2P31A

Crystal structure of human glutathione peroxidase 7
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
155
structure length
155
Chain Sequence
b'QDFYDFKAVNIRGKLVSLEKYRGSVSLVVNVASECGFTDQHYRALQQLQRDLGPHHFNVLAFPCNQFGQQEPDSNKEIESFARRTYSVSFPMFSKIAVTGTGAHPAFKYLAQTSGKEPTWNFWKYLVAPDGKVVGAWDPTVSVEEVRPQITALVR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human glutathione peroxidase 7
rcsb
molecule keywords Glutathione peroxidase 7
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 50
structure length 155
sequence length 155
chains with identical sequence B
ec nomenclature ec 1.11.1.9: Glutathione peroxidase.
pdb deposition date 2007-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00255 GSHPx Glutathione peroxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2p31A00
4GSNA 3ZVJD 3KXOA 1O6JA 3A5WA 4WXTA 3TRQA 1LU4A 3NOFA 4OFNA 2IWTA 1LBKA 1XVQA 5HFKA 2K9FA 3CMIA 1XW9A 1GWCA 2OADA 5G1LA 2FLSA 1M9AA 4MDCA 1TRUA 4TKYA 2YJHA 3ZFLA 4OD7A 1YDKA 4PGTA 5JCUA 2WGRA 4YQUA 1ILOA 4WR5A 4MF7A 3UMAA 4EF0A 1YQ1A 2F9SA 4PUAA 1TU8A 1SL0B 1K3YA 1MD4A 2HFDA 5C04A 2FNOA 3GA4A 2GT5A 3IHQA 3ME8A 5HR1A 4J57E 1TXXA 2RLIA 1WMJA 2F3MA 3HYPA 5D96A 3ZIJA 4POLA 1A24A 4NMUA 1UVZA 2M80A 3P8WA 3WGDA 3BCIA 4FO5A 4KDXA 5HR0A 4HOJA 2GLRA 3G7YA 1EEJA 3BOAA 2R6KA 5CO3A 3TJKA 3D0ZA 5G5EA 5DDLA 4KB3A 5IIZA 5AISA 1WP0A 2GZPA 2F8AA 1ZOFA 2YCDA 5A4WA 3KH7A 4KCEA 2HT9A 5ECRB 4F82A 5IO2A 4IP6A 3C1RA 4ZL8A 4BVYA 2WCIA 2P31A 3QPMA 2MMOA 2B6MA 4NV5A 2H6ZA 4ZL9A 1DUGA 4NXIA 2P5RA 1YY7A 2IMEA 3ZTLA 2DJKA 2E2GA 1X0RA 4ECBA 3Q19A 4MZBA 2V41A 3DKSA 3FZ9A 1ML6A 5DJLA 5KN0A 3KM6A 2WRTA 4MK3A 3DMLA 1XPVA 2B5YA 3EC3A 5E4WA 2O87A 1EOGA 2CA8A 5KN3A 3GSTA 4RQRA 5EVOA 3F6FA 3I9V2 4F0BA 1OE8A 2CV4A 2OKAA 2NPBA 3H1NA 3GKNA 2CAQA 2VO4A 2L59A 5EY6A 1B8XA 4I2TA 4I6XA 2KP2A 2VM1A 3FR9A 2B7KA 5B8BA 5GAND 3M0FA 4X1UA 2GZZA 2VAFA 3DVWA 1QGVA 3FY7A 3W6GA 3D21A 4WBJA 1FHEA 2L4QA 1T4YA 3LFLA 3FYGA 3KTLA 5ELAA 1HD2A 2HRFA 2FA4A 1FO5A 2YWMA 1HYUA 3GH9A 16GSA 4DEJA 4BL7A 4F0CA 2VL2C 2QSIA 3LORA 1GLQA 10GSA 3HCZA 2IMIA 1PKWA 2ZNMA 3U5RE 2OE3A 3FR3A 3CSHA 3KD0A 3W8SA 4K9ZA 4OFTA 3I6AA 1S3DA 3LQ7A 3GKXA 5DQYA 5E59A 3EMXA 1XVWA 3QDNA 4HEA2 3GSSA 4XRAA 1K0BA 2I1UA 2GQKA 2JZRA 2IMKA 3TKSC 4TVEA 2H75A 4EKZA 2CT6A 2DBCA 20GSA 1K0AA 1EV4A 2YV7A 3L4NA 4WKWA 2AJQB 4YAPA 3UVTA 1W89A 5F0GA 3P2AA 2JL4A 2LSTA 3LEFA 5ECLB 1ERVA 4LMWA 2B5XA 2QGVA 4FYUA 1R5AA 1B9YC 3QAVA 2GZYA 3Q18A 3UIWA 2X64A 4NAXA 1BJXA 1VF4A 2RM5A 4JU5A 5D9WA 2R5GA 2V1MA 3TOUA 4MPFA 1Y6EA 3W8JA 4ISDA 1K0MA 4DSSB 2YP6A 3D22A 1JZRA 4TR3A 1PD21 4GRFA 2VM2A 4KE3A 2KHPA 4ZBBA 1TRWA 5G2ZA 4Q5QA 4N0VA 3EINA 3KP8A 1Z3EA 1K3LA 3N9JA 4YQVA 1XW6A 1R4WA 5D93A 4JEDA 5J9CA 2VOCA 4KH7A 4PUFC 2O8VB 3UVHA 2R2JA 3ZMLA 2ZCTA 6GSYA 4QL9A 1EGRA 4E8EA 4GTUA 3MNGA 3VURA 2VUPA 3IDVA 2RUFA 3H79A 4KW6A 2PVOC 2ZUPA 1GSFA 3ERGA 1TW9A 3KEBA 5DAKB 4LL4B 1U3IA 1GSEA 5A4UA 4F9ZA 3DRNA 4ZB9A 3PINA 4ECIA 1SK2A 4LLRA 1Z6NA 1TK5B 2LKUA 4N0ZA 1JLVA 3VI5A 3C1SA 3SBCA 4ID0A 5A5KA 4GLTA 2IJYA 2L5LA 3BBYA 3LG6A 4POBA 2KP1A 3WGEA 1AQWA 1M99A 2RUEA 2EIOA 1SKSB 2HXKA 2VCWA 4KDYA 4ML6A 4IS0A 3QFBC 4AJ8A 2B5EA 3HZ8A 2LQQA 2JACA 1EV9A 1MTCA 4KSOA 3F4RA 1JZDA 2AUVA 2NTOA 1TDIA 5ECPB 1K0OA 6GSXA 2YANA 4GQCA 3J7Yb 1MDKA 5ECIB 3ZRDA 2C0EA 2MBTA 3R2QA 4IGJA 4MH3A 1QK8A 1BQ7A 3HJOA 3HJMA 2RIIA 2FA8A 4GCIA 2HI7A 5ECOB 4CW9A 3DVXA 2JZSA 5HFIA 3ISOA 4MJAA 2G0FA 4YAVA 2H66A 4BVXA 4DSSA 2H1DA 3TDGA 1BX9A 2NDOA 3PR8A 2YWIA 2TRCP 4LMVA 3L78A 4XIHA 1ZGNA 3ERFA 5HR2A 1HQOA 1LJRA 1ZZYA 5CYYA 1GULA 2C0GA 1O8WA 1TJDA 2C80A 1RQMA 5IPGA 2A2SA 3E0UA 4D73B 3KMNA 4J56E 2BTOT 4DVCA 2AYTA 4K2DA 1PQNA 2I81A 1EP7A 3RBTA 3CXGA 2OE1A 3D5JA 4MH2A 4IQ1A 1V57A 3HY2A 1OKDA 5DAKA 2NVLA 3EWLA 3F3RA 3KTBA 4HDEA 2GTUA 2XC2A 4GWRA 3F63A 1GRXA 1PMTA 2HZEA 3CRTA 1A2JA 2B1KA 2C0FA 3UBLA 4XS1A 5J3RA 2EC4A 1VF2A 1K0CA 5CAXA 2HNLA 3MSZA 3LYPA 3PH9A 2ES7A 4F2IA 3EU4A 4PXOA 1Z7PA 1EOHA 4CHSA 1KBNA 1PRXA 2GQLA 1X5DA 5F05A 1AUCA 2CX3A 3G7IA 4V2LA 1O7UA 1YKAA 6GSTA 3EYTA 1SENA 2K8VA 4L0UA 2MMZA 4MZCA 3EVIA 2N5AA 4XTSA 3ME7A 4AJ7A 3E3EA 1F37A 4X43A 1V58A 4NHZA 1WWJA 4OO4A 4K8MA 1F2EA 4ECJA 1NSWA 5HR3A 3VLNA 4MJEA 6GSUA 3UARA 3QFAC 2H76A 2AHEA 1XWCA 3L9UA 3QCPA 5FHIA 3KH9A 4ZBDA 3HVXA 4H86A 2VL9A 4JE1A 1M2DA 2YV9A 1PX7A 5CRGA 1AIUA 3O6TA 5J4UA 5F06A 1IYHA 2GDRA 1OC9B 3L9SA 4ZXGA 5D9XA 3WD6A 4TR0A 3VWUA 1V40A 1G7OA 4POMA 3GRXA 3KGKA 1ACVA 4XCSA 4XHMA 1BEDA 1M0UA 2FY6A 1OYJA 3DD3A 3U6VA 2NBSA 3HA9A 5DVBA 4EXJA 4D73A 1GTAA 4ZBAA 4K7NA 1GL8A 5B6NA 3ZFBA 2GSSA 1GUHA 4PX1A 1NM3A 3GH6A 2K6VA 2PERA 2R37A 1G6YA 4K1FA 1FVKA 2VCTA 3HXSA 5HFGA 4ZIJA 2TRXA 2C3NA 2H70A 2I4AA 2GQMA 2DJ0A 3IBHA 4ZL7A 1ERUA 2V6OA 4WF4A 2VCQA 5DCGA 3Q6OA 4I2UA 1SYXA 4OO5A 1TK8B 1A2MA 2WJUA 3UEMA 2PN8A 2IFQB 2IN3A 1AC1A 2CQ9A 1RK4A 1GUKA 2A2RA 1G6WA 5IM9A 5EL8A 2C8UA 4PQHA 4KCAA 4XRDA 5INYA 4ZB8A 1ST9A 1U3AA 4XS6A 3WGXA 4IVFA 5D73A 2LJKA 4BWQA 3KIJA 5JWOB 1YEXA 3HHVA 1SL1B 4KGIA 1S3CA 5H5RA 3GKMA 2ALBA 5IPHA 5G31A 2YZUA 3QOUA 4HZ2A 1SK1A 3GX0A 1A0FA 1NHYA 5LD0A 4WF5A 2WULA 4K0GA 12GSA 3IA1A 1V2AA 4J2FA 2B3SA 5DBQA 3CTGA 1JLWA 4TN8A 19GSA 1Z9HA 4MMMA 1G0TA 4L0WA 2V2GA 1PN9A 5CNWA 5JWQB 2AV4A 1OVNA 3H4KA 2XPDA 4AJ6A 22GSA 2L4CA 2OE0A 2PBJA 5ECQB 4LA1A 4OMVA 1WRYA 2N5BA 4ML1A 4HS1A 2OA7A 3I43A 4MLYA 1OC9A 1JZOA 1EEMA 1MDIA 4JZQA 3DGQA 2C3QA 3MWHA 1YJ6A 2J23A 2D2ZA 1DBYA 3TKRA 2LJAA 3WT1A 5ID2B 3G7JA 4CDOA 4O92A 2HZFA 3C8EA 5ELGA 4DSRA 1THXA 2R4VA 2C3TA 3RPNA 2CVKA 1UN2A 1SU9A 1EZKA 1TTZA 1PA3A 1M7TA 3F6DA 1ZYEA 5KN2A 2LEGA 3APQA 4MZWA 2I9HA 3IE3A 4E8HA 4HU9A 5LNKe 3ZREA 1I9DA 1A2LA 4JBBA 2K18A 3K8NA 2H71A 4ILFA 2H19A 1EWXA 1ZYQB 1KTEA 5KEJA 3G9BA 1URMA 2PVQA 3PGTA 4G2EA 5G1KA 3TJGA 5GSTA 2DMMA 4GF0A 3RDWA 1FOVA 2DJ2A 2IFQA 1GSDA 1SJZA 4Q5RA 3GV1A 2OJLA 1YF0A 1ZMAA 4N11A 3TGZA 3C73A 4NPBA 2H74A 4ECCA 2VD1A 3NIVA 1O8XA 2FCHA 3IC4A 3APSA 3F9UA 2FWGA 3EU3A 4AGSA 1AQXA 5CREA 2VD0A 1HNBA 1RW1A 1THOA 3SWLA 2H6XA 2JZTA 2H1BA 5IQYA 1T4ZA 4RUVA 4BWSA 3TOTA 3LSZA 1PKZA 4IQAA 2LQOA 1XOAA 4JR4A 1TU7A 2ON5A 1K0NA 3CTFA 1QXHA 1T00A 3VI7A 3QR6A 2LV3A 4GXZA 2C0DA 3FR6A 1XZOA 1G7EA 1Z5YE 4O7HA 1X5EA 3EMPA 4V1Ag 2YZHA 3A2WA 5IO0A 4HJ2A 1VGLA 2FGXA 1OC3A 3HJPA 4DSQA 4POKA 4QL7A 2OBKA 4ACSA 5ID2A 3FK8A 5JWRB 4LL1B 1BAYA 1SJ6A 4L5OA 2HRNA 1V9WA 3RHCA 2G2QA 3J7Yk 4MJCA 3GTUB 3VK9A 2E7PA 4TOPA 4TR4A 2M72A 5J9BA 4ZILA 2GSTA 2VL3A 3C7MA 3BCKA 3KCMA 4BA7A 2L5OA 3CSIA 2AB6A 1FVJA 2KLXA 3HVVA 3KZQA 3VWVA 2XBQA 4K7OA 3JCML 2FHEA 13GSA 2IMDA 3GIXA 1XFLA 2QC7A 1PGTA 3HVSA 1H4OA 4PURA 2VLVA 1DE2A 2DJ3A 1MD3A 4G10A 1F3BA 3LGCA 2DIYA 2LJRA 1XOBA 3L9VA 4WR4A 1N8JA 1PL1A 4EC0A 5IMVA 1WE0A 3TKQA 2LRNA 2X99A 2OACA 2MMNA 3EURA 1QQ2A 5J5NA 1YKCA 3KJYA 4IKHA 3TKSE 3IPZA 1T3BA 1XXUA 3LWAA 2B7JA 1JFUA 1TRVA 5DJMA 4K7IA 3QMXA 4KNDA 3TKPA 2H1AA 6GSWA 2OBIA 4IW9A 1A8LA 3I69A 1PSQA 2V32A 2MYGA 4GSSA 2YNXA 4MCUA 4ULXA 5F8BA 4NWYA 3FRCA 1XBSA 2F51A 3GHAA 2FWFA 4FYCA 3TJJA 1O85A 2IPAA 1AAZA 2YWOA 3ZITA 4XS4B 4IJIA 1B4QA 1QFNA 1ABAA 4MA9A 1XWGA 1DE1A 4PNFA 1F9MA 2Z9SA 2F8FA 1SYRA 1XWAA 1YF1A 1MEKA 1FAAA 1E2YA 2ON7A 4TRXA 5ECMB 4IHUA 3TRXA 1USBA 2YN1A 4AF2A 1OAZA 1MDJA 3EE2A 1I5GA 3UBKA 4O32A 4MF5A 1AW9A 5H5SA 1Q98A 3LYKA 1GSQA 1Y25A 3RAZA 4EUYA 1GTBA 2YOIA 2HYXA 2O7KA 1TRSA 3HZ4A 3KP9A 3HKRA 3C71A 4HQSA 1ZCPA 3GTUA 3P7XA 2BMXA 4Q5FA 4I5QA 2IL3A 3TCOA 3IRAA 1XWKA 4WEYA 1NW2A 2DJJA 1M2BA 3GL5A 5J41A 2X8HA 1U88A 4IELA 2P0GA 2X8GA 1ERWA 1GTUA 3Q74A 1HNCA 2GS3A 2AAWA 1QMVA 3MDKA 3M8NA 4F03A 4FIWA 1JZWA 1T8EB 4IN0A 5DQSA 1O81A 3ED3A 4IJ3A 2WZ9A 3FKFA 5KN1A 1A8YA 2LS5A 1GH2A 2HE3A 3O3TA 1HNAA 2V6KA 5IOWA 1SL2B 5GSSA 2GSRA 4TW5A 3OR5A 3CYNA 5JCGA 4G9HA 1VF3A 1K0DA 2H0IA 2EIQA 4IBPA 1PL2A 1UC7A 2JSZA 1R7HA 2GSQA 1C72A 2CVBA 1W4VA 2FUG2 3ZLPA 1GNEA 1ERTA 4OCFA 2QKEA 1FG4A 4XS4A 2KUCA 1YZXA 1GSUA 2DC5A 3GURA 1FB0A 3QAGA 2DMLA 1S3AA 2H01A 3FHKA 3TUEA 1E6BA 1V98A 1Q4JA 4KX4A 2N5FA 1BYEA 2GT6A 2O85A 5IMFA 1WPIA 4Z7XA 1VF1A 1TI1A 5IMDA 4L5LA 3VWXA 3DWVA 2E0QA 1X5CA 3GX8A 3FZAA 3VFIA 3ZIVA 2DLXA 1B48A 2DJ1A 1YEPA 1ON4A 3FZ4A 2H1GA 2XHFA 4V2MA 1T7PB 2K8SA 5B7CA 2H0HA 3FZ5A 3N5OA 1F6MC 1T1VA 1TKDB 2DIZA 5JCWA 5B6MA 1VRSD 2O89A 4NHWA 4Q5NA 4MP4A 1GTIA 3L0HA 4YQMA 7GSSA 1UA5A 3MAKA 2LNTA 3D4MA 2GGTA 3NZNA 5IOXA 4BPYA 3UL3A 1GNWA 4GSTA 1SD9A 3F8UA 3FW2A 2L6DA 1J0FA 4FH8A 4N10A 3IXRA 2E2MA 1Z6MA 1NHOA 4G19A 4WETA 2IMFA 2VLTA 18GSA 2PUKC 4WBRD 1ZL9A 4EO3A 5ECKB 1SKRB 2P5QA 1EGOA 2CVDA 3DXBA 1WJKA 2C1YA 1KNGA 2IIYA 1Z7RA 4RQXA 4KSMA 1U6TA 4QQ7A 2HSHA 8GSSA 4HZ4A 1M9BA 1SK0A 4HI7A 11GSA 3KMOA 4V1Ap 3M9KA 3ZZXA 3F4TA 5CP1A 4L8EA 6GSSA 5A4VA 4PQ1A 4KAEA 2GVPA 2REMA 2B1LA 3M1GA 5IMZA 4GQFA 5G5FA 1GUMA 2WDUA 4JR6A 3BJ5A 3M3MA 3S9FA 2A4VA 2LTKA 3GFKA 3TJBA 1FW1A 2LRTA 1AQVA 3RHBA 4MF6A 3CSJA 1XW5A 1A0RP 4ZB6A 3VWWA 2H30A 3GN3A 2C4JA 3ZMKA 2YPMA 2R3XA 3IAS2 2BJXA 2JSYA 3LXZA 4HUAA 4HQZA 4FYBA 5COHA 2CX4A 4PNGA 2FD3A 4IP1A 3QAWA 3WYWA 4K0NA 4EE0A 3D6IA 5AN1A 1FB6A 4MPGA 2TIRA 5ECHB 2PGTA 2WB9A 4TR1B 4KA0A 4EVMA 4KDUA 2PU9C 4HU7A 1U87A 2H6YA 3QD9A 2KOKA 3IK9A 1TI3A 2CZ2A 2MBSA 2H0GA 2MMAA 3VPTA 3HD5A 4TXOB 4NV2A 2PWJA 5FWGA 17GSA 2I3YA 1B9XC 4TXVA 2LNSA 2HSYA 3GMFA 5ABRA 2HLSA 3US3A 3TB2A 3UAPA 3LXTA 5L71A 1AXDA 5H5QA 4MJBA 1CQGA 3GYKA 2RM6A 5DALB 5CRHA 5HQPA 5D8IA 4P3YB 3IK7A 5AIXA 1GLPA 2WS2A 2HZEB 4OFMA 1SJIA 3BD2A 5D9VA 6GSVA 2EIRA 2VCXA 1N2AA 1X9SB 2CZ3A 1IYIA 2H73A 3H93A 2LUSA 1SKWB 4N30A 4V2NA 3ZVJA 2X8CA 3E9JB 2JADA 3M9JA 5DCHA 1WIKA 3IV4A 3ZYWA 3V1WA 2M46A 3DEXA 1TOFA 3O76A 2VLUA 3GNJA 5ENUA 2FWHA 2VL2A 5C00A 2VCZA 4I97A 5IMAA 1A23A 3GL3A 1J08A 3CBUA 1O73A 1BG5A 1QUWA 2L6CA 2PPTA 3TRPA 5GAPD 1TK0B 1XWBA 2L57A 1GP1A 1R5PA 1K3OA 2LRCA 5B8AA 2JU5A 3HDCA 4PQIA 3TJFA 4EDYA 3WT2A 1X9WB 1CQHA 1OE7A 3IAM2 1GSYA 3VPQA 3F3QA 3DYRA 3TKSA 5CRDA 4EL1A 1H75A 4I8BA 2PMTA 4TR1A 2WFCA 9GSSA 3P90A 2CAIA 2FWEA 1EP8A 3H8QA 1OKTA 4OCEA 1OC8A 3F0IA 4HJMA 1SD8A 5EPFA 5FT3A 1TP9A 5AIVA 3A2VA 3AY8A 5CRWA 1PX6A 4RI7A 3GKKA 2XBIA 1WOUA 1B4PA 3A2XA 4TXOA 3APOA 2H72A 2YJ7A 2YWNA 1JHBA 5ECNB 3DIEA 4OWYA 5AGYA 4EDZA 1J9BA 1M2AA 4RI6A 3D4TA 2H8LA 1X9MB 3F4SA 2VCVA 4JRRA 5GZZB 1XIYA 2VIMA 5DALA 1F3AA 5LCZA 5ECSA 3LJRA 2XPEA 5D9TA 2DSAA 5G30A 5IMCA 3RPPA 3IOSA 3ERWA 3CRUA 3UOMA 2MZCA 4KUNA 1R26A 3UJ1A 2J9HA 1DSBA 3FEUA 4MABA 4K6XA 4O5RA 3A3TA 4X0XA 1GSSA 5F07A 3ZL5A 1KEBA 4YH2A 14GSA 1XCCA 3GUSA 3IR4A
