2P31A

Crystal structure of human glutathione peroxidase 7
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
155
structure length
155
Chain Sequence
QDFYDFKAVNIRGKLVSLEKYRGSVSLVVNVASECGFTDQHYRALQQLQRDLGPHHFNVLAFPCNQFGQQEPDSNKEIESFARRTYSVSFPMFSKIAVTGTGAHPAFKYLAQTSGKEPTWNFWKYLVAPDGKVVGAWDPTVSVEEVRPQITALVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione peroxidase 7
publication title Crystal structure of human glutathione peroxidase 7
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 50
structure length 155
sequence length 155
chains with identical sequence B
ec nomenclature ec 1.11.1.9: Glutathione peroxidase.
pdb deposition date 2007-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00255 GSHPx Glutathione peroxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2p31A00
3GL3A 4ZBDA 3WYWA 4EL1A 5G1KA 5CYYA 1F3AA 5IO2A 2C80A 4E8HA 2KLXA 1OVNA 4IJIA 4ZBBA 1M99A 1FG4A 2X99A 4MMMA 2REMA 4JU5A 3W6GA 1SYXA 4HZ4A 1EV9A 2ON7A 1GRXA 3EURA 1GUKA 1JZOA 2H0IA 5IMFA 2LQQA 5CRDA 3DGQA 2R2JA 2P31A 2L6DA 3C8EA 2KP1A 3HY2A 5JCWA 3ME7A 3UBLA 5EPFA 3UBKA 1SKWB 2BJXA 2G2QA 3L9UA 5ECLB 2WDUA 3CTGA 3M9KA 2LKUA 4IN0A 1O6JA 3ZIJA 2ZUPA 5J4UA 3AY8A 5DALA 2MZCA 4XRAA 2YWNA 2R4VA 4O32A 1TK0B 3HHVA 1TRSA 4N10A 3TCOA 4TOPA 1EOHA 3HJMA 4HJMA 1AQXA 2AV4A 2VOCA 2WCIA 2FWGA 1ML6A 2YJ7A 2TRCP 4GTUA 6GSXA 2MMAA 3JCML 1KTEA 1KNGA 1XW9A 4XIHA 3HVSA 2YP6A 3GFKA 1SD9A 4V2MA 1GSQA 4OFMA 2R3XA 3ZMLA 4KNDA 2JSYA 3D5JA 5CRGA 3TJJA 2XBQA 1N2AA 3DRNA 3GHAA 3KH9A 1G7EA 1ZCPA 3GKKA 4N0VA 4XCSA 2WS2A 1RK4A 1SJIA 1X9MB 2XBIA 4HS1A 3ZYWA 2VCXA 1CQHA 1Z7PA 3GN3A 3H4KA 1G6WA 2HRNA 2KHPA 1LBKA 4IP6A 4MA9A 4ISDA 3TKSA 5ECPB 1O7UA 2H74A 1FAAA 3FRCA 2FWHA 1DSBA 4XS6A 4I5QA 5FT3A 3EINA 4KW6A 3VLNA 4V1Ag 2CQ9A 1T4ZA 2IFQB 1A0FA 2GVPA 2F3MA 1PN9A 2DMMA 1X9WB 1TOFA 4JZQA 5HQPA 2YZUA 2WRTA 4KCEA 4LMVA 1MDIA 3GV1A 6GSVA 1F2EA 1T8EB 1GWCA 5B7CA 3EYTA 2F8AA 4MF6A 3QFBC 4H86A 3QR6A 4HI7A 2LJAA 18GSA 2E0QA 4D73A 2LS5A 5A5KA 1B4PA 3V1WA 1WJKA 3LXZA 5ELGA 1PSQA 4F82A 1FO5A 1V58A 5H5RA 4NV5A 3F8UA 1EEMA 1AUCA 1TK8B 2IWTA 3KTLA 4AGSA 2FGXA 4TXOB 11GSA 5IO0A 2C1YA 5ECNB 5KN3A 1WRYA 3ERGA 2YV7A 2FWFA 3GTUB 3J7Yk 1T3BA 1V2AA 1X5EA 2X8HA 4TR4A 4G10A 4YQMA 4Q5QA 2BMXA 3RHBA 5JCUA 3RAZA 3F63A 4HQSA 1XWCA 2X8GA 2IMIA 2X8CA 2DJ2A 5DAKB 5JWOB 1JFUA 2B7KA 1Z5YE 4MDCA 5EY6A 5J9BA 4HQZA 4O92A 1DUGA 1GTBA 4N11A 1TKDB 3DXBA 3QAGA 3A2VA 4KSMA 1TW9A 4PQIA 5HR0A 1GULA 4FYCA 1V98A 2H1BA 1BX9A 4ZILA 2VCWA 12GSA 3EC3A 1SL2B 4I6XA 4F03A 4IHUA 3EWLA 1VF3A 4IQAA 4JRRA 4OCFA 2H8LA 1I9DA 1UVZA 5LNKe 3KD0A 4ID0A 3BCKA 3TJBA 4AJ8A 1A8YA 2FWEA 3UVTA 4DEJA 1ZOFA 3H8QA 5EL8A 1K0MA 2DC5A 3DMLA 3VK9A 3CTFA 2OKAA 5ECIB 1M2DA 4FIWA 2H71A 3CMIA 2JU5A 3VI7A 1MD3A 1XFLA 3VWVA 2PPTA 1QGVA 3KMOA 4N30A 2J9HA 4MLYA 1SK0A 4PUFC 4ECJA 1A2MA 1ERUA 3ZMKA 2LSTA 1WE0A 3UAPA 2G0FA 4RI6A 1SL0B 2LQOA 9GSSA 5L71A 3UJ1A 4OWYA 2HZFA 2PUKC 2HI7A 1Y6EA 4NV2A 5B6MA 2F9SA 2O85A 4KGIA 3PR8A 3BBYA 2RIIA 1TU8A 2LTKA 3QD9A 4MPGA 3GTUA 4I8BA 2OE3A 2MMOA 1Z6NA 2YWMA 1GNEA 5D93A 1F3BA 3KZQA 3LG6A 3TRQA 1Z3EA 2VL9A 1EGRA 5ID2B 5DJMA 4BWQA 4HJ2A 3Q18A 1TK5B 1SL1B 3CRUA 4MZBA 2L4CA 5DAKA 2B3SA 3FHKA 2XPEA 2L4QA 3GIXA 1Z6MA 1ILOA 3IK7A 1FW1A 2AHEA 4KB3A 2FUG2 1QUWA 2H6XA 1TI1A 1FB6A 1USBA 2YWOA 3M8NA 3TKQA 4K8MA 2JZSA 5G31A 4XRDA 1K0DA 4FYUA 2H1DA 2N5FA 3DVWA 4ZL8A 3IXRA 4F0CA 4OCEA 2F8FA 1N8JA 2OBKA 4NPBA 2L6CA 4I97A 5CO3A 1F6MC 4ULXA 2V1MA 2I3YA 3CBUA 1Q98A 2VCZA 4PNFA 2VCQA 4EKZA 3GSSA 3IAS2 2KUCA 2PN8A 4TR1B 4XS4B 4IGJA 1JHBA 3TDGA 1S3AA 3DWVA 4ECIA 3QMXA 3LYPA 4RI7A 3ERFA 5KEJA 3N5OA 1SD8A 4GCIA 2P0GA 5AN1A 2CVDA 3ERWA 1Q4JA 5C00A 1M7TA 5IQYA 2YJHA 1O81A 1J08A 2DLXA 3FZ9A 5A4VA 5INYA 3I43A 3HDCA 1NM3A 1B48A 2IMEA 1ABAA 4PGTA 1XWBA 4LA1A 1JZRA 4CW9A 4K0NA 1OE8A 4ML1A 2C4JA 2OADA 2AAWA 2CT6A 3ZVJA 4J2FA 1A2JA 4PURA 1GUHA 4IW9A 4MF5A 1SKRB 3QFAC 2HFDA 5LD0A 3E0UA 3DYRA 5B8BA 2JL4A 2AUVA 1THXA 3FK8A 3DIEA 3H1NA 4F2IA 4MABA 1PA3A 1KEBA 17GSA 4IVFA 4MJEA 2GSTA 1XW5A 3LGCA 1BYEA 4WR4A 5D8IA 5CREA 2WJUA 1TRUA 2H70A 3IOSA 2WB9A 3GYKA 2DJJA 3D21A 3DKSA 3OR5A 2PBJA 3TJFA 2GS3A 4JEDA 1EEJA 1BJXA 5F8BA 3KEBA 3C1SA 3IE3A 4MP4A 3SBCA 4WKWA 3M0FA 4OO4A 1XW6A 2DJ0A 2OA7A 5ECSA 2O87A 2XPDA 4F0BA 5G5FA 3F0IA 2IL3A 2JACA 4OFTA 1SENA 3PGTA 2H72A 4XS4A 4TR1A 5CNWA 2V6OA 3DD3A 1MD4A 5AISA 2CVKA 2M46A 3IBHA 3C71A 2H19A 5H5QA 3VPQA 6GSSA 3FR3A 4BPYA 4PQ1A 1THOA 3GA4A 3LORA 1XVQA 1OE7A 3G7YA 3PINA 2C3NA 1TDIA 2HSHA 4P3YB 2K18A 4LL4B 4ZB6A 2QGVA 1PKZA 3KJYA 3FZAA 1EP8A 1R4WA 2HLSA 2JSZA 2VL2A 2VCVA 4PXOA 3P90A 1GSEA 5IMAA 2QSIA 4ACSA 5D73A 1ZYEA 1C72A 1K3OA 1XWGA 4FO5A 3D4MA 3GKXA 3G9BA 3GX8A 2HYXA 1NHYA 1ZMAA 2YPMA 4X43A 1AQVA 4OMVA 5ABRA 2BTOT 3HYPA 3M1GA 4ML6A 4K2DA 3RBTA 4EDZA 1ZL9A 5DCGA 3SWLA 2IN3A 3VWXA 1UA5A 2VD0A 1U3AA 3U6VA 3GNJA 3EU4A 2FY6A 4WF5A 3WGDA 1XWKA 2H66A 3A2WA 4K9ZA 2GT5A 3EMXA 3D4TA 2QC7A 5IMVA 2FD3A 6GSWA 4NAXA 4ZL7A 3TKPA 1EP7A 4MK3A 2CX3A 3HVVA 4YAVA 2RUEA 4MPFA 16GSA 1G7OA 1T00A 3IRAA 1XWAA 5DBQA 2FLSA 5COHA 1SKSB 1ERWA 2D2ZA 5B6NA 2DSAA 1B9YC 2M72A 5G5EA 4KDYA 1YKCA 5G1LA 1GSDA 3GMFA 2HT9A 3F4SA 3D22A 4KE3A 4V2LA 4V2NA 2VLVA 2PVQA 4GSSA 3KP8A 3P8WA 5DCHA 1ZYQB 4PUAA 3NIVA 2PGTA 2V41A 1EGOA 4KUNA 3I6AA 3ZVJD 2CX4A 1DE2A 4LL1B 3IV4A 2OACA 3KP9A 3QDNA 2RM5A 1XXUA 1T1VA 3I69A 2C3TA 1TTZA 2KP2A 4LMWA 4MJBA 3VFIA 5JCGA 2H1AA 3NOFA 4Q5RA 5GZZB 2PU9C 1RW1A 2ALBA 3VWUA 1YEXA 4L0UA 1ZGNA 2DJ3A 4E8EA 2Z9SA 3G7JA 2PERA 3TKRA 3Q6OA 4I2UA 3ZFLA 2PMTA 5HR2A 4L5LA 4KH7A 3UEMA 1JLVA 2E7PA 1WPIA 3HD5A 2A4VA 1QFNA 2OJLA 3S9FA 4JR6A 4J56E 1EZKA 1HYUA 2JZRA 1GL8A 4XHMA 1XVWA 3WT1A 3L9SA 2I9HA 2I4AA 2WULA 5A4WA 4WF4A 2IFQA 3D6IA 1AQWA 5KN0A 2MMNA 3TOUA 3ZREA 4I2TA 1XBSA 1M2BA 3O76A 1UC7A 5AGYA 3QCPA 1HD2A 2CZ3A 4K7OA 3GX0A 2KOKA 5AIVA 4HZ2A 5HFIA 1A8LA 2H76A 5IM9A 22GSA 2WFCA 4XTSA 1GNWA 1GSSA 1GP1A 2PWJA 1K0OA 3O6TA 2B1LA 2TRXA 2VLTA 4IS0A 3C7MA 3GL5A 1TJDA 4GLTA 1PRXA 4AF2A 5J41A 4MZWA 2WGRA 2M80A 3Q19A 3BD2A 2LJRA 3EMPA 4KX4A 2LRNA 2LUSA 4TVEA 2GZPA 3IPZA 4YQVA 2L57A 1YY7A 1GH2A 4JE1A 3HZ8A 4DSRA 4TXOA 3TOTA 3LYKA 3L0HA 5F06A 1MDKA 3GH6A 1QQ2A 3FZ5A 1O8XA 1SJZA 2C0GA 1OC8A 2B5XA 4G9HA 3F3RA 1WOUA 3LEFA 2HRFA 2ZNMA 4O5RA 5ECOB 2VM1A 1F37A 1GTUA 1OYJA 3QAWA 4GSNA 1GSUA 1ERVA 2MBTA 5CP1A 1VGLA 1HNBA 3TKSE 4EF0A 2IMKA 3VPTA 2CVBA 4RQXA 2L5LA 1ERTA 2V6KA 1MDJA 5AIXA 2GLRA 1XOBA 4MJAA 1Y25A 5KN1A 2VUPA 3CSHA 5IOWA 2V32A 1JLWA 3UIWA 3IDVA 5JWRB 2O89A 2LNSA 4QL7A 4HOJA 1ZZYA 1XZOA 5D9XA 3J7Yb 5D96A 2DBCA 4AJ6A 1SK2A 4MCUA 4YQUA 4IKHA 1YF0A 1FVKA 5D9WA 3FZ4A 3LJRA 1OAZA 7GSSA 1V9WA 1XPVA 6GSTA 1CQGA 2GQMA 4OO5A 2QKEA 3HCZA 2HE3A 2MBSA 4NXIA 3LQ7A 5GAND 1J0FA 4TW5A 5FWGA 4GSTA 3ME8A 2AJQB 4LLRA 3KTBA 2HXKA 1YF1A 5ECHB 1NHOA 4ECBA 5DQYA 1U87A 2DJ1A 4HDEA 4G19A 1BQ7A 4TN8A 1K3YA 3QAVA 1HNCA 2K8VA 2CAQA 1AW9A 1FVJA 2H01A 4DVCA 1QXHA 1SU9A 3APQA 4ZIJA 2XC2A 1NSWA 4BWSA 2YZHA 2K9FA 5IOXA 1TI3A 1PGTA 1BG5A 5IPGA 5ID2A 2RUFA 8GSSA 3Q74A 2YNXA 2C0DA 1YKAA 5J3RA 2VM2A 4BA7A 1R26A 5IIZA 3ZIVA 5DJLA 2GTUA 4HUAA 3LXTA 5CAXA 1MTCA 2DIYA 2L5OA 5F07A 1SJ6A 5ELAA 3KIJA 3C1RA 5EVOA 3TKSC 1YEPA 3HJOA 4EC0A 4Q5FA 4MH2A 3IR4A 3MDKA 2L59A 5ENUA 3NZNA 3ZLPA 5FHIA 1T4YA 2CAIA 5KN2A 3GURA 3GUSA 2HSYA 1A23A 1GSYA 3UL3A 3F4TA 1PL1A 1VF1A 4AJ7A 4KCAA 3BOAA 1WMJA 2LEGA 4FH8A 3FEUA 5IPHA 3FY7A 2O8VB 4V1Ap 1TU7A 4KAEA 4CDOA 2ON5A 2X64A 2P5RA 4PX1A 1PKWA 1IYIA 4DSSB 1X9SB 1G0TA 5E4WA 3GKNA 4L8EA 3K8NA 4X0XA 1X5CA 3W8SA 4PQHA 4O7HA 3D0ZA 4D73B 4ZB8A 5DQSA 2MMZA 3HA9A 3CXGA 3P7XA 2AYTA 2R6KA 3ED3A 1EOGA 2H75A 1K3LA 5GSTA 4QQ7A 2LJKA 1TXXA 1B9XC 1Z7RA 2DMLA 5IMZA 2NTOA 2E2MA 1AIUA 3U5RE 4TXVA 1JZDA 1FHEA 4K0GA 2VL3A 1TRVA 2N5BA 1PL2A 1LJRA 5IMCA 2MYGA 3APOA 3M9JA 5F05A 2RLIA 1R7HA 3QPMA 2P5QA 1PX6A 3GSTA 2C3QA 3LSZA 1HNAA 4IQ1A 4KSOA 1XOAA 2V2GA 2B5YA 3MAKA 5G30A 3FR6A 2F51A 1OC9B 3HVXA 1BEDA 4JBBA 4J57E 1YQ1A 1E2YA 3RPNA 2H6YA 4GQCA 4GRFA 2VIMA 1YDKA 2EIRA 2EIOA 1YZXA 3BJ5A 1YJ6A 2R5GA 4GXZA 1FB0A 2EIQA 2GSSA 3H79A 2C0FA 2ES7A 4NHZA 1AXDA 5ECMB 2IIYA 2DIZA 2YV9A 4OD7A 4EUYA 2K8SA 14GSA 3TUEA 4TKYA 3TJGA 1O85A 4GF0A 3I9V2 4X1UA 2H6ZA 3CRTA 2IPAA 4K1FA 3QOUA 5C04A 4Q5NA 4TR0A 4KDUA 4EVMA 3TGZA 4DSSA 5HFGA 2EC4A 3O3TA 2GZYA 1AAZA 1H4OA 1DBYA 2VCTA 3CYNA 3IAM2 2CV4A 2B1KA 5D9VA 3UVHA 3FKFA 4IELA 1IYHA 4GQFA 2IMFA 1VF2A 1W4VA 4ZXGA 5IMDA 3LFLA 2I81A 3RHCA 4TRXA 1J9BA 4POLA 3C73A 3GH9A 4IBPA 1X0RA 3A2XA 1FOVA 4ZB9A 5HR3A 3L4NA 2CA8A 5DDLA 1W89A 2OBIA 1B4QA 1OKTA 4WETA 3ZL5A 3TRPA 2J23A 3L78A 3M3MA 3A3TA 3VI5A 2OE1A 2DJKA 1X5DA 2VO4A 2FNOA 3LWAA 1ACVA 3F3QA 1SYRA 2XHFA 2NBSA 3ZRDA 3IHQA 3F6DA 3MSZA 3CSJA 1M2AA 1RQMA 3WGEA 3RDWA 3KMNA 1T7PB 5H5SA 3L9VA 2O7KA 2WZ9A 1PQNA 3IA1A 20GSA 2TIRA 1SK1A 5B8AA 3VWWA 4L0WA 1LU4A 19GSA 2AB6A 1OC9A 1QMVA 3US3A 1A24A 1GLQA 1R5PA 2C8UA 2H1GA 1F9MA 3KH7A 1U6TA 1ON4A 5G2ZA 2E2GA 1NW2A 1Z9HA 2R37A 4WBRD 1R5AA 3EU3A 2H30A 3R2QA 5GSSA 3N9JA 2HZEB 2LV3A 5ECQB 5A4UA 4WR5A 3APSA 4HEA2 1GLPA 4N0ZA 3DVXA 5LCZA 1HQOA 2K6VA 2H73A 3ZZXA 4KA0A 2VLUA 1B8XA 4YH2A 3FR9A 1OKDA 2CZ2A 4F9ZA 1S3CA 4MZCA 1I5GA 4POKA 2I1UA 1TP9A 1K0NA 2B7JA 1WWJA 3A5WA 4POBA 4NWYA 5F0GA 4GWRA 1PMTA 4JR4A 1AC1A 2JZTA 1A2LA 1GTIA 3BCIA 5CRHA 6GSYA 3E9JB 3UOMA 3F6FA 2N5AA 4IJ3A 3IC4A 4ILFA 3KM6A 1K0BA 1U3IA 4MF7A 4QL9A 1H75A 2H0GA 2GT6A 5DVBA 3F4RA 4CHSA 5HR1A 4IP1A 2GQKA 1JZWA 3KGKA 1XIYA 1OC3A 5ECRB 5J5NA 2FA8A 3GKMA 1S3DA 4PNGA 2GDRA 1GTAA 6GSUA 4K7IA 1V40A 1O73A 4OFNA 3MNGA 4BL7A 3PH9A 2FA4A 4MJCA 3HXSA 4HU7A 3UMAA 3FYGA 3TJKA 1DE1A 4K7NA 2JADA 4MH3A 1URMA 4ZBAA 2YOIA 3KCMA 3ZITA 1MEKA 1M9BA 3WT2A 4EO3A 3TB2A 1A0RP 1PX7A 2H0HA 4BVYA 1WIKA 3CSIA 2IJYA 2ZCTA 3IK9A 2GGTA 2LRCA 1VF4A 2B6MA 3DEXA 4G2EA 4KDXA 3F9UA 1WP0A 2HZEA 2GQLA 3ISOA 1E6BA 1XCCA 2FCHA 3HKRA 2IMDA 4ZL9A 1TRWA 2LRTA 3TRXA 1M0UA 1K0AA 3VURA 2YN1A 3E3EA 4WBJA 2B5EA 1EV4A 2VAFA 4NHWA 2A2RA 4EDYA 5D9TA 1PD21 2NPBA 5ECKB 2VD1A 1VRSD 1ST9A 3W8JA 5DALB 4WXTA 2NVLA 5J9CA 2YWIA 3EE2A 4BVXA 1V57A 4EE0A 4TR3A 4DSQA 3HJPA 4NMUA 2OE0A 4RQRA 2C0EA 13GSA 2PVOC 3MWHA 5HFKA 3G7IA 2YANA 3H93A 1K0CA 4EXJA 4XS1A 3GRXA 2HNLA 4WEYA 1GUMA 2RM6A 5GAPD 2GZZA 4YAPA 3ZFBA 2GSRA 2GSQA 1QK8A 4Z7XA 5CRWA 3WD6A 3ZTLA 3P2AA 2VL2C 3UARA 1M9AA 1EWXA 4POMA 4RUVA 3KXOA 1U88A 4K6XA 2LNTA 3RPPA 2YCDA 1KBNA 2A2SA 1O8WA 10GSA 1UN2A 5JWQB 3EVIA 3FW2A 2NDOA 1G6YA 5E59A 3HZ4A 4L5OA 1GSFA 1BAYA 2FHEA 4FYBA 3WGXA 4HU9A 4ECCA
