4DSSA

Crystal structure of peroxiredoxin ahp1 from saccharomyces cerevisiae in complex with thioredoxin trx2
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
174
structure length
174
Chain Sequence
DLVNKKFPAGDYKFQYIAISQSDADSESCKMPQTVEWSKLISENKKVIITGAPAAFSPTSTVSHIPGYINYLDELVKEKEVDQVIVVTVDNPFANQAWAKSLGVKDTTHIKFASDPGCAFTKSIGFELAVGDGVYWSGRWAMVVENGIVTYAAKETNPGTDVTVSSVESVLAHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/transport protein
molecule keywords Peroxiredoxin type-2
publication title Structural Snapshots of Yeast Alkyl Hydroperoxide Reductase Ahp1 Peroxiredoxin Reveal a Novel Two-cysteine Mechanism of Electron Transfer to Eliminate Reactive Oxygen Species.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 50
structure length 174
sequence length 174
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2012-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08534 Redoxin Redoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4dssA00
17GSA 3K8NA 2C3TA 4POBA 3I9V2 4ECBA 4IN0A 5IMFA 3TJGA 4AJ6A 1WMJA 2IMFA 3IA1A 2O87A 1ON4A 3KM6A 2K9FA 2O89A 2CAIA 5IMDA 1KNGA 2F9SA 1BQ7A 3P7XA 2XPDA 3FK8A 4LMWA 1TK0B 2HXKA 2LQOA 5AIVA 2H1BA 1V9WA 3APQA 3P8WA 3UBKA 3W8SA 3O76A 2H8LA 1B9YC 2C4JA 1XWGA 5DJLA 1PQNA 4PUAA 1XBSA 4CHSA 1GNWA 3IAM2 1G0TA 1HNCA 2NTOA 2I3YA 3GRXA 3KXOA 1BG5A 3SWLA 3F9UA 4O32A 2NDOA 3FR6A 3GURA 2J23A 1V2AA 1PMTA 5EPFA 2ZUPA 4YQUA 2ON5A 2H0HA 1YDKA 1O8WA 2XHFA 3KMNA 6GSYA 3U5RE 3QD9A 2VM2A 2OBKA 2IMDA 3FZ5A 1WPIA 2CVBA 4EC0A 3PINA 1ZMAA 1ZCPA 3OR5A 4RI7A 4RQRA 2MMOA 3GKXA 1NHOA 4ZL8A 3E9JB 4MPGA 1TDIA 3F4SA 1JZWA 2IPAA 1QQ2A 2I9HA 3CSJA 1A8LA 4MK3A 1O6JA 3ZFBA 1S3CA 3KH9A 2GQMA 18GSA 5D73A 2QGVA 3WT2A 3SBCA 3IR4A 2WGRA 1A2MA 4DVCA 2WRTA 5CRWA 1AQWA 5EY6A 5A4UA 4Q5NA 4HUAA 3BD2A 2N5FA 4WR4A 3QFAC 3QR6A 1H75A 2MBTA 5H5RA 3DGQA 4O7HA 1THXA 4MZCA 2NVLA 3VWWA 3PR8A 3D21A 2CX4A 4ZL7A 2K8VA 4POLA 3M8NA 5JWRB 3ME8A 1F3BA 2VD1A 1FOVA 3TRXA 1TOFA 1ZZYA 4DSQA 3O3TA 4E8EA 2FNOA 2A4VA 3GKMA 2JADA 4QQ7A 1VGLA 1JZDA 1PL1A 2P31A 3CSIA 1XVQA 3PGTA 5C00A 1G7EA 2YWIA 1QK8A 3TKPA 3W8JA 2XBIA 4J2FA 4F82A 5KEJA 2H1AA 1WWJA 3D0ZA 3HJPA 1SENA 5E59A 2LNTA 1WRYA 2HSHA 1X5CA 4Q5RA 5B6NA 1GSYA 4MP4A 1V98A 3KP9A 4G9HA 3QDNA 4IP1A 2H1DA 4HU9A 8GSSA 2CZ2A 1GUKA 1SYRA 2YP6A 2LS5A 1SKRB 2VCXA 2GZYA 4H86A 5J9BA 4EUYA 2FWHA 3ED3A 4NMUA 1ML6A 3HYPA 3RPPA 2X8GA 1DE1A 5FWGA 5J3RA 3M1GA 4XIHA 4FYCA 5B8AA 4JBBA 4D73A 1MDIA 2H73A 1MD4A 5B6MA 1Z9HA 2KLXA 16GSA 4WF4A 2PVQA 1GSFA 2C3NA 3HHVA 4IJIA 1R26A 4EXJA 2PERA 2OBIA 1S3AA 4MH3A 1PN9A 1OC9B 1GUHA 2VD0A 4EF0A 2GTUA 1F6MC 4OO4A 2GGTA 2VIMA 3H79A 2CV4A 2K18A 5D8IA 2YNXA 2N5BA 4KDXA 3Q6OA 4NV2A 5JCWA 1K0AA 3QAGA 1UVZA 4ZB9A 3FZ9A 4DEJA 3CRTA 1NM3A 2JSYA 1XWBA 2GSSA 3VPQA 4P3YB 1JLVA 1GTUA 3CSHA 1V58A 2LUSA 5G1LA 3D4TA 2HRNA 3GL5A 1ZOFA 4O92A 2VCTA 4ECCA 5G5EA 4G10A 1M2DA 5LNKe 1XW6A 4LA1A 4MJCA 1SYXA 4F2IA 4IQAA 3QPMA 4L8EA 2HZFA 5J41A 2EC4A 1Z6MA 2WJUA 4PX1A 4BWSA 1PKWA 1ZYEA 5ECSA 4L5OA 2RUEA 4V1Ag 1DBYA 2QKEA 2FLSA 1I5GA 2EIOA 1ZYQB 2R5GA 4GRFA 3FYGA 4N0ZA 4GSTA 1XPVA 3TKQA 6GSVA 2GSQA 2DBCA 3LEFA 1WIKA 1XWAA 2YJ7A 2ZCTA 2P5RA 5ABRA 3BOAA 3W6GA 3ZTLA 4TR3A 5J9CA 5HR3A 2IIYA 5KN2A 3ZYWA 3LFLA 3O6TA 2YV9A 5ENUA 2PN8A 4FIWA 3TOUA 3R2QA 3IBHA 2AUVA 4ZL9A 1GSDA 2FWEA 5G5FA 4GCIA 5LD0A 3GV1A 1SL1B 2JZRA 4OMVA 5J4UA 1PA3A 1SU9A 1K3OA 2GT5A 4AF2A 1XOBA 3FZAA 1GL8A 4OO5A 2H66A 3A3TA 3RHCA 4TKYA 2R2JA 1K0DA 4BWQA 5AIXA 4G2EA 4PUFC 1EV9A 4AJ8A 2GSTA 3A2XA 2LJAA 1OC3A 1HNBA 3WD6A 3TCOA 1O7UA 2HI7A 3FHKA 3MNGA 5CRHA 5IO2A 3D5JA 1EP8A 3CTGA 2X64A 2JZTA 2H30A 2M46A 3C71A 3WYWA 4DSRA 2DJKA 1MDJA 6GSTA 3EMXA 4LL4B 3IPZA 5B7CA 4ML6A 4OFNA 2OE1A 3HVVA 4CDOA 4MMMA 4KGIA 1J9BA 5J5NA 5AISA 3ISOA 4ISDA 4K6XA 2DC5A 4KSOA 1TRWA 1KTEA 2EIRA 5DQYA 1TRVA 2V1MA 3NIVA 4PQIA 4GQCA 4HJMA 2E0QA 4OCEA 1V40A 2H0GA 4OFMA 4YAPA 2H74A 5AN1A 2YWOA 1GTIA 3TOTA 3N9JA 3C7MA 3GL3A 3EINA 2X8HA 2GZZA 2TRXA 1VF2A 3IE3A 1B8XA 1K0NA 5DAKA 3C8EA 4POKA 5G30A 1K3LA 1YJ6A 2VCWA 2H76A 3VWVA 2FWGA 4JRRA 2L59A 2V6KA 1VF3A 5DQSA 4F03A 1FVKA 2LRCA 5KN0A 1AUCA 2IFQA 2H1GA 2VCZA 3I43A 1EOGA 2LV3A 3TB2A 5HFGA 4MPFA 2B7JA 1AXDA 3M0FA 4XRDA 2VCQA 5CAXA 5CRDA 3KTLA 2P0GA 1NHYA 3EU3A 2IFQB 4PXOA 3C1RA 2B3SA 5H5QA 4EDZA 1T7PB 3VK9A 1Y6EA 4MJEA 1GTAA 1URMA 1TJDA 3ZIJA 1SK2A 5EL8A 4IW9A 3KEBA 4TRXA 5D96A 4OD7A 2DJJA 2R4VA 3DIEA 4I2TA 1BX9A 1T4ZA 5DCGA 4N10A 6GSUA 3TUEA 3H93A 2HFDA 1PGTA 3IK9A 5IMZA 4N11A 1GP1A 2H01A 1KEBA 2AB6A 3RHBA 3L4NA 4K1FA 4K7NA 5IOXA 2GZPA 3F4TA 4KCEA 1GSEA 4PQHA 2B5XA 3L0HA 2PUKC 2VLTA 5INYA 3A5WA 1U88A 4FH8A 4PQ1A 1FAAA 3TKSE 3GUSA 4HS1A 4JU5A 5IM9A 3G7IA 1GLQA 3ME7A 2G2QA 3UARA 4JR6A 5HFKA 3GA4A 1EEJA 1E6BA 1OKDA 3LSZA 4NAXA 1EEMA 2XC2A 2R6KA 4PURA 3F63A 1DUGA 1OAZA 2DLXA 4TOPA 2OADA 1VF1A 2HLSA 2LKUA 3U6VA 2LTKA 4IVFA 1SK1A 3VFIA 2VCVA 3A2WA 2K8SA 3ZL5A 3ZZXA 3KD0A 4MH2A 1X5DA 1A0RP 1EGRA 2FCHA 1PKZA 2M80A 3GNJA 4L0UA 1HD2A 3AY8A 4I2UA 2VL2A 4WBJA 3JCML 2TIRA 5ID2B 3CMIA 1EGOA 2PGTA 2DJ2A 3WGDA 1OC8A 5D9VA 3E3EA 3D6IA 4XTSA 3UJ1A 1GSSA 2FA8A 4RQXA 5JCGA 1FVJA 1TP9A 1Z7PA 4IHUA 3VWXA 4OWYA 1M9BA 4ACSA 2I81A 3EE2A 2YANA 2MBSA 1J08A 2YWNA 1YQ1A 1SK0A 4V2NA 1FB6A 2VLVA 3TJFA 6GSWA 4EL1A 1PRXA 2RIIA 5GZZB 3DD3A 1MDKA 1JLWA 3ZREA 1TTZA 2J9HA 4GWRA 4KAEA 3Q74A 2VOCA 1A24A 5CO3A 2HNLA 4Q5QA 5GAPD 2OA7A 1TKDB 1RQMA 5DBQA 2G0FA 4FO5A 1N8JA 1GWCA 4EKZA 4J57E 4GXZA 4JE1A 1EV4A 3EC3A 2VAFA 4Q5FA 2FGXA 3VPTA 4L5LA 4ZBAA 3FEUA 4F9ZA 2OKAA 1F37A 3GYKA 1XCCA 1XW9A 2LJKA 1Q4JA 3TJKA 4XS1A 4DSSB 4JEDA 3FRCA 2H6ZA 5IQYA 4WBRD 4QL7A 4BA7A 3FY7A 1YF1A 2WCIA 1M2AA 1OC9A 1M2BA 3ERFA 2VM1A 1G6YA 3BCIA 14GSA 2IMKA 4ILFA 4V2LA 1U3AA 4NHZA 2ALBA 3GIXA 1YY7A 5ECRB 1XVWA 4PNGA 2IJYA 2PPTA 1TK8B 4NV5A 3GTUB 5F07A 2O85A 3ZVJA 1R5PA 2OE3A 6GSSA 5AGYA 4TW5A 5D9XA 3CRUA 3QMXA 2MZCA 4E8HA 1EZKA 3D22A 3LQ7A 1T4YA 1YZXA 2DMMA 3TKRA 4EDYA 4AGSA 3WGXA 4IGJA 2BTOT 2H70A 3HY2A 2H6YA 9GSSA 1O81A 2WDUA 3PH9A 2FHEA 4MCUA 4LMVA 1VF4A 3GX8A 4KW6A 4KB3A 4BL7A 3ZLPA 4KNDA 3EWLA 4NXIA 3P90A 4EVMA 4TR4A 4EE0A 4HZ2A 1GUMA 2LSTA 2E7PA 1Z6NA 1X0RA 5FHIA 3IHQA 2FWFA 4IKHA 1R7HA 4TR0A 2JSZA 4QL9A 1B9XC 3HDCA 3TDGA 4GF0A 1FB0A 5ELAA 4ULXA 1Z5YE 2OACA 3H4KA 4ZB6A 2P5QA 2YCDA 5A5KA 1QFNA 1YKAA 3DVWA 5IMVA 2F8FA 4K7OA 4KA0A 2C0GA 1AW9A 2BJXA 2V41A 1X9SB 2H72A 1ST9A 1X5EA 4MDCA 3VI5A 2L5OA 4EO3A 1QUWA 2CAQA 3CTFA 4HEA2 3TJBA 1BYEA 5D9WA 3F4RA 3FR9A 4MJAA 2CT6A 3VWUA 3TRPA 1AQVA 1F9MA 4MABA 3M3MA 1S3DA 1IYIA 1SD8A 3L9VA 3MAKA 2R37A 2YZHA 1LJRA 3LORA 3MSZA 2VL3A 1TRSA 4KSMA 3WGEA 5ECNB 3M9JA 2WFCA 1WOUA 2VLUA 3E0UA 3HZ4A 1C72A 3VLNA 5IO0A 5ELGA 4TN8A 3DXBA 12GSA 4N0VA 4TXOB 3UL3A 3QAWA 1HYUA 4WXTA 4POMA 2D2ZA 1OYJA 5ECQB 4CW9A 1TRUA 4PNFA 2PMTA 2JL4A 2REMA 3IC4A 3DMLA 2FUG2 2MYGA 5ECPB 5G31A 3UOMA 3L78A 4ML1A 3S9FA 1ZL9A 2GVPA 1SL2B 3WT1A 4BPYA 3EVIA 1AAZA 1EWXA 1PX7A 4ZB8A 2HYXA 5GAND 4KCAA 2LNSA 1HQOA 4I6XA 3TGZA 3TKSC 2YJHA 1CQGA 1YF0A 7GSSA 5CRGA 1ILOA 1GRXA 1E2YA 2L57A 5IOWA 4HQZA 3BBYA 5JCUA 5B8BA 4JR4A 1T1VA 2RM5A 5ECLB 3F3RA 2HZEA 2WS2A 4KUNA 4FYBA 2WZ9A 5IIZA 2HZEB 1ABAA 3MWHA 4HDEA 3UBLA 1Z7RA 4TR1A 1JHBA 5ECHB 3CXGA 1GULA 3F3QA 2O7KA 1B48A 3IOSA 2DIZA 4TR1B 1GTBA 4HI7A 3LXZA 1YEPA 5G2ZA 1T00A 3G7YA 5CP1A 2HSYA 1OE7A 2AV4A 2Z9SA 4KE3A 4ZILA 5COHA 22GSA 3IV4A 2V2GA 4I97A 4WR5A 3Q19A 2I1UA 1G6WA 1R4WA 2HRFA 3EURA 3FW2A 2B1LA 3FKFA 3DYRA 3GHAA 3QOUA 11GSA 1EP7A 4XRAA 1SJ6A 5ECIB 2KP2A 5JWQB 2ON7A 2B7KA 1XW5A 3GKNA 4GTUA 4LL1B 3TJJA 2B5EA 1WP0A 3DEXA 2K6VA 3LG6A 3APOA 4F0CA 4K0GA 1ZGNA 3G7JA 2C80A 3KCMA 5DVBA 19GSA 2AHEA 4K9ZA 5H5SA 1JZRA 4GLTA 5L71A 4GSSA 4YQMA 4MA9A 1FHEA 1XWKA 4IP6A 2CVKA 2KUCA 2TRCP 3HJOA 3J7Yk 4NHWA 2H6XA 1RK4A 2XBQA 3KZQA 2DJ0A 4IJ3A 2F51A 3QCPA 4KH7A 2FA4A 1SL0B 1M9AA 4ZIJA 2BMXA 3ZRDA 1G7OA 2O8VB 2F8AA 1OVNA 2GDRA 4V2MA 3LXTA 1Y25A 1WE0A 3HCZA 1MD3A 5ID2A 2H19A 4HQSA 1M0UA 1B4PA 5IMAA 5DCHA 13GSA 2DSAA 3RBTA 1QXHA 5A4WA 3LGCA 4O5RA 4V1Ap 1VRSD 3F6DA 4TVEA 3TRQA 3DVXA 1U6TA 2JU5A 3KH7A 3P2AA 1PL2A 2FY6A 3A2VA 1X9MB 4HOJA 4YAVA 1A2LA 1ERTA 1EOHA 3ZMKA 2YPMA 1QGVA 4I8BA 5IPGA 3V1WA 4X0XA 5IPHA 1TK5B 4WF5A 3LYKA 2QC7A 1U3IA 1PX6A 2C3QA 4X43A 3GSTA 3J7Yb 4K8MA 5FT3A 3HD5A 3RDWA 1FW1A 3HZ8A 4MLYA 5LCZA 2AYTA 1AIUA 2IWTA 1USBA 3HKRA 1ERUA 5DDLA 1A23A 1XIYA 2YOIA 2F3MA 3UEMA 2H75A 1SKWB 2KP1A 1AC1A 5EVOA 2GQLA 3GN3A 3IXRA 2VL2C 2L5LA 1H4OA 4PGTA 4WEYA 1PD21 1UA5A 2WB9A 3GSSA 4XHMA 1ERVA 1TI1A 3D4MA 2PU9C 2CVDA 5CYYA 2LRNA 1N2AA 2V6OA 4ID0A 2L4QA 1F2EA 2A2RA 3IAS2 4FYUA 1FG4A 4DSSA 4KX4A 4ECIA 1O73A 1MEKA 1GSQA 1LU4A 10GSA 1NW2A 1YEXA 2LJRA 4KDUA 2IN3A 5ECKB 5CNWA 2OJLA 1Q98A 1TI3A 2B6MA 3KGKA 3BJ5A 2V32A 2B1KA 3HJMA 2C0EA 2HT9A 3FR3A 3UVTA 1LBKA 3Q18A 4TXVA 3DRNA 1TU7A 5GSTA 3VURA 1XZOA 2ES7A 2L6CA 3CBUA 5DALA 3LYPA 3GTUA 1XOAA 2L4CA 1A2JA 6GSXA 2LRTA 4MJBA 1XXUA 4GQFA 2YWMA 5ECMB 2L6DA 3H8QA 4D73B 4XS6A 5E4WA 5DALB 4AJ7A 1IYHA 2DMLA 3GX0A 3LWAA 5HFIA 1K0BA 3MDKA 1GSUA 2CA8A 2I4AA 3BCKA 1DE2A 4RUVA 3KMOA 1V57A 3F6FA 3ZFLA 2X8CA 1DSBA 2FD3A 5G1KA 3H1NA 2H71A 5HQPA 2AJQB 3ZIVA 2PBJA 2R3XA 3DWVA 1BJXA 3KP8A 2HE3A 1TW9A 1OE8A 1ACVA 3C73A 2YZUA 1SJZA 4OFTA 1GLPA 2RUFA 2N5AA 2RLIA 2LEGA 4OCFA 2DJ1A 3UAPA 2C8UA 3KJYA 4Z7XA 4XCSA 1KBNA 4WKWA 2JACA 3M9KA 3EYTA 4NWYA 1R5AA 5F06A 5IMCA 2X99A 4LLRA 4KDYA 2IMIA 3HXSA 2E2GA 3EU4A 2CQ9A 3I6AA 2IMEA 1HNAA 4MZBA 1JFUA 1TU8A 5D93A 2DIYA 1NSWA 5F0GA 2GT6A 2C0FA 2VL9A 2CZ3A 2XPEA 3L9SA 4L0WA 2MMAA 1A0FA 4G19A 1O85A 5A4VA 2M72A 2IL3A 2LQQA 20GSA 1K0MA 3IK7A 3EMPA 3GFKA 5DJMA 3NZNA 5KN3A 4IELA 3RAZA 3IDVA 2MMNA 1B4QA 4IBPA 1F3AA 4RI6A 4ZBDA 1M7TA 1TXXA 5HR1A 5JWOB 2E2MA 1W4VA 4WETA 4IS0A 2JZSA 2NBSA 2AAWA 3F0IA 3GH9A 2YN1A 1M99A 4HU7A 1ERWA 3L9UA 3US3A 4MF5A 1QMVA 2CX3A 1THOA 1PSQA 2YV7A 4TXOA 3RPNA 5C04A 1SKSB 1O8XA 2EIQA 4BVXA 1SJIA 3NOFA 4ZBBA 3HA9A 4J56E 4MZWA 3DKSA 3TKSA 4MF7A 5KN1A 3UIWA 4MF6A 1YKCA 5GSSA 2H0IA 4HJ2A 2KOKA 4YQVA 1WJKA 1U87A 1I9DA 1FO5A 2GLRA 1X9WB 3C1SA 3QAVA 2KHPA 2QSIA 1Z3EA 4K7IA 2A2SA 2C0DA 5D9TA 5ECOB 1BEDA 1XWCA 4HZ4A 3FZ4A 2NPBA 4N30A 2MMZA 4YH2A 3KIJA 1J0FA 1T3BA 3UVHA 2PWJA 1CQHA 1SD9A 5F8BA 1JZOA 2ZNMA 4XS4A 2DJ3A 3ZMLA 3LJRA 3G9BA 3GMFA 1AQXA 3UMAA 3ZITA 1W89A 1A8YA 3KTBA 1K3YA 4XS4B 3QFBC 1XFLA 3I69A 3GKKA 1BAYA 1K0CA 4NPBA 2GQKA 3ERWA 3ERGA 1UN2A 3IRAA 1UC7A 1RW1A 1K0OA 2RM6A 4ZXGA 5F05A 2OE0A 4BVYA 2VUPA 2B5YA 4ECJA 1GH2A 3APSA 3F8UA 2WULA 4GSNA 5DAKB 3HVXA 3VI7A 2C1YA 5HR2A 4K0NA 1GNEA 1T8EB 3N5OA 3HVSA 5HR0A 3GH6A 1MTCA 4IQ1A 4X1UA 4K2DA 3ZVJD 2GS3A 5CREA 3CYNA 2GSRA 4I5QA 2VO4A 1OKTA 4JZQA 2PVOC 4F0BA
