2P31A

Crystal structure of human glutathione peroxidase 7
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
155
structure length
155
Chain Sequence
b'QDFYDFKAVNIRGKLVSLEKYRGSVSLVVNVASECGFTDQHYRALQQLQRDLGPHHFNVLAFPCNQFGQQEPDSNKEIESFARRTYSVSFPMFSKIAVTGTGAHPAFKYLAQTSGKEPTWNFWKYLVAPDGKVVGAWDPTVSVEEVRPQITALVR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione peroxidase 7
publication title Crystal structure of human glutathione peroxidase 7
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 50
structure length 155
sequence length 155
chains with identical sequence B
ec nomenclature ec 1.11.1.9: Glutathione peroxidase.
pdb deposition date 2007-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00255 GSHPx Glutathione peroxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2p31A00
1ERTA 3DVXA 17GSA 2JZTA 3FZ5A 2MZCA 5DJMA 4X43A 3C73A 8GSSA 1F3AA 3QFAC 1SD9A 4L0UA 5EVOA 3CBUA 2H8LA 2IMDA 2V41A 4N0VA 1Z9HA 4HUAA 3UL3A 4IKHA 1PKWA 3DMLA 3GV1A 4YQUA 1HNAA 5JWQB 2R3XA 4GTUA 3W8JA 1VF1A 2D2ZA 5ECPB 3ZITA 1HYUA 2VCTA 2V6KA 1TRVA 5IMCA 4ZL8A 3LSZA 2PN8A 1A2JA 4MPGA 3HZ4A 3KIJA 2JZSA 3VWXA 4MZWA 2H66A 5CNWA 1VF4A 4OMVA 1Z5YE 2CVDA 2V32A 2RUEA 3ZIVA 4K0GA 2B5YA 1FVKA 2X64A 3ZREA 1SU9A 1XOBA 4XRDA 3GL3A 1NHYA 4EE0A 4PQHA 5DCHA 5KEJA 4RQRA 2RLIA 3BBYA 4HS1A 13GSA 1XCCA 4MZCA 1X5DA 3Q6OA 1A2LA 3TJJA 1OAZA 2H1BA 2LJKA 4ECIA 4I6XA 4IBPA 2VCVA 2FCHA 1J0FA 4MA9A 1QFNA 2O85A 2FWEA 3ERWA 1PRXA 2VM2A 3FR9A 3TGZA 3QOUA 2DC5A 2AAWA 2EIQA 4K9ZA 1U3AA 2C0DA 2OACA 3F4TA 2KHPA 4QQ7A 5C04A 2R4VA 3WGDA 4O92A 3VWUA 5IO2A 1WP0A 1FAAA 1URMA 2RUFA 5GAND 2GT5A 4K7OA 4F03A 4JEDA 2CVKA 3GKMA 3PR8A 4IJ3A 1TU8A 2YWMA 3IC4A 1MD3A 3W6GA 5IO0A 1E2YA 2GZZA 1H75A 5ECLB 2LJAA 2MBSA 4MABA 1XWAA 1M2AA 2RIIA 2AB6A 1K0CA 3NZNA 2IMFA 5B8BA 4HI7A 3QAGA 2TIRA 3I69A 4F0CA 1AIUA 5IIZA 2VL2A 5COHA 2R6KA 1WOUA 4GQFA 2JSZA 1PL2A 3APQA 4YH2A 5ELAA 1LU4A 2DMLA 1YKAA 2LRCA 6GSSA 2V6OA 4CW9A 5IQYA 3TJBA 1G7OA 1HQOA 2CA8A 3HCZA 2H6ZA 1BJXA 3EC3A 3CSIA 3IK7A 3HVSA 3PINA 3KH7A 2Z9SA 4KDXA 5HR1A 3GKNA 2OBKA 2E2GA 3DXBA 3FEUA 1YJ6A 1A23A 3FY7A 2PGTA 5JWRB 4I8BA 4OFTA 3J7Yb 2C3QA 2DSAA 2PMTA 3FW2A 5ECIB 2KLXA 1AUCA 1B4QA 4KGIA 3VURA 1OC8A 3WT2A 3D21A 4I5QA 1ZCPA 5CYYA 5EL8A 12GSA 2YNXA 3CSHA 3FRCA 3MDKA 3U6VA 1K0NA 1GSSA 4JBBA 3RPPA 1FB0A 3QR6A 3IRAA 4TXOB 1HD2A 2WZ9A 4JR6A 2YPMA 2XPEA 2N5AA 3FZAA 2FNOA 1XFLA 5CRHA 5D9XA 3BCIA 4N11A 4XS6A 1ON4A 4LMWA 2H1DA 1JLVA 3TOTA 4KCEA 2ZCTA 2XHFA 3AY8A 4GQCA 5IMAA 1EGRA 1TRWA 4WF5A 3RHCA 4ULXA 1U3IA 1H4OA 1TXXA 4POLA 3QPMA 4D73A 5IPHA 3G7JA 3GA4A 5JWOB 3DYRA 5F06A 3ZYWA 3Q19A 5KN2A 1G0TA 1ZMAA 1DE2A 1SJZA 4XRAA 1G6WA 2V1MA 2WDUA 1OC9B 3O3TA 4JRRA 2GSQA 2GSTA 2HYXA 1RK4A 5DQYA 3F6DA 2HRNA 2HI7A 3HYPA 1T4YA 5G5EA 3VK9A 1WWJA 4ZIJA 1THXA 4PUFC 1R26A 3IHQA 3FYGA 1M99A 2EIRA 1OVNA 1S3CA 4TW5A 1DE1A 1ZYEA 4RI6A 3TKPA 4E8EA 2MMZA 2H76A 3UARA 1K0AA 1B8XA 3A2WA 2CZ2A 1PL1A 1SENA 4EUYA 2XC2A 2IL3A 3QAVA 4XTSA 1T3BA 3VPTA 4KAEA 3LJRA 4V1Ap 5JCGA 2VLUA 5EY6A 3E9JB 1WRYA 4MJCA 3UJ1A 1T4ZA 4NV2A 2OE0A 1AC1A 2I3YA 3G7IA 3LORA 3G7YA 2B3SA 2C8UA 1F6MC 3EVIA 1BG5A 4HOJA 1EOGA 3DGQA 2R2JA 1J9BA 4WR4A 1A24A 2IMKA 1Z3EA 4K7IA 2XBIA 3TRQA 1K0BA 1V9WA 5J5NA 4TRXA 4RQXA 2L4QA 3F3RA 1V40A 5DAKB 4F82A 4MLYA 1XWKA 4WBRD 4KB3A 3ZFLA 3TKQA 1XVQA 1IYHA 2QC7A 2REMA 3BCKA 5ID2A 6GSYA 2QKEA 3L9UA 1NSWA 5KN1A 4XHMA 3TKSC 2MMAA 5ECNB 5F0GA 3VPQA 1I5GA 2WRTA 5G1KA 2OBIA 3APSA 1ZYQB 3HXSA 4EF0A 3GH9A 2VCQA 3KXOA 3ZVJD 3F3QA 3FZ4A 1EP7A 2F9SA 4ECJA 4K1FA 2N5BA 2LQOA 3SBCA 3F9UA 3C1RA 1X9MB 3D5JA 4POMA 5FHIA 4ECCA 3KTBA 1SYXA 4HDEA 5FWGA 2YJ7A 4ILFA 1V58A 2LNTA 3GRXA 2RM5A 1R4WA 1RQMA 2VIMA 1Y25A 3RHBA 4GF0A 2DJKA 4Q5NA 2VM1A 4AJ7A 5CRWA 4ZB8A 4MJBA 1PD21 1F9MA 3D22A 4MK3A 3DIEA 2I4AA 1I9DA 4FH8A 1QUWA 4DVCA 4PGTA 2F8AA 3TKSA 2PERA 4JU5A 2ES7A 1GUHA 2LTKA 5J4UA 4MMMA 1B9XC 4KH7A 5GZZB 3EU4A 3M1GA 3E0UA 4ZB9A 5HFGA 4EVMA 5ECMB 3UVHA 4MH3A 2H70A 3EWLA 2WULA 2H71A 4N0ZA 5F8BA 2I1UA 3LEFA 2ZNMA 5A5KA 2B1KA 1EZKA 2BJXA 5AISA 1ERUA 1AQVA 1LBKA 3FK8A 4XCSA 3GX0A 2IJYA 2I81A 4NXIA 2VCZA 4TR1A 2HSHA 2BTOT 1JZWA 2L57A 5B6MA 2VUPA 5CAXA 1OKTA 3NOFA 4JR4A 1GSDA 3OR5A 3R2QA 3TJGA 4PUAA 4XS1A 4BVYA 1KBNA 1T7PB 2HE3A 5IM9A 3ZMLA 2YZHA 2VO4A 4FYCA 2B5XA 1A8YA 4KSOA 3GH6A 3MSZA 4K2DA 3A2XA 1J08A 4V2NA 3GFKA 5GSTA 4ZILA 2NVLA 1M9AA 3P90A 1VGLA 1GUMA 2H74A 5D9TA 1TK5B 4J2FA 4N30A 3DWVA 2VCXA 4WKWA 4IS0A 2FA4A 1GTUA 2YOIA 2HXKA 4TN8A 2LEGA 3ME7A 2HSYA 4NV5A 3M9JA 2CVBA 3LGCA 3VWWA 4ID0A 4AF2A 3KP9A 1FHEA 1EWXA 3LXZA 4ECBA 2OJLA 2FWHA 3APOA 1MDIA 3FHKA 1QK8A 22GSA 4RI7A 1ABAA 2VL3A 4POBA 1JHBA 2LS5A 2ON5A 4IW9A 4ZBAA 5G2ZA 1R5PA 4HZ4A 3G9BA 1SJIA 1CQHA 3TKSE 1ZGNA 2M80A 3IDVA 4G10A 4GLTA 1YEXA 5JCWA 2PU9C 3H4KA 1FW1A 4GSSA 3GURA 3GX8A 1U88A 4DSQA 3ZZXA 2DJJA 5EPFA 2IMIA 1Q98A 1PKZA 2PWJA 4CDOA 1OE8A 4K6XA 2LRNA 2GQKA 3KP8A 3QD9A 1GSUA 3ZFBA 1M2DA 1ZOFA 4TR3A 1EEJA 1WJKA 3LWAA 2MMNA 4YAVA 2DJ0A 3VFIA 1S3DA 4KW6A 1GTAA 1QQ2A 4F2IA 2O89A 3V1WA 4JZQA 4WF4A 3F63A 1A2MA 5HR0A 3I9V2 3GN3A 3Q74A 3C71A 4LL4B 5E59A 1Z6MA 2J23A 1R7HA 9GSSA 3TUEA 1JZDA 1B48A 3VWVA 4L0WA 2K18A 3ZVJA 1K3YA 3HVXA 4IQ1A 5ECOB 3ISOA 2JZRA 2G2QA 4KSMA 1KEBA 1AAZA 1ERWA 5G30A 16GSA 3LYPA 4MP4A 3QDNA 5DALA 5D96A 2HRFA 5C00A 4XIHA 5LCZA 3L0HA 1OC3A 1XIYA 1VF2A 2LSTA 4PX1A 5HFIA 4AGSA 1IYIA 2GS3A 1EV4A 4PNGA 7GSSA 3D6IA 3HKRA 1X0RA 3EMXA 3H1NA 3UMAA 5DJLA 4N10A 1X5EA 1GRXA 3MAKA 2B7JA 3LXTA 1W4VA 3BD2A 2E2MA 1PX7A 1AQWA 2DJ3A 1O8XA 2WGRA 3P2AA 1M9BA 3WD6A 1PQNA 1XWGA 1Z6NA 5L71A 4O7HA 3ERFA 2GZPA 3DKSA 5H5RA 3M0FA 4Z7XA 1GNEA 20GSA 4MH2A 5AGYA 5LD0A 2O7KA 1B4PA 2IMEA 5H5QA 4D73B 3UIWA 2DJ2A 3IV4A 4QL7A 1UC7A 2M72A 1SJ6A 4TR0A 1BQ7A 1O85A 2LQQA 5INYA 3P7XA 3IAM2 2LJRA 3BOAA 5ABRA 2R37A 5AIVA 4LLRA 4V1Ag 5G5FA 1TRSA 2K9FA 2IFQB 2FLSA 2P5RA 5A4WA 1X5CA 2CX4A 1K3OA 4MZBA 3UOMA 5KN0A 1MDKA 2YZUA 4GSTA 3CYNA 4IP6A 10GSA 3C7MA 4KA0A 4X0XA 2TRCP 1FO5A 1OKDA 4PQ1A 1K0OA 2L4CA 3KEBA 5DCGA 4BPYA 1W89A 3DVWA 2FD3A 3IBHA 4H86A 2B6MA 4ML1A 5DBQA 5F05A 1OC9A 4DEJA 2L5LA 19GSA 4NAXA 4L5OA 2FUG2 5CRDA 2OE3A 3KM6A 3HD5A 3C8EA 2JSYA 1SK1A 3EYTA 3MNGA 2GT6A 2NDOA 2L6DA 3LG6A 1SK2A 3K8NA 1SKRB 2JL4A 2H6XA 4FYUA 1QGVA 2HZFA 3GNJA 4EL1A 2HZEA 4HU9A 1U87A 2GGTA 4KDYA 3TRXA 4TVEA 3O76A 1GLPA 2PPTA 4TXVA 2G0FA 1MEKA 2ON7A 3FKFA 4ZL9A 2H0HA 2HT9A 3FR6A 4XS4B 2GVPA 2H6YA 2CAQA 5KN3A 2WCIA 2M46A 1GSFA 2DBCA 6GSUA 3RAZA 3O6TA 5DAKA 5B8AA 2GSRA 2MYGA 2H73A 5D9VA 4Q5RA 4RUVA 2CQ9A 1SL0B 1V98A 4PNFA 2AV4A 1N2AA 1XZOA 4GSNA 2HLSA 1YEPA 1KNGA 2P5QA 2AJQB 4NWYA 1O6JA 2L5OA 5HQPA 1YF1A 3GTUB 1X9SB 1GSYA 3N9JA 3VI7A 3EE2A 4J57E 1VF3A 6GSXA 2PVQA 3F6FA 3H79A 3KD0A 3QCPA 1B9YC 1DSBA 3KCMA 2H72A 1A0RP 2YN1A 4BWSA 4Q5QA 2YANA 3EU3A 1A0FA 1ZL9A 4PURA 1N8JA 4L8EA 1YF0A 1X9WB 1UVZA 4NPBA 5GSSA 1YKCA 2OE1A 4DSSA 4LMVA 4ML6A 3KTLA 5G31A 4PQIA 4NHWA 3HJMA 2AUVA 2PBJA 2VLVA 2OADA 4J56E 3F8UA 3L78A 1O73A 5AIXA 4HZ2A 2EC4A 1BEDA 2GDRA 4KUNA 3CRUA 4TR4A 2PVOC 2FHEA 4OFNA 1XW6A 2YJHA 3IE3A 3VLNA 2C3NA 1PGTA 3FZ9A 1TDIA 2GQMA 3BJ5A 4IP1A 3CTFA 3TKRA 3GYKA 1F3BA 3DEXA 4MJEA 4O32A 2YV7A 1HNBA 2A2SA 1LJRA 1UN2A 2H75A 18GSA 4MF5A 4ZBBA 3HVVA 4LL1B 4F9ZA 1DBYA 2LNSA 1M7TA 3A2VA 3U5RE 3KH9A 3TOUA 5J41A 1JLWA 2VCWA 4IHUA 3UBLA 5IOWA 2DLXA 4WR5A 3IR4A 1Q4JA 1ST9A 4G2EA 2C80A 4G19A 1Y6EA 4WXTA 2NTOA 2GSSA 1T1VA 5F07A 1PN9A 1QMVA 2TRXA 4EDYA 3ZIJA 2GQLA 1UA5A 3E3EA 2QSIA 2DJ1A 3UVTA 3L9VA 3IOSA 3J7Yk 2KP2A 1SYRA 3GMFA 2KOKA 2NPBA 2KUCA 1GSEA 1PA3A 3UAPA 4K7NA 4TOPA 1XVWA 2B5EA 4IGJA 1TTZA 1GL8A 5E4WA 2P0GA 1USBA 2CV4A 4OD7A 2MBTA 3IAS2 3N5OA 2K6VA 2YWOA 3JCML 4GCIA 4GXZA 2VLTA 3H8QA 3HA9A 2X8CA 3HJPA 1C72A 3CMIA 4ZB6A 2VL2C 3TJFA 4WETA 2IN3A 4HJ2A 3TDGA 1G7EA 3M8NA 3FR3A 4IJIA 2ZUPA 2FA8A 5B7CA 3ZTLA 4AJ6A 4GWRA 1TI3A 2CAIA 1ML6A 2C4JA 4NHZA 1KTEA 1WMJA 5ECSA 1T00A 5IMDA 4OWYA 2IPAA 1SD8A 1SL1B 1XW5A 4KDUA 2WJUA 3CTGA 3UEMA 1VRSD 3ZL5A 1TU7A 1TKDB 1XWBA 1YDKA 2IIYA 4CHSA 4POKA 1U6TA 1O81A 2YV9A 6GSWA 2MMOA 2OKAA 2GTUA 3KMNA 4IQAA 2C1YA 4EKZA 1Z7RA 5D93A 1V57A 1BYEA 3CRTA 2A2RA 5DALB 1MD4A 2ALBA 1JZOA 4KE3A 2YWIA 3F4RA 5DVBA 3TCOA 5IMZA 2VOCA 1XBSA 2B7KA 2X99A 4F0BA 1V2AA 2NBSA 11GSA 4EXJA 1TK0B 2C0EA 1ACVA 1TOFA 3GSTA 2H1AA 2VD1A 1QXHA 4HU7A 2OA7A 2V2GA 3GKKA 3EURA 3US3A 3IPZA 2B1LA 4I2UA 3HJOA 4ISDA 2LKUA 1EGOA 2AHEA 1TW9A 2EIOA 1RW1A 1S3AA 5CREA 3PH9A 4HQSA 1Z7PA 6GSVA 2LUSA 4YQMA 2KP1A 2JADA 3LFLA 1ZZYA 2WFCA 2O8VB 3F0IA 1OYJA 1F37A 4BA7A 1PSQA 5DDLA 1BAYA 3WGXA 3GKXA 3UBKA 4HQZA 4P3YB 2YCDA 3H93A 3NIVA 5HR2A 3LQ7A 5IMVA 3KJYA 5ECRB 1SKSB 5ECHB 4HJMA 2YP6A 4ZBDA 1WE0A 5J9BA 3L4NA 3TRPA 1TK8B 2FWFA 4OO5A 1AQXA 2R5GA 5CP1A 2VD0A 2RM6A 4EO3A 1EP8A 4GRFA 2H0IA 4TXOA 4EC0A 5CRGA 1PX6A 4KCAA 2K8SA 2HFDA 4OFMA 5IMFA 5AN1A 1AXDA 2FWGA 4MPFA 4ZL7A 3VI5A 14GSA 4MCUA 3HZ8A 3C1SA 4IN0A 2FY6A 3M3MA 4PXOA 2VAFA 2N5FA 1FOVA 4O5RA 2IFQA 2LRTA 4MDCA 3SWLA 3HDCA 1TRUA 2XBQA 1G6YA 1GWCA 2H0GA 2L6CA 3QFBC 5ECQB 2K8VA 3WT1A 1GUKA 2H19A 1MDJA 5B6NA 4NMUA 1XOAA 1YY7A 4K8MA 3EMPA 2LV3A 2F51A 4EDZA 2L59A 2P31A 1FVJA 1XWCA 1K0DA 5ECKB 4V2LA 4TKYA 2HZEB 3GUSA 4MF6A 1SL2B 1A8LA 2WS2A 1JZRA 1O8WA 5HFKA 2IWTA 1EV9A 3PGTA 2H1GA 4DSRA 3ZMKA 5ID2B 2JACA 4V2MA 2F8FA 3TJKA 4BL7A 5G1LA 4WEYA 3D0ZA 1GULA 2BMXA 4OCFA 1BX9A 3ERGA 5DQSA 2QGVA 3Q18A 1HNCA 1XW9A 1E6BA 2C3TA 2VL9A 2AYTA 2O87A 2GZYA 1ERVA 5D9WA 1XXUA 3RDWA 4MF7A 4QL9A 4IVFA 1SKWB 1GH2A 3I6AA 3GIXA 1YZXA 2DIYA 4WBJA 2X8GA 3ME8A 3KMOA 1GTBA 1F2EA 3M9KA 4X1UA 4BVXA 1AW9A 1EEMA 1SK0A 1MTCA 3DD3A 3KGKA 2H01A 2A4VA 2FGXA 1GP1A 2F3MA 1ILOA 5H5SA 3W8SA 1YQ1A 3S9FA 4ACSA 4XS4A 2JU5A 1XPVA 3I43A 4YAPA 1WIKA 5CO3A 1M0UA 1CQGA 3A3TA 4OCEA 3ZLPA 2DMMA 3CSJA 2X8HA 2E0QA 5LNKe 3L9SA 2PUKC 3P8WA 4I2TA 3ZRDA 3EINA 1R5AA 2J9HA 3RPNA 1TJDA 5D73A 4MJAA 2WB9A 3HHVA 3D4TA 3A5WA 1FG4A 4ZXGA 5ELGA 4BWQA 1K3LA 3F4SA 3QMXA 4KX4A 5IPGA 1K0MA 3DRNA 2CZ3A 4K0NA 6GSTA 4LA1A 1EOHA 3HY2A 4DSSB 3WYWA 4YQVA 1JFUA 5JCUA 1GTIA 2GLRA 4G9HA 4I97A 4JE1A 3GTUA 4E8HA 1O7UA 2HNLA 3LYKA 1TP9A 5FT3A 3WGEA 4TR1B 2C0FA 5A4VA 3GSSA 1T8EB 1OE7A 3RBTA 1GLQA 4Q5FA 1DUGA 2I9HA 3D4MA 1GSQA 5IOXA 4KNDA 3IK9A 4L5LA 5J9CA 2E7PA 2YWNA 3IXRA 4FO5A 3GL5A 4FIWA 3KZQA 4HEA2 4AJ8A 1FB6A 2DIZA 1WPIA 1M2BA 3QAWA 3MWHA 4IELA 1NHOA 5J3RA 3CXGA 3TB2A 2H30A 1PMTA 2XPDA 4OO4A 1GNWA 1NW2A 5GAPD 1THOA 3IA1A 3GHAA 1TI1A 1NM3A 2CX3A 2CT6A 2C0GA 3ED3A 5ENUA 5D8IA 4FYBA 5A4UA 5HR3A