chains in the Genus database with same CATH superfamily
3GL3A 4ZBDA 3WYWA 4EL1A 5G1KA 5CYYA 1F3AA 5IO2A 2C80A 4E8HA 2KLXA 1OVNA 4IJIA 4ZBBA 1M99A 1FG4A 2X99A 4MMMA 2REMA 4JU5A 3W6GA 1SYXA 4HZ4A 1EV9A 2ON7A 1GRXA 3EURA 1GUKA 1JZOA 2H0IA 5IMFA 2LQQA 5CRDA 3DGQA 2R2JA 2P31A 2L6DA 3C8EA 2KP1A 3HY2A 5JCWA 3ME7A 3UBLA 5EPFA 3UBKA 1SKWB 2BJXA 2X4AA 2G2QA 3L9UA 5ECLB 2WDUA 3CTGA 3M9KA 2LKUA 4IN0A 1O6JA 3ZIJA 2ZUPA 5J4UA 3AY8A 5DALA 2MZCA 4XRAA 2YWNA 2R4VA 4O32A 1TK0B 3HHVA 1TRSA 4N10A 3TCOA 4TOPA 1EOHA 3HJMA 4HJMA 1AQXA 2AV4A 2VOCA 2WCIA 2FWGA 1ML6A 2YJ7A 2TRCP 5KOWA 4GTUA 6GSXA 2MMAA 3JCML 1KTEA 1KNGA 1XW9A 4XIHA 3HVSA 2YP6A 3GFKA 1SD9A 4V2MA 1GSQA 4OFMA 2R3XA 3ZMLA 4KNDA 2JSYA 3D5JA 5CRGA 3TJJA 2XBQA 1N2AA 3DRNA 3GHAA 3KH9A 1G7EA 1ZCPA 3GKKA 4N0VA 4XCSA 2WS2A 1RK4A 1SJIA 1X9MB 2XBIA 4HS1A 3ZYWA 2VCXA 1CQHA 1Z7PA 3GN3A 3H4KA 1G6WA 2HRNA 2KHPA 1LBKA 4IP6A 4MA9A 4ISDA 3TKSA 5ECPB 1O7UA 2H74A 1FAAA 3FRCA 2FWHA 1DSBA 4XS6A 4I5QA 5FT3A 3EINA 4KW6A 3VLNA 4V1Ag 2CQ9A 1T4ZA 2IFQB 1A0FA 2GVPA 1PFOA 2F3MA 1PN9A 2DMMA 1X9WB 1TOFA 4JZQA 4Z2UA 5HQPA 2YZUA 2WRTA 4KCEA 4LMVA 1MDIA 3GV1A 6GSVA 1F2EA 1T8EB 1GWCA 5B7CA 3EYTA 2F8AA 4MF6A 3QFBC 4H86A 4K5RA 3QR6A 4HI7A 2LJAA 4KF9A 18GSA 2E0QA 2HRKA 4D73A 2LS5A 5A5KA 1B4PA 3V1WA 1WJKA 3LXZA 5ELGA 1PSQA 4F82A 1FO5A 1V58A 5H5RA 4NV5A 3F8UA 1EEMA 1AUCA 1TK8B 2IWTA 3KTLA 4AGSA 2FGXA 4TXOB 11GSA 5IO0A 2C1YA 5ECNB 5KN3A 1WRYA 3ERGA 1ZYPA 2YV7A 2FWFA 3GTUB 3J7Yk 1T3BA 1V2AA 1X5EA 2X8HA 4TR4A 4G10A 4YQMA 4Q5QA 5BMUA 2BMXA 3RHBA 5JCUA 3RAZA 3F63A 4HQSA 1XWCA 2X8GA 2IMIA 2X8CA 2DJ2A 5DAKB 5JWOB 1JFUA 1M3JA 1Z5YE 2B7KA 4MDCA 5EY6A 5KOXA 5J9BA 4HQZA 4O92A 1DUGA 1GTBA 4N11A 1TKDB 3DXBA 3QAGA 3A2VA 4KSMA 1TW9A 4PQIA 5HR0A 1GULA 4FYCA 1V98A 2H1BA 1BX9A 4ZILA 2VCWA 12GSA 3EC3A 1SL2B 4I6XA 4F03A 4IHUA 3EWLA 1VF3A 4IQAA 4JRRA 4OCFA 2H8LA 1I9DA 1UVZA 5LNKe 4A5PA 3KD0A 4ID0A 3BCKA 3TJBA 4AJ8A 1A8YA 2FWEA 3UVTA 4DEJA 1ZOFA 3H8QA 5EL8A 1K0MA 2DC5A 3DMLA 3VK9A 3CTFA 2OKAA 5ECIB 1M2DA 4FIWA 2H71A 3CMIA 2JU5A 3VI7A 1MD3A 1XFLA 3VWVA 2PPTA 1QGVA 3KMOA 4N30A 2J9HA 4MLYA 1SK0A 4PUFC 4ECJA 1A2MA 1ERUA 3ZMKA 2LSTA 1WE0A 3UAPA 2G0FA 4RI6A 1SL0B 2LQOA 9GSSA 5L71A 3UJ1A 4OWYA 2HZFA 2PUKC 2HI7A 1Y6EA 4NV2A 5B6MA 2F9SA 2O85A 4KGIA 3PR8A 3BBYA 2RIIA 1TU8A 2LTKA 3QD9A 2HSMA 4MPGA 3GTUA 4I8BA 2OE3A 2MMOA 1Z6NA 2YWMA 1GNEA 5D93A 1F3BA 3PPUA 3KZQA 3LG6A 3TRQA 1Z3EA 2VL9A 1EGRA 5ID2B 5DJMA 4BWQA 4HJ2A 3Q18A 1TK5B 1SL1B 3CRUA 4MZBA 2L4CA 5DAKA 4O5UA 2B3SA 3FHKA 2XPEA 2L4QA 3GIXA 1Z6MA 1ILOA 3IK7A 1FW1A 2AHEA 4KB3A 2FUG2 1QUWA 2H6XA 1TI1A 1FB6A 1USBA 2YWOA 3M8NA 3TKQA 4K8MA 2JZSA 5G31A 4XRDA 1K0DA 4FYUA 2H1DA 2N5FA 3DVWA 4ZL8A 3IXRA 4F0CA 4OCEA 2F8FA 1N8JA 2OBKA 4NPBA 2L6CA 4I97A 5CO3A 1F6MC 4ULXA 2V1MA 4YKFA 2I3YA 3CBUA 1Q98A 2VCZA 4PNFA 2VCQA 4EKZA 3GSSA 3IAS2 2KUCA 2PN8A 4TR1B 4XS4B 4IGJA 1JHBA 3TDGA 1S3AA 3DWVA 4ECIA 3QMXA 3LYPA 4RI7A 3ERFA 5KEJA 3N5OA 1SD8A 4GCIA 4CY8A 2P0GA 5AN1A 2CVDA 3ERWA 1Q4JA 5C00A 1M7TA 5IQYA 2YJHA 1O81A 1J08A 2DLXA 3FZ9A 5A4VA 5INYA 3I43A 3HDCA 1NM3A 1B48A 2IMEA 1ABAA 4PGTA 1XWBA 4LA1A 1JZRA 4CW9A 4K0NA 1OE8A 4ML1A 2C4JA 2OADA 2AAWA 2CT6A 3ZVJA 4J2FA 4EIQA 1A2JA 4PURA 1GUHA 4IW9A 4MF5A 3FMWA 1SKRB 3QFAC 2HFDA 5LD0A 3E0UA 3DYRA 5B8BA 2JL4A 2AUVA 1THXA 3FK8A 3DIEA 3H1NA 4F2IA 4MABA 1PA3A 1KEBA 17GSA 4IVFA 4MJEA 2GSTA 1XW5A 3LGCA 1BYEA 4WR4A 5D8IA 5CREA 2WJUA 1TRUA 2H70A 3IOSA 2WB9A 3GYKA 2DJJA 3D21A 3DKSA 3OR5A 2PBJA 4K5SA 2GS3A 3TJFA 4JEDA 1EEJA 1BJXA 5F8BA 3KEBA 3C1SA 3IE3A 4MP4A 3SBCA 4X4JA 4WKWA 3M0FA 4OO4A 1XW6A 2DJ0A 2OA7A 5ECSA 2O87A 2XPDA 4F0BA 5G5FA 3F0IA 2IL3A 5BRTA 2JACA 4OFTA 1SENA 3PGTA 2H72A 4XS4A 4TR1A 5CNWA 2V6OA 3DD3A 1MD4A 5AISA 2CVKA 2M46A 3IBHA 3C71A 2H19A 5H5QA 3VPQA 6GSSA 3FR3A 4BPYA 4PQ1A 1THOA 3HVNA 3GA4A 3LORA 1XVQA 1OE7A 3G7YA 3PINA 2C3NA 4G0IA 1TDIA 2HSHA 4P3YB 2K18A 4LL4B 4ZB6A 1XG8A 2QGVA 1PKZA 3KJYA 3FZAA 1EP8A 1R4WA 2HLSA 2JSZA 2VL2A 2VCVA 4PXOA 3P90A 1GSEA 5IMAA 2QSIA 4ACSA 5D73A 1ZYEA 1C72A 1K3OA 2R0GA 1XWGA 4FO5A 3D4MA 3GKXA 3G9BA 3GX8A 2HYXA 1NHYA 1ZMAA 2YPMA 4X43A 1AQVA 4OMVA 5ABRA 2BTOT 3HYPA 3M1GA 3LW9A 3EPTA 4ML6A 4K2DA 3RBTA 4EDZA 1ZL9A 5DCGA 3SWLA 2IN3A 3VWXA 4K2XA 1UA5A 2VD0A 1U3AA 3U6VA 3GNJA 3EU4A 2FY6A 4WF5A 3WGDA 1XWKA 2H66A 3A2WA 4K9ZA 2GT5A 3EMXA 3D4TA 2QC7A 5IMVA 2FD3A 6GSWA 4NAXA 4ZL7A 3TKPA 1EP7A 4MK3A 2CX3A 3HVVA 4YAVA 2RUEA 4MPFA 16GSA 1G7OA 1T00A 3IRAA 1XWAA 5DBQA 2FLSA 5COHA 1SKSB 1ERWA 2D2ZA 5B6NA 2DSAA 1B9YC 2M72A 5G5EA 1ZYNA 4KDYA 1YKCA 2QA2A 5G1LA 1GSDA 3GMFA 2HT9A 3F4SA 3D22A 4KE3A 4V2LA 4V2NA 2VLVA 2PVQA 4GSSA 3KP8A 2DKIA 3P8WA 5DCHA 1ZYQB 4PUAA 3NIVA 2PGTA 2V41A 1EGOA 4KUNA 3I6AA 3ZVJD 2CX4A 1DE2A 4LL1B 3IV4A 2OACA 3KP9A 3QDNA 2RM5A 1XXUA 1T1VA 3I69A 2C3TA 1TTZA 2KP2A 4LMWA 4MJBA 4Z2RA 3VFIA 5JCGA 2H1AA 3NOFA 4Q5RA 5GZZB 2PU9C 1RW1A 2ALBA 3VWUA 1YEXA 4L0UA 1ZGNA 2DJ3A 4E8EA 2Z9SA 3G7JA 2PERA 3TKRA 3Q6OA 4I2UA 3ZFLA 2PMTA 5HR2A 4HSCX 4L5LA 4KH7A 3UEMA 1JLVA 2E7PA 1WPIA 3HD5A 2A4VA 1QFNA 2OJLA 3S9FA 4JR6A 4J56E 1EZKA 1HYUA 2JZRA 1GL8A 3IC8A 4XHMA 1XVWA 3WT1A 3L9SA 2I9HA 2I4AA 2WULA 5A4WA 4WF4A 2IFQA 3D6IA 1AQWA 5KN0A 2MMNA 3TOUA 3ZREA 4I2TA 1XBSA 1M2BA 3O76A 1UC7A 2UZ8A 5AGYA 3QCPA 1HD2A 2CZ3A 4K7OA 3GX0A 2KOKA 5AIVA 4HZ2A 5HFIA 1A8LA 2H76A 5IM9A 22GSA 2WFCA 4XTSA 1GNWA 1GSSA 1GP1A 2PWJA 1K0OA 3O6TA 2B1LA 2TRXA 2VLTA 4IS0A 3C7MA 3GL5A 1TJDA 4GLTA 1PRXA 4AF2A 5J41A 4MZWA 2WGRA 2M80A 3Q19A 3BD2A 2LJRA 3EMPA 4KX4A 2LRNA 2LUSA 4TVEA 2GZPA 3IPZA 4YQVA 2L57A 1YY7A 1GH2A 4JE1A 3HZ8A 4DSRA 4TXOA 3TOTA 3LYKA 3L0HA 5F06A 1MDKA 3GH6A 1QQ2A 3FZ5A 1O8XA 1SJZA 2C0GA 1OC8A 2B5XA 4G9HA 3F3RA 1WOUA 3LEFA 2HRFA 2ZNMA 4O5RA 5ECOB 2VM1A 1F37A 1GTUA 1OYJA 3QAWA 4GSNA 1GSUA 1ERVA 2MBTA 5CP1A 1VGLA 1HNBA 3TKSE 4EF0A 2IMKA 3VPTA 2CVBA 4RQXA 2L5LA 1ERTA 2V6KA 1MDJA 5AIXA 2GLRA 1XOBA 4MJAA 1Y25A 5KN1A 2VUPA 3CSHA 5IOWA 2V32A 1JLWA 3UIWA 3IDVA 5JWRB 2O89A 2LNSA 2R0CA 4QL7A 4HOJA 1ZZYA 1XZOA 5D9XA 3J7Yb 5D96A 2DBCA 4AJ6A 1SK2A 4MCUA 4YQUA 4IKHA 1YF0A 1FVKA 5D9WA 3FZ4A 3LJRA 1OAZA 7GSSA 1V9WA 1XPVA 6GSTA 1CQGA 2GQMA 4OO5A 2QKEA 3HCZA 2HE3A 2MBSA 4NXIA 3LQ7A 5GAND 1J0FA 4TW5A 5FWGA 4GSTA 3ME8A 2AJQB 3MYDA 4LLRA 3KTBA 2HXKA 1YF1A 5ECHB 1NHOA 4ECBA 5DQYA 1U87A 2DJ1A 4HDEA 4G19A 1BQ7A 4TN8A 1K3YA 3QAVA 1S3RA 1HNCA 2K8VA 2CAQA 1AW9A 1FVJA 2H01A 4DVCA 1QXHA 1SU9A 3APQA 4ZIJA 2XC2A 1NSWA 4BWSA 2YZHA 2K9FA 5IOXA 1TI3A 1PGTA 1BG5A 5IPGA 5ID2A 2RUFA 8GSSA 3Q74A 2YNXA 2C0DA 1YKAA 5J3RA 2VM2A 4BA7A 1R26A 5IIZA 3ZIVA 5DJLA 2GTUA 4HUAA 3LXTA 5CAXA 1MTCA 2DIYA 2L5OA 5F07A 1SJ6A 5ELAA 2A2PA 3KIJA 3C1RA 5EVOA 3TKSC 1YEPA 3HJOA 4EC0A 4Q5FA 4MH2A 3IR4A 3MDKA 2L59A 5ENUA 3NZNA 3ZLPA 5FHIA 1M3IA 1T4YA 2CAIA 5KN2A 3GURA 3GUSA 2HSYA 1A23A 1GSYA 3UL3A 3F4TA 1PL1A 1VF1A 4AJ7A 4KCAA 3BOAA 1WMJA 2LEGA 4FH8A 3FEUA 5IPHA 3FY7A 2O8VB 4V1Ap 1TU7A 4KAEA 4CDOA 2ON5A 2X64A 2P5RA 2QA1A 4PX1A 2R0PA 1PKWA 1IYIA 4DSSB 1X9SB 1G0TA 5E4WA 3GKNA 4L8EA 3K8NA 4X0XA 2X49A 1X5CA 3W8SA 4PQHA 4O7HA 3D0ZA 4D73B 4ZB8A 5DQSA 2MMZA 3HA9A 3CXGA 3P7XA 2AYTA 2R6KA 3ED3A 1EOGA 2H75A 1K3LA 5GSTA 4QQ7A 2LJKA 1TXXA 1B9XC 1Z7RA 2DMLA 5IMZA 2NTOA 2E2MA 1AIUA 3U5RE 4TXVA 1JZDA 1FHEA 4K0GA 2VL3A 1TRVA 2N5BA 1PL2A 4PTSA 1LJRA 5IMCA 2MYGA 3APOA 3M9JA 5F05A 2RLIA 1R7HA 3QPMA 2P5QA 1PX6A 3GSTA 2C3QA 3LSZA 1HNAA 4IQ1A 4KSOA 1XOAA 2V2GA 2B5YA 3MAKA 5G30A 3FR6A 2F51A 1OC9B 3HVXA 1BEDA 4JBBA 4J57E 1YQ1A 1E2YA 3RPNA 2H6YA 4GQCA 4GRFA 2VIMA 1YDKA 2EIRA 2EIOA 1YZXA 3BJ5A 1YJ6A 2R5GA 4GXZA 1FB0A 2EIQA 2GSSA 3H79A 2C0FA 2ES7A 4NHZA 1AXDA 5ECMB 2IIYA 2DIZA 2YV9A 4OD7A 4EUYA 2K8SA 14GSA 3TUEA 2DKHA 4TKYA 3TJGA 1O85A 4GF0A 3I9V2 4X1UA 2H6ZA 3CRTA 2IPAA 4K1FA 3QOUA 5C04A 4Q5NA 4TR0A 4KDUA 4EVMA 3TGZA 4DSSA 5HFGA 2EC4A 3O3TA 2GZYA 1AAZA 1H4OA 1DBYA 2VCTA 3CYNA 3IAM2 2CV4A 2B1KA 5D9VA 3UVHA 3FKFA 4IELA 1IYHA 4GQFA 2IMFA 1VF2A 4MNNA 1W4VA 4ZXGA 5IMDA 3LFLA 2I81A 3RHCA 4TRXA 1J9BA 4POLA 3C73A 3GH9A 4IBPA 1X0RA 3A2XA 1FOVA 4ZB9A 5HR3A 3L4NA 2CA8A 5DDLA 1W89A 2OBIA 1B4QA 1OKTA 4WETA 3ZL5A 1PN0A 3TRPA 2J23A 3L78A 3M3MA 3A3TA 3VI5A 2OE1A 2DJKA 1X5DA 2VO4A 2FNOA 3LWAA 1ACVA 3F3QA 4BL7B 1SYRA 2XHFA 2NBSA 3ZRDA 3IHQA 3F6DA 3MSZA 3CSJA 1M2AA 3IHGA 1RQMA 3WGEA 3RDWA 3KMNA 1T7PB 5H5SA 3L9VA 2O7KA 2WZ9A 1PQNA 3IA1A 4G0KA 20GSA 4USSA 2TIRA 1SK1A 5B8AA 3VWWA 3A5IA 3MIXA 4L0WA 1LU4A 19GSA 2AB6A 