chains in the Genus database with same CATH superfamily
17GSA 3K8NA 2C3TA 4POBA 3I9V2 4ECBA 4IN0A 5IMFA 3TJGA 4AJ6A 1WMJA 2IMFA 3IA1A 2O87A 1ON4A 3KM6A 2K9FA 2O89A 2CAIA 5IMDA 1KNGA 2F9SA 1BQ7A 3P7XA 2XPDA 3FK8A 4LMWA 1TK0B 2HXKA 2LQOA 5AIVA 2H1BA 1V9WA 3APQA 3P8WA 3UBKA 3W8SA 3O76A 2H8LA 3MIXA 1B9YC 2C4JA 1XWGA 5DJLA 1PQNA 4PUAA 1XBSA 4CHSA 1GNWA 3IAM2 1G0TA 1HNCA 2NTOA 2I3YA 3GRXA 3KXOA 1BG5A 3SWLA 3F9UA 4O32A 2NDOA 3FR6A 3GURA 2J23A 3MYDA 1FOHA 1V2AA 1PMTA 5EPFA 2ZUPA 4YQUA 2ON5A 2H0HA 1YDKA 1O8WA 2XHFA 3KMNA 6GSYA 3U5RE 3QD9A 2VM2A 2OBKA 2IMDA 3FZ5A 1WPIA 2CVBA 4EC0A 3PINA 1ZMAA 1ZCPA 3OR5A 4RI7A 4RQRA 2MMOA 3GKXA 1NHOA 4ZL8A 3E9JB 4MPGA 1TDIA 3F4SA 1JZWA 1ZYPA 2IPAA 1QQ2A 2I9HA 3CSJA 1A8LA 2A2PA 4MK3A 1O6JA 3ZFBA 1S3CA 3KH9A 2GQMA 18GSA 5D73A 2QGVA 3WT2A 3SBCA 3IR4A 2WGRA 3EPTA 1A2MA 4DVCA 2WRTA 5CRWA 1AQWA 5EY6A 5A4UA 4Q5NA 4HUAA 3BD2A 2N5FA 4WR4A 3QFAC 3QR6A 1H75A 2MBTA 5H5RA 3DGQA 4O7HA 1THXA 4MZCA 2NVLA 3VWWA 3PR8A 3D21A 2CX4A 4ZL7A 2K8VA 4POLA 3M8NA 5JWRB 3ME8A 1F3BA 2VD1A 1FOVA 3TRXA 1TOFA 1ZZYA 4DSQA 3O3TA 4E8EA 2FNOA 2A4VA 3GKMA 2JADA 4QQ7A 1VGLA 1JZDA 1PL1A 2P31A 3CSIA 1XVQA 3PGTA 5C00A 1G7EA 2YWIA 1QK8A 3TKPA 3W8JA 2XBIA 4J2FA 4F82A 5KEJA 2H1AA 1WWJA 3D0ZA 3HJPA 1SENA 5E59A 2LNTA 1WRYA 2HSHA 1X5CA 4Q5RA 5B6NA 1GSYA 4MP4A 1V98A 3KP9A 4G9HA 3QDNA 4IP1A 2H1DA 4HU9A 8GSSA 2CZ2A 1GUKA 1SYRA 2R0PA 2YP6A 2LS5A 1SKRB 2VCXA 2GZYA 4H86A 5J9BA 4EUYA 2FWHA 3ED3A 4NMUA 1ML6A 3HYPA 3RPPA 2X8GA 1DE1A 5FWGA 5J3RA 3M1GA 4XIHA 4FYCA 5B8AA 4JBBA 4D73A 1MDIA 2H73A 1MD4A 5B6MA 4KF9A 1Z9HA 2KLXA 16GSA 4WF4A 2PVQA 1GSFA 2C3NA 3HHVA 4IJIA 1R26A 4EXJA 2PERA 2OBIA 1S3AA 4MH3A 1PN9A 1OC9B 1GUHA 2HSMA 2VD0A 4EF0A 3HVNA 2GTUA 1F6MC 4OO4A 2GGTA 2VIMA 3H79A 2CV4A 2K18A 5D8IA 2YNXA 2N5BA 4KDXA 3Q6OA 3R3EA 4NV2A 5JCWA 1K0AA 2QA2A 3QAGA 1UVZA 4ZB9A 3FZ9A 4DEJA 3CRTA 1NM3A 1PFOA 2JSYA 1XWBA 2GSSA 3VPQA 4P3YB 1JLVA 1GTUA 3CSHA 1V58A 2LUSA 5G1LA 3D4TA 2HRNA 3GL5A 1ZOFA 4O92A 2VCTA 4ECCA 5G5EA 4G10A 1M2DA 5LNKe 1XW6A 4LA1A 4MJCA 1SYXA 4F2IA 4IQAA 3QPMA 4L8EA 2HZFA 5J41A 2EC4A 5KOWA 1Z6MA 2WJUA 4BL7B 4PX1A 4BWSA 1PKWA 1ZYEA 5ECSA 4L5OA 2RUEA 4V1Ag 1DBYA 2QKEA 2FLSA 1I5GA 2EIOA 1ZYQB 2R5GA 4GRFA 3FYGA 4N0ZA 4GSTA 1XPVA 3TKQA 6GSVA 2GSQA 2DBCA 3LEFA 1WIKA 1XWAA 2YJ7A 2ZCTA 2P5RA 5ABRA 3BOAA 3W6GA 5KOXA 3ZTLA 4TR3A 5J9CA 2QA1A 5HR3A 2IIYA 5KN2A 3ZYWA 4ICYA 3LFLA 3O6TA 2YV9A 5ENUA 2PN8A 4FIWA 3TOUA 3R2QA 3IBHA 2AUVA 4ZL9A 1GSDA 2FWEA 5G5FA 4GCIA 5LD0A 3GV1A 1SL1B 2JZRA 4OMVA 5J4UA 1PA3A 1SU9A 1K3OA 2GT5A 4AF2A 1XOBA 3FZAA 1GL8A 4OO5A 2H66A 3A3TA 3RHCA 4TKYA 2R2JA 1K0DA 4BWQA 5AIXA 4G2EA 4PUFC 1EV9A 4AJ8A 2GSTA 3A2XA 2LJAA 1OC3A 1HNBA 3WD6A 3TCOA 1O7UA 2HI7A 3FHKA 3MNGA 5CRHA 5IO2A 3D5JA 1EP8A 3CTGA 2X64A 2JZTA 2H30A 2M46A 3C71A 3WYWA 4DSRA 2DJKA 1MDJA 6GSTA 3EMXA 4LL4B 3IPZA 5B7CA 4ML6A 4OFNA 2OE1A 3HVVA 4CDOA 4MMMA 4BIKA 4KGIA 1J9BA 5J5NA 5AISA 3ISOA 4ISDA 4K6XA 2DC5A 4KSOA 1TRWA 1KTEA 2EIRA 5DQYA 1TRVA 2V1MA 3NIVA 4PQIA 4GQCA 4HJMA 2E0QA 4OCEA 1V40A 2H0GA 4OFMA 4YAPA 2H74A 5AN1A 2YWOA 1GTIA 3TOTA 3N9JA 3C7MA 3GL3A 3EINA 2X8HA 2GZZA 2TRXA 1VF2A 3IE3A 1B8XA 1K0NA 5DAKA 3C8EA 4POKA 5G30A 1K3LA 1YJ6A 2VCWA 2H76A 3VWVA 2FWGA 4JRRA 2L59A 2V6KA 1VF3A 5DQSA 4F03A 1FVKA 2LRCA 1M3IA 5KN0A 1AUCA 2IFQA 2H1GA 2VCZA 3I43A 1EOGA 2LV3A 2UZ8A 3TB2A 5HFGA 4MPFA 2B7JA 1AXDA 3M0FA 4XRDA 2VCQA 5CAXA 5CRDA 3KTLA 2P0GA 1NHYA 3EU3A 2IFQB 4PXOA 3C1RA 2B3SA 5H5QA 4EDZA 1T7PB 3VK9A 1Y6EA 4MJEA 1GTAA 1URMA 1TJDA 1S3RA 3ZIJA 1SK2A 5EL8A 4IW9A 3KEBA 4TRXA 5D96A 4OD7A 2DJJA 2R4VA 3DIEA 4I2TA 1BX9A 1T4ZA 5DCGA 4N10A 6GSUA 3TUEA 3H93A 2HFDA 4HSCX 1PGTA 3IK9A 5IMZA 4N11A 1GP1A 2H01A 1KEBA 2AB6A 3FMWA 3RHBA 3L4NA 4K1FA 4K7NA 5IOXA 2GZPA 3CQFA 3F4TA 4KCEA 1GSEA 4PQHA 2B5XA 3L0HA 2PUKC 2VLTA 5INYA 3A5WA 1U88A 4FH8A 4PQ1A 1FAAA 3TKSE 3GUSA 4HS1A 4JU5A 5IM9A 3G7IA 1GLQA 3ME7A 2G2QA 3UARA 4JR6A 5HFKA 3GA4A 1M3JA 1EEJA 1E6BA 1OKDA 3LSZA 4NAXA 1EEMA 2XC2A 2R6KA 4PURA 3F63A 1DUGA 1OAZA 2DLXA 4TOPA 2OADA 1VF1A 2HLSA 2LKUA 3U6VA 2LTKA 4IVFA 1SK1A 3VFIA 2VCVA 3LW9A 3A2WA 2K8SA 3ZL5A 3ZZXA 3KD0A 2R0CA 4MH2A 1X5DA 1A0RP 1EGRA 2FCHA 1PKZA 2M80A 3GNJA 4L0UA 1HD2A 3AY8A 4I2UA 2VL2A 4WBJA 3JCML 2TIRA 5ID2B 3CMIA 1EGOA 2PGTA 4K5SA 2DJ2A 3WGDA 1OC8A 5D9VA 3E3EA 3D6IA 4XTSA 3UJ1A 1GSSA 2FA8A 4RQXA 5JCGA 1FVJA 1TP9A 1Z7PA 4IHUA 3VWXA 4OWYA 1M9BA 4ACSA 2I81A 3EE2A 2YANA 2MBSA 1J08A 2YWNA 1YQ1A 1SK0A 4V2NA 1FB6A 2VLVA 3TJFA 6GSWA 4EL1A 1PRXA 2RIIA 5GZZB 3DD3A 1MDKA 1JLWA 3ZREA 1TTZA 2J9HA 4GWRA 4KAEA 3Q74A 2VOCA 1A24A 4Z2RA 5CO3A 2HNLA 4USSA 4Q5QA 5GAPD 2OA7A 1TKDB 1RQMA 5DBQA 2G0FA 4FO5A 1N8JA 1GWCA 4EKZA 4J57E 4GXZA 4JE1A 1EV4A 3EC3A 2VAFA 4Q5FA 2FGXA 3VPTA 4L5LA 4ZBAA 3FEUA 4F9ZA 2OKAA 1F37A 3GYKA 1XCCA 1XW9A 2LJKA 2X49A 1Q4JA 3TJKA 4XS1A 4DSSB 4JEDA 3FRCA 2H6ZA 5IQYA 4WBRD 4QL7A 4BA7A 3FY7A 1YF1A 2WCIA 1M2AA 1OC9A 1M2BA 3ERFA 2VM1A 1G6YA 3BCIA 14GSA 2IMKA 4ILFA 4V2LA 1U3AA 4NHZA 2ALBA 3GIXA 1YY7A 5ECRB 1XVWA 4PNGA 2IJYA 2PPTA 1TK8B 4NV5A 3GTUB 5F07A 2O85A 3ZVJA 1R5PA 2OE3A 6GSSA 5AGYA 4TW5A 5D9XA 3CRUA 3QMXA 2MZCA 4E8HA 1EZKA 3D22A 3LQ7A 1T4YA 1YZXA 2DMMA 3TKRA 4EDYA 4AGSA 3WGXA 4IGJA 2BTOT 2H70A 3HY2A 2H6YA 9GSSA 1O81A 2WDUA 3PH9A 2FHEA 4MCUA 4LMVA 1VF4A 3GX8A 4KW6A 4KB3A 4BL7A 3ZLPA 4KNDA 3EWLA 4NXIA 3P90A 4EVMA 4TR4A 4EE0A 4HZ2A 1GUMA 2LSTA 2E7PA 1Z6NA 1X0RA 5FHIA 3IHQA 2FWFA 4IKHA 1R7HA 4TR0A 4G0KA 2JSZA 4QL9A 1B9XC 3HDCA 3TDGA 2DKHA 4GF0A 1FB0A 5ELAA 4ULXA 1Z5YE 2OACA 3H4KA 4ZB6A 2P5QA 2YCDA 5A5KA 1QFNA 1YKAA 3DVWA 5IMVA 2F8FA 4K7OA 4KA0A 2C0GA 1AW9A 2BJXA 5BMUA 2V41A 1X9SB 2H72A 1ST9A 1X5EA 4MDCA 3VI5A 2L5OA 4EO3A 1QUWA 2CAQA 3CTFA 4HEA2 3TJBA 1BYEA 5D9WA 3F4RA 3FR9A 4MJAA 2CT6A 3VWUA 3TRPA 1AQVA 1F9MA 4MABA 3M3MA 1S3DA 1IYIA 1SD8A 3L9VA 4O5UA 3MAKA 2R37A 2YZHA 1LJRA 3LORA 3MSZA 2VL3A 4G0LA 1TRSA 2DKIA 4KSMA 3WGEA 5ECNB 3M9JA 2WFCA 1WOUA 2VLUA 3E0UA 3HZ4A 1C72A 3VLNA 5IO0A 5ELGA 4TN8A 3DXBA 12GSA 4N0VA 4TXOB 3UL3A 3QAWA 1HYUA 4WXTA 4POMA 2D2ZA 1OYJA 5ECQB 4CW9A 1TRUA 4PNFA 2PMTA 2JL4A 2REMA 3IC4A 3DMLA 2FUG2 2MYGA 5ECPB 5G31A 3UOMA 3L78A 4ML1A 3S9FA 1ZL9A 2GVPA 1SL2B 3WT1A 4BPYA 3EVIA 1AAZA 1EWXA 1PX7A 4ZB8A 2HYXA 5GAND 4KCAA 2LNSA 1HQOA 4I6XA 3TGZA 3TKSC 2YJHA 1CQGA 1YF0A 7GSSA 5CRGA 1ILOA 1GRXA 1E2YA 2L57A 5IOWA 4HQZA 3BBYA 5JCUA 5B8BA 4JR4A 1T1VA 2RM5A 5ECLB 3F3RA 2HZEA 2WS2A 4KUNA 2A4HA 4FYBA 2WZ9A 5IIZA 2HZEB 1ABAA 3MWHA 4HDEA 3UBLA 1Z7RA 4TR1A 1JHBA 2R0GA 1XG8A 5ECHB 3CXGA 1GULA 3F3QA 2O7KA 1B48A 3IOSA 2DIZA 4TR1B 1GTBA 4HI7A 3LXZA 1YEPA 5G2ZA 1T00A 3G7YA 3IHGA 5CP1A 2HSYA 1OE7A 2AV4A 2Z9SA 4KE3A 4ZILA 5COHA 22GSA 3IV4A 2V2GA 4I97A 4WR5A 3Q19A 2I1UA 1G6WA 1R4WA 2HRFA 3EURA 3FW2A 2B1LA 4G0IA 3FKFA 3DYRA 3GHAA 3QOUA 11GSA 1EP7A 4XRAA 1SJ6A 5ECIB 2KP2A 5JWQB 2ON7A 2B7KA 1XW5A 3GKNA 4GTUA 4LL1B 3TJJA 2B5EA 1WP0A 3DEXA 2K6VA 3LG6A 3APOA 4F0CA 4K0GA 1ZGNA 3G7JA 2C80A 3KCMA 5DVBA 19GSA 2AHEA 4K9ZA 5H5SA 1JZRA 4GLTA 5L71A 4GSSA 4YQMA 4MA9A 1FHEA 1XWKA 4IP6A 2CVKA 2KUCA 2TRCP 3HJOA 3J7Yk 4NHWA 2H6XA 1RK4A 2XBQA 3KZQA 2DJ0A 4IJ3A 2F51A 3QCPA 4KH7A 2FA4A 1SL0B 1M9AA 4ZIJA 2BMXA 3ZRDA 1G7OA 2O8VB 2F8AA 1OVNA 3A5IA 2GDRA 4V2MA 3LXTA 1Y25A 4EIPA 1WE0A 3HCZA 1MD3A 5ID2A 2H19A 4HQSA 1M0UA 1B4PA 5IMAA 5DCHA 13GSA 2DSAA 3RBTA 1QXHA 5A4WA 3LGCA 4O5RA 4V1Ap 1VRSD 3F6DA 4TVEA 3TRQA 3DVXA 1U6TA 2JU5A 3KH7A 3P2AA 1PL2A 2FY6A 3A2VA 1X9MB 4HOJA 4YAVA 1A2LA 1ERTA 1EOHA 3ZMKA 2YPMA 1QGVA 4I8BA 5IPGA 3V1WA 4X0XA 5IPHA 1TK5B 4WF5A 3LYKA 2QC7A 1U3IA 2X4AA 1PX6A 2C3QA 4X43A 3GSTA 3J7Yb 4K8MA 5FT3A 3HD5A 3RDWA 5BRTA 1FW1A 3HZ8A 4MLYA 5LCZA 2AYTA 1AIUA 2IWTA 1USBA 3HKRA 1ERUA 5DDLA 3PPUA 1A23A 1XIYA 2YOIA 2F3MA 3UEMA 2H75A 1SKWB 2KP1A 1AC1A 5EVOA 2GQLA 3GN3A 3IXRA 2VL2C 2L5LA 1H4OA 4PGTA 4WEYA 1PD21 1UA5A 2WB9A 3GSSA 4XHMA 1ERVA 1TI1A 3D4MA 2PU9C 2CVDA 4YKFA 5CYYA 2LRNA 1N2AA 4YKGA 2V6OA 4ID0A 2L4QA 1F2EA 2HRKA 2A2RA 3IAS2 4FYUA 1FG4A 4DSSA 4KX4A 4ECIA 1O73A 1MEKA 1GSQA 1LU4A 10GSA 1NW2A 1YEXA 2LJRA 4KDUA 2IN3A 5ECKB 5CNWA 2OJLA 1Q98A 1TI3A 2B6MA 3KGKA 3BJ5A 2V32A 2B1KA 3HJMA 2C0EA 2HT9A 3FR3A 3UVTA 1LBKA 3Q18A 4TXVA 3DRNA 1TU7A 5GSTA 3VURA 1XZOA 2ES7A 2L6CA 3CBUA 5DALA 3LYPA 3GTUA 1XOAA 2L4CA 1A2JA 6GSXA 2LRTA 