chains in the Genus database with same CATH superfamily
1ERTA 3DVXA 17GSA 2JZTA 3FZ5A 2MZCA 5DJMA 4X43A 3C73A 8GSSA 1F3AA 3QFAC 1SD9A 4L0UA 5EVOA 3CBUA 2H8LA 2IMDA 2V41A 4N0VA 1Z9HA 1XG8A 4HUAA 3UL3A 4IKHA 1PKWA 3DMLA 3GV1A 4YQUA 1HNAA 5JWQB 2R3XA 4GTUA 3W8JA 1VF1A 2D2ZA 5ECPB 3ZITA 1HYUA 2VCTA 2V6KA 1TRVA 5IMCA 4ZL8A 3LSZA 2R0PA 2PN8A 1A2JA 4MPGA 3HZ4A 3KIJA 2JZSA 3VWXA 4MZWA 2H66A 5CNWA 1VF4A 4OMVA 1Z5YE 2CVDA 2V32A 2RUEA 3ZIVA 4K0GA 2B5YA 1FVKA 2X64A 3ZREA 1SU9A 1XOBA 4XRDA 3GL3A 1NHYA 4EE0A 4PQHA 3IHGA 5DCHA 5KEJA 4RQRA 2RLIA 3BBYA 4HS1A 4K5RA 13GSA 1XCCA 4MZCA 1X5DA 3Q6OA 1A2LA 3TJJA 1OAZA 2H1BA 2LJKA 4ECIA 4I6XA 4IBPA 2VCVA 2FCHA 1J0FA 4MA9A 1QFNA 2O85A 2FWEA 3ERWA 1PRXA 2VM2A 3FR9A 3TGZA 3QOUA 2DC5A 2AAWA 2EIQA 4K9ZA 1U3AA 2C0DA 2OACA 3F4TA 2KHPA 4QQ7A 5C04A 2R4VA 3WGDA 4O92A 3VWUA 5IO2A 1WP0A 1FAAA 1URMA 2RUFA 5GAND 4EIQA 2GT5A 4K7OA 4F03A 4JEDA 2CVKA 3GKMA 3PR8A 4IJ3A 1TU8A 2YWMA 3IC4A 1MD3A 3W6GA 5IO0A 1E2YA 2GZZA 1H75A 5ECLB 2LJAA 2MBSA 4MABA 1XWAA 1M2AA 2RIIA 2AB6A 1K0CA 3NZNA 2IMFA 5B8BA 4HI7A 3QAGA 2TIRA 3I69A 4F0CA 1AIUA 1M3JA 5IIZA 2VL2A 5COHA 2R6KA 1WOUA 4GQFA 2JSZA 1PL2A 3APQA 4YH2A 5ELAA 1LU4A 2DMLA 1YKAA 2LRCA 6GSSA 2V6OA 4CW9A 5IQYA 3TJBA 1G7OA 1ZYNA 1HQOA 2CA8A 3HCZA 2H6ZA 1BJXA 3EC3A 3CSIA 3IK7A 3HVSA 3PINA 3KH7A 2Z9SA 4KDXA 4G0IA 5HR1A 3GKNA 2OBKA 2E2GA 2QA2A 3DXBA 3FEUA 1YJ6A 1A23A 3FY7A 2PGTA 5JWRB 4I8BA 4OFTA 3J7Yb 2C3QA 2DSAA 2PMTA 3FW2A 5ECIB 2KLXA 1AUCA 1B4QA 4KGIA 3VURA 1OC8A 3WT2A 3D21A 4I5QA 1ZCPA 5CYYA 5EL8A 12GSA 2YNXA 3CSHA 3FRCA 3MDKA 3U6VA 1K0NA 1GSSA 4JBBA 3RPPA 1FB0A 3QR6A 3IRAA 4TXOB 3MYDA 1HD2A 2WZ9A 4JR6A 2YPMA 2XPEA 2N5AA 3FZAA 2FNOA 1XFLA 5CRHA 5D9XA 3BCIA 4N11A 4XS6A 4LMWA 1ON4A 2H1DA 1JLVA 3TOTA 4KCEA 2ZCTA 2XHFA 3AY8A 4GQCA 5IMAA 1EGRA 1TRWA 4WF5A 3RHCA 4ULXA 1U3IA 1H4OA 1TXXA 4POLA 3QPMA 4D73A 5IPHA 3G7JA 3GA4A 5JWOB 3DYRA 5F06A 3ZYWA 3Q19A 5KN2A 1G0TA 1ZMAA 1DE2A 1SJZA 4XRAA 1G6WA 2V1MA 2WDUA 1OC9B 3O3TA 4JRRA 2GSQA 2GSTA 2HYXA 1RK4A 5DQYA 3F6DA 2HRNA 2HI7A 4PTSA 3HYPA 1T4YA 5G5EA 3VK9A 1WWJA 4ZIJA 1THXA 4FQUA 4PUFC 1R26A 3IHQA 3FYGA 1M99A 2EIRA 1OVNA 1S3CA 4TW5A 1DE1A 1ZYEA 4RI6A 3TKPA 4E8EA 2MMZA 2H76A 3UARA 1K0AA 1B8XA 3A2WA 2CZ2A 1PL1A 1SENA 4EUYA 2XC2A 2IL3A 3QAVA 4XTSA 1T3BA 3VPTA 4KAEA 4BL7B 3LJRA 4V1Ap 5JCGA 2VLUA 5EY6A 3E9JB 1WRYA 4MJCA 3UJ1A 1T4ZA 4NV2A 2OE0A 1AC1A 2I3YA 3G7IA 4ICYA 3LORA 3G7YA 2B3SA 2C8UA 1F6MC 3EVIA 1BG5A 4HOJA 1EOGA 3DGQA 2R2JA 1J9BA 4WR4A 4CY6A 1A24A 2IMKA 1Z3EA 4K7IA 2XBIA 3TRQA 1K0BA 1V9WA 5J5NA 4TRXA 4BVXB 4RQXA 2L4QA 3F3RA 1V40A 5DAKB 4F82A 4MLYA 1XWKA 4WBRD 4KB3A 3ZFLA 3TKQA 1XVQA 4KF9A 1IYHA 2QC7A 2REMA 3BCKA 4X4JA 4Z2RA 5ID2A 6GSYA 2QKEA 2QA1A 3L9UA 1NSWA 5KN1A 4XHMA 3TKSC 2MMAA 5ECNB 5F0GA 4G0LA 3VPQA 1I5GA 2WRTA 5G1KA 2DKIA 2OBIA 3APSA 1ZYQB 3HXSA 4EF0A 3GH9A 2VCQA 3KXOA 3ZVJD 3F3QA 3FZ4A 1EP7A 2F9SA 4ECJA 4K1FA 2N5BA 2LQOA 3SBCA 3F9UA 3C1RA 1X9MB 3D5JA 4POMA 3A5IA 5FHIA 4ECCA 3KTBA 1SYXA 4HDEA 5FWGA 2YJ7A 4ILFA 1V58A 2LNTA 4G0KA 3GRXA 2RM5A 1R4WA 1RQMA 2VIMA 1Y25A 3RHBA 4GF0A 2DJKA 4Q5NA 2VM1A 4AJ7A 5CRWA 4ZB8A 4MJBA 1PD21 1F9MA 3D22A 4MK3A 3DIEA 2I4AA 1I9DA 4FH8A 1QUWA 4DVCA 4PGTA 2F8AA 3TKSA 2PERA 2UZ8A 4JU5A 2ES7A 1GUHA 2LTKA 5J4UA 4MMMA 1B9XC 4KH7A 5GZZB 2A4HA 3EU4A 3M1GA 3E0UA 4ZB9A 5HFGA 4EVMA 5ECMB 3UVHA 4MH3A 2H70A 3EWLA 2WULA 2H71A 4N0ZA 5F8BA 2I1UA 3LEFA 2ZNMA 5A5KA 2B1KA 1EZKA 2BJXA 5AISA 1ERUA 1AQVA 1LBKA 3FK8A 4XCSA 3GX0A 2IJYA 2I81A 4NXIA 2VCZA 4TR1A 2HSHA 2BTOT 1JZWA 2L57A 5B6MA 3MIXA 2VUPA 5CAXA 1OKTA 3NOFA 4JR4A 2HRAA 1GSDA 3OR5A 3R2QA 3TJGA 4PUAA 4XS1A 4BVYA 1KBNA 1T7PB 2HE3A 5IM9A 3ZMLA 2YZHA 4YKFA 2VO4A 4FYCA 2B5XA 1A8YA 4KSOA 3GH6A 3MSZA 4K2DA 3A2XA 1J08A 4V2NA 3GFKA 5GSTA 4ZILA 2NVLA 1M9AA 3P90A 1VGLA 1GUMA 2H74A 5D9TA 1TK5B 4J2FA 4N30A 3DWVA 2VCXA 4WKWA 4IS0A 2FA4A 1GTUA 2YOIA 2HXKA 4TN8A 2LEGA 3ME7A 2HSYA 4A5PA 4NV5A 3M9JA 2CVBA 3LGCA 3VWWA 4ID0A 4AF2A 3KP9A 1FHEA 1EWXA 3LXZA 4ECBA 2OJLA 2FWHA 3APOA 1MDIA 3FHKA 1QK8A 4USSA 2X49A 22GSA 4RI7A 1ABAA 2VL3A 4POBA 1JHBA 2LS5A 2ON5A 4IW9A 4ZBAA 5G2ZA 1R5PA 4HZ4A 3G9BA 1SJIA 1CQHA 3TKSE 1ZGNA 2M80A 3IDVA 4G10A 4GLTA 1YEXA 5JCWA 2PU9C 3H4KA 1FW1A 4GSSA 3GURA 3GX8A 1U88A 4DSQA 3ZZXA 2DJJA 5EPFA 2IMIA 1Q98A 1PKZA 2PWJA 4CDOA 1OE8A 4K6XA 2LRNA 2GQKA 3KP8A 3QD9A 1GSUA 3ZFBA 1M2DA 1ZOFA 4TR3A 1EEJA 1WJKA 1S3RA 3PPUA 3LWAA 2MMNA 4YAVA 2DJ0A 3VFIA 1S3DA 4KW6A 1GTAA 1QQ2A 4F2IA 1PFOA 1PN0A 2O89A 3V1WA 4JZQA 4WF4A 3F63A 1A2MA 5HR0A 3I9V2 3GN3A 3Q74A 3C71A 4LL4B 5E59A 5BMUA 1Z6MA 2J23A 1R7HA 9GSSA 3TUEA 1JZDA 1B48A 3VWVA 4L0WA 2K18A 3ZVJA 1K3YA 3HVXA 4IQ1A 5ECOB 3ISOA 2JZRA 2G2QA 4KSMA 1KEBA 1AAZA 1ERWA 5G30A 16GSA 3LYPA 4MP4A 3QDNA 5DALA 5D96A 2HRFA 5C00A 4XIHA 4K2XA 5LCZA 3L0HA 1OC3A 1XIYA 1VF2A 2LSTA 4PX1A 5HFIA 4AGSA 1IYIA 2GS3A 1EV4A 4PNGA 7GSSA 3D6IA 2X4AA 3R3EA 3HKRA 1X0RA 3EMXA 3H1NA 3UMAA 5DJLA 5KOWA 4N10A 1X5EA 1GRXA 3MAKA 2B7JA 3LXTA 1W4VA 3BD2A 2E2MA 1PX7A 1AQWA 2DJ3A 1O8XA 2WGRA 3P2AA 1M9BA 3WD6A 1PQNA 1XWGA 1Z6NA 5L71A 4O7HA 3ERFA 2GZPA 3DKSA 5H5RA 3M0FA 4Z7XA 1GNEA 20GSA 4MH2A 5AGYA 5LD0A 2O7KA 1B4PA 2IMEA 5H5QA 4D73B 3UIWA 2DJ2A 3IV4A 4QL7A 1UC7A 2M72A 1SJ6A 4TR0A 1BQ7A 1O85A 2LQQA 5INYA 3P7XA 3IAM2 2LJRA 3BOAA 5ABRA 2R37A 5AIVA 4LLRA 4V1Ag 5G5FA 1TRSA 2K9FA 2IFQB 2FLSA 2P5RA 5A4WA 1X5CA 2CX4A 1K3OA 4MZBA 3UOMA 5KN0A 1MDKA 2YZUA 4GSTA 2DKHA 3CYNA 4IP6A 10GSA 3C7MA 4KA0A 4X0XA 2TRCP 4K5SA 1FO5A 1OKDA 4PQ1A 1K0OA 2L4CA 3KEBA 5DCGA 4BPYA 1W89A 3DVWA 2FD3A 3IBHA 4H86A 2B6MA 4ML1A 5DBQA 5F05A 1OC9A 4DEJA 2L5LA 19GSA 4NAXA 4L5OA 2FUG2 5CRDA 2OE3A 3KM6A 3HD5A 3C8EA 2JSYA 1SK1A 3EYTA 3MNGA 2GT6A 2NDOA 2L6DA 3LG6A 1SK2A 3K8NA 1SKRB 2JL4A 2H6XA 4FYUA 1QGVA 2HZFA 3GNJA 4EL1A 2HZEA 4HU9A 1U87A 2GGTA 4KDYA 3TRXA 4TVEA 3O76A 1GLPA 2PPTA 4TXVA 2G0FA 1MEKA 2A2PA 2ON7A 3FKFA 4ZL9A 2H0HA 2HT9A 3FR6A 4XS4B 2GVPA 2H6YA 2CAQA 5KN3A 2WCIA 2M46A 1GSFA 2DBCA 6GSUA 3RAZA 3O6TA 5DAKA 5B8AA 2GSRA 2MYGA 2H73A 5D9VA 4Q5RA 4RUVA 2CQ9A 1SL0B 1V98A 3IC8A 4PNFA 2AV4A 1N2AA 1XZOA 4GSNA 2HLSA 1YEPA 1KNGA 2P5QA 2AJQB 4NWYA 1O6JA 2L5OA 5HQPA 1YF1A 3GTUB 1X9SB 1GSYA 3N9JA 3VI7A 3EE2A 4J57E 1VF3A 6GSXA 2PVQA 3F6FA 3H79A 3KD0A 3QCPA 1B9YC 1DSBA 3KCMA 2H72A 1A0RP 2YN1A 4BWSA 4Q5QA 2YANA 3EU3A 1A0FA 1ZL9A 4PURA 1N8JA 4L8EA 1YF0A 1X9WB 1UVZA 4NPBA 5GSSA 1YKCA 2OE1A 4DSSA 4LMVA 4ML6A 3KTLA 5G31A 4PQIA 4NHWA 3HJMA 2AUVA 2PBJA 2VLVA 2OADA 4J56E 3F8UA 3L78A 1O73A 5AIXA 4HZ2A 2EC4A 1BEDA 2GDRA 4KUNA 3CRUA 4TR4A 2PVOC 2FHEA 4OFNA 1XW6A 2YJHA 3IE3A 3VLNA 2C3NA 1PGTA 3FZ9A 1TDIA 2GQMA 3BJ5A 4IP1A 3CTFA 3TKRA 3GYKA 1F3BA 3DEXA 4MJEA 4O32A 2YV7A 1HNBA 2A2SA 1LJRA 1UN2A 2H75A 18GSA 4MF5A 4ZBBA 3HVVA 4LL1B 4F9ZA 1DBYA 2LNSA 1M7TA 3A2VA 3U5RE 3KH9A 3TOUA 5J41A 1JLWA 2VCWA 4IHUA 3UBLA 5IOWA 2DLXA 4WR5A 3IR4A 1Q4JA 1ST9A 4G2EA 1M3IA 2C80A 4G19A 1Y6EA 4WXTA 2NTOA 2GSSA 1T1VA 5F07A 1PN9A 1QMVA 2TRXA 4EDYA 3ZIJA 2GQLA 1UA5A 3E3EA 2QSIA 2DJ1A 3UVTA 3L9VA 3IOSA 3J7Yk 2KP2A 1SYRA 3GMFA 2KOKA 2NPBA 2KUCA 1GSEA 1PA3A 3UAPA 4K7NA 4TOPA 1XVWA 2B5EA 4IGJA 1TTZA 1GL8A 5E4WA 2P0GA 1USBA 2CV4A 4OD7A 2MBTA 3IAS2 3N5OA 2K6VA 2YWOA 3JCML 4GCIA 4GXZA 2VLTA 3H8QA 3HA9A 2X8CA 3HJPA 1C72A 3CMIA 4ZB6A 2VL2C 3TJFA 4WETA 2IN3A 4HJ2A 3TDGA 1G7EA 3M8NA 3FR3A 4IJIA 2ZUPA 2FA8A 5B7CA 3ZTLA 4AJ6A 4GWRA 1TI3A 2CAIA 1ML6A 2C4JA 4NHZA 1KTEA 1WMJA 5ECSA 1T00A 5IMDA 4OWYA 2IPAA 1SD8A 1SL1B 1XW5A 4KDUA 2WJUA 3CTGA 3UEMA 1VRSD 3ZL5A 1TU7A 1TKDB 1XWBA 1YDKA 2IIYA 4CHSA 4POKA 1U6TA 1O81A 2YV9A 6GSWA 2MMOA 2OKAA 2GTUA 3KMNA 4IQAA 2C1YA 4EKZA 1Z7RA 5D93A 1V57A 1BYEA 3CRTA 2A2RA 5DALB 1MD4A 2ALBA 1JZOA 4KE3A 2YWIA 3F4RA 5DVBA 3TCOA 5IMZA 2VOCA 1XBSA 2B7KA 2X99A 4BIKA 4F0BA 1V2AA 2NBSA 11GSA 4EXJA 1TK0B 3LW9A 2C0EA 1ACVA 1TOFA 3GSTA 4CY8A 2H1AA 2VD1A 1QXHA 4HU7A 2OA7A 2V2GA 3GKKA 3EURA 3US3A 3IPZA 2B1LA 4I2UA 3HJOA 4ISDA 2LKUA 1EGOA 2AHEA 1TW9A 2EIOA 1RW1A 1S3AA 5CREA 3PH9A 4HQSA 1Z7PA 6GSVA 2LUSA 4YQMA 2KP1A 2JADA 3LFLA 1ZZYA 2WFCA 2O8VB 3F0IA 1OYJA 1F37A 4BA7A 1PSQA 5DDLA 1BAYA 3WGXA 3GKXA 3UBKA 4HQZA 4P3YB 2YCDA 3H93A 3NIVA 5HR2A 4O5UA 3LQ7A 5IMVA 3KJYA 5ECRB 1SKSB 5ECHB 4HJMA 2YP6A 4ZBDA 1WE0A 5J9BA 3L4NA 3TRPA 1TK8B 2FWFA 4OO5A 1AQXA 2R5GA 5CP1A 2VD0A 2RM6A 4EO3A 1EP8A 4GRFA 2H0IA 4TXOA 4EC0A 5CRGA 1PX6A 4KCAA 2K8SA 2HFDA 4OFMA 5IMFA 5AN1A 1AXDA 2FWGA 4MPFA 4ZL7A 3VI5A 