2P31A

Crystal structure of human glutathione peroxidase 7
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
155
structure length
155
Chain Sequence
QDFYDFKAVNIRGKLVSLEKYRGSVSLVVNVASECGFTDQHYRALQQLQRDLGPHHFNVLAFPCNQFGQQEPDSNKEIESFARRTYSVSFPMFSKIAVTGTGAHPAFKYLAQTSGKEPTWNFWKYLVAPDGKVVGAWDPTVSVEEVRPQITALVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Glutathione peroxidase 7
publication title Crystal structure of human glutathione peroxidase 7
rcsb
source organism Homo sapiens
total genus 50
structure length 155
sequence length 155
chains with identical sequence B
ec nomenclature ec 1.11.1.9: Glutathione peroxidase.
pdb deposition date 2007-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00255 GSHPx Glutathione peroxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2p31A00
3IHQA 1DE1A 3TJFA 2RUFA 3RBTA 1UN2A 3APQA 2LJAA 1EWXA 4G9HA 2EIQA 3CSIA 1KBNA 3L9VA 2OE3A 4KSOA 1K0BA 4MF7A 1TK5B 2LJRA 3LEFA 4IN0A 1X5CA 2ON7A 4N11A 2C8UA 2FLSA 3IRAA 2HE3A 1YF1A 4Q5RA 2OBIA 2ON5A 2WULA 3PR8A 3TKSA 4PNFA 1VF1A 1QUWA 4Q5NA 2FWGA 4HOJA 1BQ7A 3GA4A 2FY6A 2H6ZA 4TVEA 4KDUA 4FH8A 4EVMA 2PBJA 1V9WA 1GTIA 2R37A 2VCQA 3PGTA 1PKZA 2O7KA 5B6MA 2C0GA 3F3QA 2L57A 3EURA 2O85A 1WP0A 3TJKA 1OC8A 5D96A 2RM6A 3KP9A 2IMFA 1X5EA 1XXUA 3A2XA 1HNCA 2OE1A 2V6KA 1TK8B 5J4UA 3CSHA 2PMTA 2R2JA 2YPMA 2MYGA 4XRAA 1B9XC 1SU9A 5F07A 5C00A 5HR3A 3HVXA 1DBYA 1NHYA 1OE8A 5DQYA 3O3TA 3RDWA 1H75A 2PUKC 9GSSA 4BVXA 1A8YA 1AAZA 2B3SA 4V1Ap 1AW9A 3TRQA 18GSA 3Q19A 1GSQA 2P0GA 2MMAA 2G2QA 22GSA 5HFIA 2LRNA 3TKSC 4HZ4A 3RPNA 3F6DA 5F06A 5FT3A 1Y25A 3CSJA 4OFMA 3Q6OA 1M2BA 4JBBA 3VI7A 2FA4A 3MAKA 1ABAA 2CX3A 1GLPA 3US3A 2TRCP 1YJ6A 1ZMAA 4KDXA 3DKSA 1XWAA 2QKEA 2C3TA 4IELA 2GSRA 4JE1A 4BPYA 4PX1A 1XWCA 1Z6MA 5AISA 4IJ3A 1C72A 4KW6A 5B6NA 3TRPA 2VOCA 3UBKA 6GSXA 5F8BA 3A5WA 4PQ1A 2VL9A 1V57A 1GNEA 3W6GA 4E8HA 1EP7A 1LJRA 2JSZA 3TKQA 3VPQA 2TIRA 4JRRA 4MDCA 2IMKA 2VL3A 2C0DA 5EPFA 3VPTA 5D9TA 3BOAA 5CRDA 1BJXA 3DD3A 1QQ2A 4TR0A 4GTUA 4HJ2A 4MP4A 3GSSA 5J5NA 4GSSA 1DE2A 3IE3A 1Q98A 2VLUA 2H1AA 1TRVA 4QL7A 1GTUA 2PU9C 2X99A 4J57E 1F6MC 4OD7A 1SJ6A 4YQUA 4F2IA 1B9YC 2H6YA 3BD2A 3UARA 2IL3A 2V6OA 5DDLA 2L5OA 2VLTA 2IWTA 4WEYA 1K0AA 5IMZA 2NPBA 1M2DA 6GSYA 1G6WA 3C1RA 3FY7A 1WWJA 2PVQA 2OADA 2K6VA 1V58A 1SKSB 4TRXA 4WBRD 6GSSA 3ZMLA 1AUCA 2DBCA 2HSHA 2YP6A 1WPIA 2OKAA 2HLSA 4KH7A 4XS4A 3KTBA 3C1SA 3QFBC 4OO4A 2RIIA 4KB3A 1TXXA 2IPAA 2JZSA 3DIEA 2YJHA 2MMZA 2OJLA 2HXKA 4F9ZA 5HR1A 1SJIA 4I97A 4MJEA 1F9MA 1FG4A 2C0FA 2N5AA 4I2UA 4WBJA 5A4WA 4BVYA 3GUSA 2LS5A 2I3YA 1PGTA 2CAQA 2LRCA 3HVSA 1SENA 3GIXA 4BWQA 1S3AA 5G30A 1OYJA 1WOUA 1U3AA 2DMMA 3HYPA 2B7JA 1M2AA 4IKHA 3QOUA 2YCDA 1PX7A 4ACSA 3IC4A 1E6BA 1OKDA 4J2FA 3LG6A 1OE7A 3EWLA 3IR4A 4LMVA 1T1VA 1FB0A 4G2EA 3L78A 3D4TA 1U6TA 3EU3A 3I69A 4ML1A 2VCTA 5G31A 1GSUA 3J7Yk 2L6DA 8GSSA 1THOA 2IFQB 2IMDA 4KDYA 5DALB 2DSAA 2HZFA 2XHFA 4X1UA 2H1GA 4RUVA 3O76A 1K0OA 3LFLA 2B5EA 4K8MA 1BG5A 2HRFA 5ECMB 1XW9A 2FCHA 1PL1A 2LQQA 4O5RA 5IOWA 4YQMA 2WRTA 3DMLA 5IPGA 3KMNA 1AIUA 2B1KA 1WRYA 4EDZA 4IW9A 12GSA 4LL1B 4GQCA 4FYUA 4TN8A 4ZL9A 1PQNA 4CDOA 3BBYA 1AQXA 4GRFA 2H70A 1XIYA 3AY8A 4LLRA 1OAZA 3ZIJA 1J9BA 1YKCA 3ZFLA 2G0FA 1GL8A 5GZZB 1AXDA 2AJQB 5DBQA 4NV2A 2YOIA 2GGTA 1PA3A 2WZ9A 2L4QA 4ZBBA 2CVDA 1TRSA 2EIOA 5FHIA 5GSSA 2YN1A 1OC3A 2GT6A 5DCHA 4O7HA 2IMIA 2F8FA 1U88A 2VCVA 5IOXA 4XCSA 5ECHB 5ECRB 1EEMA 3K8NA 1ERUA 1N2AA 2DJ1A 2IFQA 1HQOA 4GSTA 2GZZA 2DIYA 4Z7XA 3GRXA 5DALA 3Q74A 1YKAA 5A5KA 1W4VA 3QR6A 2GLRA 1Z7RA 1R5AA 3O6TA 3KM6A 4MJAA 2ZCTA 5LNKe 4LL4B 5HFGA 1GH2A 4JR6A 20GSA 2JACA 2FWHA 3LGCA 2PVOC 2CVKA 1X0RA 2KP1A 4RI6A 2O89A 1Z9HA 2CT6A 3KEBA 3GTUB 3P90A 5ID2B 2HNLA 3M0FA 4PQHA 4GF0A 1A2MA 3VFIA 4ZB6A 3FR3A 3FW2A 4GQFA 5B8AA 2GQMA 3F9UA 2OBKA 3CRUA 4CW9A 2OE0A 2C4JA 2D2ZA 4ZB9A 2PGTA 3A2WA 5ABRA 14GSA 1MDKA 3MWHA 3IA1A 2GZYA 2C1YA 1X9SB 2B7KA 3HJMA 4RI7A 5HQPA 1TKDB 2RM5A 4NHZA 3FR9A 3VLNA 1GNWA 1SYXA 5B7CA 4ECBA 1I5GA 1VF2A 2I81A 1W89A 3LQ7A 1B8XA 4KAEA 3TJGA 3BCKA 1O6JA 3DWVA 3KMOA 1Z3EA 5DQSA 2XC2A 4KX4A 2LV3A 3HVVA 3LYPA 5GSTA 4KNDA 2H71A 5G2ZA 3EINA 3GTUA 5ID2A 3P2AA 3TKPA 3GSTA 3HHVA 2E0QA 4ZL8A 2GQKA 4AJ6A 4PURA 2H1BA 1TI3A 1XOBA 1IYIA 2C0EA 2LRTA 3G7IA 4Q5FA 1F37A 5ECQB 2ZNMA 3IK9A 5CAXA 2VUPA 6GSWA 1EV9A 2AB6A 4F82A 4V2LA 2QC7A 4PUFC 4PXOA 2YV7A 3ZZXA 1UC7A 2H1DA 1PMTA 2NDOA 1ST9A 2IJYA 1WIKA 1UVZA 2HFDA 1ON4A 4KGIA 1GP1A 2CVBA 2GVPA 2VCWA 4O32A 4FYCA 1EV4A 2DJJA 1YY7A 4EDYA 2JL4A 3PINA 1EEJA 3HKRA 4G19A 4N30A 1PKWA 2H8LA 3U5RE 1GSDA 1I9DA 1ML6A 3TB2A 1SL2B 5CRWA 1O7UA 1EGRA 4TW5A 1T00A 2K9FA 2GS3A 2YWNA 3DXBA 1ILOA 1TJDA 3WGXA 4I6XA 1QFNA 1G0TA 4XTSA 3IV4A 3RHBA 4E8EA 2MBTA 3H1NA 5J9BA 3F4SA 3GX8A 4EKZA 4YAVA 3IOSA 4BA7A 3R2QA 3ZLPA 4AF2A 3LYKA 1O85A 4EE0A 4L5OA 1F2EA 5DVBA 2EC4A 3KH7A 3KH9A 1TRUA 3NIVA 3QDNA 3GH6A 3DVWA 3M3MA 5COHA 3H79A 3UVTA 5KN0A 1ACVA 2F9SA 4QQ7A 2H72A 4KA0A 1MEKA 4Q5QA 3ZYWA 1A0FA 1G7EA 1A24A 4NAXA 1TDIA 3WGEA 3L4NA 1J08A 3HZ4A 3GN3A 3F8UA 2KHPA 4XS4B 4POMA 4K7IA 2YZUA 3CXGA 3ERFA 4IGJA 4EF0A 4IVFA 4TXVA 2P5QA 3TCOA 3DVXA 4NHWA 3FHKA 1QK8A 1X9MB 3L9SA 4K7OA 4MCUA 2KUCA 3FZAA 1GUMA 2VD1A 3QMXA 1XZOA 2H76A 1TU8A 4H86A 2ALBA 5D9VA 4ZBAA 1NW2A 5ELAA 2IN3A 1YEXA 4OMVA 1SD8A 1JHBA 3KXOA 4P3YB 3P7XA 5EY6A 1B4PA 4BL7A 1ZYEA 1E2YA 1Y6EA 2GDRA 1AC1A 3IK7A 2JADA 2XBQA 4X0XA 5D73A 2C80A 2L6CA 3F63A 2JZTA 4I8BA 1NHOA 2VD0A 3GH9A 1MD3A 3WD6A 4DEJA 4MA9A 2RUEA 3ZVJA 4D73A 1WE0A 3TJBA 1PN9A 3LJRA 3D5JA 1YQ1A 1HNAA 2V2GA 3QD9A 2IIYA 2AYTA 1XBSA 4HI7A 2WCIA 3ZIVA 1WMJA 4I2TA 1OVNA 3QAGA 3EVIA 2VM2A 5JCWA 5J9CA 2LNSA 3S9FA 1JZOA 2X64A 3FR6A 4POBA 5FWGA 3V1WA 3EU4A 4ZL7A 2X8GA 2FNOA 3GV1A 5D9WA 1B48A 1SYRA 4NPBA 5KEJA 4ID0A 1K3OA 3TKSE 1NSWA 1URMA 4XS6A 1THXA 1FO5A 3SWLA 3UOMA 2XBIA 1GUHA 3I9V2 3IPZA 1MTCA 4GSNA 1PRXA 5ENUA 1M7TA 3ZFBA 4L8EA 2I1UA 2YWIA 5CP1A 4KCEA 3GX0A 3EMPA 1QGVA 1GLQA 4N10A 3ZVJD 5EL8A 4IBPA 3FRCA 4JEDA 3GKNA 3WYWA 4WKWA 3G7YA 3F3RA 1HYUA 1GSSA 1NM3A 1ZYQB 2F8AA 2H0HA 5DJMA 2WGRA 4XRDA 5GAND 3LXZA 1GSEA 2H74A 5DAKB 1J0FA 1ZL9A 2PN8A 1VF4A 1HNBA 4F03A 4DSRA 5IIZA 3RAZA 4ISDA 1LBKA 3KD0A 4N0VA 2OACA 2J23A 13GSA 2MMOA 4IHUA 1RQMA 3ZREA 2LTKA 2WFCA 1BAYA 2XPDA 2GSTA 4K0NA 4TXOB 5LCZA 2DJ2A 4AJ8A 2HRNA 1T4ZA 3LXTA 2O8VB 3GHAA 3ISOA 2VAFA 3EC3A 3M1GA 1ZCPA 2HZEB 1U87A 2V41A 1DSBA 4O92A 4V1Ag 2MMNA 1XVWA 3KCMA 2YANA 5INYA 3A3TA 1ERVA 1YF0A 4EL1A 4XS1A 1YZXA 5J41A 2DJ3A 4K0GA 1SK0A 2H66A 1M9AA 3TKRA 3HDCA 1TP9A 1JFUA 1GTAA 3I6AA 17GSA 1X5DA 2A4VA 2DIZA 4WR4A 4ZILA 1R7HA 3F4TA 3EYTA 3LWAA 2AHEA 3IXRA 1ZZYA 4WXTA 4NWYA 1U3IA 1Z7PA 2VM1A 4KCAA 5DAKA 1N8JA 4TR1B 2GQLA 5C04A 3HZ8A 5DCGA 1PX6A 2VL2C 3MDKA 3A2VA 7GSSA 1CQHA 3DEXA 3IAM2 1XWGA 3CTGA 5H5SA 3GURA 1OC9B 4I5QA 1XFLA 3D6IA 4EUYA 1S3CA 3WGDA 3WT1A 1HD2A 2YZHA 1VF3A 1O8WA 3E9JB 4IJIA 3VWXA 3M9KA 5IMCA 2H0GA 2HI7A 3DGQA 2N5BA 4TXOA 2VO4A 1V98A 5KN1A 3MNGA 2I9HA 5A4VA 2HZEA 3FZ9A 2DMLA 1BEDA 4DSSB 3ZITA 5D93A 3HXSA 6GSVA 1RK4A 4NMUA 16GSA 3RHCA 2EIRA 2PPTA 5ECPB 2M46A 2JZRA 3KIJA 2FWFA 1K3LA 3APOA 5CREA 4MPGA 1R26A 2J9HA 2CA8A 5IO2A 3E3EA 1AQWA 2PERA 3TJJA 5D9XA 4KSMA 3HD5A 2TRXA 2LQOA 3KTLA 3GL3A 10GSA 1OKTA 2QGVA 3CMIA 4ZXGA 1XVQA 3L0HA 4IQAA 1Z5YE 5AN1A 4TR1A 1JZWA 1F3AA 4KUNA 1A23A 5IQYA 1FW1A 3HA9A 4FYBA 2VIMA 2CZ2A 3VK9A 1OC9A 3FEUA 3C71A 3HY2A 1XPVA 4ULXA 2O87A 2WJUA 3IAS2 5ECKB 5B8BA 3UBLA 1M9BA 1LU4A 2R6KA 2C3NA 3FZ4A 4AGSA 3L9UA 2KOKA 1EOGA 2M72A 4LA1A 1ERTA 3C8EA 3DRNA 4DSSA 4K9ZA 1SD9A 4MZBA 3GL5A 2LUSA 4K6XA 2GSQA 11GSA 4ILFA 3D0ZA 2AV4A 5JWOB 4IP1A 1GTBA 1H4OA 5AIVA 2E2MA 2K8SA 1FHEA 1K0NA 5E59A 3CRTA 5L71A 3CTFA 4TR3A 3ME8A 5ELGA 4BWSA 3GFKA 2FWEA 4HZ2A 4WF4A 3UJ1A 1T4YA 3Q18A 1SL1B 1QXHA 1EOHA 5JCUA 3GMFA 4K2DA 1GSYA 1ERWA 1XW6A 1YDKA 2K8VA 3OR5A 1R4WA 3RPPA 1SL0B 1O8XA 5G1LA 3C73A 4J56E 4MZWA 2YJ7A 3LSZA 5H5QA 4ML6A 2BMXA 2H0IA 2KLXA 4K7NA 2WDUA 4V2NA 4WETA 4ZBDA 5HR2A 1S3DA 4N0ZA 2FGXA 2WB9A 1EGOA 3ERGA 1T3BA 3PH9A 2F3MA 1KTEA 2CV4A 2X8CA 3P8WA 4DSQA 5A4UA 5EVOA 2IMEA 5IM9A 1SK2A 4KE3A 2YWOA 3J7Yb 2LJKA 2VCZA 5JWQB 4MK3A 5JWRB 3ZL5A 3EE2A 1FVKA 4K1FA 1UA5A 2E7PA 3D22A 1X9WB 3N5OA 4G10A 1ZOFA 2HYXA 3TUEA 3GKXA 2DC5A 1A0RP 1PSQA 3H8QA 4D73B 1MDIA 4MZCA 3QAWA 4L5LA 4RQRA 2P5RA 5CRGA 2M80A 2DJ0A 3ZTLA 2ES7A 5ECLB 2JSYA 4XHMA 1JZDA 3QCPA 3FZ5A 3TDGA 5G5FA 3ED3A 4TKYA 2A2SA 2H30A 1BX9A 3ME7A 4NXIA 1SJZA 2LEGA 1MDJA 3UVHA 1FOVA 1XW5A 5G5EA 3NOFA 2R3XA 5D8IA 2LNTA 1IYHA 1EP8A 3FYGA 4GWRA 2YWMA 1Z6NA 2BJXA 2H19A 3CBUA 1M99A 4XIHA 3TRXA 2N5FA 4ZIJA 4TR4A 4PQIA 2A2RA 4AJ7A 2VCXA 2E2GA 3W8SA 3HJPA 1O73A 3QFAC 5CNWA 1M0UA 4ECCA 2WS2A 2FA8A 2CX4A 2I4AA 1TU7A 4OFNA 2QSIA 5F0GA 4GCIA 3IDVA 4MF5A 4DVCA 5IMDA 3D21A 2DJKA 2HT9A 1CQGA 4MH3A 1SKRB 1A2LA 3LORA 4POLA 3CYNA 3KZQA 3F0IA 3MSZA 2GSSA 4HU9A 1USBA 2NVLA 2R5GA 1AQVA 3KP8A 3WT2A 2REMA 3UMAA 5IMVA 3FKFA 1SK1A 1B4QA 5E4WA 2AUVA 1K3YA 2CZ3A 5ECOB 3M8NA 3H93A 4YQVA 2R4VA 1FAAA 1FVJA 4RQXA 1TOFA 2XPEA 2ZUPA 2GTUA 4L0WA 4HDEA 2HSYA 4ECIA 3JCML 5IPHA 4HJMA 4ECJA 4MJCA 5HFKA 1R5PA 1PD21 4L0UA 2AAWA 2PWJA 2H73A 4LMWA 5GAPD 1PL2A 1TRWA 2B5XA 4OCEA 4MABA 2GT5A 4OO5A 3IBHA 2MZCA 5AIXA 2H6XA 3G9BA 5JCGA 4OCFA 4OFTA 4MJBA 3BCIA 3N9JA 1JZRA 4OWYA 3UIWA 4EXJA 5F05A 2H01A 1TI1A 5KN3A 1GULA 5AGYA 2LKUA 3BJ5A 2NTOA 1T7PB 1FB6A 2VL2A 3GYKA 1XOAA 4WF5A 4JR4A 5H5RA 3SBCA 6GSTA 1KEBA 2NBSA 4X43A 4IS0A 1G7OA 5LD0A 3C7MA 19GSA 3HJOA 1F3BA 3TOUA 3KJYA 3D4MA 2DLXA 5ECNB 4HEA2 5CO3A 1GSFA 3APSA 2V32A 3E0UA 4FO5A 3VWUA 4F0CA 4POKA 1YEPA 1ZGNA 2K18A 3M9JA 1Q4JA 4HQSA 3VI5A 3F6FA 1V2AA 4IQ1A 2RLIA 4HU7A 3UAPA 6GSUA 3GKMA 2P31A 2C3QA 3GNJA 4FIWA 2X8HA 2YV9A 3I43A 1JLVA 4QL9A 4HQZA 5J3RA 1T8EB 4TOPA 3VURA 4HUAA 5CYYA 4JU5A 3DYRA 1O81A 4YH2A 1TK0B 1A2JA 4GXZA 3UL3A 4PNGA 2BTOT 4YAPA 1BYEA 1GWCA 1VGLA 3FK8A 5HR0A 1K0DA 2L59A 2F51A 2L5LA 4EC0A 2H75A 1TTZA 4HS1A 1QMVA 4JZQA 1XWBA 4PUAA 1RW1A 3TGZA 3W8JA 4NV5A 1WJKA 4MMMA 2Z9SA 4EO3A 2CAIA 3NZNA 3ZRDA 1VRSD 1XWKA 1MD4A 4MPFA 4WR5A 3GKKA 3TOTA 1TW9A 3UEMA 1K0CA 2VLVA 2OA7A 2MBSA 5IMAA 3VWWA 1XCCA 1A8LA 2CQ9A 4F0BA 1G6YA 1KNGA 2B1LA 3EMXA 1SKWB 2FUG2 4MF6A 2YNXA 2FHEA 5IO0A 3U6VA 1GRXA 3ZMKA 4ZB8A 1GUKA 4CHSA 4GLTA 2KP2A 3KGKA 5DJLA 3HCZA 4PGTA 4V2MA 2B5YA 4MLYA 5ECIB 2FD3A 3QAVA 1V40A 1JLWA 3H4KA 5CRHA 3QPMA 4MH2A 2GZPA 5KN2A 2B6MA 1EZKA 3ERWA 3F4RA 5ECSA 1DUGA 2L4CA 4IP6A 3G7JA 5IMFA 3VWVA 2V1MA 5G1KA 2LSTA 1K0MA 2JU5A