1OC9A 1QMVA 4BVYB 3US3A 1A24A 1GLQA 1R5PA 2C8UA 2H1GA 1F9MA 3KH7A 1U6TA 1ON4A 5G2ZA 2E2GA 1NW2A 1Z9HA 2R37A 4WBRD 1R5AA 3EU3A 2H30A 3R2QA 5GSSA 3N9JA 2HZEB 2LV3A 4FQUA 5ECQB 5A4UA 4WR5A 3APSA 4HEA2 1GLPA 4N0ZA 3DVXA 3CQFA 5LCZA 1HQOA 2K6VA 2H73A 3ZZXA 4KA0A 2VLUA 1B8XA 4YH2A 3FR9A 1OKDA 2CZ2A 4F9ZA 1S3CA 4MZCA 1I5GA 4POKA 2I1UA 1TP9A 1K0NA 2B7JA 4BVXB 1WWJA 3A5WA 4POBA 4NWYA 5F0GA 4GWRA 1PMTA 4JR4A 1AC1A 2JZTA 1A2LA 1GTIA 3BCIA 5CRHA 6GSYA 3E9JB 3UOMA 3F6FA 2N5AA 4IJ3A 3IC4A 4ILFA 3KM6A 1K0BA 1U3IA 4MF7A 4QL9A 1H75A 2H0GA 2GT6A 5DVBA 3F4RA 4CHSA 4G0LA 5HR1A 4IP1A 2GQKA 1JZWA 3KGKA 1XIYA 1OC3A 5ECRB 5J5NA 2FA8A 3GKMA 1S3DA 4PNGA 2GDRA 1GTAA 6GSUA 4K7IA 1V40A 1FOHA 1O73A 4OFNA 3MNGA 4BL7A 3PH9A 2FA4A 4MJCA 3HXSA 4HU7A 3UMAA 3FYGA 3TJKA 1DE1A 4K7NA 2JADA 4MH3A 1URMA 4ZBAA 2YOIA 3KCMA 4YKGA 4BIKA 3ZITA 1MEKA 1M9BA 3WT2A 4EO3A 3TB2A 1A0RP 1PX7A 4Z2TA 2H0HA 4BVYA 1WIKA 3CSIA 2IJYA 2ZCTA 3IK9A 4CY6A 2GGTA 2LRCA 1VF4A 2B6MA 3DEXA 4G2EA 4KDXA 3F9UA 1WP0A 2HZEA 2GQLA 3ISOA 1E6BA 1XCCA 2FCHA 3HKRA 2IMDA 4ZL9A 1TRWA 2LRTA 3TRXA 1M0UA 1K0AA 3VURA 2YN1A 3E3EA 4WBJA 2B5EA 1EV4A 2VAFA 4NHWA 2A2RA 4EDYA 5D9TA 1PD21 2NPBA 5ECKB 2VD1A 1VRSD 1ST9A 3W8JA 5DALB 4WXTA 2NVLA 5J9CA 2YWIA 3EE2A 4BVXA 1V57A 4EE0A 4TR3A 4DSQA 3HJPA 4NMUA 2OE0A 4RQRA 2C0EA 13GSA 2PVOC 3MWHA 5HFKA 3G7IA 2YANA 3H93A 1K0CA 4EXJA 4XS1A 3GRXA 2HNLA 4WEYA 1GUMA 2RM6A 5GAPD 2GZZA 4YAPA 3ZFBA 2A4HA 2GSRA 2GSQA 1QK8A 4Z7XA 5CRWA 3WD6A 3ZTLA 3P2AA 2VL2C 3R3EA 3UARA 1M9AA 1EWXA 4POMA 4RUVA 3KXOA 1U88A 4K6XA 2LNTA 3RPPA 2YCDA 1KBNA 2A2SA 4ICYA 1O8WA 4O5QA 10GSA 1UN2A 4EIPA 5JWQB 3EVIA 3FW2A 2NDOA 1G6YA 5E59A 3HZ4A 4L5OA 1GSFA 1BAYA 2FHEA 4FYBA 2HRAA 3WGXA 4HU9A 4ECCA
chains in the Genus database with same CATH topology
3GL3A 4ZBDA 3WYWA 4EL1A 5G1KA 5CYYA 1F3AA 5IO2A 2C80A 4E8HA 2KLXA 1OVNA 4IJIA 4ZBBA 1M99A 1FG4A 2X99A 4MMMA 2REMA 4JU5A 3W6GA 1SYXA 4HZ4A 1EV9A 2ON7A 1GRXA 3EURA 1GUKA 1JZOA 2H0IA 5IMFA 2LQQA 5CRDA 3DGQA 2R2JA 2P31A 2L6DA 3C8EA 2KP1A 3HY2A 5JCWA 3ME7A 3UBLA 5EPFA 3UBKA 1SKWB 2BJXA 2X4AA 2G2QA 3L9UA 5ECLB 2WDUA 3CTGA 3M9KA 2LKUA 4IN0A 1O6JA 3ZIJA 2ZUPA 5J4UA 3AY8A 5DALA 2MZCA 4XRAA 2YWNA 2R4VA 4O32A 1TK0B 3HHVA 1TRSA 4N10A 3TCOA 4TOPA 1EOHA 3HJMA 4HJMA 1AQXA 2AV4A 2VOCA 2WCIA 2FWGA 1ML6A 2YJ7A 2TRCP 5KOWA 4GTUA 6GSXA 2MMAA 3JCML 1KTEA 1KNGA 1XW9A 4XIHA 3HVSA 2YP6A 3GFKA 1SD9A 4V2MA 1GSQA 4OFMA 2R3XA 3ZMLA 4KNDA 2JSYA 3D5JA 5CRGA 3TJJA 2XBQA 1N2AA 3DRNA 3GHAA 3KH9A 1G7EA 1ZCPA 3GKKA 4N0VA 4XCSA 2WS2A 1RK4A 1SJIA 1X9MB 2XBIA 4HS1A 3ZYWA 2VCXA 1CQHA 1Z7PA 3GN3A 3H4KA 1G6WA 2HRNA 2KHPA 1LBKA 4IP6A 4MA9A 4ISDA 3TKSA 5ECPB 1O7UA 2H74A 1FAAA 3FRCA 2FWHA 1DSBA 4XS6A 4I5QA 5FT3A 3EINA 4KW6A 3VLNA 4V1Ag 2CQ9A 1T4ZA 2IFQB 1A0FA 2GVPA 2F3MA 1PN9A 2DMMA 1X9WB 1TOFA 4JZQA 4Z2UA 5HQPA 2YZUA 2WRTA 4KCEA 4LMVA 1MDIA 3GV1A 6GSVA 1F2EA 1T8EB 1GWCA 5B7CA 3EYTA 2F8AA 4MF6A 3QFBC 4H86A 4K5RA 3QR6A 4HI7A 2LJAA 4KF9A 18GSA 2E0QA 2HRKA 4D73A 2LS5A 5A5KA 1B4PA 3V1WA 1WJKA 3LXZA 5ELGA 1PSQA 4F82A 1FO5A 1V58A 5H5RA 4NV5A 3F8UA 1EEMA 1AUCA 1TK8B 2IWTA 3KTLA 4AGSA 2FGXA 4TXOB 11GSA 5IO0A 2C1YA 5ECNB 5KN3A 1WRYA 3ERGA 1ZYPA 2YV7A 2FWFA 3GTUB 3J7Yk 1T3BA 1V2AA 1X5EA 2X8HA 4TR4A 4G10A 4YQMA 4Q5QA 5BMUA 2BMXA 3RHBA 5JCUA 3RAZA 3F63A 4HQSA 1XWCA 2X8GA 2IMIA 2X8CA 2DJ2A 5DAKB 5JWOB 1JFUA 2B7KA 1Z5YE 4MDCA 5EY6A 5KOXA 5J9BA 4HQZA 4O92A 1DUGA 1GTBA 4N11A 1TKDB 3DXBA 3QAGA 3A2VA 4KSMA 1TW9A 4PQIA 5HR0A 1GULA 4FYCA 1V98A 2H1BA 1BX9A 4ZILA 2VCWA 12GSA 3EC3A 1SL2B 4I6XA 4F03A 4IHUA 3EWLA 1VF3A 4IQAA 4JRRA 4OCFA 2H8LA 1I9DA 1UVZA 5LNKe 4A5PA 3KD0A 4ID0A 3BCKA 3TJBA 4AJ8A 1A8YA 2FWEA 3UVTA 4DEJA 1ZOFA 3H8QA 5EL8A 1K0MA 2DC5A 3DMLA 3VK9A 3CTFA 2OKAA 5ECIB 1M2DA 4FIWA 2H71A 3CMIA 2JU5A 3VI7A 1MD3A 1XFLA 3VWVA 2PPTA 1QGVA 3KMOA 4N30A 2J9HA 4MLYA 1SK0A 4PUFC 4ECJA 1A2MA 1ERUA 3ZMKA 2LSTA 1WE0A 3UAPA 2G0FA 4RI6A 1SL0B 2LQOA 9GSSA 5L71A 3UJ1A 4OWYA 2HZFA 2PUKC 2HI7A 1Y6EA 4NV2A 5B6MA 2F9SA 2O85A 4KGIA 3PR8A 3BBYA 2RIIA 1TU8A 2LTKA 3QD9A 2HSMA 4MPGA 3GTUA 4I8BA 2OE3A 2MMOA 1Z6NA 2YWMA 1GNEA 5D93A 1F3BA 3PPUA 3KZQA 3LG6A 3TRQA 1Z3EA 2VL9A 1EGRA 5ID2B 5DJMA 4BWQA 4HJ2A 3Q18A 1TK5B 1SL1B 3CRUA 4MZBA 2L4CA 5DAKA 4O5UA 2B3SA 3FHKA 2XPEA 2L4QA 3GIXA 1Z6MA 1ILOA 3IK7A 1FW1A 2AHEA 4KB3A 2FUG2 1QUWA 2H6XA 1TI1A 1FB6A 1USBA 2YWOA 3M8NA 3TKQA 4K8MA 2JZSA 5G31A 4XRDA 1K0DA 4FYUA 2H1DA 2N5FA 3DVWA 4ZL8A 3IXRA 4F0CA 4OCEA 2F8FA 1N8JA 2OBKA 4NPBA 2L6CA 4I97A 5CO3A 1F6MC 4ULXA 2V1MA 4YKFA 2I3YA 3CBUA 1Q98A 2VCZA 4PNFA 2VCQA 4EKZA 3GSSA 3IAS2 2KUCA 2PN8A 4TR1B 4XS4B 4IGJA 1JHBA 3TDGA 1S3AA 3DWVA 4ECIA 3QMXA 3LYPA 4RI7A 3ERFA 5KEJA 3N5OA 1SD8A 4GCIA 4CY8A 2P0GA 5AN1A 2CVDA 3ERWA 1Q4JA 5C00A 1M7TA 5IQYA 2YJHA 1O81A 1J08A 2DLXA 3FZ9A 5A4VA 5INYA 3I43A 3HDCA 1NM3A 1B48A 2IMEA 1ABAA 4PGTA 1XWBA 4LA1A 1JZRA 4CW9A 4K0NA 1OE8A 4ML1A 2C4JA 2OADA 2AAWA 2CT6A 3ZVJA 4J2FA 4EIQA 1A2JA 4PURA 1GUHA 4IW9A 4MF5A 3FMWA 1SKRB 3QFAC 2HFDA 5LD0A 3E0UA 3DYRA 5B8BA 2JL4A 2AUVA 1THXA 3FK8A 3DIEA 3H1NA 4F2IA 4MABA 1PA3A 1KEBA 17GSA 4IVFA 4MJEA 2GSTA 1XW5A 3LGCA 1BYEA 4WR4A 5D8IA 5CREA 2WJUA 1TRUA 2H70A 3IOSA 2WB9A 3GYKA 2DJJA 3D21A 3DKSA 3OR5A 2PBJA 4K5SA 2GS3A 3TJFA 4JEDA 1EEJA 1BJXA 5F8BA 3KEBA 3C1SA 3IE3A 4MP4A 3SBCA 4X4JA 4WKWA 3M0FA 4OO4A 1XW6A 2DJ0A 2OA7A 5ECSA 2O87A 2XPDA 4F0BA 5G5FA 3F0IA 2IL3A 5BRTA 2JACA 4OFTA 1SENA 3PGTA 2H72A 4XS4A 4TR1A 5CNWA 2V6OA 3DD3A 1MD4A 5AISA 2CVKA 2M46A 3IBHA 3C71A 2H19A 5H5QA 3VPQA 6GSSA 3FR3A 4BPYA 4PQ1A 1THOA 3GA4A 3LORA 1XVQA 1OE7A 3G7YA 3PINA 2C3NA 4G0IA 1TDIA 2HSHA 4P3YB 2K18A 4LL4B 4ZB6A 2QGVA 1PKZA 3KJYA 3FZAA 1EP8A 1R4WA 2HLSA 2JSZA 2VL2A 2VCVA 4PXOA 3P90A 1GSEA 5IMAA 2QSIA 4ACSA 5D73A 1ZYEA 1C72A 1K3OA 2R0GA 1XWGA 4FO5A 3D4MA 3GKXA 3G9BA 3GX8A 2HYXA 1NHYA 1ZMAA 2YPMA 4X43A 1AQVA 4OMVA 5ABRA 2BTOT 3HYPA 3M1GA 3LW9A 3EPTA 4ML6A 4K2DA 3RBTA 4EDZA 1ZL9A 5DCGA 3SWLA 2IN3A 3VWXA 4K2XA 1UA5A 2VD0A 1U3AA 3U6VA 3GNJA 3EU4A 2FY6A 4WF5A 3WGDA 1XWKA 2H66A 3A2WA 4K9ZA 2GT5A 3EMXA 3D4TA 2QC7A 5IMVA 2FD3A 6GSWA 4NAXA 4ZL7A 3TKPA 1EP7A 4MK3A 2CX3A 3HVVA 4YAVA 2RUEA 4MPFA 16GSA 1G7OA 1T00A 3IRAA 1XWAA 5DBQA 2FLSA 5COHA 1SKSB 1ERWA 2D2ZA 5B6NA 2DSAA 1B9YC 2M72A 5G5EA 1ZYNA 4KDYA 1YKCA 2QA2A 5G1LA 1GSDA 3GMFA 2HT9A 3F4SA 3D22A 4KE3A 4V2LA 4V2NA 2VLVA 2PVQA 4GSSA 3KP8A 2DKIA 3P8WA 5DCHA 1ZYQB 4PUAA 3NIVA 2PGTA 2V41A 1EGOA 4KUNA 3I6AA 3ZVJD 2CX4A 1DE2A 4LL1B 3IV4A 2OACA 3KP9A 3QDNA 2RM5A 1XXUA 1T1VA 3I69A 2C3TA 1TTZA 2KP2A 4LMWA 4MJBA 4Z2RA 3VFIA 5JCGA 2H1AA 3NOFA 4Q5RA 5GZZB 2PU9C 1RW1A 2ALBA 3VWUA 1YEXA 4L0UA 1ZGNA 2DJ3A 4E8EA 2Z9SA 3G7JA 2PERA 3TKRA 3Q6OA 4I2UA 3ZFLA 2PMTA 5HR2A 4L5LA 4KH7A 3UEMA 1JLVA 2E7PA 1WPIA 3HD5A 2A4VA 1QFNA 2OJLA 3S9FA 4JR6A 4J56E 1EZKA 1HYUA 2JZRA 1GL8A 3IC8A 4XHMA 1XVWA 3WT1A 3L9SA 2I9HA 2I4AA 2WULA 5A4WA 4WF4A 2IFQA 3D6IA 1AQWA 5KN0A 2MMNA 3TOUA 3ZREA 4I2TA 1XBSA 1M2BA 3O76A 1UC7A 2UZ8A 5AGYA 3QCPA 1HD2A 2CZ3A 4K7OA 3GX0A 2KOKA 5AIVA 4HZ2A 5HFIA 1A8LA 2H76A 5IM9A 22GSA 2WFCA 4XTSA 1GNWA 1GSSA 1GP1A 2PWJA 1K0OA 3O6TA 2B1LA 2TRXA 2VLTA 4IS0A 3C7MA 3GL5A 1TJDA 4GLTA 1PRXA 4AF2A 5J41A 4MZWA 2WGRA 2M80A 3Q19A 3BD2A 2LJRA 3EMPA 4KX4A 2LRNA 2LUSA 4TVEA 2GZPA 3IPZA 4YQVA 2L57A 1YY7A 1GH2A 4JE1A 3HZ8A 4DSRA 4TXOA 3TOTA 3LYKA 3L0HA 5F06A 1MDKA 3GH6A 1QQ2A 3FZ5A 1O8XA 1SJZA 2C0GA 1OC8A 2B5XA 4G9HA 3F3RA 1WOUA 3LEFA 2HRFA 2ZNMA 4O5RA 5ECOB 2VM1A 1F37A 1GTUA 1OYJA 3QAWA 4GSNA 1GSUA 1ERVA 2MBTA 5CP1A 1VGLA 1HNBA 3TKSE 4EF0A 2IMKA 3VPTA 2CVBA 4RQXA 2L5LA 1ERTA 2V6KA 1MDJA 5AIXA 2GLRA 1XOBA 4MJAA 1Y25A 5KN1A 2VUPA 3CSHA 5IOWA 2V32A 1JLWA 3UIWA 3IDVA 5JWRB 2O89A 2LNSA 2R0CA 4QL7A 4HOJA 1ZZYA 1XZOA 5D9XA 3J7Yb 5D96A 2DBCA 4AJ6A 1SK2A 4MCUA 4YQUA 4IKHA 1YF0A 1FVKA 5D9WA 3FZ4A 3LJRA 1OAZA 7GSSA 1V9WA 1XPVA 6GSTA 1CQGA 2GQMA 4OO5A 2QKEA 3HCZA 2HE3A 2MBSA 4NXIA 3LQ7A 5GAND 1J0FA 4TW5A 5FWGA 4GSTA 3ME8A 2AJQB 3MYDA 4LLRA 3KTBA 2HXKA 1YF1A 5ECHB 1NHOA 4ECBA 5DQYA 1U87A 2DJ1A 4HDEA 4G19A 1BQ7A 4TN8A 1K3YA 3QAVA 1HNCA 2K8VA 2CAQA 1AW9A 1FVJA 2H01A 4DVCA 1QXHA 1SU9A 3APQA 4ZIJA 2XC2A 1NSWA 4BWSA 2YZHA 2K9FA 5IOXA 1TI3A 1PGTA 1BG5A 5IPGA 5ID2A 2RUFA 8GSSA 3Q74A 2YNXA 2C0DA 1YKAA 5J3RA 2VM2A 4BA7A 1R26A 5IIZA 3ZIVA 5DJLA 2GTUA 4HUAA 3LXTA 5CAXA 1MTCA 2DIYA 2L5OA 5F07A 1SJ6A 5ELAA 2A2PA 3KIJA 3C1RA 5EVOA 3TKSC 1YEPA 3HJOA 4EC0A 4Q5FA 4MH2A 3IR4A 3MDKA 2L59A 5ENUA 3NZNA 3ZLPA 5FHIA 1T4YA 2CAIA 5KN2A 3GURA 3GUSA 2HSYA 1A23A 1GSYA 3UL3A 3F4TA 1PL1A 1VF1A 4AJ7A 4KCAA 3BOAA 1WMJA 2LEGA 4FH8A 3FEUA 5IPHA 3FY7A 2O8VB 4V1Ap 1TU7A 4KAEA 4CDOA 2ON5A 2X64A 2P5RA 2QA1A 4PX1A 2R0PA 1PKWA 1IYIA 4DSSB 1X9SB 1G0TA 5E4WA 3GKNA 4L8EA 3K8NA 4X0XA 2X49A 1X5CA 3W8SA 4PQHA 4O7HA 3D0ZA 4D73B 4ZB8A 5DQSA 2MMZA 3HA9A 3CXGA 3P7XA 2AYTA 2R6KA 3ED3A 1EOGA 2H75A 1K3LA 5GSTA 4QQ7A 2LJKA 1TXXA 1B9XC 1Z7RA 2DMLA 5IMZA 2NTOA 2E2MA 1AIUA 3U5RE 4TXVA 1JZDA 1FHEA 4K0GA 2VL3A 1TRVA 2N5BA 1PL2A 4PTSA 1LJRA 5IMCA 2MYGA 3APOA 3M9JA 5F05A 2RLIA 1R7HA 3QPMA 2P5QA 1PX6A 3GSTA 2C3QA 3LSZA 1HNAA 4IQ1A 4KSOA 1XOAA 2V2GA 2B5YA 3MAKA 5G30A 3FR6A 2F51A 1OC9B 3HVXA 1BEDA 4JBBA 4J57E 1YQ1A 1E2YA 3RPNA 2H6YA 4GQCA 4GRFA 2VIMA 1YDKA 2EIRA 2EIOA 1YZXA 3BJ5A 1YJ6A 2R5GA 4GXZA 1FB0A 2EIQA 2GSSA 3H79A 2C0FA 2ES7A 4NHZA 1AXDA 5ECMB 2IIYA 2DIZA 2YV9A 4OD7A 4EUYA 2K8SA 14GSA 3TUEA 2DKHA 4TKYA 3TJGA 1O85A 4GF0A 3I9V2 4X1UA 2H6ZA 3CRTA 2IPAA 4K1FA 3QOUA 5C04A 4Q5NA 4TR0A 