14GSA 3EPTA 4MCUA 3HZ8A 3C1SA 4IN0A 2FY6A 3M3MA 4PXOA 2VAFA 2N5FA 5KOXA 1FOVA 4O5RA 2IFQA 2LRTA 4MDCA 3SWLA 3HDCA 1TRUA 2XBQA 1G6YA 1GWCA 2H0GA 4EIPA 2L6CA 3QFBC 2R0GA 5ECQB 2K8VA 3WT1A 1GUKA 2H19A 1MDJA 5B6NA 4NMUA 1XOAA 1YY7A 4K8MA 3EMPA 2LV3A 2F51A 4EDZA 2L59A 5BRTA 2P31A 1FVJA 1XWCA 1K0DA 5ECKB 4V2LA 4TKYA 2HZEB 3GUSA 4Z2TA 4MF6A 1SL2B 1A8LA 2WS2A 1JZRA 1O8WA 5HFKA 2IWTA 1EV9A 3PGTA 2R0CA 2H1GA 4DSRA 1ZYPA 3ZMKA 5ID2B 2JACA 4V2MA 2F8FA 3TJKA 4BL7A 5G1LA 1FOHA 4WEYA 3D0ZA 1GULA 2BMXA 4OCFA 1BX9A 3ERGA 5DQSA 2QGVA 3Q18A 1HNCA 1XW9A 1E6BA 2C3TA 2VL9A 2AYTA 2O87A 2GZYA 1ERVA 5D9WA 1XXUA 3RDWA 4MF7A 4QL9A 4IVFA 1SKWB 1GH2A 3I6AA 3GIXA 1YZXA 2DIYA 4WBJA 2X8GA 3ME8A 3KMOA 1GTBA 1F2EA 3M9KA 4X1UA 4BVXA 1AW9A 1EEMA 1SK0A 1MTCA 3DD3A 3KGKA 2H01A 2A4VA 2FGXA 1GP1A 2F3MA 1ILOA 5H5SA 3W8SA 4Z2UA 1YQ1A 3S9FA 4ACSA 4XS4A 2JU5A 1XPVA 3I43A 4YAPA 1WIKA 5CO3A 1M0UA 1CQGA 3A3TA 4OCEA 3ZLPA 2DMMA 3CSJA 2X8HA 2E0QA 5LNKe 3L9SA 2PUKC 3P8WA 4I2TA 3ZRDA 3EINA 1R5AA 2J9HA 3RPNA 1TJDA 5D73A 4MJAA 3FMWA 4O5QA 2WB9A 3HHVA 3D4TA 3A5WA 1FG4A 4ZXGA 5ELGA 4YKGA 4BWQA 1K3LA 3F4SA 3QMXA 4KX4A 5IPGA 1K0MA 3DRNA 2CZ3A 4K0NA 3CQFA 4MNNA 6GSTA 4LA1A 1EOHA 3HY2A 4DSSB 3WYWA 4YQVA 1JFUA 5JCUA 1GTIA 2GLRA 4G9HA 4I97A 4JE1A 3GTUA 4E8HA 1O7UA 2HNLA 3LYKA 1TP9A 5FT3A 3WGEA 4TR1B 2C0FA 5A4VA 3GSSA 1T8EB 1OE7A 3RBTA 1GLQA 4Q5FA 1DUGA 2I9HA 3D4MA 1GSQA 5IOXA 4KNDA 3IK9A 4L5LA 5J9CA 3HVNA 2E7PA 2YWNA 3IXRA 4FO5A 3GL5A 4FIWA 3KZQA 4HEA2 4AJ8A 1FB6A 2HSMA 2DIZA 1WPIA 4BVYB 1M2BA 3QAWA 3MWHA 4IELA 1NHOA 5J3RA 3CXGA 3TB2A 2H30A 1PMTA 2XPDA 4OO4A 1GNWA 1NW2A 5GAPD 1THOA 3IA1A 4HSCX 3GHAA 1TI1A 1NM3A 2CX3A 2CT6A 2HRKA 2C0GA 3ED3A 5ENUA 5D8IA 4FYBA 5A4UA 5HR3A
chains in the Genus database with same CATH topology
1ERTA 3DVXA 17GSA 2JZTA 3FZ5A 2MZCA 5DJMA 4X43A 3C73A 8GSSA 1F3AA 3QFAC 1SD9A 4L0UA 5EVOA 3CBUA 2H8LA 2IMDA 2V41A 4N0VA 1Z9HA 4HUAA 3UL3A 4IKHA 1PKWA 3DMLA 3GV1A 4YQUA 1HNAA 5JWQB 2R3XA 4GTUA 3W8JA 1VF1A 2D2ZA 5ECPB 3ZITA 1HYUA 2VCTA 2V6KA 1TRVA 5IMCA 4ZL8A 3LSZA 2R0PA 2PN8A 1A2JA 4MPGA 3HZ4A 3KIJA 2JZSA 3VWXA 4MZWA 2H66A 5CNWA 1VF4A 4OMVA 1Z5YE 2CVDA 2V32A 2RUEA 3ZIVA 4K0GA 2B5YA 1FVKA 2X64A 3ZREA 1SU9A 1XOBA 4XRDA 3GL3A 1NHYA 4EE0A 4PQHA 3IHGA 5DCHA 5KEJA 4RQRA 2RLIA 3BBYA 4HS1A 4K5RA 13GSA 1XCCA 4MZCA 1X5DA 3Q6OA 1A2LA 3TJJA 1OAZA 2H1BA 2LJKA 4ECIA 4I6XA 4IBPA 2VCVA 2FCHA 1J0FA 4MA9A 1QFNA 2O85A 2FWEA 3ERWA 1PRXA 2VM2A 3FR9A 3TGZA 3QOUA 2DC5A 2AAWA 2EIQA 4K9ZA 1U3AA 2C0DA 2OACA 3F4TA 2KHPA 4QQ7A 5C04A 2R4VA 3WGDA 4O92A 3VWUA 5IO2A 1WP0A 1FAAA 1URMA 2RUFA 5GAND 4EIQA 2GT5A 4K7OA 4F03A 4JEDA 2CVKA 3GKMA 3PR8A 4IJ3A 1TU8A 2YWMA 3IC4A 1MD3A 3W6GA 5IO0A 1E2YA 2GZZA 1H75A 5ECLB 2LJAA 2MBSA 4MABA 1XWAA 1M2AA 2RIIA 2AB6A 1K0CA 3NZNA 2IMFA 5B8BA 4HI7A 3QAGA 2TIRA 3I69A 4F0CA 1AIUA 5IIZA 2VL2A 5COHA 2R6KA 1WOUA 4GQFA 2JSZA 1PL2A 3APQA 4YH2A 5ELAA 1LU4A 2DMLA 1YKAA 2LRCA 6GSSA 2V6OA 4CW9A 5IQYA 3TJBA 1G7OA 1ZYNA 1HQOA 2CA8A 3HCZA 2H6ZA 1BJXA 3EC3A 3CSIA 3IK7A 3HVSA 3PINA 3KH7A 2Z9SA 4KDXA 4G0IA 5HR1A 3GKNA 2OBKA 2E2GA 2QA2A 3DXBA 3FEUA 1YJ6A 1A23A 3FY7A 2PGTA 5JWRB 4I8BA 4OFTA 3J7Yb 2C3QA 2DSAA 2PMTA 3FW2A 5ECIB 2KLXA 1AUCA 1B4QA 4KGIA 3VURA 1OC8A 3WT2A 3D21A 4I5QA 1ZCPA 5CYYA 5EL8A 12GSA 2YNXA 3CSHA 3FRCA 3MDKA 3U6VA 1K0NA 1GSSA 4JBBA 3RPPA 1FB0A 3QR6A 3IRAA 4TXOB 3MYDA 1HD2A 2WZ9A 4JR6A 2YPMA 2XPEA 2N5AA 3FZAA 2FNOA 1XFLA 5CRHA 5D9XA 3BCIA 4N11A 4XS6A 1ON4A 4LMWA 2H1DA 1JLVA 3TOTA 4KCEA 2ZCTA 2XHFA 3AY8A 4GQCA 5IMAA 1EGRA 1TRWA 4WF5A 3RHCA 4ULXA 1U3IA 1H4OA 1TXXA 4POLA 3QPMA 4D73A 5IPHA 3G7JA 3GA4A 5JWOB 3DYRA 5F06A 3ZYWA 3Q19A 5KN2A 1G0TA 1ZMAA 1DE2A 1SJZA 4XRAA 1G6WA 2V1MA 2WDUA 1OC9B 3O3TA 4JRRA 2GSQA 2GSTA 2HYXA 1RK4A 5DQYA 3F6DA 2HRNA 2HI7A 4PTSA 3HYPA 1T4YA 5G5EA 3VK9A 1WWJA 4ZIJA 1THXA 4FQUA 4PUFC 1R26A 3IHQA 3FYGA 1M99A 2EIRA 1OVNA 1S3CA 4TW5A 1DE1A 1ZYEA 4RI6A 3TKPA 4E8EA 2MMZA 2H76A 3UARA 1K0AA 1B8XA 3A2WA 2CZ2A 1PL1A 1SENA 4EUYA 2XC2A 2IL3A 3QAVA 4XTSA 1T3BA 3VPTA 4KAEA 4BL7B 3LJRA 4V1Ap 5JCGA 2VLUA 5EY6A 3E9JB 1WRYA 4MJCA 3UJ1A 1T4ZA 4NV2A 2OE0A 1AC1A 2I3YA 3G7IA 4ICYA 3LORA 3G7YA 2B3SA 2C8UA 1F6MC 3EVIA 1BG5A 4HOJA 1EOGA 3DGQA 2R2JA 1J9BA 4WR4A 4CY6A 1A24A 2IMKA 1Z3EA 4K7IA 2XBIA 3TRQA 1K0BA 1V9WA 5J5NA 4TRXA 4BVXB 4RQXA 2L4QA 3F3RA 1V40A 5DAKB 4F82A 4MLYA 1XWKA 4WBRD 4KB3A 3ZFLA 3TKQA 1XVQA 4KF9A 1IYHA 2QC7A 2REMA 3BCKA 4X4JA 4Z2RA 5ID2A 6GSYA 2QKEA 2QA1A 3L9UA 1NSWA 5KN1A 4XHMA 3TKSC 2MMAA 5ECNB 5F0GA 4G0LA 3VPQA 1I5GA 2WRTA 5G1KA 2DKIA 2OBIA 3APSA 1ZYQB 3HXSA 4EF0A 3GH9A 2VCQA 3KXOA 3ZVJD 3F3QA 3FZ4A 1EP7A 2F9SA 4ECJA 4K1FA 2N5BA 2LQOA 3SBCA 3F9UA 3C1RA 1X9MB 3D5JA 4POMA 3A5IA 5FHIA 4ECCA 3KTBA 1SYXA 4HDEA 5FWGA 2YJ7A 4ILFA 1V58A 2LNTA 4G0KA 3GRXA 2RM5A 1R4WA 1RQMA 2VIMA 1Y25A 3RHBA 4GF0A 2DJKA 4Q5NA 2VM1A 4AJ7A 5CRWA 4ZB8A 4MJBA 1PD21 1F9MA 3D22A 4MK3A 3DIEA 2I4AA 1I9DA 4FH8A 1QUWA 4DVCA 4PGTA 2F8AA 3TKSA 2PERA 2UZ8A 4JU5A 2ES7A 1GUHA 2LTKA 5J4UA 4MMMA 1B9XC 4KH7A 5GZZB 2A4HA 3EU4A 3M1GA 3E0UA 4ZB9A 5HFGA 4EVMA 5ECMB 3UVHA 4MH3A 2H70A 3EWLA 2WULA 2H71A 4N0ZA 5F8BA 2I1UA 3LEFA 2ZNMA 5A5KA 2B1KA 1EZKA 2BJXA 5AISA 1ERUA 1AQVA 1LBKA 3FK8A 4XCSA 3GX0A 2IJYA 2I81A 4NXIA 2VCZA 4TR1A 2HSHA 2BTOT 1JZWA 2L57A 5B6MA 3MIXA 2VUPA 5CAXA 1OKTA 3NOFA 4JR4A 2HRAA 1GSDA 3OR5A 3R2QA 3TJGA 4PUAA 4XS1A 4BVYA 1KBNA 1T7PB 2HE3A 5IM9A 3ZMLA 2YZHA 4YKFA 2VO4A 4FYCA 2B5XA 1A8YA 4KSOA 3GH6A 3MSZA 4K2DA 3A2XA 1J08A 4V2NA 3GFKA 5GSTA 4ZILA 2NVLA 1M9AA 3P90A 1VGLA 1GUMA 2H74A 5D9TA 1TK5B 4J2FA 4N30A 3DWVA 2VCXA 4WKWA 4IS0A 2FA4A 1GTUA 2YOIA 2HXKA 4TN8A 2LEGA 3ME7A 2HSYA 4A5PA 4NV5A 3M9JA 2CVBA 3LGCA 3VWWA 4ID0A 4AF2A 3KP9A 1FHEA 1EWXA 3LXZA 4ECBA 2OJLA 2FWHA 3APOA 1MDIA 3FHKA 1QK8A 4USSA 2X49A 22GSA 4RI7A 1ABAA 2VL3A 4POBA 1JHBA 2LS5A 2ON5A 4IW9A 4ZBAA 5G2ZA 1R5PA 4HZ4A 3G9BA 1SJIA 1CQHA 3TKSE 1ZGNA 2M80A 3IDVA 4G10A 4GLTA 1YEXA 5JCWA 2PU9C 3H4KA 1FW1A 4GSSA 3GURA 3GX8A 1U88A 4DSQA 3ZZXA 2DJJA 5EPFA 2IMIA 1Q98A 1PKZA 2PWJA 4CDOA 1OE8A 4K6XA 2LRNA 2GQKA 3KP8A 3QD9A 1GSUA 3ZFBA 1M2DA 1ZOFA 4TR3A 1EEJA 1WJKA 3PPUA 3LWAA 2MMNA 4YAVA 2DJ0A 3VFIA 1S3DA 4KW6A 1GTAA 1QQ2A 4F2IA 1PN0A 2O89A 3V1WA 4JZQA 4WF4A 3F63A 1A2MA 5HR0A 3I9V2 3GN3A 3Q74A 3C71A 4LL4B 5E59A 5BMUA 1Z6MA 2J23A 1R7HA 9GSSA 3TUEA 1JZDA 1B48A 3VWVA 4L0WA 2K18A 3ZVJA 1K3YA 3HVXA 4IQ1A 5ECOB 3ISOA 2JZRA 2G2QA 4KSMA 1KEBA 1AAZA 1ERWA 5G30A 16GSA 3LYPA 4MP4A 3QDNA 5DALA 5D96A 2HRFA 5C00A 4XIHA 4K2XA 5LCZA 3L0HA 1OC3A 1XIYA 1VF2A 2LSTA 4PX1A 5HFIA 4AGSA 1IYIA 2GS3A 1EV4A 4PNGA 7GSSA 3D6IA 2X4AA 3R3EA 3HKRA 1X0RA 3EMXA 3H1NA 3UMAA 5DJLA 5KOWA 4N10A 1X5EA 1GRXA 3MAKA 2B7JA 3LXTA 1W4VA 3BD2A 2E2MA 1PX7A 1AQWA 2DJ3A 1O8XA 2WGRA 3P2AA 1M9BA 3WD6A 1PQNA 1XWGA 1Z6NA 5L71A 4O7HA 3ERFA 2GZPA 3DKSA 5H5RA 3M0FA 4Z7XA 1GNEA 20GSA 4MH2A 5AGYA 5LD0A 2O7KA 1B4PA 2IMEA 5H5QA 4D73B 3UIWA 2DJ2A 3IV4A 4QL7A 1UC7A 2M72A 1SJ6A 4TR0A 1BQ7A 1O85A 2LQQA 5INYA 3P7XA 3IAM2 2LJRA 3BOAA 5ABRA 2R37A 5AIVA 4LLRA 4V1Ag 5G5FA 1TRSA 2K9FA 2IFQB 2FLSA 2P5RA 5A4WA 1X5CA 2CX4A 1K3OA 4MZBA 3UOMA 5KN0A 1MDKA 2YZUA 4GSTA 2DKHA 3CYNA 4IP6A 10GSA 3C7MA 4KA0A 4X0XA 2TRCP 4K5SA 1FO5A 1OKDA 4PQ1A 1K0OA 2L4CA 3KEBA 5DCGA 4BPYA 1W89A 3DVWA 2FD3A 3IBHA 4H86A 2B6MA 4ML1A 5DBQA 5F05A 1OC9A 4DEJA 2L5LA 19GSA 4NAXA 4L5OA 2FUG2 5CRDA 2OE3A 3KM6A 3HD5A 3C8EA 2JSYA 1SK1A 3EYTA 3MNGA 2GT6A 2NDOA 2L6DA 3LG6A 1SK2A 3K8NA 1SKRB 2JL4A 2H6XA 4FYUA 1QGVA 2HZFA 3GNJA 4EL1A 2HZEA 4HU9A 1U87A 2GGTA 4KDYA 3TRXA 4TVEA 3O76A 1GLPA 2PPTA 4TXVA 2G0FA 1MEKA 2A2PA 2ON7A 3FKFA 4ZL9A 2H0HA 2HT9A 3FR6A 4XS4B 2GVPA 2H6YA 2CAQA 5KN3A 2WCIA 2M46A 1GSFA 2DBCA 6GSUA 3RAZA 3O6TA 5DAKA 5B8AA 2GSRA 2MYGA 2H73A 5D9VA 4Q5RA 4RUVA 2CQ9A 1SL0B 1V98A 3IC8A 4PNFA 2AV4A 1N2AA 1XZOA 4GSNA 2HLSA 1YEPA 1KNGA 2P5QA 2AJQB 4NWYA 1O6JA 2L5OA 5HQPA 1YF1A 3GTUB 1X9SB 1GSYA 3N9JA 3VI7A 3EE2A 4J57E 1VF3A 6GSXA 2PVQA 3F6FA 3H79A 3KD0A 3QCPA 1B9YC 1DSBA 3KCMA 2H72A 1A0RP 2YN1A 4BWSA 4Q5QA 2YANA 3EU3A 1A0FA 1ZL9A 4PURA 1N8JA 4L8EA 1YF0A 1X9WB 1UVZA 4NPBA 5GSSA 1YKCA 2OE1A 4DSSA 4LMVA 4ML6A 3KTLA 5G31A 4PQIA 4NHWA 3HJMA 2AUVA 2PBJA 2VLVA 2OADA 4J56E 3F8UA 3L78A 1O73A 5AIXA 4HZ2A 2EC4A 1BEDA 2GDRA 4KUNA 3CRUA 4TR4A 2PVOC 2FHEA 4OFNA 1XW6A 2YJHA 3IE3A 3VLNA 2C3NA 1PGTA 3FZ9A 1TDIA 2GQMA 3BJ5A 4IP1A 3CTFA 3TKRA 3GYKA 1F3BA 3DEXA 4MJEA 4O32A 2YV7A 1HNBA 2A2SA 1LJRA 1UN2A 2H75A 18GSA 4MF5A 4ZBBA 3HVVA 4LL1B 4F9ZA 1DBYA 2LNSA 1M7TA 3A2VA 3U5RE 3KH9A 3TOUA 5J41A 1JLWA 2VCWA 4IHUA 3UBLA 5IOWA 2DLXA 4WR5A 3IR4A 1Q4JA 1ST9A 4G2EA 2C80A 4G19A 1Y6EA 4WXTA 2NTOA 2GSSA 1T1VA 5F07A 1PN9A 1QMVA 2TRXA 4EDYA 3ZIJA 2GQLA 1UA5A 3E3EA 2QSIA 2DJ1A 3UVTA 3L9VA 3IOSA 3J7Yk 2KP2A 1SYRA 3GMFA 2KOKA 2NPBA 2KUCA 1GSEA 1PA3A 3UAPA 4K7NA 4TOPA 1XVWA 2B5EA 4IGJA 1TTZA 1GL8A 5E4WA 2P0GA 1USBA 2CV4A 4OD7A 2MBTA 3IAS2 3N5OA 2K6VA 2YWOA 3JCML 4GCIA 4GXZA 2VLTA 3H8QA 3HA9A 2X8CA 3HJPA 1C72A 3CMIA 4ZB6A 2VL2C 3TJFA 4WETA 2IN3A 4HJ2A 3TDGA 1G7EA 3M8NA 3FR3A 4IJIA 2ZUPA 2FA8A 5B7CA 3ZTLA 4AJ6A 4GWRA 1TI3A 2CAIA 1ML6A 2C4JA 4NHZA 1KTEA 1WMJA 5ECSA 1T00A 5IMDA 4OWYA 2IPAA 1SD8A 1SL1B 1XW5A 4KDUA 2WJUA 3CTGA 3UEMA 1VRSD 3ZL5A 1TU7A 1TKDB 1XWBA 1YDKA 2IIYA 4CHSA 4POKA 1U6TA 1O81A 2YV9A 6GSWA 2MMOA 2OKAA 2GTUA 3KMNA 4IQAA 2C1YA 4EKZA 1Z7RA 5D93A 1V57A 1BYEA 3CRTA 2A2RA 5DALB 1MD4A 2ALBA 1JZOA 4KE3A 2YWIA 3F4RA 5DVBA 3TCOA 5IMZA 2VOCA 1XBSA 2B7KA 2X99A 