chains in the Genus database with same CATH superfamily
3IHQA 1DE1A 3TJFA 2RUFA 3RBTA 1UN2A 3APQA 2LJAA 1EWXA 4G9HA 4BVXB 2EIQA 3CSIA 1KBNA 3L9VA 2OE3A 4KSOA 1K0BA 4MF7A 1TK5B 4EIQA 2LJRA 3LEFA 4IN0A 1X5CA 4CY6A 2ON7A 4N11A 2C8UA 2FLSA 3IRAA 2HE3A 1YF1A 4Q5RA 2OBIA 2ON5A 2WULA 3PR8A 3TKSA 4PNFA 1VF1A 1QUWA 4Q5NA 2FWGA 4HOJA 1PN0A 1BQ7A 3GA4A 2FY6A 2H6ZA 4TVEA 4KDUA 4FH8A 4EVMA 2PBJA 1V9WA 1GTIA 2R37A 2VCQA 3PGTA 1PKZA 2O7KA 5B6MA 2C0GA 3F3QA 2L57A 3EURA 2O85A 1WP0A 3TJKA 1OC8A 5D96A 2RM6A 3KP9A 2IMFA 1X5EA 1XXUA 3A2XA 1HNCA 2OE1A 2V6KA 1TK8B 5J4UA 3CSHA 2PMTA 2R2JA 4K2XA 2YPMA 2MYGA 4XRAA 1B9XC 1SU9A 5F07A 5C00A 5HR3A 3HVXA 1DBYA 1NHYA 1OE8A 5DQYA 3O3TA 3RDWA 3MIXA 1H75A 2PUKC 9GSSA 4BVXA 1A8YA 1AAZA 2B3SA 4V1Ap 1AW9A 3TRQA 18GSA 3Q19A 1GSQA 2P0GA 2MMAA 2G2QA 22GSA 5HFIA 4Z2TA 2LRNA 3TKSC 4HZ4A 3RPNA 3F6DA 5F06A 5FT3A 1Y25A 3CSJA 4OFMA 3Q6OA 1M2BA 4JBBA 3VI7A 2FA4A 3MAKA 1ABAA 2CX3A 1GLPA 3US3A 2TRCP 1YJ6A 1ZMAA 4KDXA 3DKSA 1XWAA 2QKEA 2C3TA 4IELA 2GSRA 4JE1A 4BPYA 4PX1A 1XWCA 1Z6MA 5AISA 4IJ3A 1C72A 4KW6A 5B6NA 3TRPA 2VOCA 3UBKA 6GSXA 5F8BA 3A5WA 4PQ1A 2VL9A 1V57A 1GNEA 3W6GA 4E8HA 1EP7A 1LJRA 2JSZA 3TKQA 3VPQA 2TIRA 4JRRA 4MDCA 2IMKA 2VL3A 2C0DA 5EPFA 3VPTA 5D9TA 3BOAA 5CRDA 1BJXA 3DD3A 1QQ2A 4TR0A 4BVYB 4GTUA 4HJ2A 4MP4A 3GSSA 5J5NA 4GSSA 1DE2A 3IE3A 1Q98A 2VLUA 2H1AA 1TRVA 4QL7A 1GTUA 2PU9C 2X99A 4J57E 1F6MC 4OD7A 1SJ6A 4YQUA 4F2IA 1B9YC 2H6YA 2X4AA 3BD2A 3UARA 2IL3A 2V6OA 5DDLA 2L5OA 2VLTA 2IWTA 4WEYA 1K0AA 5IMZA 2NPBA 4Z2RA 1M2DA 6GSYA 1G6WA 3C1RA 3FY7A 1WWJA 2PVQA 2OADA 2K6VA 1V58A 1SKSB 4TRXA 4WBRD 6GSSA 3ZMLA 1AUCA 2DBCA 2HSHA 2YP6A 4EIPA 1WPIA 2OKAA 2HLSA 4KH7A 4XS4A 3KTBA 3C1SA 3QFBC 4OO4A 2RIIA 4KB3A 1TXXA 2IPAA 2JZSA 3DIEA 2YJHA 3CQFA 4CY8A 2MMZA 2OJLA 2HXKA 4F9ZA 5HR1A 1SJIA 4I97A 4MJEA 1F9MA 1FG4A 2C0FA 2N5AA 4I2UA 4WBJA 5A4WA 4BVYA 3GUSA 2LS5A 2R0CA 2I3YA 1PGTA 2CAQA 2LRCA 3HVSA 1SENA 3GIXA 4BWQA 1S3AA 5G30A 1OYJA 1WOUA 1U3AA 2DMMA 3HYPA 2B7JA 1M2AA 4IKHA 3QOUA 2YCDA 1PX7A 4ACSA 3IC4A 1E6BA 1OKDA 4J2FA 3LG6A 1OE7A 3EWLA 3IR4A 4LMVA 1T1VA 1FB0A 4G2EA 3L78A 3D4TA 1U6TA 3EU3A 3I69A 4ML1A 2VCTA 5G31A 1GSUA 3J7Yk 2L6DA 8GSSA 1THOA 2IFQB 2IMDA 4KDYA 5DALB 3PPUA 2DSAA 2HZFA 2XHFA 4X1UA 2H1GA 4RUVA 3O76A 1K0OA 3LFLA 2B5EA 4K8MA 1BG5A 2HRFA 5ECMB 1M3IA 1XW9A 2FCHA 1PL1A 2LQQA 3LW9A 4O5RA 5IOWA 4YQMA 2WRTA 3DMLA 5IPGA 3KMNA 1AIUA 2B1KA 1WRYA 4EDZA 4IW9A 12GSA 4LL1B 4GQCA 4FYUA 4TN8A 4ZL9A 1PQNA 4CDOA 3BBYA 1AQXA 4GRFA 2H70A 1XIYA 3AY8A 4LLRA 1OAZA 3ZIJA 1J9BA 1YKCA 3ZFLA 2G0FA 1GL8A 5GZZB 1AXDA 2AJQB 5DBQA 4NV2A 2YOIA 2GGTA 1PA3A 2WZ9A 2L4QA 4ZBBA 2CVDA 1TRSA 2EIOA 5FHIA 5GSSA 2YN1A 1OC3A 2GT6A 5DCHA 4O7HA 2IMIA 2F8FA 1U88A 2VCVA 5IOXA 4XCSA 5ECHB 5ECRB 1EEMA 3K8NA 1ERUA 1N2AA 2DJ1A 2IFQA 1HQOA 4GSTA 2GZZA 2DIYA 4Z7XA 3GRXA 5DALA 3Q74A 1YKAA 5A5KA 1W4VA 3QR6A 2GLRA 1Z7RA 2X49A 1R5AA 3O6TA 3KM6A 4MJAA 2ZCTA 5LNKe 4LL4B 5HFGA 1GH2A 4JR6A 20GSA 2JACA 2FWHA 3LGCA 2PVOC 2CVKA 1X0RA 2KP1A 4RI6A 2O89A 1Z9HA 2CT6A 3KEBA 3GTUB 3P90A 5ID2B 2HNLA 3M0FA 4PQHA 4GF0A 1A2MA 4G0KA 3VFIA 4ZB6A 3FR3A 3FW2A 4GQFA 5B8AA 2GQMA 3F9UA 2OBKA 3CRUA 4CW9A 2OE0A 2C4JA 1S3RA 2D2ZA 4ZB9A 2PGTA 3A2WA 5ABRA 14GSA 2HRAA 1MDKA 3MWHA 4K5RA 3IA1A 2GZYA 2C1YA 1X9SB 2B7KA 3HJMA 4RI7A 5HQPA 1TKDB 4KF9A 2RM5A 4NHZA 3FR9A 3VLNA 1GNWA 1SYXA 5B7CA 4ECBA 1I5GA 1VF2A 2I81A 1W89A 3LQ7A 1B8XA 4KAEA 3TJGA 3BCKA 1O6JA 3DWVA 3KMOA 1Z3EA 4USSA 5DQSA 2XC2A 4KX4A 2LV3A 3R3EA 3HVVA 4YKGA 3LYPA 5GSTA 4KNDA 2H71A 5G2ZA 3EINA 3GTUA 5ID2A 3P2AA 3TKPA 3GSTA 3HHVA 2E0QA 4ZL8A 2GQKA 4AJ6A 4PURA 2H1BA 1TI3A 1XOBA 1IYIA 2C0EA 2LRTA 3G7IA 4Q5FA 1F37A 5ECQB 2R0GA 2ZNMA 3IK9A 5CAXA 2VUPA 6GSWA 1EV9A 2AB6A 4F82A 4V2LA 2QC7A 4PUFC 4PXOA 2YV7A 3ZZXA 1UC7A 2H1DA 1PMTA 4PTSA 2NDOA 1ST9A 2IJYA 1WIKA 1UVZA 2HFDA 1ON4A 4KGIA 1GP1A 2CVBA 2GVPA 2VCWA 4O32A 4FYCA 1EV4A 2DJJA 4MNNA 2HSMA 1YY7A 4EDYA 2JL4A 3PINA 1EEJA 3HKRA 4G19A 4N30A 1PKWA 2H8LA 3U5RE 1GSDA 1I9DA 1ML6A 3TB2A 1SL2B 5CRWA 1O7UA 1EGRA 4TW5A 1T00A 2K9FA 2GS3A 2YWNA 3DXBA 1ILOA 1TJDA 3WGXA 4I6XA 1QFNA 1G0TA 4XTSA 3IV4A 3RHBA 4E8EA 2MBTA 3H1NA 5J9BA 3F4SA 3GX8A 4EKZA 4YAVA 3IOSA 4BA7A 3R2QA 3ZLPA 4AF2A 3LYKA 1O85A 4EE0A 4L5OA 1F2EA 5DVBA 2EC4A 3KH7A 3KH9A 1TRUA 3NIVA 4BL7B 3QDNA 4O5QA 3GH6A 3DVWA 3M3MA 5COHA 3H79A 3UVTA 5KN0A 1ACVA 2F9SA 4QQ7A 2H72A 5KOWA 4KA0A 1MEKA 4Q5QA 3ZYWA 1A0FA 1G7EA 1A24A 4NAXA 1TDIA 3WGEA 3L4NA 1J08A 3HZ4A 3GN3A 3F8UA 2KHPA 4XS4B 4POMA 4K7IA 2YZUA 3CXGA 3ERFA 4IGJA 4EF0A 4IVFA 4TXVA 2P5QA 3TCOA 3DVXA 4NHWA 3FHKA 1QK8A 1X9MB 3L9SA 4K7OA 4MCUA 2KUCA 3FZAA 1GUMA 2VD1A 3QMXA 1XZOA 2H76A 1TU8A 4H86A 2ALBA 5D9VA 4ZBAA 1NW2A 5ELAA 2IN3A 1YEXA 4OMVA 1SD8A 1JHBA 2A4HA 3KXOA 4P3YB 3P7XA 5EY6A 1B4PA 4BL7A 1ZYEA 1E2YA 1Y6EA 2GDRA 1AC1A 3IK7A 2JADA 2XBQA 4X0XA 5D73A 2C80A 2L6CA 3F63A 2JZTA 3IC8A 4I8BA 1NHOA 2VD0A 3GH9A 1MD3A 3WD6A 4DEJA 3HVNA 4MA9A 2RUEA 3ZVJA 4D73A 1WE0A 3TJBA 1PN9A 3LJRA 3D5JA 1YQ1A 1HNAA 2V2GA 3QD9A 4X4JA 2IIYA 2AYTA 1XBSA 4HI7A 2WCIA 3ZIVA 1WMJA 4I2TA 1OVNA 3QAGA 3EVIA 2VM2A 5JCWA 5J9CA 2LNSA 3S9FA 1JZOA 2X64A 3FR6A 3IHGA 4POBA 5FWGA 3V1WA 3EU4A 5BRTA 3MYDA 4ZL7A 2X8GA 2FNOA 4G0LA 3GV1A 5D9WA 1B48A 1SYRA 4NPBA 5KEJA 4ID0A 1K3OA 3TKSE 1NSWA 1URMA 4XS6A 1THXA 1FO5A 3SWLA 3UOMA 2XBIA 1GUHA 3I9V2 3IPZA 1MTCA 4GSNA 1PRXA 5ENUA 1M7TA 3ZFBA 4L8EA 2I1UA 2YWIA 5CP1A 4KCEA 3GX0A 3EMPA 1QGVA 1GLQA 4N10A 3ZVJD 5EL8A 4IBPA 3FRCA 4JEDA 3GKNA 3WYWA 4WKWA 3G7YA 3F3RA 1HYUA 1GSSA 1NM3A 1ZYQB 2F8AA 2H0HA 5DJMA 2WGRA 4XRDA 3A5IA 5GAND 3LXZA 1GSEA 2H74A 5DAKB 1J0FA 1ZL9A 2PN8A 1VF4A 1HNBA 4F03A 4DSRA 5IIZA 3RAZA 4ISDA 1LBKA 3KD0A 1PFOA 4N0VA 2OACA 2J23A 13GSA 2MMOA 4IHUA 1RQMA 3ZREA 2LTKA 2WFCA 1BAYA 2XPDA 2GSTA 4K0NA 4TXOB 5LCZA 2DJ2A 4AJ8A 2HRNA 1T4ZA 3LXTA 2O8VB 3GHAA 3ISOA 2VAFA 3EC3A 3M1GA 1ZCPA 2HZEB 1U87A 2V41A 1DSBA 4O92A 4V1Ag 2MMNA 1XVWA 3KCMA 2YANA 5INYA 3A3TA 1ERVA 1YF0A 4EL1A 4XS1A 1YZXA 5J41A 2DJ3A 4K0GA 1SK0A 2H66A 4Z2UA 1M9AA 3TKRA 3HDCA 1TP9A 1JFUA 1GTAA 3I6AA 17GSA 1X5DA 2A4VA 2DIZA 4WR4A 4ZILA 1R7HA 3F4TA 3EYTA 3LWAA 2AHEA 3IXRA 1ZZYA 4WXTA 4NWYA 1U3IA 1Z7PA 2VM1A 4KCAA 5DAKA 1N8JA 4G0IA 4TR1B 2GQLA 5C04A 3HZ8A 5DCGA 1PX6A 2VL2C 3MDKA 3A2VA 7GSSA 1CQHA 3DEXA 3IAM2 1XWGA 3CTGA 5H5SA 3GURA 1OC9B 4I5QA 1XFLA 3D6IA 4EUYA 1S3CA 3WGDA 3WT1A 1HD2A 2YZHA 1VF3A 1O8WA 3E9JB 4IJIA 3VWXA 3M9KA 5IMCA 2H0GA 2HI7A 3DGQA 2N5BA 4TXOA 2VO4A 1V98A 5KN1A 3MNGA 2I9HA 5A4VA 2HZEA 3FZ9A 2DMLA 1BEDA 4DSSB 3ZITA 5D93A 3HXSA 6GSVA 1RK4A 4NMUA 16GSA 3RHCA 2EIRA 2PPTA 5ECPB 2M46A 2JZRA 3KIJA 2FWFA 1K3LA 3APOA 5CREA 2DKIA 4MPGA 1R26A 2J9HA 2CA8A 5IO2A 3E3EA 1AQWA 2PERA 3TJJA 5D9XA 4KSMA 3HD5A 2TRXA 2LQOA 3KTLA 3GL3A 10GSA 1OKTA 2QGVA 3CMIA 4ZXGA 1XVQA 3L0HA 4IQAA 1Z5YE 5AN1A 4TR1A 1JZWA 1F3AA 4KUNA 1A23A 5IQYA 1FW1A 3HA9A 4FYBA 2VIMA 2CZ2A 3VK9A 1OC9A 3FEUA 2A2PA 3C71A 3HY2A 1XPVA 4ULXA 2O87A 2WJUA 3IAS2 5ECKB 5B8BA 3UBLA 1M9BA 1LU4A 2R6KA 2C3NA 3FZ4A 4AGSA 3L9UA 2KOKA 1EOGA 2M72A 4LA1A 1ERTA 3C8EA 3DRNA 4DSSA 4K9ZA 1SD9A 4MZBA 3GL5A 2LUSA 1M3JA 4K6XA 2GSQA 11GSA 4ILFA 3D0ZA 2AV4A 5JWOB 4IP1A 1GTBA 1H4OA 5AIVA 2E2MA 2K8SA 1FHEA 1K0NA 4BIKA 5E59A 3CRTA 5L71A 3CTFA 4TR3A 3ME8A 5ELGA 4BWSA 3GFKA 2FWEA 4HZ2A 4WF4A 3UJ1A 1T4YA 3Q18A 1SL1B 1QXHA 1EOHA 5JCUA 3GMFA 4K2DA 1GSYA 1ERWA 1XW6A 1YDKA 2K8VA 3OR5A 1R4WA 3RPPA 1SL0B 1O8XA 5G1LA 3C73A 4J56E 4MZWA 2YJ7A 3LSZA 5H5QA 4ML6A 2BMXA 2H0IA 2KLXA 4K7NA 2WDUA 4V2NA 4WETA 4ZBDA 5HR2A 1S3DA 4N0ZA 2FGXA 2WB9A 1EGOA 3ERGA 1T3BA 3PH9A 2F3MA 1KTEA 2CV4A 2X8CA 3P8WA 4DSQA 5A4UA 5EVOA 2IMEA 5IM9A 1SK2A 4KE3A 2YWOA 3J7Yb 2LJKA 2VCZA 5JWQB 4MK3A 5JWRB 3ZL5A 3EE2A 1FVKA 4K1FA 1UA5A 2E7PA 3D22A 1X9WB 3N5OA 4G10A 1ZOFA 2HYXA 3TUEA 3GKXA 2DC5A 1A0RP 1PSQA 4YKFA 3H8QA 4D73B 1MDIA 4MZCA 3QAWA 4L5LA 4RQRA 2P5RA 5CRGA 2M80A 2DJ0A 3ZTLA 2ES7A 5ECLB 4HSCX 2JSYA 4XHMA 1JZDA 3QCPA 3FZ5A 2QA2A 3TDGA 5G5FA 3ED3A 4TKYA 2A2SA 2H30A 1BX9A 3ME7A 4NXIA 1SJZA 2LEGA 1MDJA 3UVHA 1FOVA 1XW5A 5G5EA 3NOFA 2R3XA 5D8IA 2LNTA 1IYHA 1EP8A 3FYGA 4GWRA 2YWMA 1Z6NA 2BJXA 2H19A 3CBUA 1M99A 4XIHA 3TRXA 2N5FA 4ZIJA 4TR4A 4PQIA 2A2RA 4AJ7A 2VCXA 2E2GA 3W8SA 3HJPA 1O73A 3QFAC 5CNWA 1M0UA 4ECCA 2WS2A 2FA8A 2CX4A 2I4AA 1TU7A 4OFNA 2QSIA 5F0GA 4GCIA 3IDVA 4MF5A 4DVCA 5IMDA 3D21A 2DJKA 2HT9A 1CQGA 4MH3A 1SKRB 1A2LA 3LORA 4POLA 3CYNA 3KZQA 3F0IA 3MSZA 