTEA 4IBPA 4LMWA 4HQSA 1GNWA 3GKMA 1ACVA 4JE1A 4GF0A 4BL7A 4PX1A 2VL9A 4TR3A 4YAPA 1WE0A 1DE2A 4KX4A 1A2MA 1TXXA 3VWVA 3D22A 4WEYA 14GSA 5JWOB 3E9JB 5EY6A 4IN0A 3F8UA 4L0WA 4KAEA 3CSIA 4YQUA 2F51A 1SYRA 1Q4JA 2OBIA 1K0NA 1I9DA 2R3XA 1N2AA 1A0FA 1VRSD 2P31A 5LCZA 1O73A 2WS2A 6GSYA 1EEMA 4NV2A 4AJ6A 3C1SA 2KOKA 2YWNA 3UBKA 1XWBA 3E3EA 4GWRA 1OC9A 3NZNA 3KTLA 4ZBDA 5IMCA 3ZFLA 1GSUA 4ZILA 3VWWA 2HFDA 2FA4A 1T3BA 1B8XA 1A24A 5FWGA 3G7YA 3GH9A 2MMAA 3RDWA 5KN1A 2G2QA 4HZ4A 3D4TA 1ERVA 4H86A 1O85A 2JSZA 1RK4A 1V58A 2KLXA 2RM6A 1EWXA 2I81A 5CNWA 1YEPA 19GSA 3ZMKA 2CVBA 3GH6A 3ZYWA 2VL3A 2B7KA 2C0GA 5DJMA 2WB9A 1SK1A 1OKDA 4MABA 4DVCA 2HLSA 3KTBA 1GH2A 3DMLA 1B9XC 3ERWA 5B6MA 1XW9A 2EC4A 8GSSA 4HOJA 2DJJA 4J57E 4KGIA 1WPIA 1OC9B 1XWKA 1M2AA 5E4WA 3WGDA 5C04A 1E2YA 3FKFA 1M99A 2GGTA 3FZAA 4ZXGA 4N10A 5D73A 1IYHA 2H76A 2YPMA 4MF5A 2CAQA 1W4VA 1MDJA 5FT3A 2H73A 3L9SA 4OMVA 4ULXA 2LV3A 2WJUA 4IELA 2YZHA 4D73B 3TOUA 3TKRA 2RUEA 3GA4A 1V98A 2F8FA 2WRTA 1T4ZA 3HYPA 2IJYA 1X5CA 3KP9A 2CZ3A 3ZZXA 5GAND 3LYPA 5G2ZA 7GSSA 3TRQA 1YKAA 1DSBA 3ZIJA 2XPEA 2L59A 5DJLA 5D9WA 5ECSA 2IMEA 3E0UA 5ABRA 4PURA 3QAVA 1BYEA 3HD5A 2FNOA 1YF1A 1BQ7A 1B9YC 4ZB9A 3DVWA 5ELGA 3Q6OA 2X8CA 4N11A 5IOWA 4HJ2A 5D9TA 2AV4A 1SJ6A 4KSMA 2DJ2A 3C1RA 4KCAA 1VF3A 3ERFA 4G9HA 4NWYA 5CO3A 1TJDA 1CQHA 4V1Ap 2GTUA 4RI6A 3M8NA 5H5SA 6GSSA 4ZBAA 1NHYA 1S3AA 1W89A 2GT5A 3FK8A 1YQ1A 3TKSE 1GULA 1X9SB 4K0NA 3GFKA 2PVOC 2HSHA 4GQFA 5IM9A 2R5GA 4ACSA 3KGKA 5CRHA 3SBCA 4MJEA 5IIZA 2LNTA 2BJXA 4FIWA 3A2VA 5AIXA 5CYYA 1XW5A 1AQVA 2OBKA 1F3BA 4RUVA 1QFNA 2X8HA 5AN1A 2VUPA 5JWQB 1SKRB 3LYKA 3ERGA 4DSQA 4ZB8A 1T1VA 1NM3A 1ABAA 4NHZA 4EE0A 1WJKA 4ZL8A 4XS6A 1RW1A 1PKWA 3ME7A 3UOMA 4DSSA 4XCSA 3IK9A 4BA7A 1TU8A 3C73A 2XBIA 1ILOA 1TK8B 2GZZA 3TKSC 4IQ1A 2WFCA 2VM1A 17GSA 3C71A 1UVZA 5FHIA 1ML6A 4V2NA 4ISDA 1YDKA 2ON7A 4TR1A 5AIVA 1URMA 1USBA 4I2TA 20GSA 3GKNA 3IC4A 2ZNMA 2HYXA 1OVNA 3CYNA 4OO5A 2GS3A 2B3SA 3AY8A 1J0FA 3F3QA 5HR2A 1SJZA 1EGRA 2PGTA 2J9HA 3A5WA 2GVPA 2VLUA 4AJ8A 4NMUA 5G1LA 3IHQA 2WGRA 2PERA 3HDCA 4J2FA 2TRXA 4GSNA 1EOHA 2YANA 3HZ8A 1ZGNA 2GT6A 4KDYA 2LS5A 4DSSB 3PH9A 2M72A 4OFTA 1GWCA 4V2LA 5IO0A 1TI1A 2PPTA 2ZCTA 2C1YA 2CQ9A 1G7OA 2CX3A 4MMMA 1HNCA 1R7HA 3EU4A 4TR1B 1XWCA 2HNLA 1YF0A 2PMTA 3LGCA 2AB6A 3WYWA 5A4WA 1KNGA 2MMZA 3GYKA 5CRWA 1QUWA 4NAXA 4KDUA 3BD2A 3DGQA 4G19A 1CQGA 4YQMA 1T00A 4OCEA 3P90A 4DEJA 4MF7A 2RUFA 3QD9A 4X0XA 11GSA 3GHAA 3TRPA 4RQXA 4V2MA 2YOIA 5CREA 5G31A 2F9SA 2M80A 3L9VA 5HR0A 1EGOA 1VF4A 2G0FA 2VLTA 2CVDA 5G5FA 2A4VA 1PRXA 1A8LA 3MSZA 2R37A 1MTCA 4PQIA 1SYXA 3P2AA 3F63A 4HU9A 2VCTA 3WGEA 2I9HA 2LTKA 3Q18A 3UIWA 10GSA 2YJHA 3A2XA 5G5EA 3WT2A 5ECMB 2DJ0A 2FA8A 2MMNA 5IMZA 1SD8A 2YWMA 4GQCA 2V32A 2DIZA 3APOA 5CRGA 1PKZA 4N30A 1B4QA 1XWGA 2YWIA 3N9JA 2H6YA 1XVWA 3FZ4A 4L0UA 3VPQA 2YV9A 2MMOA 2NBSA 3GL5A 4MH3A 4F2IA 3CSJA 2H1DA 5ID2A 1GTAA 5AGYA 1QMVA 4QL9A 1Z3EA 1HD2A 4JR4A 4YQVA 2LJKA 1FAAA 1TP9A 2XPDA 3J7Yb 1AW9A 4IGJA 3HKRA 4WF4A 2CX4A 2V1MA 1UA5A 1ERWA 1AUCA 3QMXA 2GZPA 2R4VA 1F37A 5H5QA 3QPMA 4EF0A 3QFBC 1X9MB 3RHCA 1UN2A 3L78A 5B6NA 1PSQA 3GMFA 2HZEA 1BAYA 3MDKA 3P8WA 2VLVA 6GSTA 4PQ1A 2FWGA 4LA1A 2NPBA 3DVXA 5KN0A 5JWRB 1GTBA 5ECQB 2YWOA 4LL4B 1K0DA 2H72A 2B5EA 2N5FA 3KCMA 3GNJA 2KHPA 5ID2B 1GUMA 3H79A 5D93A 3SWLA 1SU9A 2B6MA 5INYA 2IMDA 3W8SA 3TCOA 1U88A 3G7IA 1WP0A 2H74A 4TR4A 2DMMA 3DRNA 1TKDB 2XBQA 2LQQA 4XRDA 2PWJA 4E8EA 3M3MA 4V1Ag 2VIMA 2X8GA 3M1GA 3ZLPA 3LORA 1ZOFA 3GKXA 2DSAA 2DJ1A 4ECCA 3FR9A 3APQA 3H8QA 4JBBA 5J4UA 3IPZA 2GZYA 1XOBA 4PUFC 4MJCA 3RPPA 2AHEA 4MP4A 2FGXA 3U6VA 2HZEB 1XZOA 1EP7A 3LSZA 3S9FA 3TGZA 1ZL9A 4K8MA 5HFKA 1SL0B 3ZVJD 3VI7A 2H30A 2JL4A 3TRXA 3VI5A 2ALBA 2H6XA 2BTOT 4IQAA 2HT9A 3MNGA 5DQSA 2JZRA 2D2ZA 9GSSA 4EUYA 4GLTA 5B7CA 5ECPB 4K7OA 4O92A 4PNGA 2LJRA 3TJGA 4F0BA 2DJKA 1FOVA 5EL8A 2K8SA 2V41A 3KH7A 2C3TA 1ZYEA 1FVKA 22GSA 2E2GA 1KEBA 1FW1A 2CV4A 3ZMLA 1GSYA 4GCIA 4OCFA 4POMA 1H75A 4WF5A 1J9BA 2O89A 3KD0A 1O8WA 3LQ7A 1K3YA 3TKQA 5JCUA 1EP8A 2YCDA 2Z9SA 2FD3A 5GZZB 3IR4A 4I5QA 4ZL7A 4EC0A 2YN1A 2C0EA 3U5RE 2EIQA 3TUEA 5IQYA 4MZCA 2H1BA 2N5AA 2KP1A 3HCZA 3CRTA 3TOTA 1ERTA 3APSA 1PL2A 4WETA 1RQMA 3H93A 1TW9A 5LD0A 3KZQA 3W8JA 3ZFBA 1PX6A 4K0GA 1JHBA 4ML1A 4NV5A 1M2DA 2LKUA 2E7PA 2GDRA 5GSSA 4MLYA 2HRFA 4N0ZA 4GTUA 2H1AA 4QL7A 1PGTA 2NDOA 4MJBA 1FB6A 3RHBA 2JADA 3HVXA 3NOFA 1XWAA 2B5YA 2FY6A 1U87A 1OAZA 3EURA 3G9BA 4G2EA 1TRSA 1ON4A 3LJRA 4OFMA 4ZIJA 3EINA 2V6OA 2IN3A 3DKSA 1TRWA 3GV1A 1N8JA 1OE7A 3LEFA 2C0DA 3VFIA 5ECLB 2V2GA 3TJKA 4BWSA 5EVOA 3ZVJA 1M7TA 3VLNA 3KP8A 3JCML 3Q74A 4WR5A 1R5AA 4KNDA 2JSYA 1T8EB 2REMA 3J7Yk 3TB2A 2LRTA 2B1KA 3BCKA 2PVQA 6GSXA 4BWQA 1ZYQB 2GSRA 4IP1A 1S3CA 1F3AA 1V40A 4WKWA 3RPNA 2VCXA 1GSQA 1XFLA 4MPFA 2C3NA 2XC2A 2YV7A 4FYUA 2L6DA 3GSTA 4GSTA 4PNFA 4EL1A 5F07A 5B8AA 3F0IA 2MYGA 2P0GA 2XHFA 4TXOA 1Z9HA 2L6CA 1O81A 5HR1A 4AF2A 4EKZA 5F0GA 3FHKA 3RAZA 2VCVA 1AC1A 2J23A 3TKPA 3M9JA 2OA7A 2P5QA 2FCHA 5LNKe 1X5DA 1WIKA 3IA1A 1EEJA 1Z6NA 3F4TA 5IMAA 3ZL5A 2FUG2 3GL3A 1V9WA 2PU9C 2H01A 1QGVA 2H0HA 2C8UA 1DE1A 3ISOA 3ZRDA 2DJ3A 1TRUA 3GX8A 3BOAA 4CW9A 1U3AA 1BJXA 2DLXA 4IJ3A 3VK9A 3OR5A 5HFIA 3UBLA 4HQZA 1GUHA 1Y25A 4FO5A 1PD21 3QAGA 3KJYA 1U3IA 2B1LA 1HYUA 4JU5A 4F0CA 3O6TA 2YNXA 2FHEA 4TXOB 4MH2A 2VD1A 4KH7A 1SJIA 3LXZA 2OE0A 2EIRA 1Z5YE 2M46A 4K7NA 2H6ZA 2O87A 3DXBA 3K8NA 2H0IA 2FWFA 1HQOA 3O3TA 1AAZA 1MDKA 4O5RA 2RM5A 3IBHA 1U6TA 4AGSA 2X64A 3QR6A 3W6GA 3TDGA 1A23A 5ECHB 3D5JA 3QOUA 2KUCA 2C0FA 4EXJA 1GSEA 2HSYA 2L5OA 1HNBA 2A2RA 4KE3A 5KEJA 3VWUA 5IPGA 4CDOA 3GTUA 2IFQA 2VAFA 1XW6A 2E0QA 4ILFA 4ID0A 1DUGA 3I9V2 4L5LA 4IP6A 5B8BA 4JZQA 5HQPA 2GQMA 1X9WB 4MZWA 1K3LA 2CT6A 3H1NA 2IMFA 1V2AA 2LUSA 5ENUA 4LL1B 4K7IA 2CA8A 4Q5FA 3I69A 5C00A 4IHUA 4NHWA 4ZBBA 1QK8A 5ECOB 3TJFA 2WZ9A 5D8IA 4L8EA 5DVBA 1K3OA 4Z7XA 5G1KA 1GTIA 4K9ZA 2LRNA 3DWVA 2H70A 2GSSA 2LSTA 2DIYA 1Q98A 2H19A 1WRYA 1MEKA 1UC7A 3IOSA 2OE3A 2KP2A 1G0TA 2GLRA 4KA0A 1MD4A 3VURA 1VF1A 3GTUB 5IMFA 5J3RA 2IL3A 3UJ1A 2K18A 2IFQB 4F82A 2LRCA 1PQNA 4MJAA 2QKEA 4MCUA 2DC5A 4Q5RA 2QC7A 5KN2A 1V57A 3GSSA 4K6XA 4KDXA 3DEXA 3D0ZA 3L0HA 3QAWA 4TXVA 5J9CA 5IO2A 4BVXA 3NIVA 4X1UA 1NHOA 3ZIVA 1TK5B 2C4JA 2RLIA 5CAXA 4XS4A 2NVLA 1JLVA 1THOA 2YJ7A 4XTSA 3TJJA 1F6MC 1TI3A 1XBSA 2GSTA 1THXA 2I3YA 3KMNA 4NPBA 1LBKA 2PBJA 5DQYA 3ED3A 1M9BA 1AXDA 1FB0A 4E8HA 2HRNA 1LJRA 3A2WA 1G7EA 3EC3A 1WWJA 5KN3A 1GSSA 2PN8A 1B48A 3BBYA 1YY7A 4I6XA 1QQ2A 5J41A 1FHEA 3UVTA 1PN9A 2P5RA 4HI7A 1GLQA 4RQRA 2K8VA 3KMOA 4EDZA 2O8VB 4PUAA 5F05A 4O7HA 1YJ6A 1EV4A 1OC8A 4ECBA 2H1GA 2AUVA 3CTGA 2H71A 2MBSA 1C72A 1JZWA 3F3RA 5D96A 18GSA 3F4SA 1ZMAA 2FWHA 5A4UA 3EYTA 4XS4B 4ZL9A 3M9KA 1M2BA 4I97A 1YZXA 3ZREA 4PGTA 4KW6A 3PR8A 1WMJA 4JRRA 1BX9A 1MD3A 3BJ5A 2E2MA 5L71A 3V1WA 4WR4A 2RIIA 1Z7RA 2L4QA 1KBNA 2K9FA 5GAPD 3UL3A 4XRAA 1OC3A 1BG5A 16GSA 1R4WA 1QXHA 3HHVA 4D73A 3IE3A 2YP6A 4POLA 4YH2A 1GSFA 2WULA 4GRFA 12GSA 3IK7A 3IV4A 1K0AA 3WD6A 5GSTA 2K6VA 1R5PA 4HZ2A 3EMXA 4HJMA 5DCHA 4XS1A 2VO4A 5EPFA 3F9UA 1BEDA 3TJBA 3C8EA 2C80A 3C7MA 2MBTA 1I5GA 3FEUA 3ZTLA 4POKA 3Q19A 3HJPA 2WCIA 1HNAA 4MZBA 2TRCP 6GSUA 5J9BA 1K0BA 2R2JA 2QSIA 2VCQA 2OKAA 4IW9A 2OJLA 1FO5A 3F6DA 2ES7A 4I2UA 3WGXA 2A2SA 5DCGA 3IRAA 4EO3A 2GSQA 1R26A 2I4AA 2NTOA 3DIEA 3CSHA 1AQXA 1A2LA 4KSOA 1DBYA 1IYIA 2R6KA 1EZKA 4PXOA 1Z7PA 2IIYA 3D21A 1J08A 1OKTA 3EMPA 1JFUA 1VGLA 1YEXA 4WBJA 4XIHA 4MA9A 2B7JA 2TIRA 3UVHA 5D9XA 3FZ9A 3QDNA 3ME8A 3IAM2 3O76A 1GUKA 5D9VA 3LXTA 4MDCA 5J5NA 5ECKB 1O7UA 5ECRB 2L57A 3HVVA 4IKHA 4ZB6A 1GTUA 4OD7A 5G30A 5ECNB 4OO4A 2VM2A 4XHMA 4K1FA 3FR3A 5ECIB 3I43A 1TK0B 5IMVA 3R2QA 2VL2A 2IPAA 1SK0A 3GX0A 1OE8A 3CRUA 3D6IA 3P7XA 5F8BA 4TR0A 1ST9A 3WT1A 1TU7A 4TRXA 2OACA 4KB3A 1GRXA 4PQHA 3CBUA 1XVQA 3F4RA 4IS0A 3KM6A 3I6AA 1O6JA 3FYGA 1A2JA 1F9MA 4ECJA 3FZ5A 3HA9A 4MPGA 1SL2B 4MF6A 2C3QA 5HR3A 4LMVA 3LG6A 2CZ2A 4TN8A 2AYTA 2VD0A 3CMIA 2N5BA 3L9UA 4HEA2 2V6KA 5DAKA 4FYBA 3GN3A 5DALA 5ELAA 4L5OA 1PL1A 3G7JA 3MWHA 2DMLA 3VWXA 1GLPA 1OYJA 1JLWA 2VCZA 3EU3A 3UARA 4KUNA 4TOPA 1JZDA 1K0CA 1SKWB 4FH8A 1WOUA 6GSWA 5JCGA 3LFLA 2JZSA 4HS1A 3HZ4A 4WBRD 2ZUPA 1E6BA 3RBTA 3KH9A 1GSDA 3HVSA 2LEGA 3HY2A 2FWEA 3PINA 2JZTA 3CTFA 4FYCA 4MK3A 4F9ZA 2LQOA 5JCWA 4JR6A 4WXTA 2BMXA 2GQLA 1GP1A 1SKSB 1SD9A 2F3MA 3QCPA 1PMTA 1A8YA 3PGTA 4GXZA 2H8LA 4I8BA 2JU5A 3US3A
chains in the Genus database with same CATH superfamily
