1A8LA

Protein disulfide oxidoreductase from archaeon pyrococcus furiosus
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
226
structure length
226
Chain Sequence
MGLISDADKKVIKEEFFSKMVNPVKLIVFVRKDHCQYCDQLKQLVQELSELTDKLSYEIVDFDTPEGKELAKRYRIDRAPATTITQDGKDFGVRYFGLPAGHEFAAFLEDIVDVSREETNLMDETKQAIRNIDQDVRILVFVTPTCPYCPLAVRMAHKFAIENTKAGKGKILGDMVEAIEYPEWADQYNVMAVPKIVIQVNGEDRVEFEGAYPEKMFLEKLLSALS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords PROTEIN DISULFIDE OXIDOREDUCTASE
publication title A protein disulfide oxidoreductase from the archaeon Pyrococcus furiosus contains two thioredoxin fold units.
pubmed doi rcsb
source organism Pyrococcus furiosus
total genus 83
structure length 226
sequence length 226
ec nomenclature
pdb deposition date 1998-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13192 Thioredoxin_3 Thioredoxin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1a8lA01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1a8lA02
3EWLA 3ZLPA 1FOVA 1PMTA 3HYPA 3RHCA 3M9KA 5CYYA 4NXIA 1Y6EA 1ZMAA 3GKKA 1LU4A 2ZNMA 4EF0A 2FWHA 3FK8A 1EOGA 4Q5RA 2REMA 3FR9A 3F0IA 4LL4B 4HI7A 3FZ4A 2L59A 2JZTA 3GL5A 1V40A 2K8VA 1SL2B 3VURA 1BEDA 17GSA 5B7CA 2GT6A 1NM3A 4BPYA 1G7EA 1GSEA 4EVMA 2IJYA 2H72A 2LJRA 3FKFA 2JACA 1T7PB 4N30A 4PX1A 2LS5A 1Z5YE 3L9VA 1M0UA 1WOUA 3N9JA 3EINA 1K0MA 1TRWA 5H5RA 16GSA 3VI5A 4MJCA 2P5QA 3KGKA 3EU4A 4X0XA 4NAXA 1SKSB 1BX9A 3EC3A 4X1UA 1A2MA 2XPEA 4MK3A 2NVLA 2X8HA 4FYBA 2M46A 5GSSA 2TRCP 2PERA 3Q19A 2KP1A 3QAWA 5IM9A 3M0FA 4CDOA 2V1MA 4PQIA 4KDXA 5KEJA 2HSHA 1X5DA 1K3YA 1HNCA 3G7YA 3TOTA 2AHEA 4GXZA 1SD8A 1R5PA 5CREA 5HFKA 3KP8A 2H30A 3HXSA 4MCUA 5DCHA 1Z6NA 2X8GA 1JZWA 8GSSA 2N5BA 3MSZA 2YCDA 4WETA 1YJ6A 3UJ1A 3V1WA 5ECSA 2MMZA 4KGIA 2HE3A 2I9HA 1QQ2A 1V9WA 2X64A 1A2JA 5AISA 3HHVA 