4KDUA 4EVMA 3TGZA 4DSSA 5HFGA 2EC4A 3O3TA 2GZYA 1AAZA 1H4OA 1DBYA 2VCTA 3CYNA 3IAM2 2CV4A 2B1KA 5D9VA 3UVHA 3FKFA 4IELA 1IYHA 4GQFA 2IMFA 1VF2A 4MNNA 1W4VA 4ZXGA 5IMDA 3LFLA 2I81A 3RHCA 4TRXA 1J9BA 4POLA 3C73A 3GH9A 4IBPA 1X0RA 3A2XA 1FOVA 4ZB9A 5HR3A 3L4NA 2CA8A 5DDLA 1W89A 2OBIA 1B4QA 1OKTA 4WETA 3ZL5A 1PN0A 3TRPA 2J23A 3L78A 3M3MA 3A3TA 3VI5A 2OE1A 2DJKA 1X5DA 2VO4A 2FNOA 3LWAA 1ACVA 3F3QA 4BL7B 1SYRA 2XHFA 2NBSA 3ZRDA 3IHQA 3F6DA 3MSZA 3CSJA 1M2AA 3IHGA 1RQMA 3WGEA 3RDWA 3KMNA 1T7PB 5H5SA 3L9VA 2O7KA 2WZ9A 1PQNA 3IA1A 4G0KA 20GSA 4USSA 2TIRA 1SK1A 5B8AA 3VWWA 3A5IA 3MIXA 4L0WA 1LU4A 19GSA 2AB6A 1OC9A 1QMVA 4BVYB 3US3A 1A24A 1GLQA 1R5PA 2C8UA 2H1GA 1F9MA 3KH7A 1U6TA 1ON4A 5G2ZA 2E2GA 1NW2A 1Z9HA 2R37A 4WBRD 1R5AA 3EU3A 2H30A 3R2QA 5GSSA 3N9JA 2HZEB 2LV3A 4FQUA 5ECQB 5A4UA 4WR5A 3APSA 4HEA2 1GLPA 4N0ZA 3DVXA 5LCZA 1HQOA 2K6VA 2H73A 3ZZXA 4KA0A 2VLUA 1B8XA 4YH2A 3FR9A 1OKDA 2CZ2A 4F9ZA 1S3CA 4MZCA 1I5GA 4POKA 2I1UA 1TP9A 1K0NA 2B7JA 4BVXB 1WWJA 3A5WA 4POBA 4NWYA 5F0GA 4GWRA 1PMTA 4JR4A 1AC1A 2JZTA 1A2LA 1GTIA 3BCIA 5CRHA 6GSYA 3E9JB 3UOMA 3F6FA 2N5AA 4IJ3A 3IC4A 4ILFA 3KM6A 1K0BA 1U3IA 4MF7A 4QL9A 1H75A 2H0GA 2GT6A 5DVBA 3F4RA 4CHSA 4G0LA 5HR1A 4IP1A 2GQKA 1JZWA 3KGKA 1XIYA 1OC3A 5ECRB 5J5NA 2FA8A 3GKMA 1S3DA 4PNGA 2GDRA 1GTAA 6GSUA 4K7IA 1V40A 1FOHA 1O73A 4OFNA 3MNGA 4BL7A 3PH9A 2FA4A 4MJCA 3HXSA 4HU7A 3UMAA 3FYGA 3TJKA 1DE1A 4K7NA 2JADA 4MH3A 1URMA 4ZBAA 2YOIA 3KCMA 4YKGA 3ZITA 1MEKA 1M9BA 3WT2A 4EO3A 3TB2A 1A0RP 1PX7A 4Z2TA 2H0HA 4BVYA 1WIKA 3CSIA 2IJYA 2ZCTA 3IK9A 4CY6A 2GGTA 2LRCA 1VF4A 2B6MA 3DEXA 4G2EA 4KDXA 3F9UA 1WP0A 2HZEA 2GQLA 3ISOA 1E6BA 1XCCA 2FCHA 3HKRA 2IMDA 4ZL9A 1TRWA 2LRTA 3TRXA 1M0UA 1K0AA 3VURA 2YN1A 3E3EA 4WBJA 2B5EA 1EV4A 2VAFA 4NHWA 2A2RA 4EDYA 5D9TA 1PD21 2NPBA 5ECKB 2VD1A 1VRSD 1ST9A 3W8JA 5DALB 4WXTA 2NVLA 5J9CA 2YWIA 3EE2A 4BVXA 1V57A 4EE0A 4TR3A 4DSQA 3HJPA 4NMUA 2OE0A 4RQRA 2C0EA 13GSA 2PVOC 3MWHA 5HFKA 3G7IA 2YANA 3H93A 1K0CA 4EXJA 4XS1A 3GRXA 2HNLA 4WEYA 1GUMA 2RM6A 5GAPD 2GZZA 4YAPA 3ZFBA 2A4HA 2GSRA 2GSQA 1QK8A 4Z7XA 5CRWA 3WD6A 3ZTLA 3P2AA 2VL2C 3R3EA 3UARA 1M9AA 1EWXA 4POMA 4RUVA 3KXOA 1U88A 4K6XA 2LNTA 3RPPA 2YCDA 1KBNA 2A2SA 4ICYA 1O8WA 4O5QA 10GSA 1UN2A 4EIPA 5JWQB 3EVIA 3FW2A 2NDOA 1G6YA 5E59A 3HZ4A 4L5OA 1GSFA 1BAYA 2FHEA 4FYBA 2HRAA 3WGXA 4HU9A 4ECCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GL3 A;  4ZBD A;  3WYW A;  4EL1 A;  5G1K A;  5CYY A;  1F3A A;  5IO2 A;  2C80 A;  4E8H A;  2KLX A;  1OVN A;  4IJI A;  4ZBB A;  1M99 A;  1FG4 A;  2X99 A;  4MMM A;  2REM A;  4JU5 A;  3W6G A;  1SYX A;  4HZ4 A;  1EV9 A;  2ON7 A;  1GRX A;  3EUR A;  1GUK A;  1JZO A;  2H0I A;  5IMF A;  2LQQ A;  5CRD A;  3DGQ A;  2R2J A;  2P31 A;  2L6D A;  3C8E A;  2KP1 A;  3HY2 A;  5JCW A;  3ME7 A;  3UBL A;  5EPF A;  3UBK A;  1SKW B;  2BJX A;  2G2Q A;  3L9U A;  5ECL B;  2WDU A;  3CTG A;  3M9K A;  2LKU A;  4IN0 A;  1O6J A;  3ZIJ A;  2ZUP A;  5J4U A;  3AY8 A;  5DAL A;  2MZC A;  4XRA A;  2YWN A;  2R4V A;  4O32 A;  1TK0 B;  3HHV A;  1TRS A;  4N10 A;  3TCO A;  4TOP A;  1EOH A;  3HJM A;  4HJM A;  1AQX A;  2AV4 A;  2VOC A;  2WCI A;  2FWG A;  1ML6 A;  2YJ7 A;  2TRC P;  4GTU A;  6GSX A;  2MMA A;  3JCM L;  1KTE A;  1KNG A;  1XW9 A;  4XIH A;  3HVS A;  2YP6 A;  3GFK A;  1SD9 A;  4V2M A;  1GSQ A;  4OFM A;  2R3X A;  3ZML A;  4KND A;  2JSY A;  3D5J A;  5CRG A;  3TJJ A;  2XBQ A;  1N2A A;  3DRN A;  3GHA A;  3KH9 A;  1G7E A;  1ZCP A;  3GKK A;  4N0V A;  4XCS A;  2WS2 A;  1RK4 A;  1SJI A;  1X9M B;  2XBI A;  4HS1 A;  3ZYW A;  2VCX A;  1CQH A;  1Z7P A;  3GN3 A;  3H4K A;  1G6W A;  2HRN A;  2KHP A;  1LBK A;  4IP6 A;  4MA9 A;  4ISD A;  3TKS A;  5ECP B;  1O7U A;  2H74 A;  1FAA A;  3FRC A;  2FWH A;  1DSB A;  4XS6 A;  4I5Q A;  5FT3 A;  3EIN A;  4KW6 A;  3VLN A;  4V1A g;  2CQ9 A;  1T4Z A;  2IFQ B;  1A0F A;  2GVP A;  2F3M A;  1PN9 A;  2DMM A;  1X9W B;  1TOF A;  4JZQ A;  5HQP A;  2YZU A;  2WRT A;  4KCE A;  4LMV A;  1MDI A;  3GV1 A;  6GSV A;  1F2E A;  1T8E B;  1GWC A;  5B7C A;  3EYT A;  2F8A A;  4MF6 A;  3QFB C;  4H86 A;  3QR6 A;  4HI7 A;  2LJA A;  18GS A;  2E0Q A;  4D73 A;  2LS5 A;  5A5K A;  1B4P A;  3V1W A;  1WJK A;  3LXZ A;  5ELG A;  1PSQ A;  4F82 A;  1FO5 A;  1V58 A;  5H5R A;  4NV5 A;  3F8U A;  1EEM A;  1AUC A;  1TK8 B;  2IWT A;  3KTL A;  4AGS A;  2FGX A;  4TXO B;  11GS A;  5IO0 A;  2C1Y A;  5ECN B;  5KN3 A;  1WRY A;  3ERG A;  2YV7 A;  2FWF A;  3GTU B;  3J7Y k;  1T3B A;  1V2A A;  1X5E A;  2X8H A;  4TR4 A;  4G10 A;  4YQM A;  4Q5Q A;  2BMX A;  3RHB A;  5JCU A;  3RAZ A;  3F63 A;  4HQS A;  1XWC A;  2X8G A;  2IMI A;  2X8C A;  2DJ2 A;  5DAK B;  5JWO B;  1JFU A;  2B7K A;  1Z5Y E;  4MDC A;  5EY6 A;  5J9B A;  4HQZ A;  4O92 A;  1DUG A;  1GTB A;  4N11 A;  1TKD B;  3DXB A;  3QAG A;  3A2V A;  4KSM A;  1TW9 A;  4PQI A;  5HR0 A;  1GUL A;  4FYC A;  1V98 A;  2H1B A;  1BX9 A;  4ZIL A;  2VCW A;  12GS A;  3EC3 A;  1SL2 B;  4I6X A;  4F03 A;  4IHU A;  3EWL A;  1VF3 A;  4IQA A;  4JRR A;  4OCF A;  2H8L A;  1I9D A;  1UVZ A;  5LNK e;  3KD0 A;  4ID0 A;  3BCK A;  3TJB A;  4AJ8 A;  1A8Y A;  2FWE A;  3UVT A;  4DEJ A;  1ZOF A;  3H8Q A;  5EL8 A;  1K0M A;  2DC5 A;  3DML A;  3VK9 A;  3CTF A;  2OKA A;  5ECI B;  1M2D A;  4FIW A;  2H71 A;  3CMI A;  2JU5 A;  3VI7 A;  1MD3 A;  1XFL A;  3VWV A;  2PPT A;  1QGV A;  3KMO A;  4N30 A;  2J9H A;  4MLY A;  1SK0 A;  4PUF C;  4ECJ A;  1A2M A;  1ERU A;  3ZMK A;  2LST A;  1WE0 A;  3UAP A;  2G0F A;  4RI6 A;  1SL0 B;  2LQO A;  9GSS A;  5L71 A;  3UJ1 A;  4OWY A;  2HZF A;  2PUK C;  2HI7 A;  1Y6E A;  4NV2 A;  5B6M A;  2F9S A;  2O85 A;  4KGI A;  3PR8 A;  3BBY A;  2RII A;  1TU8 A;  2LTK A;  3QD9 A;  4MPG A;  3GTU A;  4I8B A;  2OE3 A;  2MMO A;  1Z6N A;  2YWM A;  1GNE A;  5D93 A;  1F3B A;  3KZQ A;  3LG6 A;  3TRQ A;  1Z3E A;  2VL9 A;  1EGR A;  5ID2 B;  5DJM A;  4BWQ A;  4HJ2 A;  3Q18 A;  1TK5 B;  1SL1 B;  3CRU A;  4MZB A;  2L4C A;  5DAK A;  2B3S A;  3FHK A;  2XPE A;  2L4Q A;  3GIX A;  1Z6M A;  1ILO A;  3IK7 A;  1FW1 A;  2AHE A;  4KB3 A;  2FUG 2;  1QUW A;  2H6X A;  1TI1 A;  1FB6 A;  1USB A;  2YWO A;  3M8N A;  3TKQ A;  4K8M A;  2JZS A;  5G31 A;  4XRD A;  1K0D A;  4FYU A;  2H1D A;  2N5F A;  3DVW A;  4ZL8 A;  3IXR A;  4F0C A;  4OCE A;  2F8F A;  1N8J A;  2OBK A;  4NPB A;  2L6C A;  4I97 A;  5CO3 A;  1F6M C;  4ULX A;  2V1M A;  2I3Y A;  3CBU A;  1Q98 A;  2VCZ A;  4PNF A;  2VCQ A;  4EKZ A;  3GSS A;  3IAS 2;  2KUC A;  2PN8 A;  4TR1 B;  4XS4 B;  4IGJ A;  1JHB A;  3TDG A;  1S3A A;  3DWV A;  4ECI A;  3QMX A;  3LYP A;  4RI7 A;  3ERF A;  5KEJ A;  3N5O A;  1SD8 A;  4GCI A;  2P0G A;  5AN1 A;  2CVD A;  3ERW A;  1Q4J A;  5C00 A;  1M7T A;  5IQY A;  2YJH A;  1O81 A;  1J08 A;  2DLX A;  3FZ9 A;  5A4V A;  5INY A;  3I43 A;  3HDC A;  1NM3 A;  1B48 A;  2IME A;  1ABA A;  4PGT A;  1XWB A;  4LA1 A;  1JZR A;  4CW9 A;  4K0N A;  1OE8 A;  4ML1 A;  2C4J A;  2OAD A;  2AAW A;  2CT6 A;  3ZVJ A;  4J2F A;  1A2J A;  4PUR A;  1GUH A;  4IW9 A;  4MF5 A;  1SKR B;  3QFA C;  2HFD A;  5LD0 A;  3E0U A;  3DYR A;  5B8B A;  2JL4 A;  2AUV A;  1THX A;  3FK8 A;  3DIE A;  3H1N A;  4F2I A;  4MAB A;  1PA3 A;  1KEB A;  17GS A;  4IVF A;  4MJE A;  2GST A;  1XW5 A;  3LGC A;  1BYE A;  4WR4 A;  5D8I A;  5CRE A;  2WJU A;  1TRU A;  2H70 A;  3IOS A;  2WB9 A;  3GYK A;  2DJJ A;  3D21 A;  3DKS A;  3OR5 A;  2PBJ A;  3TJF A;  2GS3 A;  4JED A;  1EEJ A;  1BJX A;  5F8B A;  3KEB A;  3C1S A;  3IE3 A;  4MP4 A;  3SBC A;  4WKW A;  3M0F A;  4OO4 A;  1XW6 A;  2DJ0 A;  2OA7 A;  5ECS A;  2O87 A;  2XPD A;  4F0B A;  5G5F A;  3F0I A;  2IL3 A;  2JAC A;  4OFT A;  1SEN A;  3PGT A;  2H72 A;  4XS4 A;  4TR1 A;  5CNW A;  2V6O A;  3DD3 A;  1MD4 A;  5AIS A;  2CVK A;  2M46 A;  3IBH A;  3C71 A;  2H19 A;  5H5Q A;  3VPQ A;  6GSS A;  3FR3 A;  4BPY A;  4PQ1 A;  1THO A;  3GA4 A;  3LOR A;  1XVQ A;  1OE7 A;  3G7Y A;  3PIN A;  2C3N A;  1TDI A;  2HSH A;  4P3Y B;  2K18 A;  4LL4 B;  4ZB6 A;  2QGV A;  1PKZ A;  3KJY A;  3FZA A;  1EP8 A;  1R4W A;  2HLS A;  2JSZ A;  2VL2 A;  2VCV A;  4PXO A;  3P90 A;  1GSE A;  5IMA A;  2QSI A;  4ACS A;  5D73 A;  1ZYE A;  1C72 A;  1K3O A;  1XWG A;  4FO5 A;  3D4M A;  3GKX A;  3G9B A;  3GX8 A;  2HYX A;  1NHY A;  1ZMA A;  2YPM A;  4X43 A;  1AQV A;  4OMV A;  5ABR A;  2BTO T;  3HYP A;  3M1G A;  4ML6 A;  4K2D A;  3RBT A;  4EDZ A;  1ZL9 A;  5DCG A;  3SWL A;  2IN3 A;  3VWX A;  1UA5 A;  2VD0 A;  1U3A A;  3U6V A;  3GNJ A;  3EU4 A;  2FY6 A;  4WF5 A;  3WGD A;  1XWK A;  2H66 A;  3A2W A;  4K9Z A;  2GT5 A;  3EMX A;  3D4T A;  2QC7 A;  5IMV A;  2FD3 A;  6GSW A;  4NAX A;  4ZL7 A;  3TKP A;  1EP7 A;  4MK3 A;  2CX3 A;  3HVV A;  4YAV A;  2RUE A;  4MPF A;  16GS A;  1G7O A;  1T00 A;  3IRA A;  1XWA A;  5DBQ A;  2FLS A;  5COH A;  1SKS B;  1ERW A;  2D2Z A;  5B6N A;  2DSA A;  1B9Y C;  2M72 A;  5G5E A;  4KDY A;  1YKC A;  5G1L A;  1GSD A;  3GMF A;  2HT9 A;  3F4S A;  3D22 A;  4KE3 A;  4V2L A;  4V2N A;  2VLV A;  2PVQ A;  4GSS A;  3KP8 A;  3P8W A;  5DCH A;  1ZYQ B;  4PUA A;  3NIV A;  2PGT A;  2V41 A;  1EGO A;  4KUN A;  3I6A A;  3ZVJ D;  2CX4 A;  1DE2 A;  4LL1 B;  3IV4 A;  2OAC A;  3KP9 A;  3QDN A;  2RM5 A;  1XXU A;  1T1V A;  3I69 A;  2C3T A;  1TTZ A;  2KP2 A;  4LMW A;  4MJB A;  3VFI A;  5JCG A;  2H1A A;  3NOF A;  4Q5R A;  5GZZ B;  2PU9 C;  1RW1 A;  2ALB A;  3VWU A;  1YEX A;  4L0U A;  1ZGN A;  2DJ3 A;  4E8E A;  2Z9S A;  3G7J A;  2PER