3DD3A 4HDEA 1XXUA 2VCWA 3IAS2 3KXOA 4QQ7A 4O32A 1X5EA 4OFNA 5DAKB 5IOXA 4X43A 5DALB 1Z6MA 4Q5QA 4TVEA 2HI7A 1GL8A 1G6WA 3HXSA 2MZCA 3F6FA 2QGVA 3UEMA 2IMKA 5IMDA 2FLSA 3HJOA 1AQWA 3L4NA 2H66A 4DSRA 4IJIA 1NW2A 1T7PB 1ZZYA 1EV9A 4HU7A 3EE2A 3H4KA 1SL1B 3N5OA 1X0RA 3KEBA 2JACA 1MDIA 3D4MA 4LLRA 3BCIA 2EIOA 2R0PA 2F8AA 2O7KA 1TOFA 1A0RP 5A5KA 5CRDA 1LU4A 3LWAA 3UMAA 3GRXA 4JEDA 2H0GA 5E59A 1FOHA 3CXGA 4NXIA 4G10A 2VOCA 3GIXA 1H4OA 2CAIA 1XIYA 4F03A 1SENA 2QA2A 4RI7A 2OE1A 1AIUA 1SK2A 6GSVA 4BVYA 3GURA 4ML6A 5DDLA 1VF2A 4K2DA 13GSA 2H75A 1Y6EA 4POBA 1K0OA 4TW5A 1FG4A 2WDUA 3GUSA 3KIJA 1XPVA 1G6YA 1F2EA 3VPTA 5A4VA 4EIQA 1B4PA 1EOGA 5H5RA 3EVIA 3ZITA 2HRKA 4N0VA 4BPYA 3GKKA 1GNEA 2DBCA 3IXRA 4AJ7A 1TDIA 3FW2A 1K0MA 1M9AA 4EVMA 2LJAA 2LNSA 1NSWA 4HUAA 3HJMA 4EDYA 2AAWA 1JZOA 1ZCPA 2HZFA 1S3DA 1XG8A 5AISA 1T4YA 3FRCA 5F06A 2IMIA 4YAVA 4KCEA 2L5LA 1XCCA 2YZUA 2HE3A 3UAPA 1PA3A 1JZRA 2IWTA 2AJQB 3HVNA 2L4CA 2CVKA 1TRVA 4BVYB 3A3TA 5IPHA 3IDVA 5DBQA 1YKCA 3DYRA 4ECIA 4TKYA 2I1UA 1FVJA 1ERUA 2PUKC 4P3YB 3FR6A 2GQKA 2OADA 3MAKA 4CHSA 1O8XA 4GSSA 2X99A 3EWLA 1XOAA 5KOXA 4OWYA 3M0FA 3QFAC 1PX7A 2B5XA 1M0UA 5HFGA 3FY7A 5COHA 3TKSA 1TTZA 2ON5A 4Q5NA 2O85A 4J56E 2HXKA 5CP1A 2VL2C 4IVFA 1KTEA 4IBPA 4LMWA 4HQSA 1GNWA 3GKMA 1ACVA 4JE1A 1M3JA 4GF0A 4BL7A 4PX1A 2VL9A 4TR3A 4YAPA 1WE0A 1DE2A 4KX4A 1A2MA 1TXXA 3VWVA 3D22A 4WEYA 14GSA 5JWOB 3E9JB 5EY6A 2HSMA 4IN0A 3F8UA 3MIXA 4L0WA 4KAEA 3CSIA 4YQUA 2F51A 1SYRA 1Q4JA 4YKFA 2OBIA 1K0NA 1I9DA 2R3XA 1N2AA 1A0FA 1VRSD 4Z2TA 2P31A 5LCZA 1O73A 2WS2A 6GSYA 1EEMA 4NV2A 4AJ6A 3C1SA 2KOKA 4CY8A 2YWNA 3UBKA 1XWBA 3E3EA 4GWRA 1OC9A 3NZNA 3KTLA 4ZBDA 5IMCA 3ZFLA 1GSUA 4ZILA 3VWWA 2HFDA 2FA4A 1T3BA 1B8XA 1A24A 5FWGA 3G7YA 3GH9A 4BL7B 2MMAA 3RDWA 5KN1A 2G2QA 4HZ4A 3D4TA 1ERVA 4H86A 1O85A 2JSZA 1RK4A 1V58A 2KLXA 2RM6A 1EWXA 2I81A 5CNWA 1YEPA 19GSA 3ZMKA 2CVBA 3GH6A 3ZYWA 2VL3A 2B7KA 3LW9A 2C0GA 5DJMA 2WB9A 1SK1A 1OKDA 4MABA 4DVCA 2HLSA 2HRAA 3KTBA 1GH2A 3DMLA 1B9XC 3ERWA 5B6MA 1XW9A 2EC4A 8GSSA 4HOJA 2DJJA 4J57E 4KGIA 1WPIA 1OC9B 1XWKA 1M2AA 5E4WA 3WGDA 5C04A 1E2YA 3FKFA 1M99A 2GGTA 3FZAA 4ZXGA 4N10A 5D73A 1IYHA 2H76A 2YPMA 4MF5A 2CAQA 1W4VA 1MDJA 5FT3A 2H73A 4K5SA 3L9SA 4OMVA 4ULXA 2LV3A 2WJUA 4IELA 2YZHA 4X4JA 4D73B 3TOUA 3TKRA 2RUEA 3GA4A 1V98A 2F8FA 2WRTA 1T4ZA 3HYPA 2IJYA 1X5CA 3KP9A 2CZ3A 3ZZXA 5GAND 3LYPA 5G2ZA 7GSSA 3TRQA 1YKAA 1DSBA 3ZIJA 2XPEA 2L59A 5DJLA 5D9WA 5ECSA 2IMEA 1PN0A 3E0UA 5ABRA 1ZYPA 4PURA 3QAVA 1BYEA 3HD5A 2FNOA 1YF1A 1BQ7A 1B9YC 4ZB9A 3DVWA 5ELGA 3Q6OA 2X8CA 4N11A 4Z2RA 1PFOA 5IOWA 4HJ2A 5D9TA 2AV4A 1SJ6A 4KSMA 2DJ2A 3C1RA 4KCAA 1VF3A 3ERFA 4G9HA 4NWYA 5CO3A 1TJDA 4G0IA 1CQHA 4V1Ap 2GTUA 4RI6A 3M8NA 5H5SA 6GSSA 4ZBAA 1NHYA 1S3AA 1W89A 2GT5A 3FK8A 1YQ1A 3TKSE 1GULA 1X9SB 4K0NA 3GFKA 2PVOC 2HSHA 4GQFA 5IM9A 2R5GA 4ACSA 3KGKA 5CRHA 3SBCA 4MJEA 5IIZA 2LNTA 2BJXA 4FIWA 3A2VA 5AIXA 5CYYA 1XW5A 1AQVA 2OBKA 1F3BA 4RUVA 1QFNA 2X8HA 5AN1A 2VUPA 5JWQB 1SKRB 3LYKA 3ERGA 4DSQA 4ZB8A 1T1VA 1NM3A 1ABAA 4NHZA 4EE0A 1WJKA 4ZL8A 4XS6A 1RW1A 1PKWA 3ME7A 3UOMA 4DSSA 4XCSA 3IK9A 4BA7A 1TU8A 3C73A 2XBIA 1ILOA 1TK8B 2GZZA 3TKSC 4IQ1A 2WFCA 2VM1A 3R3EA 17GSA 3C71A 1UVZA 5FHIA 1ML6A 4V2NA 4ISDA 1YDKA 2ON7A 4TR1A 5AIVA 1URMA 1USBA 4I2TA 20GSA 3GKNA 3IC4A 2ZNMA 2HYXA 1OVNA 3CYNA 4OO5A 2GS3A 2B3SA 3AY8A 1J0FA 3F3QA 5HR2A 1SJZA 1EGRA 2PGTA 2J9HA 3A5WA 2GVPA 2VLUA 4AJ8A 4NMUA 5G1LA 3IHQA 5KOWA 2WGRA 4O5UA 2PERA 3HDCA 4J2FA 2TRXA 4GSNA 1EOHA 2YANA 3HZ8A 1ZGNA 2GT6A 4KDYA 2LS5A 4DSSB 3PH9A 2M72A 4OFTA 1GWCA 4V2LA 5IO0A 1TI1A 2PPTA 2ZCTA 2C1YA 2CQ9A 1G7OA 2CX3A 4MMMA 1HNCA 1R7HA 3EU4A 4TR1B 1XWCA 2HNLA 2R0CA 3MYDA 1YF0A 2PMTA 3LGCA 2AB6A 3WYWA 5A4WA 1KNGA 2MMZA 3GYKA 5CRWA 1QUWA 4NAXA 4KDUA 3BD2A 3DGQA 4G19A 1CQGA 4YQMA 1T00A 4OCEA 3P90A 4DEJA 4MF7A 2RUFA 3QD9A 4X0XA 11GSA 3GHAA 3TRPA 4RQXA 4V2MA 2YOIA 5CREA 5G31A 2F9SA 2M80A 3L9VA 5HR0A 1EGOA 1VF4A 2G0FA 2VLTA 2CVDA 5G5FA 2A4VA 1PRXA 1A8LA 3MSZA 2R37A 1MTCA 3IC8A 4PQIA 1SYXA 3P2AA 3F63A 4HU9A 2VCTA 3WGEA 2A4HA 2I9HA 2LTKA 3Q18A 3UIWA 10GSA 2YJHA 3A2XA 4CY6A 5G5EA 3WT2A 5ECMB 2DJ0A 2FA8A 2MMNA 5IMZA 1SD8A 2YWMA 4GQCA 2V32A 2DIZA 3APOA 5CRGA 4PTSA 1PKZA 4N30A 1B4QA 1XWGA 2YWIA 3N9JA 2H6YA 1XVWA 3FZ4A 4L0UA 3VPQA 2YV9A 2MMOA 2NBSA 3GL5A 4MH3A 4F2IA 3CQFA 3CSJA 2H1DA 5ID2A 1GTAA 5AGYA 1QMVA 4QL9A 1Z3EA 1HD2A 4JR4A 4YQVA 2LJKA 1FAAA 1TP9A 2XPDA 3J7Yb 1AW9A 4IGJA 3HKRA 4WF4A 2CX4A 2V1MA 1UA5A 1ERWA 1AUCA 3QMXA 2GZPA 2R4VA 1F37A 5H5QA 3QPMA 4EF0A 3QFBC 1X9MB 3RHCA 1UN2A 3L78A 5B6NA 1PSQA 3GMFA 2HZEA 1BAYA 3MDKA 3P8WA 2VLVA 6GSTA 4PQ1A 2FWGA 1M3IA 4LA1A 2NPBA 3DVXA 5KN0A 5JWRB 1GTBA 5ECQB 2YWOA 4LL4B 1K0DA 2H72A 2B5EA 2N5FA 3KCMA 3GNJA 2KHPA 5ID2B 1GUMA 3H79A 5D93A 3SWLA 1SU9A 2B6MA 5INYA 2IMDA 3W8SA 3TCOA 1U88A 3G7IA 1WP0A 2H74A 4TR4A 2DMMA 2X4AA 3DRNA 1TKDB 2XBQA 2LQQA 4XRDA 2PWJA 4E8EA 3M3MA 4V1Ag 2VIMA 2X8GA 3M1GA 3ZLPA 3LORA 1ZOFA 3GKXA 2DSAA 2DJ1A 4ECCA 3FR9A 3APQA 3H8QA 4JBBA 5J4UA 3IPZA 2GZYA 1XOBA 4PUFC 4MJCA 3RPPA 2AHEA 4MP4A 2FGXA 3U6VA 4A5PA 2HZEB 1XZOA 1EP7A 3LSZA 3S9FA 3TGZA 1ZL9A 4K8MA 5HFKA 1SL0B 3ZVJD 3VI7A 2H30A 4FQUA 2JL4A 3TRXA 3VI5A 2ALBA 2H6XA 2BTOT 4IQAA 2HT9A 3MNGA 5DQSA 2JZRA 2D2ZA 9GSSA 4EUYA 4GLTA 5B7CA 5ECPB 4Z2UA 4K7OA 4O92A 4PNGA 2LJRA 3TJGA 4F0BA 2DJKA 1FOVA 5EL8A 2K8SA 2V41A 3KH7A 2C3TA 1ZYEA 1FVKA 22GSA 2E2GA 1KEBA 1FW1A 2CV4A 3ZMLA 1GSYA 4GCIA 4OCFA 4POMA 1H75A 4WF5A 1J9BA 2O89A 3KD0A 1O8WA 3LQ7A 1K3YA 3TKQA 5JCUA 1EP8A 2YCDA 2Z9SA 2FD3A 5GZZB 3IR4A 4I5QA 4ZL7A 4EC0A 2YN1A 2C0EA 3U5RE 2EIQA 3TUEA 5IQYA 4MZCA 2H1BA 2N5AA 2KP1A 3HCZA 3CRTA 3TOTA 1ERTA 3APSA 1PL2A 5BRTA 4WETA 1RQMA 3H93A 1TW9A 4G0LA 5LD0A 3KZQA 3W8JA 3ZFBA 1PX6A 4K0GA 1JHBA 3PPUA 4ML1A 4NV5A 1M2DA 2LKUA 2E7PA 2GDRA 5GSSA 2A2PA 4MLYA 2HRFA 4N0ZA 4GTUA 2H1AA 4QL7A 1PGTA 2NDOA 4MJBA 1FB6A 3RHBA 2JADA 3HVXA 3NOFA 1XWAA 5BMUA 2B5YA 2FY6A 1U87A 1OAZA 3EURA 3G9BA 4KF9A 4G2EA 1TRSA 1ON4A 3LJRA 4OFMA 4ZIJA 3EINA 2V6OA 2IN3A 3DKSA 1TRWA 3GV1A 1N8JA 1OE7A 3LEFA 2C0DA 3VFIA 5ECLB 2V2GA 3TJKA 3FMWA 4BWSA 5EVOA 3ZVJA 1M7TA 3VLNA 3KP8A 3JCML 3Q74A 4WR5A 1R5AA 3IHGA 4KNDA 2JSYA 1T8EB 2REMA 3J7Yk 3TB2A 2LRTA 2B1KA 4HSCX 3BCKA 2PVQA 6GSXA 4BWQA 1ZYQB 2GSRA 4IP1A 1S3CA 1F3AA 1V40A 4WKWA 3RPNA 2VCXA 1GSQA 1XFLA 4MPFA 2C3NA 2XC2A 2YV7A 4FYUA 2L6DA 3GSTA 4GSTA 4PNFA 4EL1A 5F07A 5B8AA 3F0IA 2MYGA 2P0GA 2XHFA 4TXOA 1Z9HA 2L6CA 1O81A 5HR1A 4AF2A 4EKZA 5F0GA 3FHKA 3RAZA 2VCVA 1AC1A 2J23A 3TKPA 3M9JA 2OA7A 2P5QA 2FCHA 5LNKe 1X5DA 1WIKA 3IA1A 1EEJA 1Z6NA 3F4TA 1ZYNA 5IMAA 3ZL5A 2FUG2 3GL3A 1V9WA 2PU9C 2H01A 1QGVA 2H0HA 2C8UA 1DE1A 3ISOA 3ZRDA 2DJ3A 1TRUA 3GX8A 3BOAA 4CW9A 1U3AA 1BJXA 2DLXA 4IJ3A 3VK9A 3OR5A 5HFIA 3UBLA 4HQZA 1GUHA 1Y25A 4FO5A 2DKIA 1PD21 3QAGA 3KJYA 1U3IA 2B1LA 1HYUA 4JU5A 4F0CA 3O6TA 2YNXA 2FHEA 4TXOB 4MH2A 2VD1A 4KH7A 1SJIA 3LXZA 2OE0A 2EIRA 1Z5YE 2M46A 2X49A 4K7NA 2H6ZA 2O87A 3DXBA 3K8NA 2H0IA 2FWFA 1HQOA 3O3TA 1AAZA 1MDKA 4O5RA 2RM5A 3IBHA 1U6TA 4AGSA 2X64A 3QR6A 3W6GA 3TDGA 3A5IA 1A23A 5ECHB 3D5JA 3QOUA 2KUCA 2C0FA 4EXJA 1GSEA 2HSYA 2L5OA 1HNBA 2A2RA 4KE3A 5KEJA 3VWUA 5IPGA 4CDOA 3GTUA 2IFQA 2VAFA 1XW6A 2E0QA 4ILFA 4ID0A 1DUGA 3I9V2 4L5LA 4IP6A 2QA1A 5B8BA 4JZQA 5HQPA 2GQMA 1X9WB 4MZWA 1K3LA 4BIKA 2CT6A 3H1NA 2IMFA 1V2AA 2LUSA 5ENUA 4LL1B 4K7IA 2CA8A 4Q5FA 3I69A 5C00A 4IHUA 4NHWA 4ZBBA 1QK8A 5ECOB 3TJFA 2WZ9A 5D8IA 4L8EA 5DVBA 1K3OA 4Z7XA 5G1KA 1GTIA 4K9ZA 2LRNA 3DWVA 2H70A 2GSSA 2LSTA 2DIYA 1Q98A 2H19A 1WRYA 1MEKA 1UC7A 3IOSA 2OE3A 2KP2A 1G0TA 2GLRA 4KA0A 1MD4A 3VURA 1VF1A 3GTUB 5IMFA 5J3RA 2IL3A 3UJ1A 2K18A 2IFQB 4F82A 2LRCA 1PQNA 4MJAA 4MNNA 2QKEA 4MCUA 2DC5A 4Q5RA 2QC7A 5KN2A 1V57A 3GSSA 4K6XA 4KDXA 3DEXA 2DKHA 3D0ZA 3L0HA 3QAWA 4TXVA 5J9CA 5IO2A 4BVXA 3NIVA 4X1UA 1NHOA 3ZIVA 1TK5B 2C4JA 2RLIA 5CAXA 4XS4A 4K2XA 2NVLA 1JLVA 1THOA 2YJ7A 4XTSA 3TJJA 1F6MC 1TI3A 1XBSA 4G0KA 2GSTA 1THXA 2I3YA 3KMNA 4NPBA 1LBKA 2PBJA 5DQYA 3ED3A 1M9BA 1AXDA 1FB0A 4E8HA 2HRNA 1LJRA 3A2WA 1G7EA 3EC3A 1WWJA 5KN3A 1GSSA 2PN8A 1B48A 3BBYA 1YY7A 4I6XA 1QQ2A 5J41A 1FHEA 3UVTA 1PN9A 2P5RA 4HI7A 1GLQA 4RQRA 2K8VA 3KMOA 4EDZA 2O8VB 4PUAA 5F05A 4O7HA 1YJ6A 1EV4A 1OC8A 4BVXB 4ECBA 2H1GA 2AUVA 3CTGA 2H71A 2MBSA 1C72A 1JZWA 3F3RA 5D96A 18GSA 3F4SA 1ZMAA 2FWHA 5A4UA 3EYTA 4XS4B 4ZL9A 3M9KA 1M2BA 4I97A 1YZXA 3ZREA 4PGTA 4KW6A 3PR8A 1WMJA 4JRRA 1BX9A 1MD3A 3BJ5A 2E2MA 5L71A 3V1WA 4WR4A 2RIIA 1Z7RA 2L4QA 1KBNA 2K9FA 5GAPD 3UL3A 4XRAA 1OC3A 1BG5A 16GSA 1R4WA 1QXHA 3HHVA 4D73A 3IE3A 2YP6A 4POLA 4YH2A 1GSFA 2WULA 4GRFA 12GSA 3IK7A 3IV4A 1K0AA 4YKGA 3WD6A 5GSTA 2K6VA 1R5PA 4HZ2A 3EMXA 4HJMA 5DCHA 4XS1A 2VO4A 5EPFA 3F9UA 1BEDA 3TJBA 3C8EA 2C80A 3C7MA 4ICYA 2MBTA 1I5GA 3FEUA 3ZTLA 4POKA 3Q19A 3HJPA 2WCIA 1HNAA 4MZBA 2TRCP 6GSUA 5J9BA 1K0BA 2R2JA 2QSIA 2VCQA 2OKAA 4IW9A 2OJLA 1FO5A 3F6DA 2ES7A 4I2UA 3WGXA 2A2SA 5DCGA 3IRAA 4EO3A 2GSQA 1R26A 2I4AA 2NTOA 4O5QA 3DIEA 3CSHA 1AQXA 1A2LA 4KSOA 1DBYA 1IYIA 2R6KA 1EZKA 4PXOA 1Z7PA 2IIYA 3D21A 1J08A 1OKTA 3EMPA 1JFUA 1VGLA 1YEXA 4WBJA 4XIHA 4MA9A 2B7JA 2TIRA 3UVHA 5D9XA 3FZ9A 3QDNA 3ME8A 3IAM2 3O76A 1S3RA 1GUKA 5D9VA 3LXTA 4MDCA 5J5NA 5ECKB 1O7UA 5ECRB 2L57A 4K5RA 3HVVA 4IKHA 4ZB6A 1GTUA 4OD7A 4USSA 5G30A 5ECNB 4OO4A 2VM2A 4XHMA 4K1FA 3FR3A 5ECIB 3I43A 1TK0B 5IMVA 3R2QA 2VL2A 2IPAA 1SK0A 3GX0A 1OE8A 3CRUA 3D6IA 3P7XA 5F8BA 4TR0A 1ST9A 3WT1A 1TU7A 4TRXA 2OACA 4KB3A 1GRXA 4PQHA 3CBUA 1XVQA 3F4RA 4IS0A 3KM6A 3I6AA 1O6JA 3FYGA 1A2JA 1F9MA 4ECJA 3FZ5A 3HA9A 4MPGA 1SL2B 4MF6A 2C3QA 5HR3A 4LMVA 3LG6A 2CZ2A 4TN8A 2AYTA 2VD0A 3CMIA 2N5BA 4EIPA 3L9UA 4HEA2 2V6KA 5DAKA 4FYBA 3GN3A 5DALA 5ELAA 4L5OA 1PL1A 3G7JA 3MWHA 2DMLA 3VWXA 1GLPA 1OYJA 1JLWA 2VCZA 3EU3A 3UARA 4KUNA 4TOPA 1JZDA 1K0CA 1SKWB 4FH8A 1WOUA 6GSWA 5JCGA 3LFLA 2JZSA 4HS1A 3EPTA 3HZ4A 4WBRD 2ZUPA 1E6BA 3RBTA 3KH9A 1GSDA 3HVSA 2LEGA 2R0GA 3HY2A 2FWEA 3PINA 2JZTA 3CTFA 4FYCA 4MK3A 4F9ZA 2LQOA 5JCWA 4JR6A 4WXTA 2BMXA 2GQLA 1GP1A 1SKSB 1SD9A 2F3MA 3QCPA 1PMTA 1A8YA 2UZ8A 3PGTA 4GXZA 2H8LA 4I8BA 2JU5A 3US3A