3HY2A 3IE3A 3MNGA 5G30A 2O8VB 4MH2A 2WDUA 3IXRA 2Z9SA 3LXTA 3J7Yk 4TXOA 3VPTA 4ILFA 2CZ3A 2FD3A 4D73B 3SBCA 9GSSA 5DALA 2F9SA 5ECIB 1GNEA 2B6MA 2FY6A 3GYKA 3C8EA 1TRUA 4EDZA 1FVKA 1S3CA 3ZITA 2CX4A 2IFQB 2GSRA 1VRSD 3O76A 4YH2A 3PINA 2F8AA 2QGVA 3P7XA 1X5CA 3O6TA 3Q6OA 3TJFA 4J2FA 2DC5A 3G9BA 6GSVA 2H74A 4RI7A 3H8QA 2H8LA 3F4TA 1GTAA 3H79A 5INYA 4KDYA 2CAIA 1AUCA 3SWLA 4IGJA 4HDEA 1HYUA 1WRYA 2P31A 3KJYA 2L5LA 4OCEA 2F51A 4JR4A 4GSNA 3KP9A 4MJEA 3HVSA 3HD5A 1X9SB 2G2QA 2C0FA 1NHOA 5A5KA 3D5JA 1HQOA 2O85A 3LYKA 2RLIA 1RK4A 1B4QA 1DE2A 2LRNA 1A8YA 3ZIVA 2CV4A 3VWUA 1XCCA 1GH2A 2WJUA 4GLTA 3C1RA 2RM5A 1MTCA 2VAFA 4KSOA 1R4WA 3EMPA 2B1KA 2QSIA 5DQYA 1YQ1A 3UOMA 2CAQA 1J08A 3QAVA 5DJLA 4G9HA 1KTEA 2VL2C 4KX4A 4MABA 3TJKA 3F3RA 3RPPA 1GUKA 2OADA 4Z7XA 2H1BA 3A2XA 1U6TA 2FWGA 3GX8A 2JL4A 3U6VA 3NZNA 1QXHA 5B6NA 3TJBA 1G7OA 5GSTA 3CTFA 2DBCA 4IJ3A 5HR1A 2R6KA 4AF2A 5ECKB 5DAKB 2WCIA 3F4RA 2FA8A 4GTUA 5IIZA 3LEFA 4EL1A 3TRXA 4D73A 4HQSA 4K9ZA 4KUNA 2HT9A 1EEJA 3IPZA 4L5LA 3R2QA 3KMNA 4ML1A 4FIWA 5CRHA 2B3SA 5F07A 2MZCA 2MYGA 2OE1A 2NTOA 1OE7A 3PH9A 5EVOA 4GF0A 1XVWA 4WF5A 2VL3A 4BL7A 2AYTA 5EPFA 1XZOA 2LV3A 2LNSA 1PKWA 5DQSA 5ECNB 1ON4A 3F6DA 2C1YA 4EXJA 4WXTA 4OWYA 4IELA 4F9ZA 5G2ZA 2ZUPA 5LD0A 4MF6A 5D9WA 4JEDA 2B7KA 5AIVA 3VWWA 5B6MA 3GSTA 1F3AA 1SL1B 3KM6A 1XBSA 3GIXA 4EUYA 5JCWA 1WMJA 1ERWA 4HU7A 1R26A 3GV1A 1B8XA 1PD21 4KCEA 4IN0A 1KEBA 1O8WA 4FO5A 4Q5FA 2H6XA 4EE0A 1A23A 4DSRA 1Q98A 3F4SA 4XS4B 1DE1A 2YZUA 4TW5A 2L5OA 2EIQA 1O6JA 1TRVA 3E3EA 3WGXA 2VIMA 2KHPA 1OKTA 3GKNA 3GH6A 2BMXA 1XW9A 6GSYA 4ECIA 1GTIA 2IMFA 2GQMA 3P8WA 4IQ1A 3S9FA 3WT1A 4WR5A 3PR8A 3HJOA 1XWGA 1BYEA 5LCZA 2HRFA 1GSQA 6GSTA 2PN8A 4I5QA 4YAVA 4ZB9A 4PQ1A 3WYWA 1OC9A 1YF0A 2VCTA 5AIXA 2GSQA 3NOFA 1XWBA 3TJGA 4F82A 1YY7A 3GKMA 2EIOA 3MWHA 2R3XA 3FR3A 5DAKA 