2GSSA 4HU9A 1ZYNA 1USBA 2NVLA 2R5GA 1AQVA 3KP8A 3WT2A 2REMA 3UMAA 5IMVA 3FKFA 1SK1A 1B4QA 5E4WA 2AUVA 1K3YA 2CZ3A 5ECOB 3M8NA 3H93A 4YQVA 2R4VA 1FAAA 1FVJA 4RQXA 1TOFA 5BMUA 2XPEA 2ZUPA 2GTUA 4L0WA 4HDEA 2HSYA 1FOHA 4ECIA 3JCML 5IPHA 4HJMA 4ECJA 4MJCA 5HFKA 1R5PA 1PD21 4L0UA 2AAWA 2PWJA 2H73A 4LMWA 5GAPD 4FQUA 1PL2A 1TRWA 2B5XA 4OCEA 4MABA 2GT5A 4OO5A 3IBHA 2MZCA 5AIXA 2H6XA 2R0PA 3G9BA 5JCGA 4OCFA 4OFTA 4MJBA 3BCIA 3N9JA 2HRKA 1JZRA 4OWYA 3UIWA 4EXJA 5F05A 2H01A 1TI1A 2DKHA 5KN3A 1GULA 5AGYA 2LKUA 3BJ5A 2NTOA 1T7PB 1FB6A 2VL2A 3GYKA 1XOAA 4WF5A 4JR4A 5H5RA 3SBCA 6GSTA 1KEBA 2NBSA 4X43A 4IS0A 1G7OA 5LD0A 3C7MA 19GSA 3HJOA 1F3BA 3TOUA 3KJYA 3D4MA 2DLXA 5ECNB 4HEA2 5CO3A 1GSFA 3APSA 2V32A 4K5SA 3E0UA 4FO5A 3VWUA 4F0CA 4POKA 1YEPA 1ZGNA 2K18A 3M9JA 1Q4JA 4HQSA 3VI5A 4A5PA 3F6FA 1V2AA 4IQ1A 2RLIA 4HU7A 3UAPA 6GSUA 3GKMA 2P31A 2C3QA 3GNJA 4FIWA 2X8HA 2YV9A 3I43A 1JLVA 4QL9A 4HQZA 5J3RA 1T8EB 4TOPA 3VURA 4HUAA 5CYYA 4JU5A 5KOXA 3DYRA 1O81A 4YH2A 1TK0B 1A2JA 4GXZA 3UL3A 4PNGA 2BTOT 4YAPA 1BYEA 1GWCA 1VGLA 3FK8A 5HR0A 1K0DA 2L59A 2F51A 2L5LA 4EC0A 2H75A 1TTZA 4HS1A 1QMVA 4JZQA 1XWBA 4PUAA 1RW1A 3TGZA 3W8JA 4NV5A 1WJKA 4MMMA 3EPTA 2Z9SA 4EO3A 2CAIA 3NZNA 3ZRDA 1VRSD 1XWKA 1MD4A 4MPFA 4WR5A 3GKKA 4ICYA 3TOTA 1TW9A 3FMWA 3UEMA 1K0CA 2VLVA 2OA7A 2MBSA 5IMAA 3VWWA 4O5UA 1XCCA 1A8LA 1ZYPA 2QA1A 2CQ9A 4F0BA 1G6YA 1KNGA 2B1LA 3EMXA 1SKWB 2FUG2 4MF6A 2YNXA 2FHEA 2UZ8A 5IO0A 3U6VA 1GRXA 3ZMKA 4ZB8A 1GUKA 4CHSA 4GLTA 2KP2A 3KGKA 5DJLA 3HCZA 4PGTA 4V2MA 2B5YA 4MLYA 5ECIB 2FD3A 3QAVA 1V40A 1JLWA 3H4KA 5CRHA 3QPMA 4MH2A 2GZPA 5KN2A 2B6MA 1EZKA 3ERWA 3F4RA 5ECSA 1DUGA 2L4CA 4IP6A 1XG8A 3G7JA 5IMFA 3VWVA 2V1MA 5G1KA 2LSTA 1K0MA 2JU5A
chains in the Genus database with same CATH topology
3IHQA 1DE1A 3TJFA 2RUFA 3RBTA 1UN2A 3APQA 2LJAA 1EWXA 4G9HA 4BVXB 2EIQA 3CSIA 1KBNA 3L9VA 2OE3A 4KSOA 1K0BA 4MF7A 1TK5B 4EIQA 2LJRA 3LEFA 4IN0A 1X5CA 4CY6A 2ON7A 4N11A 2C8UA 2FLSA 3IRAA 2HE3A 1YF1A 4Q5RA 2OBIA 2ON5A 2WULA 3PR8A 3TKSA 4PNFA 1VF1A 1QUWA 4Q5NA 2FWGA 4HOJA 1PN0A 1BQ7A 3GA4A 2FY6A 2H6ZA 4TVEA 4KDUA 4FH8A 4EVMA 2PBJA 1V9WA 1GTIA 2R37A 2VCQA 3PGTA 1PKZA 2O7KA 5B6MA 2C0GA 3F3QA 2L57A 3EURA 2O85A 1WP0A 3TJKA 1OC8A 5D96A 2RM6A 3KP9A 2IMFA 1X5EA 1XXUA 3A2XA 1HNCA 2OE1A 2V6KA 1TK8B 5J4UA 3CSHA 2PMTA 2R2JA 4K2XA 2YPMA 2MYGA 4XRAA 1B9XC 1SU9A 5F07A 5C00A 5HR3A 3HVXA 1DBYA 1NHYA 1OE8A 5DQYA 3O3TA 3RDWA 3MIXA 1H75A 2PUKC 9GSSA 4BVXA 1A8YA 1AAZA 2B3SA 4V1Ap 1AW9A 3TRQA 18GSA 3Q19A 1GSQA 2P0GA 2MMAA 2G2QA 22GSA 5HFIA 4Z2TA 2LRNA 3TKSC 4HZ4A 3RPNA 3F6DA 5F06A 5FT3A 1Y25A 3CSJA 4OFMA 3Q6OA 1M2BA 4JBBA 3VI7A 2FA4A 3MAKA 1ABAA 2CX3A 1GLPA 3US3A 2TRCP 1YJ6A 1ZMAA 4KDXA 3DKSA 1XWAA 2QKEA 2C3TA 4IELA 2GSRA 4JE1A 4BPYA 4PX1A 1XWCA 1Z6MA 5AISA 4IJ3A 1C72A 4KW6A 5B6NA 3TRPA 2VOCA 3UBKA 6GSXA 5F8BA 3A5WA 4PQ1A 2VL9A 1V57A 1GNEA 3W6GA 4E8HA 1EP7A 1LJRA 2JSZA 3TKQA 3VPQA 2TIRA 4JRRA 4MDCA 2IMKA 2VL3A 2C0DA 5EPFA 3VPTA 5D9TA 3BOAA 5CRDA 1BJXA 3DD3A 1QQ2A 4TR0A 4BVYB 4GTUA 4HJ2A 4MP4A 3GSSA 5J5NA 4GSSA 1DE2A 3IE3A 1Q98A 2VLUA 2H1AA 1TRVA 4QL7A 1GTUA 2PU9C 2X99A 4J57E 1F6MC 4OD7A 1SJ6A 4YQUA 4F2IA 1B9YC 2H6YA 2X4AA 3BD2A 3UARA 2IL3A 2V6OA 5DDLA 2L5OA 2VLTA 2IWTA 4WEYA 1K0AA 5IMZA 2NPBA 4Z2RA 1M2DA 6GSYA 1G6WA 3C1RA 3FY7A 1WWJA 2PVQA 2OADA 2K6VA 1V58A 1SKSB 4TRXA 4WBRD 6GSSA 3ZMLA 1AUCA 2DBCA 2HSHA 2YP6A 4EIPA 1WPIA 2OKAA 2HLSA 4KH7A 4XS4A 3KTBA 3C1SA 3QFBC 4OO4A 2RIIA 4KB3A 1TXXA 2IPAA 2JZSA 3DIEA 2YJHA 4CY8A 2MMZA 2OJLA 2HXKA 4F9ZA 5HR1A 1SJIA 4I97A 4MJEA 1F9MA 1FG4A 2C0FA 2N5AA 4I2UA 4WBJA 5A4WA 4BVYA 3GUSA 2LS5A 2R0CA 2I3YA 1PGTA 2CAQA 2LRCA 3HVSA 1SENA 3GIXA 4BWQA 1S3AA 5G30A 1OYJA 1WOUA 1U3AA 2DMMA 3HYPA 2B7JA 1M2AA 4IKHA 3QOUA 2YCDA 1PX7A 4ACSA 3IC4A 1E6BA 1OKDA 4J2FA 3LG6A 1OE7A 3EWLA 3IR4A 4LMVA 1T1VA 1FB0A 4G2EA 3L78A 3D4TA 1U6TA 3EU3A 3I69A 4ML1A 2VCTA 5G31A 1GSUA 3J7Yk 2L6DA 8GSSA 1THOA 2IFQB 2IMDA 4KDYA 5DALB 3PPUA 2DSAA 2HZFA 2XHFA 4X1UA 2H1GA 4RUVA 3O76A 1K0OA 3LFLA 2B5EA 4K8MA 1BG5A 2HRFA 5ECMB 1XW9A 2FCHA 1PL1A 2LQQA 3LW9A 4O5RA 5IOWA 4YQMA 2WRTA 3DMLA 5IPGA 3KMNA 1AIUA 2B1KA 1WRYA 4EDZA 4IW9A 12GSA 4LL1B 4GQCA 4FYUA 4TN8A 4ZL9A 1PQNA 4CDOA 3BBYA 1AQXA 4GRFA 2H70A 1XIYA 3AY8A 4LLRA 1OAZA 3ZIJA 1J9BA 1YKCA 3ZFLA 2G0FA 1GL8A 5GZZB 1AXDA 2AJQB 5DBQA 4NV2A 2YOIA 2GGTA 1PA3A 2WZ9A 2L4QA 4ZBBA 2CVDA 1TRSA 2EIOA 5FHIA 5GSSA 2YN1A 1OC3A 2GT6A 5DCHA 4O7HA 2IMIA 2F8FA 1U88A 2VCVA 5IOXA 4XCSA 5ECHB 5ECRB 1EEMA 3K8NA 1ERUA 1N2AA 2DJ1A 2IFQA 1HQOA 4GSTA 2GZZA 2DIYA 4Z7XA 3GRXA 5DALA 3Q74A 1YKAA 5A5KA 1W4VA 3QR6A 2GLRA 1Z7RA 2X49A 1R5AA 3O6TA 3KM6A 4MJAA 2ZCTA 5LNKe 4LL4B 5HFGA 1GH2A 4JR6A 20GSA 2JACA 2FWHA 3LGCA 2PVOC 2CVKA 1X0RA 2KP1A 4RI6A 2O89A 1Z9HA 2CT6A 3KEBA 3GTUB 3P90A 5ID2B 2HNLA 3M0FA 4PQHA 4GF0A 1A2MA 4G0KA 3VFIA 4ZB6A 3FR3A 3FW2A 4GQFA 5B8AA 2GQMA 3F9UA 2OBKA 3CRUA 4CW9A 2OE0A 2C4JA 2D2ZA 4ZB9A 2PGTA 3A2WA 5ABRA 14GSA 2HRAA 1MDKA 3MWHA 4K5RA 3IA1A 2GZYA 2C1YA 1X9SB 2B7KA 3HJMA 4RI7A 5HQPA 1TKDB 4KF9A 2RM5A 4NHZA 3FR9A 3VLNA 1GNWA 1SYXA 5B7CA 4ECBA 1I5GA 1VF2A 2I81A 1W89A 3LQ7A 1B8XA 4KAEA 3TJGA 3BCKA 1O6JA 3DWVA 3KMOA 1Z3EA 4USSA 5DQSA 2XC2A 4KX4A 2LV3A 3R3EA 3HVVA 4YKGA 3LYPA 5GSTA 4KNDA 2H71A 5G2ZA 3EINA 3GTUA 5ID2A 3P2AA 3TKPA 3GSTA 3HHVA 2E0QA 4ZL8A 2GQKA 4AJ6A 4PURA 2H1BA 1TI3A 1XOBA 1IYIA 2C0EA 2LRTA 3G7IA 4Q5FA 1F37A 5ECQB 2R0GA 2ZNMA 3IK9A 5CAXA 2VUPA 6GSWA 1EV9A 2AB6A 4F82A 4V2LA 2QC7A 4PUFC 4PXOA 2YV7A 3ZZXA 1UC7A 2H1DA 1PMTA 4PTSA 2NDOA 1ST9A 2IJYA 1WIKA 1UVZA 2HFDA 1ON4A 4KGIA 1GP1A 2CVBA 2GVPA 2VCWA 4O32A 4FYCA 1EV4A 2DJJA 4MNNA 2HSMA 1YY7A 4EDYA 2JL4A 3PINA 1EEJA 3HKRA 4G19A 4N30A 1PKWA 2H8LA 3U5RE 1GSDA 1I9DA 1ML6A 3TB2A 1SL2B 5CRWA 1O7UA 1EGRA 4TW5A 1T00A 2K9FA 2GS3A 2YWNA 3DXBA 1ILOA 1TJDA 3WGXA 4I6XA 1QFNA 1G0TA 4XTSA 3IV4A 3RHBA 4E8EA 2MBTA 3H1NA 5J9BA 3F4SA 3GX8A 4EKZA 4YAVA 3IOSA 4BA7A 3R2QA 3ZLPA 4AF2A 3LYKA 1O85A 4EE0A 4L5OA 1F2EA 5DVBA 2EC4A 3KH7A 3KH9A 1TRUA 3NIVA 4BL7B 3QDNA 4O5QA 3GH6A 3DVWA 3M3MA 5COHA 3H79A 3UVTA 5KN0A 1ACVA 2F9SA 4QQ7A 2H72A 5KOWA 4KA0A 1MEKA 4Q5QA 3ZYWA 1A0FA 1G7EA 1A24A 4NAXA 1TDIA 3WGEA 3L4NA 1J08A 3HZ4A 3GN3A 3F8UA 2KHPA 4XS4B 4POMA 4K7IA 2YZUA 3CXGA 3ERFA 4IGJA 4EF0A 4IVFA 4TXVA 2P5QA 3TCOA 3DVXA 4NHWA 3FHKA 1QK8A 1X9MB 3L9SA 4K7OA 4MCUA 2KUCA 3FZAA 1GUMA 2VD1A 3QMXA 1XZOA 2H76A 1TU8A 4H86A 2ALBA 5D9VA 4ZBAA 1NW2A 5ELAA 2IN3A 1YEXA 4OMVA 1SD8A 1JHBA 2A4HA 3KXOA 4P3YB 3P7XA 5EY6A 1B4PA 4BL7A 1ZYEA 1E2YA 1Y6EA 2GDRA 1AC1A 3IK7A 2JADA 2XBQA 4X0XA 5D73A 2C80A 2L6CA 3F63A 2JZTA 3IC8A 4I8BA 1NHOA 2VD0A 3GH9A 1MD3A 3WD6A 4DEJA 4MA9A 2RUEA 3ZVJA 4D73A 1WE0A 3TJBA 1PN9A 3LJRA 3D5JA 1YQ1A 1HNAA 2V2GA 3QD9A 4X4JA 2IIYA 2AYTA 1XBSA 4HI7A 2WCIA 3ZIVA 1WMJA 4I2TA 1OVNA 3QAGA 3EVIA 2VM2A 5JCWA 5J9CA 2LNSA 3S9FA 1JZOA 2X64A 3FR6A 3IHGA 4POBA 5FWGA 3V1WA 3EU4A 5BRTA 3MYDA 4ZL7A 2X8GA 2FNOA 4G0LA 3GV1A 5D9WA 1B48A 1SYRA 4NPBA 5KEJA 4ID0A 1K3OA 3TKSE 1NSWA 1URMA 4XS6A 1THXA 1FO5A 3SWLA 3UOMA 2XBIA 1GUHA 3I9V2 3IPZA 1MTCA 4GSNA 1PRXA 5ENUA 1M7TA 3ZFBA 4L8EA 2I1UA 2YWIA 5CP1A 4KCEA 3GX0A 3EMPA 1QGVA 1GLQA 4N10A 3ZVJD 5EL8A 4IBPA 3FRCA 4JEDA 3GKNA 3WYWA 4WKWA 3G7YA 3F3RA 1HYUA 1GSSA 1NM3A 1ZYQB 2F8AA 2H0HA 5DJMA 2WGRA 4XRDA 3A5IA 5GAND 3LXZA 1GSEA 2H74A 5DAKB 1J0FA 1ZL9A 2PN8A 1VF4A 1HNBA 4F03A 4DSRA 5IIZA 3RAZA 4ISDA 1LBKA 3KD0A 4N0VA 2OACA 2J23A 13GSA 2MMOA 4IHUA 1RQMA 3ZREA 2LTKA 2WFCA 1BAYA 2XPDA 2GSTA 4K0NA 4TXOB 5LCZA 2DJ2A 4AJ8A 2HRNA 1T4ZA 3LXTA 2O8VB 3GHAA 3ISOA 2VAFA 3EC3A 3M1GA 1ZCPA 2HZEB 1U87A 2V41A 1DSBA 4O92A 4V1Ag 2MMNA 1XVWA 3KCMA 2YANA 5INYA 3A3TA 1ERVA 1YF0A 4EL1A 4XS1A 1YZXA 5J41A 2DJ3A 4K0GA 1SK0A 2H66A 4Z2UA 1M9AA 3TKRA 3HDCA 1TP9A 1JFUA 1GTAA 3I6AA 17GSA 1X5DA 2A4VA 2DIZA 4WR4A 4ZILA 1R7HA 3F4TA 3EYTA 3LWAA 2AHEA 3IXRA 1ZZYA 4WXTA 4NWYA 1U3IA 1Z7PA 2VM1A 4KCAA 5DAKA 1N8JA 4G0IA 4TR1B 2GQLA 5C04A 3HZ8A 5DCGA 1PX6A 2VL2C 3MDKA 3A2VA 7GSSA 1CQHA 3DEXA 3IAM2 1XWGA 3CTGA 5H5SA 3GURA 1OC9B 4I5QA 1XFLA 3D6IA 4EUYA 1S3CA 3WGDA 3WT1A 1HD2A 2YZHA 1VF3A 1O8WA 3E9JB 4IJIA 3VWXA 3M9KA 5IMCA 2H0GA 2HI7A 3DGQA 2N5BA 4TXOA 2VO4A 1V98A 5KN1A 3MNGA 2I9HA 5A4VA 2HZEA 3FZ9A 2DMLA 1BEDA 4DSSB 3ZITA 5D93A 3HXSA 6GSVA 1RK4A 4NMUA 16GSA 3RHCA 2EIRA 2PPTA 5ECPB 2M46A 2JZRA 3KIJA 2FWFA 1K3LA 3APOA 5CREA 2DKIA 4MPGA 1R26A 2J9HA 2CA8A 5IO2A 3E3EA 1AQWA 2PERA 3TJJA 5D9XA 4KSMA 3HD5A 2TRXA 2LQOA 3KTLA 3GL3A 10GSA 1OKTA 2QGVA 3CMIA 4ZXGA 1XVQA 3L0HA 4IQAA 1Z5YE 5AN1A 4TR1A 1JZWA 1F3AA 4KUNA 1A23A 5IQYA 1FW1A 3HA9A 4FYBA 2VIMA 2CZ2A 3VK9A 1OC9A 3FEUA 2A2PA 3C71A 3HY2A 1XPVA 4ULXA 2O87A 2WJUA 3IAS2 5ECKB 5B8BA 3UBLA 1M9BA 1LU4A 2R6KA 2C3NA 3FZ4A 4AGSA 3L9UA 2KOKA 1EOGA 2M72A 4LA1A 1ERTA 3C8EA 3DRNA 4DSSA 4K9ZA 1SD9A 4MZBA 3GL5A 2LUSA 4K6XA 2GSQA 11GSA 4ILFA 3D0ZA 2AV4A 5JWOB 4IP1A 1GTBA 1H4OA 5AIVA 2E2MA 2K8SA 1FHEA 1K0NA 5E59A 3CRTA 5L71A 3CTFA 4TR3A 3ME8A 5ELGA 4BWSA 3GFKA 2FWEA 4HZ2A 4WF4A 3UJ1A 1T4YA 3Q18A 1SL1B 1QXHA 1EOHA 5JCUA 3GMFA 4K2DA 1GSYA 1ERWA 1XW6A 1YDKA 2K8VA 3OR5A 1R4WA 3RPPA 1SL0B 1O8XA 5G1LA 3C73A 4J56E 4MZWA 2YJ7A 3LSZA 5H5QA 4ML6A 2BMXA 2H0IA 2KLXA 4K7NA 2WDUA 4V2NA 4WETA 4ZBDA 5HR2A 1S3DA 4N0ZA 2FGXA 2WB9A 1EGOA 3ERGA 1T3BA 3PH9A 2F3MA 1KTEA 2CV4A 2X8CA 3P8WA 4DSQA 5A4UA 5EVOA 2IMEA 5IM9A 1SK2A 4KE3A 2YWOA 3J7Yb 2LJKA 2VCZA 5JWQB 4MK3A 5JWRB 3ZL5A 3EE2A 1FVKA 4K1FA 1UA5A 2E7PA 3D22A 1X9WB 3N5OA 4G10A 1ZOFA 