chains in the Genus database with same CATH topology
3DD3A 4HDEA 1XXUA 2VCWA 3IAS2 3KXOA 4QQ7A 4O32A 1X5EA 4OFNA 5DAKB 5IOXA 4X43A 5DALB 1Z6MA 4Q5QA 4TVEA 2HI7A 1GL8A 1G6WA 3HXSA 2MZCA 3F6FA 2QGVA 3UEMA 2IMKA 5IMDA 2FLSA 3HJOA 1AQWA 3L4NA 2H66A 4DSRA 4IJIA 1NW2A 1T7PB 1ZZYA 1EV9A 4HU7A 3EE2A 3H4KA 1SL1B 3N5OA 1X0RA 3KEBA 2JACA 1MDIA 3D4MA 4LLRA 3BCIA 2EIOA 2R0PA 2F8AA 2O7KA 1TOFA 1A0RP 5A5KA 5CRDA 1LU4A 3LWAA 3UMAA 3GRXA 4JEDA 2H0GA 5E59A 1FOHA 3CXGA 4NXIA 4G10A 2VOCA 3GIXA 1H4OA 2CAIA 1XIYA 4F03A 1SENA 2QA2A 4RI7A 2OE1A 1AIUA 1SK2A 6GSVA 4BVYA 3GURA 4ML6A 5DDLA 1VF2A 4K2DA 13GSA 2H75A 1Y6EA 4POBA 1K0OA 4TW5A 1FG4A 2WDUA 3GUSA 3KIJA 1XPVA 1G6YA 1F2EA 3VPTA 5A4VA 4EIQA 1B4PA 1EOGA 5H5RA 3EVIA 3ZITA 2HRKA 4N0VA 4BPYA 3GKKA 1GNEA 2DBCA 3IXRA 4AJ7A 1TDIA 3FW2A 1K0MA 1M9AA 4EVMA 2LJAA 2LNSA 1NSWA 4HUAA 3HJMA 4EDYA 2AAWA 1JZOA 1ZCPA 2HZFA 1S3DA 5AISA 1T4YA 3FRCA 5F06A 4YAVA 2IMIA 4KCEA 2L5LA 1XCCA 2YZUA 2HE3A 3UAPA 1PA3A 1JZRA 2IWTA 2AJQB 2L4CA 2CVKA 1TRVA 4BVYB 3A3TA 5IPHA 3IDVA 5DBQA 1YKCA 3DYRA 4ECIA 4TKYA 2I1UA 1FVJA 1ERUA 2PUKC 4P3YB 3FR6A 2GQKA 2OADA 3MAKA 4CHSA 1O8XA 4GSSA 2X99A 3EWLA 1XOAA 5KOXA 4OWYA 3M0FA 3QFAC 1PX7A 2B5XA 1M0UA 5HFGA 3FY7A 5COHA 3TKSA 1TTZA 2ON5A 4Q5NA 2O85A 4J56E 2HXKA 5CP1A 2VL2C 4IVFA 1KTEA 4IBPA 4LMWA 4HQSA 1GNWA 3GKMA 1ACVA 4JE1A 4GF0A 4BL7A 4PX1A 2VL9A 4TR3A 4YAPA 1WE0A 1DE2A 4KX4A 1A2MA 1TXXA 3VWVA 3D22A 4WEYA 14GSA 5JWOB 3E9JB 5EY6A 2HSMA 4IN0A 3F8UA 3MIXA 4L0WA 4KAEA 3CSIA 4YQUA 2F51A 1SYRA 1Q4JA 4YKFA 2OBIA 1K0NA 1I9DA 2R3XA 1N2AA 1A0FA 1VRSD 4Z2TA 2P31A 5LCZA 1O73A 2WS2A 6GSYA 1EEMA 4NV2A 4AJ6A 3C1SA 2KOKA 4CY8A 2YWNA 3UBKA 1XWBA 3E3EA 4GWRA 1OC9A 3NZNA 3KTLA 4ZBDA 5IMCA 3ZFLA 1GSUA 4ZILA 3VWWA 2HFDA 2FA4A 1T3BA 1B8XA 1A24A 5FWGA 3G7YA 3GH9A 4BL7B 2MMAA 3RDWA 5KN1A 2G2QA 4HZ4A 3D4TA 1ERVA 4H86A 1O85A 2JSZA 1RK4A 1V58A 2KLXA 2RM6A 1EWXA 2I81A 5CNWA 1YEPA 19GSA 3ZMKA 2CVBA 3GH6A 3ZYWA 2VL3A 2B7KA 3LW9A 2C0GA 5DJMA 2WB9A 1SK1A 1OKDA 4MABA 4DVCA 2HLSA 2HRAA 3KTBA 1GH2A 3DMLA 1B9XC 3ERWA 5B6MA 1XW9A 2EC4A 8GSSA 4HOJA 2DJJA 4J57E 4KGIA 1WPIA 1OC9B 1XWKA 1M2AA 5E4WA 3WGDA 5C04A 1E2YA 3FKFA 1M99A 2GGTA 3FZAA 4ZXGA 4N10A 5D73A 1IYHA 2H76A 2YPMA 4MF5A 2CAQA 1W4VA 1MDJA 5FT3A 2H73A 4K5SA 3L9SA 4OMVA 4ULXA 2LV3A 2WJUA 4IELA 2YZHA 4X4JA 4D73B 3TOUA 3TKRA 2RUEA 3GA4A 1V98A 2F8FA 2WRTA 1T4ZA 3HYPA 2IJYA 1X5CA 3KP9A 2CZ3A 3ZZXA 5GAND 3LYPA 5G2ZA 7GSSA 3TRQA 1YKAA 1DSBA 3ZIJA 2XPEA 2L59A 5DJLA 5D9WA 5ECSA 2IMEA 1PN0A 3E0UA 5ABRA 1ZYPA 4PURA 3QAVA 1BYEA 3HD5A 2FNOA 1YF1A 1BQ7A 1B9YC 4ZB9A 3DVWA 5ELGA 3Q6OA 2X8CA 4N11A 4Z2RA 5IOWA 4HJ2A 5D9TA 2AV4A 1SJ6A 4KSMA 2DJ2A 3C1RA 4KCAA 1VF3A 3ERFA 4G9HA 4NWYA 5CO3A 1TJDA 4G0IA 1CQHA 4V1Ap 2GTUA 4RI6A 3M8NA 5H5SA 6GSSA 4ZBAA 1NHYA 1S3AA 1W89A 2GT5A 3FK8A 1YQ1A 3TKSE 1GULA 1X9SB 4K0NA 3GFKA 2PVOC 2HSHA 4GQFA 5IM9A 2R5GA 4ACSA 3KGKA 5CRHA 3SBCA 4MJEA 5IIZA 2LNTA 2BJXA 4FIWA 3A2VA 5AIXA 5CYYA 1XW5A 1AQVA 2OBKA 1F3BA 4RUVA 1QFNA 2X8HA 5AN1A 2VUPA 5JWQB 1SKRB 3LYKA 3ERGA 4DSQA 4ZB8A 1T1VA 1NM3A 1ABAA 4NHZA 4EE0A 1WJKA 4ZL8A 4XS6A 1RW1A 1PKWA 3ME7A 3UOMA 4DSSA 4XCSA 3IK9A 4BA7A 1TU8A 3C73A 2XBIA 1ILOA 1TK8B 2GZZA 3TKSC 4IQ1A 2WFCA 2VM1A 3R3EA 17GSA 3C71A 1UVZA 5FHIA 1ML6A 4V2NA 4ISDA 1YDKA 2ON7A 4TR1A 5AIVA 1URMA 1USBA 4I2TA 20GSA 3GKNA 3IC4A 2ZNMA 2HYXA 1OVNA 3CYNA 4OO5A 2GS3A 2B3SA 3AY8A 1J0FA 3F3QA 5HR2A 1SJZA 1EGRA 2PGTA 2J9HA 3A5WA 2GVPA 2VLUA 4AJ8A 4NMUA 5G1LA 3IHQA 5KOWA 2WGRA 4O5UA 2PERA 3HDCA 4J2FA 2TRXA 4GSNA 1EOHA 2YANA 3HZ8A 1ZGNA 2GT6A 4KDYA 2LS5A 4DSSB 3PH9A 2M72A 4OFTA 1GWCA 4V2LA 5IO0A 1TI1A 2PPTA 2ZCTA 2C1YA 2CQ9A 1G7OA 2CX3A 4MMMA 1HNCA 1R7HA 3EU4A 4TR1B 1XWCA 2HNLA 2R0CA 3MYDA 1YF0A 2PMTA 3LGCA 2AB6A 3WYWA 5A4WA 1KNGA 2MMZA 3GYKA 5CRWA 1QUWA 4NAXA 4KDUA 3BD2A 3DGQA 4G19A 1CQGA 4YQMA 1T00A 4OCEA 3P90A 4DEJA 4MF7A 2RUFA 3QD9A 4X0XA 11GSA 3GHAA 3TRPA 4RQXA 4V2MA 2YOIA 5CREA 5G31A 2F9SA 2M80A 3L9VA 5HR0A 1EGOA 1VF4A 2G0FA 2VLTA 2CVDA 5G5FA 2A4VA 1PRXA 1A8LA 3MSZA 2R37A 1MTCA 3IC8A 4PQIA 1SYXA 3P2AA 3F63A 4HU9A 2VCTA 3WGEA 2A4HA 2I9HA 2LTKA 3Q18A 3UIWA 10GSA 2YJHA 3A2XA 4CY6A 5G5EA 3WT2A 5ECMB 2DJ0A 2FA8A 2MMNA 5IMZA 1SD8A 2YWMA 4GQCA 2V32A 2DIZA 3APOA 5CRGA 4PTSA 1PKZA 4N30A 1B4QA 1XWGA 2YWIA 3N9JA 2H6YA 1XVWA 3FZ4A 4L0UA 3VPQA 2YV9A 2MMOA 2NBSA 3GL5A 4MH3A 4F2IA 3CSJA 2H1DA 5ID2A 1GTAA 5AGYA 1QMVA 4QL9A 1Z3EA 1HD2A 4JR4A 4YQVA 2LJKA 1FAAA 1TP9A 2XPDA 3J7Yb 1AW9A 4IGJA 3HKRA 4WF4A 2CX4A 2V1MA 1UA5A 1ERWA 1AUCA 3QMXA 2GZPA 2R4VA 1F37A 5H5QA 3QPMA 4EF0A 3QFBC 1X9MB 3RHCA 1UN2A 3L78A 5B6NA 1PSQA 3GMFA 2HZEA 1BAYA 3MDKA 3P8WA 2VLVA 6GSTA 4PQ1A 2FWGA 4LA1A 2NPBA 3DVXA 5KN0A 5JWRB 1GTBA 5ECQB 2YWOA 4LL4B 1K0DA 2H72A 2B5EA 2N5FA 3KCMA 3GNJA 2KHPA 5ID2B 1GUMA 3H79A 5D93A 3SWLA 1SU9A 2B6MA 5INYA 2IMDA 3W8SA 3TCOA 1U88A 3G7IA 1WP0A 2H74A 4TR4A 2DMMA 2X4AA 3DRNA 1TKDB 2XBQA 2LQQA 4XRDA 2PWJA 4E8EA 3M3MA 4V1Ag 2VIMA 2X8GA 3M1GA 3ZLPA 3LORA 1ZOFA 3GKXA 2DSAA 2DJ1A 4ECCA 3FR9A 3APQA 3H8QA 4JBBA 5J4UA 3IPZA 2GZYA 1XOBA 4PUFC 4MJCA 3RPPA 2AHEA 4MP4A 2FGXA 3U6VA 4A5PA 2HZEB 1XZOA 1EP7A 3LSZA 3S9FA 3TGZA 1ZL9A 4K8MA 5HFKA 1SL0B 3ZVJD 3VI7A 2H30A 4FQUA 2JL4A 3TRXA 3VI5A 2ALBA 2H6XA 2BTOT 4IQAA 2HT9A 3MNGA 5DQSA 2JZRA 2D2ZA 9GSSA 4EUYA 4GLTA 5B7CA 5ECPB 4Z2UA 4K7OA 4O92A 4PNGA 2LJRA 3TJGA 4F0BA 2DJKA 1FOVA 5EL8A 2K8SA 2V41A 3KH7A 2C3TA 1ZYEA 1FVKA 22GSA 2E2GA 1KEBA 1FW1A 2CV4A 3ZMLA 1GSYA 4GCIA 4OCFA 4POMA 1H75A 4WF5A 1J9BA 2O89A 3KD0A 1O8WA 3LQ7A 1K3YA 3TKQA 5JCUA 1EP8A 2YCDA 2Z9SA 2FD3A 5GZZB 3IR4A 4I5QA 4ZL7A 4EC0A 2YN1A 2C0EA 3U5RE 2EIQA 3TUEA 5IQYA 4MZCA 2H1BA 2N5AA 2KP1A 3HCZA 3CRTA 3TOTA 1ERTA 3APSA 1PL2A 5BRTA 4WETA 1RQMA 3H93A 1TW9A 4G0LA 5LD0A 3KZQA 3W8JA 3ZFBA 1PX6A 4K0GA 1JHBA 3PPUA 4ML1A 4NV5A 1M2DA 2LKUA 2E7PA 2GDRA 5GSSA 2A2PA 4MLYA 2HRFA 4N0ZA 4GTUA 2H1AA 4QL7A 1PGTA 2NDOA 4MJBA 1FB6A 3RHBA 2JADA 3HVXA 3NOFA 1XWAA 5BMUA 2B5YA 2FY6A 1U87A 1OAZA 3EURA 3G9BA 4KF9A 4G2EA 1TRSA 1ON4A 3LJRA 4OFMA 4ZIJA 3EINA 2V6OA 2IN3A 3DKSA 1TRWA 3GV1A 1N8JA 1OE7A 3LEFA 2C0DA 3VFIA 5ECLB 2V2GA 3TJKA 3FMWA 4BWSA 5EVOA 3ZVJA 1M7TA 3VLNA 3KP8A 3JCML 3Q74A 4WR5A 1R5AA 3IHGA 4KNDA 2JSYA 1T8EB 2REMA 3J7Yk 3TB2A 2LRTA 2B1KA 3BCKA 2PVQA 6GSXA 4BWQA 1ZYQB 2GSRA 4IP1A 1S3CA 1F3AA 1V40A 4WKWA 3RPNA 2VCXA 1GSQA 1XFLA 4MPFA 2C3NA 2XC2A 2YV7A 4FYUA 2L6DA 3GSTA 4GSTA 4PNFA 4EL1A 5F07A 5B8AA 3F0IA 2MYGA 2P0GA 2XHFA 4TXOA 1Z9HA 2L6CA 1O81A 5HR1A 4AF2A 4EKZA 5F0GA 3FHKA 3RAZA 2VCVA 1AC1A 2J23A 3TKPA 3M9JA 2OA7A 2P5QA 2FCHA 5LNKe 1X5DA 1WIKA 3IA1A 1EEJA 1Z6NA 3F4TA 1ZYNA 5IMAA 3ZL5A 2FUG2 3GL3A 1V9WA 2PU9C 2H01A 1QGVA 2H0HA 2C8UA 1DE1A 3ISOA 3ZRDA 2DJ3A 1TRUA 3GX8A 3BOAA 4CW9A 1U3AA 1BJXA 2DLXA 4IJ3A 3VK9A 3OR5A 5HFIA 3UBLA 4HQZA 1GUHA 1Y25A 4FO5A 2DKIA 1PD21 3QAGA 3KJYA 1U3IA 2B1LA 1HYUA 4JU5A 4F0CA 3O6TA 2YNXA 2FHEA 4TXOB 4MH2A 2VD1A 4KH7A 1SJIA 3LXZA 2OE0A 2EIRA 1Z5YE 2M46A 2X49A 4K7NA 2H6ZA 2O87A 3DXBA 3K8NA 2H0IA 2FWFA 1HQOA 3O3TA 1AAZA 1MDKA 4O5RA 2RM5A 3IBHA 1U6TA 4AGSA 2X64A 3QR6A 3W6GA 3TDGA 3A5IA 1A23A 5ECHB 3D5JA 3QOUA 2KUCA 2C0FA 4EXJA 1GSEA 2HSYA 2L5OA 1HNBA 2A2RA 4KE3A 5KEJA 3VWUA 5IPGA 4CDOA 3GTUA 2IFQA 2VAFA 1XW6A 2E0QA 4ILFA 4ID0A 1DUGA 3I9V2 4L5LA 4IP6A 2QA1A 5B8BA 4JZQA 5HQPA 2GQMA 1X9WB 4MZWA 1K3LA 2CT6A 3H1NA 2IMFA 1V2AA 2LUSA 5ENUA 4LL1B 4K7IA 2CA8A 4Q5FA 3I69A 5C00A 4IHUA 4NHWA 4ZBBA 1QK8A 5ECOB 3TJFA 2WZ9A 5D8IA 4L8EA 5DVBA 1K3OA 4Z7XA 5G1KA 1GTIA 4K9ZA 2LRNA 3DWVA 2H70A 2GSSA 2LSTA 2DIYA 1Q98A 2H19A 1WRYA 1MEKA 1UC7A 3IOSA 2OE3A 2KP2A 1G0TA 2GLRA 4KA0A 1MD4A 3VURA 1VF1A 3GTUB 5IMFA 5J3RA 2IL3A 3UJ1A 2K18A 2IFQB 4F82A 2LRCA 1PQNA 4MJAA 4MNNA 2QKEA 4MCUA 2DC5A 4Q5RA 2QC7A 5KN2A 1V57A 3GSSA 4K6XA 4KDXA 3DEXA 2DKHA 3D0ZA 3L0HA 3QAWA 4TXVA 5J9CA 5IO2A 4BVXA 3NIVA 4X1UA 1NHOA 3ZIVA 1TK5B 2C4JA 2RLIA 5CAXA 4XS4A 4K2XA 2NVLA 1JLVA 1THOA 2YJ7A 4XTSA 3TJJA 1F6MC 1TI3A 1XBSA 4G0KA 2GSTA 1THXA 2I3YA 3KMNA 4NPBA 1LBKA 2PBJA 5DQYA 3ED3A 1M9BA 1AXDA 1FB0A 4E8HA 2HRNA 1LJRA 3A2WA 1G7EA 3EC3A 1WWJA 5KN3A 1GSSA 2PN8A 1B48A 3BBYA 1YY7A 4I6XA 1QQ2A 5J41A 1FHEA 3UVTA 1PN9A 2P5RA 4HI7A 1GLQA 4RQRA 2K8VA 3KMOA 4EDZA 2O8VB 4PUAA 5F05A 4O7HA 1YJ6A 1EV4A 1OC8A 4BVXB 4ECBA 2H1GA 2AUVA 3CTGA 2H71A 2MBSA 1C72A 1JZWA 3F3RA 5D96A 18GSA 3F4SA 1ZMAA 2FWHA 5A4UA 3EYTA 4XS4B 4ZL9A 3M9KA 1M2BA 4I97A 1YZXA 3ZREA 4PGTA 4KW6A 3PR8A 1WMJA 4JRRA 1BX9A 1MD3A 3BJ5A 2E2MA 5L71A 3V1WA 4WR4A 2RIIA 1Z7RA 2L4QA 1KBNA 2K9FA 5GAPD 3UL3A 4XRAA 1OC3A 1BG5A 16GSA 1R4WA 1QXHA 3HHVA 4D73A 3IE3A 2YP6A 4POLA 4YH2A 1GSFA 2WULA 4GRFA 12GSA 3IK7A 3IV4A 1K0AA 4YKGA 3WD6A 5GSTA 2K6VA 1R5PA 4HZ2A 3EMXA 4HJMA 5DCHA 4XS1A 2VO4A 5EPFA 3F9UA 1BEDA 3TJBA 3C8EA 2C80A 3C7MA 4ICYA 2MBTA 1I5GA 3FEUA 3ZTLA 4POKA 3Q19A 3HJPA 2WCIA 1HNAA 4MZBA 2TRCP 6GSUA 5J9BA 1K0BA 2R2JA 2QSIA 2VCQA 2OKAA 4IW9A 2OJLA 1FO5A 3F6DA 2ES7A 4I2UA 3WGXA 2A2SA 5DCGA 3IRAA 4EO3A 2GSQA 1R26A 2I4AA 2NTOA 4O5QA 3DIEA 3CSHA 1AQXA 1A2LA 4KSOA 1DBYA 1IYIA 2R6KA 1EZKA 4PXOA 1Z7PA 2IIYA 3D21A 1J08A 1OKTA 3EMPA 1JFUA 1VGLA 1YEXA 4WBJA 4XIHA 4MA9A 2B7JA 2TIRA 3UVHA 5D9XA 3FZ9A 3QDNA 3ME8A 3IAM2 3O76A 1GUKA 5D9VA 3LXTA 4MDCA 5J5NA 5ECKB 1O7UA 5ECRB 2L57A 4K5RA 3HVVA 4IKHA 4ZB6A 1GTUA 4OD7A 4USSA 5G30A 5ECNB 4OO4A 2VM2A 4XHMA 4K1FA 3FR3A 5ECIB 3I43A 1TK0B 5IMVA 3R2QA 2VL2A 2IPAA 1SK0A 3GX0A 1OE8A 3CRUA 3D6IA 3P7XA 5F8BA 4TR0A 1ST9A 3WT1A 1TU7A 4TRXA 2OACA 4KB3A 1GRXA 4PQHA 3CBUA 1XVQA 3F4RA 4IS0A 3KM6A 3I6AA 1O6JA 3FYGA 1A2JA 1F9MA 4ECJA 3FZ5A 3HA9A 4MPGA 1SL2B 4MF6A 2C3QA 5HR3A 4LMVA 3LG6A 2CZ2A 4TN8A 2AYTA 2VD0A 3CMIA 2N5BA 4EIPA 3L9UA 4HEA2 2V6KA 5DAKA 4FYBA 3GN3A 5DALA 5ELAA 4L5OA 1PL1A 3G7JA 3MWHA 2DMLA 3VWXA 1GLPA 1OYJA 1JLWA 2VCZA 3EU3A 3UARA 4KUNA 4TOPA 1JZDA 1K0CA 1SKWB 4FH8A 1WOUA 6GSWA 5JCGA 3LFLA 2JZSA 4HS1A 3EPTA 3HZ4A 4WBRD 2ZUPA 1E6BA 3RBTA 3KH9A 1GSDA 3HVSA 2LEGA 2R0GA 3HY2A 2FWEA 3PINA 2JZTA 3CTFA 4FYCA 4MK3A 4F9ZA 2LQOA 5JCWA 4JR6A 4WXTA 2BMXA 2GQLA 1GP1A 1SKSB 1SD9A 2F3MA 3QCPA 1PMTA 1A8YA 2UZ8A 3PGTA 4GXZA 2H8LA 4I8BA 2JU5A 3US3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DD3 A;  4HDE A;  1XXU A;  2VCW A;  3IAS 2;  3KXO A;  4QQ7 A;  4O32 A;  1X5E A;  4OFN A;  5DAK B;  5IOX A;  4X43 A;  5DAL B;  1Z6M A;  4Q5Q A;  4TVE A;  2HI7 A;  1GL8 A;  1G6W A;  3HXS A;  2MZC A;  3F6F A;  2QGV A;  3UEM A;  2IMK A;  5IMD A;  2FLS A;  3HJO A;  1AQW A;  3L4N A;  2H66 A;  4DSR A;  4IJI A;  1NW2 A;  1T7P B;  1ZZY A;  1EV9 A;  4HU7 A;  3EE2 A;  3H4K A;  1SL1 B;  3N5O A;  1X0R A;  3KEB A;  2JAC A;  1MDI A;  3D4M A;  4LLR A;  3BCI A;  2EIO A;  2F8A A;  2O7K A;  1TOF A;  1A0R P;  5A5K A;  5CRD A;  1LU4 A;  3LWA A;  3UMA A;  3GRX A;  4JED A;  2H0G A;  5E59 A;  3CXG A;  4NXI A;  4G10 A;  2VOC A;  3GIX A;  1H4O A;  2CAI A;  1XIY A;  4F03 A;  1SEN A;  4RI7 A;  2OE1 A;  1AIU A;  1SK2 A;  6GSV A;  4BVY A;  3GUR A;  4ML6 A;  5DDL A;  1VF2 A;  4K2D A;  13GS A;  2H75 A;  1Y6E A;  4POB A;  1K0O A;  4TW5 A;  1FG4 A;  2WDU A;  3GUS A;  3KIJ A;  1XPV A;  1G6Y A;  1F2E A;  3VPT A;  5A4V A;  1B4P A;  1EOG A;  5H5R A;  3EVI A;  3ZIT A;  4N0V A;  4BPY A;  3GKK A;  1GNE A;  2DBC A;  3IXR A;  4AJ7 A;  1TDI A;  3FW2 A;  1K0M A;  1M9A A;  4EVM A;  2LJA A;  2LNS A;  1NSW A;  4HUA A;  3HJM A;  4EDY A;  2AAW A;  1JZO A;  1ZCP A;  2HZF A;  1S3D A;  5AIS A;  1T4Y A;  3FRC A;  5F06 A;  4YAV A;  2IMI A;  4KCE A;  2L5L A;  1XCC A;  2YZU A;  2HE3 A;  3UAP A;  1PA3 A;  1JZR A;  2IWT A;  2AJQ B;  2L4C A;  2CVK A;  1TRV A;  3A3T A;  5IPH A;  3IDV A;  5DBQ A;  1YKC A;  3DYR A;  4ECI A;  4TKY A;  2I1U A;  1FVJ A;  1ERU A;  2PUK C;  4P3Y B;  3FR6 A;  2GQK A;  2OAD A;  3MAK A;  4CHS A;  1O8X A;  4GSS A;  2X99 A;  3EWL A;  1XOA A;  4OWY A;  3M0F A;  3QFA C;  1PX7 A;  2B5X A;  1M0U A;  5HFG A;  3FY7 A;  5COH A;  3TKS A;  1TTZ A;  2ON5 A;  4Q5N A;  2O85 A;  4J56 E;  2HXK A;  5CP1 A;  2VL2 C;  4IVF A;  1KTE A;  4IBP A;  4LMW A;  4HQS A;  1GNW A;  3GKM A;  1ACV A;  4JE1 A;  4GF0 A;  4BL7 A;  4PX1 A;  2VL9 A;  4TR3 A;  4YAP A;  1WE0 A;  1DE2 A;  4KX4 A;  1A2M A;  1TXX A;  3VWV A;  3D22 A;  4WEY A;  14GS A;  5JWO B;  3E9J B;  5EY6 A;  4IN0 A;  3F8U A;  4L0W A;  4KAE A;  3CSI A;  4YQU A;  2F51 A;  1SYR A;  1Q4J A;  2OBI A;  1K0N A;  1I9D A;  2R3X A;  1N2A A;  1A0F A;  1VRS D;  2P31 A;  5LCZ A;  1O73 A;  2WS2 A;  6GSY A;  1EEM A;  4NV2 A;  4AJ6 A;  3C1S A;  2KOK A;  2YWN A;  3UBK A;  1XWB A;  3E3E A;  4GWR A;  1OC9 A;  3NZN A;  3KTL A;  4ZBD A;  5IMC A;  3ZFL A;  1GSU A;  4ZIL A;  3VWW A;  2HFD A;  2FA4 A;  1T3B A;  1B8X A;  1A24 A;  5FWG A;  3G7Y A;  3GH9 A;  2MMA A;  3RDW A;  5KN1 A;  2G2Q A;  4HZ4 A;  3D4T A;  1ERV A;  4H86 A;  1O85 A;  2JSZ A;  1RK4 A;  1V58 A;  2KLX A;  2RM6 A;  1EWX A;  2I81 A;  5CNW A;  1YEP A;  19GS A;  3ZMK A;  2CVB A;  3GH6 A;  3ZYW A;  2VL3 A;  2B7K A;  2C0G A;  5DJM A;  2WB9 A;  1SK1 A;  1OKD A;  4MAB A;  4DVC A;  2HLS A;  3KTB A;  1GH2 A;  3DML A;  1B9X C;  3ERW A;  5B6M A;  1XW9 A;  2EC4 A;  8GSS A;  4HOJ A;  2DJJ A;  4J57 E;  4KGI A;  1WPI A;  1OC9 B;  1XWK A;  1M2A A;  5E4W A;  3WGD A;  5C04 A;  1E2Y A;  3FKF A;  1M99 A;  2GGT A;  3FZA A;  4ZXG A;  4N10 A;  5D73 A;  1IYH A;  2H76 A;  2YPM A;  4MF5 A;  2CAQ A;  1W4V A;  1MDJ A;  5FT3 A;  2H73 A;  3L9S A;  4OMV A;  4ULX A;  2LV3 A;  2WJU A;  4IEL A;  2YZH A;  4D73 B;  3TOU A;  3TKR A;  2RUE A;  3GA4 A;  1V98 A;  2F8F A;  2WRT A;  1T4Z A;  3HYP A;  2IJY A;  1X5C A;  3KP9 A;  2CZ3 A;  3ZZX A;  5GAN D;  3LYP A;  5G2Z A;  7GSS A;  3TRQ A;  1YKA A;  1DSB A;  3ZIJ A;  2XPE A;  2L59 A;  5DJL A;  5D9W A;  5ECS A;  2IME A;  3E0U A;  5ABR A;  4PUR A;  3QAV A;  1BYE A;  3HD5 A;  2FNO A;  1YF1 A;  1BQ7 A;  1B9Y C;  4ZB9 A;  3DVW A;  5ELG A;  3Q6O A;  2X8C A;  4N11 A;  5IOW A;  4HJ2 A;  5D9T A;  2AV4 A;  1SJ6 A;  4KSM A;  2DJ2 A;  3C1R A;  4KCA A;  1VF3 A;  3ERF A;  4G9H A;  4NWY A;  5CO3 A;  1TJD A;  1CQH A;  4V1A p;  2GTU A;  4RI6 A;  3M8N A;  5H5S A;  6GSS A;  4ZBA A;  1NHY A;  1S3A A;  1W89 A;  2GT5 A;  3FK8 A;  1YQ1 A;  3TKS E;  1GUL A;  1X9S B;  4K0N A;  3GFK A;  2PVO C;  2HSH A;  4GQF A;  5IM9 A;  2R5G A;  4ACS A;  3KGK A;  5CRH A;  3SBC A;  4MJE A;  5IIZ A;  2LNT A;  2BJX A;  4FIW A;  3A2V A;  5AIX A;  5CYY A;  1XW5 A;  1AQV A;  2OBK A;  1F3B A;  4RUV A;  1QFN A;  2X8H A;  5AN1 A;  2VUP A;  5JWQ B;  1SKR B;  3LYK A;  3ERG A;  4DSQ A;  4ZB8 A;  1T1V A;  1NM3 A;  1ABA A;  4NHZ A;  4EE0 A;  1WJK A;  4ZL8 A;  4XS6 A;  1RW1 A;  1PKW A;  3ME7 A;  3UOM A;  4DSS A;  4XCS A;  3IK9 A;  4BA7 A;  1TU8 A;  3C73 A;  2XBI A;  1ILO A;  1TK8 B;  2GZZ A;  3TKS C;  4IQ1 A;  2WFC A;  2VM1 A;  17GS A;  3C71 A;  1UVZ A;  5FHI A;  1ML6 A;  4V2N A;  4ISD A;  1YDK A;  2ON7 A;  4TR1 A;  5AIV A;  1URM A;  1USB A;  4I2T A;  20GS A;  3GKN A;  3IC4 A;  2ZNM A;  2HYX A;  1OVN A;  3CYN A;  4OO5 A;  2GS3 A;  2B3S A;  3AY8 A;  1J0F A;  3F3Q A;  5HR2 A;  1SJZ A;  1EGR A;  2PGT A;  2J9H A;  3A5W A;  2GVP A;  2VLU A;  4AJ8 A;  4NMU A;  5G1L A;  3IHQ A;  2WGR A;  2PER A;  3HDC A;  4J2F A;  2TRX A;  4GSN A;  1EOH A;  2YAN A;  3HZ8 A;  1ZGN A;  2GT6 A;  4KDY A;  2LS5 A;  4DSS B;  3PH9 A;  2M72 A;  4OFT A;  1GWC A;  4V2L A;  5IO0 A;  1TI1 A;  2PPT A;  2ZCT A;  2C1Y A;  2CQ9 A;  1G7O A;  2CX3 A;  4MMM A;  1HNC A;  1R7H A;  3EU4 A;  4TR1 B;  1XWC A;  2HNL A;  1YF0 A;  2PMT A;  3LGC A;  2AB6 A;  3WYW A;  5A4W A;  1KNG A;  2MMZ A;  3GYK A;  5CRW A;  1QUW A;  4NAX A;  4KDU A;  3BD2 A;  3DGQ A;  4G19 A;  1CQG A;  4YQM A;  1T00 A;  4OCE A;  3P90 A;  4DEJ A;  4MF7 A;  2RUF A;  3QD9 A;  4X0X A;  11GS A;  3GHA A;  3TRP A;  4RQX A;  4V2M A;  2YOI A;  5CRE A;  5G31 A;  2F9S A;  2M80 A;  3L9V A;  5HR0 A;  1EGO A;  1VF4 A;  2G0F A;  2VLT A;  2CVD A;  5G5F A;  2A4V A;  1PRX A;  1A8L A;  3MSZ A;  2R37 A;  1MTC A;  4PQI A;  1SYX A;  3P2A A;  3F63 A;  4HU9 A;  2VCT A;  3WGE A;  2I9H A;  2LTK A;  3Q18 A;  3UIW A;  10GS A;  2YJH A;  3A2X A;  5G5E A;  3WT2 A;  5ECM B;  2DJ0 A;  2FA8 A;  2MMN A;  5IMZ A;  1SD8 A;  2YWM A;  4GQC A;  2V32 A;  2DIZ A;  3APO A;  5CRG A;  1PKZ A;  4N30 A;  1B4Q A;  1XWG A;  2YWI A;  3N9J A;  2H6Y A;  1XVW A;  3FZ4 A;  4L0U A;  3VPQ A;  2YV9 A;  2MMO A;  2NBS A;  3GL5 A;  4MH3 A;  4F2I A;  3CSJ A;  2H1D A;  5ID2 A;  1GTA A;  5AGY A;  1QMV A;  4QL9 A;  1Z3E A;  1HD2 A;  4JR4 A;  4YQV A;  2LJK A;  1FAA A;  1TP9 A;  2XPD A;  3J7Y b;  1AW9 A;  4IGJ A;  3HKR A;  4WF4 A;  2CX4 A;  2V1M A;  1UA5 A;  1ERW A;  1AUC A;  3QMX A;  2GZP A;  2R4V A;  1F37 A;  5H5Q A;  3QPM A;  4EF0 A;  3QFB C;  1X9M B;  3RHC A;  1UN2 A;  3L78 A;  5B6N A;  1PSQ A;  3GMF A;  2HZE A;  1BAY A;  3MDK A;  3P8W A;  2VLV A;  6GST A;  4PQ1 A;  2FWG A;  4LA1 A;  2NPB A;  3DVX A;  5KN0 A;  5JWR B;  1GTB A;  5ECQ B;  2YWO A;  4LL4 B;  1K0D A;  2H72 A;  2B5E A;  2N5F A;  3KCM A;  3GNJ A;  2KHP A;  5ID2 B;  1GUM A;  3H79 A;  5D93 A;  3SWL A;  1SU9 A;  2B6M A;  5INY A;  2IMD A;  3W8S A;  3TCO A;  1U88 A;  3G7I A;  1WP0 A;  2H74 A;  4TR4 A;  2DMM A;  3DRN A;  1TKD B;  2XBQ A;  2LQQ A;  4XRD A;  2PWJ A;  4E8E A;  3M3M A;  4V1A g;  2VIM A;  2X8G A;  3M1G A;  3ZLP A;  3LOR A;  1ZOF A;  3GKX A;  2DSA A;  2DJ1 A;  4ECC A;  3FR9 A;  3APQ A;  3H8Q A;  4JBB A;  5J4U A;  3IPZ A;  2GZY A;  1XOB A;  4PUF C;  4MJC A;  3RPP A;  2AHE A;  4MP4 A;  2FGX A;  3U6V A;  2HZE B;  1XZO A;  1EP7 A;  3LSZ A;  3S9F A;  3TGZ A;  1ZL9 A;  4K8M A;  5HFK A;  1SL0 B;  3ZVJ D;  3VI7 A;  2H30 A;  2JL4 A;  3TRX A;  3VI5 A;  2ALB A;  2H6X A;  2BTO T;  4IQA A;  2HT9 A;  3MNG A;  5DQS A;  2JZR A;  2D2Z A;  9GSS A;  4EUY A;  4GLT A;  5B7C A;  5ECP B;  4K7O A;  4O92 A;  4PNG A;  2LJR A;  3TJG A;  4F0B A;  2DJK A;  1FOV A;  5EL8 A;  2K8S A;  2V41 A;  3KH7 A;  2C3T A;  1ZYE A;  1FVK A;  22GS A;  2E2G A;  1KEB A;  1FW1 A;  2CV4 A;  3ZML A;  1GSY A;  4GCI A;  4OCF A;  4POM A;  1H75 A;  4WF5 A;  1J9B A;  2O89 A;  3KD0 A;  1O8W A;  3LQ7 A;  1K3Y A;  3TKQ A;  5JCU A;  1EP8 A;  2YCD A;  2Z9S A;  2FD3 A;  5GZZ B;  3IR4 A;  4I5Q A;  4ZL7 A;  4EC0 A;  2YN1 A;  2C0E A;  3U5R E;  2EIQ A;  3TUE A;  