1E6BA 2GZYA 4MZCA 2CVBA 5CNWA 2VCZA 5H5SA 5EY6A 4AJ7A 1TDIA 2OA7A 1U88A 4IQAA 3GL3A 5IMZA 3QMXA 2H6ZA 1BAYA 1EWXA 5A4VA 1GLQA 3IAM2 2M80A 5J5NA 2PVQA 1ILOA 1WIKA 3C7MA 2A4VA 1YDKA 2PBJA 4MJAA 1YEXA 1M2AA 4NHZA 2WGRA 4YQMA 5ECRB 1RW1A 2P5RA 4POKA 3UEMA 1O8XA 3CTGA 4CHSA 3ZZXA 3UBKA 1TRSA 3KTLA 2I1UA 2BTOT 3IAS2 4NMUA 3FEUA 3RAZA 2H76A 5FT3A 3HA9A 1ZYQB 3BD2A 6GSSA 5D9TA 1G0TA 3LQ7A 4Q5NA 2J9HA 3D21A 1TI3A 3EYTA 2YJ7A 3HKRA 3L9SA 3FZ5A 1K0CA 1USBA 1OC3A 3QFBC 5ELGA 3L9UA 2JZRA 2LEGA 3IK7A 4J56E 4JRRA 1EV9A 1SJ6A 1I9DA 5AGYA 5FHIA 3ZRDA 3ZL5A 3JCML 2XPDA 1JZOA 1ABAA 4NV5A 2YNXA 4MPGA 2CA8A 2FA4A 3KH9A 1EZKA 2XBIA 5F8BA 3UMAA 1DUGA 2H0HA 2VLUA 4TXOB 1SYRA 3KD0A 1Z3EA 1TW9A 3CBUA 5JWRB 2HZFA 5DALB 3ZVJD 1VF4A 2WULA 1J0FA 2KLXA 2LRTA 3L4NA 1G6WA 1GSSA 2E0QA 5CRDA 3HJPA 1DSBA 4WKWA 1K0BA 5DCGA 1VF1A 1FG4A 2FUG2 1V57A 2AB6A 4MMMA 1SK2A 2GQLA 1OC8A 4V2LA 4V2MA 1G6YA 3ZMLA 1UA5A 1M99A 3ZFLA 3GKXA 1CQGA 4IP1A 4IW9A 3TCOA 4ECCA 1RQMA 2V6KA 2OE3A 1PSQA 1JLWA 4TXVA 3A3TA 1BG5A 1JZRA 2QC7A 4XS1A 5G1KA 18GSA 2RUEA 4TKYA 2H1AA 3WT2A 2PGTA 5J41A 3LSZA 4HEA2 1WP0A 2DMLA 4I6XA 3MAKA 2DJ3A 2VLTA 4HOJA 5GAPD 2XC2A 1MD4A 4NPBA 3TB2A 3ZFBA 4RUVA 5J9BA 3CSJA 2YWIA 2IL3A 3LFLA 3J7Yb 4IKHA 2I81A 2OBIA 2YWMA 2PPTA 3VLNA 3DEXA 2AJQB 5ECPB 2FLSA 1THOA 3LWAA 5D93A 1U3IA 3P90A 2ON5A 4QL7A 1F3BA 1U87A 2JADA 2L6DA 1NSWA 1F6MC 1XOBA 4DVCA 4POLA 1ST9A 5A4WA 5HFIA 2FWEA 1XWCA 2O87A 4G10A 3W6GA 3F3QA 4ZL8A 1V58A 3ZIJA 1OKDA 3DXBA 4KE3A 1IYHA 1XIYA 2KP2A 2H71A 4TR3A 1XXUA 1M2DA 1PX7A 4KDUA 5D73A 1T00A 1SK0A 4EO3A 1GTBA 2A2SA 2YWNA 3EURA 3GNJA 4JU5A 5D9XA 1BQ7A 3M9JA 1H75A 4ZL9A 3VK9A 3F6FA 1FVJA 1JFUA 2N5FA 2PVOC 4IVFA 3LORA 4I8BA 2DJJA 4EKZA 1K0OA 2IMDA 2ZCTA 2K9FA 2IPAA 2J23A 3HVVA 6GSWA 4RI6A 3BCKA 5C00A 3TKSA 3KZQA 5DJMA 2YOIA 4MJBA 2C3TA 3HCZA 4O5RA 