2HYXA 3TUEA 3GKXA 2DC5A 1A0RP 1PSQA 4YKFA 3H8QA 4D73B 1MDIA 4MZCA 3QAWA 4L5LA 4RQRA 2P5RA 5CRGA 2M80A 2DJ0A 3ZTLA 2ES7A 5ECLB 2JSYA 4XHMA 1JZDA 3QCPA 3FZ5A 2QA2A 3TDGA 5G5FA 3ED3A 4TKYA 2A2SA 2H30A 1BX9A 3ME7A 4NXIA 1SJZA 2LEGA 1MDJA 3UVHA 1FOVA 1XW5A 5G5EA 3NOFA 2R3XA 5D8IA 2LNTA 1IYHA 1EP8A 3FYGA 4GWRA 2YWMA 1Z6NA 2BJXA 2H19A 3CBUA 1M99A 4XIHA 3TRXA 2N5FA 4ZIJA 4TR4A 4PQIA 2A2RA 4AJ7A 2VCXA 2E2GA 3W8SA 3HJPA 1O73A 3QFAC 5CNWA 1M0UA 4ECCA 2WS2A 2FA8A 2CX4A 2I4AA 1TU7A 4OFNA 2QSIA 5F0GA 4GCIA 3IDVA 4MF5A 4DVCA 5IMDA 3D21A 2DJKA 2HT9A 1CQGA 4MH3A 1SKRB 1A2LA 3LORA 4POLA 3CYNA 3KZQA 3F0IA 3MSZA 2GSSA 4HU9A 1ZYNA 1USBA 2NVLA 2R5GA 1AQVA 3KP8A 3WT2A 2REMA 3UMAA 5IMVA 3FKFA 1SK1A 1B4QA 5E4WA 2AUVA 1K3YA 2CZ3A 5ECOB 3M8NA 3H93A 4YQVA 2R4VA 1FAAA 1FVJA 4RQXA 1TOFA 5BMUA 2XPEA 2ZUPA 2GTUA 4L0WA 4HDEA 2HSYA 1FOHA 4ECIA 3JCML 5IPHA 4HJMA 4ECJA 4MJCA 5HFKA 1R5PA 1PD21 4L0UA 2AAWA 2PWJA 2H73A 4LMWA 5GAPD 4FQUA 1PL2A 1TRWA 2B5XA 4OCEA 4MABA 2GT5A 4OO5A 3IBHA 2MZCA 5AIXA 2H6XA 2R0PA 3G9BA 5JCGA 4OCFA 4OFTA 4MJBA 3BCIA 3N9JA 2HRKA 1JZRA 4OWYA 3UIWA 4EXJA 5F05A 2H01A 1TI1A 2DKHA 5KN3A 1GULA 5AGYA 2LKUA 3BJ5A 2NTOA 1T7PB 1FB6A 2VL2A 3GYKA 1XOAA 4WF5A 4JR4A 5H5RA 3SBCA 6GSTA 1KEBA 2NBSA 4X43A 4IS0A 1G7OA 5LD0A 3C7MA 19GSA 3HJOA 1F3BA 3TOUA 3KJYA 3D4MA 2DLXA 5ECNB 4HEA2 5CO3A 1GSFA 3APSA 2V32A 4K5SA 3E0UA 4FO5A 3VWUA 4F0CA 4POKA 1YEPA 1ZGNA 2K18A 3M9JA 1Q4JA 4HQSA 3VI5A 4A5PA 3F6FA 1V2AA 4IQ1A 2RLIA 4HU7A 3UAPA 6GSUA 3GKMA 2P31A 2C3QA 3GNJA 4FIWA 2X8HA 2YV9A 3I43A 1JLVA 4QL9A 4HQZA 5J3RA 1T8EB 4TOPA 3VURA 4HUAA 5CYYA 4JU5A 5KOXA 3DYRA 1O81A 4YH2A 1TK0B 1A2JA 4GXZA 3UL3A 4PNGA 2BTOT 4YAPA 1BYEA 1GWCA 1VGLA 3FK8A 5HR0A 1K0DA 2L59A 2F51A 2L5LA 4EC0A 2H75A 1TTZA 4HS1A 1QMVA 4JZQA 1XWBA 4PUAA 1RW1A 3TGZA 3W8JA 4NV5A 1WJKA 4MMMA 3EPTA 2Z9SA 4EO3A 2CAIA 3NZNA 3ZRDA 1VRSD 1XWKA 1MD4A 4MPFA 4WR5A 3GKKA 4ICYA 3TOTA 1TW9A 3FMWA 3UEMA 1K0CA 2VLVA 2OA7A 2MBSA 5IMAA 3VWWA 4O5UA 1XCCA 1A8LA 1ZYPA 2QA1A 2CQ9A 4F0BA 1G6YA 1KNGA 2B1LA 3EMXA 1SKWB 2FUG2 4MF6A 2YNXA 2FHEA 2UZ8A 5IO0A 3U6VA 1GRXA 3ZMKA 4ZB8A 1GUKA 4CHSA 4GLTA 2KP2A 3KGKA 5DJLA 3HCZA 4PGTA 4V2MA 2B5YA 4MLYA 5ECIB 2FD3A 3QAVA 1V40A 1JLWA 3H4KA 5CRHA 3QPMA 4MH2A 2GZPA 5KN2A 2B6MA 1EZKA 3ERWA 3F4RA 5ECSA 1DUGA 2L4CA 4IP6A 3G7JA 5IMFA 3VWVA 2V1MA 5G1KA 2LSTA 1K0MA 2JU5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IHQ A;  1DE1 A;  3TJF A;  2RUF A;  3RBT A;  1UN2 A;  3APQ A;  2LJA A;  1EWX A;  4G9H A;  2EIQ A;  3CSI A;  1KBN A;  3L9V A;  2OE3 A;  4KSO A;  1K0B A;  4MF7 A;  1TK5 B;  2LJR A;  3LEF A;  4IN0 A;  1X5C A;  2ON7 A;  4N11 A;  2C8U A;  2FLS A;  3IRA A;  2HE3 A;  1YF1 A;  4Q5R A;  2OBI A;  2ON5 A;  2WUL A;  3PR8 A;  3TKS A;  4PNF A;  1VF1 A;  1QUW A;  4Q5N A;  2FWG A;  4HOJ A;  1BQ7 A;  3GA4 A;  2FY6 A;  2H6Z A;  4TVE A;  4KDU A;  4FH8 A;  4EVM A;  2PBJ A;  1V9W A;  1GTI A;  2R37 A;  2VCQ A;  3PGT A;  1PKZ A;  2O7K A;  5B6M A;  2C0G A;  3F3Q A;  2L57 A;  3EUR A;  2O85 A;  1WP0 A;  3TJK A;  1OC8 A;  5D96 A;  2RM6 A;  3KP9 A;  2IMF A;  1X5E A;  1XXU A;  3A2X A;  1HNC A;  2OE1 A;  2V6K A;  1TK8 B;  5J4U A;  3CSH A;  2PMT A;  2R2J A;  2YPM A;  2MYG A;  4XRA A;  1B9X C;  1SU9 A;  5F07 A;  5C00 A;  5HR3 A;  3HVX A;  1DBY A;  1NHY A;  1OE8 A;  5DQY A;  3O3T A;  3RDW A;  1H75 A;  2PUK C;  9GSS A;  4BVX A;  1A8Y A;  1AAZ A;  2B3S A;  4V1A p;  1AW9 A;  3TRQ A;  18GS A;  3Q19 A;  1GSQ A;  2P0G A;  2MMA A;  2G2Q A;  22GS A;  5HFI A;  2LRN A;  3TKS C;  4HZ4 A;  3RPN A;  3F6D A;  5F06 A;  5FT3 A;  1Y25 A;  3CSJ A;  4OFM A;  3Q6O A;  1M2B A;  4JBB A;  3VI7 A;  2FA4 A;  3MAK A;  1ABA A;  2CX3 A;  1GLP A;  3US3 A;  2TRC P;  1YJ6 A;  1ZMA A;  4KDX A;  3DKS A;  1XWA A;  2QKE A;  2C3T A;  4IEL A;  2GSR A;  4JE1 A;  4BPY A;  4PX1 A;  1XWC A;  1Z6M A;  5AIS A;  4IJ3 A;  1C72 A;  4KW6 A;  5B6N A;  3TRP A;  2VOC A;  3UBK A;  6GSX A;  5F8B A;  3A5W A;  4PQ1 A;  2VL9 A;  1V57 A;  1GNE A;  3W6G A;  4E8H A;  1EP7 A;  1LJR A;  2JSZ A;  3TKQ A;  3VPQ A;  2TIR A;  4JRR A;  4MDC A;  2IMK A;  2VL3 A;  2C0D A;  5EPF A;  3VPT A;  5D9T A;  3BOA A;  5CRD A;  1BJX A;  3DD3 A;  1QQ2 A;  4TR0 A;  4GTU A;  4HJ2 A;  4MP4 A;  3GSS A;  5J5N A;  4GSS A;  1DE2 A;  3IE3 A;  1Q98 A;  2VLU A;  2H1A A;  1TRV A;  4QL7 A;  1GTU A;  2PU9 C;  2X99 A;  4J57 E;  1F6M C;  4OD7 A;  1SJ6 A;  4YQU A;  4F2I A;  1B9Y C;  2H6Y A;  3BD2 A;  3UAR A;  2IL3 A;  2V6O A;  5DDL A;  2L5O A;  2VLT A;  2IWT A;  4WEY A;  1K0A A;  5IMZ A;  2NPB A;  1M2D A;  6GSY A;  1G6W A;  3C1R A;  3FY7 A;  1WWJ A;  2PVQ A;  2OAD A;  2K6V A;  1V58 A;  1SKS B;  4TRX A;  4WBR D;  6GSS A;  3ZML A;  1AUC A;  2DBC A;  2HSH A;  2YP6 A;  1WPI A;  2OKA A;  2HLS A;  4KH7 A;  4XS4 A;  3KTB A;  3C1S A;  3QFB C;  4OO4 A;  2RII A;  4KB3 A;  1TXX A;  2IPA A;  2JZS A;  3DIE A;  2YJH A;  2MMZ A;  2OJL A;  2HXK A;  4F9Z A;  5HR1 A;  1SJI A;  4I97 A;  4MJE A;  1F9M A;  1FG4 A;  2C0F A;  2N5A A;  4I2U A;  4WBJ A;  5A4W A;  4BVY A;  3GUS A;  2LS5 A;  2I3Y A;  1PGT A;  2CAQ A;  2LRC A;  3HVS A;  1SEN A;  3GIX A;  4BWQ A;  1S3A A;  5G30 A;  1OYJ A;  1WOU A;  1U3A A;  2DMM A;  3HYP A;  2B7J A;  1M2A A;  4IKH A;  3QOU A;  2YCD A;  1PX7 A;  4ACS A;  3IC4 A;  1E6B A;  1OKD A;  4J2F A;  3LG6 A;  1OE7 A;  3EWL A;  3IR4 A;  4LMV A;  1T1V A;  1FB0 A;  4G2E A;  3L78 A;  3D4T A;  1U6T A;  3EU3 A;  3I69 A;  4ML1 A;  2VCT A;  5G31 A;  1GSU A;  3J7Y k;  2L6D A;  8GSS A;  1THO A;  2IFQ B;  2IMD A;  4KDY A;  5DAL B;  2DSA A;  2HZF A;  2XHF A;  4X1U A;  2H1G A;  4RUV A;  3O76 A;  1K0O A;  3LFL A;  2B5E A;  4K8M A;  1BG5 A;  2HRF A;  5ECM B;  1XW9 A;  2FCH A;  1PL1 A;  2LQQ A;  4O5R A;  5IOW A;  4YQM A;  2WRT A;  3DML A;  5IPG A;  3KMN A;  1AIU A;  2B1K A;  1WRY A;  4EDZ A;  4IW9 A;  12GS A;  4LL1 B;  4GQC A;  4FYU A;  4TN8 A;  4ZL9 A;  1PQN A;  4CDO A;  3BBY A;  1AQX A;  4GRF A;  2H70 A;  1XIY A;  3AY8 A;  4LLR A;  1OAZ A;  3ZIJ A;  1J9B A;  1YKC A;  3ZFL A;  2G0F A;  1GL8 A;  5GZZ B;  1AXD A;  2AJQ B;  5DBQ A;  4NV2 A;  2YOI A;  2GGT A;  1PA3 A;  2WZ9 A;  2L4Q A;  4ZBB A;  2CVD A;  1TRS A;  2EIO A;  5FHI A;  5GSS A;  2YN1 A;  1OC3 A;  2GT6 A;  5DCH A;  4O7H A;  2IMI A;  2F8F A;  1U88 A;  2VCV A;  5IOX A;  4XCS A;  5ECH B;  5ECR B;  1EEM A;  3K8N A;  1ERU A;  1N2A A;  2DJ1 A;  2IFQ A;  1HQO A;  4GST A;  2GZZ A;  2DIY A;  4Z7X A;  3GRX A;  5DAL A;  3Q74 A;  1YKA A;  5A5K A;  1W4V A;  3QR6 A;  2GLR A;  1Z7R A;  1R5A A;  3O6T A;  3KM6 A;  4MJA A;  2ZCT A;  5LNK e;  4LL4 B;  5HFG A;  1GH2 A;  4JR6 A;  20GS A;  2JAC A;  2FWH A;  3LGC A;  2PVO C;  2CVK A;  1X0R A;  2KP1 A;  4RI6 A;  2O89 A;  1Z9H A;  2CT6 A;  3KEB A;  3GTU B;  3P90 A;  5ID2 B;  2HNL A;  3M0F A;  4PQH A;  4GF0 A;  1A2M A;  3VFI A;  4ZB6 A;  3FR3 A;  3FW2 A;  4GQF A;  5B8A A;  2GQM A;  3F9U A;  2OBK A;  3CRU A;  4CW9 A;  2OE0 A;  2C4J A;  2D2Z A;  4ZB9 A;  2PGT A;  3A2W A;  5ABR A;  14GS A;  1MDK A;  3MWH A;  3IA1 A;  2GZY A;  2C1Y A;  1X9S B;  2B7K A;  3HJM A;  4RI7 A;  5HQP A;  1TKD B;  2RM5 A;  4NHZ A;  3FR9 A;  3VLN A;  1GNW A;  1SYX A;  5B7C A;  4ECB A;  1I5G A;  1VF2 A;  2I81 A;  1W89 A;  3LQ7 A;  1B8X A;  4KAE A;  3TJG A;  3BCK A;  1O6J A;  3DWV A;  3KMO A;  1Z3E A;  5DQS A;  2XC2 A;  4KX4 A;  2LV3 A;  3HVV A;  3LYP A;  5GST A;  4KND A;  2H71 A;  5G2Z A;  3EIN A;  3GTU A;  5ID2 A;  3P2A A;  3TKP A;  3GST A;  3HHV A;  2E0Q A;  4ZL8 A;  2GQK A;  4AJ6 A;  4PUR A;  2H1B A;  1TI3 A;  1XOB A;  1IYI A;  2C0E A;  2LRT A;  3G7I A;  4Q5F A;  1F37 A;  5ECQ B;  2ZNM A;  3IK9 A;  5CAX A;  2VUP A;  6GSW A;  1EV9 A;  2AB6 A;  4F82 A;  4V2L A;  2QC7 A;  4PUF C;  4PXO A;  2YV7 A;  3ZZX A;  1UC7 A;  2H1D A;  1PMT A;  2NDO A;  1ST9 A;  2IJY A;  1WIK A;  1UVZ A;  2HFD A;  1ON4 A;  4KGI A;  1GP1 A;  2CVB A;  2GVP A;  2VCW A;  4O32 A;  4FYC A;  1EV4 A;  2DJJ A;  1YY7 A;  4EDY A;  2JL4 A;  3PIN A;  1EEJ A;  3HKR A;  4G19 A;  4N30 A;  1PKW A;  2H8L A;  3U5R E;  1GSD A;  1I9D A;  1ML6 A;  3TB2 A;  1SL2 B;  5CRW A;  1O7U A;  1EGR A;  4TW5 A;  1T00 A;  2K9F A;  2GS3 A;  2YWN A;  3DXB A;  1ILO A;  1TJD A;  3WGX A;  4I6X A;  1QFN A;  1G0T A;  4XTS A;  3IV4 A;  3RHB A;  4E8E A;  2MBT A;  3H1N A;  5J9B A;  3F4S A;  3GX8 A;  4EKZ A;  4YAV A;  3IOS A;  4BA7 A;  3R2Q A;  3ZLP A;  4AF2 A;  3LYK A;  1O85 A;  4EE0 A;  4L5O A;  1F2E A;  5DVB A;  2EC4 A;  3KH7 A;  3KH9 A;  1TRU A;  3NIV A;  3QDN A;  3GH6 A;  3DVW A;  3M3M A;  5COH A;  3H79 A;  3UVT A;  5KN0 A;  1ACV A;  2F9S A;  4QQ7 A;  2H72 A;  4KA0 A;  1MEK A;  4Q5Q A;  3ZYW A;  1A0F A;  1G7E A;  1A24 A;  4NAX A;  1TDI A;  3WGE A;  3L4N A;  1J08 A;  3HZ4 A;  3GN3 A;  3F8U A;  2KHP A;  4XS4 B;  4POM A;  4K7I A;  2YZU A;  3CXG A;  3ERF A;  4IGJ A;  4EF0 A;  4IVF A;  4TXV A;  2P5Q A;  3TCO A;  3DVX A;  4NHW A;  3FHK A;  1QK8 A;  1X9M B;  3L9S A;  4K7O A;  4MCU A;  2KUC A;  3FZA A;  1GUM A;  2VD1 A;  3QMX A;  1XZO A;  2H76 A;  1TU8 A;  4H86 A;  2ALB A;  5D9V A;  4ZBA A;  1NW2 A;  5ELA A;  2IN3 A;  1YEX A;  4OMV A;  1SD8 A;  1JHB A;  3KXO A;  4P3Y B;  3P7X A;  5EY6 A;  1B4P A;  4BL7 A;  1ZYE A;  1E2Y A;  1Y6E A;  2GDR A;  1AC1 A;  3IK7 A;  2JAD A;  2XBQ A;  4X0X A;  5D73 A;  2C80 A;  2L6C A;  3F63 A;  2JZT A;  4I8B A;  1NHO A;  2VD0 A;  3GH9 A;  1MD3 A;  3WD6 A;  4DEJ A;  4MA9 A;  2RUE A;  3ZVJ A;  4D73 A;  1WE0 