A;  3TKR A;  3Q6O A;  4I2U A;  3ZFL A;  2PMT A;  5HR2 A;  4L5L A;  4KH7 A;  3UEM A;  1JLV A;  2E7P A;  1WPI A;  3HD5 A;  2A4V A;  1QFN A;  2OJL A;  3S9F A;  4JR6 A;  4J56 E;  1EZK A;  1HYU A;  2JZR A;  1GL8 A;  4XHM A;  1XVW A;  3WT1 A;  3L9S A;  2I9H A;  2I4A A;  2WUL A;  5A4W A;  4WF4 A;  2IFQ A;  3D6I A;  1AQW A;  5KN0 A;  2MMN A;  3TOU A;  3ZRE A;  4I2T A;  1XBS A;  1M2B A;  3O76 A;  1UC7 A;  5AGY A;  3QCP A;  1HD2 A;  2CZ3 A;  4K7O A;  3GX0 A;  2KOK A;  5AIV A;  4HZ2 A;  5HFI A;  1A8L A;  2H76 A;  5IM9 A;  22GS A;  2WFC A;  4XTS A;  1GNW A;  1GSS A;  1GP1 A;  2PWJ A;  1K0O A;  3O6T A;  2B1L A;  2TRX A;  2VLT A;  4IS0 A;  3C7M A;  3GL5 A;  1TJD A;  4GLT A;  1PRX A;  4AF2 A;  5J41 A;  4MZW A;  2WGR A;  2M80 A;  3Q19 A;  3BD2 A;  2LJR A;  3EMP A;  4KX4 A;  2LRN A;  2LUS A;  4TVE A;  2GZP A;  3IPZ A;  4YQV A;  2L57 A;  1YY7 A;  1GH2 A;  4JE1 A;  3HZ8 A;  4DSR A;  4TXO A;  3TOT A;  3LYK A;  3L0H A;  5F06 A;  1MDK A;  3GH6 A;  1QQ2 A;  3FZ5 A;  1O8X A;  1SJZ A;  2C0G A;  1OC8 A;  2B5X A;  4G9H A;  3F3R A;  1WOU A;  3LEF A;  2HRF A;  2ZNM A;  4O5R A;  5ECO B;  2VM1 A;  1F37 A;  1GTU A;  1OYJ A;  3QAW A;  4GSN A;  1GSU A;  1ERV A;  2MBT A;  5CP1 A;  1VGL A;  1HNB A;  3TKS E;  4EF0 A;  2IMK A;  3VPT A;  2CVB A;  4RQX A;  2L5L A;  1ERT A;  2V6K A;  1MDJ A;  5AIX A;  2GLR A;  1XOB A;  4MJA A;  1Y25 A;  5KN1 A;  2VUP A;  3CSH A;  5IOW A;  2V32 A;  1JLW A;  3UIW A;  3IDV A;  5JWR B;  2O89 A;  2LNS A;  4QL7 A;  4HOJ A;  1ZZY A;  1XZO A;  5D9X A;  3J7Y b;  5D96 A;  2DBC A;  4AJ6 A;  1SK2 A;  4MCU A;  4YQU A;  4IKH A;  1YF0 A;  1FVK A;  5D9W A;  3FZ4 A;  3LJR A;  1OAZ A;  7GSS A;  1V9W A;  1XPV A;  6GST A;  1CQG A;  2GQM A;  4OO5 A;  2QKE A;  3HCZ A;  2HE3 A;  2MBS A;  4NXI A;  3LQ7 A;  5GAN D;  1J0F A;  4TW5 A;  5FWG A;  4GST A;  3ME8 A;  2AJQ B;  4LLR A;  3KTB A;  2HXK A;  1YF1 A;  5ECH B;  1NHO A;  4ECB A;  5DQY A;  1U87 A;  2DJ1 A;  4HDE A;  4G19 A;  1BQ7 A;  4TN8 A;  1K3Y A;  3QAV A;  1HNC A;  2K8V A;  2CAQ A;  1AW9 A;  1FVJ A;  2H01 A;  4DVC A;  1QXH A;  1SU9 A;  3APQ A;  4ZIJ A;  2XC2 A;  1NSW A;  4BWS A;  2YZH A;  2K9F A;  5IOX A;  1TI3 A;  1PGT A;  1BG5 A;  5IPG A;  5ID2 A;  2RUF A;  8GSS A;  3Q74 A;  2YNX A;  2C0D A;  1YKA A;  5J3R A;  2VM2 A;  4BA7 A;  1R26 A;  5IIZ A;  3ZIV A;  5DJL A;  2GTU A;  4HUA A;  3LXT A;  5CAX A;  1MTC A;  2DIY A;  2L5O A;  5F07 A;  1SJ6 A;  5ELA A;  3KIJ A;  3C1R A;  5EVO A;  3TKS C;  1YEP A;  3HJO A;  4EC0 A;  4Q5F A;  4MH2 A;  3IR4 A;  3MDK A;  2L59 A;  5ENU A;  3NZN A;  3ZLP A;  5FHI A;  1T4Y A;  2CAI A;  5KN2 A;  3GUR A;  3GUS A;  2HSY A;  1A23 A;  1GSY A;  3UL3 A;  3F4T A;  1PL1 A;  1VF1 A;  4AJ7 A;  4KCA A;  3BOA A;  1WMJ A;  2LEG A;  4FH8 A;  3FEU A;  5IPH A;  3FY7 A;  2O8V B;  4V1A p;  1TU7 A;  4KAE A;  4CDO A;  2ON5 A;  2X64 A;  2P5R A;  4PX1 A;  1PKW A;  1IYI A;  4DSS B;  1X9S B;  1G0T A;  5E4W A;  3GKN A;  4L8E A;  3K8N A;  4X0X A;  1X5C A;  3W8S A;  4PQH A;  4O7H A;  3D0Z A;  4D73 B;  4ZB8 A;  5DQS A;  2MMZ A;  3HA9 A;  3CXG A;  3P7X A;  2AYT A;  2R6K A;  3ED3 A;  1EOG A;  2H75 A;  1K3L A;  5GST A;  4QQ7 A;  2LJK A;  1TXX A;  1B9X C;  1Z7R A;  2DML A;  5IMZ A;  2NTO A;  2E2M A;  1AIU A;  3U5R E;  4TXV A;  1JZD A;  1FHE A;  4K0G A;  2VL3 A;  1TRV A;  2N5B A;  1PL2 A;  1LJR A;  5IMC A;  2MYG A;  3APO A;  3M9J A;  5F05 A;  2RLI A;  1R7H A;  3QPM A;  2P5Q A;  1PX6 A;  3GST A;  2C3Q A;  3LSZ A;  1HNA A;  4IQ1 A;  4KSO A;  1XOA A;  2V2G A;  2B5Y A;  3MAK A;  5G30 A;  3FR6 A;  2F51 A;  1OC9 B;  3HVX A;  1BED A;  4JBB A;  4J57 E;  1YQ1 A;  1E2Y A;  3RPN A;  2H6Y A;  4GQC A;  4GRF A;  2VIM A;  1YDK A;  2EIR A;  2EIO A;  1YZX A;  3BJ5 A;  1YJ6 A;  2R5G A;  4GXZ A;  1FB0 A;  2EIQ A;  2GSS A;  3H79 A;  2C0F A;  2ES7 A;  4NHZ A;  1AXD A;  5ECM B;  2IIY A;  2DIZ A;  2YV9 A;  4OD7 A;  4EUY A;  2K8S A;  14GS A;  3TUE A;  4TKY A;  3TJG A;  1O85 A;  4GF0 A;  3I9V 2;  4X1U A;  2H6Z A;  3CRT A;  2IPA A;  4K1F A;  3QOU A;  5C04 A;  4Q5N A;  4TR0 A;  4KDU A;  4EVM A;  3TGZ A;  4DSS A;  5HFG A;  2EC4 A;  3O3T A;  2GZY A;  1AAZ A;  1H4O A;  1DBY A;  2VCT A;  3CYN A;  3IAM 2;  2CV4 A;  2B1K A;  5D9V A;  3UVH A;  3FKF A;  4IEL A;  1IYH A;  4GQF A;  2IMF A;  1VF2 A;  1W4V A;  4ZXG A;  5IMD A;  3LFL A;  2I81 A;  3RHC A;  4TRX A;  1J9B A;  4POL A;  3C73 A;  3GH9 A;  4IBP A;  1X0R A;  3A2X A;  1FOV A;  4ZB9 A;  5HR3 A;  3L4N A;  2CA8 A;  5DDL A;  1W89 A;  2OBI A;  1B4Q A;  1OKT A;  4WET A;  3ZL5 A;  3TRP A;  2J23 A;  3L78 A;  3M3M A;  3A3T A;  3VI5 A;  2OE1 A;  2DJK A;  1X5D A;  2VO4 A;  2FNO A;  3LWA A;  1ACV A;  3F3Q A;  1SYR A;  2XHF A;  2NBS A;  3ZRD A;  3IHQ A;  3F6D A;  3MSZ A;  3CSJ A;  1M2A A;  1RQM A;  3WGE A;  3RDW A;  3KMN A;  1T7P B;  5H5S A;  3L9V A;  2O7K A;  2WZ9 A;  1PQN A;  3IA1 A;  20GS A;  2TIR A;  1SK1 A;  5B8A A;  3VWW A;  4L0W A;  1LU4 A;  19GS A;  2AB6 A;  1OC9 A;  1QMV A;  3US3 A;  1A24 A;  1GLQ A;  1R5P A;  2C8U A;  2H1G A;  1F9M A;  3KH7 A;  1U6T A;  1ON4 A;  5G2Z A;  2E2G A;  1NW2 A;  1Z9H A;  2R37 A;  4WBR D;  1R5A A;  3EU3 A;  2H30 A;  3R2Q A;  5GSS A;  3N9J A;  2HZE B;  2LV3 A;  5ECQ B;  5A4U A;  4WR5 A;  3APS A;  4HEA 2;  1GLP A;  4N0Z A;  3DVX A;  5LCZ A;  1HQO A;  2K6V A;  2H73 A;  3ZZX A;  4KA0 A;  2VLU A;  1B8X A;  4YH2 A;  3FR9 A;  1OKD A;  2CZ2 A;  4F9Z A;  1S3C A;  4MZC A;  1I5G A;  4POK A;  2I1U A;  1TP9 A;  1K0N A;  2B7J A;  1WWJ A;  3A5W A;  4POB A;  4NWY A;  5F0G A;  4GWR A;  1PMT A;  4JR4 A;  1AC1 A;  2JZT A;  1A2L A;  1GTI A;  3BCI A;  5CRH A;  6GSY A;  3E9J B;  3UOM A;  3F6F A;  2N5A A;  4IJ3 A;  3IC4 A;  4ILF A;  3KM6 A;  1K0B A;  1U3I A;  4MF7 A;  4QL9 A;  1H75 A;  2H0G A;  2GT6 A;  5DVB A;  3F4R A;  4CHS A;  5HR1 A;  4IP1 A;  2GQK A;  1JZW A;  3KGK A;  1XIY A;  1OC3 A;  5ECR B;  5J5N A;  2FA8 A;  3GKM A;  1S3D A;  4PNG A;  2GDR A;  1GTA A;  6GSU A;  4K7I A;  1V40 A;  1O73 A;  4OFN A;  3MNG A;  4BL7 A;  3PH9 A;  2FA4 A;  4MJC A;  3HXS A;  4HU7 A;  3UMA A;  3FYG A;  3TJK A;  1DE1 A;  4K7N A;  2JAD A;  4MH3 A;  1URM A;  4ZBA A;  2YOI A;  3KCM A;  3ZIT A;  1MEK A;  1M9B A;  3WT2 A;  4EO3 A;  3TB2 A;  1A0R P;  1PX7 A;  2H0H A;  4BVY A;  1WIK A;  3CSI A;  2IJY A;  2ZCT A;  3IK9 A;  2GGT A;  2LRC A;  1VF4 A;  2B6M A;  3DEX A;  4G2E A;  4KDX A;  3F9U A;  1WP0 A;  2HZE A;  2GQL A;  3ISO A;  1E6B A;  1XCC A;  2FCH A;  3HKR A;  2IMD A;  4ZL9 A;  1TRW A;  2LRT A;  3TRX A;  1M0U A;  1K0A A;  3VUR A;  2YN1 A;  3E3E A;  4WBJ A;  2B5E A;  1EV4 A;  2VAF A;  4NHW A;  2A2R A;  4EDY A;  5D9T A;  1PD2 1;  2NPB A;  5ECK B;  2VD1 A;  1VRS D;  1ST9 A;  3W8J A;  5DAL B;  4WXT A;  2NVL A;  5J9C A;  2YWI A;  3EE2 A;  4BVX A;  1V57 A;  4EE0 A;  4TR3 A;  4DSQ A;  3HJP A;  4NMU A;  2OE0 A;  4RQR A;  2C0E A;  13GS A;  2PVO C;  3MWH A;  5HFK A;  3G7I A;  2YAN A;  3H93 A;  1K0C A;  4EXJ A;  4XS1 A;  3GRX A;  2HNL A;  4WEY A;  1GUM A;  2RM6 A;  5GAP D;  2GZZ A;  4YAP A;  3ZFB A;  2GSR A;  2GSQ A;  1QK8 A;  4Z7X A;  5CRW A;  3WD6 A;  3ZTL A;  3P2A A;  2VL2 C;  3UAR A;  1M9A A;  1EWX A;  4POM A;  4RUV A;  3KXO A;  1U88 A;  4K6X A;  2LNT A;  3RPP A;  2YCD A;  1KBN A;  2A2S A;  1O8W A;  10GS A;  1UN2 A;  5JWQ B;  3EVI A;  3FW2 A;  2NDO A;  1G6Y A;  5E59 A;  3HZ4 A;  4L5O A;  1GSF A;  1BAY A;  2FHE A;  4FYB A;  3WGX A;  4HU9 A;  4ECC A; 
#chains in the Genus database with same CATH topology
 3GL3 A;  4ZBD A;  3WYW A;  4EL1 A;  5G1K A;  5CYY A;  1F3A A;  5IO2 A;  2C80 A;  4E8H A;  2KLX A;  1OVN A;  4IJI A;  4ZBB A;  1M99 A;  1FG4 A;  2X99 A;  4MMM A;  2REM A;  4JU5 A;  3W6G A;  1SYX A;  4HZ4 A;  1EV9 A;  2ON7 A;  1GRX A;  3EUR A;  1GUK A;  1JZO A;  2H0I A;  5IMF A;  2LQQ A;  5CRD A;  3DGQ A;  2R2J A;  2P31 A;  2L6D A;  3C8E A;  2KP1 A;  3HY2 A;  5JCW A;  3ME7 A;  3UBL A;  5EPF A;  3UBK A;  1SKW B;  2BJX A;  2X4A A;  2G2Q A;  3L9U A;  5ECL B;  2WDU A;  3CTG A;  3M9K A;  2LKU A;  4IN0 A;  1O6J A;  3ZIJ A;  2ZUP A;  5J4U A;  3AY8 A;  5DAL A;  2MZC A;  4XRA A;  2YWN A;  2R4V A;  4O32 A;  1TK0 B;  3HHV A;  1TRS A;  4N10 A;  3TCO A;  4TOP A;  1EOH A;  3HJM A;  4HJM A;  1AQX A;  2AV4 A;  2VOC A;  2WCI A;  2FWG A;  1ML6 A;  2YJ7 A;  2TRC P;  5KOW A;  4GTU A;  6GSX A;  2MMA A;  3JCM L;  1KTE A;  1KNG A;  1XW9 A;  4XIH A;  3HVS A;  2YP6 A;  3GFK A;  1SD9 A;  4V2M A;  1GSQ A;  4OFM A;  2R3X A;  3ZML A;  4KND A;  2JSY A;  3D5J A;  5CRG A;  3TJJ A;  2XBQ A;  1N2A A;  3DRN A;  3GHA A;  3KH9 A;  1G7E A;  1ZCP A;  3GKK A;  4N0V A;  4XCS A;  2WS2 A;  1RK4 A;  1SJI A;  1X9M B;  2XBI A;  4HS1 A;  3ZYW A;  2VCX A;  1CQH A;  1Z7P A;  3GN3 A;  3H4K A;  1G6W A;  2HRN A;  2KHP A;  1LBK A;  4IP6 A;  4MA9 A;  4ISD A;  3TKS A;  5ECP B;  1O7U A;  2H74 A;  1FAA A;  3FRC A;  2FWH A;  1DSB A;  4XS6 A;  4I5Q A;  5FT3 A;  3EIN A;  4KW6 A;  3VLN A;  4V1A g;  2CQ9 A;  1T4Z A;  2IFQ B;  1A0F A;  2GVP A;  1PFO A;  2F3M A;  1PN9 A;  2DMM A;  1X9W B;  1TOF A;  4JZQ A;  4Z2U A;  5HQP A;  2YZU A;  2WRT A;  4KCE A;  4LMV A;  1MDI A;  3GV1 A;  6GSV A;  1F2E A;  1T8E B;  1GWC A;  5B7C A;  3EYT A;  2F8A A;  4MF6 A;  3QFB C;  4H86 A;  4K5R A;  3QR6 A;  4HI7 A;  2LJA A;  4KF9 A;  18GS A;  2E0Q A;  2HRK A;  4D73 A;  2LS5 A;  5A5K A;  1B4P A;  3V1W A;  1WJK A;  3LXZ A;  5ELG A;  1PSQ A;  4F82 A;  1FO5 A;  1V58 A;  5H5R A;  4NV5 