7GSSA 4ZIJA 2YV7A 4L8EA 3FW2A 3IR4A 1WJKA 4E8HA 1A0RP 2FHEA 1H4OA 2CQ9A 2RM6A 2TIRA 2DMMA 1YKAA 2B7JA 2LSTA 1M9BA 4HZ4A 2YN1A 3AY8A 3TUEA 5ECHB 3KXOA 2PU9C 3GURA 4GSTA 4HJMA 4GCIA 4AJ8A 3Q74A 4Q5QA 3GFKA 4CW9A 3D4MA 5CRGA 3GX0A 4AGSA 3HVXA 3D0ZA 5D9VA 4I2TA 2DSAA 3DMLA 1NW2A 1NHYA 2FGXA 5HFGA 3TDGA 3LGCA 4TN8A 3GTUA 1OC9B 2B5XA 4F0BA 3IV4A 2L4QA 4DSSB 2GZZA 2H01A 4ML6A 3LG6A 3DD3A 2OJLA 1TU8A 5GZZB 2IIYA 3ED3A 2GGTA 5IQYA 4QQ7A 3L0HA 1QMVA 1OVNA 2JZSA 5J4UA 2GSTA 2AV4A 2L57A 1YKCA 4O32A 5ENUA 2ON7A 1KBNA 4V2NA 2B5YA 2VCXA 1U3AA 5ECOB 4N11A 3GMFA 3APSA 3FZAA 1FHEA 4POBA 2GDRA 5JCUA 1K0NA 5DVBA 1SJZA 1CQHA 4HZ2A 5CP1A 4BWQA 1O7UA 2WFCA 1FW1A 3U5RE 4IBPA 1TJDA 4EDYA 3W8JA 4IS0A 1T1VA 1OE8A 2GQKA 3CSHA 2PMTA 3CXGA 1XOAA 1I5GA 3TKRA 3C71A 1EP7A 4OCFA 1SYXA 10GSA 2C0DA 2VO4A 4I97A 3VPQA 1SKRB 4JBBA 3GUSA 13GSA 1K0DA 2H1DA 4XS6A 3I69A 3FZ9A 5JWQB 5IMVA 3F8UA 1Z6MA 3GH9A 4IJIA 4GQFA 4PQHA 2VLVA 3FHKA 5D8IA 1GRXA 3DKSA 3TKPA 4ZB6A 3NIVA 1THXA 3HZ4A 3A2WA 1Z7PA 1ZGNA 2NDOA 1K3OA 1AXDA 1ERTA 3APOA 3DGQA 4DSSA 1A0FA 5F05A 5ECQB 2FWFA 3WGEA 4K0GA 2JU5A 5G5FA 3VI7A 5HR0A 3KIJA 5G5EA 2LJAA 1GTUA 4BWSA 1ACVA 5D96A 4LMVA 1O85A 3O3TA 1T8EB 5EL8A 1W4VA 1ZL9A 5IMFA 5ID2A 1ERVA 1QGVA 3DVWA 1ZZYA 2H6YA 2VD1A 1R5AA 1PA3A 1YZXA 3ISOA 1YF1A 1SU9A 3UVHA 1TK0B 3QAGA 4AJ6A 2OBKA 2GS3A 4WEYA 3IOSA 2WS2A 1ERUA 5LNKe 19GSA 1GSFA 1VF2A 2DLXA 1YEPA 4FYUA 1PRXA 2MMAA 2DJ2A 14GSA 3UAPA 4K2DA 1MDJA 3ME8A 2ES7A 3N5OA 1GNWA 4GSSA 2LQQA 2GZPA 1TTZA 3EVIA 5CRWA 3ZYWA 4MLYA 3I43A 2H70A 1QFNA 1GLPA 4ZILA 2XHFA 1EGOA 2QKEA 5B8BA 1X0RA 2FNOA 3GRXA 1E2YA 2G0FA 4IHUA 1JLVA 1F9MA 4FH8A 3LJRA 5JCGA 1OAZA 1PN9A 4RQRA 4YQUA 5KN0A 2GTUA 4L0UA 4ZBDA 2C4JA 4HUAA 1GWCA 1EEMA 4OO4A 1GULA 1PL2A 2IWTA 5IOXA 3VWVA 4GRFA 3HDCA 1LJRA 1O73A 4F03A 1UVZA 2VCVA 1JHBA 4O7HA 3TKSC 2CX3A 