4MJBA 1XXUA 4GQFA 2YWMA 5ECMB 2L6DA 3H8QA 4D73B 4XS6A 5E4WA 5DALB 4AJ7A 4CY8A 1IYHA 2DMLA 3GX0A 3LWAA 5HFIA 1K0BA 3MDKA 1GSUA 2CA8A 2I4AA 3BCKA 1DE2A 4RUVA 3KMOA 1V57A 3F6FA 3ZFLA 1PN0A 2X8CA 1DSBA 2FD3A 4O5QA 5G1KA 3H1NA 2H71A 5HQPA 2AJQB 3ZIVA 2PBJA 2R3XA 3DWVA 1BJXA 3KP8A 2HE3A 1TW9A 1OE8A 1ACVA 3C73A 2YZUA 1SJZA 4OFTA 1GLPA 2RUFA 2N5AA 2RLIA 2LEGA 4OCFA 2DJ1A 3UAPA 2C8UA 3IC8A 3KJYA 4Z7XA 4XCSA 1KBNA 4WKWA 2JACA 3M9KA 3EYTA 4NWYA 1R5AA 5F06A 5IMCA 2X99A 4LLRA 4FQUA 4KDYA 2IMIA 4K5RA 3HXSA 4Z2TA 2E2GA 3EU4A 2CQ9A 3I6AA 2IMEA 1HNAA 4MZBA 1JFUA 1TU8A 5D93A 4PTSA 2DIYA 1NSWA 5F0GA 2GT6A 2C0FA 2VL9A 2CZ3A 2XPEA 3L9SA 4L0WA 2MMAA 1A0FA 4G19A 1O85A 5A4VA 2M72A 2IL3A 2LQQA 20GSA 1K0MA 3IK7A 4CY6A 3EMPA 3GFKA 5DJMA 3NZNA 5KN3A 4A5PA 4IELA 3RAZA 3IDVA 2MMNA 1B4QA 4IBPA 1F3AA 4RI6A 4ZBDA 1M7TA 1TXXA 5HR1A 5JWOB 2E2MA 1W4VA 4WETA 4IS0A 2JZSA 2NBSA 2AAWA 3F0IA 3GH9A 2YN1A 1M99A 4HU7A 1ERWA 3L9UA 3US3A 4MF5A 1QMVA 2CX3A 1THOA 1PSQA 2YV7A 4TXOA 3RPNA 5C04A 1SKSB 1O8XA 2EIQA 4BVXA 1SJIA 3NOFA 4ZBBA 3HA9A 4J56E 4MZWA 3DKSA 3TKSA 4BVXB 4MF7A 5KN1A 3UIWA 4MF6A 1YKCA 5GSSA 2H0IA 4HJ2A 2KOKA 4YQVA 1WJKA 1U87A 4X4JA 1I9DA 1FO5A 2GLRA 2HRAA 1X9WB 3C1SA 3QAVA 2KHPA 2QSIA 1Z3EA 4K7IA 4EIQA 2A2SA 2C0DA 5D9TA 5ECOB 1BEDA 1XWCA 4HZ4A 3FZ4A 2NPBA 4N30A 2MMZA 4YH2A 3KIJA 1J0FA 1T3BA 3UVHA 2PWJA 1ZYNA 1CQHA 1SD9A 4MNNA 5F8BA 1JZOA 2ZNMA 4XS4A 2DJ3A 3ZMLA 3LJRA 3G9BA 3GMFA 1AQXA 3UMAA 3ZITA 1W89A 1A8YA 3KTBA 4Z2UA 1K3YA 4XS4B 3QFBC 1XFLA 3I69A 3GKKA 1BAYA 1K0CA 4NPBA 2GQKA 3ERWA 3ERGA 1UN2A 3IRAA 1UC7A 1RW1A 1K0OA 2RM6A 4ZXGA 5F05A 2OE0A 4BVYA 2VUPA 2B5YA 4ECJA 1GH2A 3APSA 3F8UA 2WULA 4GSNA 5DAKB 4BVYB 3HVXA 4K2XA 2C1YA 3VI7A 5HR2A 4K0NA 1GNEA 1T8EB 3N5OA 3HVSA 5HR0A 3GH6A 1MTCA 4IQ1A 4X1UA 4K2DA 3ZVJD 2GS3A 5CREA 3CYNA 2GSRA 4I5QA 2VO4A 1OKTA 4JZQA 2PVOC 4F0BA
chains in the Genus database with same CATH topology
17GSA 3K8NA 2C3TA 4POBA 3I9V2 4ECBA 4IN0A 5IMFA 3TJGA 4AJ6A 1WMJA 2IMFA 3IA1A 2O87A 1ON4A 3KM6A 2K9FA 2O89A 2CAIA 5IMDA 1KNGA 2F9SA 1BQ7A 3P7XA 2XPDA 3FK8A 4LMWA 1TK0B 2HXKA 2LQOA 5AIVA 2H1BA 1V9WA 3APQA 3P8WA 3UBKA 3W8SA 3O76A 2H8LA 3MIXA 1B9YC 2C4JA 1XWGA 5DJLA 1PQNA 4PUAA 1XBSA 4CHSA 1GNWA 3IAM2 1G0TA 1HNCA 2NTOA 2I3YA 3GRXA 3KXOA 1BG5A 3SWLA 3F9UA 4O32A 2NDOA 3FR6A 3GURA 2J23A 3MYDA 1FOHA 1V2AA 1PMTA 5EPFA 2ZUPA 4YQUA 2ON5A 2H0HA 1YDKA 1O8WA 2XHFA 3KMNA 6GSYA 3U5RE 3QD9A 2VM2A 2OBKA 2IMDA 3FZ5A 1WPIA 2CVBA 4EC0A 3PINA 1ZMAA 1ZCPA 3OR5A 4RI7A 4RQRA 2MMOA 3GKXA 1NHOA 4ZL8A 3E9JB 4MPGA 1TDIA 3F4SA 1JZWA 1ZYPA 2IPAA 1QQ2A 2I9HA 3CSJA 1A8LA 2A2PA 4MK3A 1O6JA 3ZFBA 1S3CA 3KH9A 2GQMA 18GSA 5D73A 2QGVA 3WT2A 3SBCA 3IR4A 2WGRA 3EPTA 1A2MA 4DVCA 2WRTA 5CRWA 1AQWA 5EY6A 5A4UA 4Q5NA 4HUAA 3BD2A 2N5FA 4WR4A 3QFAC 3QR6A 1H75A 2MBTA 5H5RA 3DGQA 4O7HA 1THXA 4MZCA 2NVLA 3VWWA 3PR8A 3D21A 2CX4A 4ZL7A 2K8VA 4POLA 3M8NA 5JWRB 3ME8A 1F3BA 2VD1A 1FOVA 3TRXA 1TOFA 1ZZYA 4DSQA 3O3TA 4E8EA 2FNOA 2A4VA 3GKMA 2JADA 4QQ7A 1VGLA 1JZDA 1PL1A 2P31A 3CSIA 1XVQA 3PGTA 5C00A 1G7EA 2YWIA 1QK8A 3TKPA 3W8JA 2XBIA 4J2FA 4F82A 5KEJA 2H1AA 1WWJA 3D0ZA 3HJPA 1SENA 5E59A 2LNTA 1WRYA 2HSHA 1X5CA 4Q5RA 5B6NA 1GSYA 4MP4A 1V98A 3KP9A 4G9HA 3QDNA 4IP1A 2H1DA 4HU9A 8GSSA 2CZ2A 1GUKA 1SYRA 2R0PA 2YP6A 2LS5A 1SKRB 2VCXA 2GZYA 4H86A 5J9BA 4EUYA 2FWHA 3ED3A 4NMUA 1ML6A 3HYPA 3RPPA 2X8GA 1DE1A 5FWGA 5J3RA 3M1GA 4XIHA 4FYCA 5B8AA 4JBBA 4D73A 1MDIA 2H73A 1MD4A 5B6MA 4KF9A 1Z9HA 2KLXA 16GSA 4WF4A 2PVQA 1GSFA 2C3NA 3HHVA 4IJIA 1R26A 4EXJA 2PERA 2OBIA 1S3AA 4MH3A 1PN9A 1OC9B 1GUHA 2HSMA 2VD0A 4EF0A 2GTUA 1F6MC 4OO4A 2GGTA 2VIMA 3H79A 2CV4A 2K18A 5D8IA 2YNXA 2N5BA 4KDXA 3Q6OA 3R3EA 4NV2A 5JCWA 1K0AA 2QA2A 3QAGA 1UVZA 4ZB9A 3FZ9A 4DEJA 3CRTA 1NM3A 2JSYA 1XWBA 2GSSA 3VPQA 4P3YB 1JLVA 1GTUA 3CSHA 1V58A 2LUSA 5G1LA 3D4TA 2HRNA 3GL5A 1ZOFA 4O92A 2VCTA 4ECCA 5G5EA 4G10A 1M2DA 5LNKe 1XW6A 4LA1A 4MJCA 1SYXA 4F2IA 4IQAA 3QPMA 4L8EA 2HZFA 5J41A 2EC4A 5KOWA 1Z6MA 2WJUA 4BL7B 4PX1A 4BWSA 1PKWA 1ZYEA 5ECSA 4L5OA 2RUEA 4V1Ag 1DBYA 2QKEA 2FLSA 1I5GA 2EIOA 1ZYQB 2R5GA 4GRFA 3FYGA 4N0ZA 4GSTA 1XPVA 3TKQA 6GSVA 2GSQA 2DBCA 3LEFA 1WIKA 1XWAA 2YJ7A 2ZCTA 2P5RA 5ABRA 3BOAA 3W6GA 5KOXA 3ZTLA 4TR3A 5J9CA 2QA1A 5HR3A 2IIYA 5KN2A 3ZYWA 4ICYA 3LFLA 3O6TA 2YV9A 5ENUA 2PN8A 4FIWA 3TOUA 3R2QA 3IBHA 2AUVA 4ZL9A 1GSDA 2FWEA 5G5FA 4GCIA 5LD0A 3GV1A 1SL1B 2JZRA 4OMVA 5J4UA 1PA3A 1SU9A 1K3OA 2GT5A 4AF2A 1XOBA 3FZAA 1GL8A 4OO5A 2H66A 3A3TA 3RHCA 4TKYA 2R2JA 1K0DA 4BWQA 5AIXA 4G2EA 4PUFC 1EV9A 4AJ8A 2GSTA 3A2XA 2LJAA 1OC3A 1HNBA 3WD6A 3TCOA 1O7UA 2HI7A 3FHKA 3MNGA 5CRHA 5IO2A 3D5JA 1EP8A 3CTGA 2X64A 2JZTA 2H30A 2M46A 3C71A 3WYWA 4DSRA 2DJKA 1MDJA 6GSTA 3EMXA 4LL4B 3IPZA 5B7CA 4ML6A 4OFNA 2OE1A 3HVVA 4CDOA 4MMMA 4KGIA 1J9BA 5J5NA 5AISA 3ISOA 4ISDA 4K6XA 2DC5A 4KSOA 1TRWA 1KTEA 2EIRA 5DQYA 1TRVA 2V1MA 3NIVA 4PQIA 4GQCA 4HJMA 2E0QA 4OCEA 1V40A 2H0GA 4OFMA 4YAPA 2H74A 5AN1A 2YWOA 1GTIA 3TOTA 3N9JA 3C7MA 3GL3A 3EINA 2X8HA 2GZZA 2TRXA 1VF2A 3IE3A 1B8XA 1K0NA 5DAKA 3C8EA 4POKA 5G30A 1K3LA 1YJ6A 2VCWA 2H76A 3VWVA 2FWGA 4JRRA 2L59A 2V6KA 1VF3A 5DQSA 4F03A 1FVKA 2LRCA 5KN0A 1AUCA 2IFQA 2H1GA 2VCZA 3I43A 1EOGA 2LV3A 2UZ8A 3TB2A 5HFGA 4MPFA 2B7JA 1AXDA 3M0FA 4XRDA 2VCQA 5CAXA 5CRDA 3KTLA 2P0GA 1NHYA 3EU3A 2IFQB 4PXOA 3C1RA 2B3SA 5H5QA 4EDZA 1T7PB 3VK9A 1Y6EA 4MJEA 1GTAA 1URMA 1TJDA 3ZIJA 1SK2A 5EL8A 4IW9A 3KEBA 4TRXA 5D96A 4OD7A 2DJJA 2R4VA 3DIEA 4I2TA 1BX9A 1T4ZA 5DCGA 4N10A 6GSUA 3TUEA 3H93A 2HFDA 1PGTA 3IK9A 5IMZA 4N11A 1GP1A 2H01A 1KEBA 2AB6A 3FMWA 3RHBA 3L4NA 4K1FA 4K7NA 5IOXA 2GZPA 3F4TA 4KCEA 1GSEA 4PQHA 2B5XA 3L0HA 2PUKC 2VLTA 5INYA 3A5WA 1U88A 4FH8A 4PQ1A 1FAAA 3TKSE 3GUSA 4HS1A 4JU5A 5IM9A 3G7IA 1GLQA 3ME7A 2G2QA 3UARA 4JR6A 5HFKA 3GA4A 1EEJA 1E6BA 1OKDA 3LSZA 4NAXA 1EEMA 2XC2A 2R6KA 4PURA 3F63A 1DUGA 1OAZA 2DLXA 4TOPA 2OADA 1VF1A 2HLSA 2LKUA 3U6VA 2LTKA 4IVFA 1SK1A 3VFIA 2VCVA 3LW9A 3A2WA 2K8SA 3ZL5A 3ZZXA 3KD0A 2R0CA 4MH2A 1X5DA 1A0RP 1EGRA 2FCHA 1PKZA 2M80A 3GNJA 4L0UA 1HD2A 3AY8A 4I2UA 2VL2A 4WBJA 3JCML 2TIRA 5ID2B 3CMIA 1EGOA 2PGTA 4K5SA 2DJ2A 3WGDA 1OC8A 5D9VA 3E3EA 3D6IA 4XTSA 3UJ1A 1GSSA 2FA8A 4RQXA 5JCGA 1FVJA 1TP9A 1Z7PA 4IHUA 3VWXA 4OWYA 1M9BA 4ACSA 2I81A 3EE2A 2YANA 2MBSA 1J08A 2YWNA 1YQ1A 1SK0A 4V2NA 1FB6A 2VLVA 3TJFA 6GSWA 4EL1A 1PRXA 2RIIA 5GZZB 3DD3A 1MDKA 1JLWA 3ZREA 1TTZA 2J9HA 4GWRA 4KAEA 3Q74A 2VOCA 1A24A 4Z2RA 5CO3A 2HNLA 4USSA 4Q5QA 5GAPD 2OA7A 1TKDB 1RQMA 5DBQA 2G0FA 4FO5A 1N8JA 1GWCA 4EKZA 4J57E 4GXZA 4JE1A 1EV4A 3EC3A 2VAFA 4Q5FA 2FGXA 3VPTA 4L5LA 4ZBAA 3FEUA 4F9ZA 2OKAA 1F37A 3GYKA 1XCCA 1XW9A 2LJKA 2X49A 1Q4JA 3TJKA 4XS1A 4DSSB 4JEDA 3FRCA 2H6ZA 5IQYA 4WBRD 4QL7A 4BA7A 3FY7A 1YF1A 2WCIA 1M2AA 1OC9A 1M2BA 3ERFA 2VM1A 1G6YA 3BCIA 14GSA 2IMKA 4ILFA 4V2LA 1U3AA 4NHZA 2ALBA 3GIXA 1YY7A 5ECRB 1XVWA 4PNGA 2IJYA 2PPTA 1TK8B 4NV5A 3GTUB 5F07A 2O85A 3ZVJA 1R5PA 2OE3A 6GSSA 5AGYA 4TW5A 5D9XA 3CRUA 3QMXA 2MZCA 4E8HA 1EZKA 3D22A 3LQ7A 1T4YA 1YZXA 2DMMA 3TKRA 4EDYA 4AGSA 3WGXA 4IGJA 2BTOT 2H70A 3HY2A 2H6YA 9GSSA 1O81A 2WDUA 3PH9A 2FHEA 4MCUA 4LMVA 1VF4A 3GX8A 4KW6A 4KB3A 4BL7A 3ZLPA 4KNDA 3EWLA 4NXIA 3P90A 4EVMA 4TR4A 4EE0A 4HZ2A 1GUMA 2LSTA 2E7PA 1Z6NA 1X0RA 5FHIA 3IHQA 2FWFA 4IKHA 1R7HA 4TR0A 4G0KA 2JSZA 4QL9A 1B9XC 3HDCA 3TDGA 2DKHA 4GF0A 1FB0A 5ELAA 4ULXA 1Z5YE 2OACA 3H4KA 4ZB6A 2P5QA 2YCDA 5A5KA 1QFNA 1YKAA 3DVWA 5IMVA 2F8FA 4K7OA 4KA0A 2C0GA 1AW9A 2BJXA 5BMUA 2V41A 1X9SB 2H72A 1ST9A 1X5EA 4MDCA 3VI5A 2L5OA 4EO3A 1QUWA 2CAQA 3CTFA 4HEA2 3TJBA 1BYEA 5D9WA 3F4RA 3FR9A 4MJAA 2CT6A 3VWUA 3TRPA 1AQVA 1F9MA 4MABA 3M3MA 1S3DA 1IYIA 1SD8A 3L9VA 4O5UA 3MAKA 2R37A 2YZHA 1LJRA 3LORA 3MSZA 2VL3A 4G0LA 1TRSA 2DKIA 4KSMA 3WGEA 5ECNB 3M9JA 2WFCA 1WOUA 2VLUA 3E0UA 3HZ4A 1C72A 3VLNA 5IO0A 5ELGA 4TN8A 3DXBA 12GSA 4N0VA 4TXOB 3UL3A 3QAWA 1HYUA 4WXTA 4POMA 2D2ZA 1OYJA 5ECQB 4CW9A 1TRUA 4PNFA 2PMTA 2JL4A 2REMA 3IC4A 3DMLA 2FUG2 2MYGA 5ECPB 5G31A 3UOMA 3L78A 4ML1A 3S9FA 1ZL9A 2GVPA 1SL2B 3WT1A 4BPYA 3EVIA 1AAZA 1EWXA 1PX7A 4ZB8A 2HYXA 5GAND 4KCAA 2LNSA 1HQOA 4I6XA 3TGZA 3TKSC 2YJHA 1CQGA 1YF0A 7GSSA 5CRGA 1ILOA 1GRXA 1E2YA 2L57A 5IOWA 4HQZA 3BBYA 5JCUA 5B8BA 4JR4A 1T1VA 2RM5A 5ECLB 3F3RA 2HZEA 2WS2A 4KUNA 2A4HA 4FYBA 2WZ9A 5IIZA 2HZEB 1ABAA 3MWHA 4HDEA 3UBLA 1Z7RA 4TR1A 1JHBA 2R0GA 5ECHB 3CXGA 1GULA 3F3QA 2O7KA 1B48A 3IOSA 2DIZA 4TR1B 1GTBA 4HI7A 3LXZA 1YEPA 5G2ZA 1T00A 3G7YA 3IHGA 5CP1A 2HSYA 1OE7A 2AV4A 2Z9SA 4KE3A 4ZILA 5COHA 22GSA 3IV4A 2V2GA 4I97A 4WR5A 3Q19A 2I1UA 1G6WA 1R4WA 2HRFA 3EURA 3FW2A 2B1LA 4G0IA 3FKFA 3DYRA 3GHAA 3QOUA 11GSA 1EP7A 4XRAA 1SJ6A 5ECIB 2KP2A 5JWQB 2ON7A 2B7KA 1XW5A 3GKNA 4GTUA 4LL1B 3TJJA 2B5EA 1WP0A 3DEXA 2K6VA 3LG6A 3APOA 4F0CA 4K0GA 1ZGNA 3G7JA 2C80A 3KCMA 5DVBA 19GSA 2AHEA 4K9ZA 5H5SA 1JZRA 4GLTA 5L71A 4GSSA 4YQMA 4MA9A 1FHEA 1XWKA 4IP6A 2CVKA 2KUCA 2TRCP 3HJOA 3J7Yk 4NHWA 2H6XA 1RK4A 2XBQA 3KZQA 2DJ0A 4IJ3A 2F51A 3QCPA 4KH7A 2FA4A 1SL0B 1M9AA 4ZIJA 2BMXA 3ZRDA 1G7OA 2O8VB 2F8AA 1OVNA 3A5IA 2GDRA 4V2MA 3LXTA 1Y25A 4EIPA 1WE0A 3HCZA 1MD3A 5ID2A 2H19A 4HQSA 1M0UA 1B4PA 5IMAA 5DCHA 13GSA 2DSAA 3RBTA 1QXHA 5A4WA 3LGCA 4O5RA 4V1Ap 1VRSD 3F6DA 4TVEA 3TRQA 3DVXA 1U6TA 2JU5A 3KH7A 3P2AA 1PL2A 2FY6A 3A2VA 1X9MB 4HOJA 4YAVA 1A2LA 1ERTA 1EOHA 3ZMKA 2YPMA 1QGVA 4I8BA 5IPGA 3V1WA 4X0XA 5IPHA 1TK5B 4WF5A 3LYKA 2QC7A 1U3IA 2X4AA 1PX6A 2C3QA 4X43A 3GSTA 3J7Yb 4K8MA 5FT3A 3HD5A 3RDWA 5BRTA 1FW1A 3HZ8A 4MLYA 5LCZA 2AYTA 