A;  3TJB A;  1PN9 A;  3LJR A;  3D5J A;  1YQ1 A;  1HNA A;  2V2G A;  3QD9 A;  2IIY A;  2AYT A;  1XBS A;  4HI7 A;  2WCI A;  3ZIV A;  1WMJ A;  4I2T A;  1OVN A;  3QAG A;  3EVI A;  2VM2 A;  5JCW A;  5J9C A;  2LNS A;  3S9F A;  1JZO A;  2X64 A;  3FR6 A;  4POB A;  5FWG A;  3V1W A;  3EU4 A;  4ZL7 A;  2X8G A;  2FNO A;  3GV1 A;  5D9W A;  1B48 A;  1SYR A;  4NPB A;  5KEJ A;  4ID0 A;  1K3O A;  3TKS E;  1NSW A;  1URM A;  4XS6 A;  1THX A;  1FO5 A;  3SWL A;  3UOM A;  2XBI A;  1GUH A;  3I9V 2;  3IPZ A;  1MTC A;  4GSN A;  1PRX A;  5ENU A;  1M7T A;  3ZFB A;  4L8E A;  2I1U A;  2YWI A;  5CP1 A;  4KCE A;  3GX0 A;  3EMP A;  1QGV A;  1GLQ A;  4N10 A;  3ZVJ D;  5EL8 A;  4IBP A;  3FRC A;  4JED A;  3GKN A;  3WYW A;  4WKW A;  3G7Y A;  3F3R A;  1HYU A;  1GSS A;  1NM3 A;  1ZYQ B;  2F8A A;  2H0H A;  5DJM A;  2WGR A;  4XRD A;  5GAN D;  3LXZ A;  1GSE A;  2H74 A;  5DAK B;  1J0F A;  1ZL9 A;  2PN8 A;  1VF4 A;  1HNB A;  4F03 A;  4DSR A;  5IIZ A;  3RAZ A;  4ISD A;  1LBK A;  3KD0 A;  4N0V A;  2OAC A;  2J23 A;  13GS A;  2MMO A;  4IHU A;  1RQM A;  3ZRE A;  2LTK A;  2WFC A;  1BAY A;  2XPD A;  2GST A;  4K0N A;  4TXO B;  5LCZ A;  2DJ2 A;  4AJ8 A;  2HRN A;  1T4Z A;  3LXT A;  2O8V B;  3GHA A;  3ISO A;  2VAF A;  3EC3 A;  3M1G A;  1ZCP A;  2HZE B;  1U87 A;  2V41 A;  1DSB A;  4O92 A;  4V1A g;  2MMN A;  1XVW A;  3KCM A;  2YAN A;  5INY A;  3A3T A;  1ERV A;  1YF0 A;  4EL1 A;  4XS1 A;  1YZX A;  5J41 A;  2DJ3 A;  4K0G A;  1SK0 A;  2H66 A;  1M9A A;  3TKR A;  3HDC A;  1TP9 A;  1JFU A;  1GTA A;  3I6A A;  17GS A;  1X5D A;  2A4V A;  2DIZ A;  4WR4 A;  4ZIL A;  1R7H A;  3F4T A;  3EYT A;  3LWA A;  2AHE A;  3IXR A;  1ZZY A;  4WXT A;  4NWY A;  1U3I A;  1Z7P A;  2VM1 A;  4KCA A;  5DAK A;  1N8J A;  4TR1 B;  2GQL A;  5C04 A;  3HZ8 A;  5DCG A;  1PX6 A;  2VL2 C;  3MDK A;  3A2V A;  7GSS A;  1CQH A;  3DEX A;  3IAM 2;  1XWG A;  3CTG A;  5H5S A;  3GUR A;  1OC9 B;  4I5Q A;  1XFL A;  3D6I A;  4EUY A;  1S3C A;  3WGD A;  3WT1 A;  1HD2 A;  2YZH A;  1VF3 A;  1O8W A;  3E9J B;  4IJI A;  3VWX A;  3M9K A;  5IMC A;  2H0G A;  2HI7 A;  3DGQ A;  2N5B A;  4TXO A;  2VO4 A;  1V98 A;  5KN1 A;  3MNG A;  2I9H A;  5A4V A;  2HZE A;  3FZ9 A;  2DML A;  1BED A;  4DSS B;  3ZIT A;  5D93 A;  3HXS A;  6GSV A;  1RK4 A;  4NMU A;  16GS A;  3RHC A;  2EIR A;  2PPT A;  5ECP B;  2M46 A;  2JZR A;  3KIJ A;  2FWF A;  1K3L A;  3APO A;  5CRE A;  4MPG A;  1R26 A;  2J9H A;  2CA8 A;  5IO2 A;  3E3E A;  1AQW A;  2PER A;  3TJJ A;  5D9X A;  4KSM A;  3HD5 A;  2TRX A;  2LQO A;  3KTL A;  3GL3 A;  10GS A;  1OKT A;  2QGV A;  3CMI A;  4ZXG A;  1XVQ A;  3L0H A;  4IQA A;  1Z5Y E;  5AN1 A;  4TR1 A;  1JZW A;  1F3A A;  4KUN A;  1A23 A;  5IQY A;  1FW1 A;  3HA9 A;  4FYB A;  2VIM A;  2CZ2 A;  3VK9 A;  1OC9 A;  3FEU A;  3C71 A;  3HY2 A;  1XPV A;  4ULX A;  2O87 A;  2WJU A;  3IAS 2;  5ECK B;  5B8B A;  3UBL A;  1M9B A;  1LU4 A;  2R6K A;  2C3N A;  3FZ4 A;  4AGS A;  3L9U A;  2KOK A;  1EOG A;  2M72 A;  4LA1 A;  1ERT A;  3C8E A;  3DRN A;  4DSS A;  4K9Z A;  1SD9 A;  4MZB A;  3GL5 A;  2LUS A;  4K6X A;  2GSQ A;  11GS A;  4ILF A;  3D0Z A;  2AV4 A;  5JWO B;  4IP1 A;  1GTB A;  1H4O A;  5AIV A;  2E2M A;  2K8S A;  1FHE A;  1K0N A;  5E59 A;  3CRT A;  5L71 A;  3CTF A;  4TR3 A;  3ME8 A;  5ELG A;  4BWS A;  3GFK A;  2FWE A;  4HZ2 A;  4WF4 A;  3UJ1 A;  1T4Y A;  3Q18 A;  1SL1 B;  1QXH A;  1EOH A;  5JCU A;  3GMF A;  4K2D A;  1GSY A;  1ERW A;  1XW6 A;  1YDK A;  2K8V A;  3OR5 A;  1R4W A;  3RPP A;  1SL0 B;  1O8X A;  5G1L A;  3C73 A;  4J56 E;  4MZW A;  2YJ7 A;  3LSZ A;  5H5Q A;  4ML6 A;  2BMX A;  2H0I A;  2KLX A;  4K7N A;  2WDU A;  4V2N A;  4WET A;  4ZBD A;  5HR2 A;  1S3D A;  4N0Z A;  2FGX A;  2WB9 A;  1EGO A;  3ERG A;  1T3B A;  3PH9 A;  2F3M A;  1KTE A;  2CV4 A;  2X8C A;  3P8W A;  4DSQ A;  5A4U A;  5EVO A;  2IME A;  5IM9 A;  1SK2 A;  4KE3 A;  2YWO A;  3J7Y b;  2LJK A;  2VCZ A;  5JWQ B;  4MK3 A;  5JWR B;  3ZL5 A;  3EE2 A;  1FVK A;  4K1F A;  1UA5 A;  2E7P A;  3D22 A;  1X9W B;  3N5O A;  4G10 A;  1ZOF A;  2HYX A;  3TUE A;  3GKX A;  2DC5 A;  1A0R P;  1PSQ A;  3H8Q A;  4D73 B;  1MDI A;  4MZC A;  3QAW A;  4L5L A;  4RQR A;  2P5R A;  5CRG A;  2M80 A;  2DJ0 A;  3ZTL A;  2ES7 A;  5ECL B;  2JSY A;  4XHM A;  1JZD A;  3QCP A;  3FZ5 A;  3TDG A;  5G5F A;  3ED3 A;  4TKY A;  2A2S A;  2H30 A;  1BX9 A;  3ME7 A;  4NXI A;  1SJZ A;  2LEG A;  1MDJ A;  3UVH A;  1FOV A;  1XW5 A;  5G5E A;  3NOF A;  2R3X A;  5D8I A;  2LNT A;  1IYH A;  1EP8 A;  3FYG A;  4GWR A;  2YWM A;  1Z6N A;  2BJX A;  2H19 A;  3CBU A;  1M99 A;  4XIH A;  3TRX A;  2N5F A;  4ZIJ A;  4TR4 A;  4PQI A;  2A2R A;  4AJ7 A;  2VCX A;  2E2G A;  3W8S A;  3HJP A;  1O73 A;  3QFA C;  5CNW A;  1M0U A;  4ECC A;  2WS2 A;  2FA8 A;  2CX4 A;  2I4A A;  1TU7 A;  4OFN A;  2QSI A;  5F0G A;  4GCI A;  3IDV A;  4MF5 A;  4DVC A;  5IMD A;  3D21 A;  2DJK A;  2HT9 A;  1CQG A;  4MH3 A;  1SKR B;  1A2L A;  3LOR A;  4POL A;  3CYN A;  3KZQ A;  3F0I A;  3MSZ A;  2GSS A;  4HU9 A;  1USB A;  2NVL A;  2R5G A;  1AQV A;  3KP8 A;  3WT2 A;  2REM A;  3UMA A;  5IMV A;  3FKF A;  1SK1 A;  1B4Q A;  5E4W A;  2AUV A;  1K3Y A;  2CZ3 A;  5ECO B;  3M8N A;  3H93 A;  4YQV A;  2R4V A;  1FAA A;  1FVJ A;  4RQX A;  1TOF A;  2XPE A;  2ZUP A;  2GTU A;  4L0W A;  4HDE A;  2HSY A;  4ECI A;  3JCM L;  5IPH A;  4HJM A;  4ECJ A;  4MJC A;  5HFK A;  1R5P A;  1PD2 1;  4L0U A;  2AAW A;  2PWJ A;  2H73 A;  4LMW A;  5GAP D;  1PL2 A;  1TRW A;  2B5X A;  4OCE A;  4MAB A;  2GT5 A;  4OO5 A;  3IBH A;  2MZC A;  5AIX A;  2H6X A;  3G9B A;  5JCG A;  4OCF A;  4OFT A;  4MJB A;  3BCI A;  3N9J A;  1JZR A;  4OWY A;  3UIW A;  4EXJ A;  5F05 A;  2H01 A;  1TI1 A;  5KN3 A;  1GUL A;  5AGY A;  2LKU A;  3BJ5 A;  2NTO A;  1T7P B;  1FB6 A;  2VL2 A;  3GYK A;  1XOA A;  4WF5 A;  4JR4 A;  5H5R A;  3SBC A;  6GST A;  1KEB A;  2NBS A;  4X43 A;  4IS0 A;  1G7O A;  5LD0 A;  3C7M A;  19GS A;  3HJO A;  1F3B A;  3TOU A;  3KJY A;  3D4M A;  2DLX A;  5ECN B;  4HEA 2;  5CO3 A;  1GSF A;  3APS A;  2V32 A;  3E0U A;  4FO5 A;  3VWU A;  4F0C A;  4POK A;  1YEP A;  1ZGN A;  2K18 A;  3M9J A;  1Q4J A;  4HQS A;  3VI5 A;  3F6F A;  1V2A A;  4IQ1 A;  2RLI A;  4HU7 A;  3UAP A;  6GSU A;  3GKM A;  2P31 A;  2C3Q A;  3GNJ A;  4FIW A;  2X8H A;  2YV9 A;  3I43 A;  1JLV A;  4QL9 A;  4HQZ A;  5J3R A;  1T8E B;  4TOP A;  3VUR A;  4HUA A;  5CYY A;  4JU5 A;  3DYR A;  1O81 A;  4YH2 A;  1TK0 B;  1A2J A;  4GXZ A;  3UL3 A;  4PNG A;  2BTO T;  4YAP A;  1BYE A;  1GWC A;  1VGL A;  3FK8 A;  5HR0 A;  1K0D A;  2L59 A;  2F51 A;  2L5L A;  4EC0 A;  2H75 A;  1TTZ A;  4HS1 A;  1QMV A;  4JZQ A;  1XWB A;  4PUA A;  1RW1 A;  3TGZ A;  3W8J A;  4NV5 A;  1WJK A;  4MMM A;  2Z9S A;  4EO3 A;  2CAI A;  3NZN A;  3ZRD A;  1VRS D;  1XWK A;  1MD4 A;  4MPF A;  4WR5 A;  3GKK A;  3TOT A;  1TW9 A;  3UEM A;  1K0C A;  2VLV A;  2OA7 A;  2MBS A;  5IMA A;  3VWW A;  1XCC A;  1A8L A;  2CQ9 A;  4F0B A;  1G6Y A;  1KNG A;  2B1L A;  3EMX A;  1SKW B;  2FUG 2;  4MF6 A;  2YNX A;  2FHE A;  5IO0 A;  3U6V A;  1GRX A;  3ZMK A;  4ZB8 A;  1GUK A;  4CHS A;  4GLT A;  2KP2 A;  3KGK A;  5DJL A;  3HCZ A;  4PGT A;  4V2M A;  2B5Y A;  4MLY A;  5ECI B;  2FD3 A;  3QAV A;  1V40 A;  1JLW A;  3H4K A;  5CRH A;  3QPM A;  4MH2 A;  2GZP A;  5KN2 A;  2B6M A;  1EZK A;  3ERW A;  3F4R A;  5ECS A;  1DUG A;  2L4C A;  4IP6 A;  3G7J A;  5IMF A;  3VWV A;  2V1M A;  5G1K A;  2LST A;  1K0M A;  2JU5 A; 
#chains in the Genus database with same CATH topology
 3IHQ A;  1DE1 A;  3TJF A;  2RUF A;  3RBT A;  1UN2 A;  3APQ A;  2LJA A;  1EWX A;  4G9H A;  4BVX B;  2EIQ A;  3CSI A;  1KBN A;  3L9V A;  2OE3 A;  4KSO A;  1K0B A;  4MF7 A;  1TK5 B;  4EIQ A;  2LJR A;  3LEF A;  4IN0 A;  1X5C A;  4CY6 A;  2ON7 A;  4N11 A;  2C8U A;  2FLS A;  3IRA A;  2HE3 A;  1YF1 A;  4Q5R A;  2OBI A;  2ON5 A;  2WUL A;  3PR8 A;  3TKS A;  4PNF A;  1VF1 A;  1QUW A;  4Q5N A;  2FWG A;  4HOJ A;  1PN0 A;  1BQ7 A;  3GA4 A;  2FY6 A;  2H6Z A;  4TVE A;  4KDU A;  4FH8 A;  4EVM A;  2PBJ A;  1V9W A;  1GTI A;  2R37 A;  2VCQ A;  3PGT A;  1PKZ A;  2O7K A;  5B6M A;  2C0G A;  3F3Q A;  2L57 A;  3EUR A;  2O85 A;  1WP0 A;  3TJK A;  1OC8 A;  5D96 A;  2RM6 A;  3KP9 A;  2IMF A;  1X5E A;  1XXU A;  3A2X A;  1HNC A;  2OE1 A;  2V6K A;  1TK8 B;  5J4U A;  3CSH A;  2PMT A;  2R2J A;  4K2X A;  2YPM A;  2MYG A;  4XRA A;  1B9X C;  1SU9 A;  5F07 A;  5C00 A;  5HR3 A;  3HVX A;  1DBY A;  1NHY A;  1OE8 A;  5DQY A;  3O3T A;  3RDW A;  3MIX A;  1H75 A;  2PUK C;  9GSS A;  4BVX A;  1A8Y A;  1AAZ A;  2B3S A;  4V1A p;  1AW9 A;  3TRQ A;  18GS A;  3Q19 A;  1GSQ A;  2P0G A;  2MMA A;  2G2Q A;  22GS A;  5HFI A;  4Z2T A;  2LRN A;  3TKS C;  4HZ4 A;  3RPN A;  3F6D A;  5F06 A;  5FT3 A;  1Y25 A;  3CSJ A;  4OFM A;  3Q6O A;  1M2B A;  4JBB A;  3VI7 A;  2FA4 A;  3MAK A;  1ABA A;  2CX3 A;  1GLP A;  3US3 A;  2TRC P;  1YJ6 A;  1ZMA A;  4KDX A;  3DKS A;  1XWA A;  2QKE A;  2C3T A;  4IEL A;  2GSR A;  4JE1 A;  4BPY A;  4PX1 A;  1XWC A;  1Z6M A;  5AIS A;  4IJ3 A;  1C72 A;  4KW6 A;  5B6N A;  3TRP A;  2VOC A;  3UBK A;  6GSX A;  5F8B A;  3A5W A;  4PQ1 A;  2VL9 A;  1V57 A;  1GNE A;  3W6G A;  4E8H A;  1EP7 A;  1LJR A;  2JSZ A;  3TKQ A;  3VPQ A;  2TIR A;  4JRR A;  4MDC A;  2IMK A;  2VL3 A;  2C0D A;  5EPF A;  3VPT A;  5D9T A;  3BOA A;  5CRD A;  1BJX A;  3DD3 A;  1QQ2 A;  4TR0 A;  4BVY B;  4GTU A;  4HJ2 A;  4MP4 A;  3GSS A;  5J5N A;  4GSS A;  1DE2 A;  3IE3 