A;  3F8U A;  1EEM A;  1AUC A;  1TK8 B;  2IWT A;  3KTL A;  4AGS A;  2FGX A;  4TXO B;  11GS A;  5IO0 A;  2C1Y A;  5ECN B;  5KN3 A;  1WRY A;  3ERG A;  1ZYP A;  2YV7 A;  2FWF A;  3GTU B;  3J7Y k;  1T3B A;  1V2A A;  1X5E A;  2X8H A;  4TR4 A;  4G10 A;  4YQM A;  4Q5Q A;  5BMU A;  2BMX A;  3RHB A;  5JCU A;  3RAZ A;  3F63 A;  4HQS A;  1XWC A;  2X8G A;  2IMI A;  2X8C A;  2DJ2 A;  5DAK B;  5JWO B;  1JFU A;  1M3J A;  1Z5Y E;  2B7K A;  4MDC A;  5EY6 A;  5KOX A;  5J9B A;  4HQZ A;  4O92 A;  1DUG A;  1GTB A;  4N11 A;  1TKD B;  3DXB A;  3QAG A;  3A2V A;  4KSM A;  1TW9 A;  4PQI A;  5HR0 A;  1GUL A;  4FYC A;  1V98 A;  2H1B A;  1BX9 A;  4ZIL A;  2VCW A;  12GS A;  3EC3 A;  1SL2 B;  4I6X A;  4F03 A;  4IHU A;  3EWL A;  1VF3 A;  4IQA A;  4JRR A;  4OCF A;  2H8L A;  1I9D A;  1UVZ A;  5LNK e;  4A5P A;  3KD0 A;  4ID0 A;  3BCK A;  3TJB A;  4AJ8 A;  1A8Y A;  2FWE A;  3UVT A;  4DEJ A;  1ZOF A;  3H8Q A;  5EL8 A;  1K0M A;  2DC5 A;  3DML A;  3VK9 A;  3CTF A;  2OKA A;  5ECI B;  1M2D A;  4FIW A;  2H71 A;  3CMI A;  2JU5 A;  3VI7 A;  1MD3 A;  1XFL A;  3VWV A;  2PPT A;  1QGV A;  3KMO A;  4N30 A;  2J9H A;  4MLY A;  1SK0 A;  4PUF C;  4ECJ A;  1A2M A;  1ERU A;  3ZMK A;  2LST A;  1WE0 A;  3UAP A;  2G0F A;  4RI6 A;  1SL0 B;  2LQO A;  9GSS A;  5L71 A;  3UJ1 A;  4OWY A;  2HZF A;  2PUK C;  2HI7 A;  1Y6E A;  4NV2 A;  5B6M A;  2F9S A;  2O85 A;  4KGI A;  3PR8 A;  3BBY A;  2RII A;  1TU8 A;  2LTK A;  3QD9 A;  2HSM A;  4MPG A;  3GTU A;  4I8B A;  2OE3 A;  2MMO A;  1Z6N A;  2YWM A;  1GNE A;  5D93 A;  1F3B A;  3PPU A;  3KZQ A;  3LG6 A;  3TRQ A;  1Z3E A;  2VL9 A;  1EGR A;  5ID2 B;  5DJM A;  4BWQ A;  4HJ2 A;  3Q18 A;  1TK5 B;  1SL1 B;  3CRU A;  4MZB A;  2L4C A;  5DAK A;  4O5U A;  2B3S A;  3FHK A;  2XPE A;  2L4Q A;  3GIX A;  1Z6M A;  1ILO A;  3IK7 A;  1FW1 A;  2AHE A;  4KB3 A;  2FUG 2;  1QUW A;  2H6X A;  1TI1 A;  1FB6 A;  1USB A;  2YWO A;  3M8N A;  3TKQ A;  4K8M A;  2JZS A;  5G31 A;  4XRD A;  1K0D A;  4FYU A;  2H1D A;  2N5F A;  3DVW A;  4ZL8 A;  3IXR A;  4F0C A;  4OCE A;  2F8F A;  1N8J A;  2OBK A;  4NPB A;  2L6C A;  4I97 A;  5CO3 A;  1F6M C;  4ULX A;  2V1M A;  4YKF A;  2I3Y A;  3CBU A;  1Q98 A;  2VCZ A;  4PNF A;  2VCQ A;  4EKZ A;  3GSS A;  3IAS 2;  2KUC A;  2PN8 A;  4TR1 B;  4XS4 B;  4IGJ A;  1JHB A;  3TDG A;  1S3A A;  3DWV A;  4ECI A;  3QMX A;  3LYP A;  4RI7 A;  3ERF A;  5KEJ A;  3N5O A;  1SD8 A;  4GCI A;  4CY8 A;  2P0G A;  5AN1 A;  2CVD A;  3ERW A;  1Q4J A;  5C00 A;  1M7T A;  5IQY A;  2YJH A;  1O81 A;  1J08 A;  2DLX A;  3FZ9 A;  5A4V A;  5INY A;  3I43 A;  3HDC A;  1NM3 A;  1B48 A;  2IME A;  1ABA A;  4PGT A;  1XWB A;  4LA1 A;  1JZR A;  4CW9 A;  4K0N A;  1OE8 A;  4ML1 A;  2C4J A;  2OAD A;  2AAW A;  2CT6 A;  3ZVJ A;  4J2F A;  4EIQ A;  1A2J A;  4PUR A;  1GUH A;  4IW9 A;  4MF5 A;  3FMW A;  1SKR B;  3QFA C;  2HFD A;  5LD0 A;  3E0U A;  3DYR A;  5B8B A;  2JL4 A;  2AUV A;  1THX A;  3FK8 A;  3DIE A;  3H1N A;  4F2I A;  4MAB A;  1PA3 A;  1KEB A;  17GS A;  4IVF A;  4MJE A;  2GST A;  1XW5 A;  3LGC A;  1BYE A;  4WR4 A;  5D8I A;  5CRE A;  2WJU A;  1TRU A;  2H70 A;  3IOS A;  2WB9 A;  3GYK A;  2DJJ A;  3D21 A;  3DKS A;  3OR5 A;  2PBJ A;  4K5S A;  2GS3 A;  3TJF A;  4JED A;  1EEJ A;  1BJX A;  5F8B A;  3KEB A;  3C1S A;  3IE3 A;  4MP4 A;  3SBC A;  4X4J A;  4WKW A;  3M0F A;  4OO4 A;  1XW6 A;  2DJ0 A;  2OA7 A;  5ECS A;  2O87 A;  2XPD A;  4F0B A;  5G5F A;  3F0I A;  2IL3 A;  5BRT A;  2JAC A;  4OFT A;  1SEN A;  3PGT A;  2H72 A;  4XS4 A;  4TR1 A;  5CNW A;  2V6O A;  3DD3 A;  1MD4 A;  5AIS A;  2CVK A;  2M46 A;  3IBH A;  3C71 A;  2H19 A;  5H5Q A;  3VPQ A;  6GSS A;  3FR3 A;  4BPY A;  4PQ1 A;  1THO A;  3HVN A;  3GA4 A;  3LOR A;  1XVQ A;  1OE7 A;  3G7Y A;  3PIN A;  2C3N A;  4G0I A;  1TDI A;  2HSH A;  4P3Y B;  2K18 A;  4LL4 B;  4ZB6 A;  1XG8 A;  2QGV A;  1PKZ A;  3KJY A;  3FZA A;  1EP8 A;  1R4W A;  2HLS A;  2JSZ A;  2VL2 A;  2VCV A;  4PXO A;  3P90 A;  1GSE A;  5IMA A;  2QSI A;  4ACS A;  5D73 A;  1ZYE A;  1C72 A;  1K3O A;  2R0G A;  1XWG A;  4FO5 A;  3D4M A;  3GKX A;  3G9B A;  3GX8 A;  2HYX A;  1NHY A;  1ZMA A;  2YPM A;  4X43 A;  1AQV A;  4OMV A;  5ABR A;  2BTO T;  3HYP A;  3M1G A;  3LW9 A;  3EPT A;  4ML6 A;  4K2D A;  3RBT A;  4EDZ A;  1ZL9 A;  5DCG A;  3SWL A;  2IN3 A;  3VWX A;  4K2X A;  1UA5 A;  2VD0 A;  1U3A A;  3U6V A;  3GNJ A;  3EU4 A;  2FY6 A;  4WF5 A;  3WGD A;  1XWK A;  2H66 A;  3A2W A;  4K9Z A;  2GT5 A;  3EMX A;  3D4T A;  2QC7 A;  5IMV A;  2FD3 A;  6GSW A;  4NAX A;  4ZL7 A;  3TKP A;  1EP7 A;  4MK3 A;  2CX3 A;  3HVV A;  4YAV A;  2RUE A;  4MPF A;  16GS A;  1G7O A;  1T00 A;  3IRA A;  1XWA A;  5DBQ A;  2FLS A;  5COH A;  1SKS B;  1ERW A;  2D2Z A;  5B6N A;  2DSA A;  1B9Y C;  2M72 A;  5G5E A;  1ZYN A;  4KDY A;  1YKC A;  2QA2 A;  5G1L A;  1GSD A;  3GMF A;  2HT9 A;  3F4S A;  3D22 A;  4KE3 A;  4V2L A;  4V2N A;  2VLV A;  2PVQ A;  4GSS A;  3KP8 A;  2DKI A;  3P8W A;  5DCH A;  1ZYQ B;  4PUA A;  3NIV A;  2PGT A;  2V41 A;  1EGO A;  4KUN A;  3I6A A;  3ZVJ D;  2CX4 A;  1DE2 A;  4LL1 B;  3IV4 A;  2OAC A;  3KP9 A;  3QDN A;  2RM5 A;  1XXU A;  1T1V A;  3I69 A;  2C3T A;  1TTZ A;  2KP2 A;  4LMW A;  4MJB A;  4Z2R A;  3VFI A;  5JCG A;  2H1A A;  3NOF A;  4Q5R A;  5GZZ B;  2PU9 C;  1RW1 A;  2ALB A;  3VWU A;  1YEX A;  4L0U A;  1ZGN A;  2DJ3 A;  4E8E A;  2Z9S A;  3G7J A;  2PER A;  3TKR A;  3Q6O A;  4I2U A;  3ZFL A;  2PMT A;  5HR2 A;  4HSC X;  4L5L A;  4KH7 A;  3UEM A;  1JLV A;  2E7P A;  1WPI A;  3HD5 A;  2A4V A;  1QFN A;  2OJL A;  3S9F A;  4JR6 A;  4J56 E;  1EZK A;  1HYU A;  2JZR A;  1GL8 A;  3IC8 A;  4XHM A;  1XVW A;  3WT1 A;  3L9S A;  2I9H A;  2I4A A;  2WUL A;  5A4W A;  4WF4 A;  2IFQ A;  3D6I A;  1AQW A;  5KN0 A;  2MMN A;  3TOU A;  3ZRE A;  4I2T A;  1XBS A;  1M2B A;  3O76 A;  1UC7 A;  2UZ8 A;  5AGY A;  3QCP A;  1HD2 A;  2CZ3 A;  4K7O A;  3GX0 A;  2KOK A;  5AIV A;  4HZ2 A;  5HFI A;  1A8L A;  2H76 A;  5IM9 A;  22GS A;  2WFC A;  4XTS A;  1GNW A;  1GSS A;  1GP1 A;  2PWJ A;  1K0O A;  3O6T A;  2B1L A;  2TRX A;  2VLT A;  4IS0 A;  3C7M A;  3GL5 A;  1TJD A;  4GLT A;  1PRX A;  4AF2 A;  5J41 A;  4MZW A;  2WGR A;  2M80 A;  3Q19 A;  3BD2 A;  2LJR A;  3EMP A;  4KX4 A;  2LRN A;  2LUS A;  4TVE A;  2GZP A;  3IPZ A;  4YQV A;  2L57 A;  1YY7 A;  1GH2 A;  4JE1 A;  3HZ8 A;  4DSR A;  4TXO A;  3TOT A;  3LYK A;  3L0H A;  5F06 A;  1MDK A;  3GH6 A;  1QQ2 A;  3FZ5 A;  1O8X A;  1SJZ A;  2C0G A;  1OC8 A;  2B5X A;  4G9H A;  3F3R A;  1WOU A;  3LEF A;  2HRF A;  2ZNM A;  4O5R A;  5ECO B;  2VM1 A;  1F37 A;  1GTU A;  1OYJ A;  3QAW A;  4GSN A;  1GSU A;  1ERV A;  2MBT A;  5CP1 A;  1VGL A;  1HNB A;  3TKS E;  4EF0 A;  2IMK A;  3VPT A;  2CVB A;  4RQX A;  2L5L A;  1ERT A;  2V6K A;  1MDJ A;  5AIX A;  2GLR A;  1XOB A;  4MJA A;  1Y25 A;  5KN1 A;  2VUP A;  3CSH A;  5IOW A;  2V32 A;  1JLW A;  3UIW A;  3IDV A;  5JWR B;  2O89 A;  2LNS A;  2R0C A;  4QL7 A;  4HOJ A;  1ZZY A;  1XZO A;  5D9X A;  3J7Y b;  5D96 A;  2DBC A;  4AJ6 A;  1SK2 A;  4MCU A;  4YQU A;  4IKH A;  1YF0 A;  1FVK A;  5D9W A;  3FZ4 A;  3LJR A;  1OAZ A;  7GSS A;  1V9W A;  1XPV A;  6GST A;  1CQG A;  2GQM A;  4OO5 A;  2QKE A;  3HCZ A;  2HE3 A;  2MBS A;  4NXI A;  3LQ7 A;  5GAN D;  1J0F A;  4TW5 A;  5FWG A;  4GST A;  3ME8 A;  2AJQ B;  3MYD A;  4LLR A;  3KTB A;  2HXK A;  1YF1 A;  5ECH B;  1NHO A;  4ECB A;  5DQY A;  1U87 A;  2DJ1 A;  4HDE A;  4G19 A;  1BQ7 A;  4TN8 A;  1K3Y A;  3QAV A;  1S3R A;  1HNC A;  2K8V A;  2CAQ A;  1AW9 A;  1FVJ A;  2H01 A;  4DVC A;  1QXH A;  1SU9 A;  3APQ A;  4ZIJ A;  2XC2 A;  1NSW A;  4BWS A;  2YZH A;  2K9F A;  5IOX A;  1TI3 A;  1PGT A;  1BG5 A;  5IPG A;  5ID2 A;  2RUF A;  8GSS A;  3Q74 A;  2YNX A;  2C0D A;  1YKA A;  5J3R A;  2VM2 A;  4BA7 A;  1R26 A;  5IIZ A;  3ZIV A;  5DJL A;  2GTU A;  4HUA A;  3LXT A;  5CAX A;  1MTC A;  2DIY A;  2L5O A;  5F07 A;  1SJ6 A;  5ELA A;  2A2P A;  3KIJ A;  3C1R A;  5EVO A;  3TKS C;  1YEP A;  3HJO A;  4EC0 A;  4Q5F A;  4MH2 A;  3IR4 A;  3MDK A;  2L59 A;  5ENU A;  3NZN A;  3ZLP A;  5FHI A;  1M3I A;  1T4Y A;  2CAI A;  5KN2 A;  3GUR A;  3GUS A;  2HSY A;  1A23 A;  1GSY A;  3UL3 A;  3F4T A;  1PL1 A;  1VF1 A;  4AJ7 A;  4KCA A;  3BOA A;  1WMJ A;  2LEG A;  4FH8 A;  3FEU A;  5IPH A;  3FY7 A;  2O8V B;  4V1A p;  1TU7 A;  4KAE A;  4CDO A;  2ON5 A;  2X64 A;  2P5R A;  2QA1 A;  4PX1 A;  2R0P A;  1PKW A;  1IYI A;  4DSS B;  1X9S B;  1G0T A;  5E4W A;  3GKN A;  4L8E A;  3K8N A;  4X0X A;  2X49 A;  1X5C A;  3W8S A;  4PQH A;  4O7H A;  3D0Z A;  4D73 B;  4ZB8 A;  5DQS A;  2MMZ A;  3HA9 A;  3CXG A;  3P7X A;  2AYT A;  2R6K A;  3ED3 A;  1EOG A;  2H75 A;  1K3L A;  5GST A;  4QQ7 A;  2LJK A;  1TXX A;  1B9X C;  1Z7R A;  2DML A;  5IMZ A;  2NTO A;  2E2M A;  1AIU A;  3U5R E;  4TXV A;  1JZD A;  1FHE A;  4K0G A;  2VL3 A;  1TRV A;  2N5B A;  1PL2 A;  4PTS A;  1LJR A;  5IMC A;  2MYG A;  3APO A;  3M9J A;  5F05 A;  2RLI A;  1R7H A;  3QPM A;  2P5Q A;  1PX6 A;  3GST A;  2C3Q A;  3LSZ A;  1HNA A;  4IQ1 A;  4KSO A;  1XOA A;  2V2G A;  2B5Y A;  3MAK A;  5G30 A;  3FR6 A;  2F51 A;  1OC9 B;  3HVX A;  1BED A;  4JBB A;  4J57 E;  1YQ1 A;  1E2Y A;  3RPN A;  2H6Y A;  4GQC A;  4GRF A;  2VIM A;  1YDK A;  2EIR A;  2EIO A;  1YZX A;  3BJ5 A;  1YJ6 A;  2R5G A;  4GXZ A;  1FB0 A;  2EIQ A;  2GSS A;  3H79 A;  2C0F A;  2ES7 A;  4NHZ A;  1AXD A;  5ECM B;  2IIY A;  2DIZ A;  2YV9 A;  4OD7 A;  4EUY A;  2K8S A;  14GS A;  