5IQY A;  4MZC A;  2H1B A;  2N5A A;  2KP1 A;  3HCZ A;  3CRT A;  3TOT A;  1ERT A;  3APS A;  1PL2 A;  4WET A;  1RQM A;  3H93 A;  1TW9 A;  5LD0 A;  3KZQ A;  3W8J A;  3ZFB A;  1PX6 A;  4K0G A;  1JHB A;  4ML1 A;  4NV5 A;  1M2D A;  2LKU A;  2E7P A;  2GDR A;  5GSS A;  4MLY A;  2HRF A;  4N0Z A;  4GTU A;  2H1A A;  4QL7 A;  1PGT A;  2NDO A;  4MJB A;  1FB6 A;  3RHB A;  2JAD A;  3HVX A;  3NOF A;  1XWA A;  2B5Y A;  2FY6 A;  1U87 A;  1OAZ A;  3EUR A;  3G9B A;  4G2E A;  1TRS A;  1ON4 A;  3LJR A;  4OFM A;  4ZIJ A;  3EIN A;  2V6O A;  2IN3 A;  3DKS A;  1TRW A;  3GV1 A;  1N8J A;  1OE7 A;  3LEF A;  2C0D A;  3VFI A;  5ECL B;  2V2G A;  3TJK A;  4BWS A;  5EVO A;  3ZVJ A;  1M7T A;  3VLN A;  3KP8 A;  3JCM L;  3Q74 A;  4WR5 A;  1R5A A;  4KND A;  2JSY A;  1T8E B;  2REM A;  3J7Y k;  3TB2 A;  2LRT A;  2B1K A;  3BCK A;  2PVQ A;  6GSX A;  4BWQ A;  1ZYQ B;  2GSR A;  4IP1 A;  1S3C A;  1F3A A;  1V40 A;  4WKW A;  3RPN A;  2VCX A;  1GSQ A;  1XFL A;  4MPF A;  2C3N A;  2XC2 A;  2YV7 A;  4FYU A;  2L6D A;  3GST A;  4GST A;  4PNF A;  4EL1 A;  5F07 A;  5B8A A;  3F0I A;  2MYG A;  2P0G A;  2XHF A;  4TXO A;  1Z9H A;  2L6C A;  1O81 A;  5HR1 A;  4AF2 A;  4EKZ A;  5F0G A;  3FHK A;  3RAZ A;  2VCV A;  1AC1 A;  2J23 A;  3TKP A;  3M9J A;  2OA7 A;  2P5Q A;  2FCH A;  5LNK e;  1X5D A;  1WIK A;  3IA1 A;  1EEJ A;  1Z6N A;  3F4T A;  5IMA A;  3ZL5 A;  2FUG 2;  3GL3 A;  1V9W A;  2PU9 C;  2H01 A;  1QGV A;  2H0H A;  2C8U A;  1DE1 A;  3ISO A;  3ZRD A;  2DJ3 A;  1TRU A;  3GX8 A;  3BOA A;  4CW9 A;  1U3A A;  1BJX A;  2DLX A;  4IJ3 A;  3VK9 A;  3OR5 A;  5HFI A;  3UBL A;  4HQZ A;  1GUH A;  1Y25 A;  4FO5 A;  1PD2 1;  3QAG A;  3KJY A;  1U3I A;  2B1L A;  1HYU A;  4JU5 A;  4F0C A;  3O6T A;  2YNX A;  2FHE A;  4TXO B;  4MH2 A;  2VD1 A;  4KH7 A;  1SJI A;  3LXZ A;  2OE0 A;  2EIR A;  1Z5Y E;  2M46 A;  4K7N A;  2H6Z A;  2O87 A;  3DXB A;  3K8N A;  2H0I A;  2FWF A;  1HQO A;  3O3T A;  1AAZ A;  1MDK A;  4O5R A;  2RM5 A;  3IBH A;  1U6T A;  4AGS A;  2X64 A;  3QR6 A;  3W6G A;  3TDG A;  1A23 A;  5ECH B;  3D5J A;  3QOU A;  2KUC A;  2C0F A;  4EXJ A;  1GSE A;  2HSY A;  2L5O A;  1HNB A;  2A2R A;  4KE3 A;  5KEJ A;  3VWU A;  5IPG A;  4CDO A;  3GTU A;  2IFQ A;  2VAF A;  1XW6 A;  2E0Q A;  4ILF A;  4ID0 A;  1DUG A;  3I9V 2;  4L5L A;  4IP6 A;  5B8B A;  4JZQ A;  5HQP A;  2GQM A;  1X9W B;  4MZW A;  1K3L A;  2CT6 A;  3H1N A;  2IMF A;  1V2A A;  2LUS A;  5ENU A;  4LL1 B;  4K7I A;  2CA8 A;  4Q5F A;  3I69 A;  5C00 A;  4IHU A;  4NHW A;  4ZBB A;  1QK8 A;  5ECO B;  3TJF A;  2WZ9 A;  5D8I A;  4L8E A;  5DVB A;  1K3O A;  4Z7X A;  5G1K A;  1GTI A;  4K9Z A;  2LRN A;  3DWV A;  2H70 A;  2GSS A;  2LST A;  2DIY A;  1Q98 A;  2H19 A;  1WRY A;  1MEK A;  1UC7 A;  3IOS A;  2OE3 A;  2KP2 A;  1G0T A;  2GLR A;  4KA0 A;  1MD4 A;  3VUR A;  1VF1 A;  3GTU B;  5IMF A;  5J3R A;  2IL3 A;  3UJ1 A;  2K18 A;  2IFQ B;  4F82 A;  2LRC A;  1PQN A;  4MJA A;  2QKE A;  4MCU A;  2DC5 A;  4Q5R A;  2QC7 A;  5KN2 A;  1V57 A;  3GSS A;  4K6X A;  4KDX A;  3DEX A;  3D0Z A;  3L0H A;  3QAW A;  4TXV A;  5J9C A;  5IO2 A;  4BVX A;  3NIV A;  4X1U A;  1NHO A;  3ZIV A;  1TK5 B;  2C4J A;  2RLI A;  5CAX A;  4XS4 A;  2NVL A;  1JLV A;  1THO A;  2YJ7 A;  4XTS A;  3TJJ A;  1F6M C;  1TI3 A;  1XBS A;  2GST A;  1THX A;  2I3Y A;  3KMN A;  4NPB A;  1LBK A;  2PBJ A;  5DQY A;  3ED3 A;  1M9B A;  1AXD A;  1FB0 A;  4E8H A;  2HRN A;  1LJR A;  3A2W A;  1G7E A;  3EC3 A;  1WWJ A;  5KN3 A;  1GSS A;  2PN8 A;  1B48 A;  3BBY A;  1YY7 A;  4I6X A;  1QQ2 A;  5J41 A;  1FHE A;  3UVT A;  1PN9 A;  2P5R A;  4HI7 A;  1GLQ A;  4RQR A;  2K8V A;  3KMO A;  4EDZ A;  2O8V B;  4PUA A;  5F05 A;  4O7H A;  1YJ6 A;  1EV4 A;  1OC8 A;  4ECB A;  2H1G A;  2AUV A;  3CTG A;  2H71 A;  2MBS A;  1C72 A;  1JZW A;  3F3R A;  5D96 A;  18GS A;  3F4S A;  1ZMA A;  2FWH A;  5A4U A;  3EYT A;  4XS4 B;  4ZL9 A;  3M9K A;  1M2B A;  4I97 A;  1YZX A;  3ZRE A;  4PGT A;  4KW6 A;  3PR8 A;  1WMJ A;  4JRR A;  1BX9 A;  1MD3 A;  3BJ5 A;  2E2M A;  5L71 A;  3V1W A;  4WR4 A;  2RII A;  1Z7R A;  2L4Q A;  1KBN A;  2K9F A;  5GAP D;  3UL3 A;  4XRA A;  1OC3 A;  1BG5 A;  16GS A;  1R4W A;  1QXH A;  3HHV A;  4D73 A;  3IE3 A;  2YP6 A;  4POL A;  4YH2 A;  1GSF A;  2WUL A;  4GRF A;  12GS A;  3IK7 A;  3IV4 A;  1K0A A;  3WD6 A;  5GST A;  2K6V A;  1R5P A;  4HZ2 A;  3EMX A;  4HJM A;  5DCH A;  4XS1 A;  2VO4 A;  5EPF A;  3F9U A;  1BED A;  3TJB A;  3C8E A;  2C80 A;  3C7M A;  2MBT A;  1I5G A;  3FEU A;  3ZTL A;  4POK A;  3Q19 A;  3HJP A;  2WCI A;  1HNA A;  4MZB A;  2TRC P;  6GSU A;  5J9B A;  1K0B A;  2R2J A;  2QSI A;  2VCQ A;  2OKA A;  4IW9 A;  2OJL A;  1FO5 A;  3F6D A;  2ES7 A;  4I2U A;  3WGX A;  2A2S A;  5DCG A;  3IRA A;  4EO3 A;  2GSQ A;  1R26 A;  2I4A A;  2NTO A;  3DIE A;  3CSH A;  1AQX A;  1A2L A;  4KSO A;  1DBY A;  1IYI A;  2R6K A;  1EZK A;  4PXO A;  1Z7P A;  2IIY A;  3D21 A;  1J08 A;  1OKT A;  3EMP A;  1JFU A;  1VGL A;  1YEX A;  4WBJ A;  4XIH A;  4MA9 A;  2B7J A;  2TIR A;  3UVH A;  5D9X A;  3FZ9 A;  3QDN A;  3ME8 A;  3IAM 2;  3O76 A;  1GUK A;  5D9V A;  3LXT A;  4MDC A;  5J5N A;  5ECK B;  1O7U A;  5ECR B;  2L57 A;  3HVV A;  4IKH A;  4ZB6 A;  1GTU A;  4OD7 A;  5G30 A;  5ECN B;  4OO4 A;  2VM2 A;  4XHM A;  4K1F A;  3FR3 A;  5ECI B;  3I43 A;  1TK0 B;  5IMV A;  3R2Q A;  2VL2 A;  2IPA A;  1SK0 A;  3GX0 A;  1OE8 A;  3CRU A;  3D6I A;  3P7X A;  5F8B A;  4TR0 A;  1ST9 A;  3WT1 A;  1TU7 A;  4TRX A;  2OAC A;  4KB3 A;  1GRX A;  4PQH A;  3CBU A;  1XVQ A;  3F4R A;  4IS0 A;  3KM6 A;  3I6A A;  1O6J A;  3FYG A;  1A2J A;  1F9M A;  4ECJ A;  3FZ5 A;  3HA9 A;  4MPG A;  1SL2 B;  4MF6 A;  2C3Q A;  5HR3 A;  4LMV A;  3LG6 A;  2CZ2 A;  4TN8 A;  2AYT A;  2VD0 A;  3CMI A;  2N5B A;  3L9U A;  4HEA 2;  2V6K A;  5DAK A;  4FYB A;  3GN3 A;  5DAL A;  5ELA A;  4L5O A;  1PL1 A;  3G7J A;  3MWH A;  2DML A;  3VWX A;  1GLP A;  1OYJ A;  1JLW A;  2VCZ A;  3EU3 A;  3UAR A;  4KUN A;  4TOP A;  1JZD A;  1K0C A;  1SKW B;  4FH8 A;  1WOU A;  6GSW A;  5JCG A;  3LFL A;  2JZS A;  4HS1 A;  3HZ4 A;  4WBR D;  2ZUP A;  1E6B A;  3RBT A;  3KH9 A;  1GSD A;  3HVS A;  2LEG A;  3HY2 A;  2FWE A;  3PIN A;  2JZT A;  3CTF A;  4FYC A;  4MK3 A;  4F9Z A;  2LQO A;  5JCW A;  4JR6 A;  4WXT A;  2BMX A;  2GQL A;  1GP1 A;  1SKS B;  1SD9 A;  2F3M A;  3QCP A;  1PMT A;  1A8Y A;  3PGT A;  4GXZ A;  2H8L A;  4I8B A;  2JU5 A;  3US3 A; 
#chains in the Genus database with same CATH topology
 3DD3 A;  4HDE A;  1XXU A;  2VCW A;  3IAS 2;  3KXO A;  4QQ7 A;  4O32 A;  1X5E A;  4OFN A;  5DAK B;  5IOX A;  4X43 A;  5DAL B;  1Z6M A;  4Q5Q A;  4TVE A;  2HI7 A;  1GL8 A;  1G6W A;  3HXS A;  2MZC A;  3F6F A;  2QGV A;  3UEM A;  2IMK A;  5IMD A;  2FLS A;  3HJO A;  1AQW A;  3L4N A;  2H66 A;  4DSR A;  4IJI A;  1NW2 A;  1T7P B;  1ZZY A;  1EV9 A;  4HU7 A;  3EE2 A;  3H4K A;  1SL1 B;  3N5O A;  1X0R A;  3KEB A;  2JAC A;  1MDI A;  3D4M A;  4LLR A;  3BCI A;  2EIO A;  2R0P A;  2F8A A;  2O7K A;  1TOF A;  1A0R P;  5A5K A;  5CRD A;  1LU4 A;  3LWA A;  3UMA A;  3GRX A;  4JED A;  2H0G A;  5E59 A;  1FOH A;  3CXG A;  4NXI A;  4G10 A;  2VOC A;  3GIX A;  1H4O A;  2CAI A;  1XIY A;  4F03 A;  1SEN A;  2QA2 A;  4RI7 A;  2OE1 A;  1AIU A;  1SK2 A;  6GSV A;  4BVY A;  3GUR A;  4ML6 A;  5DDL A;  1VF2 A;  4K2D A;  13GS A;  2H75 A;  1Y6E A;  4POB A;  1K0O A;  4TW5 A;  1FG4 A;  2WDU A;  3GUS A;  3KIJ A;  1XPV A;  1G6Y A;  1F2E A;  3VPT A;  5A4V A;  4EIQ A;  1B4P A;  1EOG A;  5H5R A;  3EVI A;  3ZIT A;  2HRK A;  4N0V A;  4BPY A;  3GKK A;  1GNE A;  2DBC A;  3IXR A;  4AJ7 A;  1TDI A;  3FW2 A;  1K0M A;  1M9A A;  4EVM A;  2LJA A;  2LNS A;  1NSW A;  4HUA A;  3HJM A;  4EDY A;  2AAW A;  1JZO A;  1ZCP A;  2HZF A;  1S3D A;  1XG8 A;  5AIS A;  1T4Y A;  3FRC A;  5F06 A;  2IMI A;  4YAV A;  4KCE A;  2L5L A;  1XCC A;  2YZU A;  2HE3 A;  3UAP A;  1PA3 A;  1JZR A;  2IWT A;  2AJQ B;  3HVN A;  2L4C A;  2CVK A;  1TRV A;  4BVY B;  3A3T A;  5IPH A;  3IDV A;  5DBQ A;  1YKC A;  3DYR A;  4ECI A;  4TKY A;  2I1U A;  1FVJ A;  1ERU A;  2PUK C;  4P3Y B;  3FR6 A;  2GQK A;  2OAD A;  3MAK A;  4CHS A;  1O8X A;  4GSS A;  2X99 A;  3EWL A;  1XOA A;  5KOX A;  4OWY A;  3M0F A;  3QFA C;  1PX7 A;  2B5X A;  1M0U A;  5HFG A;  3FY7 A;  5COH A;  3TKS A;  1TTZ A;  2ON5 A;  4Q5N A;  2O85 A;  4J56 E;  2HXK A;  5CP1 A;  2VL2 C;  4IVF A;  1KTE A;  4IBP A;  4LMW A;  4HQS A;  1GNW A;  3GKM A;  1ACV A;  4JE1 A;  1M3J A;  4GF0 A;  4BL7 A;  4PX1 A;  2VL9 A;  4TR3 A;  4YAP A;  1WE0 A;  1DE2 A;  4KX4 A;  1A2M A;  1TXX A;  3VWV A;  3D22 A;  4WEY A;  14GS A;  5JWO B;  3E9J B;  5EY6 A;  2HSM A;  4IN0 A;  3F8U A;  3MIX A;  4L0W A;  4KAE A;  3CSI A;  4YQU A;  2F51 A;  1SYR A;  1Q4J A;  4YKF A;  2OBI A;  1K0N A;  1I9D A;  2R3X A;  1N2A A;  1A0F A;  1VRS D;  4Z2T A;  2P31 A;  5LCZ A;  1O73 A;  2WS2 A;  6GSY A;  1EEM A;  4NV2 A;  4AJ6 A;  3C1S A;  2KOK A;  4CY8 A;  2YWN A;  3UBK A;  1XWB A;  3E3E A;  4GWR A;  1OC9 A;  3NZN A;  3KTL A;  4ZBD A;  5IMC A;  3ZFL A;  1GSU A;  4ZIL A;  3VWW A;  2HFD A;  2FA4 A;  1T3B A;  1B8X A;  1A24 A;  5FWG A;  3G7Y A;  3GH9 A;  4BL7 B;  2MMA A;  3RDW A;  5KN1 A;  2G2Q A;  4HZ4 