chains in the Genus database with same CATH superfamily
4GSNA 3ZVJD 3KXOA 1O6JA 3A5WA 4WXTA 3TRQA 1LU4A 3NOFA 4OFNA 2IWTA 1LBKA 1XVQA 5HFKA 2K9FA 3CMIA 1XW9A 4HSCX 1GWCA 2OADA 5G1LA 2FLSA 1M9AA 4MDCA 1TRUA 4TKYA 2YJHA 3ZFLA 4OD7A 1YDKA 4PGTA 5JCUA 2WGRA 4YQUA 1ILOA 4WR5A 4MF7A 3UMAA 4EF0A 1YQ1A 2F9SA 4PUAA 1TU8A 1SL0B 1K3YA 1MD4A 2HFDA 5C04A 2FNOA 3GA4A 2GT5A 3IHQA 3ME8A 5HR1A 4J57E 1TXXA 2RLIA 1WMJA 2F3MA 3HYPA 5D96A 3ZIJA 4POLA 1A24A 4NMUA 1UVZA 2M80A 3P8WA 3WGDA 3BCIA 4FO5A 4KDXA 5HR0A 4HOJA 2GLRA 3G7YA 1EEJA 3BOAA 2R6KA 5CO3A 3TJKA 3D0ZA 5G5EA 5DDLA 4KB3A 5IIZA 2X4AA 5AISA 1WP0A 2GZPA 2F8AA 1ZOFA 2YCDA 5A4WA 3KH7A 4KCEA 2HT9A 5ECRB 4F82A 5IO2A 4IP6A 2R0CA 3C1RA 4ZL8A 4BVYA 2WCIA 2P31A 3QPMA 2MMOA 2B6MA 4NV5A 2H6ZA 4ZL9A 1DUGA 4NXIA 2P5RA 1YY7A 2IMEA 3ZTLA 2DJKA 2E2GA 3LW9A 1X0RA 4ECBA 3Q19A 4MZBA 2V41A 3DKSA 3FZ9A 1ML6A 5DJLA 5KN0A 3KM6A 2WRTA 4MK3A 3DMLA 1XPVA 2B5YA 3EC3A 5E4WA 2O87A 1EOGA 2CA8A 5KN3A 3GSTA 4RQRA 5EVOA 3F6FA 3I9V2 4F0BA 1OE8A 2CV4A 2OKAA 2NPBA 3H1NA 3GKNA 2CAQA 2VO4A 2L59A 5EY6A 1B8XA 4I2TA 4I6XA 2KP2A 2VM1A 3FR9A 2B7KA 5B8BA 5GAND 3M0FA 4X1UA 2GZZA 2VAFA 3DVWA 1QGVA 3FY7A 3W6GA 3D21A 4WBJA 1FHEA 2L4QA 1T4YA 3LFLA 3FYGA 3KTLA 5ELAA 1HD2A 2HRFA 5BRTA 2FA4A 1FO5A 2YWMA 1HYUA 3GH9A 16GSA 4DEJA 4BL7A 4F0CA 2VL2C 2QSIA 3LORA 1GLQA 10GSA 3HCZA 2IMIA 1PKWA 2ZNMA 3U5RE 2OE3A 3FR3A 3CSHA 3KD0A 3W8SA 4K9ZA 4OFTA 3I6AA 1S3DA 3LQ7A 3GKXA 5DQYA 5E59A 3EMXA 1XVWA 3QDNA 4HEA2 3GSSA 4XRAA 1K0BA 2I1UA 3CQFA 2GQKA 2JZRA 1M3JA 2IMKA 3TKSC 4TVEA 2H75A 4EKZA 2CT6A 2DBCA 20GSA 1K0AA 1EV4A 2YV7A 3L4NA 4WKWA 2AJQB 4YAPA 3UVTA 1W89A 5F0GA 3P2AA 2JL4A 2LSTA 3LEFA 5ECLB 1ERVA 2HRAA 4LMWA 2B5XA 2QGVA 4FYUA 1R5AA 1B9YC 4Z2RA 3QAVA 2GZYA 3Q18A 3UIWA 2X64A 4NAXA 1BJXA 1VF4A 2RM5A 4JU5A 5D9WA 2R5GA 2V1MA 3TOUA 4MPFA 1Y6EA 3W8JA 4ISDA 1K0MA 4DSSB 2YP6A 3D22A 1JZRA 4TR3A 1PD21 4GRFA 2VM2A 4KE3A 2KHPA 4ZBBA 1TRWA 5G2ZA 4Q5QA 4N0VA 3EINA 3KP8A 1Z3EA 1K3LA 3N9JA 4YQVA 1XW6A 1R4WA 5D93A 4JEDA 5J9CA 2VOCA 4KH7A 4PUFC 2O8VB 3UVHA 2R2JA 3ZMLA 2ZCTA 6GSYA 4QL9A 1EGRA 4E8EA 4GTUA 3MNGA 3VURA 2VUPA 3IDVA 2RUFA 3H79A 4KW6A 2PVOC 2ZUPA 1GSFA 3ERGA 1TW9A 3KEBA 5DAKB 4LL4B 1U3IA 1GSEA 5A4UA 4F9ZA 3DRNA 4ZB9A 3PINA 4ECIA 1SK2A 4LLRA 1Z6NA 3IHGA 1TK5B 2LKUA 4N0ZA 1JLVA 3VI5A 3C1SA 3SBCA 4ID0A 5A5KA 4GLTA 2IJYA 2L5LA 3BBYA 3LG6A 4POBA 2KP1A 3WGEA 1AQWA 1M99A 2RUEA 2EIOA 1SKSB 2HXKA 2VCWA 4KDYA 4ML6A 4IS0A 3QFBC 4AJ8A 2B5EA 3HZ8A 2LQQA 2JACA 1EV9A 1MTCA 4KSOA 3F4RA 1JZDA 2AUVA 2NTOA 1TDIA 5ECPB 1K0OA 6GSXA 2YANA 4GQCA 3J7Yb 1MDKA 5ECIB 4A5PA 3ZRDA 2C0EA 2MBTA 3R2QA 4IGJA 4MH3A 1QK8A 1BQ7A 3HJOA 3HJMA 2RIIA 2FA8A 4GCIA 2HI7A 5ECOB 4CW9A 3DVXA 2JZSA 5HFIA 3ISOA 4MJAA 2G0FA 4YAVA 2H66A 4BVXA 4DSSA 2H1DA 3TDGA 1BX9A 2NDOA 3PR8A 2YWIA 2TRCP 4LMVA 3L78A 4XIHA 1ZGNA 3ERFA 5HR2A 1HQOA 1ZYNA 1LJRA 1ZZYA 5CYYA 1GULA 2C0GA 1O8WA 1TJDA 2C80A 1RQMA 5IPGA 2A2SA 3E0UA 2A2PA 4D73B 3KMNA 4J56E 2BTOT 4DVCA 2AYTA 4K2DA 1PQNA 2I81A 1EP7A 3RBTA 4EIQA 3CXGA 3IC8A 2OE1A 3D5JA 4MH2A 4IQ1A 1V57A 3HY2A 1OKDA 5DAKA 2NVLA 3EWLA 3F3RA 3KTBA 4HDEA 2GTUA 2XC2A 4GWRA 3F63A 1GRXA 1PMTA 2HZEA 3CRTA 1A2JA 2B1KA 2C0FA 3UBLA 4XS1A 5J3RA 2EC4A 1VF2A 1K0CA 5CAXA 2HNLA 3EPTA 3MSZA 3LYPA 3PH9A 2ES7A 4F2IA 3EU4A 4PXOA 1Z7PA 1EOHA 4CHSA 1KBNA 1PRXA 2GQLA 1X5DA 5F05A 1AUCA 2CX3A 3G7IA 4V2LA 1O7UA 1YKAA 6GSTA 3EYTA 1SENA 2K8VA 4L0UA 2MMZA 4MZCA 3EVIA 2N5AA 4XTSA 3ME7A 4AJ7A 3E3EA 1F37A 4X43A 1V58A 4NHZA 1WWJA 4OO4A 4K8MA 1F2EA 4ECJA 1NSWA 5HR3A 3VLNA 4MJEA 6GSUA 3UARA 3QFAC 2H76A 2AHEA 1XWCA 3L9UA 3QCPA 5FHIA 3KH9A 4ZBDA 3HVXA 4H86A 2VL9A 4JE1A 1M2DA 2YV9A 1PX7A 5CRGA 1AIUA 3O6TA 5J4UA 5F06A 1IYHA 2GDRA 1OC9B 4O5UA 3L9SA 4ZXGA 5D9XA 3WD6A 4TR0A 3VWUA 4YKFA 1V40A 1G7OA 4POMA 3GRXA 3KGKA 1ACVA 4XCSA 4XHMA 4MNNA 1BEDA 1M0UA 2FY6A 1OYJA 3DD3A 3U6VA 2NBSA 3HA9A 5DVBA 4EXJA 4D73A 1GTAA 4ZBAA 4K7NA 1GL8A 5B6NA 3ZFBA 2GSSA 1GUHA 4PX1A 1NM3A 3GH6A 2K6VA 2PERA 2R37A 1G6YA 4K1FA 1FVKA 2VCTA 3HXSA 5HFGA 4ZIJA 2TRXA 2C3NA 2H70A 2I4AA 2GQMA 2DJ0A 3IBHA 4ZL7A 1ERUA 4X4JA 2V6OA 4WF4A 2VCQA 5DCGA 3Q6OA 4I2UA 1SYXA 4OO5A 1TK8B 1A2MA 2WJUA 3UEMA 2PN8A 2IFQB 2IN3A 1AC1A 2CQ9A 1RK4A 1GUKA 2A2RA 1G6WA 5IM9A 5EL8A 2C8UA 4O5QA 4PQHA 4KCAA 4XRDA 5INYA 4ZB8A 1ST9A 1U3AA 4XS6A 3WGXA 4IVFA 5D73A 2LJKA 4BWQA 3KIJA 5JWOB 1YEXA 3HHVA 1SL1B 2R0PA 4KGIA 1S3CA 5H5RA 3GKMA 2ALBA 5IPHA 5G31A 2YZUA 3QOUA 4HZ2A 1SK1A 3GX0A 1A0FA 1NHYA 5LD0A 4WF5A 2WULA 4K0GA 12GSA 3IA1A 1V2AA 4J2FA 2B3SA 5DBQA 3CTGA 1JLWA 4TN8A 19GSA 1Z9HA 4MMMA 1G0TA 4L0WA 2V2GA 1PN9A 5CNWA 5JWQB 2AV4A 1OVNA 3H4KA 2XPDA 4AJ6A 22GSA 2L4CA 2OE0A 2PBJA 4ICYA 5ECQB 4LA1A 4OMVA 1WRYA 2N5BA 4ML1A 4HS1A 2OA7A 3I43A 4MLYA 1OC9A 1JZOA 1EEMA 1MDIA 4JZQA 3DGQA 2C3QA 2A4HA 3MWHA 1YJ6A 2J23A 2D2ZA 3PPUA 1DBYA 3TKRA 2LJAA 3WT1A 5ID2B 3G7JA 4CDOA 4O92A 2HZFA 3C8EA 5ELGA 4DSRA 1THXA 2R4VA 2C3TA 3RPNA 2CVKA 1UN2A 1SU9A 1EZKA 1TTZA 1PA3A 1M7TA 3F6DA 1ZYEA 5KN2A 2LEGA 3APQA 4MZWA 2I9HA 3IE3A 4G0IA 3FMWA 4E8HA 4HU9A 5LNKe 2HRKA 3ZREA 1I9DA 1A2LA 4JBBA 2K18A 3K8NA 2H71A 4ILFA 2H19A 1EWXA 1ZYQB 1KTEA 5KEJA 3G9BA 1URMA 2PVQA 3PGTA 4G2EA 5G1KA 3TJGA 5GSTA 2DMMA 4GF0A 3RDWA 4YKGA 1FOVA 2DJ2A 2IFQA 1GSDA 1SJZA 4Q5RA 3GV1A 4KF9A 2OJLA 1YF0A 1ZMAA 4N11A 3TGZA 3C73A 1PN0A 4NPBA 2H74A 4ECCA 2VD1A 3NIVA 1O8XA 2FCHA 2DKIA 3IC4A 3APSA 3F9UA 2FWGA 3EU3A 4AGSA 1AQXA 5CREA 2VD0A 1HNBA 1RW1A 1THOA 3SWLA 2H6XA 2JZTA 2H1BA 5IQYA 1T4ZA 4RUVA 4BWSA 3TOTA 3LSZA 1PKZA 4IQAA 2LQOA 1XOAA 4JR4A 1TU7A 2ON5A 1K0NA 3CTFA 1QXHA 1T00A 2QA2A 3VI7A 3QR6A 2LV3A 4GXZA 2C0DA 3FR6A 1XZOA 1G7EA 1XG8A 1Z5YE 4O7HA 1X5EA 3EMPA 4V1Ag 2YZHA 3A2WA 1M3IA 5IO0A 4HJ2A 1VGLA 2FGXA 1OC3A 3HJPA 4DSQA 4POKA 4QL7A 2OBKA 4ACSA 5ID2A 3FK8A 5JWRB 4LL1B 1BAYA 1SJ6A 4L5OA 2HRNA 1V9WA 3RHCA 2G2QA 3J7Yk 4MJCA 3GTUB 3VK9A 2E7PA 4TOPA 4TR4A 2M72A 5J9BA 4ZILA 2GSTA 2VL3A 3C7MA 3BCKA 3KCMA 3HVNA 4BA7A 2L5OA 3CSIA 2AB6A 1FVJA 2KLXA 2R0GA 3HVVA 3KZQA 3VWVA 2XBQA 4K7OA 3JCML 2FHEA 13GSA 2IMDA 3GIXA 1XFLA 2QC7A 1PGTA 3HVSA 1H4OA 4PURA 2VLVA 1DE2A 2DJ3A 1MD3A 4G10A 1F3BA 3LGCA 2DIYA 2LJRA 1XOBA 3L9VA 4WR4A 1N8JA 1PL1A 4EC0A 5IMVA 1WE0A 3TKQA 2LRNA 2X99A 2OACA 2MMNA 3EURA 1QQ2A 5J5NA 1YKCA 3KJYA 4IKHA 3TKSE 3IPZA 1T3BA 1XXUA 3LWAA 2B7JA 1JFUA 1TRVA 5DJMA 4K7IA 3QMXA 4KNDA 3TKPA 2H1AA 6GSWA 2OBIA 4IW9A 1A8LA 3I69A 1PSQA 2V32A 2MYGA 4GSSA 2YNXA 4MCUA 4ULXA 5F8BA 4NWYA 3FRCA 1XBSA 2F51A 3GHAA 2FWFA 4FYCA 3TJJA 1O85A 2IPAA 1AAZA 2YWOA 3ZITA 4XS4B 4IJIA 1B4QA 1QFNA 1ABAA 4MA9A 5KOWA 4G0KA 1XWGA 1DE1A 4PNFA 1F9MA 2Z9SA 2F8FA 1SYRA 1XWAA 1YF1A 1MEKA 1FAAA 1E2YA 2ON7A 4TRXA 5ECMB 4IHUA 4BVYB 3TRXA 1USBA 2YN1A 4AF2A 1OAZA 1MDJA 3EE2A 1I5GA 3UBKA 4O32A 4MF5A 1AW9A 5H5SA 1Q98A 3LYKA 1GSQA 1Y25A 3RAZA 4EUYA 1GTBA 2YOIA 2HYXA 2O7KA 1TRSA 3HZ4A 3KP9A 3HKRA 3C71A 1FOHA 1ZCPA 4HQSA 4Z2UA 3GTUA 3P7XA 2BMXA 4Q5FA 4I5QA 2IL3A 3TCOA 3IRAA 1XWKA 4WEYA 1S3RA 1NW2A 2DJJA 1M2BA 3GL5A 5J41A 2X8HA 1U88A 4IELA 2P0GA 2X8GA 1ERWA 1GTUA 3Q74A 1HNCA 2GS3A 2AAWA 1QMVA 3MDKA 3M8NA 4F03A 4FIWA 1JZWA 1T8EB 4IN0A 5DQSA 1O81A 2DKHA 3ED3A 4IJ3A 2WZ9A 3FKFA 4PTSA 5KN1A 1A8YA 2LS5A 1GH2A 2HE3A 3O3TA 1HNAA 2V6KA 2X49A 5IOWA 4USSA 1SL2B 5GSSA 2GSRA 4TW5A 3OR5A 4BL7B 3CYNA 5JCGA 4G9HA 1VF3A 1K0DA 2H0IA 2EIQA 4IBPA 1PL2A 1UC7A 2JSZA 1R7HA 2GSQA 1C72A 2CVBA 1W4VA 2FUG2 3ZLPA 1GNEA 1ERTA 4OCFA 2QKEA 1FG4A 4XS4A 2KUCA 1YZXA 1GSUA 2DC5A 3GURA 1FB0A 3QAGA 2DMLA 1S3AA 2H01A 3FHKA 3TUEA 4CY8A 1E6BA 1V98A 1Q4JA 4KX4A 2N5FA 1PFOA 1BYEA 2GT6A 2O85A 5IMFA 1WPIA 4Z7XA 1VF1A 1TI1A 5IMDA 4L5LA 3VWXA 3DWVA 2E0QA 2HSMA 1X5CA 3GX8A 3FZAA 3VFIA 3ZIVA 2DLXA 1B48A 2DJ1A 1YEPA 1ON4A 3FZ4A 2H1GA 2XHFA 4V2MA 1T7PB 2K8SA 3R3EA 5B7CA 2H0HA 3FZ5A 3N5OA 1F6MC 1T1VA 1TKDB 2DIZA 5JCWA 5B6MA 1VRSD 4Z2TA 2O89A 4NHWA 4Q5NA 4MP4A 2UZ8A 1GTIA 3L0HA 4YQMA 7GSSA 1UA5A 3MAKA 2LNTA 4G0LA 3D4MA 2GGTA 3NZNA 5IOXA 4BPYA 3UL3A 1GNWA 4GSTA 1SD9A 3F8UA 3FW2A 2L6DA 1J0FA 4FH8A 4N10A 3IXRA 2E2MA 1Z6MA 1NHOA 4G19A 4WETA 2IMFA 2VLTA 18GSA 2PUKC 4WBRD 1ZL9A 4EO3A 5ECKB 1SKRB 2P5QA 1EGOA 2CVDA 3DXBA 1WJKA 2C1YA 1KNGA 2IIYA 1Z7RA 4RQXA 4KSMA 1U6TA 4QQ7A 2HSHA 3MIXA 8GSSA 4HZ4A 1M9BA 1SK0A 4HI7A 11GSA 3KMOA 4V1Ap 3M9KA 3ZZXA 3F4TA 5CP1A 4K5RA 4L8EA 6GSSA 5A4VA 4PQ1A 4KAEA 2GVPA 2REMA 2B1LA 3M1GA 5IMZA 4GQFA 5G5FA 1GUMA 2WDUA 4JR6A 3BJ5A 3M3MA 3S9FA 2A4VA 2LTKA 3GFKA 