4F0BA 1V2AA 2NBSA 11GSA 4EXJA 1TK0B 3LW9A 2C0EA 1ACVA 1TOFA 3GSTA 4CY8A 2H1AA 2VD1A 1QXHA 4HU7A 2OA7A 2V2GA 3GKKA 3EURA 3US3A 3IPZA 2B1LA 4I2UA 3HJOA 4ISDA 2LKUA 1EGOA 2AHEA 1TW9A 2EIOA 1RW1A 1S3AA 5CREA 3PH9A 4HQSA 1Z7PA 6GSVA 2LUSA 4YQMA 2KP1A 2JADA 3LFLA 1ZZYA 2WFCA 2O8VB 3F0IA 1OYJA 1F37A 4BA7A 1PSQA 5DDLA 1BAYA 3WGXA 3GKXA 3UBKA 4HQZA 4P3YB 2YCDA 3H93A 3NIVA 5HR2A 4O5UA 3LQ7A 5IMVA 3KJYA 5ECRB 1SKSB 5ECHB 4HJMA 2YP6A 4ZBDA 1WE0A 5J9BA 3L4NA 3TRPA 1TK8B 2FWFA 4OO5A 1AQXA 2R5GA 5CP1A 2VD0A 2RM6A 4EO3A 1EP8A 4GRFA 2H0IA 4TXOA 4EC0A 5CRGA 1PX6A 4KCAA 2K8SA 2HFDA 4OFMA 5IMFA 5AN1A 1AXDA 2FWGA 4MPFA 4ZL7A 3VI5A 14GSA 3EPTA 4MCUA 3HZ8A 3C1SA 4IN0A 2FY6A 3M3MA 4PXOA 2VAFA 2N5FA 5KOXA 1FOVA 4O5RA 2IFQA 2LRTA 4MDCA 3SWLA 3HDCA 1TRUA 2XBQA 1G6YA 1GWCA 2H0GA 4EIPA 2L6CA 3QFBC 2R0GA 5ECQB 2K8VA 3WT1A 1GUKA 2H19A 1MDJA 5B6NA 4NMUA 1XOAA 1YY7A 4K8MA 3EMPA 2LV3A 2F51A 4EDZA 2L59A 5BRTA 2P31A 1FVJA 1XWCA 1K0DA 5ECKB 4V2LA 4TKYA 2HZEB 3GUSA 4Z2TA 4MF6A 1SL2B 1A8LA 2WS2A 1JZRA 1O8WA 5HFKA 2IWTA 1EV9A 3PGTA 2R0CA 2H1GA 4DSRA 1ZYPA 3ZMKA 5ID2B 2JACA 4V2MA 2F8FA 3TJKA 4BL7A 5G1LA 1FOHA 4WEYA 3D0ZA 1GULA 2BMXA 4OCFA 1BX9A 3ERGA 5DQSA 2QGVA 3Q18A 1HNCA 1XW9A 1E6BA 2C3TA 2VL9A 2AYTA 2O87A 2GZYA 1ERVA 5D9WA 1XXUA 3RDWA 4MF7A 4QL9A 4IVFA 1SKWB 1GH2A 3I6AA 3GIXA 1YZXA 2DIYA 4WBJA 2X8GA 3ME8A 3KMOA 1GTBA 1F2EA 3M9KA 4X1UA 4BVXA 1AW9A 1EEMA 1SK0A 1MTCA 3DD3A 3KGKA 2H01A 2A4VA 2FGXA 1GP1A 2F3MA 1ILOA 5H5SA 3W8SA 4Z2UA 1YQ1A 3S9FA 4ACSA 4XS4A 2JU5A 1XPVA 3I43A 4YAPA 1WIKA 5CO3A 1M0UA 1CQGA 3A3TA 4OCEA 3ZLPA 2DMMA 3CSJA 2X8HA 2E0QA 5LNKe 3L9SA 2PUKC 3P8WA 4I2TA 3ZRDA 3EINA 1R5AA 2J9HA 3RPNA 1TJDA 5D73A 4MJAA 3FMWA 4O5QA 2WB9A 3HHVA 3D4TA 3A5WA 1FG4A 4ZXGA 5ELGA 4YKGA 4BWQA 1K3LA 3F4SA 3QMXA 4KX4A 5IPGA 1K0MA 3DRNA 2CZ3A 4K0NA 4MNNA 6GSTA 4LA1A 1EOHA 3HY2A 4DSSB 3WYWA 4YQVA 1JFUA 5JCUA 1GTIA 2GLRA 4G9HA 4I97A 4JE1A 3GTUA 4E8HA 1O7UA 2HNLA 3LYKA 1TP9A 5FT3A 3WGEA 4TR1B 2C0FA 5A4VA 3GSSA 1T8EB 1OE7A 3RBTA 1GLQA 4Q5FA 1DUGA 2I9HA 3D4MA 1GSQA 5IOXA 4KNDA 3IK9A 4L5LA 5J9CA 2E7PA 2YWNA 3IXRA 4FO5A 3GL5A 4FIWA 3KZQA 4HEA2 4AJ8A 1FB6A 2HSMA 2DIZA 1WPIA 4BVYB 1M2BA 3QAWA 3MWHA 4IELA 1NHOA 5J3RA 3CXGA 3TB2A 2H30A 1PMTA 2XPDA 4OO4A 1GNWA 1NW2A 5GAPD 1THOA 3IA1A 3GHAA 1TI1A 1NM3A 2CX3A 2CT6A 2HRKA 2C0GA 3ED3A 5ENUA 5D8IA 4FYBA 5A4UA 5HR3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ERT A;  3DVX A;  17GS A;  2JZT A;  3FZ5 A;  2MZC A;  5DJM A;  4X43 A;  3C73 A;  8GSS A;  1F3A A;  3QFA C;  1SD9 A;  4L0U A;  5EVO A;  3CBU A;  2H8L A;  2IMD A;  2V41 A;  4N0V A;  1Z9H A;  4HUA A;  3UL3 A;  4IKH A;  1PKW A;  3DML A;  3GV1 A;  4YQU A;  1HNA A;  5JWQ B;  2R3X A;  4GTU A;  3W8J A;  1VF1 A;  2D2Z A;  5ECP B;  3ZIT A;  1HYU A;  2VCT A;  2V6K A;  1TRV A;  5IMC A;  4ZL8 A;  3LSZ A;  2PN8 A;  1A2J A;  4MPG A;  3HZ4 A;  3KIJ A;  2JZS A;  3VWX A;  4MZW A;  2H66 A;  5CNW A;  1VF4 A;  4OMV A;  1Z5Y E;  2CVD A;  2V32 A;  2RUE A;  3ZIV A;  4K0G A;  2B5Y A;  1FVK A;  2X64 A;  3ZRE A;  1SU9 A;  1XOB A;  4XRD A;  3GL3 A;  1NHY A;  4EE0 A;  4PQH A;  5DCH A;  5KEJ A;  4RQR A;  2RLI A;  3BBY A;  4HS1 A;  13GS A;  1XCC A;  4MZC A;  1X5D A;  3Q6O A;  1A2L A;  3TJJ A;  1OAZ A;  2H1B A;  2LJK A;  4ECI A;  4I6X A;  4IBP A;  2VCV A;  2FCH A;  1J0F A;  4MA9 A;  1QFN A;  2O85 A;  2FWE A;  3ERW A;  1PRX A;  2VM2 A;  3FR9 A;  3TGZ A;  3QOU A;  2DC5 A;  2AAW A;  2EIQ A;  4K9Z A;  1U3A A;  2C0D A;  2OAC A;  3F4T A;  2KHP A;  4QQ7 A;  5C04 A;  2R4V A;  3WGD A;  4O92 A;  3VWU A;  5IO2 A;  1WP0 A;  1FAA A;  1URM A;  2RUF A;  5GAN D;  2GT5 A;  4K7O A;  4F03 A;  4JED A;  2CVK A;  3GKM A;  3PR8 A;  4IJ3 A;  1TU8 A;  2YWM A;  3IC4 A;  1MD3 A;  3W6G A;  5IO0 A;  1E2Y A;  2GZZ A;  1H75 A;  5ECL B;  2LJA A;  2MBS A;  4MAB A;  1XWA A;  1M2A A;  2RII A;  2AB6 A;  1K0C A;  3NZN A;  2IMF A;  5B8B A;  4HI7 A;  3QAG A;  2TIR A;  3I69 A;  4F0C A;  1AIU A;  5IIZ A;  2VL2 A;  5COH A;  2R6K A;  1WOU A;  4GQF A;  2JSZ A;  1PL2 A;  3APQ A;  4YH2 A;  5ELA A;  1LU4 A;  2DML A;  1YKA A;  2LRC A;  6GSS A;  2V6O A;  4CW9 A;  5IQY A;  3TJB A;  1G7O A;  1HQO A;  2CA8 A;  3HCZ A;  2H6Z A;  1BJX A;  3EC3 A;  3CSI A;  3IK7 A;  3HVS A;  3PIN A;  3KH7 A;  2Z9S A;  4KDX A;  5HR1 A;  3GKN A;  2OBK A;  2E2G A;  3DXB A;  3FEU A;  1YJ6 A;  1A23 A;  3FY7 A;  2PGT A;  5JWR B;  4I8B A;  4OFT A;  3J7Y b;  2C3Q A;  2DSA A;  2PMT A;  3FW2 A;  5ECI B;  2KLX A;  1AUC A;  1B4Q A;  4KGI A;  3VUR A;  1OC8 A;  3WT2 A;  3D21 A;  4I5Q A;  1ZCP A;  5CYY A;  5EL8 A;  12GS A;  2YNX A;  3CSH A;  3FRC A;  3MDK A;  3U6V A;  1K0N A;  1GSS A;  4JBB A;  3RPP A;  1FB0 A;  3QR6 A;  3IRA A;  4TXO B;  1HD2 A;  2WZ9 A;  4JR6 A;  2YPM A;  2XPE A;  2N5A A;  3FZA A;  2FNO A;  1XFL A;  5CRH A;  5D9X A;  3BCI A;  4N11 A;  4XS6 A;  1ON4 A;  4LMW A;  2H1D A;  1JLV A;  3TOT A;  4KCE A;  2ZCT A;  2XHF A;  3AY8 A;  4GQC A;  5IMA A;  1EGR A;  1TRW A;  4WF5 A;  3RHC A;  4ULX A;  1U3I A;  1H4O A;  1TXX A;  4POL A;  3QPM A;  4D73 A;  5IPH A;  3G7J A;  3GA4 A;  5JWO B;  3DYR A;  5F06 A;  3ZYW A;  3Q19 A;  5KN2 A;  1G0T A;  1ZMA A;  1DE2 A;  1SJZ A;  4XRA A;  1G6W A;  2V1M A;  2WDU A;  1OC9 B;  3O3T A;  4JRR A;  2GSQ A;  2GST A;  2HYX A;  1RK4 A;  5DQY A;  3F6D A;  2HRN A;  2HI7 A;  3HYP A;  1T4Y A;  5G5E A;  3VK9 A;  1WWJ A;  4ZIJ A;  1THX A;  4PUF C;  1R26 A;  3IHQ A;  3FYG A;  1M99 A;  2EIR A;  1OVN A;  1S3C A;  4TW5 A;  1DE1 A;  1ZYE A;  4RI6 A;  3TKP A;  4E8E A;  2MMZ A;  2H76 A;  3UAR A;  1K0A A;  1B8X A;  3A2W A;  2CZ2 A;  1PL1 A;  1SEN A;  4EUY A;  2XC2 A;  2IL3 A;  3QAV A;  4XTS A;  1T3B A;  3VPT A;  4KAE A;  3LJR A;  4V1A p;  5JCG A;  2VLU A;  5EY6 A;  3E9J B;  1WRY A;  4MJC A;  3UJ1 A;  1T4Z A;  4NV2 A;  2OE0 A;  1AC1 A;  2I3Y A;  3G7I A;  3LOR A;  3G7Y A;  2B3S A;  2C8U A;  1F6M C;  3EVI A;  1BG5 A;  4HOJ A;  1EOG A;  3DGQ A;  2R2J A;  1J9B A;  4WR4 A;  1A24 A;  2IMK A;  1Z3E A;  4K7I A;  2XBI A;  3TRQ A;  1K0B A;  1V9W A;  5J5N A;  4TRX A;  4RQX A;  2L4Q A;  3F3R A;  1V40 A;  5DAK B;  4F82 A;  4MLY A;  1XWK A;  4WBR D;  4KB3 A;  3ZFL A;  3TKQ A;  1XVQ A;  1IYH A;  2QC7 A;  2REM A;  3BCK A;  5ID2 A;  6GSY A;  2QKE A;  3L9U A;  1NSW A;  5KN1 A;  4XHM A;  3TKS C;  2MMA A;  5ECN B;  5F0G A;  3VPQ A;  1I5G A;  2WRT A;  5G1K A;  2OBI A;  3APS A;  1ZYQ B;  3HXS A;  4EF0 A;  3GH9 A;  2VCQ A;  3KXO A;  3ZVJ D;  3F3Q A;  3FZ4 A;  1EP7 A;  2F9S A;  4ECJ A;  4K1F A;  2N5B A;  2LQO A;  3SBC A;  3F9U A;  3C1R A;  1X9M B;  3D5J A;  4POM A;  5FHI A;  4ECC A;  3KTB A;  1SYX A;  4HDE A;  5FWG A;  2YJ7 A;  4ILF A;  1V58 A;  2LNT A;  3GRX A;  2RM5 A;  1R4W A;  1RQM A;  2VIM A;  1Y25 A;  3RHB A;  4GF0 A;  2DJK A;  4Q5N A;  2VM1 A;  4AJ7 A;  5CRW A;  4ZB8 A;  4MJB A;  1PD2 1;  1F9M A;  3D22 A;  4MK3 A;  3DIE A;  2I4A A;  1I9D A;  4FH8 A;  1QUW A;  4DVC A;  4PGT A;  2F8A A;  3TKS A;  2PER A;  4JU5 A;  2ES7 A;  1GUH A;  2LTK A;  5J4U A;  4MMM A;  1B9X C;  4KH7 A;  5GZZ B;  3EU4 A;  3M1G A;  3E0U A;  4ZB9 A;  5HFG A;  4EVM A;  5ECM B;  3UVH A;  4MH3 A;  2H70 A;  3EWL A;  2WUL A;  2H71 A;  4N0Z A;  5F8B A;  2I1U A;  3LEF A;  2ZNM A;  5A5K A;  2B1K A;  1EZK A;  2BJX A;  5AIS A;  1ERU A;  1AQV A;  1LBK A;  3FK8 A;  4XCS A;  3GX0 A;  2IJY A;  2I81 A;  4NXI A;  2VCZ A;  4TR1 A;  2HSH A;  2BTO T;  1JZW A;  2L57 A;  5B6M A;  2VUP A;  5CAX A;  1OKT A;  3NOF A;  4JR4 A;  1GSD A;  3OR5 A;  3R2Q A;  3TJG A;  4PUA A;  4XS1 A;  4BVY A;  1KBN A;  1T7P B;  2HE3 A;  5IM9 A;  3ZML A;  2YZH A;  2VO4 A;  4FYC A;  2B5X A;  1A8Y A;  4KSO A;  3GH6 A;  3MSZ A;  4K2D A;  3A2X A;  1J08 A;  4V2N A;  3GFK A;  5GST A;  4ZIL A;  2NVL A;  1M9A A;  3P90 A;  1VGL A;  1GUM A;  2H74 A;  5D9T A;  1TK5 B;  4J2F A;  4N30 A;  3DWV A;  2VCX A;  4WKW A;  4IS0 A;  2FA4 A;  1GTU A;  2YOI A;  2HXK A;  4TN8 A;  2LEG A;  3ME7 A;  2HSY A;  4NV5 A;  3M9J A;  2CVB A;  3LGC A;  3VWW A;  4ID0 A;  4AF2 A;  3KP9 A;  1FHE A;  1EWX A;  3LXZ A;  4ECB A;  2OJL A;  2FWH A;  3APO A;  1MDI A;  3FHK A;  1QK8 A;  22GS A;  4RI7 A;  1ABA A;  2VL3 A;  4POB A;  1JHB A;  2LS5 A;  2ON5 A;  4IW9 A;  4ZBA A;  5G2Z A;  1R5P A;  4HZ4 A;  3G9B A;  1SJI A;  1CQH A;  3TKS E;  1ZGN A;  2M80 A;  3IDV A;  4G10 A;  4GLT A;  1YEX A;  5JCW A;  2PU9 C;  3H4K A;  1FW1 A;  4GSS A;  3GUR A;  3GX8 A;  1U88 A;  4DSQ A;  3ZZX A;  2DJJ A;  5EPF A;  2IMI A;  1Q98 A;  1PKZ A;  2PWJ A;  4CDO A;  1OE8 A;  4K6X A;  2LRN A;  2GQK A;  3KP8 A;  3QD9 A;  1GSU A;  3ZFB A;  1M2D A;  1ZOF A;  4TR3 A;  1EEJ A;  1WJK A;  3LWA A;  2MMN A;  4YAV A;  2DJ0 A;  3VFI A;  1S3D A;  4KW6 A;  1GTA A;  1QQ2 A;  4F2I A;  2O89 A;  3V1W A;  4JZQ A;  4WF4 A;  3F63 A;  1A2M A;  5HR0 A;  3I9V 2;  3GN3 A;  3Q74 A;  3C71 A;  4LL4 B;  5E59 A;  1Z6M A;  2J23 A;  1R7H A;  9GSS A;  3TUE A;  1JZD A;  1B48 A;  3VWV A;  4L0W A;  2K18 A;  3ZVJ A;  1K3Y A;  3HVX A;  4IQ1 A;  5ECO B;  3ISO A;  2JZR A;  2G2Q A;  4KSM A;  1KEB A;  1AAZ A;  1ERW A;  5G30 A;  16GS A;  3LYP A;  4MP4 A;  3QDN A;  5DAL A;  5D96 A;  2HRF A;  5C00 A;  4XIH A;  5LCZ A;  3L0H A;  1OC3 A;  1XIY A;  1VF2 A;  2LST A;  4PX1 A;  5HFI A;  4AGS A;  1IYI A;  2GS3 A;  1EV4 A;  4PNG A;  7GSS A;  3D6I A;  3HKR A;  1X0R A;  3EMX A;  3H1N A;  3UMA A;  5DJL A;  4N10 A;  1X5E A;  1GRX A;  3MAK A;  2B7J A;  3LXT A;  1W4V A;  3BD2 A;  2E2M