1AIUA 2IWTA 1USBA 3HKRA 1ERUA 5DDLA 3PPUA 1A23A 1XIYA 2YOIA 2F3MA 3UEMA 2H75A 1SKWB 2KP1A 1AC1A 5EVOA 2GQLA 3GN3A 3IXRA 2VL2C 2L5LA 1H4OA 4PGTA 4WEYA 1PD21 1UA5A 2WB9A 3GSSA 4XHMA 1ERVA 1TI1A 3D4MA 2PU9C 2CVDA 4YKFA 5CYYA 2LRNA 1N2AA 4YKGA 2V6OA 4ID0A 2L4QA 1F2EA 2HRKA 2A2RA 3IAS2 4FYUA 1FG4A 4DSSA 4KX4A 4ECIA 1O73A 1MEKA 1GSQA 1LU4A 10GSA 1NW2A 1YEXA 2LJRA 4KDUA 2IN3A 5ECKB 5CNWA 2OJLA 1Q98A 1TI3A 2B6MA 3KGKA 3BJ5A 2V32A 2B1KA 3HJMA 2C0EA 2HT9A 3FR3A 3UVTA 1LBKA 3Q18A 4TXVA 3DRNA 1TU7A 5GSTA 3VURA 1XZOA 2ES7A 2L6CA 3CBUA 5DALA 3LYPA 3GTUA 1XOAA 2L4CA 1A2JA 6GSXA 2LRTA 4MJBA 1XXUA 4GQFA 2YWMA 5ECMB 2L6DA 3H8QA 4D73B 4XS6A 5E4WA 5DALB 4AJ7A 4CY8A 1IYHA 2DMLA 3GX0A 3LWAA 5HFIA 1K0BA 3MDKA 1GSUA 2CA8A 2I4AA 3BCKA 1DE2A 4RUVA 3KMOA 1V57A 3F6FA 3ZFLA 1PN0A 2X8CA 1DSBA 2FD3A 4O5QA 5G1KA 3H1NA 2H71A 5HQPA 2AJQB 3ZIVA 2PBJA 2R3XA 3DWVA 1BJXA 3KP8A 2HE3A 1TW9A 1OE8A 1ACVA 3C73A 2YZUA 1SJZA 4OFTA 1GLPA 2RUFA 2N5AA 2RLIA 2LEGA 4OCFA 2DJ1A 3UAPA 2C8UA 3IC8A 3KJYA 4Z7XA 4XCSA 1KBNA 4WKWA 2JACA 3M9KA 3EYTA 4NWYA 1R5AA 5F06A 5IMCA 2X99A 4LLRA 4FQUA 4KDYA 2IMIA 4K5RA 3HXSA 4Z2TA 2E2GA 3EU4A 2CQ9A 3I6AA 2IMEA 1HNAA 4MZBA 1JFUA 1TU8A 5D93A 4PTSA 2DIYA 1NSWA 5F0GA 2GT6A 2C0FA 2VL9A 2CZ3A 2XPEA 3L9SA 4L0WA 2MMAA 1A0FA 4G19A 1O85A 5A4VA 2M72A 2IL3A 2LQQA 20GSA 1K0MA 3IK7A 4CY6A 3EMPA 3GFKA 5DJMA 3NZNA 5KN3A 4A5PA 4IELA 3RAZA 3IDVA 2MMNA 1B4QA 4IBPA 1F3AA 4RI6A 4ZBDA 1M7TA 1TXXA 5HR1A 5JWOB 2E2MA 1W4VA 4WETA 4IS0A 2JZSA 2NBSA 2AAWA 3F0IA 3GH9A 2YN1A 1M99A 4HU7A 1ERWA 3L9UA 3US3A 4MF5A 1QMVA 2CX3A 1THOA 1PSQA 2YV7A 4TXOA 3RPNA 5C04A 1SKSB 1O8XA 2EIQA 4BVXA 1SJIA 3NOFA 4ZBBA 3HA9A 4J56E 4MZWA 3DKSA 3TKSA 4BVXB 4MF7A 5KN1A 3UIWA 4MF6A 1YKCA 5GSSA 2H0IA 4HJ2A 2KOKA 4YQVA 1WJKA 1U87A 4X4JA 1I9DA 1FO5A 2GLRA 2HRAA 1X9WB 3C1SA 3QAVA 2KHPA 2QSIA 1Z3EA 4K7IA 4EIQA 2A2SA 2C0DA 5D9TA 5ECOB 1BEDA 1XWCA 4HZ4A 3FZ4A 2NPBA 4N30A 2MMZA 4YH2A 3KIJA 1J0FA 1T3BA 3UVHA 2PWJA 1ZYNA 1CQHA 1SD9A 4MNNA 5F8BA 1JZOA 2ZNMA 4XS4A 2DJ3A 3ZMLA 3LJRA 3G9BA 3GMFA 1AQXA 3UMAA 3ZITA 1W89A 1A8YA 3KTBA 4Z2UA 1K3YA 4XS4B 3QFBC 1XFLA 3I69A 3GKKA 1BAYA 1K0CA 4NPBA 2GQKA 3ERWA 3ERGA 1UN2A 3IRAA 1UC7A 1RW1A 1K0OA 2RM6A 4ZXGA 5F05A 2OE0A 4BVYA 2VUPA 2B5YA 4ECJA 1GH2A 3APSA 3F8UA 2WULA 4GSNA 5DAKB 4BVYB 3HVXA 4K2XA 2C1YA 3VI7A 5HR2A 4K0NA 1GNEA 1T8EB 3N5OA 3HVSA 5HR0A 3GH6A 1MTCA 4IQ1A 4X1UA 4K2DA 3ZVJD 2GS3A 5CREA 3CYNA 2GSRA 4I5QA 2VO4A 1OKTA 4JZQA 2PVOC 4F0BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 17GS A;  3K8N A;  2C3T A;  4POB A;  3I9V 2;  4ECB A;  4IN0 A;  5IMF A;  3TJG A;  4AJ6 A;  1WMJ A;  2IMF A;  3IA1 A;  2O87 A;  1ON4 A;  3KM6 A;  2K9F A;  2O89 A;  2CAI A;  5IMD A;  1KNG A;  2F9S A;  1BQ7 A;  3P7X A;  2XPD A;  3FK8 A;  4LMW A;  1TK0 B;  2HXK A;  2LQO A;  5AIV A;  2H1B A;  1V9W A;  3APQ A;  3P8W A;  3UBK A;  3W8S A;  3O76 A;  2H8L A;  1B9Y C;  2C4J A;  1XWG A;  5DJL A;  1PQN A;  4PUA A;  1XBS A;  4CHS A;  1GNW A;  3IAM 2;  1G0T A;  1HNC A;  2NTO A;  2I3Y A;  3GRX A;  3KXO A;  1BG5 A;  3SWL A;  3F9U A;  4O32 A;  2NDO A;  3FR6 A;  3GUR A;  2J23 A;  1V2A A;  1PMT A;  5EPF A;  2ZUP A;  4YQU A;  2ON5 A;  2H0H A;  1YDK A;  1O8W A;  2XHF A;  3KMN A;  6GSY A;  3U5R E;  3QD9 A;  2VM2 A;  2OBK A;  2IMD A;  3FZ5 A;  1WPI A;  2CVB A;  4EC0 A;  3PIN A;  1ZMA A;  1ZCP A;  3OR5 A;  4RI7 A;  4RQR A;  2MMO A;  3GKX A;  1NHO A;  4ZL8 A;  3E9J B;  4MPG A;  1TDI A;  3F4S A;  1JZW A;  2IPA A;  1QQ2 A;  2I9H A;  3CSJ A;  1A8L A;  4MK3 A;  1O6J A;  3ZFB A;  1S3C A;  3KH9 A;  2GQM A;  18GS A;  5D73 A;  2QGV A;  3WT2 A;  3SBC A;  3IR4 A;  2WGR A;  1A2M A;  4DVC A;  2WRT A;  5CRW A;  1AQW A;  5EY6 A;  5A4U A;  4Q5N A;  4HUA A;  3BD2 A;  2N5F A;  4WR4 A;  3QFA C;  3QR6 A;  1H75 A;  2MBT A;  5H5R A;  3DGQ A;  4O7H A;  1THX A;  4MZC A;  2NVL A;  3VWW A;  3PR8 A;  3D21 A;  2CX4 A;  4ZL7 A;  2K8V A;  4POL A;  3M8N A;  5JWR B;  3ME8 A;  1F3B A;  2VD1 A;  1FOV A;  3TRX A;  1TOF A;  1ZZY A;  4DSQ A;  3O3T A;  4E8E A;  2FNO A;  2A4V A;  3GKM A;  2JAD A;  4QQ7 A;  1VGL A;  1JZD A;  1PL1 A;  2P31 A;  3CSI A;  1XVQ A;  3PGT A;  5C00 A;  1G7E A;  2YWI A;  1QK8 A;  3TKP A;  3W8J A;  2XBI A;  4J2F A;  4F82 A;  5KEJ A;  2H1A A;  1WWJ A;  3D0Z A;  3HJP A;  1SEN A;  5E59 A;  2LNT A;  1WRY A;  2HSH A;  1X5C A;  4Q5R A;  5B6N A;  1GSY A;  4MP4 A;  1V98 A;  3KP9 A;  4G9H A;  3QDN A;  4IP1 A;  2H1D A;  4HU9 A;  8GSS A;  2CZ2 A;  1GUK A;  1SYR A;  2YP6 A;  2LS5 A;  1SKR B;  2VCX A;  2GZY A;  4H86 A;  5J9B A;  4EUY A;  2FWH A;  3ED3 A;  4NMU A;  1ML6 A;  3HYP A;  3RPP A;  2X8G A;  1DE1 A;  5FWG A;  5J3R A;  3M1G A;  4XIH A;  4FYC A;  5B8A A;  4JBB A;  4D73 A;  1MDI A;  2H73 A;  1MD4 A;  5B6M A;  1Z9H A;  2KLX A;  16GS A;  4WF4 A;  2PVQ A;  1GSF A;  2C3N A;  3HHV A;  4IJI A;  1R26 A;  4EXJ A;  2PER A;  2OBI A;  1S3A A;  4MH3 A;  1PN9 A;  1OC9 B;  1GUH A;  2VD0 A;  4EF0 A;  2GTU A;  1F6M C;  4OO4 A;  2GGT A;  2VIM A;  3H79 A;  2CV4 A;  2K18 A;  5D8I A;  2YNX A;  2N5B A;  4KDX A;  3Q6O A;  4NV2 A;  5JCW A;  1K0A A;  3QAG A;  1UVZ A;  4ZB9 A;  3FZ9 A;  4DEJ A;  3CRT A;  1NM3 A;  2JSY A;  1XWB A;  2GSS A;  3VPQ A;  4P3Y B;  1JLV A;  1GTU A;  3CSH A;  1V58 A;  2LUS A;  5G1L A;  3D4T A;  2HRN A;  3GL5 A;  1ZOF A;  4O92 A;  2VCT A;  4ECC A;  5G5E A;  4G10 A;  1M2D A;  5LNK e;  1XW6 A;  4LA1 A;  4MJC A;  1SYX A;  4F2I A;  4IQA A;  3QPM A;  4L8E A;  2HZF A;  5J41 A;  2EC4 A;  1Z6M A;  2WJU A;  4PX1 A;  4BWS A;  1PKW A;  1ZYE A;  5ECS A;  4L5O A;  2RUE A;  4V1A g;  1DBY A;  2QKE A;  2FLS A;  1I5G A;  2EIO A;  1ZYQ B;  2R5G A;  4GRF A;  3FYG A;  4N0Z A;  4GST A;  1XPV A;  3TKQ A;  6GSV A;  2GSQ A;  2DBC A;  3LEF A;  1WIK A;  1XWA A;  2YJ7 A;  2ZCT A;  2P5R A;  5ABR A;  3BOA A;  3W6G A;  3ZTL A;  4TR3 A;  5J9C A;  5HR3 A;  2IIY A;  5KN2 A;  3ZYW A;  3LFL A;  3O6T A;  2YV9 A;  5ENU A;  2PN8 A;  4FIW A;  3TOU A;  3R2Q A;  3IBH A;  2AUV A;  4ZL9 A;  1GSD A;  2FWE A;  5G5F A;  4GCI A;  5LD0 A;  3GV1 A;  1SL1 B;  2JZR A;  4OMV A;  5J4U A;  1PA3 A;  1SU9 A;  1K3O A;  2GT5 A;  4AF2 A;  1XOB A;  3FZA A;  1GL8 A;  4OO5 A;  2H66 A;  3A3T A;  3RHC A;  4TKY A;  2R2J A;  1K0D A;  4BWQ A;  5AIX A;  4G2E A;  4PUF C;  1EV9 A;  4AJ8 A;  2GST A;  3A2X A;  2LJA A;  1OC3 A;  1HNB A;  3WD6 A;  3TCO A;  1O7U A;  2HI7 A;  3FHK A;  3MNG A;  5CRH A;  5IO2 A;  3D5J A;  1EP8 A;  3CTG A;  2X64 A;  2JZT A;  2H30 A;  2M46 A;  3C71 A;  3WYW A;  4DSR A;  2DJK A;  1MDJ A;  6GST A;  3EMX A;  4LL4 B;  3IPZ A;  5B7C A;  4ML6 A;  4OFN A;  2OE1 A;  3HVV A;  4CDO A;  4MMM A;  4KGI A;  1J9B A;  5J5N A;  5AIS A;  3ISO A;  4ISD A;  4K6X A;  2DC5 A;  4KSO A;  1TRW A;  1KTE A;  2EIR A;  5DQY A;  1TRV A;  2V1M A;  3NIV A;  4PQI A;  4GQC A;  4HJM A;  2E0Q A;  4OCE A;  1V40 A;  2H0G A;  4OFM A;  4YAP A;  2H74 A;  5AN1 A;  2YWO A;  1GTI A;  3TOT A;  3N9J A;  3C7M A;  3GL3 A;  3EIN A;  2X8H A;  2GZZ A;  2TRX A;  1VF2 A;  3IE3 A;  1B8X A;  1K0N A;  5DAK A;  3C8E A;  4POK A;  5G30 A;  1K3L A;  1YJ6 A;  2VCW A;  2H76 A;  3VWV A;  2FWG A;  4JRR A;  2L59 A;  2V6K A;  1VF3 A;  5DQS A;  4F03 A;  1FVK A;  2LRC A;  5KN0 A;  1AUC A;  2IFQ A;  2H1G A;  2VCZ A;  3I43 A;  1EOG A;  2LV3 A;  3TB2 A;  5HFG A;  4MPF A;  2B7J A;  1AXD A;  3M0F A;  4XRD A;  2VCQ A;  5CAX A;  5CRD A;  3KTL A;  2P0G A;  1NHY A;  3EU3 A;  2IFQ B;  4PXO A;  3C1R A;  2B3S A;  5H5Q A;  4EDZ A;  1T7P B;  3VK9 A;  1Y6E A;  4MJE A;  1GTA A;  1URM A;  1TJD A;  3ZIJ A;  1SK2 A;  5EL8 A;  4IW9 A;  3KEB A;  4TRX A;  5D96 A;  4OD7 A;  2DJJ A;  2R4V A;  3DIE A;  4I2T A;  1BX9 A;  1T4Z A;  5DCG A;  4N10 A;  6GSU A;  3TUE A;  3H93 A;  2HFD A;  1PGT A;  3IK9 A;  5IMZ A;  4N11 A;  1GP1 A;  2H01 A;  1KEB A;  2AB6 A;  3RHB A;  3L4N A;  4K1F A;  4K7N A;  5IOX A;  2GZP A;  3F4T A;  4KCE A;  1GSE A;  4PQH A;  2B5X A;  3L0H A;  2PUK C;  2VLT A;  5INY A;  3A5W A;  1U88 A;  4FH8 A;  4PQ1 A;  1FAA A;  3TKS E;  3GUS A;  4HS1 A;  4JU5 A;  5IM9 A;  3G7I A;  1GLQ A;  3ME7 A;  2G2Q A;  3UAR A;  4JR6 A;  5HFK A;  3GA4 A;  1EEJ A;  1E6B A;  1OKD A;  3LSZ A;  4NAX A;  1EEM A;  2XC2 A;  2R6K A;  4PUR A;  3F63 A;  1DUG A;  1OAZ A;  2DLX A;  4TOP A;  2OAD A;  1VF1 A;  2HLS A;  2LKU A;  3U6V A;  2LTK A;  4IVF A;  1SK1 A;  3VFI A;  2VCV A;  3A2W A;  2K8S A;  3ZL5 A;  3ZZX A;  3KD0 A;  4MH2 A;  1X5D A;  1A0R P;  1EGR A;  2FCH A;  1PKZ A;  2M80 A;  3GNJ A;  4L0U A;  1HD2 A;  3AY8 A;  4I2U A;  2VL2 A;  4WBJ A;  3JCM L;  2TIR A;  5ID2 B;  3CMI A;  1EGO A;  2PGT A;  2DJ2 A;  3WGD A;  1OC8 A;  5D9V A;  3E3E A;  3D6I A;  4XTS A;  3UJ1 A;  1GSS A;  2FA8 A;  4RQX A;  5JCG A;  1FVJ A;  1TP9 A;  1Z7P A;  4IHU A;  3VWX A;  4OWY A;  1M9B A;  4ACS A;  2I81 A;  3EE2 A;  2YAN A;  2MBS A;  1J08 A;  2YWN A;  1YQ1 A;  1SK0 A;  4V2N A;  1FB6 A;  2VLV A;  3TJF A;  6GSW A;  4EL1 A;  1PRX A;  2RII A;  5GZZ B;  3DD3 A;  1MDK A;  1JLW A;  3ZRE A;  1TTZ A;  2J9H A;  4GWR A;  4KAE A;  3Q74 A;  2VOC A;  1A24 A;  5CO3 A;  2HNL A;  4Q5Q A;  5GAP D;  2OA7 A;  1TKD B;  1RQM A;  5DBQ A;  2G0F A;  4FO5 A;  1N8J A;  1GWC A;  4EKZ A;  4J57 E;  4GXZ A;  4JE1 A;  1EV4 A;  3EC3 A;  2VAF A;  4Q5F A;  2FGX A;  3VPT A;  4L5L A;  4ZBA A;  3FEU A;  4F9Z A;  2OKA A;  1F37 A;  3GYK A;  1XCC A;  1XW9 A;  2LJK A;  1Q4J A;  3TJK A;  4XS1 A;  4DSS B;  4JED A;  3FRC A;  2H6Z A;  5IQY A;  4WBR D;  