3TJBA 1FW1A 2LRTA 1AQVA 3RHBA 4MF6A 3CSJA 5BMUA 1XW5A 1A0RP 4ZB6A 3VWWA 2H30A 3GN3A 2C4JA 3ZMKA 2YPMA 2R3XA 3IAS2 2BJXA 2JSYA 3LXZA 4HUAA 4HQZA 4FYBA 5COHA 2CX4A 4PNGA 2FD3A 4IP1A 3QAWA 3WYWA 4K0NA 4EE0A 3D6IA 3A5IA 5AN1A 1FB6A 4MPGA 2TIRA 5ECHB 2PGTA 2WB9A 4TR1B 4KA0A 4BVXB 4EVMA 4KDUA 4BIKA 2PU9C 4HU7A 1U87A 2H6YA 3QD9A 2KOKA 3IK9A 1TI3A 2CZ2A 2MBSA 2H0GA 2MMAA 3VPTA 3HD5A 4TXOB 4NV2A 2PWJA 5FWGA 17GSA 2I3YA 1B9XC 4TXVA 2LNSA 2HSYA 4FQUA 3GMFA 5ABRA 2HLSA 3US3A 3TB2A 3UAPA 3LXTA 5L71A 1AXDA 5H5QA 4MJBA 1CQGA 3GYKA 2RM6A 5DALB 5CRHA 5HQPA 5D8IA 4P3YB 3IK7A 5AIXA 1GLPA 2WS2A 2HZEB 4OFMA 1SJIA 3BD2A 5D9VA 6GSVA 2EIRA 2VCXA 1N2AA 1X9SB 2CZ3A 1IYIA 2H73A 3H93A 2LUSA 4K2XA 1SKWB 4N30A 4V2NA 3ZVJA 2X8CA 3E9JB 2JADA 3M9JA 5DCHA 1WIKA 3IV4A 3ZYWA 3V1WA 2M46A 3DEXA 1TOFA 3O76A 2VLUA 3GNJA 5ENUA 2FWHA 2QA1A 2VL2A 5C00A 2VCZA 4I97A 1ZYPA 5IMAA 1A23A 3GL3A 1J08A 3CBUA 1O73A 1BG5A 1QUWA 2L6CA 2PPTA 3TRPA 5GAPD 1TK0B 1XWBA 2L57A 1GP1A 1R5PA 4K5SA 1K3OA 2LRCA 5B8AA 2JU5A 3HDCA 4PQIA 3TJFA 4EDYA 3WT2A 1X9WB 1CQHA 1OE7A 3IAM2 1GSYA 3VPQA 3F3QA 3DYRA 3TKSA 5CRDA 4EL1A 1H75A 4I8BA 2PMTA 4TR1A 2WFCA 9GSSA 3P90A 2CAIA 2FWEA 1EP8A 3H8QA 1OKTA 4OCEA 1OC8A 3F0IA 4HJMA 1SD8A 4CY6A 5EPFA 5FT3A 1TP9A 5AIVA 3A2VA 3AY8A 5CRWA 1PX6A 4RI7A 3GKKA 2XBIA 1WOUA 1B4PA 3A2XA 4TXOA 3APOA 4EIPA 2H72A 2YJ7A 2YWNA 1JHBA 5ECNB 3DIEA 4OWYA 5AGYA 4EDZA 4RI6A 1J9BA 1M2AA 3D4TA 2H8LA 1X9MB 3F4SA 2VCVA 4JRRA 5GZZB 1XIYA 2VIMA 5DALA 1F3AA 5LCZA 5ECSA 3LJRA 2XPEA 5D9TA 2DSAA 3MYDA 5G30A 5IMCA 5KOXA 3RPPA 3IOSA 3ERWA 3CRUA 3UOMA 2MZCA 4KUNA 1R26A 3UJ1A 2J9HA 1DSBA 3FEUA 4MABA 4K6XA 4O5RA 3A3TA 4X0XA 1GSSA 5F07A 3ZL5A 1KEBA 4YH2A 14GSA 1XCCA 3GUSA 3IR4A
chains in the Genus database with same CATH topology
4GSNA 3ZVJD 3KXOA 1O6JA 3A5WA 4WXTA 3TRQA 1LU4A 3NOFA 4OFNA 2IWTA 1LBKA 1XVQA 5HFKA 2K9FA 3CMIA 1XW9A 1GWCA 2OADA 5G1LA 2FLSA 1M9AA 4MDCA 1TRUA 4TKYA 2YJHA 3ZFLA 4OD7A 1YDKA 4PGTA 5JCUA 2WGRA 4YQUA 1ILOA 4WR5A 4MF7A 3UMAA 4EF0A 1YQ1A 2F9SA 4PUAA 1TU8A 1SL0B 1K3YA 1MD4A 2HFDA 5C04A 2FNOA 3GA4A 2GT5A 3IHQA 3ME8A 5HR1A 4J57E 1TXXA 2RLIA 1WMJA 2F3MA 3HYPA 5D96A 3ZIJA 4POLA 1A24A 4NMUA 1UVZA 2M80A 3P8WA 3WGDA 3BCIA 4FO5A 4KDXA 5HR0A 4HOJA 2GLRA 3G7YA 1EEJA 3BOAA 2R6KA 5CO3A 3TJKA 3D0ZA 5G5EA 5DDLA 4KB3A 5IIZA 2X4AA 5AISA 1WP0A 2GZPA 2F8AA 1ZOFA 2YCDA 5A4WA 3KH7A 4KCEA 2HT9A 5ECRB 4F82A 5IO2A 4IP6A 2R0CA 3C1RA 4ZL8A 4BVYA 2WCIA 2P31A 3QPMA 2MMOA 2B6MA 4NV5A 2H6ZA 4ZL9A 1DUGA 4NXIA 2P5RA 1YY7A 2IMEA 3ZTLA 2DJKA 2E2GA 3LW9A 1X0RA 4ECBA 3Q19A 4MZBA 2V41A 3DKSA 3FZ9A 1ML6A 5DJLA 5KN0A 3KM6A 2WRTA 4MK3A 3DMLA 1XPVA 2B5YA 3EC3A 5E4WA 2O87A 1EOGA 2CA8A 5KN3A 3GSTA 4RQRA 5EVOA 3F6FA 3I9V2 4F0BA 1OE8A 2CV4A 2OKAA 2NPBA 3H1NA 3GKNA 2CAQA 2VO4A 2L59A 5EY6A 1B8XA 4I2TA 4I6XA 2KP2A 2VM1A 3FR9A 2B7KA 5B8BA 5GAND 3M0FA 4X1UA 2GZZA 2VAFA 3DVWA 1QGVA 3FY7A 3W6GA 3D21A 4WBJA 1FHEA 2L4QA 1T4YA 3LFLA 3FYGA 3KTLA 5ELAA 1HD2A 2HRFA 5BRTA 2FA4A 1FO5A 2YWMA 1HYUA 3GH9A 16GSA 4DEJA 4BL7A 4F0CA 2VL2C 2QSIA 3LORA 1GLQA 10GSA 3HCZA 2IMIA 1PKWA 2ZNMA 3U5RE 2OE3A 3FR3A 3CSHA 3KD0A 3W8SA 4K9ZA 4OFTA 3I6AA 1S3DA 3LQ7A 3GKXA 5DQYA 5E59A 3EMXA 1XVWA 3QDNA 4HEA2 3GSSA 4XRAA 1K0BA 2I1UA 2GQKA 2JZRA 2IMKA 3TKSC 4TVEA 2H75A 4EKZA 2CT6A 2DBCA 20GSA 1K0AA 1EV4A 2YV7A 3L4NA 4WKWA 2AJQB 4YAPA 3UVTA 1W89A 5F0GA 3P2AA 2JL4A 2LSTA 3LEFA 5ECLB 1ERVA 2HRAA 4LMWA 2B5XA 2QGVA 4FYUA 1R5AA 1B9YC 4Z2RA 3QAVA 2GZYA 3Q18A 3UIWA 2X64A 4NAXA 1BJXA 1VF4A 2RM5A 4JU5A 5D9WA 2R5GA 2V1MA 3TOUA 4MPFA 1Y6EA 3W8JA 4ISDA 1K0MA 4DSSB 2YP6A 3D22A 1JZRA 4TR3A 1PD21 4GRFA 2VM2A 4KE3A 2KHPA 4ZBBA 1TRWA 5G2ZA 4Q5QA 4N0VA 3EINA 3KP8A 1Z3EA 1K3LA 3N9JA 4YQVA 1XW6A 1R4WA 5D93A 4JEDA 5J9CA 2VOCA 4KH7A 4PUFC 2O8VB 3UVHA 2R2JA 3ZMLA 2ZCTA 6GSYA 4QL9A 1EGRA 4E8EA 4GTUA 3MNGA 3VURA 2VUPA 3IDVA 2RUFA 3H79A 4KW6A 2PVOC 2ZUPA 1GSFA 3ERGA 1TW9A 3KEBA 5DAKB 4LL4B 1U3IA 1GSEA 5A4UA 4F9ZA 3DRNA 4ZB9A 3PINA 4ECIA 1SK2A 4LLRA 1Z6NA 3IHGA 1TK5B 2LKUA 4N0ZA 1JLVA 3VI5A 3C1SA 3SBCA 4ID0A 5A5KA 4GLTA 2IJYA 2L5LA 3BBYA 3LG6A 4POBA 2KP1A 3WGEA 1AQWA 1M99A 2RUEA 2EIOA 1SKSB 2HXKA 2VCWA 4KDYA 4ML6A 4IS0A 3QFBC 4AJ8A 2B5EA 3HZ8A 2LQQA 2JACA 1EV9A 1MTCA 4KSOA 3F4RA 1JZDA 2AUVA 2NTOA 1TDIA 5ECPB 1K0OA 6GSXA 2YANA 4GQCA 3J7Yb 1MDKA 5ECIB 4A5PA 3ZRDA 2C0EA 2MBTA 3R2QA 4IGJA 4MH3A 1QK8A 1BQ7A 3HJOA 3HJMA 2RIIA 2FA8A 4GCIA 2HI7A 5ECOB 4CW9A 3DVXA 2JZSA 5HFIA 3ISOA 4MJAA 2G0FA 4YAVA 2H66A 4BVXA 4DSSA 2H1DA 3TDGA 1BX9A 2NDOA 3PR8A 2YWIA 2TRCP 4LMVA 3L78A 4XIHA 1ZGNA 3ERFA 5HR2A 1HQOA 1ZYNA 1LJRA 1ZZYA 5CYYA 1GULA 2C0GA 1O8WA 1TJDA 2C80A 1RQMA 5IPGA 2A2SA 3E0UA 2A2PA 4D73B 3KMNA 4J56E 2BTOT 4DVCA 2AYTA 4K2DA 1PQNA 2I81A 1EP7A 3RBTA 4EIQA 3CXGA 3IC8A 2OE1A 3D5JA 4MH2A 4IQ1A 1V57A 3HY2A 1OKDA 5DAKA 2NVLA 3EWLA 3F3RA 3KTBA 4HDEA 2GTUA 2XC2A 4GWRA 3F63A 1GRXA 1PMTA 2HZEA 3CRTA 1A2JA 2B1KA 2C0FA 3UBLA 4XS1A 5J3RA 2EC4A 1VF2A 1K0CA 5CAXA 2HNLA 3EPTA 3MSZA 3LYPA 3PH9A 2ES7A 4F2IA 3EU4A 4PXOA 1Z7PA 1EOHA 4CHSA 1KBNA 1PRXA 2GQLA 1X5DA 5F05A 1AUCA 2CX3A 3G7IA 4V2LA 1O7UA 1YKAA 6GSTA 3EYTA 1SENA 2K8VA 4L0UA 2MMZA 4MZCA 3EVIA 2N5AA 4XTSA 3ME7A 4AJ7A 3E3EA 1F37A 4X43A 1V58A 4NHZA 1WWJA 4OO4A 4K8MA 1F2EA 4ECJA 1NSWA 5HR3A 3VLNA 4MJEA 6GSUA 3UARA 3QFAC 2H76A 2AHEA 1XWCA 3L9UA 3QCPA 5FHIA 3KH9A 4ZBDA 3HVXA 4H86A 2VL9A 4JE1A 1M2DA 2YV9A 1PX7A 5CRGA 1AIUA 3O6TA 5J4UA 5F06A 1IYHA 2GDRA 1OC9B 4O5UA 3L9SA 4ZXGA 5D9XA 3WD6A 4TR0A 3VWUA 4YKFA 1V40A 1G7OA 4POMA 3GRXA 3KGKA 1ACVA 4XCSA 4XHMA 4MNNA 1BEDA 1M0UA 2FY6A 1OYJA 3DD3A 3U6VA 2NBSA 3HA9A 5DVBA 4EXJA 4D73A 1GTAA 4ZBAA 4K7NA 1GL8A 5B6NA 3ZFBA 2GSSA 1GUHA 4PX1A 1NM3A 3GH6A 2K6VA 2PERA 2R37A 1G6YA 4K1FA 1FVKA 2VCTA 3HXSA 5HFGA 4ZIJA 2TRXA 2C3NA 2H70A 2I4AA 2GQMA 2DJ0A 3IBHA 4ZL7A 1ERUA 4X4JA 2V6OA 4WF4A 2VCQA 5DCGA 3Q6OA 4I2UA 1SYXA 4OO5A 1TK8B 1A2MA 2WJUA 3UEMA 2PN8A 2IFQB 2IN3A 1AC1A 2CQ9A 1RK4A 1GUKA 2A2RA 1G6WA 5IM9A 5EL8A 2C8UA 4O5QA 4PQHA 4KCAA 4XRDA 5INYA 4ZB8A 1ST9A 1U3AA 4XS6A 3WGXA 4IVFA 5D73A 2LJKA 4BWQA 3KIJA 5JWOB 1YEXA 3HHVA 1SL1B 2R0PA 4KGIA 1S3CA 5H5RA 3GKMA 2ALBA 5IPHA 5G31A 2YZUA 3QOUA 4HZ2A 1SK1A 3GX0A 1A0FA 1NHYA 5LD0A 4WF5A 2WULA 4K0GA 12GSA 3IA1A 1V2AA 4J2FA 2B3SA 5DBQA 3CTGA 1JLWA 4TN8A 19GSA 1Z9HA 4MMMA 1G0TA 4L0WA 2V2GA 1PN9A 5CNWA 5JWQB 2AV4A 1OVNA 3H4KA 2XPDA 4AJ6A 22GSA 2L4CA 2OE0A 2PBJA 4ICYA 5ECQB 4LA1A 4OMVA 1WRYA 2N5BA 4ML1A 4HS1A 2OA7A 3I43A 4MLYA 1OC9A 1JZOA 1EEMA 1MDIA 4JZQA 3DGQA 2C3QA 2A4HA 3MWHA 1YJ6A 2J23A 2D2ZA 3PPUA 1DBYA 3TKRA 2LJAA 3WT1A 5ID2B 3G7JA 4CDOA 4O92A 2HZFA 3C8EA 5ELGA 4DSRA 1THXA 2R4VA 2C3TA 3RPNA 2CVKA 1UN2A 1SU9A 1EZKA 1TTZA 1PA3A 1M7TA 3F6DA 1ZYEA 5KN2A 2LEGA 3APQA 4MZWA 2I9HA 3IE3A 4G0IA 3FMWA 4E8HA 4HU9A 5LNKe 2HRKA 3ZREA 1I9DA 1A2LA 4JBBA 2K18A 3K8NA 2H71A 4ILFA 2H19A 1EWXA 1ZYQB 1KTEA 5KEJA 3G9BA 1URMA 2PVQA 3PGTA 4G2EA 5G1KA 3TJGA 5GSTA 2DMMA 4GF0A 3RDWA 4YKGA 1FOVA 2DJ2A 2IFQA 1GSDA 1SJZA 4Q5RA 3GV1A 4KF9A 2OJLA 1YF0A 1ZMAA 4N11A 3TGZA 3C73A 1PN0A 4NPBA 2H74A 4ECCA 2VD1A 3NIVA 1O8XA 2FCHA 2DKIA 3IC4A 3APSA 3F9UA 2FWGA 3EU3A 4AGSA 1AQXA 5CREA 2VD0A 1HNBA 1RW1A 1THOA 3SWLA 2H6XA 2JZTA 2H1BA 5IQYA 1T4ZA 4RUVA 4BWSA 3TOTA 3LSZA 1PKZA 4IQAA 2LQOA 1XOAA 4JR4A 1TU7A 2ON5A 1K0NA 3CTFA 1QXHA 1T00A 2QA2A 3VI7A 3QR6A 2LV3A 4GXZA 2C0DA 3FR6A 1XZOA 1G7EA 1Z5YE 4O7HA 1X5EA 3EMPA 4V1Ag 2YZHA 3A2WA 5IO0A 4HJ2A 1VGLA 2FGXA 1OC3A 3HJPA 4DSQA 4POKA 4QL7A 2OBKA 4ACSA 5ID2A 3FK8A 5JWRB 4LL1B 1BAYA 1SJ6A 4L5OA 2HRNA 1V9WA 3RHCA 2G2QA 3J7Yk 4MJCA 3GTUB 3VK9A 2E7PA 4TOPA 4TR4A 2M72A 5J9BA 4ZILA 2GSTA 2VL3A 3C7MA 3BCKA 3KCMA 4BA7A 2L5OA 3CSIA 2AB6A 1FVJA 2KLXA 2R0GA 3HVVA 3KZQA 3VWVA 2XBQA 4K7OA 3JCML 2FHEA 13GSA 2IMDA 3GIXA 1XFLA 2QC7A 1PGTA 3HVSA 1H4OA 4PURA 2VLVA 1DE2A 2DJ3A 1MD3A 4G10A 1F3BA 3LGCA 2DIYA 2LJRA 1XOBA 3L9VA 4WR4A 1N8JA 1PL1A 4EC0A 5IMVA 1WE0A 3TKQA 2LRNA 2X99A 2OACA 2MMNA 3EURA 1QQ2A 5J5NA 1YKCA 3KJYA 4IKHA 3TKSE 3IPZA 1T3BA 1XXUA 3LWAA 2B7JA 1JFUA 1TRVA 5DJMA 4K7IA 3QMXA 4KNDA 3TKPA 2H1AA 6GSWA 2OBIA 4IW9A 1A8LA 3I69A 1PSQA 2V32A 2MYGA 4GSSA 2YNXA 4MCUA 4ULXA 5F8BA 4NWYA 3FRCA 1XBSA 2F51A 3GHAA 2FWFA 4FYCA 3TJJA 1O85A 2IPAA 1AAZA 2YWOA 3ZITA 4XS4B 4IJIA 1B4QA 1QFNA 1ABAA 4MA9A 5KOWA 4G0KA 1XWGA 1DE1A 4PNFA 1F9MA 2Z9SA 2F8FA 1SYRA 1XWAA 1YF1A 1MEKA 1FAAA 1E2YA 2ON7A 4TRXA 5ECMB 4IHUA 4BVYB 3TRXA 1USBA 2YN1A 4AF2A 1OAZA 1MDJA 3EE2A 1I5GA 3UBKA 4O32A 4MF5A 1AW9A 5H5SA 1Q98A 3LYKA 1GSQA 1Y25A 3RAZA 4EUYA 1GTBA 2YOIA 2HYXA 2O7KA 1TRSA 3HZ4A 3KP9A 3HKRA 3C71A 1FOHA 1ZCPA 4HQSA 4Z2UA 3GTUA 3P7XA 2BMXA 4Q5FA 4I5QA 2IL3A 3TCOA 3IRAA 1XWKA 4WEYA 1NW2A 2DJJA 1M2BA 3GL5A 5J41A 2X8HA 1U88A 4IELA 2P0GA 2X8GA 1ERWA 1GTUA 3Q74A 1HNCA 2GS3A 2AAWA 1QMVA 3MDKA 3M8NA 4F03A 4FIWA 1JZWA 1T8EB 4IN0A 5DQSA 1O81A 2DKHA 3ED3A 4IJ3A 2WZ9A 3FKFA 4PTSA 5KN1A 1A8YA 2LS5A 1GH2A 2HE3A 3O3TA 1HNAA 2V6KA 2X49A 5IOWA 4USSA 1SL2B 5GSSA 2GSRA 4TW5A 3OR5A 4BL7B 3CYNA 5JCGA 4G9HA 1VF3A 1K0DA 2H0IA 2EIQA 4IBPA 1PL2A 1UC7A 2JSZA 1R7HA 2GSQA 1C72A 2CVBA 1W4VA 2FUG2 3ZLPA 1GNEA 1ERTA 4OCFA 2QKEA 1FG4A 4XS4A 2KUCA 1YZXA 1GSUA 2DC5A 3GURA 1FB0A 3QAGA 2DMLA 1S3AA 2H01A 3FHKA 3TUEA 4CY8A 1E6BA 1V98A 1Q4JA 4KX4A 2N5FA 1BYEA 2GT6A 2O85A 5IMFA 1WPIA 4Z7XA 1VF1A 1TI1A 5IMDA 4L5LA 3VWXA 3DWVA 2E0QA 2HSMA 1X5CA 3GX8A 3FZAA 3VFIA 3ZIVA 2DLXA 1B48A 2DJ1A 1YEPA 1ON4A 3FZ4A 2H1GA 2XHFA 4V2MA 1T7PB 2K8SA 3R3EA 5B7CA 2H0HA 3FZ5A 