A;  1PX7 A;  1AQW A;  2DJ3 A;  1O8X A;  2WGR A;  3P2A A;  1M9B A;  3WD6 A;  1PQN A;  1XWG A;  1Z6N A;  5L71 A;  4O7H A;  3ERF A;  2GZP A;  3DKS A;  5H5R A;  3M0F A;  4Z7X A;  1GNE A;  20GS A;  4MH2 A;  5AGY A;  5LD0 A;  2O7K A;  1B4P A;  2IME A;  5H5Q A;  4D73 B;  3UIW A;  2DJ2 A;  3IV4 A;  4QL7 A;  1UC7 A;  2M72 A;  1SJ6 A;  4TR0 A;  1BQ7 A;  1O85 A;  2LQQ A;  5INY A;  3P7X A;  3IAM 2;  2LJR A;  3BOA A;  5ABR A;  2R37 A;  5AIV A;  4LLR A;  4V1A g;  5G5F A;  1TRS A;  2K9F A;  2IFQ B;  2FLS A;  2P5R A;  5A4W A;  1X5C A;  2CX4 A;  1K3O A;  4MZB A;  3UOM A;  5KN0 A;  1MDK A;  2YZU A;  4GST A;  3CYN A;  4IP6 A;  10GS A;  3C7M A;  4KA0 A;  4X0X A;  2TRC P;  1FO5 A;  1OKD A;  4PQ1 A;  1K0O A;  2L4C A;  3KEB A;  5DCG A;  4BPY A;  1W89 A;  3DVW A;  2FD3 A;  3IBH A;  4H86 A;  2B6M A;  4ML1 A;  5DBQ A;  5F05 A;  1OC9 A;  4DEJ A;  2L5L A;  19GS A;  4NAX A;  4L5O A;  2FUG 2;  5CRD A;  2OE3 A;  3KM6 A;  3HD5 A;  3C8E A;  2JSY A;  1SK1 A;  3EYT A;  3MNG A;  2GT6 A;  2NDO A;  2L6D A;  3LG6 A;  1SK2 A;  3K8N A;  1SKR B;  2JL4 A;  2H6X A;  4FYU A;  1QGV A;  2HZF A;  3GNJ A;  4EL1 A;  2HZE A;  4HU9 A;  1U87 A;  2GGT A;  4KDY A;  3TRX A;  4TVE A;  3O76 A;  1GLP A;  2PPT A;  4TXV A;  2G0F A;  1MEK A;  2ON7 A;  3FKF A;  4ZL9 A;  2H0H A;  2HT9 A;  3FR6 A;  4XS4 B;  2GVP A;  2H6Y A;  2CAQ A;  5KN3 A;  2WCI A;  2M46 A;  1GSF A;  2DBC A;  6GSU A;  3RAZ A;  3O6T A;  5DAK A;  5B8A A;  2GSR A;  2MYG A;  2H73 A;  5D9V A;  4Q5R A;  4RUV A;  2CQ9 A;  1SL0 B;  1V98 A;  4PNF A;  2AV4 A;  1N2A A;  1XZO A;  4GSN A;  2HLS A;  1YEP A;  1KNG A;  2P5Q A;  2AJQ B;  4NWY A;  1O6J A;  2L5O A;  5HQP A;  1YF1 A;  3GTU B;  1X9S B;  1GSY A;  3N9J A;  3VI7 A;  3EE2 A;  4J57 E;  1VF3 A;  6GSX A;  2PVQ A;  3F6F A;  3H79 A;  3KD0 A;  3QCP A;  1B9Y C;  1DSB A;  3KCM A;  2H72 A;  1A0R P;  2YN1 A;  4BWS A;  4Q5Q A;  2YAN A;  3EU3 A;  1A0F A;  1ZL9 A;  4PUR A;  1N8J A;  4L8E A;  1YF0 A;  1X9W B;  1UVZ A;  4NPB A;  5GSS A;  1YKC A;  2OE1 A;  4DSS A;  4LMV A;  4ML6 A;  3KTL A;  5G31 A;  4PQI A;  4NHW A;  3HJM A;  2AUV A;  2PBJ A;  2VLV A;  2OAD A;  4J56 E;  3F8U A;  3L78 A;  1O73 A;  5AIX A;  4HZ2 A;  2EC4 A;  1BED A;  2GDR A;  4KUN A;  3CRU A;  4TR4 A;  2PVO C;  2FHE A;  4OFN A;  1XW6 A;  2YJH A;  3IE3 A;  3VLN A;  2C3N A;  1PGT A;  3FZ9 A;  1TDI A;  2GQM A;  3BJ5 A;  4IP1 A;  3CTF A;  3TKR A;  3GYK A;  1F3B A;  3DEX A;  4MJE A;  4O32 A;  2YV7 A;  1HNB A;  2A2S A;  1LJR A;  1UN2 A;  2H75 A;  18GS A;  4MF5 A;  4ZBB A;  3HVV A;  4LL1 B;  4F9Z A;  1DBY A;  2LNS A;  1M7T A;  3A2V A;  3U5R E;  3KH9 A;  3TOU A;  5J41 A;  1JLW A;  2VCW A;  4IHU A;  3UBL A;  5IOW A;  2DLX A;  4WR5 A;  3IR4 A;  1Q4J A;  1ST9 A;  4G2E A;  2C80 A;  4G19 A;  1Y6E A;  4WXT A;  2NTO A;  2GSS A;  1T1V A;  5F07 A;  1PN9 A;  1QMV A;  2TRX A;  4EDY A;  3ZIJ A;  2GQL A;  1UA5 A;  3E3E A;  2QSI A;  2DJ1 A;  3UVT A;  3L9V A;  3IOS A;  3J7Y k;  2KP2 A;  1SYR A;  3GMF A;  2KOK A;  2NPB A;  2KUC A;  1GSE A;  1PA3 A;  3UAP A;  4K7N A;  4TOP A;  1XVW A;  2B5E A;  4IGJ A;  1TTZ A;  1GL8 A;  5E4W A;  2P0G A;  1USB A;  2CV4 A;  4OD7 A;  2MBT A;  3IAS 2;  3N5O A;  2K6V A;  2YWO A;  3JCM L;  4GCI A;  4GXZ A;  2VLT A;  3H8Q A;  3HA9 A;  2X8C A;  3HJP A;  1C72 A;  3CMI A;  4ZB6 A;  2VL2 C;  3TJF A;  4WET A;  2IN3 A;  4HJ2 A;  3TDG A;  1G7E A;  3M8N A;  3FR3 A;  4IJI A;  2ZUP A;  2FA8 A;  5B7C A;  3ZTL A;  4AJ6 A;  4GWR A;  1TI3 A;  2CAI A;  1ML6 A;  2C4J A;  4NHZ A;  1KTE A;  1WMJ A;  5ECS A;  1T00 A;  5IMD A;  4OWY A;  2IPA A;  1SD8 A;  1SL1 B;  1XW5 A;  4KDU A;  2WJU A;  3CTG A;  3UEM A;  1VRS D;  3ZL5 A;  1TU7 A;  1TKD B;  1XWB A;  1YDK A;  2IIY A;  4CHS A;  4POK A;  1U6T A;  1O81 A;  2YV9 A;  6GSW A;  2MMO A;  2OKA A;  2GTU A;  3KMN A;  4IQA A;  2C1Y A;  4EKZ A;  1Z7R A;  5D93 A;  1V57 A;  1BYE A;  3CRT A;  2A2R A;  5DAL B;  1MD4 A;  2ALB A;  1JZO A;  4KE3 A;  2YWI A;  3F4R A;  5DVB A;  3TCO A;  5IMZ A;  2VOC A;  1XBS A;  2B7K A;  2X99 A;  4F0B A;  1V2A A;  2NBS A;  11GS A;  4EXJ A;  1TK0 B;  2C0E A;  1ACV A;  1TOF A;  3GST A;  2H1A A;  2VD1 A;  1QXH A;  4HU7 A;  2OA7 A;  2V2G A;  3GKK A;  3EUR A;  3US3 A;  3IPZ A;  2B1L A;  4I2U A;  3HJO A;  4ISD A;  2LKU A;  1EGO A;  2AHE A;  1TW9 A;  2EIO A;  1RW1 A;  1S3A A;  5CRE A;  3PH9 A;  4HQS A;  1Z7P A;  6GSV A;  2LUS A;  4YQM A;  2KP1 A;  2JAD A;  3LFL A;  1ZZY A;  2WFC A;  2O8V B;  3F0I A;  1OYJ A;  1F37 A;  4BA7 A;  1PSQ A;  5DDL A;  1BAY A;  3WGX A;  3GKX A;  3UBK A;  4HQZ A;  4P3Y B;  2YCD A;  3H93 A;  3NIV A;  5HR2 A;  3LQ7 A;  5IMV A;  3KJY A;  5ECR B;  1SKS B;  5ECH B;  4HJM A;  2YP6 A;  4ZBD A;  1WE0 A;  5J9B A;  3L4N A;  3TRP A;  1TK8 B;  2FWF A;  4OO5 A;  1AQX A;  2R5G A;  5CP1 A;  2VD0 A;  2RM6 A;  4EO3 A;  1EP8 A;  4GRF A;  2H0I A;  4TXO A;  4EC0 A;  5CRG A;  1PX6 A;  4KCA A;  2K8S A;  2HFD A;  4OFM A;  5IMF A;  5AN1 A;  1AXD A;  2FWG A;  4MPF A;  4ZL7 A;  3VI5 A;  14GS A;  4MCU A;  3HZ8 A;  3C1S A;  4IN0 A;  2FY6 A;  3M3M A;  4PXO A;  2VAF A;  2N5F A;  1FOV A;  4O5R A;  2IFQ A;  2LRT A;  4MDC A;  3SWL A;  3HDC A;  1TRU A;  2XBQ A;  1G6Y A;  1GWC A;  2H0G A;  2L6C A;  3QFB C;  5ECQ B;  2K8V A;  3WT1 A;  1GUK A;  2H19 A;  1MDJ A;  5B6N A;  4NMU A;  1XOA A;  1YY7 A;  4K8M A;  3EMP A;  2LV3 A;  2F51 A;  4EDZ A;  2L59 A;  2P31 A;  1FVJ A;  1XWC A;  1K0D A;  5ECK B;  4V2L A;  4TKY A;  2HZE B;  3GUS A;  4MF6 A;  1SL2 B;  1A8L A;  2WS2 A;  1JZR A;  1O8W A;  5HFK A;  2IWT A;  1EV9 A;  3PGT A;  2H1G A;  4DSR A;  3ZMK A;  5ID2 B;  2JAC A;  4V2M A;  2F8F A;  3TJK A;  4BL7 A;  5G1L A;  4WEY A;  3D0Z A;  1GUL A;  2BMX A;  4OCF A;  1BX9 A;  3ERG A;  5DQS A;  2QGV A;  3Q18 A;  1HNC A;  1XW9 A;  1E6B A;  2C3T A;  2VL9 A;  2AYT A;  2O87 A;  2GZY A;  1ERV A;  5D9W A;  1XXU A;  3RDW A;  4MF7 A;  4QL9 A;  4IVF A;  1SKW B;  1GH2 A;  3I6A A;  3GIX A;  1YZX A;  2DIY A;  4WBJ A;  2X8G A;  3ME8 A;  3KMO A;  1GTB A;  1F2E A;  3M9K A;  4X1U A;  4BVX A;  1AW9 A;  1EEM A;  1SK0 A;  1MTC A;  3DD3 A;  3KGK A;  2H01 A;  2A4V A;  2FGX A;  1GP1 A;  2F3M A;  1ILO A;  5H5S A;  3W8S A;  1YQ1 A;  3S9F A;  4ACS A;  4XS4 A;  2JU5 A;  1XPV A;  3I43 A;  4YAP A;  1WIK A;  5CO3 A;  1M0U A;  1CQG A;  3A3T A;  4OCE A;  3ZLP A;  2DMM A;  3CSJ A;  2X8H A;  2E0Q A;  5LNK e;  3L9S A;  2PUK C;  3P8W A;  4I2T A;  3ZRD A;  3EIN A;  1R5A A;  2J9H A;  3RPN A;  1TJD A;  5D73 A;  4MJA A;  2WB9 A;  3HHV A;  3D4T A;  3A5W A;  1FG4 A;  4ZXG A;  5ELG A;  4BWQ A;  1K3L A;  3F4S A;  3QMX A;  4KX4 A;  5IPG A;  1K0M A;  3DRN A;  2CZ3 A;  4K0N A;  6GST A;  4LA1 A;  1EOH A;  3HY2 A;  4DSS B;  3WYW A;  4YQV A;  1JFU A;  5JCU A;  1GTI A;  2GLR A;  4G9H A;  4I97 A;  4JE1 A;  3GTU A;  4E8H A;  1O7U A;  2HNL A;  3LYK A;  1TP9 A;  5FT3 A;  3WGE A;  4TR1 B;  2C0F A;  5A4V A;  3GSS A;  1T8E B;  1OE7 A;  3RBT A;  1GLQ A;  4Q5F A;  1DUG A;  2I9H A;  3D4M A;  1GSQ A;  5IOX A;  4KND A;  3IK9 A;  4L5L A;  5J9C A;  2E7P A;  2YWN A;  3IXR A;  4FO5 A;  3GL5 A;  4FIW A;  3KZQ A;  4HEA 2;  4AJ8 A;  1FB6 A;  2DIZ A;  1WPI A;  1M2B A;  3QAW A;  3MWH A;  4IEL A;  1NHO A;  5J3R A;  3CXG A;  3TB2 A;  2H30 A;  1PMT A;  2XPD A;  4OO4 A;  1GNW A;  1NW2 A;  5GAP D;  1THO A;  3IA1 A;  3GHA A;  1TI1 A;  1NM3 A;  2CX3 A;  2CT6 A;  2C0G A;  3ED3 A;  5ENU A;  5D8I A;  4FYB A;  5A4U A;  5HR3 A; 
#chains in the Genus database with same CATH topology
 1ERT A;  3DVX A;  17GS A;  2JZT A;  3FZ5 A;  2MZC A;  5DJM A;  4X43 A;  3C73 A;  8GSS A;  1F3A A;  3QFA C;  1SD9 A;  4L0U A;  5EVO A;  3CBU A;  2H8L A;  2IMD A;  2V41 A;  4N0V A;  1Z9H A;  1XG8 A;  4HUA A;  3UL3 A;  4IKH A;  1PKW A;  3DML A;  3GV1 A;  4YQU A;  1HNA A;  5JWQ B;  2R3X A;  4GTU A;  3W8J A;  1VF1 A;  2D2Z A;  5ECP B;  3ZIT A;  1HYU A;  2VCT A;  2V6K A;  1TRV A;  5IMC A;  4ZL8 A;  3LSZ A;  2R0P A;  2PN8 A;  1A2J A;  4MPG A;  3HZ4 A;  3KIJ A;  2JZS A;  3VWX A;  4MZW A;  2H66 A;  5CNW A;  1VF4 A;  4OMV A;  1Z5Y E;  2CVD A;  2V32 A;  2RUE A;  3ZIV A;  4K0G A;  2B5Y A;  1FVK A;  2X64 A;  3ZRE A;  1SU9 A;  1XOB A;  4XRD A;  3GL3 A;  1NHY A;  4EE0 A;  4PQH A;  3IHG A;  5DCH A;  5KEJ A;  4RQR A;  2RLI A;  3BBY A;  4HS1 A;  4K5R A;  13GS A;  1XCC A;  4MZC A;  1X5D A;  3Q6O A;  1A2L A;  3TJJ A;  1OAZ A;  2H1B A;  2LJK A;  4ECI A;  4I6X A;  4IBP A;  2VCV A;  2FCH A;  1J0F A;  4MA9 A;  1QFN A;  2O85 A;  2FWE A;  3ERW A;  1PRX A;  2VM2 A;  3FR9 A;  3TGZ A;  3QOU A;  2DC5 A;  2AAW A;  2EIQ A;  4K9Z A;  1U3A A;  2C0D A;  2OAC A;  3F4T A;  2KHP A;  4QQ7 A;  5C04 A;  2R4V A;  3WGD A;  4O92 A;  3VWU A;  5IO2 A;  1WP0 A;  1FAA A;  1URM A;  2RUF A;  5GAN D;  4EIQ A;  2GT5 A;  4K7O A;  4F03 A;  4JED A;  2CVK A;  3GKM A;  3PR8 A;  4IJ3 A;  1TU8 A;  2YWM A;  3IC4 A;  1MD3 A;  3W6G A;  5IO0 A;  1E2Y A;  2GZZ A;  1H75 A;  5ECL B;  2LJA A;  2MBS A;  4MAB A;  1XWA A;  1M2A A;  2RII A;  2AB6 A;  1K0C A;  3NZN A;  2IMF A;  5B8B A;  4HI7 A;  3QAG A;  2TIR A;  3I69 A;  4F0C A;  1AIU A;  1M3J A;  5IIZ A;  2VL2 A;  5COH A;  2R6K A;  1WOU A;  4GQF A;  2JSZ A;  1PL2 A;  3APQ A;  4YH2 A;  5ELA A;  1LU4 A;  2DML A;  1YKA A;  2LRC A;  6GSS A;  2V6O A;  4CW9 A;  5IQY A;  3TJB A;  1G7O A;  1ZYN A;  1HQO A;  2CA8 A;  3HCZ A;  2H6Z A;  1BJX A;  3EC3 A;  3CSI A;  3IK7 A;  3HVS A;  3PIN A;  3KH7 A;  2Z9S A;  4KDX A;  4G0I