3KEBA 1XFLA 4DSQA 4J57E 4ISDA 2V2GA 5L71A 4L0WA 2FCHA 3A2VA 2R5GA 4ACSA 4G2EA 1GUHA 2GT5A 4WBRD 2NBSA 2LJKA 3IRAA 2R37A 1XWKA 4KA0A 3CSIA 1ZOFA 3CRTA 1AQVA 3LYPA 1XPVA 2LNTA 4K0NA 5IMDA 4PURA 3KTBA 2KUCA 1GL8A 1X9MB 1XW6A 3TOUA 2AUVA 5DDLA 4I2UA 1PL1A 3UL3A 2DIYA 4MF7A 1SL0B 2DJ0A 3QCPA 1V98A 1K0AA 4MH3A 2H73A 3GHAA 5IO2A 1ML6A 3ERFA 2C8UA 2YANA 4XIHA 4N0VA 1SJIA 2OE0A 4XCSA 2VCWA 3UVTA 3HJMA 5JWOB 2X8CA 5ELAA 5IO0A 2VCQA 1F37A 1HNBA 3IHQA 1M7TA 3CYNA 4JR6A 4MA9A 4ZXGA 3QFAC 2H0GA 5E59A 2LRCA 2LTKA 4ZBAA 3TRQA 2IMKA 2HZEA 1AIUA 2X99A 3ME7A 2WB9A 5E4WA 3GTUB 3EE2A 1SKWB 2LUSA 2RUFA 2DJKA 1A2LA 2F3MA 4KW6A 1GSUA 4LA1A 4ULXA 2K6VA 3BOAA 1MDIA 2TRXA 2YV9A 2PWJA 1B4PA 4OFTA 3OR5A 4HJ2A 2V6OA 3ZTLA 1TP9A 4KH7A 4X43A 2C0GA 1PQNA 3GN3A 1B48A 4HQZA 3KCMA 22GSA 1KNGA 3E9JB 1Q4JA 1XW5A 4K7OA 2L4CA 4TR4A 1TXXA 4N0ZA 2L6CA 3F9UA 4MF5A 3FY7A 1XWAA 3M3MA 3D4TA 5FWGA 2K18A 3EMXA 5F06A 4IP6A 2B5EA 2M72A 2I3YA 1URMA 3BJ5A 3GA4A 2NPBA 2OKAA 3RBTA 4F2IA 1LBKA 2H75A 2EC4A 5KN3A 3C73A 4BVYA 3I6AA 4BA7A 1TU7A 3ERWA 2HFDA 2CVDA 4V1Ap 2LKUA 2HXKA 3IDVA 4L5OA 4OFMA 4GQCA 2N5AA 1FB6A 1MDKA 3H1NA 3IK9A 4MPFA 4WF4A 2PUKC 2WRTA 5GAND 3UIWA 3TKQA 2MBTA 5ECMB 3W8SA 2O7KA 1PKZA 1N2AA 4KSMA 3UBLA 4K8MA 5H5QA 3D6IA 1B9YC 2MMNA 4EC0A 1AAZA 2HRNA 4QL9A 4KB3A 1EP8A 4PXOA 1O81A 1S3DA 4YAPA 6GSUA 1QUWA 3IA1A 2RIIA 2E7PA 2A2RA 3EU3A 2K8SA 1EGRA 2BJXA 2C3QA 3QPMA 3H93A 4MZBA 2I4AA 4KNDA 4LL1B 4V1Ag 3TRPA 5HQPA 1M2BA 2P0GA 3UARA 2F8FA 3E0UA 3ZREA 3DIEA 4K7IA 1VF3A 4NHWA 3IC4A 2E2GA 4NV2A 3KMOA 5ID2B 5J3RA 12GSA 3CRUA 1AQXA 1N8JA 3M1GA 5AN1A 1MD3A 1UC7A 4RQXA 2GVPA 3BBYA 5KN2A 3KH7A 4TR0A 1SD9A 1X9WB 4LMWA 1V2AA 5J9CA 3IBHA 2IFQA 2KOKA 3DRNA 3WD6A 1W89A 1ZCPA 3ZVJA 1GP1A 1FO5A 4K1FA 4HS1A 4ID0A 2H66A 2DIZA 5KN1A 4ECBA 3RPNA 4PNGA 5G31A 1SK1A 4TOPA 4TR1B 4TRXA 