3N5OA 1F6MC 1T1VA 1TKDB 2DIZA 5JCWA 5B6MA 1VRSD 4Z2TA 2O89A 4NHWA 4Q5NA 4MP4A 2UZ8A 1GTIA 3L0HA 4YQMA 7GSSA 1UA5A 3MAKA 2LNTA 4G0LA 3D4MA 2GGTA 3NZNA 5IOXA 4BPYA 3UL3A 1GNWA 4GSTA 1SD9A 3F8UA 3FW2A 2L6DA 1J0FA 4FH8A 4N10A 3IXRA 2E2MA 1Z6MA 1NHOA 4G19A 4WETA 2IMFA 2VLTA 18GSA 2PUKC 4WBRD 1ZL9A 4EO3A 5ECKB 1SKRB 2P5QA 1EGOA 2CVDA 3DXBA 1WJKA 2C1YA 1KNGA 2IIYA 1Z7RA 4RQXA 4KSMA 1U6TA 4QQ7A 2HSHA 3MIXA 8GSSA 4HZ4A 1M9BA 1SK0A 4HI7A 11GSA 3KMOA 4V1Ap 3M9KA 3ZZXA 3F4TA 5CP1A 4K5RA 4L8EA 6GSSA 5A4VA 4PQ1A 4KAEA 2GVPA 2REMA 2B1LA 3M1GA 5IMZA 4GQFA 5G5FA 1GUMA 2WDUA 4JR6A 3BJ5A 3M3MA 3S9FA 2A4VA 2LTKA 3GFKA 3TJBA 1FW1A 2LRTA 1AQVA 3RHBA 4MF6A 3CSJA 5BMUA 1XW5A 1A0RP 4ZB6A 3VWWA 2H30A 3GN3A 2C4JA 3ZMKA 2YPMA 2R3XA 3IAS2 2BJXA 2JSYA 3LXZA 4HUAA 4HQZA 4FYBA 5COHA 2CX4A 4PNGA 2FD3A 4IP1A 3QAWA 3WYWA 4K0NA 4EE0A 3D6IA 3A5IA 5AN1A 1FB6A 4MPGA 2TIRA 5ECHB 2PGTA 2WB9A 4TR1B 4KA0A 4BVXB 4EVMA 4KDUA 2PU9C 4HU7A 1U87A 2H6YA 3QD9A 2KOKA 3IK9A 1TI3A 2CZ2A 2MBSA 2H0GA 2MMAA 3VPTA 3HD5A 4TXOB 4NV2A 2PWJA 5FWGA 17GSA 2I3YA 1B9XC 4TXVA 2LNSA 2HSYA 4FQUA 3GMFA 5ABRA 2HLSA 3US3A 3TB2A 3UAPA 3LXTA 5L71A 1AXDA 5H5QA 4MJBA 1CQGA 3GYKA 2RM6A 5DALB 5CRHA 5HQPA 5D8IA 4P3YB 3IK7A 5AIXA 1GLPA 2WS2A 2HZEB 4OFMA 1SJIA 3BD2A 5D9VA 6GSVA 2EIRA 2VCXA 1N2AA 1X9SB 2CZ3A 1IYIA 2H73A 3H93A 2LUSA 4K2XA 1SKWB 4N30A 4V2NA 3ZVJA 2X8CA 3E9JB 2JADA 3M9JA 5DCHA 1WIKA 3IV4A 3ZYWA 3V1WA 2M46A 3DEXA 1TOFA 3O76A 2VLUA 3GNJA 5ENUA 2FWHA 2QA1A 2VL2A 5C00A 2VCZA 4I97A 1ZYPA 5IMAA 1A23A 3GL3A 1J08A 3CBUA 1O73A 1BG5A 1QUWA 2L6CA 2PPTA 3TRPA 5GAPD 1TK0B 1XWBA 2L57A 1GP1A 1R5PA 4K5SA 1K3OA 2LRCA 5B8AA 2JU5A 3HDCA 4PQIA 3TJFA 4EDYA 3WT2A 1X9WB 1CQHA 1OE7A 3IAM2 1GSYA 3VPQA 3F3QA 3DYRA 3TKSA 5CRDA 4EL1A 1H75A 4I8BA 2PMTA 4TR1A 2WFCA 9GSSA 3P90A 2CAIA 2FWEA 1EP8A 3H8QA 1OKTA 4OCEA 1OC8A 3F0IA 4HJMA 1SD8A 4CY6A 5EPFA 5FT3A 1TP9A 5AIVA 3A2VA 3AY8A 5CRWA 1PX6A 4RI7A 3GKKA 2XBIA 1WOUA 1B4PA 3A2XA 4TXOA 3APOA 4EIPA 2H72A 2YJ7A 2YWNA 1JHBA 5ECNB 3DIEA 4OWYA 5AGYA 4EDZA 4RI6A 1J9BA 1M2AA 3D4TA 2H8LA 1X9MB 3F4SA 2VCVA 4JRRA 5GZZB 1XIYA 2VIMA 5DALA 1F3AA 5LCZA 5ECSA 3LJRA 2XPEA 5D9TA 2DSAA 3MYDA 5G30A 5IMCA 5KOXA 3RPPA 3IOSA 3ERWA 3CRUA 3UOMA 2MZCA 4KUNA 1R26A 3UJ1A 2J9HA 1DSBA 3FEUA 4MABA 4K6XA 4O5RA 3A3TA 4X0XA 1GSSA 5F07A 3ZL5A 1KEBA 4YH2A 14GSA 1XCCA 3GUSA 3IR4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GSN A;  3ZVJ D;  3KXO A;  1O6J A;  3A5W A;  4WXT A;  3TRQ A;  1LU4 A;  3NOF A;  4OFN A;  2IWT A;  1LBK A;  1XVQ A;  5HFK A;  2K9F A;  3CMI A;  1XW9 A;  1GWC A;  2OAD A;  5G1L A;  2FLS A;  1M9A A;  4MDC A;  1TRU A;  4TKY A;  2YJH A;  3ZFL A;  4OD7 A;  1YDK A;  4PGT A;  5JCU A;  2WGR A;  4YQU A;  1ILO A;  4WR5 A;  4MF7 A;  3UMA A;  4EF0 A;  1YQ1 A;  2F9S A;  4PUA A;  1TU8 A;  1SL0 B;  1K3Y A;  1MD4 A;  2HFD A;  5C04 A;  2FNO A;  3GA4 A;  2GT5 A;  3IHQ A;  3ME8 A;  5HR1 A;  4J57 E;  1TXX A;  2RLI A;  1WMJ A;  2F3M A;  3HYP A;  5D96 A;  3ZIJ A;  4POL A;  1A24 A;  4NMU A;  1UVZ A;  2M80 A;  3P8W A;  3WGD A;  3BCI A;  4FO5 A;  4KDX A;  5HR0 A;  4HOJ A;  2GLR A;  3G7Y A;  1EEJ A;  3BOA A;  2R6K A;  5CO3 A;  3TJK A;  3D0Z A;  5G5E A;  5DDL A;  4KB3 A;  5IIZ A;  5AIS A;  1WP0 A;  2GZP A;  2F8A A;  1ZOF A;  2YCD A;  5A4W A;  3KH7 A;  4KCE A;  2HT9 A;  5ECR B;  4F82 A;  5IO2 A;  4IP6 A;  3C1R A;  4ZL8 A;  4BVY A;  2WCI A;  2P31 A;  3QPM A;  2MMO A;  2B6M A;  4NV5 A;  2H6Z A;  4ZL9 A;  1DUG A;  4NXI A;  2P5R A;  1YY7 A;  2IME A;  3ZTL A;  2DJK A;  2E2G A;  1X0R A;  4ECB A;  3Q19 A;  4MZB A;  2V41 A;  3DKS A;  3FZ9 A;  1ML6 A;  5DJL A;  5KN0 A;  3KM6 A;  2WRT A;  4MK3 A;  3DML A;  1XPV A;  2B5Y A;  3EC3 A;  5E4W A;  2O87 A;  1EOG A;  2CA8 A;  5KN3 A;  3GST A;  4RQR A;  5EVO A;  3F6F A;  3I9V 2;  4F0B A;  1OE8 A;  2CV4 A;  2OKA A;  2NPB A;  3H1N A;  3GKN A;  2CAQ A;  2VO4 A;  2L59 A;  5EY6 A;  1B8X A;  4I2T A;  4I6X A;  2KP2 A;  2VM1 A;  3FR9 A;  2B7K A;  5B8B A;  5GAN D;  3M0F A;  4X1U A;  2GZZ A;  2VAF A;  3DVW A;  1QGV A;  3FY7 A;  3W6G A;  3D21 A;  4WBJ A;  1FHE A;  2L4Q A;  1T4Y A;  3LFL A;  3FYG A;  3KTL A;  5ELA A;  1HD2 A;  2HRF A;  2FA4 A;  1FO5 A;  2YWM A;  1HYU A;  3GH9 A;  16GS A;  4DEJ A;  4BL7 A;  4F0C A;  2VL2 C;  2QSI A;  3LOR A;  1GLQ A;  10GS A;  3HCZ A;  2IMI A;  1PKW A;  2ZNM A;  3U5R E;  2OE3 A;  3FR3 A;  3CSH A;  3KD0 A;  3W8S A;  4K9Z A;  4OFT A;  3I6A A;  1S3D A;  3LQ7 A;  3GKX A;  5DQY A;  5E59 A;  3EMX A;  1XVW A;  3QDN A;  4HEA 2;  3GSS A;  4XRA A;  1K0B A;  2I1U A;  2GQK A;  2JZR A;  2IMK A;  3TKS C;  4TVE A;  2H75 A;  4EKZ A;  2CT6 A;  2DBC A;  20GS A;  1K0A A;  1EV4 A;  2YV7 A;  3L4N A;  4WKW A;  2AJQ B;  4YAP A;  3UVT A;  1W89 A;  5F0G A;  3P2A A;  2JL4 A;  2LST A;  3LEF A;  5ECL B;  1ERV A;  4LMW A;  2B5X A;  2QGV A;  4FYU A;  1R5A A;  1B9Y C;  3QAV A;  2GZY A;  3Q18 A;  3UIW A;  2X64 A;  4NAX A;  1BJX A;  1VF4 A;  2RM5 A;  4JU5 A;  5D9W A;  2R5G A;  2V1M A;  3TOU A;  4MPF A;  1Y6E A;  3W8J A;  4ISD A;  1K0M A;  4DSS B;  2YP6 A;  3D22 A;  1JZR A;  4TR3 A;  1PD2 1;  4GRF A;  2VM2 A;  4KE3 A;  2KHP A;  4ZBB A;  1TRW A;  5G2Z A;  4Q5Q A;  4N0V A;  3EIN A;  3KP8 A;  1Z3E A;  1K3L A;  3N9J A;  4YQV A;  1XW6 A;  1R4W A;  5D93 A;  4JED A;  5J9C A;  2VOC A;  4KH7 A;  4PUF C;  2O8V B;  3UVH A;  2R2J A;  3ZML A;  2ZCT A;  6GSY A;  4QL9 A;  1EGR A;  4E8E A;  4GTU A;  3MNG A;  3VUR A;  2VUP A;  3IDV A;  2RUF A;  3H79 A;  4KW6 A;  2PVO C;  2ZUP A;  1GSF A;  3ERG A;  1TW9 A;  3KEB A;  5DAK B;  4LL4 B;  1U3I A;  1GSE A;  5A4U A;  4F9Z A;  3DRN A;  4ZB9 A;  3PIN A;  4ECI A;  1SK2 A;  4LLR A;  1Z6N A;  1TK5 B;  2LKU A;  4N0Z A;  1JLV A;  3VI5 A;  3C1S A;  3SBC A;  4ID0 A;  5A5K A;  4GLT A;  2IJY A;  2L5L A;  3BBY A;  3LG6 A;  4POB A;  2KP1 A;  3WGE A;  1AQW A;  1M99 A;  2RUE A;  2EIO A;  1SKS B;  2HXK A;  2VCW A;  4KDY A;  4ML6 A;  4IS0 A;  3QFB C;  4AJ8 A;  2B5E A;  3HZ8 A;  2LQQ A;  2JAC A;  1EV9 A;  1MTC A;  4KSO A;  3F4R A;  1JZD A;  2AUV A;  2NTO A;  1TDI A;  5ECP B;  1K0O A;  6GSX A;  2YAN A;  4GQC A;  3J7Y b;  1MDK A;  5ECI B;  3ZRD A;  2C0E A;  2MBT A;  3R2Q A;  4IGJ A;  4MH3 A;  1QK8 A;  1BQ7 A;  3HJO A;  3HJM A;  2RII A;  2FA8 A;  4GCI A;  2HI7 A;  5ECO B;  4CW9 A;  3DVX A;  2JZS A;  5HFI A;  3ISO A;  4MJA A;  2G0F A;  4YAV A;  2H66 A;  4BVX A;  4DSS A;  2H1D A;  3TDG A;  1BX9 A;  2NDO A;  3PR8 A;  2YWI A;  2TRC P;  4LMV A;  3L78 A;  4XIH A;  1ZGN A;  3ERF A;  5HR2 A;  1HQO A;  1LJR A;  1ZZY A;  5CYY A;  1GUL A;  2C0G A;  1O8W A;  1TJD A;  2C80 A;  1RQM A;  5IPG A;  2A2S A;  3E0U A;  4D73 B;  3KMN A;  4J56 E;  2BTO T;  4DVC A;  2AYT A;  4K2D A;  1PQN A;  2I81 A;  1EP7 A;  3RBT A;  3CXG A;  2OE1 A;  3D5J A;  4MH2 A;  4IQ1 A;  1V57 A;  3HY2 A;  1OKD A;  5DAK A;  2NVL A;  3EWL A;  3F3R A;  3KTB A;  4HDE A;  2GTU A;  2XC2 A;  4GWR A;  3F63 A;  1GRX A;  1PMT A;  2HZE A;  3CRT A;  1A2J A;  2B1K A;  2C0F A;  3UBL A;  4XS1 A;  5J3R A;  2EC4 A;  1VF2 A;  1K0C A;  5CAX A;  2HNL A;  3MSZ A;  3LYP A;  3PH9 A;  2ES7 A;  4F2I A;  3EU4 A;  4PXO A;  1Z7P A;  1EOH A;  4CHS A;  1KBN A;  1PRX A;  2GQL A;  1X5D A;  5F05 A;  1AUC A;  2CX3 A;  3G7I A;  4V2L A;  1O7U A;  1YKA A;  6GST A;  3EYT A;  1SEN A;  2K8V A;  4L0U A;  2MMZ A;  4MZC A;  3EVI A;  2N5A A;  4XTS A;  3ME7 A;  4AJ7 A;  3E3E A;  1F37 A;  4X43 A;  1V58 A;  4NHZ A;  1WWJ A;  4OO4 A;  4K8M A;  1F2E A;  4ECJ A;  1NSW A;  5HR3 A;  3VLN A;  4MJE A;  6GSU A;  3UAR A;  3QFA C;  2H76 A;  2AHE A;  1XWC A;  3L9U A;  3QCP A;  5FHI A;  3KH9 A;  4ZBD A;  3HVX A;  4H86 A;  2VL9 A;  4JE1 A;  1M2D A;  2YV9 A;  1PX7 A;  5CRG A;  1AIU A;  3O6T A;  5J4U A;  5F06 A;  1IYH A;  2GDR A;  1OC9 B;  3L9S A;  4ZXG A;  5D9X A;  3WD6 A;  4TR0 A;  3VWU A;  1V40 A;  1G7O A;  4POM A;  3GRX A;  3KGK A;  1ACV A;  4XCS A;  4XHM A;  1BED A;  1M0U A;  2FY6 A;  1OYJ A;  3DD3 A;  3U6V A;  2NBS A;  3HA9 A;  5DVB A;  4EXJ A;  4D73 A;  1GTA A;  4ZBA A;  4K7N A;  1GL8 A;  5B6N A;  3ZFB A;  2GSS A;  1GUH A;  4PX1 A;  1NM3 A;  3GH6 A;  2K6V A;  2PER A;  2R37 A;  1G6Y A;  4K1F A;  1FVK A;  2VCT A;  3HXS A;  5HFG A;  4ZIJ A;  2TRX A;  2C3N A;  2H70 A;  2I4A A;  2GQM A;  2DJ0 A;  3IBH A;  4ZL7 A;  1ERU A;  2V6O A;  4WF4 A;  2VCQ A;  5DCG A;  3Q6O A;  4I2U A;  1SYX A;  4OO5 A;  1TK8 B;  1A2M A;  2WJU A;  3UEM A;  2PN8 A;  2IFQ B;  2IN3 A;  1AC1 A;  2CQ9 A;  1RK4 A;  1GUK A;  2A2R A;  1G6W A;  5IM9 A;  5EL8 A;  2C8U A;  4PQH A;  4KCA A;  4XRD A;  5INY A;  4ZB8 A;  1ST9 A;  1U3A A;  4XS6 A;  3WGX A;  4IVF A;  5D73 A;  2LJK A;  4BWQ A;  3KIJ A;  5JWO B;  1YEX A;  3HHV A;  1SL1 B;  4KGI A;  1S3C A;  5H5R A;  3GKM A;  2ALB A;  5IPH A;  5G31 A;  2YZU A;  3QOU A;  4HZ2 A;  1SK1 A;  3GX0 A;  1A0F A;  1NHY A;  5LD0 A;  4WF5 A;  2WUL A;  4K0G A;  12GS A;  3IA1 A;  1V2A A;  4J2F A;  2B3S A;  5DBQ A;  3CTG A;  1JLW A;  4TN8 A;  19GS A;  1Z9H A;  4MMM A;  1G0T A;  4L0W A;  2V2G A;  1PN9 A;  5CNW A;  5JWQ B;  2AV4 A;  1OVN A;  3H4K A;  2XPD A;  4AJ6 A;  22GS A;  2L4C A;  2OE0 A;  2PBJ A;  5ECQ B;  4LA1 A;  4OMV A;  1WRY A;  2N5B A;  4ML1 A;  4HS1 A;  2OA7 A;  3I43 A;  4MLY A;  1OC9 A;  1JZO A;  1EEM A;  1MDI A;  4JZQ A;  3DGQ A;  2C3Q A;  3MWH A;  1YJ6 A;  2J23 A;  2D2Z A;  1DBY A;  3TKR A;  2LJA A;  3WT1 A;  5ID2 B;  3G7J A;  4CDO A;  4O92 A;  2HZF A;  3C8E A;  5ELG A;  