4QL7 A;  4BA7 A;  3FY7 A;  1YF1 A;  2WCI A;  1M2A A;  1OC9 A;  1M2B A;  3ERF A;  2VM1 A;  1G6Y A;  3BCI A;  14GS A;  2IMK A;  4ILF A;  4V2L A;  1U3A A;  4NHZ A;  2ALB A;  3GIX A;  1YY7 A;  5ECR B;  1XVW A;  4PNG A;  2IJY A;  2PPT A;  1TK8 B;  4NV5 A;  3GTU B;  5F07 A;  2O85 A;  3ZVJ A;  1R5P A;  2OE3 A;  6GSS A;  5AGY A;  4TW5 A;  5D9X A;  3CRU A;  3QMX A;  2MZC A;  4E8H A;  1EZK A;  3D22 A;  3LQ7 A;  1T4Y A;  1YZX A;  2DMM A;  3TKR A;  4EDY A;  4AGS A;  3WGX A;  4IGJ A;  2BTO T;  2H70 A;  3HY2 A;  2H6Y A;  9GSS A;  1O81 A;  2WDU A;  3PH9 A;  2FHE A;  4MCU A;  4LMV A;  1VF4 A;  3GX8 A;  4KW6 A;  4KB3 A;  4BL7 A;  3ZLP A;  4KND A;  3EWL A;  4NXI A;  3P90 A;  4EVM A;  4TR4 A;  4EE0 A;  4HZ2 A;  1GUM A;  2LST A;  2E7P A;  1Z6N A;  1X0R A;  5FHI A;  3IHQ A;  2FWF A;  4IKH A;  1R7H A;  4TR0 A;  2JSZ A;  4QL9 A;  1B9X C;  3HDC A;  3TDG A;  4GF0 A;  1FB0 A;  5ELA A;  4ULX A;  1Z5Y E;  2OAC A;  3H4K A;  4ZB6 A;  2P5Q A;  2YCD A;  5A5K A;  1QFN A;  1YKA A;  3DVW A;  5IMV A;  2F8F A;  4K7O A;  4KA0 A;  2C0G A;  1AW9 A;  2BJX A;  2V41 A;  1X9S B;  2H72 A;  1ST9 A;  1X5E A;  4MDC A;  3VI5 A;  2L5O A;  4EO3 A;  1QUW A;  2CAQ A;  3CTF A;  4HEA 2;  3TJB A;  1BYE A;  5D9W A;  3F4R A;  3FR9 A;  4MJA A;  2CT6 A;  3VWU A;  3TRP A;  1AQV A;  1F9M A;  4MAB A;  3M3M A;  1S3D A;  1IYI A;  1SD8 A;  3L9V A;  3MAK A;  2R37 A;  2YZH A;  1LJR A;  3LOR A;  3MSZ A;  2VL3 A;  1TRS A;  4KSM A;  3WGE A;  5ECN B;  3M9J A;  2WFC A;  1WOU A;  2VLU A;  3E0U A;  3HZ4 A;  1C72 A;  3VLN A;  5IO0 A;  5ELG A;  4TN8 A;  3DXB A;  12GS A;  4N0V A;  4TXO B;  3UL3 A;  3QAW A;  1HYU A;  4WXT A;  4POM A;  2D2Z A;  1OYJ A;  5ECQ B;  4CW9 A;  1TRU A;  4PNF A;  2PMT A;  2JL4 A;  2REM A;  3IC4 A;  3DML A;  2FUG 2;  2MYG A;  5ECP B;  5G31 A;  3UOM A;  3L78 A;  4ML1 A;  3S9F A;  1ZL9 A;  2GVP A;  1SL2 B;  3WT1 A;  4BPY A;  3EVI A;  1AAZ A;  1EWX A;  1PX7 A;  4ZB8 A;  2HYX A;  5GAN D;  4KCA A;  2LNS A;  1HQO A;  4I6X A;  3TGZ A;  3TKS C;  2YJH A;  1CQG A;  1YF0 A;  7GSS A;  5CRG A;  1ILO A;  1GRX A;  1E2Y A;  2L57 A;  5IOW A;  4HQZ A;  3BBY A;  5JCU A;  5B8B A;  4JR4 A;  1T1V A;  2RM5 A;  5ECL B;  3F3R A;  2HZE A;  2WS2 A;  4KUN A;  4FYB A;  2WZ9 A;  5IIZ A;  2HZE B;  1ABA A;  3MWH A;  4HDE A;  3UBL A;  1Z7R A;  4TR1 A;  1JHB A;  5ECH B;  3CXG A;  1GUL A;  3F3Q A;  2O7K A;  1B48 A;  3IOS A;  2DIZ A;  4TR1 B;  1GTB A;  4HI7 A;  3LXZ A;  1YEP A;  5G2Z A;  1T00 A;  3G7Y A;  5CP1 A;  2HSY A;  1OE7 A;  2AV4 A;  2Z9S A;  4KE3 A;  4ZIL A;  5COH A;  22GS A;  3IV4 A;  2V2G A;  4I97 A;  4WR5 A;  3Q19 A;  2I1U A;  1G6W A;  1R4W A;  2HRF A;  3EUR A;  3FW2 A;  2B1L A;  3FKF A;  3DYR A;  3GHA A;  3QOU A;  11GS A;  1EP7 A;  4XRA A;  1SJ6 A;  5ECI B;  2KP2 A;  5JWQ B;  2ON7 A;  2B7K A;  1XW5 A;  3GKN A;  4GTU A;  4LL1 B;  3TJJ A;  2B5E A;  1WP0 A;  3DEX A;  2K6V A;  3LG6 A;  3APO A;  4F0C A;  4K0G A;  1ZGN A;  3G7J A;  2C80 A;  3KCM A;  5DVB A;  19GS A;  2AHE A;  4K9Z A;  5H5S A;  1JZR A;  4GLT A;  5L71 A;  4GSS A;  4YQM A;  4MA9 A;  1FHE A;  1XWK A;  4IP6 A;  2CVK A;  2KUC A;  2TRC P;  3HJO A;  3J7Y k;  4NHW A;  2H6X A;  1RK4 A;  2XBQ A;  3KZQ A;  2DJ0 A;  4IJ3 A;  2F51 A;  3QCP A;  4KH7 A;  2FA4 A;  1SL0 B;  1M9A A;  4ZIJ A;  2BMX A;  3ZRD A;  1G7O A;  2O8V B;  2F8A A;  1OVN A;  2GDR A;  4V2M A;  3LXT A;  1Y25 A;  1WE0 A;  3HCZ A;  1MD3 A;  5ID2 A;  2H19 A;  4HQS A;  1M0U A;  1B4P A;  5IMA A;  5DCH A;  13GS A;  2DSA A;  3RBT A;  1QXH A;  5A4W A;  3LGC A;  4O5R A;  4V1A p;  1VRS D;  3F6D A;  4TVE A;  3TRQ A;  3DVX A;  1U6T A;  2JU5 A;  3KH7 A;  3P2A A;  1PL2 A;  2FY6 A;  3A2V A;  1X9M B;  4HOJ A;  4YAV A;  1A2L A;  1ERT A;  1EOH A;  3ZMK A;  2YPM A;  1QGV A;  4I8B A;  5IPG A;  3V1W A;  4X0X A;  5IPH A;  1TK5 B;  4WF5 A;  3LYK A;  2QC7 A;  1U3I A;  1PX6 A;  2C3Q A;  4X43 A;  3GST A;  3J7Y b;  4K8M A;  5FT3 A;  3HD5 A;  3RDW A;  1FW1 A;  3HZ8 A;  4MLY A;  5LCZ A;  2AYT A;  1AIU A;  2IWT A;  1USB A;  3HKR A;  1ERU A;  5DDL A;  1A23 A;  1XIY A;  2YOI A;  2F3M A;  3UEM A;  2H75 A;  1SKW B;  2KP1 A;  1AC1 A;  5EVO A;  2GQL A;  3GN3 A;  3IXR A;  2VL2 C;  2L5L A;  1H4O A;  4PGT A;  4WEY A;  1PD2 1;  1UA5 A;  2WB9 A;  3GSS A;  4XHM A;  1ERV A;  1TI1 A;  3D4M A;  2PU9 C;  2CVD A;  5CYY A;  2LRN A;  1N2A A;  2V6O A;  4ID0 A;  2L4Q A;  1F2E A;  2A2R A;  3IAS 2;  4FYU A;  1FG4 A;  4DSS A;  4KX4 A;  4ECI A;  1O73 A;  1MEK A;  1GSQ A;  1LU4 A;  10GS A;  1NW2 A;  1YEX A;  2LJR A;  4KDU A;  2IN3 A;  5ECK B;  5CNW A;  2OJL A;  1Q98 A;  1TI3 A;  2B6M A;  3KGK A;  3BJ5 A;  2V32 A;  2B1K A;  3HJM A;  2C0E A;  2HT9 A;  3FR3 A;  3UVT A;  1LBK A;  3Q18 A;  4TXV A;  3DRN A;  1TU7 A;  5GST A;  3VUR A;  1XZO A;  2ES7 A;  2L6C A;  3CBU A;  5DAL A;  3LYP A;  3GTU A;  1XOA A;  2L4C A;  1A2J A;  6GSX A;  2LRT A;  4MJB A;  1XXU A;  4GQF A;  2YWM A;  5ECM B;  2L6D A;  3H8Q A;  4D73 B;  4XS6 A;  5E4W A;  5DAL B;  4AJ7 A;  1IYH A;  2DML A;  3GX0 A;  3LWA A;  5HFI A;  1K0B A;  3MDK A;  1GSU A;  2CA8 A;  2I4A A;  3BCK A;  1DE2 A;  4RUV A;  3KMO A;  1V57 A;  3F6F A;  3ZFL A;  2X8C A;  1DSB A;  2FD3 A;  5G1K A;  3H1N A;  2H71 A;  5HQP A;  2AJQ B;  3ZIV A;  2PBJ A;  2R3X A;  3DWV A;  1BJX A;  3KP8 A;  2HE3 A;  1TW9 A;  1OE8 A;  1ACV A;  3C73 A;  2YZU A;  1SJZ A;  4OFT A;  1GLP A;  2RUF A;  2N5A A;  2RLI A;  2LEG A;  4OCF A;  2DJ1 A;  3UAP A;  2C8U A;  3KJY A;  4Z7X A;  4XCS A;  1KBN A;  4WKW A;  2JAC A;  3M9K A;  3EYT A;  4NWY A;  1R5A A;  5F06 A;  5IMC A;  2X99 A;  4LLR A;  4KDY A;  2IMI A;  3HXS A;  2E2G A;  3EU4 A;  2CQ9 A;  3I6A A;  2IME A;  1HNA A;  4MZB A;  1JFU A;  1TU8 A;  5D93 A;  2DIY A;  1NSW A;  5F0G A;  2GT6 A;  2C0F A;  2VL9 A;  2CZ3 A;  2XPE A;  3L9S A;  4L0W A;  2MMA A;  1A0F A;  4G19 A;  1O85 A;  5A4V A;  2M72 A;  2IL3 A;  2LQQ A;  20GS A;  1K0M A;  3IK7 A;  3EMP A;  3GFK A;  5DJM A;  3NZN A;  5KN3 A;  4IEL A;  3RAZ A;  3IDV A;  2MMN A;  1B4Q A;  4IBP A;  1F3A A;  4RI6 A;  4ZBD A;  1M7T A;  1TXX A;  5HR1 A;  5JWO B;  2E2M A;  1W4V A;  4WET A;  4IS0 A;  2JZS A;  2NBS A;  2AAW A;  3F0I A;  3GH9 A;  2YN1 A;  1M99 A;  4HU7 A;  1ERW A;  3L9U A;  3US3 A;  4MF5 A;  1QMV A;  2CX3 A;  1THO A;  1PSQ A;  2YV7 A;  4TXO A;  3RPN A;  5C04 A;  1SKS B;  1O8X A;  2EIQ A;  4BVX A;  1SJI A;  3NOF A;  4ZBB A;  3HA9 A;  4J56 E;  4MZW A;  3DKS A;  3TKS A;  4MF7 A;  5KN1 A;  3UIW A;  4MF6 A;  1YKC A;  5GSS A;  2H0I A;  4HJ2 A;  2KOK A;  4YQV A;  1WJK A;  1U87 A;  1I9D A;  1FO5 A;  2GLR A;  1X9W B;  3C1S A;  3QAV A;  2KHP A;  2QSI A;  1Z3E A;  4K7I A;  2A2S A;  2C0D A;  5D9T A;  5ECO B;  1BED A;  1XWC A;  4HZ4 A;  3FZ4 A;  2NPB A;  4N30 A;  2MMZ A;  4YH2 A;  3KIJ A;  1J0F A;  1T3B A;  3UVH A;  2PWJ A;  1CQH A;  1SD9 A;  5F8B A;  1JZO A;  2ZNM A;  4XS4 A;  2DJ3 A;  3ZML A;  3LJR A;  3G9B A;  3GMF A;  1AQX A;  3UMA A;  3ZIT A;  1W89 A;  1A8Y A;  3KTB A;  1K3Y A;  4XS4 B;  3QFB C;  1XFL A;  3I69 A;  3GKK A;  1BAY A;  1K0C A;  4NPB A;  2GQK A;  3ERW A;  3ERG A;  1UN2 A;  3IRA A;  1UC7 A;  1RW1 A;  1K0O A;  2RM6 A;  4ZXG A;  5F05 A;  2OE0 A;  4BVY A;  2VUP A;  2B5Y A;  4ECJ A;  1GH2 A;  3APS A;  3F8U A;  2WUL A;  4GSN A;  5DAK B;  3HVX A;  3VI7 A;  2C1Y A;  5HR2 A;  4K0N A;  1GNE A;  1T8E B;  3N5O A;  3HVS A;  5HR0 A;  3GH6 A;  1MTC A;  4IQ1 A;  4X1U A;  4K2D A;  3ZVJ D;  2GS3 A;  5CRE A;  3CYN A;  2GSR A;  4I5Q A;  2VO4 A;  1OKT A;  4JZQ A;  2PVO C;  4F0B A; 
#chains in the Genus database with same CATH topology
 17GS A;  3K8N A;  2C3T A;  4POB A;  3I9V 2;  4ECB A;  4IN0 A;  5IMF A;  3TJG A;  4AJ6 A;  1WMJ A;  2IMF A;  3IA1 A;  2O87 A;  1ON4 A;  3KM6 A;  2K9F A;  2O89 A;  2CAI A;  5IMD A;  1KNG A;  2F9S A;  1BQ7 A;  3P7X A;  2XPD A;  3FK8 A;  4LMW A;  1TK0 B;  2HXK A;  2LQO A;  5AIV A;  2H1B A;  1V9W A;  3APQ A;  3P8W A;  3UBK A;  3W8S A;  3O76 A;  2H8L A;  3MIX A;  1B9Y C;  2C4J A;  1XWG A;  5DJL A;  1PQN A;  4PUA A;  1XBS A;  4CHS A;  1GNW A;  3IAM 2;  1G0T A;  1HNC A;  2NTO A;  2I3Y A;  3GRX A;  3KXO A;  1BG5 A;  3SWL A;  3F9U A;  4O32 A;  2NDO A;  3FR6 A;  3GUR A;  2J23 A;  3MYD A;  1FOH A;  1V2A A;  1PMT A;  5EPF A;  2ZUP A;  4YQU A;  2ON5 A;  2H0H A;  1YDK A;  1O8W A;  2XHF A;  3KMN A;  6GSY A;  3U5R E;  3QD9 A;  2VM2 A;  2OBK A;  2IMD A;  3FZ5 A;  1WPI A;  2CVB A;  4EC0 A;  3PIN A;  1ZMA A;  1ZCP A;  3OR5 A;  4RI7 A;  4RQR A;  2MMO A;  3GKX A;  1NHO A;  4ZL8 A;  3E9J B;  4MPG A;  1TDI A;  3F4S A;  1JZW A;  1ZYP A;  2IPA A;  1QQ2 A;  2I9H A;  3CSJ A;  1A8L A;  2A2P A;  4MK3 A;  1O6J A;  3ZFB A;  1S3C A;  3KH9 A;  2GQM A;  18GS A;  5D73 A;  2QGV A;  3WT2 A;  3SBC A;  3IR4 A;  2WGR A;  3EPT A;  1A2M A;  4DVC A;  2WRT A;  5CRW A;  1AQW A;  5EY6 A;  5A4U A;  4Q5N A;  4HUA A;  3BD2 A;  2N5F A;  4WR4 A;  3QFA C;  3QR6 A;  1H75 A;  2MBT A;  5H5R A;  3DGQ A;  4O7H A;  1THX A;  4MZC A;  2NVL A;  3VWW A;  3PR8 A;  3D21 A;  2CX4 A;  4ZL7 A;  2K8V A;  4POL A;  3M8N A;  5JWR B;  3ME8 A;  1F3B A;  2VD1 A;  1FOV A;  3TRX A;  1TOF A;  1ZZY A;  4DSQ A;  3O3T A;  4E8E A;  2FNO A;  2A4V A;  3GKM A;  2JAD A;  4QQ7 A;  1VGL A;  1JZD A;  1PL1 A;  2P31 A;  3CSI A;  1XVQ A;  3PGT A;  5C00 A;  1G7E A;  2YWI A;  1QK8 A;  3TKP A;  3W8J A;  2XBI A;  4J2F A;  4F82 A;  5KEJ A;  2H1A A;  1WWJ A;  3D0Z A;  3HJP A;  1SEN A;  5E59 A;  2LNT A;  1WRY A;  2HSH A;  1X5C