A;  3D4T A;  1ERV A;  4H86 A;  1O85 A;  2JSZ A;  1RK4 A;  1V58 A;  2KLX A;  2RM6 A;  1EWX A;  2I81 A;  5CNW A;  1YEP A;  19GS A;  3ZMK A;  2CVB A;  3GH6 A;  3ZYW A;  2VL3 A;  2B7K A;  3LW9 A;  2C0G A;  5DJM A;  2WB9 A;  1SK1 A;  1OKD A;  4MAB A;  4DVC A;  2HLS A;  2HRA A;  3KTB A;  1GH2 A;  3DML A;  1B9X C;  3ERW A;  5B6M A;  1XW9 A;  2EC4 A;  8GSS A;  4HOJ A;  2DJJ A;  4J57 E;  4KGI A;  1WPI A;  1OC9 B;  1XWK A;  1M2A A;  5E4W A;  3WGD A;  5C04 A;  1E2Y A;  3FKF A;  1M99 A;  2GGT A;  3FZA A;  4ZXG A;  4N10 A;  5D73 A;  1IYH A;  2H76 A;  2YPM A;  4MF5 A;  2CAQ A;  1W4V A;  1MDJ A;  5FT3 A;  2H73 A;  4K5S A;  3L9S A;  4OMV A;  4ULX A;  2LV3 A;  2WJU A;  4IEL A;  2YZH A;  4X4J A;  4D73 B;  3TOU A;  3TKR A;  2RUE A;  3GA4 A;  1V98 A;  2F8F A;  2WRT A;  1T4Z A;  3HYP A;  2IJY A;  1X5C A;  3KP9 A;  2CZ3 A;  3ZZX A;  5GAN D;  3LYP A;  5G2Z A;  7GSS A;  3TRQ A;  1YKA A;  1DSB A;  3ZIJ A;  2XPE A;  2L59 A;  5DJL A;  5D9W A;  5ECS A;  2IME A;  1PN0 A;  3E0U A;  5ABR A;  1ZYP A;  4PUR A;  3QAV A;  1BYE A;  3HD5 A;  2FNO A;  1YF1 A;  1BQ7 A;  1B9Y C;  4ZB9 A;  3DVW A;  5ELG A;  3Q6O A;  2X8C A;  4N11 A;  4Z2R A;  1PFO A;  5IOW A;  4HJ2 A;  5D9T A;  2AV4 A;  1SJ6 A;  4KSM A;  2DJ2 A;  3C1R A;  4KCA A;  1VF3 A;  3ERF A;  4G9H A;  4NWY A;  5CO3 A;  1TJD A;  4G0I A;  1CQH A;  4V1A p;  2GTU A;  4RI6 A;  3M8N A;  5H5S A;  6GSS A;  4ZBA A;  1NHY A;  1S3A A;  1W89 A;  2GT5 A;  3FK8 A;  1YQ1 A;  3TKS E;  1GUL A;  1X9S B;  4K0N A;  3GFK A;  2PVO C;  2HSH A;  4GQF A;  5IM9 A;  2R5G A;  4ACS A;  3KGK A;  5CRH A;  3SBC A;  4MJE A;  5IIZ A;  2LNT A;  2BJX A;  4FIW A;  3A2V A;  5AIX A;  5CYY A;  1XW5 A;  1AQV A;  2OBK A;  1F3B A;  4RUV A;  1QFN A;  2X8H A;  5AN1 A;  2VUP A;  5JWQ B;  1SKR B;  3LYK A;  3ERG A;  4DSQ A;  4ZB8 A;  1T1V A;  1NM3 A;  1ABA A;  4NHZ A;  4EE0 A;  1WJK A;  4ZL8 A;  4XS6 A;  1RW1 A;  1PKW A;  3ME7 A;  3UOM A;  4DSS A;  4XCS A;  3IK9 A;  4BA7 A;  1TU8 A;  3C73 A;  2XBI A;  1ILO A;  1TK8 B;  2GZZ A;  3TKS C;  4IQ1 A;  2WFC A;  2VM1 A;  3R3E A;  17GS A;  3C71 A;  1UVZ A;  5FHI A;  1ML6 A;  4V2N A;  4ISD A;  1YDK A;  2ON7 A;  4TR1 A;  5AIV A;  1URM A;  1USB A;  4I2T A;  20GS A;  3GKN A;  3IC4 A;  2ZNM A;  2HYX A;  1OVN A;  3CYN A;  4OO5 A;  2GS3 A;  2B3S A;  3AY8 A;  1J0F A;  3F3Q A;  5HR2 A;  1SJZ A;  1EGR A;  2PGT A;  2J9H A;  3A5W A;  2GVP A;  2VLU A;  4AJ8 A;  4NMU A;  5G1L A;  3IHQ A;  5KOW A;  2WGR A;  4O5U A;  2PER A;  3HDC A;  4J2F A;  2TRX A;  4GSN A;  1EOH A;  2YAN A;  3HZ8 A;  1ZGN A;  2GT6 A;  4KDY A;  2LS5 A;  4DSS B;  3PH9 A;  2M72 A;  4OFT A;  1GWC A;  4V2L A;  5IO0 A;  1TI1 A;  2PPT A;  2ZCT A;  2C1Y A;  2CQ9 A;  1G7O A;  2CX3 A;  4MMM A;  1HNC A;  1R7H A;  3EU4 A;  4TR1 B;  1XWC A;  2HNL A;  2R0C A;  3MYD A;  1YF0 A;  2PMT A;  3LGC A;  2AB6 A;  3WYW A;  5A4W A;  1KNG A;  2MMZ A;  3GYK A;  5CRW A;  1QUW A;  4NAX A;  4KDU A;  3BD2 A;  3DGQ A;  4G19 A;  1CQG A;  4YQM A;  1T00 A;  4OCE A;  3P90 A;  4DEJ A;  4MF7 A;  2RUF A;  3QD9 A;  4X0X A;  11GS A;  3GHA A;  3TRP A;  4RQX A;  4V2M A;  2YOI A;  5CRE A;  5G31 A;  2F9S A;  2M80 A;  3L9V A;  5HR0 A;  1EGO A;  1VF4 A;  2G0F A;  2VLT A;  2CVD A;  5G5F A;  2A4V A;  1PRX A;  1A8L A;  3MSZ A;  2R37 A;  1MTC A;  3IC8 A;  4PQI A;  1SYX A;  3P2A A;  3F63 A;  4HU9 A;  2VCT A;  3WGE A;  2A4H A;  2I9H A;  2LTK A;  3Q18 A;  3UIW A;  10GS A;  2YJH A;  3A2X A;  4CY6 A;  5G5E A;  3WT2 A;  5ECM B;  2DJ0 A;  2FA8 A;  2MMN A;  5IMZ A;  1SD8 A;  2YWM A;  4GQC A;  2V32 A;  2DIZ A;  3APO A;  5CRG A;  4PTS A;  1PKZ A;  4N30 A;  1B4Q A;  1XWG A;  2YWI A;  3N9J A;  2H6Y A;  1XVW A;  3FZ4 A;  4L0U A;  3VPQ A;  2YV9 A;  2MMO A;  2NBS A;  3GL5 A;  4MH3 A;  4F2I A;  3CQF A;  3CSJ A;  2H1D A;  5ID2 A;  1GTA A;  5AGY A;  1QMV A;  4QL9 A;  1Z3E A;  1HD2 A;  4JR4 A;  4YQV A;  2LJK A;  1FAA A;  1TP9 A;  2XPD A;  3J7Y b;  1AW9 A;  4IGJ A;  3HKR A;  4WF4 A;  2CX4 A;  2V1M A;  1UA5 A;  1ERW A;  1AUC A;  3QMX A;  2GZP A;  2R4V A;  1F37 A;  5H5Q A;  3QPM A;  4EF0 A;  3QFB C;  1X9M B;  3RHC A;  1UN2 A;  3L78 A;  5B6N A;  1PSQ A;  3GMF A;  2HZE A;  1BAY A;  3MDK A;  3P8W A;  2VLV A;  6GST A;  4PQ1 A;  2FWG A;  1M3I A;  4LA1 A;  2NPB A;  3DVX A;  5KN0 A;  5JWR B;  1GTB A;  5ECQ B;  2YWO A;  4LL4 B;  1K0D A;  2H72 A;  2B5E A;  2N5F A;  3KCM A;  3GNJ A;  2KHP A;  5ID2 B;  1GUM A;  3H79 A;  5D93 A;  3SWL A;  1SU9 A;  2B6M A;  5INY A;  2IMD A;  3W8S A;  3TCO A;  1U88 A;  3G7I A;  1WP0 A;  2H74 A;  4TR4 A;  2DMM A;  2X4A A;  3DRN A;  1TKD B;  2XBQ A;  2LQQ A;  4XRD A;  2PWJ A;  4E8E A;  3M3M A;  4V1A g;  2VIM A;  2X8G A;  3M1G A;  3ZLP A;  3LOR A;  1ZOF A;  3GKX A;  2DSA A;  2DJ1 A;  4ECC A;  3FR9 A;  3APQ A;  3H8Q A;  4JBB A;  5J4U A;  3IPZ A;  2GZY A;  1XOB A;  4PUF C;  4MJC A;  3RPP A;  2AHE A;  4MP4 A;  2FGX A;  3U6V A;  4A5P A;  2HZE B;  1XZO A;  1EP7 A;  3LSZ A;  3S9F A;  3TGZ A;  1ZL9 A;  4K8M A;  5HFK A;  1SL0 B;  3ZVJ D;  3VI7 A;  2H30 A;  4FQU A;  2JL4 A;  3TRX A;  3VI5 A;  2ALB A;  2H6X A;  2BTO T;  4IQA A;  2HT9 A;  3MNG A;  5DQS A;  2JZR A;  2D2Z A;  9GSS A;  4EUY A;  4GLT A;  5B7C A;  5ECP B;  4Z2U A;  4K7O A;  4O92 A;  4PNG A;  2LJR A;  3TJG A;  4F0B A;  2DJK A;  1FOV A;  5EL8 A;  2K8S A;  2V41 A;  3KH7 A;  2C3T A;  1ZYE A;  1FVK A;  22GS A;  2E2G A;  1KEB A;  1FW1 A;  2CV4 A;  3ZML A;  1GSY A;  4GCI A;  4OCF A;  4POM A;  1H75 A;  4WF5 A;  1J9B A;  2O89 A;  3KD0 A;  1O8W A;  3LQ7 A;  1K3Y A;  3TKQ A;  5JCU A;  1EP8 A;  2YCD A;  2Z9S A;  2FD3 A;  5GZZ B;  3IR4 A;  4I5Q A;  4ZL7 A;  4EC0 A;  2YN1 A;  2C0E A;  3U5R E;  2EIQ A;  3TUE A;  5IQY A;  4MZC A;  2H1B A;  2N5A A;  2KP1 A;  3HCZ A;  3CRT A;  3TOT A;  1ERT A;  3APS A;  1PL2 A;  5BRT A;  4WET A;  1RQM A;  3H93 A;  1TW9 A;  4G0L A;  5LD0 A;  3KZQ A;  3W8J A;  3ZFB A;  1PX6 A;  4K0G A;  1JHB A;  3PPU A;  4ML1 A;  4NV5 A;  1M2D A;  2LKU A;  2E7P A;  2GDR A;  5GSS A;  2A2P A;  4MLY A;  2HRF A;  4N0Z A;  4GTU A;  2H1A A;  4QL7 A;  1PGT A;  2NDO A;  4MJB A;  1FB6 A;  3RHB A;  2JAD A;  3HVX A;  3NOF A;  1XWA A;  5BMU A;  2B5Y A;  2FY6 A;  1U87 A;  1OAZ A;  3EUR A;  3G9B A;  4KF9 A;  4G2E A;  1TRS A;  1ON4 A;  3LJR A;  4OFM A;  4ZIJ A;  3EIN A;  2V6O A;  2IN3 A;  3DKS A;  1TRW A;  3GV1 A;  1N8J A;  1OE7 A;  3LEF A;  2C0D A;  3VFI A;  5ECL B;  2V2G A;  3TJK A;  3FMW A;  4BWS A;  5EVO A;  3ZVJ A;  1M7T A;  3VLN A;  3KP8 A;  3JCM L;  3Q74 A;  4WR5 A;  1R5A A;  3IHG A;  4KND A;  2JSY A;  1T8E B;  2REM A;  3J7Y k;  3TB2 A;  2LRT A;  2B1K A;  4HSC X;  3BCK A;  2PVQ A;  6GSX A;  4BWQ A;  1ZYQ B;  2GSR A;  4IP1 A;  1S3C A;  1F3A A;  1V40 A;  4WKW A;  3RPN A;  2VCX A;  1GSQ A;  1XFL A;  4MPF A;  2C3N A;  2XC2 A;  2YV7 A;  4FYU A;  2L6D A;  3GST A;  4GST A;  4PNF A;  4EL1 A;  5F07 A;  5B8A A;  3F0I A;  2MYG A;  2P0G A;  2XHF A;  4TXO A;  1Z9H A;  2L6C A;  1O81 A;  5HR1 A;  4AF2 A;  4EKZ A;  5F0G A;  3FHK A;  3RAZ A;  2VCV A;  1AC1 A;  2J23 A;  3TKP A;  3M9J A;  2OA7 A;  2P5Q A;  2FCH A;  5LNK e;  1X5D A;  1WIK A;  3IA1 A;  1EEJ A;  1Z6N A;  3F4T A;  1ZYN A;  5IMA A;  3ZL5 A;  2FUG 2;  3GL3 A;  1V9W A;  2PU9 C;  2H01 A;  1QGV A;  2H0H A;  2C8U A;  1DE1 A;  3ISO A;  3ZRD A;  2DJ3 A;  1TRU A;  3GX8 A;  3BOA A;  4CW9 A;  1U3A A;  1BJX A;  2DLX A;  4IJ3 A;  3VK9 A;  3OR5 A;  5HFI A;  3UBL A;  4HQZ A;  1GUH A;  1Y25 A;  4FO5 A;  2DKI A;  1PD2 1;  3QAG A;  3KJY A;  1U3I A;  2B1L A;  1HYU A;  4JU5 A;  4F0C A;  3O6T A;  2YNX A;  2FHE A;  4TXO B;  4MH2 A;  2VD1 A;  4KH7 A;  1SJI A;  3LXZ A;  2OE0 A;  2EIR A;  1Z5Y E;  2M46 A;  2X49 A;  4K7N A;  2H6Z A;  2O87 A;  3DXB A;  3K8N A;  2H0I A;  2FWF A;  1HQO A;  3O3T A;  1AAZ A;  1MDK A;  4O5R A;  2RM5 A;  3IBH A;  1U6T A;  4AGS A;  2X64 A;  3QR6 A;  3W6G A;  3TDG A;  3A5I A;  1A23 A;  5ECH B;  3D5J A;  3QOU A;  2KUC A;  2C0F A;  4EXJ A;  1GSE A;  2HSY A;  2L5O A;  1HNB A;  2A2R A;  4KE3 A;  5KEJ A;  3VWU A;  5IPG A;  4CDO A;  3GTU A;  2IFQ A;  2VAF A;  1XW6 A;  2E0Q A;  4ILF A;  4ID0 A;  1DUG A;  3I9V 2;  4L5L A;  4IP6 A;  2QA1 A;  5B8B A;  4JZQ A;  5HQP A;  2GQM A;  1X9W B;  4MZW A;  1K3L A;  4BIK A;  2CT6 A;  3H1N A;  2IMF A;  1V2A A;  2LUS A;  5ENU A;  4LL1 B;  4K7I A;  2CA8 A;  4Q5F A;  3I69 A;  5C00 A;  4IHU A;  4NHW A;  4ZBB A;  1QK8 A;  5ECO B;  3TJF A;  2WZ9 A;  5D8I A;  4L8E A;  5DVB A;  1K3O A;  4Z7X A;  5G1K A;  1GTI A;  4K9Z A;  2LRN A;  3DWV A;  2H70 A;  2GSS A;  2LST A;  2DIY A;  1Q98 A;  2H19 A;  1WRY A;  1MEK A;  1UC7 A;  3IOS A;  2OE3 A;  2KP2 A;  1G0T A;  2GLR A;  4KA0 A;  1MD4 A;  3VUR A;  1VF1 A;  3GTU B;  5IMF A;  5J3R A;  2IL3 A;  3UJ1 A;  2K18 A;  2IFQ B;  4F82 A;  2LRC A;  1PQN A;  4MJA A;  4MNN A;  2QKE A;  4MCU A;  2DC5 A;  4Q5R A;  2QC7 A;  5KN2 A;  1V57 A;  3GSS A;  4K6X A;  4KDX A;  3DEX A;  2DKH A;  3D0Z A;  3L0H A;  3QAW A;  4TXV A;  5J9C A;  5IO2 A;  4BVX A;  3NIV A;  4X1U A;  1NHO A;  3ZIV A;  1TK5 B;  2C4J A;  2RLI A;  5CAX A;  4XS4 A;  4K2X A;  2NVL A;  1JLV A;  1THO A;  2YJ7 A;  4XTS A;  3TJJ A;  1F6M C;  1TI3 A;  1XBS A;  4G0K A;  