4DSR A;  1THX A;  2R4V A;  2C3T A;  3RPN A;  2CVK A;  1UN2 A;  1SU9 A;  1EZK A;  1TTZ A;  1PA3 A;  1M7T A;  3F6D A;  1ZYE A;  5KN2 A;  2LEG A;  3APQ A;  4MZW A;  2I9H A;  3IE3 A;  4E8H A;  4HU9 A;  5LNK e;  3ZRE A;  1I9D A;  1A2L A;  4JBB A;  2K18 A;  3K8N A;  2H71 A;  4ILF A;  2H19 A;  1EWX A;  1ZYQ B;  1KTE A;  5KEJ A;  3G9B A;  1URM A;  2PVQ A;  3PGT A;  4G2E A;  5G1K A;  3TJG A;  5GST A;  2DMM A;  4GF0 A;  3RDW A;  1FOV A;  2DJ2 A;  2IFQ A;  1GSD A;  1SJZ A;  4Q5R A;  3GV1 A;  2OJL A;  1YF0 A;  1ZMA A;  4N11 A;  3TGZ A;  3C73 A;  4NPB A;  2H74 A;  4ECC A;  2VD1 A;  3NIV A;  1O8X A;  2FCH A;  3IC4 A;  3APS A;  3F9U A;  2FWG A;  3EU3 A;  4AGS A;  1AQX A;  5CRE A;  2VD0 A;  1HNB A;  1RW1 A;  1THO A;  3SWL A;  2H6X A;  2JZT A;  2H1B A;  5IQY A;  1T4Z A;  4RUV A;  4BWS A;  3TOT A;  3LSZ A;  1PKZ A;  4IQA A;  2LQO A;  1XOA A;  4JR4 A;  1TU7 A;  2ON5 A;  1K0N A;  3CTF A;  1QXH A;  1T00 A;  3VI7 A;  3QR6 A;  2LV3 A;  4GXZ A;  2C0D A;  3FR6 A;  1XZO A;  1G7E A;  1Z5Y E;  4O7H A;  1X5E A;  3EMP A;  4V1A g;  2YZH A;  3A2W A;  5IO0 A;  4HJ2 A;  1VGL A;  2FGX A;  1OC3 A;  3HJP A;  4DSQ A;  4POK A;  4QL7 A;  2OBK A;  4ACS A;  5ID2 A;  3FK8 A;  5JWR B;  4LL1 B;  1BAY A;  1SJ6 A;  4L5O A;  2HRN A;  1V9W A;  3RHC A;  2G2Q A;  3J7Y k;  4MJC A;  3GTU B;  3VK9 A;  2E7P A;  4TOP A;  4TR4 A;  2M72 A;  5J9B A;  4ZIL A;  2GST A;  2VL3 A;  3C7M A;  3BCK A;  3KCM A;  4BA7 A;  2L5O A;  3CSI A;  2AB6 A;  1FVJ A;  2KLX A;  3HVV A;  3KZQ A;  3VWV A;  2XBQ A;  4K7O A;  3JCM L;  2FHE A;  13GS A;  2IMD A;  3GIX A;  1XFL A;  2QC7 A;  1PGT A;  3HVS A;  1H4O A;  4PUR A;  2VLV A;  1DE2 A;  2DJ3 A;  1MD3 A;  4G10 A;  1F3B A;  3LGC A;  2DIY A;  2LJR A;  1XOB A;  3L9V A;  4WR4 A;  1N8J A;  1PL1 A;  4EC0 A;  5IMV A;  1WE0 A;  3TKQ A;  2LRN A;  2X99 A;  2OAC A;  2MMN A;  3EUR A;  1QQ2 A;  5J5N A;  1YKC A;  3KJY A;  4IKH A;  3TKS E;  3IPZ A;  1T3B A;  1XXU A;  3LWA A;  2B7J A;  1JFU A;  1TRV A;  5DJM A;  4K7I A;  3QMX A;  4KND A;  3TKP A;  2H1A A;  6GSW A;  2OBI A;  4IW9 A;  1A8L A;  3I69 A;  1PSQ A;  2V32 A;  2MYG A;  4GSS A;  2YNX A;  4MCU A;  4ULX A;  5F8B A;  4NWY A;  3FRC A;  1XBS A;  2F51 A;  3GHA A;  2FWF A;  4FYC A;  3TJJ A;  1O85 A;  2IPA A;  1AAZ A;  2YWO A;  3ZIT A;  4XS4 B;  4IJI A;  1B4Q A;  1QFN A;  1ABA A;  4MA9 A;  1XWG A;  1DE1 A;  4PNF A;  1F9M A;  2Z9S A;  2F8F A;  1SYR A;  1XWA A;  1YF1 A;  1MEK A;  1FAA A;  1E2Y A;  2ON7 A;  4TRX A;  5ECM B;  4IHU A;  3TRX A;  1USB A;  2YN1 A;  4AF2 A;  1OAZ A;  1MDJ A;  3EE2 A;  1I5G A;  3UBK A;  4O32 A;  4MF5 A;  1AW9 A;  5H5S A;  1Q98 A;  3LYK A;  1GSQ A;  1Y25 A;  3RAZ A;  4EUY A;  1GTB A;  2YOI A;  2HYX A;  2O7K A;  1TRS A;  3HZ4 A;  3KP9 A;  3HKR A;  3C71 A;  4HQS A;  1ZCP A;  3GTU A;  3P7X A;  2BMX A;  4Q5F A;  4I5Q A;  2IL3 A;  3TCO A;  3IRA A;  1XWK A;  4WEY A;  1NW2 A;  2DJJ A;  1M2B A;  3GL5 A;  5J41 A;  2X8H A;  1U88 A;  4IEL A;  2P0G A;  2X8G A;  1ERW A;  1GTU A;  3Q74 A;  1HNC A;  2GS3 A;  2AAW A;  1QMV A;  3MDK A;  3M8N A;  4F03 A;  4FIW A;  1JZW A;  1T8E B;  4IN0 A;  5DQS A;  1O81 A;  3ED3 A;  4IJ3 A;  2WZ9 A;  3FKF A;  5KN1 A;  1A8Y A;  2LS5 A;  1GH2 A;  2HE3 A;  3O3T A;  1HNA A;  2V6K A;  5IOW A;  1SL2 B;  5GSS A;  2GSR A;  4TW5 A;  3OR5 A;  3CYN A;  5JCG A;  4G9H A;  1VF3 A;  1K0D A;  2H0I A;  2EIQ A;  4IBP A;  1PL2 A;  1UC7 A;  2JSZ A;  1R7H A;  2GSQ A;  1C72 A;  2CVB A;  1W4V A;  2FUG 2;  3ZLP A;  1GNE A;  1ERT A;  4OCF A;  2QKE A;  1FG4 A;  4XS4 A;  2KUC A;  1YZX A;  1GSU A;  2DC5 A;  3GUR A;  1FB0 A;  3QAG A;  2DML A;  1S3A A;  2H01 A;  3FHK A;  3TUE A;  1E6B A;  1V98 A;  1Q4J A;  4KX4 A;  2N5F A;  1BYE A;  2GT6 A;  2O85 A;  5IMF A;  1WPI A;  4Z7X A;  1VF1 A;  1TI1 A;  5IMD A;  4L5L A;  3VWX A;  3DWV A;  2E0Q A;  1X5C A;  3GX8 A;  3FZA A;  3VFI A;  3ZIV A;  2DLX A;  1B48 A;  2DJ1 A;  1YEP A;  1ON4 A;  3FZ4 A;  2H1G A;  2XHF A;  4V2M A;  1T7P B;  2K8S A;  5B7C A;  2H0H A;  3FZ5 A;  3N5O A;  1F6M C;  1T1V A;  1TKD B;  2DIZ A;  5JCW A;  5B6M A;  1VRS D;  2O89 A;  4NHW A;  4Q5N A;  4MP4 A;  1GTI A;  3L0H A;  4YQM A;  7GSS A;  1UA5 A;  3MAK A;  2LNT A;  3D4M A;  2GGT A;  3NZN A;  5IOX A;  4BPY A;  3UL3 A;  1GNW A;  4GST A;  1SD9 A;  3F8U A;  3FW2 A;  2L6D A;  1J0F A;  4FH8 A;  4N10 A;  3IXR A;  2E2M A;  1Z6M A;  1NHO A;  4G19 A;  4WET A;  2IMF A;  2VLT A;  18GS A;  2PUK C;  4WBR D;  1ZL9 A;  4EO3 A;  5ECK B;  1SKR B;  2P5Q A;  1EGO A;  2CVD A;  3DXB A;  1WJK A;  2C1Y A;  1KNG A;  2IIY A;  1Z7R A;  4RQX A;  4KSM A;  1U6T A;  4QQ7 A;  2HSH A;  8GSS A;  4HZ4 A;  1M9B A;  1SK0 A;  4HI7 A;  11GS A;  3KMO A;  4V1A p;  3M9K A;  3ZZX A;  3F4T A;  5CP1 A;  4L8E A;  6GSS A;  5A4V A;  4PQ1 A;  4KAE A;  2GVP A;  2REM A;  2B1L A;  3M1G A;  5IMZ A;  4GQF A;  5G5F A;  1GUM A;  2WDU A;  4JR6 A;  3BJ5 A;  3M3M A;  3S9F A;  2A4V A;  2LTK A;  3GFK A;  3TJB A;  1FW1 A;  2LRT A;  1AQV A;  3RHB A;  4MF6 A;  3CSJ A;  1XW5 A;  1A0R P;  4ZB6 A;  3VWW A;  2H30 A;  3GN3 A;  2C4J A;  3ZMK A;  2YPM A;  2R3X A;  3IAS 2;  2BJX A;  2JSY A;  3LXZ A;  4HUA A;  4HQZ A;  4FYB A;  5COH A;  2CX4 A;  4PNG A;  2FD3 A;  4IP1 A;  3QAW A;  3WYW A;  4K0N A;  4EE0 A;  3D6I A;  5AN1 A;  1FB6 A;  4MPG A;  2TIR A;  5ECH B;  2PGT A;  2WB9 A;  4TR1 B;  4KA0 A;  4EVM A;  4KDU A;  2PU9 C;  4HU7 A;  1U87 A;  2H6Y A;  3QD9 A;  2KOK A;  3IK9 A;  1TI3 A;  2CZ2 A;  2MBS A;  2H0G A;  2MMA A;  3VPT A;  3HD5 A;  4TXO B;  4NV2 A;  2PWJ A;  5FWG A;  17GS A;  2I3Y A;  1B9X C;  4TXV A;  2LNS A;  2HSY A;  3GMF A;  5ABR A;  2HLS A;  3US3 A;  3TB2 A;  3UAP A;  3LXT A;  5L71 A;  1AXD A;  5H5Q A;  4MJB A;  1CQG A;  3GYK A;  2RM6 A;  5DAL B;  5CRH A;  5HQP A;  5D8I A;  4P3Y B;  3IK7 A;  5AIX A;  1GLP A;  2WS2 A;  2HZE B;  4OFM A;  1SJI A;  3BD2 A;  5D9V A;  6GSV A;  2EIR A;  2VCX A;  1N2A A;  1X9S B;  2CZ3 A;  1IYI A;  2H73 A;  3H93 A;  2LUS A;  1SKW B;  4N30 A;  4V2N A;  3ZVJ A;  2X8C A;  3E9J B;  2JAD A;  3M9J A;  5DCH A;  1WIK A;  3IV4 A;  3ZYW A;  3V1W A;  2M46 A;  3DEX A;  1TOF A;  3O76 A;  2VLU A;  3GNJ A;  5ENU A;  2FWH A;  2VL2 A;  5C00 A;  2VCZ A;  4I97 A;  5IMA A;  1A23 A;  3GL3 A;  1J08 A;  3CBU A;  1O73 A;  1BG5 A;  1QUW A;  2L6C A;  2PPT A;  3TRP A;  5GAP D;  1TK0 B;  1XWB A;  2L57 A;  1GP1 A;  1R5P A;  1K3O A;  2LRC A;  5B8A A;  2JU5 A;  3HDC A;  4PQI A;  3TJF A;  4EDY A;  3WT2 A;  1X9W B;  1CQH A;  1OE7 A;  3IAM 2;  1GSY A;  3VPQ A;  3F3Q A;  3DYR A;  3TKS A;  5CRD A;  4EL1 A;  1H75 A;  4I8B A;  2PMT A;  4TR1 A;  2WFC A;  9GSS A;  3P90 A;  2CAI A;  2FWE A;  1EP8 A;  3H8Q A;  1OKT A;  4OCE A;  1OC8 A;  3F0I A;  4HJM A;  1SD8 A;  5EPF A;  5FT3 A;  1TP9 A;  5AIV A;  3A2V A;  3AY8 A;  5CRW A;  1PX6 A;  4RI7 A;  3GKK A;  2XBI A;  1WOU A;  1B4P A;  3A2X A;  4TXO A;  3APO A;  2H72 A;  2YJ7 A;  2YWN A;  1JHB A;  5ECN B;  3DIE A;  4OWY A;  5AGY A;  4EDZ A;  1J9B A;  1M2A A;  4RI6 A;  3D4T A;  2H8L A;  1X9M B;  3F4S A;  2VCV A;  4JRR A;  5GZZ B;  1XIY A;  2VIM A;  5DAL A;  1F3A A;  5LCZ A;  5ECS A;  3LJR A;  2XPE A;  5D9T A;  2DSA A;  5G30 A;  5IMC A;  3RPP A;  3IOS A;  3ERW A;  3CRU A;  3UOM A;  2MZC A;  4KUN A;  1R26 A;  3UJ1 A;  2J9H A;  1DSB A;  3FEU A;  4MAB A;  4K6X A;  4O5R A;  3A3T A;  4X0X A;  1GSS A;  5F07 A;  3ZL5 A;  1KEB A;  4YH2 A;  14GS A;  1XCC A;  3GUS A;  3IR4 A; 
#chains in the Genus database with same CATH topology
 4GSN A;  3ZVJ D;  3KXO A;  1O6J A;  3A5W A;  4WXT A;  3TRQ A;  1LU4 A;  3NOF A;  4OFN A;  2IWT A;  1LBK A;  1XVQ A;  5HFK A;  2K9F A;  3CMI A;  1XW9 A;  4HSC X;  1GWC A;  2OAD A;  5G1L A;  2FLS A;  1M9A A;  4MDC A;  1TRU A;  4TKY A;  2YJH A;  3ZFL A;  4OD7 A;  1YDK A;  4PGT A;  5JCU A;  2WGR A;  4YQU A;  1ILO A;  4WR5 A;  4MF7 A;  3UMA A;  4EF0 A;  1YQ1 A;  2F9S A;  4PUA A;  1TU8 A;  1SL0 B;  1K3Y A;  1MD4 A;  2HFD A;  5C04 A;  2FNO A;  3GA4 A;  2GT5 A;  3IHQ A;  3ME8 A;  5HR1 A;  4J57 E;  1TXX A;  2RLI A;  1WMJ A;  2F3M A;  3HYP A;  5D96 A;  3ZIJ A;  4POL A;  1A24 A;  4NMU A;  1UVZ A;  2M80 A;  3P8W A;  3WGD A;  3BCI A;  4FO5 A;  4KDX A;  5HR0 A;  4HOJ A;  2GLR A;  3G7Y A;  1EEJ A;  3BOA A;  2R6K A;  5CO3 A;  3TJK A;  3D0Z A;  5G5E A;  5DDL A;  4KB3 A;  5IIZ A;  2X4A A;  5AIS A;  1WP0 A;  2GZP A;  2F8A A;  1ZOF A;  2YCD A;  5A4W A;  3KH7 A;  4KCE A;  2HT9 A;  5ECR B;  4F82 A;  5IO2 A;  4IP6 A;  2R0C A;  3C1R A;  4ZL8 A;  4BVY A;  2WCI A;  2P31 A;  3QPM A;  2MMO A;  2B6M A;  4NV5 A;  2H6Z A;  4ZL9 A;  1DUG A;  4NXI A;  2P5R A;  1YY7 A;  2IME A;  3ZTL A;  2DJK A;  2E2G A;  3LW9 A;  1X0R A;  4ECB A;  3Q19 A;  4MZB A;  2V41 A;  3DKS A;  3FZ9 A;  1ML6 A;  5DJL A;  5KN0 A;  3KM6 A;  2WRT A;  4MK3 A;  3DML A;  1XPV A;  2B5Y A;  3EC3 A;  5E4W A;  2O87 A;  1EOG A;  2CA8 A;  5KN3 A;  3GST A;  4RQR A;  5EVO A;  3F6F A;  3I9V 2;  4F0B A;  1OE8 A;  2CV4 A;  2OKA A;  2NPB A;  3H1N A;  3GKN A;  2CAQ A;  2VO4 A;  2L59 A;  5EY6 A;  1B8X A;  4I2T A;  4I6X A;  2KP2 A;  2VM1 A;  3FR9 A;  2B7K A;  5B8B A;  5GAN D;  3M0F A;  4X1U A;  2GZZ A;  2VAF A;  3DVW A;  1QGV A;  3FY7 A;  3W6G A;  3D21 A;  4WBJ A;  1FHE A;  2L4Q A;  1T4Y A;  3LFL A;  3FYG A;  3KTL A;  5ELA A;  1HD2 A;  2HRF A;  5BRT A;  2FA4 A;  1FO5 A;  2YWM A;  1HYU A;  3GH9 A;  16GS A;  4DEJ A;  4BL7 A;  4F0C A;  2VL2 C;  2QSI A;  3LOR A;  1GLQ A;  10GS A;  