A;  4Q5R A;  5B6N A;  1GSY A;  4MP4 A;  1V98 A;  3KP9 A;  4G9H A;  3QDN A;  4IP1 A;  2H1D A;  4HU9 A;  8GSS A;  2CZ2 A;  1GUK A;  1SYR A;  2R0P A;  2YP6 A;  2LS5 A;  1SKR B;  2VCX A;  2GZY A;  4H86 A;  5J9B A;  4EUY A;  2FWH A;  3ED3 A;  4NMU A;  1ML6 A;  3HYP A;  3RPP A;  2X8G A;  1DE1 A;  5FWG A;  5J3R A;  3M1G A;  4XIH A;  4FYC A;  5B8A A;  4JBB A;  4D73 A;  1MDI A;  2H73 A;  1MD4 A;  5B6M A;  4KF9 A;  1Z9H A;  2KLX A;  16GS A;  4WF4 A;  2PVQ A;  1GSF A;  2C3N A;  3HHV A;  4IJI A;  1R26 A;  4EXJ A;  2PER A;  2OBI A;  1S3A A;  4MH3 A;  1PN9 A;  1OC9 B;  1GUH A;  2HSM A;  2VD0 A;  4EF0 A;  3HVN A;  2GTU A;  1F6M C;  4OO4 A;  2GGT A;  2VIM A;  3H79 A;  2CV4 A;  2K18 A;  5D8I A;  2YNX A;  2N5B A;  4KDX A;  3Q6O A;  3R3E A;  4NV2 A;  5JCW A;  1K0A A;  2QA2 A;  3QAG A;  1UVZ A;  4ZB9 A;  3FZ9 A;  4DEJ A;  3CRT A;  1NM3 A;  1PFO A;  2JSY A;  1XWB A;  2GSS A;  3VPQ A;  4P3Y B;  1JLV A;  1GTU A;  3CSH A;  1V58 A;  2LUS A;  5G1L A;  3D4T A;  2HRN A;  3GL5 A;  1ZOF A;  4O92 A;  2VCT A;  4ECC A;  5G5E A;  4G10 A;  1M2D A;  5LNK e;  1XW6 A;  4LA1 A;  4MJC A;  1SYX A;  4F2I A;  4IQA A;  3QPM A;  4L8E A;  2HZF A;  5J41 A;  2EC4 A;  5KOW A;  1Z6M A;  2WJU A;  4BL7 B;  4PX1 A;  4BWS A;  1PKW A;  1ZYE A;  5ECS A;  4L5O A;  2RUE A;  4V1A g;  1DBY A;  2QKE A;  2FLS A;  1I5G A;  2EIO A;  1ZYQ B;  2R5G A;  4GRF A;  3FYG A;  4N0Z A;  4GST A;  1XPV A;  3TKQ A;  6GSV A;  2GSQ A;  2DBC A;  3LEF A;  1WIK A;  1XWA A;  2YJ7 A;  2ZCT A;  2P5R A;  5ABR A;  3BOA A;  3W6G A;  5KOX A;  3ZTL A;  4TR3 A;  5J9C A;  2QA1 A;  5HR3 A;  2IIY A;  5KN2 A;  3ZYW A;  4ICY A;  3LFL A;  3O6T A;  2YV9 A;  5ENU A;  2PN8 A;  4FIW A;  3TOU A;  3R2Q A;  3IBH A;  2AUV A;  4ZL9 A;  1GSD A;  2FWE A;  5G5F A;  4GCI A;  5LD0 A;  3GV1 A;  1SL1 B;  2JZR A;  4OMV A;  5J4U A;  1PA3 A;  1SU9 A;  1K3O A;  2GT5 A;  4AF2 A;  1XOB A;  3FZA A;  1GL8 A;  4OO5 A;  2H66 A;  3A3T A;  3RHC A;  4TKY A;  2R2J A;  1K0D A;  4BWQ A;  5AIX A;  4G2E A;  4PUF C;  1EV9 A;  4AJ8 A;  2GST A;  3A2X A;  2LJA A;  1OC3 A;  1HNB A;  3WD6 A;  3TCO A;  1O7U A;  2HI7 A;  3FHK A;  3MNG A;  5CRH A;  5IO2 A;  3D5J A;  1EP8 A;  3CTG A;  2X64 A;  2JZT A;  2H30 A;  2M46 A;  3C71 A;  3WYW A;  4DSR A;  2DJK A;  1MDJ A;  6GST A;  3EMX A;  4LL4 B;  3IPZ A;  5B7C A;  4ML6 A;  4OFN A;  2OE1 A;  3HVV A;  4CDO A;  4MMM A;  4BIK A;  4KGI A;  1J9B A;  5J5N A;  5AIS A;  3ISO A;  4ISD A;  4K6X A;  2DC5 A;  4KSO A;  1TRW A;  1KTE A;  2EIR A;  5DQY A;  1TRV A;  2V1M A;  3NIV A;  4PQI A;  4GQC A;  4HJM A;  2E0Q A;  4OCE A;  1V40 A;  2H0G A;  4OFM A;  4YAP A;  2H74 A;  5AN1 A;  2YWO A;  1GTI A;  3TOT A;  3N9J A;  3C7M A;  3GL3 A;  3EIN A;  2X8H A;  2GZZ A;  2TRX A;  1VF2 A;  3IE3 A;  1B8X A;  1K0N A;  5DAK A;  3C8E A;  4POK A;  5G30 A;  1K3L A;  1YJ6 A;  2VCW A;  2H76 A;  3VWV A;  2FWG A;  4JRR A;  2L59 A;  2V6K A;  1VF3 A;  5DQS A;  4F03 A;  1FVK A;  2LRC A;  1M3I A;  5KN0 A;  1AUC A;  2IFQ A;  2H1G A;  2VCZ A;  3I43 A;  1EOG A;  2LV3 A;  2UZ8 A;  3TB2 A;  5HFG A;  4MPF A;  2B7J A;  1AXD A;  3M0F A;  4XRD A;  2VCQ A;  5CAX A;  5CRD A;  3KTL A;  2P0G A;  1NHY A;  3EU3 A;  2IFQ B;  4PXO A;  3C1R A;  2B3S A;  5H5Q A;  4EDZ A;  1T7P B;  3VK9 A;  1Y6E A;  4MJE A;  1GTA A;  1URM A;  1TJD A;  1S3R A;  3ZIJ A;  1SK2 A;  5EL8 A;  4IW9 A;  3KEB A;  4TRX A;  5D96 A;  4OD7 A;  2DJJ A;  2R4V A;  3DIE A;  4I2T A;  1BX9 A;  1T4Z A;  5DCG A;  4N10 A;  6GSU A;  3TUE A;  3H93 A;  2HFD A;  4HSC X;  1PGT A;  3IK9 A;  5IMZ A;  4N11 A;  1GP1 A;  2H01 A;  1KEB A;  2AB6 A;  3FMW A;  3RHB A;  3L4N A;  4K1F A;  4K7N A;  5IOX A;  2GZP A;  3CQF A;  3F4T A;  4KCE A;  1GSE A;  4PQH A;  2B5X A;  3L0H A;  2PUK C;  2VLT A;  5INY A;  3A5W A;  1U88 A;  4FH8 A;  4PQ1 A;  1FAA A;  3TKS E;  3GUS A;  4HS1 A;  4JU5 A;  5IM9 A;  3G7I A;  1GLQ A;  3ME7 A;  2G2Q A;  3UAR A;  4JR6 A;  5HFK A;  3GA4 A;  1M3J A;  1EEJ A;  1E6B A;  1OKD A;  3LSZ A;  4NAX A;  1EEM A;  2XC2 A;  2R6K A;  4PUR A;  3F63 A;  1DUG A;  1OAZ A;  2DLX A;  4TOP A;  2OAD A;  1VF1 A;  2HLS A;  2LKU A;  3U6V A;  2LTK A;  4IVF A;  1SK1 A;  3VFI A;  2VCV A;  3LW9 A;  3A2W A;  2K8S A;  3ZL5 A;  3ZZX A;  3KD0 A;  2R0C A;  4MH2 A;  1X5D A;  1A0R P;  1EGR A;  2FCH A;  1PKZ A;  2M80 A;  3GNJ A;  4L0U A;  1HD2 A;  3AY8 A;  4I2U A;  2VL2 A;  4WBJ A;  3JCM L;  2TIR A;  5ID2 B;  3CMI A;  1EGO A;  2PGT A;  4K5S A;  2DJ2 A;  3WGD A;  1OC8 A;  5D9V A;  3E3E A;  3D6I A;  4XTS A;  3UJ1 A;  1GSS A;  2FA8 A;  4RQX A;  5JCG A;  1FVJ A;  1TP9 A;  1Z7P A;  4IHU A;  3VWX A;  4OWY A;  1M9B A;  4ACS A;  2I81 A;  3EE2 A;  2YAN A;  2MBS A;  1J08 A;  2YWN A;  1YQ1 A;  1SK0 A;  4V2N A;  1FB6 A;  2VLV A;  3TJF A;  6GSW A;  4EL1 A;  1PRX A;  2RII A;  5GZZ B;  3DD3 A;  1MDK A;  1JLW A;  3ZRE A;  1TTZ A;  2J9H A;  4GWR A;  4KAE A;  3Q74 A;  2VOC A;  1A24 A;  4Z2R A;  5CO3 A;  2HNL A;  4USS A;  4Q5Q A;  5GAP D;  2OA7 A;  1TKD B;  1RQM A;  5DBQ A;  2G0F A;  4FO5 A;  1N8J A;  1GWC A;  4EKZ A;  4J57 E;  4GXZ A;  4JE1 A;  1EV4 A;  3EC3 A;  2VAF A;  4Q5F A;  2FGX A;  3VPT A;  4L5L A;  4ZBA A;  3FEU A;  4F9Z A;  2OKA A;  1F37 A;  3GYK A;  1XCC A;  1XW9 A;  2LJK A;  2X49 A;  1Q4J A;  3TJK A;  4XS1 A;  4DSS B;  4JED A;  3FRC A;  2H6Z A;  5IQY A;  4WBR D;  4QL7 A;  4BA7 A;  3FY7 A;  1YF1 A;  2WCI A;  1M2A A;  1OC9 A;  1M2B A;  3ERF A;  2VM1 A;  1G6Y A;  3BCI A;  14GS A;  2IMK A;  4ILF A;  4V2L A;  1U3A A;  4NHZ A;  2ALB A;  3GIX A;  1YY7 A;  5ECR B;  1XVW A;  4PNG A;  2IJY A;  2PPT A;  1TK8 B;  4NV5 A;  3GTU B;  5F07 A;  2O85 A;  3ZVJ A;  1R5P A;  2OE3 A;  6GSS A;  5AGY A;  4TW5 A;  5D9X A;  3CRU A;  3QMX A;  2MZC A;  4E8H A;  1EZK A;  3D22 A;  3LQ7 A;  1T4Y A;  1YZX A;  2DMM A;  3TKR A;  4EDY A;  4AGS A;  3WGX A;  4IGJ A;  2BTO T;  2H70 A;  3HY2 A;  2H6Y A;  9GSS A;  1O81 A;  2WDU A;  3PH9 A;  2FHE A;  4MCU A;  4LMV A;  1VF4 A;  3GX8 A;  4KW6 A;  4KB3 A;  4BL7 A;  3ZLP A;  4KND A;  3EWL A;  4NXI A;  3P90 A;  4EVM A;  4TR4 A;  4EE0 A;  4HZ2 A;  1GUM A;  2LST A;  2E7P A;  1Z6N A;  1X0R A;  5FHI A;  3IHQ A;  2FWF A;  4IKH A;  1R7H A;  4TR0 A;  4G0K A;  2JSZ A;  4QL9 A;  1B9X C;  3HDC A;  3TDG A;  2DKH A;  4GF0 A;  1FB0 A;  5ELA A;  4ULX A;  1Z5Y E;  2OAC A;  3H4K A;  4ZB6 A;  2P5Q A;  2YCD A;  5A5K A;  1QFN A;  1YKA A;  3DVW A;  5IMV A;  2F8F A;  4K7O A;  4KA0 A;  2C0G A;  1AW9 A;  2BJX A;  5BMU A;  2V41 A;  1X9S B;  2H72 A;  1ST9 A;  1X5E A;  4MDC A;  3VI5 A;  2L5O A;  4EO3 A;  1QUW A;  2CAQ A;  3CTF A;  4HEA 2;  3TJB A;  1BYE A;  5D9W A;  3F4R A;  3FR9 A;  4MJA A;  2CT6 A;  3VWU A;  3TRP A;  1AQV A;  1F9M A;  4MAB A;  3M3M A;  1S3D A;  1IYI A;  1SD8 A;  3L9V A;  4O5U A;  3MAK A;  2R37 A;  2YZH A;  1LJR A;  3LOR A;  3MSZ A;  2VL3 A;  4G0L A;  1TRS A;  2DKI A;  4KSM A;  3WGE A;  5ECN B;  3M9J A;  2WFC A;  1WOU A;  2VLU A;  3E0U A;  3HZ4 A;  1C72 A;  3VLN A;  5IO0 A;  5ELG A;  4TN8 A;  3DXB A;  12GS A;  4N0V A;  4TXO B;  3UL3 A;  3QAW A;  1HYU A;  4WXT A;  4POM A;  2D2Z A;  1OYJ A;  5ECQ B;  4CW9 A;  1TRU A;  4PNF A;  2PMT A;  2JL4 A;  2REM A;  3IC4 A;  3DML A;  2FUG 2;  2MYG A;  5ECP B;  5G31 A;  3UOM A;  3L78 A;  4ML1 A;  3S9F A;  1ZL9 A;  2GVP A;  1SL2 B;  3WT1 A;  4BPY A;  3EVI A;  1AAZ A;  1EWX A;  1PX7 A;  4ZB8 A;  2HYX A;  5GAN D;  4KCA A;  2LNS A;  1HQO A;  4I6X A;  3TGZ A;  3TKS C;  2YJH A;  1CQG A;  1YF0 A;  7GSS A;  5CRG A;  1ILO A;  1GRX A;  1E2Y A;  2L57 A;  5IOW A;  4HQZ A;  3BBY A;  5JCU A;  5B8B A;  4JR4 A;  1T1V A;  2RM5 A;  5ECL B;  3F3R A;  2HZE A;  2WS2 A;  4KUN A;  2A4H A;  4FYB A;  2WZ9 A;  5IIZ A;  2HZE B;  1ABA A;  3MWH A;  4HDE A;  3UBL A;  1Z7R A;  4TR1 A;  1JHB A;  2R0G A;  1XG8 A;  5ECH B;  3CXG A;  1GUL A;  3F3Q A;  2O7K A;  1B48 A;  3IOS A;  2DIZ A;  4TR1 B;  1GTB A;  4HI7 A;  3LXZ A;  1YEP A;  5G2Z A;  1T00 A;  3G7Y A;  3IHG A;  5CP1 A;  2HSY A;  1OE7 A;  2AV4 A;  2Z9S A;  4KE3 A;  4ZIL A;  5COH A;  22GS A;  3IV4 A;  2V2G A;  4I97 A;  4WR5 A;  3Q19 A;  2I1U A;  1G6W A;  1R4W A;  2HRF A;  3EUR A;  3FW2 A;  2B1L A;  4G0I A;  3FKF A;  3DYR A;  3GHA A;  3QOU A;  11GS A;  1EP7 A;  4XRA A;  1SJ6 A;  5ECI B;  2KP2 A;  5JWQ B;  2ON7 A;  2B7K A;  1XW5 A;  3GKN A;  4GTU A;  4LL1 B;  3TJJ A;  2B5E A;  1WP0 A;  3DEX A;  2K6V A;  3LG6 A;  3APO A;  4F0C A;  4K0G A;  1ZGN A;  3G7J A;  2C80 A;  3KCM A;  5DVB A;  19GS A;  2AHE A;  4K9Z A;  5H5S A;  1JZR A;  4GLT A;  5L71 A;  4GSS A;  4YQM A;  4MA9 A;  1FHE A;  1XWK A;  4IP6 A;  2CVK A;  2KUC A;  2TRC P;  3HJO A;  3J7Y k;  4NHW A;  2H6X A;  1RK4 A;  2XBQ A;  3KZQ A;  2DJ0 A;  4IJ3 A;  2F51 A;  3QCP A;  4KH7 A;  2FA4 A;  1SL0 B;  1M9A A;  4ZIJ A;  2BMX A;  3ZRD A;  1G7O A;  2O8V B;  2F8A A;  1OVN A;  3A5I A;  2GDR A;  4V2M A;  3LXT A;  1Y25 A;  4EIP A;  1WE0 A;  3HCZ A;  1MD3 A;  5ID2 A;  2H19 A;  4HQS A;  1M0U A;  1B4P A;  5IMA A;  5DCH A;  13GS A;  2DSA A;  3RBT A;  1QXH A;  5A4W A;  3LGC A;  4O5R A;  4V1A p;  1VRS D;  3F6D A;  4TVE A;  3TRQ A;  3DVX A;  1U6T A;  2JU5 A;  3KH7 A;  3P2A A;  1PL2 A;  2FY6 A;  3A2V A;  1X9M B;  4HOJ A;  4YAV A;  1A2L A;  1ERT A;  1EOH A;  3ZMK A;  2YPM A;  1QGV A;  4I8B A;  5IPG A;  3V1W A;  4X0X A;  5IPH A;  1TK5 B;  4WF5 A;  3LYK A;  2QC7 A;  1U3I A;  2X4A A;  1PX6 A;  2C3Q A;  4X43 A;  3GST A;  3J7Y b;  4K8M A;  5FT3 A;  3HD5 A;  3RDW A;  5BRT A;  1FW1 