2GST A;  1THX A;  2I3Y A;  3KMN A;  4NPB A;  1LBK A;  2PBJ A;  5DQY A;  3ED3 A;  1M9B A;  1AXD A;  1FB0 A;  4E8H A;  2HRN A;  1LJR A;  3A2W A;  1G7E A;  3EC3 A;  1WWJ A;  5KN3 A;  1GSS A;  2PN8 A;  1B48 A;  3BBY A;  1YY7 A;  4I6X A;  1QQ2 A;  5J41 A;  1FHE A;  3UVT A;  1PN9 A;  2P5R A;  4HI7 A;  1GLQ A;  4RQR A;  2K8V A;  3KMO A;  4EDZ A;  2O8V B;  4PUA A;  5F05 A;  4O7H A;  1YJ6 A;  1EV4 A;  1OC8 A;  4BVX B;  4ECB A;  2H1G A;  2AUV A;  3CTG A;  2H71 A;  2MBS A;  1C72 A;  1JZW A;  3F3R A;  5D96 A;  18GS A;  3F4S A;  1ZMA A;  2FWH A;  5A4U A;  3EYT A;  4XS4 B;  4ZL9 A;  3M9K A;  1M2B A;  4I97 A;  1YZX A;  3ZRE A;  4PGT A;  4KW6 A;  3PR8 A;  1WMJ A;  4JRR A;  1BX9 A;  1MD3 A;  3BJ5 A;  2E2M A;  5L71 A;  3V1W A;  4WR4 A;  2RII A;  1Z7R A;  2L4Q A;  1KBN A;  2K9F A;  5GAP D;  3UL3 A;  4XRA A;  1OC3 A;  1BG5 A;  16GS A;  1R4W A;  1QXH A;  3HHV A;  4D73 A;  3IE3 A;  2YP6 A;  4POL A;  4YH2 A;  1GSF A;  2WUL A;  4GRF A;  12GS A;  3IK7 A;  3IV4 A;  1K0A A;  4YKG A;  3WD6 A;  5GST A;  2K6V A;  1R5P A;  4HZ2 A;  3EMX A;  4HJM A;  5DCH A;  4XS1 A;  2VO4 A;  5EPF A;  3F9U A;  1BED A;  3TJB A;  3C8E A;  2C80 A;  3C7M A;  4ICY A;  2MBT A;  1I5G A;  3FEU A;  3ZTL A;  4POK A;  3Q19 A;  3HJP A;  2WCI A;  1HNA A;  4MZB A;  2TRC P;  6GSU A;  5J9B A;  1K0B A;  2R2J A;  2QSI A;  2VCQ A;  2OKA A;  4IW9 A;  2OJL A;  1FO5 A;  3F6D A;  2ES7 A;  4I2U A;  3WGX A;  2A2S A;  5DCG A;  3IRA A;  4EO3 A;  2GSQ A;  1R26 A;  2I4A A;  2NTO A;  4O5Q A;  3DIE A;  3CSH A;  1AQX A;  1A2L A;  4KSO A;  1DBY A;  1IYI A;  2R6K A;  1EZK A;  4PXO A;  1Z7P A;  2IIY A;  3D21 A;  1J08 A;  1OKT A;  3EMP A;  1JFU A;  1VGL A;  1YEX A;  4WBJ A;  4XIH A;  4MA9 A;  2B7J A;  2TIR A;  3UVH A;  5D9X A;  3FZ9 A;  3QDN A;  3ME8 A;  3IAM 2;  3O76 A;  1S3R A;  1GUK A;  5D9V A;  3LXT A;  4MDC A;  5J5N A;  5ECK B;  1O7U A;  5ECR B;  2L57 A;  4K5R A;  3HVV A;  4IKH A;  4ZB6 A;  1GTU A;  4OD7 A;  4USS A;  5G30 A;  5ECN B;  4OO4 A;  2VM2 A;  4XHM A;  4K1F A;  3FR3 A;  5ECI B;  3I43 A;  1TK0 B;  5IMV A;  3R2Q A;  2VL2 A;  2IPA A;  1SK0 A;  3GX0 A;  1OE8 A;  3CRU A;  3D6I A;  3P7X A;  5F8B A;  4TR0 A;  1ST9 A;  3WT1 A;  1TU7 A;  4TRX A;  2OAC A;  4KB3 A;  1GRX A;  4PQH A;  3CBU A;  1XVQ A;  3F4R A;  4IS0 A;  3KM6 A;  3I6A A;  1O6J A;  3FYG A;  1A2J A;  1F9M A;  4ECJ A;  3FZ5 A;  3HA9 A;  4MPG A;  1SL2 B;  4MF6 A;  2C3Q A;  5HR3 A;  4LMV A;  3LG6 A;  2CZ2 A;  4TN8 A;  2AYT A;  2VD0 A;  3CMI A;  2N5B A;  4EIP A;  3L9U A;  4HEA 2;  2V6K A;  5DAK A;  4FYB A;  3GN3 A;  5DAL A;  5ELA A;  4L5O A;  1PL1 A;  3G7J A;  3MWH A;  2DML A;  3VWX A;  1GLP A;  1OYJ A;  1JLW A;  2VCZ A;  3EU3 A;  3UAR A;  4KUN A;  4TOP A;  1JZD A;  1K0C A;  1SKW B;  4FH8 A;  1WOU A;  6GSW A;  5JCG A;  3LFL A;  2JZS A;  4HS1 A;  3EPT A;  3HZ4 A;  4WBR D;  2ZUP A;  1E6B A;  3RBT A;  3KH9 A;  1GSD A;  3HVS A;  2LEG A;  2R0G A;  3HY2 A;  2FWE A;  3PIN A;  2JZT A;  3CTF A;  4FYC A;  4MK3 A;  4F9Z A;  2LQO A;  5JCW A;  4JR6 A;  4WXT A;  2BMX A;  2GQL A;  1GP1 A;  1SKS B;  1SD9 A;  2F3M A;  3QCP A;  1PMT A;  1A8Y A;  2UZ8 A;  3PGT A;  4GXZ A;  2H8L A;  4I8B A;  2JU5 A;  3US3 A; 
#chains in the Genus database with same CATH homology
 3DD3 A;  4HDE A;  1XXU A;  2VCW A;  3IAS 2;  3KXO A;  4QQ7 A;  4O32 A;  1X5E A;  4OFN A;  5DAK B;  5IOX A;  4X43 A;  5DAL B;  1Z6M A;  4Q5Q A;  4TVE A;  2HI7 A;  1GL8 A;  1G6W A;  3HXS A;  2MZC A;  3F6F A;  2QGV A;  3UEM A;  2IMK A;  5IMD A;  2FLS A;  3HJO A;  1AQW A;  3L4N A;  2H66 A;  4DSR A;  4IJI A;  1NW2 A;  1T7P B;  1ZZY A;  1EV9 A;  4HU7 A;  3EE2 A;  3H4K A;  1SL1 B;  3N5O A;  1X0R A;  3KEB A;  2JAC A;  1MDI A;  3D4M A;  4LLR A;  3BCI A;  2EIO A;  2R0P A;  2F8A A;  2O7K A;  1TOF A;  1A0R P;  5A5K A;  5CRD A;  1LU4 A;  3LWA A;  3UMA A;  3GRX A;  4JED A;  2H0G A;  5E59 A;  1FOH A;  3CXG A;  4NXI A;  4G10 A;  2VOC A;  3GIX A;  1H4O A;  2CAI A;  1XIY A;  4F03 A;  1SEN A;  2QA2 A;  4RI7 A;  2OE1 A;  1AIU A;  1SK2 A;  6GSV A;  4BVY A;  3GUR A;  4ML6 A;  5DDL A;  1VF2 A;  4K2D A;  13GS A;  2H75 A;  1Y6E A;  4POB A;  1K0O A;  4TW5 A;  1FG4 A;  2WDU A;  3GUS A;  3KIJ A;  1XPV A;  1G6Y A;  1F2E A;  3VPT A;  5A4V A;  4EIQ A;  1B4P A;  1EOG A;  5H5R A;  3EVI A;  3ZIT A;  2HRK A;  4N0V A;  4BPY A;  3GKK A;  1GNE A;  2DBC A;  3IXR A;  4AJ7 A;  1TDI A;  3FW2 A;  1K0M A;  1M9A A;  4EVM A;  2LJA A;  2LNS A;  1NSW A;  4HUA A;  3HJM A;  4EDY A;  2AAW A;  1JZO A;  1ZCP A;  2HZF A;  1S3D A;  5AIS A;  1T4Y A;  3FRC A;  5F06 A;  4YAV A;  2IMI A;  4KCE A;  2L5L A;  1XCC A;  2YZU A;  2HE3 A;  3UAP A;  1PA3 A;  1JZR A;  2IWT A;  2AJQ B;  2L4C A;  2CVK A;  1TRV A;  4BVY B;  3A3T A;  5IPH A;  3IDV A;  5DBQ A;  1YKC A;  3DYR A;  4ECI A;  4TKY A;  2I1U A;  1FVJ A;  1ERU A;  2PUK C;  4P3Y B;  3FR6 A;  2GQK A;  2OAD A;  3MAK A;  4CHS A;  1O8X A;  4GSS A;  2X99 A;  3EWL A;  1XOA A;  5KOX A;  4OWY A;  3M0F A;  3QFA C;  1PX7 A;  2B5X A;  1M0U A;  5HFG A;  3FY7 A;  5COH A;  3TKS A;  1TTZ A;  2ON5 A;  4Q5N A;  2O85 A;  4J56 E;  2HXK A;  5CP1 A;  2VL2 C;  4IVF A;  1KTE A;  4IBP A;  4LMW A;  4HQS A;  1GNW A;  3GKM A;  1ACV A;  4JE1 A;  4GF0 A;  4BL7 A;  4PX1 A;  2VL9 A;  4TR3 A;  4YAP A;  1WE0 A;  1DE2 A;  4KX4 A;  1A2M A;  1TXX A;  3VWV A;  3D22 A;  4WEY A;  14GS A;  5JWO B;  3E9J B;  5EY6 A;  2HSM A;  4IN0 A;  3F8U A;  3MIX A;  4L0W A;  4KAE A;  3CSI A;  4YQU A;  2F51 A;  1SYR A;  1Q4J A;  4YKF A;  2OBI A;  1K0N A;  1I9D A;  2R3X A;  1N2A A;  1A0F A;  1VRS D;  4Z2T A;  2P31 A;  5LCZ A;  1O73 A;  2WS2 A;  6GSY A;  1EEM A;  4NV2 A;  4AJ6 A;  3C1S A;  2KOK A;  4CY8 A;  2YWN A;  3UBK A;  1XWB A;  3E3E A;  4GWR A;  1OC9 A;  3NZN A;  3KTL A;  4ZBD A;  5IMC A;  3ZFL A;  1GSU A;  4ZIL A;  3VWW A;  2HFD A;  2FA4 A;  1T3B A;  1B8X A;  1A24 A;  5FWG A;  3G7Y A;  3GH9 A;  4BL7 B;  2MMA A;  3RDW A;  5KN1 A;  2G2Q A;  4HZ4 A;  3D4T A;  1ERV A;  4H86 A;  1O85 A;  2JSZ A;  1RK4 A;  1V58 A;  2KLX A;  2RM6 A;  1EWX A;  2I81 A;  5CNW A;  1YEP A;  19GS A;  3ZMK A;  2CVB A;  3GH6 A;  3ZYW A;  2VL3 A;  2B7K A;  3LW9 A;  2C0G A;  5DJM A;  2WB9 A;  1SK1 A;  1OKD A;  4MAB A;  4DVC A;  2HLS A;  2HRA A;  3KTB A;  1GH2 A;  3DML A;  1B9X C;  3ERW A;  5B6M A;  1XW9 A;  2EC4 A;  8GSS A;  4HOJ A;  2DJJ A;  4J57 E;  4KGI A;  1WPI A;  1OC9 B;  1XWK A;  1M2A A;  5E4W A;  3WGD A;  5C04 A;  1E2Y A;  3FKF A;  1M99 A;  2GGT A;  3FZA A;  4ZXG A;  4N10 A;  5D73 A;  1IYH A;  2H76 A;  2YPM A;  4MF5 A;  2CAQ A;  1W4V A;  1MDJ A;  5FT3 A;  2H73 A;  4K5S A;  3L9S A;  4OMV A;  4ULX A;  2LV3 A;  2WJU A;  4IEL A;  2YZH A;  4X4J A;  4D73 B;  3TOU A;  3TKR A;  2RUE A;  3GA4 A;  1V98 A;  2F8F A;  2WRT A;  1T4Z A;  3HYP A;  2IJY A;  1X5C A;  3KP9 A;  2CZ3 A;  3ZZX A;  5GAN D;  3LYP A;  5G2Z A;  7GSS A;  3TRQ A;  1YKA A;  1DSB A;  3ZIJ A;  2XPE A;  2L59 A;  5DJL A;  5D9W A;  5ECS A;  2IME A;  1PN0 A;  3E0U A;  5ABR A;  1ZYP A;  4PUR A;  3QAV A;  1BYE A;  3HD5 A;  2FNO A;  1YF1 A;  1BQ7 A;  1B9Y C;  4ZB9 A;  3DVW A;  5ELG A;  3Q6O A;  2X8C A;  4N11 A;  4Z2R A;  5IOW A;  4HJ2 A;  5D9T A;  2AV4 A;  1SJ6 A;  4KSM A;  2DJ2 A;  3C1R A;  4KCA A;  1VF3 A;  3ERF A;  4G9H A;  4NWY A;  5CO3 A;  1TJD A;  4G0I A;  1CQH A;  4V1A p;  2GTU A;  4RI6 A;  3M8N A;  5H5S A;  6GSS A;  4ZBA A;  1NHY A;  1S3A A;  1W89 A;  2GT5 A;  3FK8 A;  1YQ1 A;  3TKS E;  1GUL A;  1X9S B;  4K0N A;  3GFK A;  2PVO C;  2HSH A;  4GQF A;  5IM9 A;  2R5G A;  4ACS A;  3KGK A;  5CRH A;  3SBC A;  4MJE A;  5IIZ A;  2LNT A;  2BJX A;  4FIW A;  3A2V A;  5AIX A;  5CYY A;  1XW5 A;  1AQV A;  2OBK A;  1F3B A;  4RUV A;  1QFN A;  2X8H A;  5AN1 A;  2VUP A;  5JWQ B;  1SKR B;  3LYK A;  3ERG A;  4DSQ A;  4ZB8 A;  1T1V A;  1NM3 A;  1ABA A;  4NHZ A;  4EE0 A;  1WJK A;  4ZL8 A;  4XS6 A;  1RW1 A;  1PKW A;  3ME7 A;  3UOM A;  4DSS A;  4XCS A;  3IK9 A;  4BA7 A;  1TU8 A;  3C73 A;  2XBI A;  1ILO A;  1TK8 B;  2GZZ A;  3TKS C;  4IQ1 A;  2WFC A;  2VM1 A;  3R3E A;  17GS A;  3C71 A;  1UVZ A;  5FHI A;  1ML6 A;  4V2N A;  4ISD A;  1YDK A;  2ON7 A;  4TR1 A;  5AIV A;  1URM A;  1USB A;  4I2T A;  20GS A;  3GKN A;  3IC4 A;  2ZNM A;  2HYX A;  1OVN A;  3CYN A;  4OO5 A;  2GS3 A;  2B3S A;  3AY8 A;  1J0F A;  3F3Q A;  5HR2 A;  1SJZ A;  1EGR A;  2PGT A;  2J9H A;  3A5W A;  2GVP A;  2VLU A;  4AJ8 A;  4NMU A;  5G1L A;  3IHQ A;  5KOW A;  2WGR A;  4O5U A;  2PER A;  3HDC A;  4J2F A;  2TRX A;  4GSN A;  1EOH A;  2YAN A;  3HZ8 A;  1ZGN A;  2GT6 A;  4KDY A;  2LS5 A;  4DSS B;  3PH9 A;  2M72 A;  4OFT A;  1GWC A;  4V2L A;  5IO0 A;  1TI1 A;  2PPT A;  2ZCT A;  2C1Y A;  2CQ9 A;  1G7O A;  2CX3 A;  4MMM A;  1HNC A;  1R7H A;  3EU4 A;  4TR1 B;  1XWC A;  2HNL A;  2R0C A;  3MYD A;  1YF0 A;  2PMT A;  3LGC A;  2AB6 A;  3WYW A;  5A4W A;  1KNG A;  2MMZ A;  3GYK A;  5CRW A;  1QUW A;  4NAX A;  4KDU A;  3BD2 A;  3DGQ A;  4G19 A;  1CQG A;  4YQM A;  1T00 A;  4OCE A;  3P90 A;  4DEJ A;  4MF7 A;  2RUF A;  3QD9 A;  4X0X A;  11GS A;  3GHA A;  3TRP A;  4RQX A;  4V2M A;  2YOI A;  5CRE A;  5G31 A;  2F9S A;  2M80 A;  3L9V A;  5HR0 A;  1EGO A;  1VF4 A;  