3HCZ A;  2IMI A;  1PKW A;  2ZNM A;  3U5R E;  2OE3 A;  3FR3 A;  3CSH A;  3KD0 A;  3W8S A;  4K9Z A;  4OFT A;  3I6A A;  1S3D A;  3LQ7 A;  3GKX A;  5DQY A;  5E59 A;  3EMX A;  1XVW A;  3QDN A;  4HEA 2;  3GSS A;  4XRA A;  1K0B A;  2I1U A;  3CQF A;  2GQK A;  2JZR A;  1M3J A;  2IMK A;  3TKS C;  4TVE A;  2H75 A;  4EKZ A;  2CT6 A;  2DBC A;  20GS A;  1K0A A;  1EV4 A;  2YV7 A;  3L4N A;  4WKW A;  2AJQ B;  4YAP A;  3UVT A;  1W89 A;  5F0G A;  3P2A A;  2JL4 A;  2LST A;  3LEF A;  5ECL B;  1ERV A;  2HRA A;  4LMW A;  2B5X A;  2QGV A;  4FYU A;  1R5A A;  1B9Y C;  4Z2R A;  3QAV A;  2GZY A;  3Q18 A;  3UIW A;  2X64 A;  4NAX A;  1BJX A;  1VF4 A;  2RM5 A;  4JU5 A;  5D9W A;  2R5G A;  2V1M A;  3TOU A;  4MPF A;  1Y6E A;  3W8J A;  4ISD A;  1K0M A;  4DSS B;  2YP6 A;  3D22 A;  1JZR A;  4TR3 A;  1PD2 1;  4GRF A;  2VM2 A;  4KE3 A;  2KHP A;  4ZBB A;  1TRW A;  5G2Z A;  4Q5Q A;  4N0V A;  3EIN A;  3KP8 A;  1Z3E A;  1K3L A;  3N9J A;  4YQV A;  1XW6 A;  1R4W A;  5D93 A;  4JED A;  5J9C A;  2VOC A;  4KH7 A;  4PUF C;  2O8V B;  3UVH A;  2R2J A;  3ZML A;  2ZCT A;  6GSY A;  4QL9 A;  1EGR A;  4E8E A;  4GTU A;  3MNG A;  3VUR A;  2VUP A;  3IDV A;  2RUF A;  3H79 A;  4KW6 A;  2PVO C;  2ZUP A;  1GSF A;  3ERG A;  1TW9 A;  3KEB A;  5DAK B;  4LL4 B;  1U3I A;  1GSE A;  5A4U A;  4F9Z A;  3DRN A;  4ZB9 A;  3PIN A;  4ECI A;  1SK2 A;  4LLR A;  1Z6N A;  3IHG A;  1TK5 B;  2LKU A;  4N0Z A;  1JLV A;  3VI5 A;  3C1S A;  3SBC A;  4ID0 A;  5A5K A;  4GLT A;  2IJY A;  2L5L A;  3BBY A;  3LG6 A;  4POB A;  2KP1 A;  3WGE A;  1AQW A;  1M99 A;  2RUE A;  2EIO A;  1SKS B;  2HXK A;  2VCW A;  4KDY A;  4ML6 A;  4IS0 A;  3QFB C;  4AJ8 A;  2B5E A;  3HZ8 A;  2LQQ A;  2JAC A;  1EV9 A;  1MTC A;  4KSO A;  3F4R A;  1JZD A;  2AUV A;  2NTO A;  1TDI A;  5ECP B;  1K0O A;  6GSX A;  2YAN A;  4GQC A;  3J7Y b;  1MDK A;  5ECI B;  4A5P A;  3ZRD A;  2C0E A;  2MBT A;  3R2Q A;  4IGJ A;  4MH3 A;  1QK8 A;  1BQ7 A;  3HJO A;  3HJM A;  2RII A;  2FA8 A;  4GCI A;  2HI7 A;  5ECO B;  4CW9 A;  3DVX A;  2JZS A;  5HFI A;  3ISO A;  4MJA A;  2G0F A;  4YAV A;  2H66 A;  4BVX A;  4DSS A;  2H1D A;  3TDG A;  1BX9 A;  2NDO A;  3PR8 A;  2YWI A;  2TRC P;  4LMV A;  3L78 A;  4XIH A;  1ZGN A;  3ERF A;  5HR2 A;  1HQO A;  1ZYN A;  1LJR A;  1ZZY A;  5CYY A;  1GUL A;  2C0G A;  1O8W A;  1TJD A;  2C80 A;  1RQM A;  5IPG A;  2A2S A;  3E0U A;  2A2P A;  4D73 B;  3KMN A;  4J56 E;  2BTO T;  4DVC A;  2AYT A;  4K2D A;  1PQN A;  2I81 A;  1EP7 A;  3RBT A;  4EIQ A;  3CXG A;  3IC8 A;  2OE1 A;  3D5J A;  4MH2 A;  4IQ1 A;  1V57 A;  3HY2 A;  1OKD A;  5DAK A;  2NVL A;  3EWL A;  3F3R A;  3KTB A;  4HDE A;  2GTU A;  2XC2 A;  4GWR A;  3F63 A;  1GRX A;  1PMT A;  2HZE A;  3CRT A;  1A2J A;  2B1K A;  2C0F A;  3UBL A;  4XS1 A;  5J3R A;  2EC4 A;  1VF2 A;  1K0C A;  5CAX A;  2HNL A;  3EPT A;  3MSZ A;  3LYP A;  3PH9 A;  2ES7 A;  4F2I A;  3EU4 A;  4PXO A;  1Z7P A;  1EOH A;  4CHS A;  1KBN A;  1PRX A;  2GQL A;  1X5D A;  5F05 A;  1AUC A;  2CX3 A;  3G7I A;  4V2L A;  1O7U A;  1YKA A;  6GST A;  3EYT A;  1SEN A;  2K8V A;  4L0U A;  2MMZ A;  4MZC A;  3EVI A;  2N5A A;  4XTS A;  3ME7 A;  4AJ7 A;  3E3E A;  1F37 A;  4X43 A;  1V58 A;  4NHZ A;  1WWJ A;  4OO4 A;  4K8M A;  1F2E A;  4ECJ A;  1NSW A;  5HR3 A;  3VLN A;  4MJE A;  6GSU A;  3UAR A;  3QFA C;  2H76 A;  2AHE A;  1XWC A;  3L9U A;  3QCP A;  5FHI A;  3KH9 A;  4ZBD A;  3HVX A;  4H86 A;  2VL9 A;  4JE1 A;  1M2D A;  2YV9 A;  1PX7 A;  5CRG A;  1AIU A;  3O6T A;  5J4U A;  5F06 A;  1IYH A;  2GDR A;  1OC9 B;  4O5U A;  3L9S A;  4ZXG A;  5D9X A;  3WD6 A;  4TR0 A;  3VWU A;  4YKF A;  1V40 A;  1G7O A;  4POM A;  3GRX A;  3KGK A;  1ACV A;  4XCS A;  4XHM A;  4MNN A;  1BED A;  1M0U A;  2FY6 A;  1OYJ A;  3DD3 A;  3U6V A;  2NBS A;  3HA9 A;  5DVB A;  4EXJ A;  4D73 A;  1GTA A;  4ZBA A;  4K7N A;  1GL8 A;  5B6N A;  3ZFB A;  2GSS A;  1GUH A;  4PX1 A;  1NM3 A;  3GH6 A;  2K6V A;  2PER A;  2R37 A;  1G6Y A;  4K1F A;  1FVK A;  2VCT A;  3HXS A;  5HFG A;  4ZIJ A;  2TRX A;  2C3N A;  2H70 A;  2I4A A;  2GQM A;  2DJ0 A;  3IBH A;  4ZL7 A;  1ERU A;  4X4J A;  2V6O A;  4WF4 A;  2VCQ A;  5DCG A;  3Q6O A;  4I2U A;  1SYX A;  4OO5 A;  1TK8 B;  1A2M A;  2WJU A;  3UEM A;  2PN8 A;  2IFQ B;  2IN3 A;  1AC1 A;  2CQ9 A;  1RK4 A;  1GUK A;  2A2R A;  1G6W A;  5IM9 A;  5EL8 A;  2C8U A;  4O5Q A;  4PQH A;  4KCA A;  4XRD A;  5INY A;  4ZB8 A;  1ST9 A;  1U3A A;  4XS6 A;  3WGX A;  4IVF A;  5D73 A;  2LJK A;  4BWQ A;  3KIJ A;  5JWO B;  1YEX A;  3HHV A;  1SL1 B;  2R0P A;  4KGI A;  1S3C A;  5H5R A;  3GKM A;  2ALB A;  5IPH A;  5G31 A;  2YZU A;  3QOU A;  4HZ2 A;  1SK1 A;  3GX0 A;  1A0F A;  1NHY A;  5LD0 A;  4WF5 A;  2WUL A;  4K0G A;  12GS A;  3IA1 A;  1V2A A;  4J2F A;  2B3S A;  5DBQ A;  3CTG A;  1JLW A;  4TN8 A;  19GS A;  1Z9H A;  4MMM A;  1G0T A;  4L0W A;  2V2G A;  1PN9 A;  5CNW A;  5JWQ B;  2AV4 A;  1OVN A;  3H4K A;  2XPD A;  4AJ6 A;  22GS A;  2L4C A;  2OE0 A;  2PBJ A;  4ICY A;  5ECQ B;  4LA1 A;  4OMV A;  1WRY A;  2N5B A;  4ML1 A;  4HS1 A;  2OA7 A;  3I43 A;  4MLY A;  1OC9 A;  1JZO A;  1EEM A;  1MDI A;  4JZQ A;  3DGQ A;  2C3Q A;  2A4H A;  3MWH A;  1YJ6 A;  2J23 A;  2D2Z A;  3PPU A;  1DBY A;  3TKR A;  2LJA A;  3WT1 A;  5ID2 B;  3G7J A;  4CDO A;  4O92 A;  2HZF A;  3C8E A;  5ELG A;  4DSR A;  1THX A;  2R4V A;  2C3T A;  3RPN A;  2CVK A;  1UN2 A;  1SU9 A;  1EZK A;  1TTZ A;  1PA3 A;  1M7T A;  3F6D A;  1ZYE A;  5KN2 A;  2LEG A;  3APQ A;  4MZW A;  2I9H A;  3IE3 A;  4G0I A;  3FMW A;  4E8H A;  4HU9 A;  5LNK e;  2HRK A;  3ZRE A;  1I9D A;  1A2L A;  4JBB A;  2K18 A;  3K8N A;  2H71 A;  4ILF A;  2H19 A;  1EWX A;  1ZYQ B;  1KTE A;  5KEJ A;  3G9B A;  1URM A;  2PVQ A;  3PGT A;  4G2E A;  5G1K A;  3TJG A;  5GST A;  2DMM A;  4GF0 A;  3RDW A;  4YKG A;  1FOV A;  2DJ2 A;  2IFQ A;  1GSD A;  1SJZ A;  4Q5R A;  3GV1 A;  4KF9 A;  2OJL A;  1YF0 A;  1ZMA A;  4N11 A;  3TGZ A;  3C73 A;  1PN0 A;  4NPB A;  2H74 A;  4ECC A;  2VD1 A;  3NIV A;  1O8X A;  2FCH A;  2DKI A;  3IC4 A;  3APS A;  3F9U A;  2FWG A;  3EU3 A;  4AGS A;  1AQX A;  5CRE A;  2VD0 A;  1HNB A;  1RW1 A;  1THO A;  3SWL A;  2H6X A;  2JZT A;  2H1B A;  5IQY A;  1T4Z A;  4RUV A;  4BWS A;  3TOT A;  3LSZ A;  1PKZ A;  4IQA A;  2LQO A;  1XOA A;  4JR4 A;  1TU7 A;  2ON5 A;  1K0N A;  3CTF A;  1QXH A;  1T00 A;  2QA2 A;  3VI7 A;  3QR6 A;  2LV3 A;  4GXZ A;  2C0D A;  3FR6 A;  1XZO A;  1G7E A;  1XG8 A;  1Z5Y E;  4O7H A;  1X5E A;  3EMP A;  4V1A g;  2YZH A;  3A2W A;  1M3I A;  5IO0 A;  4HJ2 A;  1VGL A;  2FGX A;  1OC3 A;  3HJP A;  4DSQ A;  4POK A;  4QL7 A;  2OBK A;  4ACS A;  5ID2 A;  3FK8 A;  5JWR B;  4LL1 B;  1BAY A;  1SJ6 A;  4L5O A;  2HRN A;  1V9W A;  3RHC A;  2G2Q A;  3J7Y k;  4MJC A;  3GTU B;  3VK9 A;  2E7P A;  4TOP A;  4TR4 A;  2M72 A;  5J9B A;  4ZIL A;  2GST A;  2VL3 A;  3C7M A;  3BCK A;  3KCM A;  3HVN A;  4BA7 A;  2L5O A;  3CSI A;  2AB6 A;  1FVJ A;  2KLX A;  2R0G A;  3HVV A;  3KZQ A;  3VWV A;  2XBQ A;  4K7O A;  3JCM L;  2FHE A;  13GS A;  2IMD A;  3GIX A;  1XFL A;  2QC7 A;  1PGT A;  3HVS A;  1H4O A;  4PUR A;  2VLV A;  1DE2 A;  2DJ3 A;  1MD3 A;  4G10 A;  1F3B A;  3LGC A;  2DIY A;  2LJR A;  1XOB A;  3L9V A;  4WR4 A;  1N8J A;  1PL1 A;  4EC0 A;  5IMV A;  1WE0 A;  3TKQ A;  2LRN A;  2X99 A;  2OAC A;  2MMN A;  3EUR A;  1QQ2 A;  5J5N A;  1YKC A;  3KJY A;  4IKH A;  3TKS E;  3IPZ A;  1T3B A;  1XXU A;  3LWA A;  2B7J A;  1JFU A;  1TRV A;  5DJM A;  4K7I A;  3QMX A;  4KND A;  3TKP A;  2H1A A;  6GSW A;  2OBI A;  4IW9 A;  1A8L A;  3I69 A;  1PSQ A;  2V32 A;  2MYG A;  4GSS A;  2YNX A;  4MCU A;  4ULX A;  5F8B A;  4NWY A;  3FRC A;  1XBS A;  2F51 A;  3GHA A;  2FWF A;  4FYC A;  3TJJ A;  1O85 A;  2IPA A;  1AAZ A;  2YWO A;  3ZIT A;  4XS4 B;  4IJI A;  1B4Q A;  1QFN A;  1ABA A;  4MA9 A;  5KOW A;  4G0K A;  1XWG A;  1DE1 A;  4PNF A;  1F9M A;  2Z9S A;  2F8F A;  1SYR A;  1XWA A;  1YF1 A;  1MEK A;  1FAA A;  1E2Y A;  2ON7 A;  4TRX A;  5ECM B;  4IHU A;  4BVY B;  3TRX A;  1USB A;  2YN1 A;  4AF2 A;  1OAZ A;  1MDJ A;  3EE2 A;  1I5G A;  3UBK A;  4O32 A;  4MF5 A;  1AW9 A;  5H5S A;  1Q98 A;  3LYK A;  1GSQ A;  1Y25 A;  3RAZ A;  4EUY A;  1GTB A;  2YOI A;  2HYX A;  2O7K A;  1TRS A;  3HZ4 A;  3KP9 A;  3HKR A;  3C71 A;  1FOH A;  1ZCP A;  4HQS A;  4Z2U A;  3GTU A;  3P7X A;  2BMX A;  4Q5F A;  4I5Q A;  2IL3 A;  3TCO A;  3IRA A;  1XWK A;  4WEY A;  1S3R A;  1NW2 A;  2DJJ A;  1M2B A;  3GL5 A;  5J41 A;  2X8H A;  1U88 A;  4IEL A;  2P0G A;  2X8G A;  1ERW A;  1GTU A;  3Q74 A;  1HNC A;  2GS3 A;  2AAW A;  1QMV A;  3MDK A;  3M8N A;  4F03 A;  4FIW A;  1JZW A;  1T8E B;  4IN0 A;  5DQS A;  1O81 A;  2DKH A;  3ED3 A;  4IJ3 A;  2WZ9 A;  3FKF A;  4PTS A;  5KN1 A;  1A8Y A;  2LS5 A;  1GH2 A;  2HE3 A;  3O3T A;  1HNA A;  2V6K A;  2X49 A;  5IOW A;  4USS A;  1SL2 B;  5GSS A;  2GSR A;  4TW5 A;  3OR5 A;  4BL7 B;  3CYN A;  5JCG A;  4G9H A;  1VF3 A;  1K0D A;  2H0I A;  2EIQ A;  4IBP A;  1PL2 A;  1UC7 A;  2JSZ A;  1R7H A;  2GSQ A;  1C72 A;  2CVB A;  1W4V A;  2FUG 2;  3ZLP A;  1GNE A;  1ERT A;  4OCF A;  2QKE A;  1FG4 A;  4XS4 A;  2KUC A;  1YZX A;  1GSU A;  2DC5 A;  3GUR A;  1FB0 A;  3QAG A;  2DML A;  1S3A A;  2H01 A;  3FHK A;  3TUE A;  4CY8 A;  1E6B A;  1V98 A;  1Q4J A;  4KX4 A;  2N5F A;  1PFO A;  1BYE A;  2GT6 A;  2O85 A;  5IMF A;  1WPI A;  4Z7X A;  1VF1 A;  1TI1 A;  5IMD A;  4L5L A;  3VWX A;  3DWV A;  2E0Q A;  2HSM A;  1X5C A;  3GX8 A;  3FZA A;  