A;  3HZ8 A;  4MLY A;  5LCZ A;  2AYT A;  1AIU A;  2IWT A;  1USB A;  3HKR A;  1ERU A;  5DDL A;  3PPU A;  1A23 A;  1XIY A;  2YOI A;  2F3M A;  3UEM A;  2H75 A;  1SKW B;  2KP1 A;  1AC1 A;  5EVO A;  2GQL A;  3GN3 A;  3IXR A;  2VL2 C;  2L5L A;  1H4O A;  4PGT A;  4WEY A;  1PD2 1;  1UA5 A;  2WB9 A;  3GSS A;  4XHM A;  1ERV A;  1TI1 A;  3D4M A;  2PU9 C;  2CVD A;  4YKF A;  5CYY A;  2LRN A;  1N2A A;  4YKG A;  2V6O A;  4ID0 A;  2L4Q A;  1F2E A;  2HRK A;  2A2R A;  3IAS 2;  4FYU A;  1FG4 A;  4DSS A;  4KX4 A;  4ECI A;  1O73 A;  1MEK A;  1GSQ A;  1LU4 A;  10GS A;  1NW2 A;  1YEX A;  2LJR A;  4KDU A;  2IN3 A;  5ECK B;  5CNW A;  2OJL A;  1Q98 A;  1TI3 A;  2B6M A;  3KGK A;  3BJ5 A;  2V32 A;  2B1K A;  3HJM A;  2C0E A;  2HT9 A;  3FR3 A;  3UVT A;  1LBK A;  3Q18 A;  4TXV A;  3DRN A;  1TU7 A;  5GST A;  3VUR A;  1XZO A;  2ES7 A;  2L6C A;  3CBU A;  5DAL A;  3LYP A;  3GTU A;  1XOA A;  2L4C A;  1A2J A;  6GSX A;  2LRT A;  4MJB A;  1XXU A;  4GQF A;  2YWM A;  5ECM B;  2L6D A;  3H8Q A;  4D73 B;  4XS6 A;  5E4W A;  5DAL B;  4AJ7 A;  4CY8 A;  1IYH A;  2DML A;  3GX0 A;  3LWA A;  5HFI A;  1K0B A;  3MDK A;  1GSU A;  2CA8 A;  2I4A A;  3BCK A;  1DE2 A;  4RUV A;  3KMO A;  1V57 A;  3F6F A;  3ZFL A;  1PN0 A;  2X8C A;  1DSB A;  2FD3 A;  4O5Q A;  5G1K A;  3H1N A;  2H71 A;  5HQP A;  2AJQ B;  3ZIV A;  2PBJ A;  2R3X A;  3DWV A;  1BJX A;  3KP8 A;  2HE3 A;  1TW9 A;  1OE8 A;  1ACV A;  3C73 A;  2YZU A;  1SJZ A;  4OFT A;  1GLP A;  2RUF A;  2N5A A;  2RLI A;  2LEG A;  4OCF A;  2DJ1 A;  3UAP A;  2C8U A;  3IC8 A;  3KJY A;  4Z7X A;  4XCS A;  1KBN A;  4WKW A;  2JAC A;  3M9K A;  3EYT A;  4NWY A;  1R5A A;  5F06 A;  5IMC A;  2X99 A;  4LLR A;  4FQU A;  4KDY A;  2IMI A;  4K5R A;  3HXS A;  4Z2T A;  2E2G A;  3EU4 A;  2CQ9 A;  3I6A A;  2IME A;  1HNA A;  4MZB A;  1JFU A;  1TU8 A;  5D93 A;  4PTS A;  2DIY A;  1NSW A;  5F0G A;  2GT6 A;  2C0F A;  2VL9 A;  2CZ3 A;  2XPE A;  3L9S A;  4L0W A;  2MMA A;  1A0F A;  4G19 A;  1O85 A;  5A4V A;  2M72 A;  2IL3 A;  2LQQ A;  20GS A;  1K0M A;  3IK7 A;  4CY6 A;  3EMP A;  3GFK A;  5DJM A;  3NZN A;  5KN3 A;  4A5P A;  4IEL A;  3RAZ A;  3IDV A;  2MMN A;  1B4Q A;  4IBP A;  1F3A A;  4RI6 A;  4ZBD A;  1M7T A;  1TXX A;  5HR1 A;  5JWO B;  2E2M A;  1W4V A;  4WET A;  4IS0 A;  2JZS A;  2NBS A;  2AAW A;  3F0I A;  3GH9 A;  2YN1 A;  1M99 A;  4HU7 A;  1ERW A;  3L9U A;  3US3 A;  4MF5 A;  1QMV A;  2CX3 A;  1THO A;  1PSQ A;  2YV7 A;  4TXO A;  3RPN A;  5C04 A;  1SKS B;  1O8X A;  2EIQ A;  4BVX A;  1SJI A;  3NOF A;  4ZBB A;  3HA9 A;  4J56 E;  4MZW A;  3DKS A;  3TKS A;  4BVX B;  4MF7 A;  5KN1 A;  3UIW A;  4MF6 A;  1YKC A;  5GSS A;  2H0I A;  4HJ2 A;  2KOK A;  4YQV A;  1WJK A;  1U87 A;  4X4J A;  1I9D A;  1FO5 A;  2GLR A;  2HRA A;  1X9W B;  3C1S A;  3QAV A;  2KHP A;  2QSI A;  1Z3E A;  4K7I A;  4EIQ A;  2A2S A;  2C0D A;  5D9T A;  5ECO B;  1BED A;  1XWC A;  4HZ4 A;  3FZ4 A;  2NPB A;  4N30 A;  2MMZ A;  4YH2 A;  3KIJ A;  1J0F A;  1T3B A;  3UVH A;  2PWJ A;  1ZYN A;  1CQH A;  1SD9 A;  4MNN A;  5F8B A;  1JZO A;  2ZNM A;  4XS4 A;  2DJ3 A;  3ZML A;  3LJR A;  3G9B A;  3GMF A;  1AQX A;  3UMA A;  3ZIT A;  1W89 A;  1A8Y A;  3KTB A;  4Z2U A;  1K3Y A;  4XS4 B;  3QFB C;  1XFL A;  3I69 A;  3GKK A;  1BAY A;  1K0C A;  4NPB A;  2GQK A;  3ERW A;  3ERG A;  1UN2 A;  3IRA A;  1UC7 A;  1RW1 A;  1K0O A;  2RM6 A;  4ZXG A;  5F05 A;  2OE0 A;  4BVY A;  2VUP A;  2B5Y A;  4ECJ A;  1GH2 A;  3APS A;  3F8U A;  2WUL A;  4GSN A;  5DAK B;  4BVY B;  3HVX A;  4K2X A;  2C1Y A;  3VI7 A;  5HR2 A;  4K0N A;  1GNE A;  1T8E B;  3N5O A;  3HVS A;  5HR0 A;  3GH6 A;  1MTC A;  4IQ1 A;  4X1U A;  4K2D A;  3ZVJ D;  2GS3 A;  5CRE A;  3CYN A;  2GSR A;  4I5Q A;  2VO4 A;  1OKT A;  4JZQ A;  2PVO C;  4F0B A; 
#chains in the Genus database with same CATH homology
 17GS A;  3K8N A;  2C3T A;  4POB A;  3I9V 2;  4ECB A;  4IN0 A;  5IMF A;  3TJG A;  4AJ6 A;  1WMJ A;  2IMF A;  3IA1 A;  2O87 A;  1ON4 A;  3KM6 A;  2K9F A;  2O89 A;  2CAI A;  5IMD A;  1KNG A;  2F9S A;  1BQ7 A;  3P7X A;  2XPD A;  3FK8 A;  4LMW A;  1TK0 B;  2HXK A;  2LQO A;  5AIV A;  2H1B A;  1V9W A;  3APQ A;  3P8W A;  3UBK A;  3W8S A;  3O76 A;  2H8L A;  3MIX A;  1B9Y C;  2C4J A;  1XWG A;  5DJL A;  1PQN A;  4PUA A;  1XBS A;  4CHS A;  1GNW A;  3IAM 2;  1G0T A;  1HNC A;  2NTO A;  2I3Y A;  3GRX A;  3KXO A;  1BG5 A;  3SWL A;  3F9U A;  4O32 A;  2NDO A;  3FR6 A;  3GUR A;  2J23 A;  3MYD A;  1FOH A;  1V2A A;  1PMT A;  5EPF A;  2ZUP A;  4YQU A;  2ON5 A;  2H0H A;  1YDK A;  1O8W A;  2XHF A;  3KMN A;  6GSY A;  3U5R E;  3QD9 A;  2VM2 A;  2OBK A;  2IMD A;  3FZ5 A;  1WPI A;  2CVB A;  4EC0 A;  3PIN A;  1ZMA A;  1ZCP A;  3OR5 A;  4RI7 A;  4RQR A;  2MMO A;  3GKX A;  1NHO A;  4ZL8 A;  3E9J B;  4MPG A;  1TDI A;  3F4S A;  1JZW A;  1ZYP A;  2IPA A;  1QQ2 A;  2I9H A;  3CSJ A;  1A8L A;  2A2P A;  4MK3 A;  1O6J A;  3ZFB A;  1S3C A;  3KH9 A;  2GQM A;  18GS A;  5D73 A;  2QGV A;  3WT2 A;  3SBC A;  3IR4 A;  2WGR A;  3EPT A;  1A2M A;  4DVC A;  2WRT A;  5CRW A;  1AQW A;  5EY6 A;  5A4U A;  4Q5N A;  4HUA A;  3BD2 A;  2N5F A;  4WR4 A;  3QFA C;  3QR6 A;  1H75 A;  2MBT A;  5H5R A;  3DGQ A;  4O7H A;  1THX A;  4MZC A;  2NVL A;  3VWW A;  3PR8 A;  3D21 A;  2CX4 A;  4ZL7 A;  2K8V A;  4POL A;  3M8N A;  5JWR B;  3ME8 A;  1F3B A;  2VD1 A;  1FOV A;  3TRX A;  1TOF A;  1ZZY A;  4DSQ A;  3O3T A;  4E8E A;  2FNO A;  2A4V A;  3GKM A;  2JAD A;  4QQ7 A;  1VGL A;  1JZD A;  1PL1 A;  2P31 A;  3CSI A;  1XVQ A;  3PGT A;  5C00 A;  1G7E A;  2YWI A;  1QK8 A;  3TKP A;  3W8J A;  2XBI A;  4J2F A;  4F82 A;  5KEJ A;  2H1A A;  1WWJ A;  3D0Z A;  3HJP A;  1SEN A;  5E59 A;  2LNT A;  1WRY A;  2HSH A;  1X5C A;  4Q5R A;  5B6N A;  1GSY A;  4MP4 A;  1V98 A;  3KP9 A;  4G9H A;  3QDN A;  4IP1 A;  2H1D A;  4HU9 A;  8GSS A;  2CZ2 A;  1GUK A;  1SYR A;  2R0P A;  2YP6 A;  2LS5 A;  1SKR B;  2VCX A;  2GZY A;  4H86 A;  5J9B A;  4EUY A;  2FWH A;  3ED3 A;  4NMU A;  1ML6 A;  3HYP A;  3RPP A;  2X8G A;  1DE1 A;  5FWG A;  5J3R A;  3M1G A;  4XIH A;  4FYC A;  5B8A A;  4JBB A;  4D73 A;  1MDI A;  2H73 A;  1MD4 A;  5B6M A;  4KF9 A;  1Z9H A;  2KLX A;  16GS A;  4WF4 A;  2PVQ A;  1GSF A;  2C3N A;  3HHV A;  4IJI A;  1R26 A;  4EXJ A;  2PER A;  2OBI A;  1S3A A;  4MH3 A;  1PN9 A;  1OC9 B;  1GUH A;  2HSM A;  2VD0 A;  4EF0 A;  2GTU A;  1F6M C;  4OO4 A;  2GGT A;  2VIM A;  3H79 A;  2CV4 A;  2K18 A;  5D8I A;  2YNX A;  2N5B A;  4KDX A;  3Q6O A;  3R3E A;  4NV2 A;  5JCW A;  1K0A A;  2QA2 A;  3QAG A;  1UVZ A;  4ZB9 A;  3FZ9 A;  4DEJ A;  3CRT A;  1NM3 A;  2JSY A;  1XWB A;  2GSS A;  3VPQ A;  4P3Y B;  1JLV A;  1GTU A;  3CSH A;  1V58 A;  2LUS A;  5G1L A;  3D4T A;  2HRN A;  3GL5 A;  1ZOF A;  4O92 A;  2VCT A;  4ECC A;  5G5E A;  4G10 A;  1M2D A;  5LNK e;  1XW6 A;  4LA1 A;  4MJC A;  1SYX A;  4F2I A;  4IQA A;  3QPM A;  4L8E A;  2HZF A;  5J41 A;  2EC4 A;  5KOW A;  1Z6M A;  2WJU A;  4BL7 B;  4PX1 A;  4BWS A;  1PKW A;  1ZYE A;  5ECS A;  4L5O A;  2RUE A;  4V1A g;  1DBY A;  2QKE A;  2FLS A;  1I5G A;  2EIO A;  1ZYQ B;  2R5G A;  4GRF A;  3FYG A;  4N0Z A;  4GST A;  1XPV A;  3TKQ A;  6GSV A;  2GSQ A;  2DBC A;  3LEF A;  1WIK A;  1XWA A;  2YJ7 A;  2ZCT A;  2P5R A;  5ABR A;  3BOA A;  3W6G A;  5KOX A;  3ZTL A;  4TR3 A;  5J9C A;  2QA1 A;  5HR3 A;  2IIY A;  5KN2 A;  3ZYW A;  4ICY A;  3LFL A;  3O6T A;  2YV9 A;  5ENU A;  2PN8 A;  4FIW A;  3TOU A;  3R2Q A;  3IBH A;  2AUV A;  4ZL9 A;  1GSD A;  2FWE A;  5G5F A;  4GCI A;  5LD0 A;  3GV1 A;  1SL1 B;  2JZR A;  4OMV A;  5J4U A;  1PA3 A;  1SU9 A;  1K3O A;  2GT5 A;  4AF2 A;  1XOB A;  3FZA A;  1GL8 A;  4OO5 A;  2H66 A;  3A3T A;  3RHC A;  4TKY A;  2R2J A;  1K0D A;  4BWQ A;  5AIX A;  4G2E A;  4PUF C;  1EV9 A;  4AJ8 A;  2GST A;  3A2X A;  2LJA A;  1OC3 A;  1HNB A;  3WD6 A;  3TCO A;  1O7U A;  2HI7 A;  3FHK A;  3MNG A;  5CRH A;  5IO2 A;  3D5J A;  1EP8 A;  3CTG A;  2X64 A;  2JZT A;  2H30 A;  2M46 A;  3C71 A;  3WYW A;  4DSR A;  2DJK A;  1MDJ A;  6GST A;  3EMX A;  4LL4 B;  3IPZ A;  5B7C A;  4ML6 A;  4OFN A;  2OE1 A;  3HVV A;  4CDO A;  4MMM A;  4KGI A;  1J9B A;  5J5N A;  5AIS A;  3ISO A;  4ISD A;  4K6X A;  2DC5 A;  4KSO A;  1TRW A;  1KTE A;  2EIR A;  5DQY A;  1TRV A;  2V1M A;  3NIV A;  4PQI A;  4GQC A;  4HJM A;  2E0Q A;  4OCE A;  1V40 A;  2H0G A;  4OFM A;  4YAP A;  2H74 A;  5AN1 A;  2YWO A;  1GTI A;  3TOT A;  3N9J A;  3C7M A;  3GL3 A;  3EIN A;  2X8H A;  2GZZ A;  2TRX A;  1VF2 A;  3IE3 A;  1B8X A;  1K0N A;  5DAK A;  3C8E A;  4POK A;  5G30 A;  1K3L A;  1YJ6 A;  2VCW A;  2H76 A;  3VWV A;  2FWG A;  4JRR A;  2L59 A;  2V6K A;  1VF3 A;  5DQS A;  4F03 A;  1FVK A;  2LRC A;  5KN0 A;  1AUC A;  2IFQ A;  2H1G A;  2VCZ A;  3I43 A;  1EOG A;  2LV3 A;  2UZ8 A;  3TB2 A;  5HFG A;  4MPF A;  2B7J A;  1AXD A;  3M0F A;  4XRD A;  2VCQ A;  5CAX A;  5CRD A;  3KTL A;  2P0G A;  1NHY A;  3EU3 A;  2IFQ B;  4PXO A;  3C1R A;  2B3S A;  5H5Q A;  4EDZ A;  1T7P B;  3VK9 A;  1Y6E A;  4MJE A;  1GTA A;  1URM A;  1TJD A;  3ZIJ A;  1SK2 A;  5EL8 A;  4IW9 A;  3KEB A;  4TRX A;  5D96 A;  4OD7 A;  2DJJ A;  2R4V A;  3DIE A;  4I2T A;  1BX9 A;  1T4Z A;  5DCG A;  4N10 A;  6GSU A;  3TUE A;  3H93 A;  2HFD A;  1PGT A;  3IK9 A;  5IMZ A;  4N11 A;  1GP1 A;  2H01 A;  1KEB A;  2AB6 A;  3FMW A;  3RHB A;  3L4N A;  4K1F A;  4K7N A;  5IOX A;  2GZP A;  3F4T A;  4KCE A;  1GSE A;  4PQH A;  2B5X A;  3L0H A;  2PUK C;  2VLT A;  5INY A;  3A5W A;  1U88 A;  4FH8 A;  