A;  1Q98 A;  2VLU A;  2H1A A;  1TRV A;  4QL7 A;  1GTU A;  2PU9 C;  2X99 A;  4J57 E;  1F6M C;  4OD7 A;  1SJ6 A;  4YQU A;  4F2I A;  1B9Y C;  2H6Y A;  2X4A A;  3BD2 A;  3UAR A;  2IL3 A;  2V6O A;  5DDL A;  2L5O A;  2VLT A;  2IWT A;  4WEY A;  1K0A A;  5IMZ A;  2NPB A;  4Z2R A;  1M2D A;  6GSY A;  1G6W A;  3C1R A;  3FY7 A;  1WWJ A;  2PVQ A;  2OAD A;  2K6V A;  1V58 A;  1SKS B;  4TRX A;  4WBR D;  6GSS A;  3ZML A;  1AUC A;  2DBC A;  2HSH A;  2YP6 A;  4EIP A;  1WPI A;  2OKA A;  2HLS A;  4KH7 A;  4XS4 A;  3KTB A;  3C1S A;  3QFB C;  4OO4 A;  2RII A;  4KB3 A;  1TXX A;  2IPA A;  2JZS A;  3DIE A;  2YJH A;  3CQF A;  4CY8 A;  2MMZ A;  2OJL A;  2HXK A;  4F9Z A;  5HR1 A;  1SJI A;  4I97 A;  4MJE A;  1F9M A;  1FG4 A;  2C0F A;  2N5A A;  4I2U A;  4WBJ A;  5A4W A;  4BVY A;  3GUS A;  2LS5 A;  2R0C A;  2I3Y A;  1PGT A;  2CAQ A;  2LRC A;  3HVS A;  1SEN A;  3GIX A;  4BWQ A;  1S3A A;  5G30 A;  1OYJ A;  1WOU A;  1U3A A;  2DMM A;  3HYP A;  2B7J A;  1M2A A;  4IKH A;  3QOU A;  2YCD A;  1PX7 A;  4ACS A;  3IC4 A;  1E6B A;  1OKD A;  4J2F A;  3LG6 A;  1OE7 A;  3EWL A;  3IR4 A;  4LMV A;  1T1V A;  1FB0 A;  4G2E A;  3L78 A;  3D4T A;  1U6T A;  3EU3 A;  3I69 A;  4ML1 A;  2VCT A;  5G31 A;  1GSU A;  3J7Y k;  2L6D A;  8GSS A;  1THO A;  2IFQ B;  2IMD A;  4KDY A;  5DAL B;  3PPU A;  2DSA A;  2HZF A;  2XHF A;  4X1U A;  2H1G A;  4RUV A;  3O76 A;  1K0O A;  3LFL A;  2B5E A;  4K8M A;  1BG5 A;  2HRF A;  5ECM B;  1M3I A;  1XW9 A;  2FCH A;  1PL1 A;  2LQQ A;  3LW9 A;  4O5R A;  5IOW A;  4YQM A;  2WRT A;  3DML A;  5IPG A;  3KMN A;  1AIU A;  2B1K A;  1WRY A;  4EDZ A;  4IW9 A;  12GS A;  4LL1 B;  4GQC A;  4FYU A;  4TN8 A;  4ZL9 A;  1PQN A;  4CDO A;  3BBY A;  1AQX A;  4GRF A;  2H70 A;  1XIY A;  3AY8 A;  4LLR A;  1OAZ A;  3ZIJ A;  1J9B A;  1YKC A;  3ZFL A;  2G0F A;  1GL8 A;  5GZZ B;  1AXD A;  2AJQ B;  5DBQ A;  4NV2 A;  2YOI A;  2GGT A;  1PA3 A;  2WZ9 A;  2L4Q A;  4ZBB A;  2CVD A;  1TRS A;  2EIO A;  5FHI A;  5GSS A;  2YN1 A;  1OC3 A;  2GT6 A;  5DCH A;  4O7H A;  2IMI A;  2F8F A;  1U88 A;  2VCV A;  5IOX A;  4XCS A;  5ECH B;  5ECR B;  1EEM A;  3K8N A;  1ERU A;  1N2A A;  2DJ1 A;  2IFQ A;  1HQO A;  4GST A;  2GZZ A;  2DIY A;  4Z7X A;  3GRX A;  5DAL A;  3Q74 A;  1YKA A;  5A5K A;  1W4V A;  3QR6 A;  2GLR A;  1Z7R A;  2X49 A;  1R5A A;  3O6T A;  3KM6 A;  4MJA A;  2ZCT A;  5LNK e;  4LL4 B;  5HFG A;  1GH2 A;  4JR6 A;  20GS A;  2JAC A;  2FWH A;  3LGC A;  2PVO C;  2CVK A;  1X0R A;  2KP1 A;  4RI6 A;  2O89 A;  1Z9H A;  2CT6 A;  3KEB A;  3GTU B;  3P90 A;  5ID2 B;  2HNL A;  3M0F A;  4PQH A;  4GF0 A;  1A2M A;  4G0K A;  3VFI A;  4ZB6 A;  3FR3 A;  3FW2 A;  4GQF A;  5B8A A;  2GQM A;  3F9U A;  2OBK A;  3CRU A;  4CW9 A;  2OE0 A;  2C4J A;  1S3R A;  2D2Z A;  4ZB9 A;  2PGT A;  3A2W A;  5ABR A;  14GS A;  2HRA A;  1MDK A;  3MWH A;  4K5R A;  3IA1 A;  2GZY A;  2C1Y A;  1X9S B;  2B7K A;  3HJM A;  4RI7 A;  5HQP A;  1TKD B;  4KF9 A;  2RM5 A;  4NHZ A;  3FR9 A;  3VLN A;  1GNW A;  1SYX A;  5B7C A;  4ECB A;  1I5G A;  1VF2 A;  2I81 A;  1W89 A;  3LQ7 A;  1B8X A;  4KAE A;  3TJG A;  3BCK A;  1O6J A;  3DWV A;  3KMO A;  1Z3E A;  4USS A;  5DQS A;  2XC2 A;  4KX4 A;  2LV3 A;  3R3E A;  3HVV A;  4YKG A;  3LYP A;  5GST A;  4KND A;  2H71 A;  5G2Z A;  3EIN A;  3GTU A;  5ID2 A;  3P2A A;  3TKP A;  3GST A;  3HHV A;  2E0Q A;  4ZL8 A;  2GQK A;  4AJ6 A;  4PUR A;  2H1B A;  1TI3 A;  1XOB A;  1IYI A;  2C0E A;  2LRT A;  3G7I A;  4Q5F A;  1F37 A;  5ECQ B;  2R0G A;  2ZNM A;  3IK9 A;  5CAX A;  2VUP A;  6GSW A;  1EV9 A;  2AB6 A;  4F82 A;  4V2L A;  2QC7 A;  4PUF C;  4PXO A;  2YV7 A;  3ZZX A;  1UC7 A;  2H1D A;  1PMT A;  4PTS A;  2NDO A;  1ST9 A;  2IJY A;  1WIK A;  1UVZ A;  2HFD A;  1ON4 A;  4KGI A;  1GP1 A;  2CVB A;  2GVP A;  2VCW A;  4O32 A;  4FYC A;  1EV4 A;  2DJJ A;  4MNN A;  2HSM A;  1YY7 A;  4EDY A;  2JL4 A;  3PIN A;  1EEJ A;  3HKR A;  4G19 A;  4N30 A;  1PKW A;  2H8L A;  3U5R E;  1GSD A;  1I9D A;  1ML6 A;  3TB2 A;  1SL2 B;  5CRW A;  1O7U A;  1EGR A;  4TW5 A;  1T00 A;  2K9F A;  2GS3 A;  2YWN A;  3DXB A;  1ILO A;  1TJD A;  3WGX A;  4I6X A;  1QFN A;  1G0T A;  4XTS A;  3IV4 A;  3RHB A;  4E8E A;  2MBT A;  3H1N A;  5J9B A;  3F4S A;  3GX8 A;  4EKZ A;  4YAV A;  3IOS A;  4BA7 A;  3R2Q A;  3ZLP A;  4AF2 A;  3LYK A;  1O85 A;  4EE0 A;  4L5O A;  1F2E A;  5DVB A;  2EC4 A;  3KH7 A;  3KH9 A;  1TRU A;  3NIV A;  4BL7 B;  3QDN A;  4O5Q A;  3GH6 A;  3DVW A;  3M3M A;  5COH A;  3H79 A;  3UVT A;  5KN0 A;  1ACV A;  2F9S A;  4QQ7 A;  2H72 A;  5KOW A;  4KA0 A;  1MEK A;  4Q5Q A;  3ZYW A;  1A0F A;  1G7E A;  1A24 A;  4NAX A;  1TDI A;  3WGE A;  3L4N A;  1J08 A;  3HZ4 A;  3GN3 A;  3F8U A;  2KHP A;  4XS4 B;  4POM A;  4K7I A;  2YZU A;  3CXG A;  3ERF A;  4IGJ A;  4EF0 A;  4IVF A;  4TXV A;  2P5Q A;  3TCO A;  3DVX A;  4NHW A;  3FHK A;  1QK8 A;  1X9M B;  3L9S A;  4K7O A;  4MCU A;  2KUC A;  3FZA A;  1GUM A;  2VD1 A;  3QMX A;  1XZO A;  2H76 A;  1TU8 A;  4H86 A;  2ALB A;  5D9V A;  4ZBA A;  1NW2 A;  5ELA A;  2IN3 A;  1YEX A;  4OMV A;  1SD8 A;  1JHB A;  2A4H A;  3KXO A;  4P3Y B;  3P7X A;  5EY6 A;  1B4P A;  4BL7 A;  1ZYE A;  1E2Y A;  1Y6E A;  2GDR A;  1AC1 A;  3IK7 A;  2JAD A;  2XBQ A;  4X0X A;  5D73 A;  2C80 A;  2L6C A;  3F63 A;  2JZT A;  3IC8 A;  4I8B A;  1NHO A;  2VD0 A;  3GH9 A;  1MD3 A;  3WD6 A;  4DEJ A;  3HVN A;  4MA9 A;  2RUE A;  3ZVJ A;  4D73 A;  1WE0 A;  3TJB A;  1PN9 A;  3LJR A;  3D5J A;  1YQ1 A;  1HNA A;  2V2G A;  3QD9 A;  4X4J A;  2IIY A;  2AYT A;  1XBS A;  4HI7 A;  2WCI A;  3ZIV A;  1WMJ A;  4I2T A;  1OVN A;  3QAG A;  3EVI A;  2VM2 A;  5JCW A;  5J9C A;  2LNS A;  3S9F A;  1JZO A;  2X64 A;  3FR6 A;  3IHG A;  4POB A;  5FWG A;  3V1W A;  3EU4 A;  5BRT A;  3MYD A;  4ZL7 A;  2X8G A;  2FNO A;  4G0L A;  3GV1 A;  5D9W A;  1B48 A;  1SYR A;  4NPB A;  5KEJ A;  4ID0 A;  1K3O A;  3TKS E;  1NSW A;  1URM A;  4XS6 A;  1THX A;  1FO5 A;  3SWL A;  3UOM A;  2XBI A;  1GUH A;  3I9V 2;  3IPZ A;  1MTC A;  4GSN A;  1PRX A;  5ENU A;  1M7T A;  3ZFB A;  4L8E A;  2I1U A;  2YWI A;  5CP1 A;  4KCE A;  3GX0 A;  3EMP A;  1QGV A;  1GLQ A;  4N10 A;  3ZVJ D;  5EL8 A;  4IBP A;  3FRC A;  4JED A;  3GKN A;  3WYW A;  4WKW A;  3G7Y A;  3F3R A;  1HYU A;  1GSS A;  1NM3 A;  1ZYQ B;  2F8A A;  2H0H A;  5DJM A;  2WGR A;  4XRD A;  3A5I A;  5GAN D;  3LXZ A;  1GSE A;  2H74 A;  5DAK B;  1J0F A;  1ZL9 A;  2PN8 A;  1VF4 A;  1HNB A;  4F03 A;  4DSR A;  5IIZ A;  3RAZ A;  4ISD A;  1LBK A;  3KD0 A;  1PFO A;  4N0V A;  2OAC A;  2J23 A;  13GS A;  2MMO A;  4IHU A;  1RQM A;  3ZRE A;  2LTK A;  2WFC A;  1BAY A;  2XPD A;  2GST A;  4K0N A;  4TXO B;  5LCZ A;  2DJ2 A;  4AJ8 A;  2HRN A;  1T4Z A;  3LXT A;  2O8V B;  3GHA A;  3ISO A;  2VAF A;  3EC3 A;  3M1G A;  1ZCP A;  2HZE B;  1U87 A;  2V41 A;  1DSB A;  4O92 A;  4V1A g;  2MMN A;  1XVW A;  3KCM A;  2YAN A;  5INY A;  3A3T A;  1ERV A;  1YF0 A;  4EL1 A;  4XS1 A;  1YZX A;  5J41 A;  2DJ3 A;  4K0G A;  1SK0 A;  2H66 A;  4Z2U A;  1M9A A;  3TKR A;  3HDC A;  1TP9 A;  1JFU A;  1GTA A;  3I6A A;  17GS A;  1X5D A;  2A4V A;  2DIZ A;  4WR4 A;  4ZIL A;  1R7H A;  3F4T A;  3EYT A;  3LWA A;  2AHE A;  3IXR A;  1ZZY A;  4WXT A;  4NWY A;  1U3I A;  1Z7P A;  2VM1 A;  4KCA A;  5DAK A;  1N8J A;  4G0I A;  4TR1 B;  2GQL A;  5C04 A;  3HZ8 A;  5DCG A;  1PX6 A;  2VL2 C;  3MDK A;  3A2V A;  7GSS A;  1CQH A;  3DEX A;  3IAM 2;  1XWG A;  3CTG A;  5H5S A;  3GUR A;  1OC9 B;  4I5Q A;  1XFL A;  3D6I A;  4EUY A;  1S3C A;  3WGD A;  3WT1 A;  1HD2 A;  2YZH A;  1VF3 A;  1O8W A;  3E9J B;  4IJI A;  3VWX A;  3M9K A;  5IMC A;  2H0G A;  2HI7 A;  3DGQ A;  2N5B A;  4TXO A;  2VO4 A;  1V98 A;  5KN1 A;  3MNG A;  2I9H A;  5A4V A;  2HZE A;  3FZ9 A;  2DML A;  1BED A;  4DSS B;  3ZIT A;  5D93 A;  3HXS A;  6GSV A;  1RK4 A;  4NMU A;  16GS A;  3RHC A;  2EIR A;  2PPT A;  5ECP B;  2M46 A;  2JZR A;  3KIJ A;  2FWF A;  1K3L A;  3APO A;  5CRE A;  2DKI A;  4MPG A;  1R26 A;  2J9H A;  2CA8 A;  5IO2 A;  3E3E A;  1AQW A;  2PER A;  3TJJ A;  5D9X A;  4KSM A;  3HD5 A;  2TRX A;  2LQO A;  3KTL A;  3GL3 A;  10GS A;  1OKT A;  2QGV A;  3CMI A;  4ZXG A;  1XVQ A;  3L0H A;  4IQA A;  1Z5Y E;  5AN1 A;  4TR1 A;  1JZW A;  1F3A A;  4KUN A;  1A23 A;  5IQY A;  1FW1 A;  3HA9 A;  4FYB A;  2VIM A;  2CZ2 A;  3VK9 A;  1OC9 A;  3FEU A;  2A2P A;  3C71 A;  3HY2 A;  1XPV A;  4ULX A;  2O87 A;  2WJU A;  3IAS 2;  5ECK B;  5B8B A;  3UBL A;  1M9B A;  1LU4 A;  2R6K A;  2C3N A;  3FZ4 A;  4AGS A;  3L9U A;  2KOK A;  1EOG A;  2M72 A;  4LA1 A;  1ERT A;  3C8E A;  3DRN A;  4DSS A;  4K9Z A;  1SD9 A;  4MZB A;  3GL5 A;  2LUS A;  1M3J A;  4K6X A;  2GSQ A;  11GS A;  4ILF A;  3D0Z A;  2AV4 A;  5JWO B;  4IP1 A;  1GTB A;  1H4O A;  5AIV A;  2E2M A;  2K8S A;  1FHE A;  1K0N A;  4BIK A;  5E59 A;  3CRT A;  5L71 A;  3CTF A;  4TR3 A;  3ME8 A;  5ELG A;  4BWS A;  3GFK A;  2FWE A;  4HZ2 A;  4WF4 A;  3UJ1 A;  1T4Y A;  3Q18 A;  1SL1 B;  1QXH A;  1EOH A;  5JCU A;  3GMF A;  4K2D A;  1GSY A;  1ERW A;  1XW6 A;  1YDK A;  2K8V A;  3OR5 A;  1R4W A;  3RPP A;  1SL0 B;  1O8X A;  5G1L A;  3C73 A;  4J56 E;  4MZW A;  2YJ7 A;  3LSZ A;  5H5Q A;  4ML6 A;  2BMX A;  2H0I A;  2KLX A;  4K7N A;  2WDU A;  4V2N A;  4WET A;  4ZBD A;  5HR2 A;  1S3D A;  4N0Z A;  2FGX A;  2WB9 A;  1EGO A;  3ERG A;  1T3B A;  3PH9 A;  2F3M A;  1KTE A;  2CV4 A;  2X8C A;  3P8W A;  4DSQ A;  5A4U A;  5EVO A;  2IME A;  5IM9 A;  1SK2 A;  4KE3 A;  2YWO A;  3J7Y b;  