A;  5HR1 A;  3GKN A;  2OBK A;  2E2G A;  2QA2 A;  3DXB A;  3FEU A;  1YJ6 A;  1A23 A;  3FY7 A;  2PGT A;  5JWR B;  4I8B A;  4OFT A;  3J7Y b;  2C3Q A;  2DSA A;  2PMT A;  3FW2 A;  5ECI B;  2KLX A;  1AUC A;  1B4Q A;  4KGI A;  3VUR A;  1OC8 A;  3WT2 A;  3D21 A;  4I5Q A;  1ZCP A;  5CYY A;  5EL8 A;  12GS A;  2YNX A;  3CSH A;  3FRC A;  3MDK A;  3U6V A;  1K0N A;  1GSS A;  4JBB A;  3RPP A;  1FB0 A;  3QR6 A;  3IRA A;  4TXO B;  3MYD A;  1HD2 A;  2WZ9 A;  4JR6 A;  2YPM A;  2XPE A;  2N5A A;  3FZA A;  2FNO A;  1XFL A;  5CRH A;  5D9X A;  3BCI A;  4N11 A;  4XS6 A;  4LMW A;  1ON4 A;  2H1D A;  1JLV A;  3TOT A;  4KCE A;  2ZCT A;  2XHF A;  3AY8 A;  4GQC A;  5IMA A;  1EGR A;  1TRW A;  4WF5 A;  3RHC A;  4ULX A;  1U3I A;  1H4O A;  1TXX A;  4POL A;  3QPM A;  4D73 A;  5IPH A;  3G7J A;  3GA4 A;  5JWO B;  3DYR A;  5F06 A;  3ZYW A;  3Q19 A;  5KN2 A;  1G0T A;  1ZMA A;  1DE2 A;  1SJZ A;  4XRA A;  1G6W A;  2V1M A;  2WDU A;  1OC9 B;  3O3T A;  4JRR A;  2GSQ A;  2GST A;  2HYX A;  1RK4 A;  5DQY A;  3F6D A;  2HRN A;  2HI7 A;  4PTS A;  3HYP A;  1T4Y A;  5G5E A;  3VK9 A;  1WWJ A;  4ZIJ A;  1THX A;  4FQU A;  4PUF C;  1R26 A;  3IHQ A;  3FYG A;  1M99 A;  2EIR A;  1OVN A;  1S3C A;  4TW5 A;  1DE1 A;  1ZYE A;  4RI6 A;  3TKP A;  4E8E A;  2MMZ A;  2H76 A;  3UAR A;  1K0A A;  1B8X A;  3A2W A;  2CZ2 A;  1PL1 A;  1SEN A;  4EUY A;  2XC2 A;  2IL3 A;  3QAV A;  4XTS A;  1T3B A;  3VPT A;  4KAE A;  4BL7 B;  3LJR A;  4V1A p;  5JCG A;  2VLU A;  5EY6 A;  3E9J B;  1WRY A;  4MJC A;  3UJ1 A;  1T4Z A;  4NV2 A;  2OE0 A;  1AC1 A;  2I3Y A;  3G7I A;  4ICY A;  3LOR A;  3G7Y A;  2B3S A;  2C8U A;  1F6M C;  3EVI A;  1BG5 A;  4HOJ A;  1EOG A;  3DGQ A;  2R2J A;  1J9B A;  4WR4 A;  4CY6 A;  1A24 A;  2IMK A;  1Z3E A;  4K7I A;  2XBI A;  3TRQ A;  1K0B A;  1V9W A;  5J5N A;  4TRX A;  4BVX B;  4RQX A;  2L4Q A;  3F3R A;  1V40 A;  5DAK B;  4F82 A;  4MLY A;  1XWK A;  4WBR D;  4KB3 A;  3ZFL A;  3TKQ A;  1XVQ A;  4KF9 A;  1IYH A;  2QC7 A;  2REM A;  3BCK A;  4X4J A;  4Z2R A;  5ID2 A;  6GSY A;  2QKE A;  2QA1 A;  3L9U A;  1NSW A;  5KN1 A;  4XHM A;  3TKS C;  2MMA A;  5ECN B;  5F0G A;  4G0L A;  3VPQ A;  1I5G A;  2WRT A;  5G1K A;  2DKI A;  2OBI A;  3APS A;  1ZYQ B;  3HXS A;  4EF0 A;  3GH9 A;  2VCQ A;  3KXO A;  3ZVJ D;  3F3Q A;  3FZ4 A;  1EP7 A;  2F9S A;  4ECJ A;  4K1F A;  2N5B A;  2LQO A;  3SBC A;  3F9U A;  3C1R A;  1X9M B;  3D5J A;  4POM A;  3A5I A;  5FHI A;  4ECC A;  3KTB A;  1SYX A;  4HDE A;  5FWG A;  2YJ7 A;  4ILF A;  1V58 A;  2LNT A;  4G0K A;  3GRX A;  2RM5 A;  1R4W A;  1RQM A;  2VIM A;  1Y25 A;  3RHB A;  4GF0 A;  2DJK A;  4Q5N A;  2VM1 A;  4AJ7 A;  5CRW A;  4ZB8 A;  4MJB A;  1PD2 1;  1F9M A;  3D22 A;  4MK3 A;  3DIE A;  2I4A A;  1I9D A;  4FH8 A;  1QUW A;  4DVC A;  4PGT A;  2F8A A;  3TKS A;  2PER A;  2UZ8 A;  4JU5 A;  2ES7 A;  1GUH A;  2LTK A;  5J4U A;  4MMM A;  1B9X C;  4KH7 A;  5GZZ B;  2A4H A;  3EU4 A;  3M1G A;  3E0U A;  4ZB9 A;  5HFG A;  4EVM A;  5ECM B;  3UVH A;  4MH3 A;  2H70 A;  3EWL A;  2WUL A;  2H71 A;  4N0Z A;  5F8B A;  2I1U A;  3LEF A;  2ZNM A;  5A5K A;  2B1K A;  1EZK A;  2BJX A;  5AIS A;  1ERU A;  1AQV A;  1LBK A;  3FK8 A;  4XCS A;  3GX0 A;  2IJY A;  2I81 A;  4NXI A;  2VCZ A;  4TR1 A;  2HSH A;  2BTO T;  1JZW A;  2L57 A;  5B6M A;  3MIX A;  2VUP A;  5CAX A;  1OKT A;  3NOF A;  4JR4 A;  2HRA A;  1GSD A;  3OR5 A;  3R2Q A;  3TJG A;  4PUA A;  4XS1 A;  4BVY A;  1KBN A;  1T7P B;  2HE3 A;  5IM9 A;  3ZML A;  2YZH A;  4YKF A;  2VO4 A;  4FYC A;  2B5X A;  1A8Y A;  4KSO A;  3GH6 A;  3MSZ A;  4K2D A;  3A2X A;  1J08 A;  4V2N A;  3GFK A;  5GST A;  4ZIL A;  2NVL A;  1M9A A;  3P90 A;  1VGL A;  1GUM A;  2H74 A;  5D9T A;  1TK5 B;  4J2F A;  4N30 A;  3DWV A;  2VCX A;  4WKW A;  4IS0 A;  2FA4 A;  1GTU A;  2YOI A;  2HXK A;  4TN8 A;  2LEG A;  3ME7 A;  2HSY A;  4A5P A;  4NV5 A;  3M9J A;  2CVB A;  3LGC A;  3VWW A;  4ID0 A;  4AF2 A;  3KP9 A;  1FHE A;  1EWX A;  3LXZ A;  4ECB A;  2OJL A;  2FWH A;  3APO A;  1MDI A;  3FHK A;  1QK8 A;  4USS A;  2X49 A;  22GS A;  4RI7 A;  1ABA A;  2VL3 A;  4POB A;  1JHB A;  2LS5 A;  2ON5 A;  4IW9 A;  4ZBA A;  5G2Z A;  1R5P A;  4HZ4 A;  3G9B A;  1SJI A;  1CQH A;  3TKS E;  1ZGN A;  2M80 A;  3IDV A;  4G10 A;  4GLT A;  1YEX A;  5JCW A;  2PU9 C;  3H4K A;  1FW1 A;  4GSS A;  3GUR A;  3GX8 A;  1U88 A;  4DSQ A;  3ZZX A;  2DJJ A;  5EPF A;  2IMI A;  1Q98 A;  1PKZ A;  2PWJ A;  4CDO A;  1OE8 A;  4K6X A;  2LRN A;  2GQK A;  3KP8 A;  3QD9 A;  1GSU A;  3ZFB A;  1M2D A;  1ZOF A;  4TR3 A;  1EEJ A;  1WJK A;  1S3R A;  3PPU A;  3LWA A;  2MMN A;  4YAV A;  2DJ0 A;  3VFI A;  1S3D A;  4KW6 A;  1GTA A;  1QQ2 A;  4F2I A;  1PFO A;  1PN0 A;  2O89 A;  3V1W A;  4JZQ A;  4WF4 A;  3F63 A;  1A2M A;  5HR0 A;  3I9V 2;  3GN3 A;  3Q74 A;  3C71 A;  4LL4 B;  5E59 A;  5BMU A;  1Z6M A;  2J23 A;  1R7H A;  9GSS A;  3TUE A;  1JZD A;  1B48 A;  3VWV A;  4L0W A;  2K18 A;  3ZVJ A;  1K3Y A;  3HVX A;  4IQ1 A;  5ECO B;  3ISO A;  2JZR A;  2G2Q A;  4KSM A;  1KEB A;  1AAZ A;  1ERW A;  5G30 A;  16GS A;  3LYP A;  4MP4 A;  3QDN A;  5DAL A;  5D96 A;  2HRF A;  5C00 A;  4XIH A;  4K2X A;  5LCZ A;  3L0H A;  1OC3 A;  1XIY A;  1VF2 A;  2LST A;  4PX1 A;  5HFI A;  4AGS A;  1IYI A;  2GS3 A;  1EV4 A;  4PNG A;  7GSS A;  3D6I A;  2X4A A;  3R3E A;  3HKR A;  1X0R A;  3EMX A;  3H1N A;  3UMA A;  5DJL A;  5KOW A;  4N10 A;  1X5E A;  1GRX A;  3MAK A;  2B7J A;  3LXT A;  1W4V A;  3BD2 A;  2E2M A;  1PX7 A;  1AQW A;  2DJ3 A;  1O8X A;  2WGR A;  3P2A A;  1M9B A;  3WD6 A;  1PQN A;  1XWG A;  1Z6N A;  5L71 A;  4O7H A;  3ERF A;  2GZP A;  3DKS A;  5H5R A;  3M0F A;  4Z7X A;  1GNE A;  20GS A;  4MH2 A;  5AGY A;  5LD0 A;  2O7K A;  1B4P A;  2IME A;  5H5Q A;  4D73 B;  3UIW A;  2DJ2 A;  3IV4 A;  4QL7 A;  1UC7 A;  2M72 A;  1SJ6 A;  4TR0 A;  1BQ7 A;  1O85 A;  2LQQ A;  5INY A;  3P7X A;  3IAM 2;  2LJR A;  3BOA A;  5ABR A;  2R37 A;  5AIV A;  4LLR A;  4V1A g;  5G5F A;  1TRS A;  2K9F A;  2IFQ B;  2FLS A;  2P5R A;  5A4W A;  1X5C A;  2CX4 A;  1K3O A;  4MZB A;  3UOM A;  5KN0 A;  1MDK A;  2YZU A;  4GST A;  2DKH A;  3CYN A;  4IP6 A;  10GS A;  3C7M A;  4KA0 A;  4X0X A;  2TRC P;  4K5S A;  1FO5 A;  1OKD A;  4PQ1 A;  1K0O A;  2L4C A;  3KEB A;  5DCG A;  4BPY A;  1W89 A;  3DVW A;  2FD3 A;  3IBH A;  4H86 A;  2B6M A;  4ML1 A;  5DBQ A;  5F05 A;  1OC9 A;  4DEJ A;  2L5L A;  19GS A;  4NAX A;  4L5O A;  2FUG 2;  5CRD A;  2OE3 A;  3KM6 A;  3HD5 A;  3C8E A;  2JSY A;  1SK1 A;  3EYT A;  3MNG A;  2GT6 A;  2NDO A;  2L6D A;  3LG6 A;  1SK2 A;  3K8N A;  1SKR B;  2JL4 A;  2H6X A;  4FYU A;  1QGV A;  2HZF A;  3GNJ A;  4EL1 A;  2HZE A;  4HU9 A;  1U87 A;  2GGT A;  4KDY A;  3TRX A;  4TVE A;  3O76 A;  1GLP A;  2PPT A;  4TXV A;  2G0F A;  1MEK A;  2A2P A;  2ON7 A;  3FKF A;  4ZL9 A;  2H0H A;  2HT9 A;  3FR6 A;  4XS4 B;  2GVP A;  2H6Y A;  2CAQ A;  5KN3 A;  2WCI A;  2M46 A;  1GSF A;  2DBC A;  6GSU A;  3RAZ A;  3O6T A;  5DAK A;  5B8A A;  2GSR A;  2MYG A;  2H73 A;  5D9V A;  4Q5R A;  4RUV A;  2CQ9 A;  1SL0 B;  1V98 A;  3IC8 A;  4PNF A;  2AV4 A;  1N2A A;  1XZO A;  4GSN A;  2HLS A;  1YEP A;  1KNG A;  2P5Q A;  2AJQ B;  4NWY A;  1O6J A;  2L5O A;  5HQP A;  1YF1 A;  3GTU B;  1X9S B;  1GSY A;  3N9J A;  3VI7 A;  3EE2 A;  4J57 E;  1VF3 A;  6GSX A;  2PVQ A;  3F6F A;  3H79 A;  3KD0 A;  3QCP A;  1B9Y C;  1DSB A;  3KCM A;  2H72 A;  1A0R P;  2YN1 A;  4BWS A;  4Q5Q A;  2YAN A;  3EU3 A;  1A0F A;  1ZL9 A;  4PUR A;  1N8J A;  4L8E A;  1YF0 A;  1X9W B;  1UVZ A;  4NPB A;  5GSS A;  1YKC A;  2OE1 A;  4DSS A;  4LMV A;  4ML6 A;  3KTL A;  5G31 A;  4PQI A;  4NHW A;  3HJM A;  2AUV A;  2PBJ A;  2VLV A;  2OAD A;  4J56 E;  3F8U A;  3L78 A;  1O73 A;  5AIX A;  4HZ2 A;  2EC4 A;  1BED A;  2GDR A;  4KUN A;  3CRU A;  4TR4 A;  2PVO C;  2FHE A;  4OFN A;  1XW6 A;  2YJH A;  3IE3 A;  3VLN A;  2C3N A;  1PGT A;  3FZ9 A;  1TDI A;  2GQM A;  3BJ5 A;  4IP1 A;  3CTF A;  3TKR A;  3GYK A;  1F3B A;  3DEX A;  4MJE A;  4O32 A;  2YV7 A;  1HNB A;  2A2S A;  1LJR A;  1UN2 A;  2H75 A;  18GS A;  4MF5 A;  4ZBB A;  3HVV A;  4LL1 B;  4F9Z A;  1DBY A;  2LNS A;  1M7T A;  3A2V A;  3U5R E;  3KH9 A;  3TOU A;  5J41 A;  1JLW A;  2VCW A;  4IHU A;  3UBL A;  5IOW A;  2DLX A;  4WR5 A;  3IR4 A;  1Q4J A;  1ST9 A;  4G2E A;  1M3I A;  2C80 A;  4G19 A;  1Y6E A;  4WXT A;  2NTO A;  2GSS A;  1T1V A;  5F07 A;  1PN9 A;  1QMV A;  2TRX A;  4EDY A;  3ZIJ A;  2GQL A;  1UA5 A;  3E3E A;  2QSI A;  2DJ1 A;  3UVT A;  3L9V A;  3IOS A;  3J7Y k;  2KP2 A;  1SYR A;  3GMF A;  2KOK A;  2NPB A;  2KUC A;  1GSE A;  1PA3 A;  3UAP A;  4K7N A;  4TOP A;  1XVW A;  2B5E A;  4IGJ A;  1TTZ A;  1GL8 A;  5E4W A;  2P0G A;  1USB A;  2CV4 A;  4OD7 A;  2MBT A;  3IAS 2;  3N5O A;  2K6V A;  2YWO A;  3JCM L;  4GCI A;  4GXZ A;  2VLT A;  3H8Q A;  3HA9 A;  2X8C A;  3HJP A;  1C72 A;  3CMI A;  4ZB6 A;  2VL2 C;  3TJF A;  4WET A;  2IN3 A;  4HJ2 A;  3TDG A;  1G7E A;  3M8N A;  3FR3 A;  4IJI A;  2ZUP A;  2FA8 A;  5B7C A;  3ZTL A;  4AJ6 A;  4GWR A;  1TI3 A;  2CAI A;  1ML6 A;  2C4J A;  4NHZ A;  1KTE A;  1WMJ A;  5ECS A;  1T00 A;  5IMD A;  4OWY A;  2IPA A;  1SD8 A;  1SL1 B;  1XW5 A;  4KDU A;  2WJU A;  3CTG A;  3UEM A;  1VRS D;  3ZL5 A;  1TU7 A;  1TKD B;  1XWB A;  1YDK A;  2IIY A;  4CHS A;  4POK A;  1U6T A;  1O81 A;  2YV9 A;  6GSW A;  2MMO A;  2OKA A;  2GTU A;  3KMN A;  4IQA A;  2C1Y A;  4EKZ A;  1Z7R A;  5D93 A;  1V57 A;  1BYE A;  3CRT A;  2A2R A;  5DAL B;  