2G0F A;  2VLT A;  2CVD A;  5G5F A;  2A4V A;  1PRX A;  1A8L A;  3MSZ A;  2R37 A;  1MTC A;  3IC8 A;  4PQI A;  1SYX A;  3P2A A;  3F63 A;  4HU9 A;  2VCT A;  3WGE A;  2A4H A;  2I9H A;  2LTK A;  3Q18 A;  3UIW A;  10GS A;  2YJH A;  3A2X A;  4CY6 A;  5G5E A;  3WT2 A;  5ECM B;  2DJ0 A;  2FA8 A;  2MMN A;  5IMZ A;  1SD8 A;  2YWM A;  4GQC A;  2V32 A;  2DIZ A;  3APO A;  5CRG A;  4PTS A;  1PKZ A;  4N30 A;  1B4Q A;  1XWG A;  2YWI A;  3N9J A;  2H6Y A;  1XVW A;  3FZ4 A;  4L0U A;  3VPQ A;  2YV9 A;  2MMO A;  2NBS A;  3GL5 A;  4MH3 A;  4F2I A;  3CSJ A;  2H1D A;  5ID2 A;  1GTA A;  5AGY A;  1QMV A;  4QL9 A;  1Z3E A;  1HD2 A;  4JR4 A;  4YQV A;  2LJK A;  1FAA A;  1TP9 A;  2XPD A;  3J7Y b;  1AW9 A;  4IGJ A;  3HKR A;  4WF4 A;  2CX4 A;  2V1M A;  1UA5 A;  1ERW A;  1AUC A;  3QMX A;  2GZP A;  2R4V A;  1F37 A;  5H5Q A;  3QPM A;  4EF0 A;  3QFB C;  1X9M B;  3RHC A;  1UN2 A;  3L78 A;  5B6N A;  1PSQ A;  3GMF A;  2HZE A;  1BAY A;  3MDK A;  3P8W A;  2VLV A;  6GST A;  4PQ1 A;  2FWG A;  4LA1 A;  2NPB A;  3DVX A;  5KN0 A;  5JWR B;  1GTB A;  5ECQ B;  2YWO A;  4LL4 B;  1K0D A;  2H72 A;  2B5E A;  2N5F A;  3KCM A;  3GNJ A;  2KHP A;  5ID2 B;  1GUM A;  3H79 A;  5D93 A;  3SWL A;  1SU9 A;  2B6M A;  5INY A;  2IMD A;  3W8S A;  3TCO A;  1U88 A;  3G7I A;  1WP0 A;  2H74 A;  4TR4 A;  2DMM A;  2X4A A;  3DRN A;  1TKD B;  2XBQ A;  2LQQ A;  4XRD A;  2PWJ A;  4E8E A;  3M3M A;  4V1A g;  2VIM A;  2X8G A;  3M1G A;  3ZLP A;  3LOR A;  1ZOF A;  3GKX A;  2DSA A;  2DJ1 A;  4ECC A;  3FR9 A;  3APQ A;  3H8Q A;  4JBB A;  5J4U A;  3IPZ A;  2GZY A;  1XOB A;  4PUF C;  4MJC A;  3RPP A;  2AHE A;  4MP4 A;  2FGX A;  3U6V A;  4A5P A;  2HZE B;  1XZO A;  1EP7 A;  3LSZ A;  3S9F A;  3TGZ A;  1ZL9 A;  4K8M A;  5HFK A;  1SL0 B;  3ZVJ D;  3VI7 A;  2H30 A;  4FQU A;  2JL4 A;  3TRX A;  3VI5 A;  2ALB A;  2H6X A;  2BTO T;  4IQA A;  2HT9 A;  3MNG A;  5DQS A;  2JZR A;  2D2Z A;  9GSS A;  4EUY A;  4GLT A;  5B7C A;  5ECP B;  4Z2U A;  4K7O A;  4O92 A;  4PNG A;  2LJR A;  3TJG A;  4F0B A;  2DJK A;  1FOV A;  5EL8 A;  2K8S A;  2V41 A;  3KH7 A;  2C3T A;  1ZYE A;  1FVK A;  22GS A;  2E2G A;  1KEB A;  1FW1 A;  2CV4 A;  3ZML A;  1GSY A;  4GCI A;  4OCF A;  4POM A;  1H75 A;  4WF5 A;  1J9B A;  2O89 A;  3KD0 A;  1O8W A;  3LQ7 A;  1K3Y A;  3TKQ A;  5JCU A;  1EP8 A;  2YCD A;  2Z9S A;  2FD3 A;  5GZZ B;  3IR4 A;  4I5Q A;  4ZL7 A;  4EC0 A;  2YN1 A;  2C0E A;  3U5R E;  2EIQ A;  3TUE A;  5IQY A;  4MZC A;  2H1B A;  2N5A A;  2KP1 A;  3HCZ A;  3CRT A;  3TOT A;  1ERT A;  3APS A;  1PL2 A;  5BRT A;  4WET A;  1RQM A;  3H93 A;  1TW9 A;  4G0L A;  5LD0 A;  3KZQ A;  3W8J A;  3ZFB A;  1PX6 A;  4K0G A;  1JHB A;  3PPU A;  4ML1 A;  4NV5 A;  1M2D A;  2LKU A;  2E7P A;  2GDR A;  5GSS A;  2A2P A;  4MLY A;  2HRF A;  4N0Z A;  4GTU A;  2H1A A;  4QL7 A;  1PGT A;  2NDO A;  4MJB A;  1FB6 A;  3RHB A;  2JAD A;  3HVX A;  3NOF A;  1XWA A;  5BMU A;  2B5Y A;  2FY6 A;  1U87 A;  1OAZ A;  3EUR A;  3G9B A;  4KF9 A;  4G2E A;  1TRS A;  1ON4 A;  3LJR A;  4OFM A;  4ZIJ A;  3EIN A;  2V6O A;  2IN3 A;  3DKS A;  1TRW A;  3GV1 A;  1N8J A;  1OE7 A;  3LEF A;  2C0D A;  3VFI A;  5ECL B;  2V2G A;  3TJK A;  3FMW A;  4BWS A;  5EVO A;  3ZVJ A;  1M7T A;  3VLN A;  3KP8 A;  3JCM L;  3Q74 A;  4WR5 A;  1R5A A;  3IHG A;  4KND A;  2JSY A;  1T8E B;  2REM A;  3J7Y k;  3TB2 A;  2LRT A;  2B1K A;  3BCK A;  2PVQ A;  6GSX A;  4BWQ A;  1ZYQ B;  2GSR A;  4IP1 A;  1S3C A;  1F3A A;  1V40 A;  4WKW A;  3RPN A;  2VCX A;  1GSQ A;  1XFL A;  4MPF A;  2C3N A;  2XC2 A;  2YV7 A;  4FYU A;  2L6D A;  3GST A;  4GST A;  4PNF A;  4EL1 A;  5F07 A;  5B8A A;  3F0I A;  2MYG A;  2P0G A;  2XHF A;  4TXO A;  1Z9H A;  2L6C A;  1O81 A;  5HR1 A;  4AF2 A;  4EKZ A;  5F0G A;  3FHK A;  3RAZ A;  2VCV A;  1AC1 A;  2J23 A;  3TKP A;  3M9J A;  2OA7 A;  2P5Q A;  2FCH A;  5LNK e;  1X5D A;  1WIK A;  3IA1 A;  1EEJ A;  1Z6N A;  3F4T A;  1ZYN A;  5IMA A;  3ZL5 A;  2FUG 2;  3GL3 A;  1V9W A;  2PU9 C;  2H01 A;  1QGV A;  2H0H A;  2C8U A;  1DE1 A;  3ISO A;  3ZRD A;  2DJ3 A;  1TRU A;  3GX8 A;  3BOA A;  4CW9 A;  1U3A A;  1BJX A;  2DLX A;  4IJ3 A;  3VK9 A;  3OR5 A;  5HFI A;  3UBL A;  4HQZ A;  1GUH A;  1Y25 A;  4FO5 A;  2DKI A;  1PD2 1;  3QAG A;  3KJY A;  1U3I A;  2B1L A;  1HYU A;  4JU5 A;  4F0C A;  3O6T A;  2YNX A;  2FHE A;  4TXO B;  4MH2 A;  2VD1 A;  4KH7 A;  1SJI A;  3LXZ A;  2OE0 A;  2EIR A;  1Z5Y E;  2M46 A;  2X49 A;  4K7N A;  2H6Z A;  2O87 A;  3DXB A;  3K8N A;  2H0I A;  2FWF A;  1HQO A;  3O3T A;  1AAZ A;  1MDK A;  4O5R A;  2RM5 A;  3IBH A;  1U6T A;  4AGS A;  2X64 A;  3QR6 A;  3W6G A;  3TDG A;  3A5I A;  1A23 A;  5ECH B;  3D5J A;  3QOU A;  2KUC A;  2C0F A;  4EXJ A;  1GSE A;  2HSY A;  2L5O A;  1HNB A;  2A2R A;  4KE3 A;  5KEJ A;  3VWU A;  5IPG A;  4CDO A;  3GTU A;  2IFQ A;  2VAF A;  1XW6 A;  2E0Q A;  4ILF A;  4ID0 A;  1DUG A;  3I9V 2;  4L5L A;  4IP6 A;  2QA1 A;  5B8B A;  4JZQ A;  5HQP A;  2GQM A;  1X9W B;  4MZW A;  1K3L A;  2CT6 A;  3H1N A;  2IMF A;  1V2A A;  2LUS A;  5ENU A;  4LL1 B;  4K7I A;  2CA8 A;  4Q5F A;  3I69 A;  5C00 A;  4IHU A;  4NHW A;  4ZBB A;  1QK8 A;  5ECO B;  3TJF A;  2WZ9 A;  5D8I A;  4L8E A;  5DVB A;  1K3O A;  4Z7X A;  5G1K A;  1GTI A;  4K9Z A;  2LRN A;  3DWV A;  2H70 A;  2GSS A;  2LST A;  2DIY A;  1Q98 A;  2H19 A;  1WRY A;  1MEK A;  1UC7 A;  3IOS A;  2OE3 A;  2KP2 A;  1G0T A;  2GLR A;  4KA0 A;  1MD4 A;  3VUR A;  1VF1 A;  3GTU B;  5IMF A;  5J3R A;  2IL3 A;  3UJ1 A;  2K18 A;  2IFQ B;  4F82 A;  2LRC A;  1PQN A;  4MJA A;  4MNN A;  2QKE A;  4MCU A;  2DC5 A;  4Q5R A;  2QC7 A;  5KN2 A;  1V57 A;  3GSS A;  4K6X A;  4KDX A;  3DEX A;  2DKH A;  3D0Z A;  3L0H A;  3QAW A;  4TXV A;  5J9C A;  5IO2 A;  4BVX A;  3NIV A;  4X1U A;  1NHO A;  3ZIV A;  1TK5 B;  2C4J A;  2RLI A;  5CAX A;  4XS4 A;  4K2X A;  2NVL A;  1JLV A;  1THO A;  2YJ7 A;  4XTS A;  3TJJ A;  1F6M C;  1TI3 A;  1XBS A;  4G0K A;  2GST A;  1THX A;  2I3Y A;  3KMN A;  4NPB A;  1LBK A;  2PBJ A;  5DQY A;  3ED3 A;  1M9B A;  1AXD A;  1FB0 A;  4E8H A;  2HRN A;  1LJR A;  3A2W A;  1G7E A;  3EC3 A;  1WWJ A;  5KN3 A;  1GSS A;  2PN8 A;  1B48 A;  3BBY A;  1YY7 A;  4I6X A;  1QQ2 A;  5J41 A;  1FHE A;  3UVT A;  1PN9 A;  2P5R A;  4HI7 A;  1GLQ A;  4RQR A;  2K8V A;  3KMO A;  4EDZ A;  2O8V B;  4PUA A;  5F05 A;  4O7H A;  1YJ6 A;  1EV4 A;  1OC8 A;  4BVX B;  4ECB A;  2H1G A;  2AUV A;  3CTG A;  2H71 A;  2MBS A;  1C72 A;  1JZW A;  3F3R A;  5D96 A;  18GS A;  3F4S A;  1ZMA A;  2FWH A;  5A4U A;  3EYT A;  4XS4 B;  4ZL9 A;  3M9K A;  1M2B A;  4I97 A;  1YZX A;  3ZRE A;  4PGT A;  4KW6 A;  3PR8 A;  1WMJ A;  4JRR A;  1BX9 A;  1MD3 A;  3BJ5 A;  2E2M A;  5L71 A;  3V1W A;  4WR4 A;  2RII A;  1Z7R A;  2L4Q A;  1KBN A;  2K9F A;  5GAP D;  3UL3 A;  4XRA A;  1OC3 A;  1BG5 A;  16GS A;  1R4W A;  1QXH A;  3HHV A;  4D73 A;  3IE3 A;  2YP6 A;  4POL A;  4YH2 A;  1GSF A;  2WUL A;  4GRF A;  12GS A;  3IK7 A;  3IV4 A;  1K0A A;  4YKG A;  3WD6 A;  5GST A;  2K6V A;  1R5P A;  4HZ2 A;  3EMX A;  4HJM A;  5DCH A;  4XS1 A;  2VO4 A;  5EPF A;  3F9U A;  1BED A;  3TJB A;  3C8E A;  2C80 A;  3C7M A;  4ICY A;  2MBT A;  1I5G A;  3FEU A;  3ZTL A;  4POK A;  3Q19 A;  3HJP A;  2WCI A;  1HNA A;  4MZB A;  2TRC P;  6GSU A;  5J9B A;  1K0B A;  2R2J A;  2QSI A;  2VCQ A;  2OKA A;  4IW9 A;  2OJL A;  1FO5 A;  3F6D A;  2ES7 A;  4I2U A;  3WGX A;  2A2S A;  5DCG A;  3IRA A;  4EO3 A;  2GSQ A;  1R26 A;  2I4A A;  2NTO A;  4O5Q A;  3DIE A;  3CSH A;  1AQX A;  1A2L A;  4KSO A;  1DBY A;  1IYI A;  2R6K A;  1EZK A;  4PXO A;  1Z7P A;  2IIY A;  3D21 A;  1J08 A;  1OKT A;  3EMP A;  1JFU A;  1VGL A;  1YEX A;  4WBJ A;  4XIH A;  4MA9 A;  2B7J A;  2TIR A;  3UVH A;  5D9X A;  3FZ9 A;  3QDN A;  3ME8 A;  3IAM 2;  3O76 A;  1GUK A;  5D9V A;  3LXT A;  4MDC A;  5J5N A;  5ECK B;  1O7U A;  5ECR B;  2L57 A;  4K5R A;  3HVV A;  4IKH A;  4ZB6 A;  1GTU A;  4OD7 A;  4USS A;  5G30 A;  5ECN B;  4OO4 A;  2VM2 A;  4XHM A;  4K1F A;  3FR3 A;  5ECI B;  3I43 A;  1TK0 B;  5IMV A;  3R2Q A;  2VL2 A;  2IPA A;  1SK0 A;  3GX0 A;  1OE8 A;  3CRU A;  3D6I A;  3P7X A;  5F8B A;  4TR0 A;  1ST9 A;  3WT1 A;  1TU7 A;  4TRX A;  2OAC A;  4KB3 A;  1GRX A;  4PQH A;  3CBU A;  1XVQ A;  3F4R A;  4IS0 A;  3KM6 A;  3I6A A;  1O6J A;  3FYG A;  1A2J A;  1F9M A;  4ECJ A;  3FZ5 A;  3HA9 A;  4MPG A;  1SL2 B;  4MF6 A;  2C3Q A;  5HR3 A;  4LMV A;  3LG6 A;  2CZ2 A;  4TN8 A;  2AYT A;  2VD0 A;  3CMI A;  2N5B A;  4EIP A;  3L9U A;  4HEA 2;  2V6K A;  5DAK A;  4FYB A;  3GN3 A;  5DAL A;  5ELA A;  4L5O A;  1PL1 A;  3G7J A;  3MWH A;  2DML A;  3VWX A;  1GLP A;  1OYJ A;  1JLW A;  2VCZ A;  3EU3 A;  3UAR A;  4KUN A;  4TOP A;  1JZD A;  1K0C A;  1SKW B;  4FH8 A;  1WOU A;  6GSW A;  5JCG A;  3LFL A;  2JZS A;  4HS1 A;  3EPT A;  3HZ4 A;  4WBR D;  2ZUP A;  1E6B A;  3RBT A;  3KH9 A;  1GSD A;  3HVS A;  2LEG A;  2R0G A;  3HY2 A;  2FWE A;  3PIN A;  2JZT A;  3CTF A;  4FYC A;  4MK3 A;  4F9Z A;  2LQO A;  5JCW A;  4JR6 A;  4WXT A;  2BMX A;  2GQL A;  1GP1 A;  1SKS B;  1SD9 A;  2F3M A;  3QCP A;  1PMT A;  1A8Y A;  2UZ8 A;  3PGT A;  4GXZ A;  2H8L A;  4I8B A;  2JU5 A;  3US3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...