3VFI A;  3ZIV A;  2DLX A;  1B48 A;  2DJ1 A;  1YEP A;  1ON4 A;  3FZ4 A;  2H1G A;  2XHF A;  4V2M A;  1T7P B;  2K8S A;  3R3E A;  5B7C A;  2H0H A;  3FZ5 A;  3N5O A;  1F6M C;  1T1V A;  1TKD B;  2DIZ A;  5JCW A;  5B6M A;  1VRS D;  4Z2T A;  2O89 A;  4NHW A;  4Q5N A;  4MP4 A;  2UZ8 A;  1GTI A;  3L0H A;  4YQM A;  7GSS A;  1UA5 A;  3MAK A;  2LNT A;  4G0L A;  3D4M A;  2GGT A;  3NZN A;  5IOX A;  4BPY A;  3UL3 A;  1GNW A;  4GST A;  1SD9 A;  3F8U A;  3FW2 A;  2L6D A;  1J0F A;  4FH8 A;  4N10 A;  3IXR A;  2E2M A;  1Z6M A;  1NHO A;  4G19 A;  4WET A;  2IMF A;  2VLT A;  18GS A;  2PUK C;  4WBR D;  1ZL9 A;  4EO3 A;  5ECK B;  1SKR B;  2P5Q A;  1EGO A;  2CVD A;  3DXB A;  1WJK A;  2C1Y A;  1KNG A;  2IIY A;  1Z7R A;  4RQX A;  4KSM A;  1U6T A;  4QQ7 A;  2HSH A;  3MIX A;  8GSS A;  4HZ4 A;  1M9B A;  1SK0 A;  4HI7 A;  11GS A;  3KMO A;  4V1A p;  3M9K A;  3ZZX A;  3F4T A;  5CP1 A;  4K5R A;  4L8E A;  6GSS A;  5A4V A;  4PQ1 A;  4KAE A;  2GVP A;  2REM A;  2B1L A;  3M1G A;  5IMZ A;  4GQF A;  5G5F A;  1GUM A;  2WDU A;  4JR6 A;  3BJ5 A;  3M3M A;  3S9F A;  2A4V A;  2LTK A;  3GFK A;  3TJB A;  1FW1 A;  2LRT A;  1AQV A;  3RHB A;  4MF6 A;  3CSJ A;  5BMU A;  1XW5 A;  1A0R P;  4ZB6 A;  3VWW A;  2H30 A;  3GN3 A;  2C4J A;  3ZMK A;  2YPM A;  2R3X A;  3IAS 2;  2BJX A;  2JSY A;  3LXZ A;  4HUA A;  4HQZ A;  4FYB A;  5COH A;  2CX4 A;  4PNG A;  2FD3 A;  4IP1 A;  3QAW A;  3WYW A;  4K0N A;  4EE0 A;  3D6I A;  3A5I A;  5AN1 A;  1FB6 A;  4MPG A;  2TIR A;  5ECH B;  2PGT A;  2WB9 A;  4TR1 B;  4KA0 A;  4BVX B;  4EVM A;  4KDU A;  4BIK A;  2PU9 C;  4HU7 A;  1U87 A;  2H6Y A;  3QD9 A;  2KOK A;  3IK9 A;  1TI3 A;  2CZ2 A;  2MBS A;  2H0G A;  2MMA A;  3VPT A;  3HD5 A;  4TXO B;  4NV2 A;  2PWJ A;  5FWG A;  17GS A;  2I3Y A;  1B9X C;  4TXV A;  2LNS A;  2HSY A;  4FQU A;  3GMF A;  5ABR A;  2HLS A;  3US3 A;  3TB2 A;  3UAP A;  3LXT A;  5L71 A;  1AXD A;  5H5Q A;  4MJB A;  1CQG A;  3GYK A;  2RM6 A;  5DAL B;  5CRH A;  5HQP A;  5D8I A;  4P3Y B;  3IK7 A;  5AIX A;  1GLP A;  2WS2 A;  2HZE B;  4OFM A;  1SJI A;  3BD2 A;  5D9V A;  6GSV A;  2EIR A;  2VCX A;  1N2A A;  1X9S B;  2CZ3 A;  1IYI A;  2H73 A;  3H93 A;  2LUS A;  4K2X A;  1SKW B;  4N30 A;  4V2N A;  3ZVJ A;  2X8C A;  3E9J B;  2JAD A;  3M9J A;  5DCH A;  1WIK A;  3IV4 A;  3ZYW A;  3V1W A;  2M46 A;  3DEX A;  1TOF A;  3O76 A;  2VLU A;  3GNJ A;  5ENU A;  2FWH A;  2QA1 A;  2VL2 A;  5C00 A;  2VCZ A;  4I97 A;  1ZYP A;  5IMA A;  1A23 A;  3GL3 A;  1J08 A;  3CBU A;  1O73 A;  1BG5 A;  1QUW A;  2L6C A;  2PPT A;  3TRP A;  5GAP D;  1TK0 B;  1XWB A;  2L57 A;  1GP1 A;  1R5P A;  4K5S A;  1K3O A;  2LRC A;  5B8A A;  2JU5 A;  3HDC A;  4PQI A;  3TJF A;  4EDY A;  3WT2 A;  1X9W B;  1CQH A;  1OE7 A;  3IAM 2;  1GSY A;  3VPQ A;  3F3Q A;  3DYR A;  3TKS A;  5CRD A;  4EL1 A;  1H75 A;  4I8B A;  2PMT A;  4TR1 A;  2WFC A;  9GSS A;  3P90 A;  2CAI A;  2FWE A;  1EP8 A;  3H8Q A;  1OKT A;  4OCE A;  1OC8 A;  3F0I A;  4HJM A;  1SD8 A;  4CY6 A;  5EPF A;  5FT3 A;  1TP9 A;  5AIV A;  3A2V A;  3AY8 A;  5CRW A;  1PX6 A;  4RI7 A;  3GKK A;  2XBI A;  1WOU A;  1B4P A;  3A2X A;  4TXO A;  3APO A;  4EIP A;  2H72 A;  2YJ7 A;  2YWN A;  1JHB A;  5ECN B;  3DIE A;  4OWY A;  5AGY A;  4EDZ A;  4RI6 A;  1J9B A;  1M2A A;  3D4T A;  2H8L A;  1X9M B;  3F4S A;  2VCV A;  4JRR A;  5GZZ B;  1XIY A;  2VIM A;  5DAL A;  1F3A A;  5LCZ A;  5ECS A;  3LJR A;  2XPE A;  5D9T A;  2DSA A;  3MYD A;  5G30 A;  5IMC A;  5KOX A;  3RPP A;  3IOS A;  3ERW A;  3CRU A;  3UOM A;  2MZC A;  4KUN A;  1R26 A;  3UJ1 A;  2J9H A;  1DSB A;  3FEU A;  4MAB A;  4K6X A;  4O5R A;  3A3T A;  4X0X A;  1GSS A;  5F07 A;  3ZL5 A;  1KEB A;  4YH2 A;  14GS A;  1XCC A;  3GUS A;  3IR4 A; 
#chains in the Genus database with same CATH homology
 4GSN A;  3ZVJ D;  3KXO A;  1O6J A;  3A5W A;  4WXT A;  3TRQ A;  1LU4 A;  3NOF A;  4OFN A;  2IWT A;  1LBK A;  1XVQ A;  5HFK A;  2K9F A;  3CMI A;  1XW9 A;  1GWC A;  2OAD A;  5G1L A;  2FLS A;  1M9A A;  4MDC A;  1TRU A;  4TKY A;  2YJH A;  3ZFL A;  4OD7 A;  1YDK A;  4PGT A;  5JCU A;  2WGR A;  4YQU A;  1ILO A;  4WR5 A;  4MF7 A;  3UMA A;  4EF0 A;  1YQ1 A;  2F9S A;  4PUA A;  1TU8 A;  1SL0 B;  1K3Y A;  1MD4 A;  2HFD A;  5C04 A;  2FNO A;  3GA4 A;  2GT5 A;  3IHQ A;  3ME8 A;  5HR1 A;  4J57 E;  1TXX A;  2RLI A;  1WMJ A;  2F3M A;  3HYP A;  5D96 A;  3ZIJ A;  4POL A;  1A24 A;  4NMU A;  1UVZ A;  2M80 A;  3P8W A;  3WGD A;  3BCI A;  4FO5 A;  4KDX A;  5HR0 A;  4HOJ A;  2GLR A;  3G7Y A;  1EEJ A;  3BOA A;  2R6K A;  5CO3 A;  3TJK A;  3D0Z A;  5G5E A;  5DDL A;  4KB3 A;  5IIZ A;  2X4A A;  5AIS A;  1WP0 A;  2GZP A;  2F8A A;  1ZOF A;  2YCD A;  5A4W A;  3KH7 A;  4KCE A;  2HT9 A;  5ECR B;  4F82 A;  5IO2 A;  4IP6 A;  2R0C A;  3C1R A;  4ZL8 A;  4BVY A;  2WCI A;  2P31 A;  3QPM A;  2MMO A;  2B6M A;  4NV5 A;  2H6Z A;  4ZL9 A;  1DUG A;  4NXI A;  2P5R A;  1YY7 A;  2IME A;  3ZTL A;  2DJK A;  2E2G A;  3LW9 A;  1X0R A;  4ECB A;  3Q19 A;  4MZB A;  2V41 A;  3DKS A;  3FZ9 A;  1ML6 A;  5DJL A;  5KN0 A;  3KM6 A;  2WRT A;  4MK3 A;  3DML A;  1XPV A;  2B5Y A;  3EC3 A;  5E4W A;  2O87 A;  1EOG A;  2CA8 A;  5KN3 A;  3GST A;  4RQR A;  5EVO A;  3F6F A;  3I9V 2;  4F0B A;  1OE8 A;  2CV4 A;  2OKA A;  2NPB A;  3H1N A;  3GKN A;  2CAQ A;  2VO4 A;  2L59 A;  5EY6 A;  1B8X A;  4I2T A;  4I6X A;  2KP2 A;  2VM1 A;  3FR9 A;  2B7K A;  5B8B A;  5GAN D;  3M0F A;  4X1U A;  2GZZ A;  2VAF A;  3DVW A;  1QGV A;  3FY7 A;  3W6G A;  3D21 A;  4WBJ A;  1FHE A;  2L4Q A;  1T4Y A;  3LFL A;  3FYG A;  3KTL A;  5ELA A;  1HD2 A;  2HRF A;  5BRT A;  2FA4 A;  1FO5 A;  2YWM A;  1HYU A;  3GH9 A;  16GS A;  4DEJ A;  4BL7 A;  4F0C A;  2VL2 C;  2QSI A;  3LOR A;  1GLQ A;  10GS A;  3HCZ A;  2IMI A;  1PKW A;  2ZNM A;  3U5R E;  2OE3 A;  3FR3 A;  3CSH A;  3KD0 A;  3W8S A;  4K9Z A;  4OFT A;  3I6A A;  1S3D A;  3LQ7 A;  3GKX A;  5DQY A;  5E59 A;  3EMX A;  1XVW A;  3QDN A;  4HEA 2;  3GSS A;  4XRA A;  1K0B A;  2I1U A;  2GQK A;  2JZR A;  2IMK A;  3TKS C;  4TVE A;  2H75 A;  4EKZ A;  2CT6 A;  2DBC A;  20GS A;  1K0A A;  1EV4 A;  2YV7 A;  3L4N A;  4WKW A;  2AJQ B;  4YAP A;  3UVT A;  1W89 A;  5F0G A;  3P2A A;  2JL4 A;  2LST A;  3LEF A;  5ECL B;  1ERV A;  2HRA A;  4LMW A;  2B5X A;  2QGV A;  4FYU A;  1R5A A;  1B9Y C;  4Z2R A;  3QAV A;  2GZY A;  3Q18 A;  3UIW A;  2X64 A;  4NAX A;  1BJX A;  1VF4 A;  2RM5 A;  4JU5 A;  5D9W A;  2R5G A;  2V1M A;  3TOU A;  4MPF A;  1Y6E A;  3W8J A;  4ISD A;  1K0M A;  4DSS B;  2YP6 A;  3D22 A;  1JZR A;  4TR3 A;  1PD2 1;  4GRF A;  2VM2 A;  4KE3 A;  2KHP A;  4ZBB A;  1TRW A;  5G2Z A;  4Q5Q A;  4N0V A;  3EIN A;  3KP8 A;  1Z3E A;  1K3L A;  3N9J A;  4YQV A;  1XW6 A;  1R4W A;  5D93 A;  4JED A;  5J9C A;  2VOC A;  4KH7 A;  4PUF C;  2O8V B;  3UVH A;  2R2J A;  3ZML A;  2ZCT A;  6GSY A;  4QL9 A;  1EGR A;  4E8E A;  4GTU A;  3MNG A;  3VUR A;  2VUP A;  3IDV A;  2RUF A;  3H79 A;  4KW6 A;  2PVO C;  2ZUP A;  1GSF A;  3ERG A;  1TW9 A;  3KEB A;  5DAK B;  4LL4 B;  1U3I A;  1GSE A;  5A4U A;  4F9Z A;  3DRN A;  4ZB9 A;  3PIN A;  4ECI A;  1SK2 A;  4LLR A;  1Z6N A;  3IHG A;  1TK5 B;  2LKU A;  4N0Z A;  1JLV A;  3VI5 A;  3C1S A;  3SBC A;  4ID0 A;  5A5K A;  4GLT A;  2IJY A;  2L5L A;  3BBY A;  3LG6 A;  4POB A;  2KP1 A;  3WGE A;  1AQW A;  1M99 A;  2RUE A;  2EIO A;  1SKS B;  2HXK A;  2VCW A;  4KDY A;  4ML6 A;  4IS0 A;  3QFB C;  4AJ8 A;  2B5E A;  3HZ8 A;  2LQQ A;  2JAC A;  1EV9 A;  1MTC A;  4KSO A;  3F4R A;  1JZD A;  2AUV A;  2NTO A;  1TDI A;  5ECP B;  1K0O A;  6GSX A;  2YAN A;  4GQC A;  3J7Y b;  1MDK A;  5ECI B;  4A5P A;  3ZRD A;  2C0E A;  2MBT A;  3R2Q A;  4IGJ A;  4MH3 A;  1QK8 A;  1BQ7 A;  3HJO A;  3HJM A;  2RII A;  2FA8 A;  4GCI A;  2HI7 A;  5ECO B;  4CW9 A;  3DVX A;  2JZS A;  5HFI A;  3ISO A;  4MJA A;  2G0F A;  4YAV A;  2H66 A;  4BVX A;  4DSS A;  2H1D A;  3TDG A;  1BX9 A;  2NDO A;  3PR8 A;  2YWI A;  2TRC P;  4LMV A;  3L78 A;  4XIH A;  1ZGN A;  3ERF A;  5HR2 A;  1HQO A;  1ZYN A;  1LJR A;  1ZZY A;  5CYY A;  1GUL A;  2C0G A;  1O8W A;  1TJD A;  2C80 A;  1RQM A;  5IPG A;  2A2S A;  3E0U A;  2A2P A;  4D73 B;  3KMN A;  4J56 E;  2BTO T;  4DVC A;  2AYT A;  4K2D A;  1PQN A;  2I81 A;  1EP7 A;  3RBT A;  4EIQ A;  3CXG A;  3IC8 A;  2OE1 A;  3D5J A;  4MH2 A;  4IQ1 A;  1V57 A;  3HY2 A;  1OKD A;  5DAK A;  2NVL A;  3EWL A;  3F3R A;  3KTB A;  4HDE A;  2GTU A;  2XC2 A;  4GWR A;  3F63 A;  1GRX A;  1PMT A;  2HZE A;  3CRT A;  1A2J A;  2B1K A;  2C0F A;  3UBL A;  4XS1 A;  5J3R A;  2EC4 A;  1VF2 A;  1K0C A;  5CAX A;  2HNL A;  3EPT A;  3MSZ A;  3LYP A;  3PH9 A;  2ES7 A;  4F2I A;  3EU4 A;  4PXO A;  1Z7P A;  1EOH A;  4CHS A;  1KBN A;  1PRX A;  2GQL A;  1X5D A;  5F05 A;  1AUC A;  2CX3 A;  3G7I A;  4V2L A;  1O7U A;  1YKA A;  6GST A;  3EYT A;  1SEN A;  2K8V A;  4L0U A;  2MMZ A;  4MZC A;  3EVI A;  2N5A A;  4XTS A;  3ME7 A;  4AJ7 A;  3E3E A;  1F37 A;  4X43 A;  1V58 A;  4NHZ A;  1WWJ A;  4OO4 A;  4K8M A;  1F2E A;  4ECJ A;  1NSW A;  5HR3 A;  3VLN A;  4MJE A;  6GSU A;  3UAR A;  3QFA C;  2H76 A;  2AHE A;  1XWC A;  3L9U A;  3QCP A;  5FHI A;  3KH9 A;  4ZBD A;  3HVX A;  4H86 A;  2VL9 A;  4JE1 A;  1M2D A;  2YV9 A;  1PX7 A;  5CRG A;  1AIU A;  3O6T A;  5J4U A;  5F06 A;  1IYH A;  2GDR A;  1OC9 B;  4O5U A;  3L9S A;  4ZXG A;  5D9X A;  3WD6 A;  4TR0 A;  3VWU A;  4YKF A;  1V40 A;  1G7O A;  4POM A;  3GRX A;  3KGK A;  1ACV A;  4XCS A;  4XHM A;  4MNN A;  1BED A;  1M0U