1MD4 A;  2ALB A;  1JZO A;  4KE3 A;  2YWI A;  3F4R A;  5DVB A;  3TCO A;  5IMZ A;  2VOC A;  1XBS A;  2B7K A;  2X99 A;  4BIK A;  4F0B A;  1V2A A;  2NBS A;  11GS A;  4EXJ A;  1TK0 B;  3LW9 A;  2C0E A;  1ACV A;  1TOF A;  3GST A;  4CY8 A;  2H1A A;  2VD1 A;  1QXH A;  4HU7 A;  2OA7 A;  2V2G A;  3GKK A;  3EUR A;  3US3 A;  3IPZ A;  2B1L A;  4I2U A;  3HJO A;  4ISD A;  2LKU A;  1EGO A;  2AHE A;  1TW9 A;  2EIO A;  1RW1 A;  1S3A A;  5CRE A;  3PH9 A;  4HQS A;  1Z7P A;  6GSV A;  2LUS A;  4YQM A;  2KP1 A;  2JAD A;  3LFL A;  1ZZY A;  2WFC A;  2O8V B;  3F0I A;  1OYJ A;  1F37 A;  4BA7 A;  1PSQ A;  5DDL A;  1BAY A;  3WGX A;  3GKX A;  3UBK A;  4HQZ A;  4P3Y B;  2YCD A;  3H93 A;  3NIV A;  5HR2 A;  4O5U A;  3LQ7 A;  5IMV A;  3KJY A;  5ECR B;  1SKS B;  5ECH B;  4HJM A;  2YP6 A;  4ZBD A;  1WE0 A;  5J9B A;  3L4N A;  3TRP A;  1TK8 B;  2FWF A;  4OO5 A;  1AQX A;  2R5G A;  5CP1 A;  2VD0 A;  2RM6 A;  4EO3 A;  1EP8 A;  4GRF A;  2H0I A;  4TXO A;  4EC0 A;  5CRG A;  1PX6 A;  4KCA A;  2K8S A;  2HFD A;  4OFM A;  5IMF A;  5AN1 A;  1AXD A;  2FWG A;  4MPF A;  4ZL7 A;  3VI5 A;  14GS A;  3EPT A;  4MCU A;  3HZ8 A;  3C1S A;  4IN0 A;  2FY6 A;  3M3M A;  4PXO A;  2VAF A;  2N5F A;  5KOX A;  1FOV A;  4O5R A;  2IFQ A;  2LRT A;  4MDC A;  3SWL A;  3HDC A;  1TRU A;  2XBQ A;  1G6Y A;  1GWC A;  2H0G A;  4EIP A;  2L6C A;  3QFB C;  2R0G A;  5ECQ B;  2K8V A;  3WT1 A;  1GUK A;  2H19 A;  1MDJ A;  5B6N A;  4NMU A;  1XOA A;  1YY7 A;  4K8M A;  3EMP A;  2LV3 A;  2F51 A;  4EDZ A;  2L59 A;  5BRT A;  2P31 A;  1FVJ A;  1XWC A;  1K0D A;  5ECK B;  4V2L A;  4TKY A;  2HZE B;  3GUS A;  4Z2T A;  4MF6 A;  1SL2 B;  1A8L A;  2WS2 A;  1JZR A;  1O8W A;  5HFK A;  2IWT A;  1EV9 A;  3PGT A;  2R0C A;  2H1G A;  4DSR A;  1ZYP A;  3ZMK A;  5ID2 B;  2JAC A;  4V2M A;  2F8F A;  3TJK A;  4BL7 A;  5G1L A;  1FOH A;  4WEY A;  3D0Z A;  1GUL A;  2BMX A;  4OCF A;  1BX9 A;  3ERG A;  5DQS A;  2QGV A;  3Q18 A;  1HNC A;  1XW9 A;  1E6B A;  2C3T A;  2VL9 A;  2AYT A;  2O87 A;  2GZY A;  1ERV A;  5D9W A;  1XXU A;  3RDW A;  4MF7 A;  4QL9 A;  4IVF A;  1SKW B;  1GH2 A;  3I6A A;  3GIX A;  1YZX A;  2DIY A;  4WBJ A;  2X8G A;  3ME8 A;  3KMO A;  1GTB A;  1F2E A;  3M9K A;  4X1U A;  4BVX A;  1AW9 A;  1EEM A;  1SK0 A;  1MTC A;  3DD3 A;  3KGK A;  2H01 A;  2A4V A;  2FGX A;  1GP1 A;  2F3M A;  1ILO A;  5H5S A;  3W8S A;  4Z2U A;  1YQ1 A;  3S9F A;  4ACS A;  4XS4 A;  2JU5 A;  1XPV A;  3I43 A;  4YAP A;  1WIK A;  5CO3 A;  1M0U A;  1CQG A;  3A3T A;  4OCE A;  3ZLP A;  2DMM A;  3CSJ A;  2X8H A;  2E0Q A;  5LNK e;  3L9S A;  2PUK C;  3P8W A;  4I2T A;  3ZRD A;  3EIN A;  1R5A A;  2J9H A;  3RPN A;  1TJD A;  5D73 A;  4MJA A;  3FMW A;  4O5Q A;  2WB9 A;  3HHV A;  3D4T A;  3A5W A;  1FG4 A;  4ZXG A;  5ELG A;  4YKG A;  4BWQ A;  1K3L A;  3F4S A;  3QMX A;  4KX4 A;  5IPG A;  1K0M A;  3DRN A;  2CZ3 A;  4K0N A;  3CQF A;  4MNN A;  6GST A;  4LA1 A;  1EOH A;  3HY2 A;  4DSS B;  3WYW A;  4YQV A;  1JFU A;  5JCU A;  1GTI A;  2GLR A;  4G9H A;  4I97 A;  4JE1 A;  3GTU A;  4E8H A;  1O7U A;  2HNL A;  3LYK A;  1TP9 A;  5FT3 A;  3WGE A;  4TR1 B;  2C0F A;  5A4V A;  3GSS A;  1T8E B;  1OE7 A;  3RBT A;  1GLQ A;  4Q5F A;  1DUG A;  2I9H A;  3D4M A;  1GSQ A;  5IOX A;  4KND A;  3IK9 A;  4L5L A;  5J9C A;  3HVN A;  2E7P A;  2YWN A;  3IXR A;  4FO5 A;  3GL5 A;  4FIW A;  3KZQ A;  4HEA 2;  4AJ8 A;  1FB6 A;  2HSM A;  2DIZ A;  1WPI A;  4BVY B;  1M2B A;  3QAW A;  3MWH A;  4IEL A;  1NHO A;  5J3R A;  3CXG A;  3TB2 A;  2H30 A;  1PMT A;  2XPD A;  4OO4 A;  1GNW A;  1NW2 A;  5GAP D;  1THO A;  3IA1 A;  4HSC X;  3GHA A;  1TI1 A;  1NM3 A;  2CX3 A;  2CT6 A;  2HRK A;  2C0G A;  3ED3 A;  5ENU A;  5D8I A;  4FYB A;  5A4U A;  5HR3 A; 
#chains in the Genus database with same CATH homology
 1ERT A;  3DVX A;  17GS A;  2JZT A;  3FZ5 A;  2MZC A;  5DJM A;  4X43 A;  3C73 A;  8GSS A;  1F3A A;  3QFA C;  1SD9 A;  4L0U A;  5EVO A;  3CBU A;  2H8L A;  2IMD A;  2V41 A;  4N0V A;  1Z9H A;  4HUA A;  3UL3 A;  4IKH A;  1PKW A;  3DML A;  3GV1 A;  4YQU A;  1HNA A;  5JWQ B;  2R3X A;  4GTU A;  3W8J A;  1VF1 A;  2D2Z A;  5ECP B;  3ZIT A;  1HYU A;  2VCT A;  2V6K A;  1TRV A;  5IMC A;  4ZL8 A;  3LSZ A;  2R0P A;  2PN8 A;  1A2J A;  4MPG A;  3HZ4 A;  3KIJ A;  2JZS A;  3VWX A;  4MZW A;  2H66 A;  5CNW A;  1VF4 A;  4OMV A;  1Z5Y E;  2CVD A;  2V32 A;  2RUE A;  3ZIV A;  4K0G A;  2B5Y A;  1FVK A;  2X64 A;  3ZRE A;  1SU9 A;  1XOB A;  4XRD A;  3GL3 A;  1NHY A;  4EE0 A;  4PQH A;  3IHG A;  5DCH A;  5KEJ A;  4RQR A;  2RLI A;  3BBY A;  4HS1 A;  4K5R A;  13GS A;  1XCC A;  4MZC A;  1X5D A;  3Q6O A;  1A2L A;  3TJJ A;  1OAZ A;  2H1B A;  2LJK A;  4ECI A;  4I6X A;  4IBP A;  2VCV A;  2FCH A;  1J0F A;  4MA9 A;  1QFN A;  2O85 A;  2FWE A;  3ERW A;  1PRX A;  2VM2 A;  3FR9 A;  3TGZ A;  3QOU A;  2DC5 A;  2AAW A;  2EIQ A;  4K9Z A;  1U3A A;  2C0D A;  2OAC A;  3F4T A;  2KHP A;  4QQ7 A;  5C04 A;  2R4V A;  3WGD A;  4O92 A;  3VWU A;  5IO2 A;  1WP0 A;  1FAA A;  1URM A;  2RUF A;  5GAN D;  4EIQ A;  2GT5 A;  4K7O A;  4F03 A;  4JED A;  2CVK A;  3GKM A;  3PR8 A;  4IJ3 A;  1TU8 A;  2YWM A;  3IC4 A;  1MD3 A;  3W6G A;  5IO0 A;  1E2Y A;  2GZZ A;  1H75 A;  5ECL B;  2LJA A;  2MBS A;  4MAB A;  1XWA A;  1M2A A;  2RII A;  2AB6 A;  1K0C A;  3NZN A;  2IMF A;  5B8B A;  4HI7 A;  3QAG A;  2TIR A;  3I69 A;  4F0C A;  1AIU A;  5IIZ A;  2VL2 A;  5COH A;  2R6K A;  1WOU A;  4GQF A;  2JSZ A;  1PL2 A;  3APQ A;  4YH2 A;  5ELA A;  1LU4 A;  2DML A;  1YKA A;  2LRC A;  6GSS A;  2V6O A;  4CW9 A;  5IQY A;  3TJB A;  1G7O A;  1ZYN A;  1HQO A;  2CA8 A;  3HCZ A;  2H6Z A;  1BJX A;  3EC3 A;  3CSI A;  3IK7 A;  3HVS A;  3PIN A;  3KH7 A;  2Z9S A;  4KDX A;  4G0I A;  5HR1 A;  3GKN A;  2OBK A;  2E2G A;  2QA2 A;  3DXB A;  3FEU A;  1YJ6 A;  1A23 A;  3FY7 A;  2PGT A;  5JWR B;  4I8B A;  4OFT A;  3J7Y b;  2C3Q A;  2DSA A;  2PMT A;  3FW2 A;  5ECI B;  2KLX A;  1AUC A;  1B4Q A;  4KGI A;  3VUR A;  1OC8 A;  3WT2 A;  3D21 A;  4I5Q A;  1ZCP A;  5CYY A;  5EL8 A;  12GS A;  2YNX A;  3CSH A;  3FRC A;  3MDK A;  3U6V A;  1K0N A;  1GSS A;  4JBB A;  3RPP A;  1FB0 A;  3QR6 A;  3IRA A;  4TXO B;  3MYD A;  1HD2 A;  2WZ9 A;  4JR6 A;  2YPM A;  2XPE A;  2N5A A;  3FZA A;  2FNO A;  1XFL A;  5CRH A;  5D9X A;  3BCI A;  4N11 A;  4XS6 A;  1ON4 A;  4LMW A;  2H1D A;  1JLV A;  3TOT A;  4KCE A;  2ZCT A;  2XHF A;  3AY8 A;  4GQC A;  5IMA A;  1EGR A;  1TRW A;  4WF5 A;  3RHC A;  4ULX A;  1U3I A;  1H4O A;  1TXX A;  4POL A;  3QPM A;  4D73 A;  5IPH A;  3G7J A;  3GA4 A;  5JWO B;  3DYR A;  5F06 A;  3ZYW A;  3Q19 A;  5KN2 A;  1G0T A;  1ZMA A;  1DE2 A;  1SJZ A;  4XRA A;  1G6W A;  2V1M A;  2WDU A;  1OC9 B;  3O3T A;  4JRR A;  2GSQ A;  2GST A;  2HYX A;  1RK4 A;  5DQY A;  3F6D A;  2HRN A;  2HI7 A;  4PTS A;  3HYP A;  1T4Y A;  5G5E A;  3VK9 A;  1WWJ A;  4ZIJ A;  1THX A;  4FQU A;  4PUF C;  1R26 A;  3IHQ A;  3FYG A;  1M99 A;  2EIR A;  1OVN A;  1S3C A;  4TW5 A;  1DE1 A;  1ZYE A;  4RI6 A;  3TKP A;  4E8E A;  2MMZ A;  2H76 A;  3UAR A;  1K0A A;  1B8X A;  3A2W A;  2CZ2 A;  1PL1 A;  1SEN A;  4EUY A;  2XC2 A;  2IL3 A;  3QAV A;  4XTS A;  1T3B A;  3VPT A;  4KAE A;  4BL7 B;  3LJR A;  4V1A p;  5JCG A;  2VLU A;  5EY6 A;  3E9J B;  1WRY A;  4MJC A;  3UJ1 A;  1T4Z A;  4NV2 A;  2OE0 A;  1AC1 A;  2I3Y A;  3G7I A;  4ICY A;  3LOR A;  3G7Y A;  2B3S A;  2C8U A;  1F6M C;  3EVI A;  1BG5 A;  4HOJ A;  1EOG A;  3DGQ A;  2R2J A;  1J9B A;  4WR4 A;  4CY6 A;  1A24 A;  2IMK A;  1Z3E A;  4K7I A;  2XBI A;  3TRQ A;  1K0B A;  1V9W A;  5J5N A;  4TRX A;  4BVX B;  4RQX A;  2L4Q A;  3F3R A;  1V40 A;  5DAK B;  4F82 A;  4MLY A;  1XWK A;  4WBR D;  4KB3 A;  3ZFL A;  3TKQ A;  1XVQ A;  4KF9 A;  1IYH A;  2QC7 A;  2REM A;  3BCK A;  4X4J A;  4Z2R A;  5ID2 A;  6GSY A;  2QKE A;  2QA1 A;  3L9U A;  1NSW A;  5KN1 A;  4XHM A;  3TKS C;  2MMA A;  5ECN B;  5F0G A;  4G0L A;  3VPQ A;  1I5G A;  2WRT A;  5G1K A;  2DKI A;  2OBI A;  3APS A;  1ZYQ B;  3HXS A;  4EF0 A;  3GH9 A;  2VCQ A;  3KXO A;  3ZVJ D;  3F3Q A;  3FZ4 A;  1EP7 A;  2F9S A;  4ECJ A;  4K1F A;  2N5B A;  2LQO A;  3SBC A;  3F9U A;  3C1R A;  1X9M B;  3D5J A;  4POM A;  3A5I A;  5FHI A;  4ECC A;  3KTB A;  1SYX A;  4HDE A;  5FWG A;  2YJ7 A;  4ILF A;  1V58 A;  2LNT A;  4G0K A;  3GRX A;  2RM5 A;  1R4W A;  1RQM A;  2VIM A;  1Y25 A;  3RHB A;  4GF0 A;  2DJK A;  4Q5N A;  2VM1 A;  4AJ7 A;  5CRW A;  4ZB8 A;  4MJB A;  1PD2 1;  1F9M A;  3D22 A;  4MK3 A;  3DIE A;  2I4A A;  1I9D A;  4FH8 A;  1QUW A;  4DVC A;  4PGT A;  2F8A A;  3TKS A;  2PER A;  2UZ8 A;  4JU5 A;  2ES7 A;  1GUH A;  2LTK A;  5J4U A;  4MMM A;  1B9X C;  4KH7 A;  5GZZ B;  2A4H A;  3EU4 A;  3M1G A;  3E0U A;  4ZB9 A;  5HFG A;  4EVM A;  5ECM B;  3UVH A;  4MH3 A;  2H70 A;  3EWL A;  2WUL A;  2H71 A;  4N0Z A;  5F8B A;  2I1U A;  3LEF A;  2ZNM A;  5A5K A;  2B1K A;  1EZK A;  2BJX A;  5AIS A;  1ERU A;  1AQV A;  1LBK A;  3FK8 A;  4XCS A;  3GX0 A;  2IJY A;  2I81 A;  4NXI A;  2VCZ A;  4TR1 A;  2HSH A;  2BTO T;  1JZW A;  2L57 A;  5B6M A;  3MIX A;  2VUP A;  5CAX A;  1OKT A;  3NOF A;  4JR4 A;  2HRA A;  1GSD A;  3OR5 A;  3R2Q A;  3TJG A;  4PUA A;  4XS1 A;  4BVY A;  1KBN A;  1T7P B;  2HE3 A;  5IM9 A;  3ZML A;  2YZH A;  4YKF A;  2VO4 A;  4FYC A;  2B5X A;  1A8Y A;  4KSO A;  3GH6 A;  3MSZ A;  4K2D A;  3A2X A;  1J08 A;  4V2N A;  3GFK A;  5GST A;  4ZIL A;  2NVL A;  1M9A A;  3P90 A;  1VGL A;  1GUM A;  2H74 A;  5D9T A;  1TK5 B;  