2LJK A;  2VCZ A;  5JWQ B;  4MK3 A;  5JWR B;  3ZL5 A;  3EE2 A;  1FVK A;  4K1F A;  1UA5 A;  2E7P A;  3D22 A;  1X9W B;  3N5O A;  4G10 A;  1ZOF A;  2HYX A;  3TUE A;  3GKX A;  2DC5 A;  1A0R P;  1PSQ A;  4YKF A;  3H8Q A;  4D73 B;  1MDI A;  4MZC A;  3QAW A;  4L5L A;  4RQR A;  2P5R A;  5CRG A;  2M80 A;  2DJ0 A;  3ZTL A;  2ES7 A;  5ECL B;  4HSC X;  2JSY A;  4XHM A;  1JZD A;  3QCP A;  3FZ5 A;  2QA2 A;  3TDG A;  5G5F A;  3ED3 A;  4TKY A;  2A2S A;  2H30 A;  1BX9 A;  3ME7 A;  4NXI A;  1SJZ A;  2LEG A;  1MDJ A;  3UVH A;  1FOV A;  1XW5 A;  5G5E A;  3NOF A;  2R3X A;  5D8I A;  2LNT A;  1IYH A;  1EP8 A;  3FYG A;  4GWR A;  2YWM A;  1Z6N A;  2BJX A;  2H19 A;  3CBU A;  1M99 A;  4XIH A;  3TRX A;  2N5F A;  4ZIJ A;  4TR4 A;  4PQI A;  2A2R A;  4AJ7 A;  2VCX A;  2E2G A;  3W8S A;  3HJP A;  1O73 A;  3QFA C;  5CNW A;  1M0U A;  4ECC A;  2WS2 A;  2FA8 A;  2CX4 A;  2I4A A;  1TU7 A;  4OFN A;  2QSI A;  5F0G A;  4GCI A;  3IDV A;  4MF5 A;  4DVC A;  5IMD A;  3D21 A;  2DJK A;  2HT9 A;  1CQG A;  4MH3 A;  1SKR B;  1A2L A;  3LOR A;  4POL A;  3CYN A;  3KZQ A;  3F0I A;  3MSZ A;  2GSS A;  4HU9 A;  1ZYN A;  1USB A;  2NVL A;  2R5G A;  1AQV A;  3KP8 A;  3WT2 A;  2REM A;  3UMA A;  5IMV A;  3FKF A;  1SK1 A;  1B4Q A;  5E4W A;  2AUV A;  1K3Y A;  2CZ3 A;  5ECO B;  3M8N A;  3H93 A;  4YQV A;  2R4V A;  1FAA A;  1FVJ A;  4RQX A;  1TOF A;  5BMU A;  2XPE A;  2ZUP A;  2GTU A;  4L0W A;  4HDE A;  2HSY A;  1FOH A;  4ECI A;  3JCM L;  5IPH A;  4HJM A;  4ECJ A;  4MJC A;  5HFK A;  1R5P A;  1PD2 1;  4L0U A;  2AAW A;  2PWJ A;  2H73 A;  4LMW A;  5GAP D;  4FQU A;  1PL2 A;  1TRW A;  2B5X A;  4OCE A;  4MAB A;  2GT5 A;  4OO5 A;  3IBH A;  2MZC A;  5AIX A;  2H6X A;  2R0P A;  3G9B A;  5JCG A;  4OCF A;  4OFT A;  4MJB A;  3BCI A;  3N9J A;  2HRK A;  1JZR A;  4OWY A;  3UIW A;  4EXJ A;  5F05 A;  2H01 A;  1TI1 A;  2DKH A;  5KN3 A;  1GUL A;  5AGY A;  2LKU A;  3BJ5 A;  2NTO A;  1T7P B;  1FB6 A;  2VL2 A;  3GYK A;  1XOA A;  4WF5 A;  4JR4 A;  5H5R A;  3SBC A;  6GST A;  1KEB A;  2NBS A;  4X43 A;  4IS0 A;  1G7O A;  5LD0 A;  3C7M A;  19GS A;  3HJO A;  1F3B A;  3TOU A;  3KJY A;  3D4M A;  2DLX A;  5ECN B;  4HEA 2;  5CO3 A;  1GSF A;  3APS A;  2V32 A;  4K5S A;  3E0U A;  4FO5 A;  3VWU A;  4F0C A;  4POK A;  1YEP A;  1ZGN A;  2K18 A;  3M9J A;  1Q4J A;  4HQS A;  3VI5 A;  4A5P A;  3F6F A;  1V2A A;  4IQ1 A;  2RLI A;  4HU7 A;  3UAP A;  6GSU A;  3GKM A;  2P31 A;  2C3Q A;  3GNJ A;  4FIW A;  2X8H A;  2YV9 A;  3I43 A;  1JLV A;  4QL9 A;  4HQZ A;  5J3R A;  1T8E B;  4TOP A;  3VUR A;  4HUA A;  5CYY A;  4JU5 A;  5KOX A;  3DYR A;  1O81 A;  4YH2 A;  1TK0 B;  1A2J A;  4GXZ A;  3UL3 A;  4PNG A;  2BTO T;  4YAP A;  1BYE A;  1GWC A;  1VGL A;  3FK8 A;  5HR0 A;  1K0D A;  2L59 A;  2F51 A;  2L5L A;  4EC0 A;  2H75 A;  1TTZ A;  4HS1 A;  1QMV A;  4JZQ A;  1XWB A;  4PUA A;  1RW1 A;  3TGZ A;  3W8J A;  4NV5 A;  1WJK A;  4MMM A;  3EPT A;  2Z9S A;  4EO3 A;  2CAI A;  3NZN A;  3ZRD A;  1VRS D;  1XWK A;  1MD4 A;  4MPF A;  4WR5 A;  3GKK A;  4ICY A;  3TOT A;  1TW9 A;  3FMW A;  3UEM A;  1K0C A;  2VLV A;  2OA7 A;  2MBS A;  5IMA A;  3VWW A;  4O5U A;  1XCC A;  1A8L A;  1ZYP A;  2QA1 A;  2CQ9 A;  4F0B A;  1G6Y A;  1KNG A;  2B1L A;  3EMX A;  1SKW B;  2FUG 2;  4MF6 A;  2YNX A;  2FHE A;  2UZ8 A;  5IO0 A;  3U6V A;  1GRX A;  3ZMK A;  4ZB8 A;  1GUK A;  4CHS A;  4GLT A;  2KP2 A;  3KGK A;  5DJL A;  3HCZ A;  4PGT A;  4V2M A;  2B5Y A;  4MLY A;  5ECI B;  2FD3 A;  3QAV A;  1V40 A;  1JLW A;  3H4K A;  5CRH A;  3QPM A;  4MH2 A;  2GZP A;  5KN2 A;  2B6M A;  1EZK A;  3ERW A;  3F4R A;  5ECS A;  1DUG A;  2L4C A;  4IP6 A;  1XG8 A;  3G7J A;  5IMF A;  3VWV A;  2V1M A;  5G1K A;  2LST A;  1K0M A;  2JU5 A; 
#chains in the Genus database with same CATH homology
 3IHQ A;  1DE1 A;  3TJF A;  2RUF A;  3RBT A;  1UN2 A;  3APQ A;  2LJA A;  1EWX A;  4G9H A;  4BVX B;  2EIQ A;  3CSI A;  1KBN A;  3L9V A;  2OE3 A;  4KSO A;  1K0B A;  4MF7 A;  1TK5 B;  4EIQ A;  2LJR A;  3LEF A;  4IN0 A;  1X5C A;  4CY6 A;  2ON7 A;  4N11 A;  2C8U A;  2FLS A;  3IRA A;  2HE3 A;  1YF1 A;  4Q5R A;  2OBI A;  2ON5 A;  2WUL A;  3PR8 A;  3TKS A;  4PNF A;  1VF1 A;  1QUW A;  4Q5N A;  2FWG A;  4HOJ A;  1PN0 A;  1BQ7 A;  3GA4 A;  2FY6 A;  2H6Z A;  4TVE A;  4KDU A;  4FH8 A;  4EVM A;  2PBJ A;  1V9W A;  1GTI A;  2R37 A;  2VCQ A;  3PGT A;  1PKZ A;  2O7K A;  5B6M A;  2C0G A;  3F3Q A;  2L57 A;  3EUR A;  2O85 A;  1WP0 A;  3TJK A;  1OC8 A;  5D96 A;  2RM6 A;  3KP9 A;  2IMF A;  1X5E A;  1XXU A;  3A2X A;  1HNC A;  2OE1 A;  2V6K A;  1TK8 B;  5J4U A;  3CSH A;  2PMT A;  2R2J A;  4K2X A;  2YPM A;  2MYG A;  4XRA A;  1B9X C;  1SU9 A;  5F07 A;  5C00 A;  5HR3 A;  3HVX A;  1DBY A;  1NHY A;  1OE8 A;  5DQY A;  3O3T A;  3RDW A;  3MIX A;  1H75 A;  2PUK C;  9GSS A;  4BVX A;  1A8Y A;  1AAZ A;  2B3S A;  4V1A p;  1AW9 A;  3TRQ A;  18GS A;  3Q19 A;  1GSQ A;  2P0G A;  2MMA A;  2G2Q A;  22GS A;  5HFI A;  4Z2T A;  2LRN A;  3TKS C;  4HZ4 A;  3RPN A;  3F6D A;  5F06 A;  5FT3 A;  1Y25 A;  3CSJ A;  4OFM A;  3Q6O A;  1M2B A;  4JBB A;  3VI7 A;  2FA4 A;  3MAK A;  1ABA A;  2CX3 A;  1GLP A;  3US3 A;  2TRC P;  1YJ6 A;  1ZMA A;  4KDX A;  3DKS A;  1XWA A;  2QKE A;  2C3T A;  4IEL A;  2GSR A;  4JE1 A;  4BPY A;  4PX1 A;  1XWC A;  1Z6M A;  5AIS A;  4IJ3 A;  1C72 A;  4KW6 A;  5B6N A;  3TRP A;  2VOC A;  3UBK A;  6GSX A;  5F8B A;  3A5W A;  4PQ1 A;  2VL9 A;  1V57 A;  1GNE A;  3W6G A;  4E8H A;  1EP7 A;  1LJR A;  2JSZ A;  3TKQ A;  3VPQ A;  2TIR A;  4JRR A;  4MDC A;  2IMK A;  2VL3 A;  2C0D A;  5EPF A;  3VPT A;  5D9T A;  3BOA A;  5CRD A;  1BJX A;  3DD3 A;  1QQ2 A;  4TR0 A;  4BVY B;  4GTU A;  4HJ2 A;  4MP4 A;  3GSS A;  5J5N A;  4GSS A;  1DE2 A;  3IE3 A;  1Q98 A;  2VLU A;  2H1A A;  1TRV A;  4QL7 A;  1GTU A;  2PU9 C;  2X99 A;  4J57 E;  1F6M C;  4OD7 A;  1SJ6 A;  4YQU A;  4F2I A;  1B9Y C;  2H6Y A;  2X4A A;  3BD2 A;  3UAR A;  2IL3 A;  2V6O A;  5DDL A;  2L5O A;  2VLT A;  2IWT A;  4WEY A;  1K0A A;  5IMZ A;  2NPB A;  4Z2R A;  1M2D A;  6GSY A;  1G6W A;  3C1R A;  3FY7 A;  1WWJ A;  2PVQ A;  2OAD A;  2K6V A;  1V58 A;  1SKS B;  4TRX A;  4WBR D;  6GSS A;  3ZML A;  1AUC A;  2DBC A;  2HSH A;  2YP6 A;  4EIP A;  1WPI A;  2OKA A;  2HLS A;  4KH7 A;  4XS4 A;  3KTB A;  3C1S A;  3QFB C;  4OO4 A;  2RII A;  4KB3 A;  1TXX A;  2IPA A;  2JZS A;  3DIE A;  2YJH A;  4CY8 A;  2MMZ A;  2OJL A;  2HXK A;  4F9Z A;  5HR1 A;  1SJI A;  4I97 A;  4MJE A;  1F9M A;  1FG4 A;  2C0F A;  2N5A A;  4I2U A;  4WBJ A;  5A4W A;  4BVY A;  3GUS A;  2LS5 A;  2R0C A;  2I3Y A;  1PGT A;  2CAQ A;  2LRC A;  3HVS A;  1SEN A;  3GIX A;  4BWQ A;  1S3A A;  5G30 A;  1OYJ A;  1WOU A;  1U3A A;  2DMM A;  3HYP A;  2B7J A;  1M2A A;  4IKH A;  3QOU A;  2YCD A;  1PX7 A;  4ACS A;  3IC4 A;  1E6B A;  1OKD A;  4J2F A;  3LG6 A;  1OE7 A;  3EWL A;  3IR4 A;  4LMV A;  1T1V A;  1FB0 A;  4G2E A;  3L78 A;  3D4T A;  1U6T A;  3EU3 A;  3I69 A;  4ML1 A;  2VCT A;  5G31 A;  1GSU A;  3J7Y k;  2L6D A;  8GSS A;  1THO A;  2IFQ B;  2IMD A;  4KDY A;  5DAL B;  3PPU A;  2DSA A;  2HZF A;  2XHF A;  4X1U A;  2H1G A;  4RUV A;  3O76 A;  1K0O A;  3LFL A;  2B5E A;  4K8M A;  1BG5 A;  2HRF A;  5ECM B;  1XW9 A;  2FCH A;  1PL1 A;  2LQQ A;  3LW9 A;  4O5R A;  5IOW A;  4YQM A;  2WRT A;  3DML A;  5IPG A;  3KMN A;  1AIU A;  2B1K A;  1WRY A;  4EDZ A;  4IW9 A;  12GS A;  4LL1 B;  4GQC A;  4FYU A;  4TN8 A;  4ZL9 A;  1PQN A;  4CDO A;  3BBY A;  1AQX A;  4GRF A;  2H70 A;  1XIY A;  3AY8 A;  4LLR A;  1OAZ A;  3ZIJ A;  1J9B A;  1YKC A;  3ZFL A;  2G0F A;  1GL8 A;  5GZZ B;  1AXD A;  2AJQ B;  5DBQ A;  4NV2 A;  2YOI A;  2GGT A;  1PA3 A;  2WZ9 A;  2L4Q A;  4ZBB A;  2CVD A;  1TRS A;  2EIO A;  5FHI A;  5GSS A;  2YN1 A;  1OC3 A;  2GT6 A;  5DCH A;  4O7H A;  2IMI A;  2F8F A;  1U88 A;  2VCV A;  5IOX A;  4XCS A;  5ECH B;  5ECR B;  1EEM A;  3K8N A;  1ERU A;  1N2A A;  2DJ1 A;  2IFQ A;  1HQO A;  4GST A;  2GZZ A;  2DIY A;  4Z7X A;  3GRX A;  5DAL A;  3Q74 A;  1YKA A;  5A5K A;  1W4V A;  3QR6 A;  2GLR A;  1Z7R A;  2X49 A;  1R5A A;  3O6T A;  3KM6 A;  4MJA A;  2ZCT A;  5LNK e;  4LL4 B;  5HFG A;  1GH2 A;  4JR6 A;  20GS A;  2JAC A;  2FWH A;  3LGC A;  2PVO C;  2CVK A;  1X0R A;  2KP1 A;  4RI6 A;  2O89 A;  1Z9H A;  2CT6 A;  3KEB A;  3GTU B;  3P90 A;  5ID2 B;  2HNL A;  3M0F A;  4PQH A;  4GF0 A;  1A2M A;  4G0K A;  3VFI A;  4ZB6 A;  3FR3 A;  3FW2 A;  4GQF A;  5B8A A;  2GQM A;  3F9U A;  2OBK A;  3CRU A;  4CW9 A;  2OE0 A;  2C4J A;  2D2Z A;  4ZB9 A;  2PGT A;  3A2W A;  5ABR A;  14GS A;  2HRA A;  1MDK A;  3MWH A;  4K5R A;  3IA1 A;  2GZY A;  2C1Y A;  1X9S B;  2B7K A;  3HJM A;  4RI7 A;  5HQP A;  1TKD B;  4KF9 A;  2RM5 A;  4NHZ A;  3FR9 A;  3VLN A;  1GNW A;  1SYX A;  5B7C A;  4ECB A;  1I5G A;  1VF2 A;  2I81 A;  1W89 A;  3LQ7 A;  1B8X A;  4KAE A;  3TJG A;  3BCK A;  1O6J A;  3DWV A;  3KMO A;  1Z3E A;  4USS A;  5DQS A;  2XC2 A;  4KX4 A;  2LV3 A;  3R3E A;  3HVV A;  4YKG A;  3LYP A;  5GST A;  4KND A;  2H71 A;  5G2Z A;  3EIN A;  3GTU A;  5ID2 A;  3P2A A;  3TKP A;  3GST A;  3HHV A;  2E0Q A;  4ZL8 A;  2GQK A;  4AJ6 A;  4PUR A;  2H1B A;  1TI3 A;  1XOB A;  1IYI A;  2C0E A;  2LRT A;  3G7I A;  4Q5F A;  1F37 A;  5ECQ B;  2R0G A;  2ZNM A;  3IK9 A;  5CAX A;  2VUP A;  6GSW A;  1EV9 A;  2AB6 A;  4F82 A;  4V2L A;  2QC7 A;  4PUF C;  4PXO A;  2YV7 A;  3ZZX A;  1UC7 A;  2H1D A;  1PMT A;  4PTS A;  2NDO A;  1ST9 A;  2IJY A;  1WIK A;  1UVZ A;  2HFD