3TUE A;  2DKH A;  4TKY A;  3TJG A;  1O85 A;  4GF0 A;  3I9V 2;  4X1U A;  2H6Z A;  3CRT A;  2IPA A;  4K1F A;  3QOU A;  5C04 A;  4Q5N A;  4TR0 A;  4KDU A;  4EVM A;  3TGZ A;  4DSS A;  5HFG A;  2EC4 A;  3O3T A;  2GZY A;  1AAZ A;  1H4O A;  1DBY A;  2VCT A;  3CYN A;  3IAM 2;  2CV4 A;  2B1K A;  5D9V A;  3UVH A;  3FKF A;  4IEL A;  1IYH A;  4GQF A;  2IMF A;  1VF2 A;  4MNN A;  1W4V A;  4ZXG A;  5IMD A;  3LFL A;  2I81 A;  3RHC A;  4TRX A;  1J9B A;  4POL A;  3C73 A;  3GH9 A;  4IBP A;  1X0R A;  3A2X A;  1FOV A;  4ZB9 A;  5HR3 A;  3L4N A;  2CA8 A;  5DDL A;  1W89 A;  2OBI A;  1B4Q A;  1OKT A;  4WET A;  3ZL5 A;  1PN0 A;  3TRP A;  2J23 A;  3L78 A;  3M3M A;  3A3T A;  3VI5 A;  2OE1 A;  2DJK A;  1X5D A;  2VO4 A;  2FNO A;  3LWA A;  1ACV A;  3F3Q A;  4BL7 B;  1SYR A;  2XHF A;  2NBS A;  3ZRD A;  3IHQ A;  3F6D A;  3MSZ A;  3CSJ A;  1M2A A;  3IHG A;  1RQM A;  3WGE A;  3RDW A;  3KMN A;  1T7P B;  5H5S A;  3L9V A;  2O7K A;  2WZ9 A;  1PQN A;  3IA1 A;  4G0K A;  20GS A;  4USS A;  2TIR A;  1SK1 A;  5B8A A;  3VWW A;  3A5I A;  3MIX A;  4L0W A;  1LU4 A;  19GS A;  2AB6 A;  1OC9 A;  1QMV A;  4BVY B;  3US3 A;  1A24 A;  1GLQ A;  1R5P A;  2C8U A;  2H1G A;  1F9M A;  3KH7 A;  1U6T A;  1ON4 A;  5G2Z A;  2E2G A;  1NW2 A;  1Z9H A;  2R37 A;  4WBR D;  1R5A A;  3EU3 A;  2H30 A;  3R2Q A;  5GSS A;  3N9J A;  2HZE B;  2LV3 A;  4FQU A;  5ECQ B;  5A4U A;  4WR5 A;  3APS A;  4HEA 2;  1GLP A;  4N0Z A;  3DVX A;  3CQF A;  5LCZ A;  1HQO A;  2K6V A;  2H73 A;  3ZZX A;  4KA0 A;  2VLU A;  1B8X A;  4YH2 A;  3FR9 A;  1OKD A;  2CZ2 A;  4F9Z A;  1S3C A;  4MZC A;  1I5G A;  4POK A;  2I1U A;  1TP9 A;  1K0N A;  2B7J A;  4BVX B;  1WWJ A;  3A5W A;  4POB A;  4NWY A;  5F0G A;  4GWR A;  1PMT A;  4JR4 A;  1AC1 A;  2JZT A;  1A2L A;  1GTI A;  3BCI A;  5CRH A;  6GSY A;  3E9J B;  3UOM A;  3F6F A;  2N5A A;  4IJ3 A;  3IC4 A;  4ILF A;  3KM6 A;  1K0B A;  1U3I A;  4MF7 A;  4QL9 A;  1H75 A;  2H0G A;  2GT6 A;  5DVB A;  3F4R A;  4CHS A;  4G0L A;  5HR1 A;  4IP1 A;  2GQK A;  1JZW A;  3KGK A;  1XIY A;  1OC3 A;  5ECR B;  5J5N A;  2FA8 A;  3GKM A;  1S3D A;  4PNG A;  2GDR A;  1GTA A;  6GSU A;  4K7I A;  1V40 A;  1FOH A;  1O73 A;  4OFN A;  3MNG A;  4BL7 A;  3PH9 A;  2FA4 A;  4MJC A;  3HXS A;  4HU7 A;  3UMA A;  3FYG A;  3TJK A;  1DE1 A;  4K7N A;  2JAD A;  4MH3 A;  1URM A;  4ZBA A;  2YOI A;  3KCM A;  4YKG A;  4BIK A;  3ZIT A;  1MEK A;  1M9B A;  3WT2 A;  4EO3 A;  3TB2 A;  1A0R P;  1PX7 A;  4Z2T A;  2H0H A;  4BVY A;  1WIK A;  3CSI A;  2IJY A;  2ZCT A;  3IK9 A;  4CY6 A;  2GGT A;  2LRC A;  1VF4 A;  2B6M A;  3DEX A;  4G2E A;  4KDX A;  3F9U A;  1WP0 A;  2HZE A;  2GQL A;  3ISO A;  1E6B A;  1XCC A;  2FCH A;  3HKR A;  2IMD A;  4ZL9 A;  1TRW A;  2LRT A;  3TRX A;  1M0U A;  1K0A A;  3VUR A;  2YN1 A;  3E3E A;  4WBJ A;  2B5E A;  1EV4 A;  2VAF A;  4NHW A;  2A2R A;  4EDY A;  5D9T A;  1PD2 1;  2NPB A;  5ECK B;  2VD1 A;  1VRS D;  1ST9 A;  3W8J A;  5DAL B;  4WXT A;  2NVL A;  5J9C A;  2YWI A;  3EE2 A;  4BVX A;  1V57 A;  4EE0 A;  4TR3 A;  4DSQ A;  3HJP A;  4NMU A;  2OE0 A;  4RQR A;  2C0E A;  13GS A;  2PVO C;  3MWH A;  5HFK A;  3G7I A;  2YAN A;  3H93 A;  1K0C A;  4EXJ A;  4XS1 A;  3GRX A;  2HNL A;  4WEY A;  1GUM A;  2RM6 A;  5GAP D;  2GZZ A;  4YAP A;  3ZFB A;  2A4H A;  2GSR A;  2GSQ A;  1QK8 A;  4Z7X A;  5CRW A;  3WD6 A;  3ZTL A;  3P2A A;  2VL2 C;  3R3E A;  3UAR A;  1M9A A;  1EWX A;  4POM A;  4RUV A;  3KXO A;  1U88 A;  4K6X A;  2LNT A;  3RPP A;  2YCD A;  1KBN A;  2A2S A;  4ICY A;  1O8W A;  4O5Q A;  10GS A;  1UN2 A;  4EIP A;  5JWQ B;  3EVI A;  3FW2 A;  2NDO A;  1G6Y A;  5E59 A;  3HZ4 A;  4L5O A;  1GSF A;  1BAY A;  2FHE A;  4FYB A;  2HRA A;  3WGX A;  4HU9 A;  4ECC A; 
#chains in the Genus database with same CATH homology
 3GL3 A;  4ZBD A;  3WYW A;  4EL1 A;  5G1K A;  5CYY A;  1F3A A;  5IO2 A;  2C80 A;  4E8H A;  2KLX A;  1OVN A;  4IJI A;  4ZBB A;  1M99 A;  1FG4 A;  2X99 A;  4MMM A;  2REM A;  4JU5 A;  3W6G A;  1SYX A;  4HZ4 A;  1EV9 A;  2ON7 A;  1GRX A;  3EUR A;  1GUK A;  1JZO A;  2H0I A;  5IMF A;  2LQQ A;  5CRD A;  3DGQ A;  2R2J A;  2P31 A;  2L6D A;  3C8E A;  2KP1 A;  3HY2 A;  5JCW A;  3ME7 A;  3UBL A;  5EPF A;  3UBK A;  1SKW B;  2BJX A;  2X4A A;  2G2Q A;  3L9U A;  5ECL B;  2WDU A;  3CTG A;  3M9K A;  2LKU A;  4IN0 A;  1O6J A;  3ZIJ A;  2ZUP A;  5J4U A;  3AY8 A;  5DAL A;  2MZC A;  4XRA A;  2YWN A;  2R4V A;  4O32 A;  1TK0 B;  3HHV A;  1TRS A;  4N10 A;  3TCO A;  4TOP A;  1EOH A;  3HJM A;  4HJM A;  1AQX A;  2AV4 A;  2VOC A;  2WCI A;  2FWG A;  1ML6 A;  2YJ7 A;  2TRC P;  5KOW A;  4GTU A;  6GSX A;  2MMA A;  3JCM L;  1KTE A;  1KNG A;  1XW9 A;  4XIH A;  3HVS A;  2YP6 A;  3GFK A;  1SD9 A;  4V2M A;  1GSQ A;  4OFM A;  2R3X A;  3ZML A;  4KND A;  2JSY A;  3D5J A;  5CRG A;  3TJJ A;  2XBQ A;  1N2A A;  3DRN A;  3GHA A;  3KH9 A;  1G7E A;  1ZCP A;  3GKK A;  4N0V A;  4XCS A;  2WS2 A;  1RK4 A;  1SJI A;  1X9M B;  2XBI A;  4HS1 A;  3ZYW A;  2VCX A;  1CQH A;  1Z7P A;  3GN3 A;  3H4K A;  1G6W A;  2HRN A;  2KHP A;  1LBK A;  4IP6 A;  4MA9 A;  4ISD A;  3TKS A;  5ECP B;  1O7U A;  2H74 A;  1FAA A;  3FRC A;  2FWH A;  1DSB A;  4XS6 A;  4I5Q A;  5FT3 A;  3EIN A;  4KW6 A;  3VLN A;  4V1A g;  2CQ9 A;  1T4Z A;  2IFQ B;  1A0F A;  2GVP A;  2F3M A;  1PN9 A;  2DMM A;  1X9W B;  1TOF A;  4JZQ A;  4Z2U A;  5HQP A;  2YZU A;  2WRT A;  4KCE A;  4LMV A;  1MDI A;  3GV1 A;  6GSV A;  1F2E A;  1T8E B;  1GWC A;  5B7C A;  3EYT A;  2F8A A;  4MF6 A;  3QFB C;  4H86 A;  4K5R A;  3QR6 A;  4HI7 A;  2LJA A;  4KF9 A;  18GS A;  2E0Q A;  2HRK A;  4D73 A;  2LS5 A;  5A5K A;  1B4P A;  3V1W A;  1WJK A;  3LXZ A;  5ELG A;  1PSQ A;  4F82 A;  1FO5 A;  1V58 A;  5H5R A;  4NV5 A;  3F8U A;  1EEM A;  1AUC A;  1TK8 B;  2IWT A;  3KTL A;  4AGS A;  2FGX A;  4TXO B;  11GS A;  5IO0 A;  2C1Y A;  5ECN B;  5KN3 A;  1WRY A;  3ERG A;  1ZYP A;  2YV7 A;  2FWF A;  3GTU B;  3J7Y k;  1T3B A;  1V2A A;  1X5E A;  2X8H A;  4TR4 A;  4G10 A;  4YQM A;  4Q5Q A;  5BMU A;  2BMX A;  3RHB A;  5JCU A;  3RAZ A;  3F63 A;  4HQS A;  1XWC A;  2X8G A;  2IMI A;  2X8C A;  2DJ2 A;  5DAK B;  5JWO B;  1JFU A;  2B7K A;  1Z5Y E;  4MDC A;  5EY6 A;  5KOX A;  5J9B A;  4HQZ A;  4O92 A;  1DUG A;  1GTB A;  4N11 A;  1TKD B;  3DXB A;  3QAG A;  3A2V A;  4KSM A;  1TW9 A;  4PQI A;  5HR0 A;  1GUL A;  4FYC A;  1V98 A;  2H1B A;  1BX9 A;  4ZIL A;  2VCW A;  12GS A;  3EC3 A;  1SL2 B;  4I6X A;  4F03 A;  4IHU A;  3EWL A;  1VF3 A;  4IQA A;  4JRR A;  4OCF A;  2H8L A;  1I9D A;  1UVZ A;  5LNK e;  4A5P A;  3KD0 A;  4ID0 A;  3BCK A;  3TJB A;  4AJ8 A;  1A8Y A;  2FWE A;  3UVT A;  4DEJ A;  1ZOF A;  3H8Q A;  5EL8 A;  1K0M A;  2DC5 A;  3DML A;  3VK9 A;  3CTF A;  2OKA A;  5ECI B;  1M2D A;  4FIW A;  2H71 A;  3CMI A;  2JU5 A;  3VI7 A;  1MD3 A;  1XFL A;  3VWV A;  2PPT A;  1QGV A;  3KMO A;  4N30 A;  2J9H A;  4MLY A;  1SK0 A;  4PUF C;  4ECJ A;  1A2M A;  1ERU A;  3ZMK A;  2LST A;  1WE0 A;  3UAP A;  2G0F A;  4RI6 A;  1SL0 B;  2LQO A;  9GSS A;  5L71 A;  3UJ1 A;  4OWY A;  2HZF A;  2PUK C;  2HI7 A;  1Y6E A;  4NV2 A;  5B6M A;  2F9S A;  2O85 A;  4KGI A;  3PR8 A;  3BBY A;  2RII A;  1TU8 A;  2LTK A;  3QD9 A;  2HSM A;  4MPG A;  3GTU A;  4I8B A;  2OE3 A;  2MMO A;  1Z6N A;  2YWM A;  1GNE A;  5D93 A;  1F3B A;  3PPU A;  3KZQ A;  3LG6 A;  3TRQ A;  1Z3E A;  2VL9 A;  1EGR A;  5ID2 B;  5DJM A;  4BWQ A;  4HJ2 A;  3Q18 A;  1TK5 B;  1SL1 B;  3CRU A;  4MZB A;  2L4C A;  5DAK A;  4O5U A;  2B3S A;  3FHK A;  2XPE A;  2L4Q A;  3GIX A;  1Z6M A;  1ILO A;  3IK7 A;  1FW1 A;  2AHE A;  4KB3 A;  2FUG 2;  1QUW A;  2H6X A;  1TI1 A;  1FB6 A;  1USB A;  2YWO A;  3M8N A;  3TKQ A;  4K8M A;  2JZS A;  5G31 A;  4XRD A;  1K0D A;  4FYU A;  2H1D A;  2N5F A;  3DVW A;  4ZL8 A;  3IXR A;  4F0C A;  4OCE A;  2F8F A;  1N8J A;  2OBK A;  4NPB A;  2L6C A;  4I97 A;  5CO3 A;  1F6M C;  4ULX A;  2V1M A;  4YKF A;  2I3Y A;  3CBU A;  1Q98 A;  2VCZ A;  4PNF A;  2VCQ A;  4EKZ A;  3GSS A;  3IAS 2;  2KUC A;  2PN8 A;  4TR1 B;  4XS4 B;  4IGJ A;  1JHB A;  3TDG A;  1S3A A;  3DWV A;  4ECI A;  3QMX A;  3LYP A;  4RI7 A;  3ERF A;  5KEJ A;  3N5O A;  1SD8 A;  4GCI A;  4CY8 A;  2P0G A;  5AN1 A;  2CVD A;  3ERW A;  1Q4J A;  5C00 A;  1M7T A;  5IQY A;  2YJH A;  1O81 A;  1J08 A;  2DLX A;  3FZ9 A;  5A4V A;  5INY A;  3I43 A;  3HDC A;  1NM3 A;  1B48 A;  2IME A;  1ABA A;  4PGT A;  1XWB A;  4LA1 A;  1JZR A;  4CW9 A;  4K0N A;  1OE8 A;  4ML1 A;  2C4J A;  2OAD A;  2AAW A;  2CT6 A;  3ZVJ A;  4J2F A;  4EIQ A;  1A2J A;  4PUR A;  1GUH A;  4IW9 A;  4MF5 A;  3FMW A;  1SKR B;  3QFA C;  2HFD A;  5LD0 A;  3E0U A;  3DYR A;  5B8B A;  2JL4 A;  2AUV A;  1THX A;  3FK8 A;  3DIE A;  3H1N A;  4F2I A;  4MAB A;  1PA3 A;  1KEB A;  17GS A;  4IVF A;  4MJE A;  2GST A;  1XW5 A;  3LGC A;  1BYE A;  4WR4 A;  5D8I A;  5CRE A;  2WJU A;  1TRU A;  2H70 A;  3IOS A;  2WB9 A;  3GYK A;  2DJJ A;  3D21 A;  3DKS A;  3OR5 A;  2PBJ A;  4K5S A;  2GS3 A;  3TJF A;  4JED A;  1EEJ A;  1BJX A;  5F8B A;  3KEB A;  3C1S A;  3IE3 A;  4MP4 A;  3SBC A;  4X4J A;  4WKW A;  3M0F A;  4OO4 A;  1XW6 A;  2DJ0 A;  2OA7 A;  5ECS A;  2O87 A;  2XPD A;  4F0B A;  5G5F A;  3F0I A;  2IL3 A;  5BRT A;  2JAC A;  4OFT A;  1SEN A;  3PGT A;  2H72 A;  4XS4 A;  4TR1 A;  5CNW A;  2V6O A;  3DD3 A;  1MD4 A;  5AIS A;  2CVK A;  2M46 A;  3IBH A;  3C71 A;  2H19 A;  5H5Q A;  3VPQ A;  6GSS A;  3FR3 A;  4BPY A;  4PQ1 A;  1THO A;  3GA4 A;  3LOR A;  1XVQ A;  1OE7 A;  3G7Y A;  3PIN A;  2C3N A;  4G0I A;  1TDI A;  2HSH A;  4P3Y B;  2K18 A;  4LL4 B;  4ZB6 A;  2QGV A;  1PKZ A;  3KJY A;  3FZA A;  1EP8 A;  1R4W A;  2HLS A;  2JSZ A;  2VL2 A;  2VCV A;  4PXO A;  3P90 A;  1GSE A;  5IMA A;  2QSI A;  4ACS A;  5D73 A;  1ZYE A;  1C72 A;  1K3O A;  2R0G A;  1XWG A;  4FO5 A;  3D4M A;  3GKX A;  3G9B A;  3GX8 A;  2HYX A;  1NHY A;  1ZMA A;  2YPM A;  4X43 A;  1AQV A;  4OMV A;  5ABR A;  2BTO T;  3HYP A;  3M1G A;  3LW9 A;  3EPT A;  4ML6 A;  4K2D A;  3RBT A;  4EDZ A;  1ZL9 A;  5DCG A;  3SWL A;  2IN3 A;  3VWX A;  4K2X A;  1UA5 A;  2VD0 A;  1U3A A;  3U6V A;  3GNJ A;  3EU4 A;  2FY6 A;  4WF5 A;  3WGD A;  1XWK A;  2H66 A;  3A2W A;  4K9Z A;  2GT5 A;  3EMX A;  3D4T A;  2QC7 A;  5IMV A;  2FD3 A;  6GSW A;  4NAX A;  4ZL7 A;  3TKP A;  1EP7 A;  4MK3 A;  2CX3 A;  3HVV A;  4YAV A;  2RUE A;  4MPF A;  16GS A;  1G7O A;  1T00 A;  3IRA A;  1XWA A;  5DBQ A;  2FLS A;  5COH A;  1SKS B;  1ERW A;  2D2Z A;  5B6N A;  2DSA A;  1B9Y C;  2M72 A;  5G5E A;  1ZYN A;  4KDY A;  1YKC A;  2QA2 A;  5G1L A;  1GSD A;  3GMF A;  2HT9 A;  3F4S A;  3D22 A;  4KE3 A;  4V2L A;  4V2N A;  2VLV A;  2PVQ A;  4GSS A;  3KP8 A;  2DKI A;  3P8W A;  5DCH A;  1ZYQ B;  4PUA A;  3NIV A;  2PGT A;  2V41 A;  1EGO A;  4KUN A;  3I6A A;  3ZVJ D;  2CX4 A;  1DE2 A;  4LL1 B;  3IV4 A;  2OAC A;  3KP9 A;  3QDN A;  2RM5 A;  1XXU A;  1T1V A;  3I69 A;  2C3T A;  1TTZ A;  2KP2 A;  4LMW A;  4MJB A;  4Z2R A;  3VFI A;  5JCG A;  2H1A A;  3NOF A;  4Q5R A;  5GZZ B;  2PU9 C;  1RW1 A;  2ALB A;  3VWU A;  1YEX A;  4L0U A;  1ZGN A;  2DJ3 A;  4E8E A;  2Z9S A;  3G7J A;  2PER A;  3TKR A;  3Q6O A;  4I2U A;  3ZFL A;  2PMT A;  5HR2 A;  4L5L A;  4KH7 A;  3UEM A;  1JLV A;  2E7P A;  1WPI A;  3HD5 A;  2A4V A;  1QFN A;  2OJL A;  3S9F A;  4JR6 A;  4J56 E;  1EZK A;  1HYU A;  2JZR A;  1GL8 A;  3IC8 A;  4XHM A;  1XVW A;  3WT1 A;  3L9S A;  2I9H A;  2I4A A;  2WUL A;  5A4W A;  4WF4 A;  2IFQ A;  3D6I A;  1AQW A;  5KN0 A;  2MMN A;  3TOU A;  3ZRE A;  4I2T A;  1XBS A;  1M2B A;  3O76 A;  1UC7 A;  2UZ8 A;  5AGY A;  3QCP A;  1HD2 A;  2CZ3 A;  4K7O A;  3GX0 A;  2KOK A;  5AIV A;  4HZ2 A;  5HFI A;  1A8L A;  2H76 A;  5IM9 A;  22GS A;  2WFC A;  4XTS A;  1GNW A;  1GSS A;  1GP1 A;  2PWJ A;  1K0O A;  3O6T A;  2B1L A;  2TRX A;  2VLT A;  4IS0 A;  3C7M A;  3GL5 A;  1TJD A;  4GLT A;  1PRX A;  4AF2 A;  5J41 A;  4MZW A;  2WGR A;  2M80 A;  3Q19 A;  3BD2 A;  2LJR A;  3EMP A;  4KX4 A;  2LRN A;  2LUS A;  4TVE A;  2GZP A;  3IPZ A;  4YQV A;  2L57 A;  1YY7 A;  1GH2 A;  4JE1 A;  3HZ8 A;  4DSR A;  4TXO A;  3TOT A;  3LYK A;  3L0H A;  5F06 A;  1MDK A;  3GH6 A;  1QQ2 A;  3FZ5 A;  1O8X A;  1SJZ A;  2C0G A;  1OC8 A;  2B5X A;  4G9H A;  3F3R A;  1WOU A;  3LEF A;  2HRF A;  2ZNM A;  4O5R A;  5ECO B;  2VM1 A;  1F37 A;  1GTU A;  1OYJ A;  3QAW A;  4GSN A;  1GSU A;  1ERV A;  2MBT A;  5CP1 A;  1VGL A;  1HNB A;  3TKS E;  4EF0 A;  2IMK A;  3VPT A;  2CVB A;  4RQX A;  2L5L A;  1ERT A;  2V6K A;  1MDJ A;  5AIX A;  2GLR A;  1XOB A;  4MJA A;  1Y25 A;  5KN1 A;  2VUP A;  3CSH A;  5IOW A;  2V32 A;  1JLW A;  3UIW A;  3IDV A;  5JWR B;  2O89 A;  2LNS A;  2R0C A;  4QL7 A;  4HOJ A;  1ZZY A;  1XZO A;  5D9X A;  3J7Y b;  5D96 A;  2DBC A;  4AJ6 A;  1SK2 A;  4MCU A;  4YQU A;  4IKH A;  1YF0 A;  1FVK A;  5D9W A;  3FZ4 A;  3LJR A;  1OAZ A;  7GSS A;  1V9W A;  1XPV A;  6GST A;  1CQG A;  2GQM A;  4OO5 A;  2QKE A;  3HCZ A;  2HE3 A;  2MBS A;  4NXI A;  3LQ7 A;  5GAN D;  1J0F A;  4TW5 A;  5FWG A;  4GST A;  3ME8 A;  2AJQ B;  3MYD A;  4LLR A;  3KTB A;  2HXK A;  1YF1 A;  5ECH B;  1NHO A;  4ECB A;  5DQY A;  1U87 A;  2DJ1 A;  4HDE A;  4G19 A;  1BQ7 A;  4TN8 A;  1K3Y A;  3QAV A;  1HNC A;  2K8V A;  2CAQ A;  1AW9 A;  1FVJ A;  2H01 A;  4DVC A;  1QXH A;  1SU9 A;  3APQ A;  4ZIJ A;  2XC2 A;  1NSW A;  4BWS A;  2YZH A;  2K9F A;  5IOX A;  1TI3 A;  1PGT A;  1BG5 A;  5IPG A;  5ID2 A;  2RUF A;  8GSS A;  3Q74 A;  2YNX A;  2C0D A;  1YKA A;  5J3R A;  2VM2 A;  4BA7 A;  1R26 A;  5IIZ A;  3ZIV A;  5DJL A;  2GTU A;  4HUA A;  3LXT A;  5CAX A;  1MTC A;  2DIY A;  2L5O A;  5F07 A;  1SJ6 A;  5ELA A;  2A2P A;  3KIJ A;  3C1R A;  5EVO A;  3TKS C;  1YEP A;  3HJO A;  4EC0 A;  4Q5F A;  4MH2 A;  3IR4 A;  3MDK A;  2L59 A;  5ENU A;  3NZN A;  3ZLP A;  5FHI A;  1T4Y A;  2CAI A;  5KN2 A;  3GUR A;  3GUS A;  2HSY A;  1A23 A;  1GSY A;  3UL3 A;  3F4T A;  1PL1 A;  1VF1 A;  4AJ7 A;  4KCA A;  3BOA A;  1WMJ A;  2LEG A;  4FH8 A;  3FEU A;  5IPH A;  3FY7 A;  2O8V B;  4V1A p;  1TU7 A;  4KAE A;  4CDO A;  2ON5 A;  2X64 A;  2P5R A;  2QA1 A;  4PX1 A;  2R0P A;  1PKW A;  1IYI A;  4DSS B;  1X9S B;  1G0T A;  5E4W A;  3GKN A;  4L8E A;  3K8N A;  4X0X A;  2X49 A;  1X5C A;  3W8S A;  4PQH A;  4O7H A;  3D0Z A;  4D73 B;  4ZB8 A;  5DQS A;  2MMZ A;  3HA9 A;  3CXG A;  3P7X A;  2AYT A;  2R6K A;  3ED3 A;  1EOG A;  2H75 A;  1K3L A;  5GST A;  4QQ7 A;  2LJK A;  1TXX A;  1B9X C;  1Z7R A;  2DML A;  5IMZ A;  2NTO A;  2E2M A;  1AIU A;  3U5R E;  4TXV A;  1JZD A;  1FHE A;  4K0G A;  2VL3 A;  1TRV A;  2N5B A;  1PL2 A;  4PTS A;  1LJR A;  5IMC A;  2MYG A;  3APO A;  3M9J A;  5F05 A;  2RLI A;  1R7H A;  3QPM A;  2P5Q A;  1PX6 A;  3GST A;  2C3Q A;  3LSZ A;  1HNA A;  4IQ1 A;  4KSO A;  1XOA A;  2V2G A;  2B5Y A;  3MAK A;  5G30 A;  3FR6 A;  2F51 A;  1OC9 B;  3HVX A;  1BED A;  4JBB A;  4J57 E;  1YQ1 A;  1E2Y A;  3RPN A;  2H6Y A;  4GQC A;  4GRF A;  2VIM A;  1YDK A;  2EIR A;  2EIO A;  1YZX A;  3BJ5 A;  1YJ6 A;  2R5G A;  4GXZ A;  1FB0 A;  2EIQ A;  2GSS A;  3H79 A;  2C0F A;  2ES7 A;  4NHZ A;  1AXD A;  5ECM B;  2IIY A;  2DIZ A;  2YV9 A;  4OD7 A;  4EUY A;  2K8S A;  14GS A;  3TUE A;  2DKH A;  4TKY A;  3TJG A;  1O85 A;  4GF0 A;  3I9V 2;  4X1U A;  2H6Z A;  3CRT A;  2IPA A;  4K1F A;  3QOU A;  5C04 A;  4Q5N A;  4TR0 A;  4KDU A;  4EVM A;  3TGZ A;  4DSS A;  5HFG A;  2EC4 A;  3O3T A;  2GZY A;  1AAZ A;  1H4O A;  1DBY A;  2VCT A;  3CYN A;  3IAM 2;  2CV4 A;  2B1K A;  5D9V A;  3UVH A;  3FKF A;  4IEL A;  1IYH A;  4GQF A;  2IMF A;  1VF2 A;  4MNN A;  1W4V A;  4ZXG A;  5IMD A;  3LFL A;  2I81 A;  3RHC A;  4TRX A;  1J9B A;  4POL A;  3C73 A;  3GH9 A;  4IBP A;  1X0R A;  3A2X A;  1FOV A;  4ZB9 A;  5HR3 A;  3L4N A;  2CA8 A;  5DDL A;  1W89 A;  2OBI A;  1B4Q A;  1OKT A;  4WET A;  3ZL5 A;  1PN0 A;  3TRP A;  2J23 A;  3L78 A;  3M3M A;  3A3T A;  3VI5 A;  2OE1 A;  2DJK A;  1X5D A;  2VO4 A;  2FNO A;  3LWA A;  1ACV A;  3F3Q A;  4BL7 B;  1SYR A;  2XHF A;  2NBS A;  3ZRD A;  3IHQ A;  3F6D A;  3MSZ A;  3CSJ A;  1M2A A;  3IHG A;  1RQM A;  3WGE A;  3RDW A;  3KMN A;  1T7P B;  5H5S A;  3L9V A;  2O7K A;  2WZ9 A;  1PQN A;  3IA1 A;  4G0K A;  20GS A;  4USS A;  2TIR A;  1SK1 A;  5B8A A;  3VWW A;  3A5I A;  3MIX A;  4L0W A;  1LU4 A;  19GS A;  2AB6 A;  1OC9 A;  1QMV A;  4BVY B;  3US3 A;  1A24 A;  1GLQ A;  1R5P A;  2C8U A;  2H1G A;  1F9M A;  3KH7 A;  1U6T A;  1ON4 A;  5G2Z A;  2E2G A;  1NW2 A;  1Z9H A;  2R37 A;  4WBR D;  1R5A A;  3EU3 A;  2H30 A;  3R2Q A;  5GSS A;  3N9J A;  2HZE B;  2LV3 A;  4FQU A;  5ECQ B;  5A4U A;  4WR5 A;  3APS A;  4HEA 2;  1GLP A;  4N0Z A;  3DVX A;  5LCZ A;  1HQO A;  2K6V A;  2H73 A;  3ZZX A;  4KA0 A;  2VLU A;  1B8X A;  4YH2 A;  3FR9 A;  1OKD A;  2CZ2 A;  4F9Z A;  1S3C A;  4MZC A;  1I5G A;  4POK A;  2I1U A;  1TP9 A;  1K0N A;  2B7J A;  4BVX B;  1WWJ A;  3A5W A;  4POB A;  4NWY A;  5F0G A;  4GWR A;  1PMT A;  4JR4 A;  1AC1 A;  2JZT A;  1A2L A;  1GTI A;  3BCI A;  5CRH A;  6GSY A;  3E9J B;  3UOM A;  3F6F A;  2N5A A;  4IJ3 A;  3IC4 A;  4ILF A;  3KM6 A;  1K0B A;  1U3I A;  4MF7 A;  4QL9 A;  1H75 A;  2H0G A;  2GT6 A;  5DVB A;  3F4R A;  4CHS A;  4G0L A;  5HR1 A;  4IP1 A;  2GQK A;  1JZW A;  3KGK A;  1XIY A;  1OC3 A;  5ECR B;  5J5N A;  2FA8 A;  3GKM A;  1S3D A;  4PNG A;  2GDR A;  1GTA A;  6GSU A;  4K7I A;  1V40 A;  1FOH A;  1O73 A;  4OFN A;  3MNG A;  4BL7 A;  3PH9 A;  2FA4 A;  4MJC A;  3HXS A;  4HU7 A;  3UMA A;  3FYG A;  3TJK A;  1DE1 A;  4K7N A;  2JAD A;  4MH3 A;  1URM A;  4ZBA A;  2YOI A;  3KCM A;  4YKG A;  3ZIT A;  1MEK A;  1M9B A;  3WT2 A;  4EO3 A;  3TB2 A;  1A0R P;  1PX7 A;  4Z2T A;  2H0H A;  4BVY A;  1WIK A;  3CSI A;  2IJY A;  2ZCT A;  3IK9 A;  4CY6 A;  2GGT A;  2LRC A;  1VF4 A;  2B6M A;  3DEX A;  4G2E A;  4KDX A;  3F9U A;  1WP0 A;  2HZE A;  2GQL A;  3ISO A;  1E6B A;  1XCC A;  2FCH A;  3HKR A;  2IMD A;  4ZL9 A;  1TRW A;  2LRT A;  3TRX A;  1M0U A;  1K0A A;  3VUR A;  2YN1 A;  3E3E A;  4WBJ A;  2B5E A;  1EV4 A;  2VAF A;  4NHW A;  2A2R A;  4EDY A;  5D9T A;  1PD2 1;  2NPB A;  5ECK B;  2VD1 A;  1VRS D;  1ST9 A;  3W8J A;  5DAL B;  4WXT A;  2NVL A;  5J9C A;  2YWI A;  3EE2 A;  4BVX A;  1V57 A;  4EE0 A;  4TR3 A;  4DSQ A;  3HJP A;  4NMU A;  2OE0 A;  4RQR A;  2C0E A;  13GS A;  2PVO C;  3MWH A;  5HFK A;  3G7I A;  2YAN A;  3H93 A;  1K0C A;  4EXJ A;  4XS1 A;  3GRX A;  2HNL A;  4WEY A;  1GUM A;  2RM6 A;  5GAP D;  2GZZ A;  4YAP A;  3ZFB A;  2A4H A;  2GSR A;  2GSQ A;  1QK8 A;  4Z7X A;  5CRW A;  3WD6 A;  3ZTL A;  3P2A A;  2VL2 C;  3R3E A;  3UAR A;  1M9A A;  1EWX A;  4POM A;  4RUV A;  3KXO A;  1U88 A;  4K6X A;  2LNT A;  3RPP A;  2YCD A;  1KBN A;  2A2S A;  4ICY A;  1O8W A;  4O5Q A;  10GS A;  1UN2 A;  4EIP A;  5JWQ B;  3EVI A;  3FW2 A;  2NDO A;  1G6Y A;  5E59 A;  3HZ4 A;  4L5O A;  1GSF A;  1BAY A;  2FHE A;  4FYB A;  2HRA A;  3WGX A;  4HU9 A;  4ECC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...