4J2F A;  4N30 A;  3DWV A;  2VCX A;  4WKW A;  4IS0 A;  2FA4 A;  1GTU A;  2YOI A;  2HXK A;  4TN8 A;  2LEG A;  3ME7 A;  2HSY A;  4A5P A;  4NV5 A;  3M9J A;  2CVB A;  3LGC A;  3VWW A;  4ID0 A;  4AF2 A;  3KP9 A;  1FHE A;  1EWX A;  3LXZ A;  4ECB A;  2OJL A;  2FWH A;  3APO A;  1MDI A;  3FHK A;  1QK8 A;  4USS A;  2X49 A;  22GS A;  4RI7 A;  1ABA A;  2VL3 A;  4POB A;  1JHB A;  2LS5 A;  2ON5 A;  4IW9 A;  4ZBA A;  5G2Z A;  1R5P A;  4HZ4 A;  3G9B A;  1SJI A;  1CQH A;  3TKS E;  1ZGN A;  2M80 A;  3IDV A;  4G10 A;  4GLT A;  1YEX A;  5JCW A;  2PU9 C;  3H4K A;  1FW1 A;  4GSS A;  3GUR A;  3GX8 A;  1U88 A;  4DSQ A;  3ZZX A;  2DJJ A;  5EPF A;  2IMI A;  1Q98 A;  1PKZ A;  2PWJ A;  4CDO A;  1OE8 A;  4K6X A;  2LRN A;  2GQK A;  3KP8 A;  3QD9 A;  1GSU A;  3ZFB A;  1M2D A;  1ZOF A;  4TR3 A;  1EEJ A;  1WJK A;  3PPU A;  3LWA A;  2MMN A;  4YAV A;  2DJ0 A;  3VFI A;  1S3D A;  4KW6 A;  1GTA A;  1QQ2 A;  4F2I A;  1PN0 A;  2O89 A;  3V1W A;  4JZQ A;  4WF4 A;  3F63 A;  1A2M A;  5HR0 A;  3I9V 2;  3GN3 A;  3Q74 A;  3C71 A;  4LL4 B;  5E59 A;  5BMU A;  1Z6M A;  2J23 A;  1R7H A;  9GSS A;  3TUE A;  1JZD A;  1B48 A;  3VWV A;  4L0W A;  2K18 A;  3ZVJ A;  1K3Y A;  3HVX A;  4IQ1 A;  5ECO B;  3ISO A;  2JZR A;  2G2Q A;  4KSM A;  1KEB A;  1AAZ A;  1ERW A;  5G30 A;  16GS A;  3LYP A;  4MP4 A;  3QDN A;  5DAL A;  5D96 A;  2HRF A;  5C00 A;  4XIH A;  4K2X A;  5LCZ A;  3L0H A;  1OC3 A;  1XIY A;  1VF2 A;  2LST A;  4PX1 A;  5HFI A;  4AGS A;  1IYI A;  2GS3 A;  1EV4 A;  4PNG A;  7GSS A;  3D6I A;  2X4A A;  3R3E A;  3HKR A;  1X0R A;  3EMX A;  3H1N A;  3UMA A;  5DJL A;  5KOW A;  4N10 A;  1X5E A;  1GRX A;  3MAK A;  2B7J A;  3LXT A;  1W4V A;  3BD2 A;  2E2M A;  1PX7 A;  1AQW A;  2DJ3 A;  1O8X A;  2WGR A;  3P2A A;  1M9B A;  3WD6 A;  1PQN A;  1XWG A;  1Z6N A;  5L71 A;  4O7H A;  3ERF A;  2GZP A;  3DKS A;  5H5R A;  3M0F A;  4Z7X A;  1GNE A;  20GS A;  4MH2 A;  5AGY A;  5LD0 A;  2O7K A;  1B4P A;  2IME A;  5H5Q A;  4D73 B;  3UIW A;  2DJ2 A;  3IV4 A;  4QL7 A;  1UC7 A;  2M72 A;  1SJ6 A;  4TR0 A;  1BQ7 A;  1O85 A;  2LQQ A;  5INY A;  3P7X A;  3IAM 2;  2LJR A;  3BOA A;  5ABR A;  2R37 A;  5AIV A;  4LLR A;  4V1A g;  5G5F A;  1TRS A;  2K9F A;  2IFQ B;  2FLS A;  2P5R A;  5A4W A;  1X5C A;  2CX4 A;  1K3O A;  4MZB A;  3UOM A;  5KN0 A;  1MDK A;  2YZU A;  4GST A;  2DKH A;  3CYN A;  4IP6 A;  10GS A;  3C7M A;  4KA0 A;  4X0X A;  2TRC P;  4K5S A;  1FO5 A;  1OKD A;  4PQ1 A;  1K0O A;  2L4C A;  3KEB A;  5DCG A;  4BPY A;  1W89 A;  3DVW A;  2FD3 A;  3IBH A;  4H86 A;  2B6M A;  4ML1 A;  5DBQ A;  5F05 A;  1OC9 A;  4DEJ A;  2L5L A;  19GS A;  4NAX A;  4L5O A;  2FUG 2;  5CRD A;  2OE3 A;  3KM6 A;  3HD5 A;  3C8E A;  2JSY A;  1SK1 A;  3EYT A;  3MNG A;  2GT6 A;  2NDO A;  2L6D A;  3LG6 A;  1SK2 A;  3K8N A;  1SKR B;  2JL4 A;  2H6X A;  4FYU A;  1QGV A;  2HZF A;  3GNJ A;  4EL1 A;  2HZE A;  4HU9 A;  1U87 A;  2GGT A;  4KDY A;  3TRX A;  4TVE A;  3O76 A;  1GLP A;  2PPT A;  4TXV A;  2G0F A;  1MEK A;  2A2P A;  2ON7 A;  3FKF A;  4ZL9 A;  2H0H A;  2HT9 A;  3FR6 A;  4XS4 B;  2GVP A;  2H6Y A;  2CAQ A;  5KN3 A;  2WCI A;  2M46 A;  1GSF A;  2DBC A;  6GSU A;  3RAZ A;  3O6T A;  5DAK A;  5B8A A;  2GSR A;  2MYG A;  2H73 A;  5D9V A;  4Q5R A;  4RUV A;  2CQ9 A;  1SL0 B;  1V98 A;  3IC8 A;  4PNF A;  2AV4 A;  1N2A A;  1XZO A;  4GSN A;  2HLS A;  1YEP A;  1KNG A;  2P5Q A;  2AJQ B;  4NWY A;  1O6J A;  2L5O A;  5HQP A;  1YF1 A;  3GTU B;  1X9S B;  1GSY A;  3N9J A;  3VI7 A;  3EE2 A;  4J57 E;  1VF3 A;  6GSX A;  2PVQ A;  3F6F A;  3H79 A;  3KD0 A;  3QCP A;  1B9Y C;  1DSB A;  3KCM A;  2H72 A;  1A0R P;  2YN1 A;  4BWS A;  4Q5Q A;  2YAN A;  3EU3 A;  1A0F A;  1ZL9 A;  4PUR A;  1N8J A;  4L8E A;  1YF0 A;  1X9W B;  1UVZ A;  4NPB A;  5GSS A;  1YKC A;  2OE1 A;  4DSS A;  4LMV A;  4ML6 A;  3KTL A;  5G31 A;  4PQI A;  4NHW A;  3HJM A;  2AUV A;  2PBJ A;  2VLV A;  2OAD A;  4J56 E;  3F8U A;  3L78 A;  1O73 A;  5AIX A;  4HZ2 A;  2EC4 A;  1BED A;  2GDR A;  4KUN A;  3CRU A;  4TR4 A;  2PVO C;  2FHE A;  4OFN A;  1XW6 A;  2YJH A;  3IE3 A;  3VLN A;  2C3N A;  1PGT A;  3FZ9 A;  1TDI A;  2GQM A;  3BJ5 A;  4IP1 A;  3CTF A;  3TKR A;  3GYK A;  1F3B A;  3DEX A;  4MJE A;  4O32 A;  2YV7 A;  1HNB A;  2A2S A;  1LJR A;  1UN2 A;  2H75 A;  18GS A;  4MF5 A;  4ZBB A;  3HVV A;  4LL1 B;  4F9Z A;  1DBY A;  2LNS A;  1M7T A;  3A2V A;  3U5R E;  3KH9 A;  3TOU A;  5J41 A;  1JLW A;  2VCW A;  4IHU A;  3UBL A;  5IOW A;  2DLX A;  4WR5 A;  3IR4 A;  1Q4J A;  1ST9 A;  4G2E A;  2C80 A;  4G19 A;  1Y6E A;  4WXT A;  2NTO A;  2GSS A;  1T1V A;  5F07 A;  1PN9 A;  1QMV A;  2TRX A;  4EDY A;  3ZIJ A;  2GQL A;  1UA5 A;  3E3E A;  2QSI A;  2DJ1 A;  3UVT A;  3L9V A;  3IOS A;  3J7Y k;  2KP2 A;  1SYR A;  3GMF A;  2KOK A;  2NPB A;  2KUC A;  1GSE A;  1PA3 A;  3UAP A;  4K7N A;  4TOP A;  1XVW A;  2B5E A;  4IGJ A;  1TTZ A;  1GL8 A;  5E4W A;  2P0G A;  1USB A;  2CV4 A;  4OD7 A;  2MBT A;  3IAS 2;  3N5O A;  2K6V A;  2YWO A;  3JCM L;  4GCI A;  4GXZ A;  2VLT A;  3H8Q A;  3HA9 A;  2X8C A;  3HJP A;  1C72 A;  3CMI A;  4ZB6 A;  2VL2 C;  3TJF A;  4WET A;  2IN3 A;  4HJ2 A;  3TDG A;  1G7E A;  3M8N A;  3FR3 A;  4IJI A;  2ZUP A;  2FA8 A;  5B7C A;  3ZTL A;  4AJ6 A;  4GWR A;  1TI3 A;  2CAI A;  1ML6 A;  2C4J A;  4NHZ A;  1KTE A;  1WMJ A;  5ECS A;  1T00 A;  5IMD A;  4OWY A;  2IPA A;  1SD8 A;  1SL1 B;  1XW5 A;  4KDU A;  2WJU A;  3CTG A;  3UEM A;  1VRS D;  3ZL5 A;  1TU7 A;  1TKD B;  1XWB A;  1YDK A;  2IIY A;  4CHS A;  4POK A;  1U6T A;  1O81 A;  2YV9 A;  6GSW A;  2MMO A;  2OKA A;  2GTU A;  3KMN A;  4IQA A;  2C1Y A;  4EKZ A;  1Z7R A;  5D93 A;  1V57 A;  1BYE A;  3CRT A;  2A2R A;  5DAL B;  1MD4 A;  2ALB A;  1JZO A;  4KE3 A;  2YWI A;  3F4R A;  5DVB A;  3TCO A;  5IMZ A;  2VOC A;  1XBS A;  2B7K A;  2X99 A;  4F0B A;  1V2A A;  2NBS A;  11GS A;  4EXJ A;  1TK0 B;  3LW9 A;  2C0E A;  1ACV A;  1TOF A;  3GST A;  4CY8 A;  2H1A A;  2VD1 A;  1QXH A;  4HU7 A;  2OA7 A;  2V2G A;  3GKK A;  3EUR A;  3US3 A;  3IPZ A;  2B1L A;  4I2U A;  3HJO A;  4ISD A;  2LKU A;  1EGO A;  2AHE A;  1TW9 A;  2EIO A;  1RW1 A;  1S3A A;  5CRE A;  3PH9 A;  4HQS A;  1Z7P A;  6GSV A;  2LUS A;  4YQM A;  2KP1 A;  2JAD A;  3LFL A;  1ZZY A;  2WFC A;  2O8V B;  3F0I A;  1OYJ A;  1F37 A;  4BA7 A;  1PSQ A;  5DDL A;  1BAY A;  3WGX A;  3GKX A;  3UBK A;  4HQZ A;  4P3Y B;  2YCD A;  3H93 A;  3NIV A;  5HR2 A;  4O5U A;  3LQ7 A;  5IMV A;  3KJY A;  5ECR B;  1SKS B;  5ECH B;  4HJM A;  2YP6 A;  4ZBD A;  1WE0 A;  5J9B A;  3L4N A;  3TRP A;  1TK8 B;  2FWF A;  4OO5 A;  1AQX A;  2R5G A;  5CP1 A;  2VD0 A;  2RM6 A;  4EO3 A;  1EP8 A;  4GRF A;  2H0I A;  4TXO A;  4EC0 A;  5CRG A;  1PX6 A;  4KCA A;  2K8S A;  2HFD A;  4OFM A;  5IMF A;  5AN1 A;  1AXD A;  2FWG A;  4MPF A;  4ZL7 A;  3VI5 A;  14GS A;  3EPT A;  4MCU A;  3HZ8 A;  3C1S A;  4IN0 A;  2FY6 A;  3M3M A;  4PXO A;  2VAF A;  2N5F A;  5KOX A;  1FOV A;  4O5R A;  2IFQ A;  2LRT A;  4MDC A;  3SWL A;  3HDC A;  1TRU A;  2XBQ A;  1G6Y A;  1GWC A;  2H0G A;  4EIP A;  2L6C A;  3QFB C;  2R0G A;  5ECQ B;  2K8V A;  3WT1 A;  1GUK A;  2H19 A;  1MDJ A;  5B6N A;  4NMU A;  1XOA A;  1YY7 A;  4K8M A;  3EMP A;  2LV3 A;  2F51 A;  4EDZ A;  2L59 A;  5BRT A;  2P31 A;  1FVJ A;  1XWC A;  1K0D A;  5ECK B;  4V2L A;  4TKY A;  2HZE B;  3GUS A;  4Z2T A;  4MF6 A;  1SL2 B;  1A8L A;  2WS2 A;  1JZR A;  1O8W A;  5HFK A;  2IWT A;  1EV9 A;  3PGT A;  2R0C A;  2H1G A;  4DSR A;  1ZYP A;  3ZMK A;  5ID2 B;  2JAC A;  4V2M A;  2F8F A;  3TJK A;  4BL7 A;  5G1L A;  1FOH A;  4WEY A;  3D0Z A;  1GUL A;  2BMX A;  4OCF A;  1BX9 A;  3ERG A;  5DQS A;  2QGV A;  3Q18 A;  1HNC A;  1XW9 A;  1E6B A;  2C3T A;  2VL9 A;  2AYT A;  2O87 A;  2GZY A;  1ERV A;  5D9W A;  1XXU A;  3RDW A;  4MF7 A;  4QL9 A;  4IVF A;  1SKW B;  1GH2 A;  3I6A A;  3GIX A;  1YZX A;  2DIY A;  4WBJ A;  2X8G A;  3ME8 A;  3KMO A;  1GTB A;  1F2E A;  3M9K A;  4X1U A;  4BVX A;  1AW9 A;  1EEM A;  1SK0 A;  1MTC A;  3DD3 A;  3KGK A;  2H01 A;  2A4V A;  2FGX A;  1GP1 A;  2F3M A;  1ILO A;  5H5S A;  3W8S A;  4Z2U A;  1YQ1 A;  3S9F A;  4ACS A;  4XS4 A;  2JU5 A;  1XPV A;  3I43 A;  4YAP A;  1WIK A;  5CO3 A;  1M0U A;  1CQG A;  3A3T A;  4OCE A;  3ZLP A;  2DMM A;  3CSJ A;  2X8H A;  2E0Q A;  5LNK e;  3L9S A;  2PUK C;  3P8W A;  4I2T A;  3ZRD A;  3EIN A;  1R5A A;  2J9H A;  3RPN A;  1TJD A;  5D73 A;  4MJA A;  3FMW A;  4O5Q A;  2WB9 A;  3HHV A;  3D4T A;  3A5W A;  1FG4 A;  4ZXG A;  5ELG A;  4YKG A;  4BWQ A;  1K3L A;  3F4S A;  3QMX A;  4KX4 A;  5IPG A;  1K0M A;  3DRN A;  2CZ3 A;  4K0N A;  4MNN A;  6GST A;  4LA1 A;  1EOH A;  3HY2 A;  4DSS B;  3WYW A;  4YQV A;  1JFU A;  5JCU A;  1GTI A;  2GLR A;  4G9H A;  4I97 A;  4JE1 A;  3GTU A;  4E8H A;  1O7U A;  2HNL A;  3LYK A;  1TP9 A;  5FT3 A;  3WGE A;  4TR1 B;  2C0F A;  5A4V A;  3GSS A;  1T8E B;  1OE7 A;  3RBT A;  1GLQ A;  4Q5F A;  1DUG A;  2I9H A;  3D4M A;  1GSQ A;  5IOX A;  4KND A;  3IK9 A;  4L5L A;  5J9C A;  2E7P A;  2YWN A;  3IXR A;  4FO5 A;  3GL5 A;  4FIW A;  3KZQ A;  4HEA 2;  4AJ8 A;  1FB6 A;  2HSM A;  2DIZ A;  1WPI A;  4BVY B;  1M2B A;  3QAW A;  3MWH A;  4IEL A;  1NHO A;  5J3R A;  3CXG A;  3TB2 A;  2H30 A;  1PMT A;  2XPD A;  4OO4 A;  1GNW A;  1NW2 A;  5GAP D;  1THO A;  3IA1 A;  3GHA A;  1TI1 A;  1NM3 A;  2CX3 A;  2CT6 A;  2HRK A;  2C0G A;  3ED3 A;  5ENU A;  5D8I A;  4FYB A;  5A4U A;  5HR3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...