A;  1ON4 A;  4KGI A;  1GP1 A;  2CVB A;  2GVP A;  2VCW A;  4O32 A;  4FYC A;  1EV4 A;  2DJJ A;  4MNN A;  2HSM A;  1YY7 A;  4EDY A;  2JL4 A;  3PIN A;  1EEJ A;  3HKR A;  4G19 A;  4N30 A;  1PKW A;  2H8L A;  3U5R E;  1GSD A;  1I9D A;  1ML6 A;  3TB2 A;  1SL2 B;  5CRW A;  1O7U A;  1EGR A;  4TW5 A;  1T00 A;  2K9F A;  2GS3 A;  2YWN A;  3DXB A;  1ILO A;  1TJD A;  3WGX A;  4I6X A;  1QFN A;  1G0T A;  4XTS A;  3IV4 A;  3RHB A;  4E8E A;  2MBT A;  3H1N A;  5J9B A;  3F4S A;  3GX8 A;  4EKZ A;  4YAV A;  3IOS A;  4BA7 A;  3R2Q A;  3ZLP A;  4AF2 A;  3LYK A;  1O85 A;  4EE0 A;  4L5O A;  1F2E A;  5DVB A;  2EC4 A;  3KH7 A;  3KH9 A;  1TRU A;  3NIV A;  4BL7 B;  3QDN A;  4O5Q A;  3GH6 A;  3DVW A;  3M3M A;  5COH A;  3H79 A;  3UVT A;  5KN0 A;  1ACV A;  2F9S A;  4QQ7 A;  2H72 A;  5KOW A;  4KA0 A;  1MEK A;  4Q5Q A;  3ZYW A;  1A0F A;  1G7E A;  1A24 A;  4NAX A;  1TDI A;  3WGE A;  3L4N A;  1J08 A;  3HZ4 A;  3GN3 A;  3F8U A;  2KHP A;  4XS4 B;  4POM A;  4K7I A;  2YZU A;  3CXG A;  3ERF A;  4IGJ A;  4EF0 A;  4IVF A;  4TXV A;  2P5Q A;  3TCO A;  3DVX A;  4NHW A;  3FHK A;  1QK8 A;  1X9M B;  3L9S A;  4K7O A;  4MCU A;  2KUC A;  3FZA A;  1GUM A;  2VD1 A;  3QMX A;  1XZO A;  2H76 A;  1TU8 A;  4H86 A;  2ALB A;  5D9V A;  4ZBA A;  1NW2 A;  5ELA A;  2IN3 A;  1YEX A;  4OMV A;  1SD8 A;  1JHB A;  2A4H A;  3KXO A;  4P3Y B;  3P7X A;  5EY6 A;  1B4P A;  4BL7 A;  1ZYE A;  1E2Y A;  1Y6E A;  2GDR A;  1AC1 A;  3IK7 A;  2JAD A;  2XBQ A;  4X0X A;  5D73 A;  2C80 A;  2L6C A;  3F63 A;  2JZT A;  3IC8 A;  4I8B A;  1NHO A;  2VD0 A;  3GH9 A;  1MD3 A;  3WD6 A;  4DEJ A;  4MA9 A;  2RUE A;  3ZVJ A;  4D73 A;  1WE0 A;  3TJB A;  1PN9 A;  3LJR A;  3D5J A;  1YQ1 A;  1HNA A;  2V2G A;  3QD9 A;  4X4J A;  2IIY A;  2AYT A;  1XBS A;  4HI7 A;  2WCI A;  3ZIV A;  1WMJ A;  4I2T A;  1OVN A;  3QAG A;  3EVI A;  2VM2 A;  5JCW A;  5J9C A;  2LNS A;  3S9F A;  1JZO A;  2X64 A;  3FR6 A;  3IHG A;  4POB A;  5FWG A;  3V1W A;  3EU4 A;  5BRT A;  3MYD A;  4ZL7 A;  2X8G A;  2FNO A;  4G0L A;  3GV1 A;  5D9W A;  1B48 A;  1SYR A;  4NPB A;  5KEJ A;  4ID0 A;  1K3O A;  3TKS E;  1NSW A;  1URM A;  4XS6 A;  1THX A;  1FO5 A;  3SWL A;  3UOM A;  2XBI A;  1GUH A;  3I9V 2;  3IPZ A;  1MTC A;  4GSN A;  1PRX A;  5ENU A;  1M7T A;  3ZFB A;  4L8E A;  2I1U A;  2YWI A;  5CP1 A;  4KCE A;  3GX0 A;  3EMP A;  1QGV A;  1GLQ A;  4N10 A;  3ZVJ D;  5EL8 A;  4IBP A;  3FRC A;  4JED A;  3GKN A;  3WYW A;  4WKW A;  3G7Y A;  3F3R A;  1HYU A;  1GSS A;  1NM3 A;  1ZYQ B;  2F8A A;  2H0H A;  5DJM A;  2WGR A;  4XRD A;  3A5I A;  5GAN D;  3LXZ A;  1GSE A;  2H74 A;  5DAK B;  1J0F A;  1ZL9 A;  2PN8 A;  1VF4 A;  1HNB A;  4F03 A;  4DSR A;  5IIZ A;  3RAZ A;  4ISD A;  1LBK A;  3KD0 A;  4N0V A;  2OAC A;  2J23 A;  13GS A;  2MMO A;  4IHU A;  1RQM A;  3ZRE A;  2LTK A;  2WFC A;  1BAY A;  2XPD A;  2GST A;  4K0N A;  4TXO B;  5LCZ A;  2DJ2 A;  4AJ8 A;  2HRN A;  1T4Z A;  3LXT A;  2O8V B;  3GHA A;  3ISO A;  2VAF A;  3EC3 A;  3M1G A;  1ZCP A;  2HZE B;  1U87 A;  2V41 A;  1DSB A;  4O92 A;  4V1A g;  2MMN A;  1XVW A;  3KCM A;  2YAN A;  5INY A;  3A3T A;  1ERV A;  1YF0 A;  4EL1 A;  4XS1 A;  1YZX A;  5J41 A;  2DJ3 A;  4K0G A;  1SK0 A;  2H66 A;  4Z2U A;  1M9A A;  3TKR A;  3HDC A;  1TP9 A;  1JFU A;  1GTA A;  3I6A A;  17GS A;  1X5D A;  2A4V A;  2DIZ A;  4WR4 A;  4ZIL A;  1R7H A;  3F4T A;  3EYT A;  3LWA A;  2AHE A;  3IXR A;  1ZZY A;  4WXT A;  4NWY A;  1U3I A;  1Z7P A;  2VM1 A;  4KCA A;  5DAK A;  1N8J A;  4G0I A;  4TR1 B;  2GQL A;  5C04 A;  3HZ8 A;  5DCG A;  1PX6 A;  2VL2 C;  3MDK A;  3A2V A;  7GSS A;  1CQH A;  3DEX A;  3IAM 2;  1XWG A;  3CTG A;  5H5S A;  3GUR A;  1OC9 B;  4I5Q A;  1XFL A;  3D6I A;  4EUY A;  1S3C A;  3WGD A;  3WT1 A;  1HD2 A;  2YZH A;  1VF3 A;  1O8W A;  3E9J B;  4IJI A;  3VWX A;  3M9K A;  5IMC A;  2H0G A;  2HI7 A;  3DGQ A;  2N5B A;  4TXO A;  2VO4 A;  1V98 A;  5KN1 A;  3MNG A;  2I9H A;  5A4V A;  2HZE A;  3FZ9 A;  2DML A;  1BED A;  4DSS B;  3ZIT A;  5D93 A;  3HXS A;  6GSV A;  1RK4 A;  4NMU A;  16GS A;  3RHC A;  2EIR A;  2PPT A;  5ECP B;  2M46 A;  2JZR A;  3KIJ A;  2FWF A;  1K3L A;  3APO A;  5CRE A;  2DKI A;  4MPG A;  1R26 A;  2J9H A;  2CA8 A;  5IO2 A;  3E3E A;  1AQW A;  2PER A;  3TJJ A;  5D9X A;  4KSM A;  3HD5 A;  2TRX A;  2LQO A;  3KTL A;  3GL3 A;  10GS A;  1OKT A;  2QGV A;  3CMI A;  4ZXG A;  1XVQ A;  3L0H A;  4IQA A;  1Z5Y E;  5AN1 A;  4TR1 A;  1JZW A;  1F3A A;  4KUN A;  1A23 A;  5IQY A;  1FW1 A;  3HA9 A;  4FYB A;  2VIM A;  2CZ2 A;  3VK9 A;  1OC9 A;  3FEU A;  2A2P A;  3C71 A;  3HY2 A;  1XPV A;  4ULX A;  2O87 A;  2WJU A;  3IAS 2;  5ECK B;  5B8B A;  3UBL A;  1M9B A;  1LU4 A;  2R6K A;  2C3N A;  3FZ4 A;  4AGS A;  3L9U A;  2KOK A;  1EOG A;  2M72 A;  4LA1 A;  1ERT A;  3C8E A;  3DRN A;  4DSS A;  4K9Z A;  1SD9 A;  4MZB A;  3GL5 A;  2LUS A;  4K6X A;  2GSQ A;  11GS A;  4ILF A;  3D0Z A;  2AV4 A;  5JWO B;  4IP1 A;  1GTB A;  1H4O A;  5AIV A;  2E2M A;  2K8S A;  1FHE A;  1K0N A;  5E59 A;  3CRT A;  5L71 A;  3CTF A;  4TR3 A;  3ME8 A;  5ELG A;  4BWS A;  3GFK A;  2FWE A;  4HZ2 A;  4WF4 A;  3UJ1 A;  1T4Y A;  3Q18 A;  1SL1 B;  1QXH A;  1EOH A;  5JCU A;  3GMF A;  4K2D A;  1GSY A;  1ERW A;  1XW6 A;  1YDK A;  2K8V A;  3OR5 A;  1R4W A;  3RPP A;  1SL0 B;  1O8X A;  5G1L A;  3C73 A;  4J56 E;  4MZW A;  2YJ7 A;  3LSZ A;  5H5Q A;  4ML6 A;  2BMX A;  2H0I A;  2KLX A;  4K7N A;  2WDU A;  4V2N A;  4WET A;  4ZBD A;  5HR2 A;  1S3D A;  4N0Z A;  2FGX A;  2WB9 A;  1EGO A;  3ERG A;  1T3B A;  3PH9 A;  2F3M A;  1KTE A;  2CV4 A;  2X8C A;  3P8W A;  4DSQ A;  5A4U A;  5EVO A;  2IME A;  5IM9 A;  1SK2 A;  4KE3 A;  2YWO A;  3J7Y b;  2LJK A;  2VCZ A;  5JWQ B;  4MK3 A;  5JWR B;  3ZL5 A;  3EE2 A;  1FVK A;  4K1F A;  1UA5 A;  2E7P A;  3D22 A;  1X9W B;  3N5O A;  4G10 A;  1ZOF A;  2HYX A;  3TUE A;  3GKX A;  2DC5 A;  1A0R P;  1PSQ A;  4YKF A;  3H8Q A;  4D73 B;  1MDI A;  4MZC A;  3QAW A;  4L5L A;  4RQR A;  2P5R A;  5CRG A;  2M80 A;  2DJ0 A;  3ZTL A;  2ES7 A;  5ECL B;  2JSY A;  4XHM A;  1JZD A;  3QCP A;  3FZ5 A;  2QA2 A;  3TDG A;  5G5F A;  3ED3 A;  4TKY A;  2A2S A;  2H30 A;  1BX9 A;  3ME7 A;  4NXI A;  1SJZ A;  2LEG A;  1MDJ A;  3UVH A;  1FOV A;  1XW5 A;  5G5E A;  3NOF A;  2R3X A;  5D8I A;  2LNT A;  1IYH A;  1EP8 A;  3FYG A;  4GWR A;  2YWM A;  1Z6N A;  2BJX A;  2H19 A;  3CBU A;  1M99 A;  4XIH A;  3TRX A;  2N5F A;  4ZIJ A;  4TR4 A;  4PQI A;  2A2R A;  4AJ7 A;  2VCX A;  2E2G A;  3W8S A;  3HJP A;  1O73 A;  3QFA C;  5CNW A;  1M0U A;  4ECC A;  2WS2 A;  2FA8 A;  2CX4 A;  2I4A A;  1TU7 A;  4OFN A;  2QSI A;  5F0G A;  4GCI A;  3IDV A;  4MF5 A;  4DVC A;  5IMD A;  3D21 A;  2DJK A;  2HT9 A;  1CQG A;  4MH3 A;  1SKR B;  1A2L A;  3LOR A;  4POL A;  3CYN A;  3KZQ A;  3F0I A;  3MSZ A;  2GSS A;  4HU9 A;  1ZYN A;  1USB A;  2NVL A;  2R5G A;  1AQV A;  3KP8 A;  3WT2 A;  2REM A;  3UMA A;  5IMV A;  3FKF A;  1SK1 A;  1B4Q A;  5E4W A;  2AUV A;  1K3Y A;  2CZ3 A;  5ECO B;  3M8N A;  3H93 A;  4YQV A;  2R4V A;  1FAA A;  1FVJ A;  4RQX A;  1TOF A;  5BMU A;  2XPE A;  2ZUP A;  2GTU A;  4L0W A;  4HDE A;  2HSY A;  1FOH A;  4ECI A;  3JCM L;  5IPH A;  4HJM A;  4ECJ A;  4MJC A;  5HFK A;  1R5P A;  1PD2 1;  4L0U A;  2AAW A;  2PWJ A;  2H73 A;  4LMW A;  5GAP D;  4FQU A;  1PL2 A;  1TRW A;  2B5X A;  4OCE A;  4MAB A;  2GT5 A;  4OO5 A;  3IBH A;  2MZC A;  5AIX A;  2H6X A;  2R0P A;  3G9B A;  5JCG A;  4OCF A;  4OFT A;  4MJB A;  3BCI A;  3N9J A;  2HRK A;  1JZR A;  4OWY A;  3UIW A;  4EXJ A;  5F05 A;  2H01 A;  1TI1 A;  2DKH A;  5KN3 A;  1GUL A;  5AGY A;  2LKU A;  3BJ5 A;  2NTO A;  1T7P B;  1FB6 A;  2VL2 A;  3GYK A;  1XOA A;  4WF5 A;  4JR4 A;  5H5R A;  3SBC A;  6GST A;  1KEB A;  2NBS A;  4X43 A;  4IS0 A;  1G7O A;  5LD0 A;  3C7M A;  19GS A;  3HJO A;  1F3B A;  3TOU A;  3KJY A;  3D4M A;  2DLX A;  5ECN B;  4HEA 2;  5CO3 A;  1GSF A;  3APS A;  2V32 A;  4K5S A;  3E0U A;  4FO5 A;  3VWU A;  4F0C A;  4POK A;  1YEP A;  1ZGN A;  2K18 A;  3M9J A;  1Q4J A;  4HQS A;  3VI5 A;  4A5P A;  3F6F A;  1V2A A;  4IQ1 A;  2RLI A;  4HU7 A;  3UAP A;  6GSU A;  3GKM A;  2P31 A;  2C3Q A;  3GNJ A;  4FIW A;  2X8H A;  2YV9 A;  3I43 A;  1JLV A;  4QL9 A;  4HQZ A;  5J3R A;  1T8E B;  4TOP A;  3VUR A;  4HUA A;  5CYY A;  4JU5 A;  5KOX A;  3DYR A;  1O81 A;  4YH2 A;  1TK0 B;  1A2J A;  4GXZ A;  3UL3 A;  4PNG A;  2BTO T;  4YAP A;  1BYE A;  1GWC A;  1VGL A;  3FK8 A;  5HR0 A;  1K0D A;  2L59 A;  2F51 A;  2L5L A;  4EC0 A;  2H75 A;  1TTZ A;  4HS1 A;  1QMV A;  4JZQ A;  1XWB A;  4PUA A;  1RW1 A;  3TGZ A;  3W8J A;  4NV5 A;  1WJK A;  4MMM A;  3EPT A;  2Z9S A;  4EO3 A;  2CAI A;  3NZN A;  3ZRD A;  1VRS D;  1XWK A;  1MD4 A;  4MPF A;  4WR5 A;  3GKK A;  4ICY A;  3TOT A;  1TW9 A;  3FMW A;  3UEM A;  1K0C A;  2VLV A;  2OA7 A;  2MBS A;  5IMA A;  3VWW A;  4O5U A;  1XCC A;  1A8L A;  1ZYP A;  2QA1 A;  2CQ9 A;  4F0B A;  1G6Y A;  1KNG A;  2B1L A;  3EMX A;  1SKW B;  2FUG 2;  4MF6 A;  2YNX A;  2FHE A;  2UZ8 A;  5IO0 A;  3U6V A;  1GRX A;  3ZMK A;  4ZB8 A;  1GUK A;  4CHS A;  4GLT A;  2KP2 A;  3KGK A;  5DJL A;  3HCZ A;  4PGT A;  4V2M A;  2B5Y A;  4MLY A;  5ECI B;  2FD3 A;  3QAV A;  1V40 A;  1JLW A;  3H4K A;  5CRH A;  3QPM A;  4MH2 A;  2GZP A;  5KN2 A;  2B6M A;  1EZK A;  3ERW A;  3F4R A;  5ECS A;  1DUG A;  2L4C A;  4IP6 A;  3G7J A;  5IMF A;  3VWV A;  2V1M A;  5G1K A;  2LST A;  1K0M A;  2JU5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...