4PQ1 A;  1FAA A;  3TKS E;  3GUS A;  4HS1 A;  4JU5 A;  5IM9 A;  3G7I A;  1GLQ A;  3ME7 A;  2G2Q A;  3UAR A;  4JR6 A;  5HFK A;  3GA4 A;  1EEJ A;  1E6B A;  1OKD A;  3LSZ A;  4NAX A;  1EEM A;  2XC2 A;  2R6K A;  4PUR A;  3F63 A;  1DUG A;  1OAZ A;  2DLX A;  4TOP A;  2OAD A;  1VF1 A;  2HLS A;  2LKU A;  3U6V A;  2LTK A;  4IVF A;  1SK1 A;  3VFI A;  2VCV A;  3LW9 A;  3A2W A;  2K8S A;  3ZL5 A;  3ZZX A;  3KD0 A;  2R0C A;  4MH2 A;  1X5D A;  1A0R P;  1EGR A;  2FCH A;  1PKZ A;  2M80 A;  3GNJ A;  4L0U A;  1HD2 A;  3AY8 A;  4I2U A;  2VL2 A;  4WBJ A;  3JCM L;  2TIR A;  5ID2 B;  3CMI A;  1EGO A;  2PGT A;  4K5S A;  2DJ2 A;  3WGD A;  1OC8 A;  5D9V A;  3E3E A;  3D6I A;  4XTS A;  3UJ1 A;  1GSS A;  2FA8 A;  4RQX A;  5JCG A;  1FVJ A;  1TP9 A;  1Z7P A;  4IHU A;  3VWX A;  4OWY A;  1M9B A;  4ACS A;  2I81 A;  3EE2 A;  2YAN A;  2MBS A;  1J08 A;  2YWN A;  1YQ1 A;  1SK0 A;  4V2N A;  1FB6 A;  2VLV A;  3TJF A;  6GSW A;  4EL1 A;  1PRX A;  2RII A;  5GZZ B;  3DD3 A;  1MDK A;  1JLW A;  3ZRE A;  1TTZ A;  2J9H A;  4GWR A;  4KAE A;  3Q74 A;  2VOC A;  1A24 A;  4Z2R A;  5CO3 A;  2HNL A;  4USS A;  4Q5Q A;  5GAP D;  2OA7 A;  1TKD B;  1RQM A;  5DBQ A;  2G0F A;  4FO5 A;  1N8J A;  1GWC A;  4EKZ A;  4J57 E;  4GXZ A;  4JE1 A;  1EV4 A;  3EC3 A;  2VAF A;  4Q5F A;  2FGX A;  3VPT A;  4L5L A;  4ZBA A;  3FEU A;  4F9Z A;  2OKA A;  1F37 A;  3GYK A;  1XCC A;  1XW9 A;  2LJK A;  2X49 A;  1Q4J A;  3TJK A;  4XS1 A;  4DSS B;  4JED A;  3FRC A;  2H6Z A;  5IQY A;  4WBR D;  4QL7 A;  4BA7 A;  3FY7 A;  1YF1 A;  2WCI A;  1M2A A;  1OC9 A;  1M2B A;  3ERF A;  2VM1 A;  1G6Y A;  3BCI A;  14GS A;  2IMK A;  4ILF A;  4V2L A;  1U3A A;  4NHZ A;  2ALB A;  3GIX A;  1YY7 A;  5ECR B;  1XVW A;  4PNG A;  2IJY A;  2PPT A;  1TK8 B;  4NV5 A;  3GTU B;  5F07 A;  2O85 A;  3ZVJ A;  1R5P A;  2OE3 A;  6GSS A;  5AGY A;  4TW5 A;  5D9X A;  3CRU A;  3QMX A;  2MZC A;  4E8H A;  1EZK A;  3D22 A;  3LQ7 A;  1T4Y A;  1YZX A;  2DMM A;  3TKR A;  4EDY A;  4AGS A;  3WGX A;  4IGJ A;  2BTO T;  2H70 A;  3HY2 A;  2H6Y A;  9GSS A;  1O81 A;  2WDU A;  3PH9 A;  2FHE A;  4MCU A;  4LMV A;  1VF4 A;  3GX8 A;  4KW6 A;  4KB3 A;  4BL7 A;  3ZLP A;  4KND A;  3EWL A;  4NXI A;  3P90 A;  4EVM A;  4TR4 A;  4EE0 A;  4HZ2 A;  1GUM A;  2LST A;  2E7P A;  1Z6N A;  1X0R A;  5FHI A;  3IHQ A;  2FWF A;  4IKH A;  1R7H A;  4TR0 A;  4G0K A;  2JSZ A;  4QL9 A;  1B9X C;  3HDC A;  3TDG A;  2DKH A;  4GF0 A;  1FB0 A;  5ELA A;  4ULX A;  1Z5Y E;  2OAC A;  3H4K A;  4ZB6 A;  2P5Q A;  2YCD A;  5A5K A;  1QFN A;  1YKA A;  3DVW A;  5IMV A;  2F8F A;  4K7O A;  4KA0 A;  2C0G A;  1AW9 A;  2BJX A;  5BMU A;  2V41 A;  1X9S B;  2H72 A;  1ST9 A;  1X5E A;  4MDC A;  3VI5 A;  2L5O A;  4EO3 A;  1QUW A;  2CAQ A;  3CTF A;  4HEA 2;  3TJB A;  1BYE A;  5D9W A;  3F4R A;  3FR9 A;  4MJA A;  2CT6 A;  3VWU A;  3TRP A;  1AQV A;  1F9M A;  4MAB A;  3M3M A;  1S3D A;  1IYI A;  1SD8 A;  3L9V A;  4O5U A;  3MAK A;  2R37 A;  2YZH A;  1LJR A;  3LOR A;  3MSZ A;  2VL3 A;  4G0L A;  1TRS A;  2DKI A;  4KSM A;  3WGE A;  5ECN B;  3M9J A;  2WFC A;  1WOU A;  2VLU A;  3E0U A;  3HZ4 A;  1C72 A;  3VLN A;  5IO0 A;  5ELG A;  4TN8 A;  3DXB A;  12GS A;  4N0V A;  4TXO B;  3UL3 A;  3QAW A;  1HYU A;  4WXT A;  4POM A;  2D2Z A;  1OYJ A;  5ECQ B;  4CW9 A;  1TRU A;  4PNF A;  2PMT A;  2JL4 A;  2REM A;  3IC4 A;  3DML A;  2FUG 2;  2MYG A;  5ECP B;  5G31 A;  3UOM A;  3L78 A;  4ML1 A;  3S9F A;  1ZL9 A;  2GVP A;  1SL2 B;  3WT1 A;  4BPY A;  3EVI A;  1AAZ A;  1EWX A;  1PX7 A;  4ZB8 A;  2HYX A;  5GAN D;  4KCA A;  2LNS A;  1HQO A;  4I6X A;  3TGZ A;  3TKS C;  2YJH A;  1CQG A;  1YF0 A;  7GSS A;  5CRG A;  1ILO A;  1GRX A;  1E2Y A;  2L57 A;  5IOW A;  4HQZ A;  3BBY A;  5JCU A;  5B8B A;  4JR4 A;  1T1V A;  2RM5 A;  5ECL B;  3F3R A;  2HZE A;  2WS2 A;  4KUN A;  2A4H A;  4FYB A;  2WZ9 A;  5IIZ A;  2HZE B;  1ABA A;  3MWH A;  4HDE A;  3UBL A;  1Z7R A;  4TR1 A;  1JHB A;  2R0G A;  5ECH B;  3CXG A;  1GUL A;  3F3Q A;  2O7K A;  1B48 A;  3IOS A;  2DIZ A;  4TR1 B;  1GTB A;  4HI7 A;  3LXZ A;  1YEP A;  5G2Z A;  1T00 A;  3G7Y A;  3IHG A;  5CP1 A;  2HSY A;  1OE7 A;  2AV4 A;  2Z9S A;  4KE3 A;  4ZIL A;  5COH A;  22GS A;  3IV4 A;  2V2G A;  4I97 A;  4WR5 A;  3Q19 A;  2I1U A;  1G6W A;  1R4W A;  2HRF A;  3EUR A;  3FW2 A;  2B1L A;  4G0I A;  3FKF A;  3DYR A;  3GHA A;  3QOU A;  11GS A;  1EP7 A;  4XRA A;  1SJ6 A;  5ECI B;  2KP2 A;  5JWQ B;  2ON7 A;  2B7K A;  1XW5 A;  3GKN A;  4GTU A;  4LL1 B;  3TJJ A;  2B5E A;  1WP0 A;  3DEX A;  2K6V A;  3LG6 A;  3APO A;  4F0C A;  4K0G A;  1ZGN A;  3G7J A;  2C80 A;  3KCM A;  5DVB A;  19GS A;  2AHE A;  4K9Z A;  5H5S A;  1JZR A;  4GLT A;  5L71 A;  4GSS A;  4YQM A;  4MA9 A;  1FHE A;  1XWK A;  4IP6 A;  2CVK A;  2KUC A;  2TRC P;  3HJO A;  3J7Y k;  4NHW A;  2H6X A;  1RK4 A;  2XBQ A;  3KZQ A;  2DJ0 A;  4IJ3 A;  2F51 A;  3QCP A;  4KH7 A;  2FA4 A;  1SL0 B;  1M9A A;  4ZIJ A;  2BMX A;  3ZRD A;  1G7O A;  2O8V B;  2F8A A;  1OVN A;  3A5I A;  2GDR A;  4V2M A;  3LXT A;  1Y25 A;  4EIP A;  1WE0 A;  3HCZ A;  1MD3 A;  5ID2 A;  2H19 A;  4HQS A;  1M0U A;  1B4P A;  5IMA A;  5DCH A;  13GS A;  2DSA A;  3RBT A;  1QXH A;  5A4W A;  3LGC A;  4O5R A;  4V1A p;  1VRS D;  3F6D A;  4TVE A;  3TRQ A;  3DVX A;  1U6T A;  2JU5 A;  3KH7 A;  3P2A A;  1PL2 A;  2FY6 A;  3A2V A;  1X9M B;  4HOJ A;  4YAV A;  1A2L A;  1ERT A;  1EOH A;  3ZMK A;  2YPM A;  1QGV A;  4I8B A;  5IPG A;  3V1W A;  4X0X A;  5IPH A;  1TK5 B;  4WF5 A;  3LYK A;  2QC7 A;  1U3I A;  2X4A A;  1PX6 A;  2C3Q A;  4X43 A;  3GST A;  3J7Y b;  4K8M A;  5FT3 A;  3HD5 A;  3RDW A;  5BRT A;  1FW1 A;  3HZ8 A;  4MLY A;  5LCZ A;  2AYT A;  1AIU A;  2IWT A;  1USB A;  3HKR A;  1ERU A;  5DDL A;  3PPU A;  1A23 A;  1XIY A;  2YOI A;  2F3M A;  3UEM A;  2H75 A;  1SKW B;  2KP1 A;  1AC1 A;  5EVO A;  2GQL A;  3GN3 A;  3IXR A;  2VL2 C;  2L5L A;  1H4O A;  4PGT A;  4WEY A;  1PD2 1;  1UA5 A;  2WB9 A;  3GSS A;  4XHM A;  1ERV A;  1TI1 A;  3D4M A;  2PU9 C;  2CVD A;  4YKF A;  5CYY A;  2LRN A;  1N2A A;  4YKG A;  2V6O A;  4ID0 A;  2L4Q A;  1F2E A;  2HRK A;  2A2R A;  3IAS 2;  4FYU A;  1FG4 A;  4DSS A;  4KX4 A;  4ECI A;  1O73 A;  1MEK A;  1GSQ A;  1LU4 A;  10GS A;  1NW2 A;  1YEX A;  2LJR A;  4KDU A;  2IN3 A;  5ECK B;  5CNW A;  2OJL A;  1Q98 A;  1TI3 A;  2B6M A;  3KGK A;  3BJ5 A;  2V32 A;  2B1K A;  3HJM A;  2C0E A;  2HT9 A;  3FR3 A;  3UVT A;  1LBK A;  3Q18 A;  4TXV A;  3DRN A;  1TU7 A;  5GST A;  3VUR A;  1XZO A;  2ES7 A;  2L6C A;  3CBU A;  5DAL A;  3LYP A;  3GTU A;  1XOA A;  2L4C A;  1A2J A;  6GSX A;  2LRT A;  4MJB A;  1XXU A;  4GQF A;  2YWM A;  5ECM B;  2L6D A;  3H8Q A;  4D73 B;  4XS6 A;  5E4W A;  5DAL B;  4AJ7 A;  4CY8 A;  1IYH A;  2DML A;  3GX0 A;  3LWA A;  5HFI A;  1K0B A;  3MDK A;  1GSU A;  2CA8 A;  2I4A A;  3BCK A;  1DE2 A;  4RUV A;  3KMO A;  1V57 A;  3F6F A;  3ZFL A;  1PN0 A;  2X8C A;  1DSB A;  2FD3 A;  4O5Q A;  5G1K A;  3H1N A;  2H71 A;  5HQP A;  2AJQ B;  3ZIV A;  2PBJ A;  2R3X A;  3DWV A;  1BJX A;  3KP8 A;  2HE3 A;  1TW9 A;  1OE8 A;  1ACV A;  3C73 A;  2YZU A;  1SJZ A;  4OFT A;  1GLP A;  2RUF A;  2N5A A;  2RLI A;  2LEG A;  4OCF A;  2DJ1 A;  3UAP A;  2C8U A;  3IC8 A;  3KJY A;  4Z7X A;  4XCS A;  1KBN A;  4WKW A;  2JAC A;  3M9K A;  3EYT A;  4NWY A;  1R5A A;  5F06 A;  5IMC A;  2X99 A;  4LLR A;  4FQU A;  4KDY A;  2IMI A;  4K5R A;  3HXS A;  4Z2T A;  2E2G A;  3EU4 A;  2CQ9 A;  3I6A A;  2IME A;  1HNA A;  4MZB A;  1JFU A;  1TU8 A;  5D93 A;  4PTS A;  2DIY A;  1NSW A;  5F0G A;  2GT6 A;  2C0F A;  2VL9 A;  2CZ3 A;  2XPE A;  3L9S A;  4L0W A;  2MMA A;  1A0F A;  4G19 A;  1O85 A;  5A4V A;  2M72 A;  2IL3 A;  2LQQ A;  20GS A;  1K0M A;  3IK7 A;  4CY6 A;  3EMP A;  3GFK A;  5DJM A;  3NZN A;  5KN3 A;  4A5P A;  4IEL A;  3RAZ A;  3IDV A;  2MMN A;  1B4Q A;  4IBP A;  1F3A A;  4RI6 A;  4ZBD A;  1M7T A;  1TXX A;  5HR1 A;  5JWO B;  2E2M A;  1W4V A;  4WET A;  4IS0 A;  2JZS A;  2NBS A;  2AAW A;  3F0I A;  3GH9 A;  2YN1 A;  1M99 A;  4HU7 A;  1ERW A;  3L9U A;  3US3 A;  4MF5 A;  1QMV A;  2CX3 A;  1THO A;  1PSQ A;  2YV7 A;  4TXO A;  3RPN A;  5C04 A;  1SKS B;  1O8X A;  2EIQ A;  4BVX A;  1SJI A;  3NOF A;  4ZBB A;  3HA9 A;  4J56 E;  4MZW A;  3DKS A;  3TKS A;  4BVX B;  4MF7 A;  5KN1 A;  3UIW A;  4MF6 A;  1YKC A;  5GSS A;  2H0I A;  4HJ2 A;  2KOK A;  4YQV A;  1WJK A;  1U87 A;  4X4J A;  1I9D A;  1FO5 A;  2GLR A;  2HRA A;  1X9W B;  3C1S A;  3QAV A;  2KHP A;  2QSI A;  1Z3E A;  4K7I A;  4EIQ A;  2A2S A;  2C0D A;  5D9T A;  5ECO B;  1BED A;  1XWC A;  4HZ4 A;  3FZ4 A;  2NPB A;  4N30 A;  2MMZ A;  4YH2 A;  3KIJ A;  1J0F A;  1T3B A;  3UVH A;  2PWJ A;  1ZYN A;  1CQH A;  1SD9 A;  4MNN A;  5F8B A;  1JZO A;  2ZNM A;  4XS4 A;  2DJ3 A;  3ZML A;  3LJR A;  3G9B A;  3GMF A;  1AQX A;  3UMA A;  3ZIT A;  1W89 A;  1A8Y A;  3KTB A;  4Z2U A;  1K3Y A;  4XS4 B;  3QFB C;  1XFL A;  3I69 A;  3GKK A;  1BAY A;  1K0C A;  4NPB A;  2GQK A;  3ERW A;  3ERG A;  1UN2 A;  3IRA A;  1UC7 A;  1RW1 A;  1K0O A;  2RM6 A;  4ZXG A;  5F05 A;  2OE0 A;  4BVY A;  2VUP A;  2B5Y A;  4ECJ A;  1GH2 A;  3APS A;  3F8U A;  2WUL A;  4GSN A;  5DAK B;  4BVY B;  3HVX A;  4K2X A;  2C1Y A;  3VI7 A;  5HR2 A;  4K0N A;  1GNE A;  1T8E B;  3N5O A;  3HVS A;  5HR0 A;  3GH6 A;  1MTC A;  4IQ1 A;  4X1U A;  4K2D A;  3ZVJ D;  2GS3 A;  5CRE A;  3CYN A;  2GSR A;  4I5Q A;  2VO4 A;  1OKT A;  4JZQ A;  2PVO C;  4F0B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...