A;  2FY6 A;  1OYJ A;  3DD3 A;  3U6V A;  2NBS A;  3HA9 A;  5DVB A;  4EXJ A;  4D73 A;  1GTA A;  4ZBA A;  4K7N A;  1GL8 A;  5B6N A;  3ZFB A;  2GSS A;  1GUH A;  4PX1 A;  1NM3 A;  3GH6 A;  2K6V A;  2PER A;  2R37 A;  1G6Y A;  4K1F A;  1FVK A;  2VCT A;  3HXS A;  5HFG A;  4ZIJ A;  2TRX A;  2C3N A;  2H70 A;  2I4A A;  2GQM A;  2DJ0 A;  3IBH A;  4ZL7 A;  1ERU A;  4X4J A;  2V6O A;  4WF4 A;  2VCQ A;  5DCG A;  3Q6O A;  4I2U A;  1SYX A;  4OO5 A;  1TK8 B;  1A2M A;  2WJU A;  3UEM A;  2PN8 A;  2IFQ B;  2IN3 A;  1AC1 A;  2CQ9 A;  1RK4 A;  1GUK A;  2A2R A;  1G6W A;  5IM9 A;  5EL8 A;  2C8U A;  4O5Q A;  4PQH A;  4KCA A;  4XRD A;  5INY A;  4ZB8 A;  1ST9 A;  1U3A A;  4XS6 A;  3WGX A;  4IVF A;  5D73 A;  2LJK A;  4BWQ A;  3KIJ A;  5JWO B;  1YEX A;  3HHV A;  1SL1 B;  2R0P A;  4KGI A;  1S3C A;  5H5R A;  3GKM A;  2ALB A;  5IPH A;  5G31 A;  2YZU A;  3QOU A;  4HZ2 A;  1SK1 A;  3GX0 A;  1A0F A;  1NHY A;  5LD0 A;  4WF5 A;  2WUL A;  4K0G A;  12GS A;  3IA1 A;  1V2A A;  4J2F A;  2B3S A;  5DBQ A;  3CTG A;  1JLW A;  4TN8 A;  19GS A;  1Z9H A;  4MMM A;  1G0T A;  4L0W A;  2V2G A;  1PN9 A;  5CNW A;  5JWQ B;  2AV4 A;  1OVN A;  3H4K A;  2XPD A;  4AJ6 A;  22GS A;  2L4C A;  2OE0 A;  2PBJ A;  4ICY A;  5ECQ B;  4LA1 A;  4OMV A;  1WRY A;  2N5B A;  4ML1 A;  4HS1 A;  2OA7 A;  3I43 A;  4MLY A;  1OC9 A;  1JZO A;  1EEM A;  1MDI A;  4JZQ A;  3DGQ A;  2C3Q A;  2A4H A;  3MWH A;  1YJ6 A;  2J23 A;  2D2Z A;  3PPU A;  1DBY A;  3TKR A;  2LJA A;  3WT1 A;  5ID2 B;  3G7J A;  4CDO A;  4O92 A;  2HZF A;  3C8E A;  5ELG A;  4DSR A;  1THX A;  2R4V A;  2C3T A;  3RPN A;  2CVK A;  1UN2 A;  1SU9 A;  1EZK A;  1TTZ A;  1PA3 A;  1M7T A;  3F6D A;  1ZYE A;  5KN2 A;  2LEG A;  3APQ A;  4MZW A;  2I9H A;  3IE3 A;  4G0I A;  3FMW A;  4E8H A;  4HU9 A;  5LNK e;  2HRK A;  3ZRE A;  1I9D A;  1A2L A;  4JBB A;  2K18 A;  3K8N A;  2H71 A;  4ILF A;  2H19 A;  1EWX A;  1ZYQ B;  1KTE A;  5KEJ A;  3G9B A;  1URM A;  2PVQ A;  3PGT A;  4G2E A;  5G1K A;  3TJG A;  5GST A;  2DMM A;  4GF0 A;  3RDW A;  4YKG A;  1FOV A;  2DJ2 A;  2IFQ A;  1GSD A;  1SJZ A;  4Q5R A;  3GV1 A;  4KF9 A;  2OJL A;  1YF0 A;  1ZMA A;  4N11 A;  3TGZ A;  3C73 A;  1PN0 A;  4NPB A;  2H74 A;  4ECC A;  2VD1 A;  3NIV A;  1O8X A;  2FCH A;  2DKI A;  3IC4 A;  3APS A;  3F9U A;  2FWG A;  3EU3 A;  4AGS A;  1AQX A;  5CRE A;  2VD0 A;  1HNB A;  1RW1 A;  1THO A;  3SWL A;  2H6X A;  2JZT A;  2H1B A;  5IQY A;  1T4Z A;  4RUV A;  4BWS A;  3TOT A;  3LSZ A;  1PKZ A;  4IQA A;  2LQO A;  1XOA A;  4JR4 A;  1TU7 A;  2ON5 A;  1K0N A;  3CTF A;  1QXH A;  1T00 A;  2QA2 A;  3VI7 A;  3QR6 A;  2LV3 A;  4GXZ A;  2C0D A;  3FR6 A;  1XZO A;  1G7E A;  1Z5Y E;  4O7H A;  1X5E A;  3EMP A;  4V1A g;  2YZH A;  3A2W A;  5IO0 A;  4HJ2 A;  1VGL A;  2FGX A;  1OC3 A;  3HJP A;  4DSQ A;  4POK A;  4QL7 A;  2OBK A;  4ACS A;  5ID2 A;  3FK8 A;  5JWR B;  4LL1 B;  1BAY A;  1SJ6 A;  4L5O A;  2HRN A;  1V9W A;  3RHC A;  2G2Q A;  3J7Y k;  4MJC A;  3GTU B;  3VK9 A;  2E7P A;  4TOP A;  4TR4 A;  2M72 A;  5J9B A;  4ZIL A;  2GST A;  2VL3 A;  3C7M A;  3BCK A;  3KCM A;  4BA7 A;  2L5O A;  3CSI A;  2AB6 A;  1FVJ A;  2KLX A;  2R0G A;  3HVV A;  3KZQ A;  3VWV A;  2XBQ A;  4K7O A;  3JCM L;  2FHE A;  13GS A;  2IMD A;  3GIX A;  1XFL A;  2QC7 A;  1PGT A;  3HVS A;  1H4O A;  4PUR A;  2VLV A;  1DE2 A;  2DJ3 A;  1MD3 A;  4G10 A;  1F3B A;  3LGC A;  2DIY A;  2LJR A;  1XOB A;  3L9V A;  4WR4 A;  1N8J A;  1PL1 A;  4EC0 A;  5IMV A;  1WE0 A;  3TKQ A;  2LRN A;  2X99 A;  2OAC A;  2MMN A;  3EUR A;  1QQ2 A;  5J5N A;  1YKC A;  3KJY A;  4IKH A;  3TKS E;  3IPZ A;  1T3B A;  1XXU A;  3LWA A;  2B7J A;  1JFU A;  1TRV A;  5DJM A;  4K7I A;  3QMX A;  4KND A;  3TKP A;  2H1A A;  6GSW A;  2OBI A;  4IW9 A;  1A8L A;  3I69 A;  1PSQ A;  2V32 A;  2MYG A;  4GSS A;  2YNX A;  4MCU A;  4ULX A;  5F8B A;  4NWY A;  3FRC A;  1XBS A;  2F51 A;  3GHA A;  2FWF A;  4FYC A;  3TJJ A;  1O85 A;  2IPA A;  1AAZ A;  2YWO A;  3ZIT A;  4XS4 B;  4IJI A;  1B4Q A;  1QFN A;  1ABA A;  4MA9 A;  5KOW A;  4G0K A;  1XWG A;  1DE1 A;  4PNF A;  1F9M A;  2Z9S A;  2F8F A;  1SYR A;  1XWA A;  1YF1 A;  1MEK A;  1FAA A;  1E2Y A;  2ON7 A;  4TRX A;  5ECM B;  4IHU A;  4BVY B;  3TRX A;  1USB A;  2YN1 A;  4AF2 A;  1OAZ A;  1MDJ A;  3EE2 A;  1I5G A;  3UBK A;  4O32 A;  4MF5 A;  1AW9 A;  5H5S A;  1Q98 A;  3LYK A;  1GSQ A;  1Y25 A;  3RAZ A;  4EUY A;  1GTB A;  2YOI A;  2HYX A;  2O7K A;  1TRS A;  3HZ4 A;  3KP9 A;  3HKR A;  3C71 A;  1FOH A;  1ZCP A;  4HQS A;  4Z2U A;  3GTU A;  3P7X A;  2BMX A;  4Q5F A;  4I5Q A;  2IL3 A;  3TCO A;  3IRA A;  1XWK A;  4WEY A;  1NW2 A;  2DJJ A;  1M2B A;  3GL5 A;  5J41 A;  2X8H A;  1U88 A;  4IEL A;  2P0G A;  2X8G A;  1ERW A;  1GTU A;  3Q74 A;  1HNC A;  2GS3 A;  2AAW A;  1QMV A;  3MDK A;  3M8N A;  4F03 A;  4FIW A;  1JZW A;  1T8E B;  4IN0 A;  5DQS A;  1O81 A;  2DKH A;  3ED3 A;  4IJ3 A;  2WZ9 A;  3FKF A;  4PTS A;  5KN1 A;  1A8Y A;  2LS5 A;  1GH2 A;  2HE3 A;  3O3T A;  1HNA A;  2V6K A;  2X49 A;  5IOW A;  4USS A;  1SL2 B;  5GSS A;  2GSR A;  4TW5 A;  3OR5 A;  4BL7 B;  3CYN A;  5JCG A;  4G9H A;  1VF3 A;  1K0D A;  2H0I A;  2EIQ A;  4IBP A;  1PL2 A;  1UC7 A;  2JSZ A;  1R7H A;  2GSQ A;  1C72 A;  2CVB A;  1W4V A;  2FUG 2;  3ZLP A;  1GNE A;  1ERT A;  4OCF A;  2QKE A;  1FG4 A;  4XS4 A;  2KUC A;  1YZX A;  1GSU A;  2DC5 A;  3GUR A;  1FB0 A;  3QAG A;  2DML A;  1S3A A;  2H01 A;  3FHK A;  3TUE A;  4CY8 A;  1E6B A;  1V98 A;  1Q4J A;  4KX4 A;  2N5F A;  1BYE A;  2GT6 A;  2O85 A;  5IMF A;  1WPI A;  4Z7X A;  1VF1 A;  1TI1 A;  5IMD A;  4L5L A;  3VWX A;  3DWV A;  2E0Q A;  2HSM A;  1X5C A;  3GX8 A;  3FZA A;  3VFI A;  3ZIV A;  2DLX A;  1B48 A;  2DJ1 A;  1YEP A;  1ON4 A;  3FZ4 A;  2H1G A;  2XHF A;  4V2M A;  1T7P B;  2K8S A;  3R3E A;  5B7C A;  2H0H A;  3FZ5 A;  3N5O A;  1F6M C;  1T1V A;  1TKD B;  2DIZ A;  5JCW A;  5B6M A;  1VRS D;  4Z2T A;  2O89 A;  4NHW A;  4Q5N A;  4MP4 A;  2UZ8 A;  1GTI A;  3L0H A;  4YQM A;  7GSS A;  1UA5 A;  3MAK A;  2LNT A;  4G0L A;  3D4M A;  2GGT A;  3NZN A;  5IOX A;  4BPY A;  3UL3 A;  1GNW A;  4GST A;  1SD9 A;  3F8U A;  3FW2 A;  2L6D A;  1J0F A;  4FH8 A;  4N10 A;  3IXR A;  2E2M A;  1Z6M A;  1NHO A;  4G19 A;  4WET A;  2IMF A;  2VLT A;  18GS A;  2PUK C;  4WBR D;  1ZL9 A;  4EO3 A;  5ECK B;  1SKR B;  2P5Q A;  1EGO A;  2CVD A;  3DXB A;  1WJK A;  2C1Y A;  1KNG A;  2IIY A;  1Z7R A;  4RQX A;  4KSM A;  1U6T A;  4QQ7 A;  2HSH A;  3MIX A;  8GSS A;  4HZ4 A;  1M9B A;  1SK0 A;  4HI7 A;  11GS A;  3KMO A;  4V1A p;  3M9K A;  3ZZX A;  3F4T A;  5CP1 A;  4K5R A;  4L8E A;  6GSS A;  5A4V A;  4PQ1 A;  4KAE A;  2GVP A;  2REM A;  2B1L A;  3M1G A;  5IMZ A;  4GQF A;  5G5F A;  1GUM A;  2WDU A;  4JR6 A;  3BJ5 A;  3M3M A;  3S9F A;  2A4V A;  2LTK A;  3GFK A;  3TJB A;  1FW1 A;  2LRT A;  1AQV A;  3RHB A;  4MF6 A;  3CSJ A;  5BMU A;  1XW5 A;  1A0R P;  4ZB6 A;  3VWW A;  2H30 A;  3GN3 A;  2C4J A;  3ZMK A;  2YPM A;  2R3X A;  3IAS 2;  2BJX A;  2JSY A;  3LXZ A;  4HUA A;  4HQZ A;  4FYB A;  5COH A;  2CX4 A;  4PNG A;  2FD3 A;  4IP1 A;  3QAW A;  3WYW A;  4K0N A;  4EE0 A;  3D6I A;  3A5I A;  5AN1 A;  1FB6 A;  4MPG A;  2TIR A;  5ECH B;  2PGT A;  2WB9 A;  4TR1 B;  4KA0 A;  4BVX B;  4EVM A;  4KDU A;  2PU9 C;  4HU7 A;  1U87 A;  2H6Y A;  3QD9 A;  2KOK A;  3IK9 A;  1TI3 A;  2CZ2 A;  2MBS A;  2H0G A;  2MMA A;  3VPT A;  3HD5 A;  4TXO B;  4NV2 A;  2PWJ A;  5FWG A;  17GS A;  2I3Y A;  1B9X C;  4TXV A;  2LNS A;  2HSY A;  4FQU A;  3GMF A;  5ABR A;  2HLS A;  3US3 A;  3TB2 A;  3UAP A;  3LXT A;  5L71 A;  1AXD A;  5H5Q A;  4MJB A;  1CQG A;  3GYK A;  2RM6 A;  5DAL B;  5CRH A;  5HQP A;  5D8I A;  4P3Y B;  3IK7 A;  5AIX A;  1GLP A;  2WS2 A;  2HZE B;  4OFM A;  1SJI A;  3BD2 A;  5D9V A;  6GSV A;  2EIR A;  2VCX A;  1N2A A;  1X9S B;  2CZ3 A;  1IYI A;  2H73 A;  3H93 A;  2LUS A;  4K2X A;  1SKW B;  4N30 A;  4V2N A;  3ZVJ A;  2X8C A;  3E9J B;  2JAD A;  3M9J A;  5DCH A;  1WIK A;  3IV4 A;  3ZYW A;  3V1W A;  2M46 A;  3DEX A;  1TOF A;  3O76 A;  2VLU A;  3GNJ A;  5ENU A;  2FWH A;  2QA1 A;  2VL2 A;  5C00 A;  2VCZ A;  4I97 A;  1ZYP A;  5IMA A;  1A23 A;  3GL3 A;  1J08 A;  3CBU A;  1O73 A;  1BG5 A;  1QUW A;  2L6C A;  2PPT A;  3TRP A;  5GAP D;  1TK0 B;  1XWB A;  2L57 A;  1GP1 A;  1R5P A;  4K5S A;  1K3O A;  2LRC A;  5B8A A;  2JU5 A;  3HDC A;  4PQI A;  3TJF A;  4EDY A;  3WT2 A;  1X9W B;  1CQH A;  1OE7 A;  3IAM 2;  1GSY A;  3VPQ A;  3F3Q A;  3DYR A;  3TKS A;  5CRD A;  4EL1 A;  1H75 A;  4I8B A;  2PMT A;  4TR1 A;  2WFC A;  9GSS A;  3P90 A;  2CAI A;  2FWE A;  1EP8 A;  3H8Q A;  1OKT A;  4OCE A;  1OC8 A;  3F0I A;  4HJM A;  1SD8 A;  4CY6 A;  5EPF A;  5FT3 A;  1TP9 A;  5AIV A;  3A2V A;  3AY8 A;  5CRW A;  1PX6 A;  4RI7 A;  3GKK A;  2XBI A;  1WOU A;  1B4P A;  3A2X A;  4TXO A;  3APO A;  4EIP A;  2H72 A;  2YJ7 A;  2YWN A;  1JHB A;  5ECN B;  3DIE A;  4OWY A;  5AGY A;  4EDZ A;  4RI6 A;  1J9B A;  1M2A A;  3D4T A;  2H8L A;  1X9M B;  3F4S A;  2VCV A;  4JRR A;  5GZZ B;  1XIY A;  2VIM A;  5DAL A;  1F3A A;  5LCZ A;  5ECS A;  3LJR A;  2XPE A;  5D9T A;  2DSA A;  3MYD A;  5G30 A;  5IMC A;  5KOX A;  3RPP A;  3IOS A;  3ERW A;  3CRU A;  3UOM A;  2MZC A;  4KUN A;  1R26 A;  3UJ1 A;  2J9H A;  1DSB A;  3FEU A;  4MAB A;  4K6X A;  4O5R A;  3A3T A;  4X0X A;  1GSS A;  5F07 A;  3ZL5 A;  1KEB A;  4YH2 A;  14GS A;  1XCC A;  3GUS A;  3IR4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...