2YP6A 2CT6A 5IOWA 1GSYA 4G19A 2R4VA 1T4YA 5B8AA 1OYJA 2YPMA 3L78A 3H4KA 1MEKA 3G7JA 2OACA 4FYCA 3TKSE 1UN2A 4YQVA 5IPHA 3ZMKA 2JSZA 4F0CA 2MBSA 3G7IA 4K6XA 5COHA 1PGTA 1Z9HA 4XTSA 5CAXA 3M8NA 3QD9A 4H86A 1K3LA 1AC1A 3K8NA 6GSXA 5ABRA 4E8EA 2ALBA 11GSA 3VWXA 1T4ZA 4PNFA 1S3AA 4OD7A 4MP4A 1GSDA 1Z7RA 2VL9A 1X5EA 4KAEA 1ZYEA 3LXZA 2IN3A 2LQOA 5IPGA 2IMEA 2H19A 2C80A 3APQA 3I9V2 4O92A 1AQWA 1PX6A 1A8LA 20GSA 2VOCA 2V41A 1VGLA 1EV4A 3PGTA 3D22A 1Y25A 4XHMA 1TOFA 1WPIA 3ERGA 2GLRA 3QOUA 2HI7A 5HR2A 3WGDA 1XVQA 1JZDA 1TK8B 2VM2A 4OO5A 4N10A 2VL2A 5HR3A 3US3A 3QR6A 4POMA 1HNAA 2VM1A 5CO3A 3RDWA 1SENA 4ZB8A 2HLSA 3A5WA 4JE1A 4XRDA 2HYXA 1DBYA 2AAWA 5IMAA 4MZWA 4HU9A 5C04A 3MDKA 4K7NA 4MDCA 3RHBA 1A24A 3GSSA 3DWVA 1IYIA 4TR1A 3TJJA 1FB0A 5DBQA 2YZHA 3FR6A 4KCAA 1HD2A 3C1SA 1BJXA 2CVKA 2DJ1A 1M9AA 4PUFC 1TKDB 3Q18A 2CZ2A 4ZL7A 2E2MA 1FAAA 5A4UA 3DVXA 4GWRA 4WR4A 1T3BA 3P2AA 2V32A 4NWYA 1GUMA 2B1LA 1AW9A 1B9XC 1C72A 4PUAA 3CMIA 4WBJA 5ECLB 5G1LA 2R2JA 2GSSA 2H0IA 2HZEB 2IMIA 2EIRA 2XBQA 2MMOA 4OFNA 4DEJA 2H1GA 1WWJA 1TK5B 4P3YB 3HZ8A 2D2ZA 3DYRA 1R7HA 2C0EA 5F0GA 4JZQA 4XRAA 4XS4A 2HSYA 3TGZA 4TVEA 2WZ9A 2HNLA 1J9BA 3BCIA 3FYGA 4PGTA 2O89A 2JSYA 3FRCA 4ECJA 2C3NA 1QK8A 2YWOA 2VUPA 4BVXA 1EOHA 1WE0A 3QDNA 1TI1A 1F2EA 2YJHA 4LLRA 2VD0A 3VFIA 4OMVA 3F63A 5IMCA 4ZBBA
chains in the Genus database with same CATH superfamily
3EWLA 3ZLPA 1FOVA 1PMTA 3HYPA 3RHCA 3M9KA 5CYYA 4NXIA 1Y6EA 1ZMAA 3GKKA 1LU4A 2ZNMA 4EF0A 2FWHA 3FK8A 1EOGA 4Q5RA 2REMA 3FR9A 3F0IA 4LL4B 4HI7A 3FZ4A 2L59A 2JZTA 3GL5A 1V40A 2K8VA 1SL2B 3VURA 1BEDA 17GSA 5B7CA 2GT6A 1NM3A 4BPYA 1G7EA 1GSEA 4EVMA 2IJYA 2H72A 2LJRA 3FKFA 2JACA 1T7PB 4N30A 4PX1A 2LS5A 1Z5YE 3L9VA 1M0UA 1WOUA 3N9JA 3EINA 1K0MA 1TRWA 5H5RA 16GSA 3VI5A 4MJCA 2P5QA 3KGKA 3EU4A 4X0XA 4NAXA 1SKSB 1BX9A 3EC3A 4X1UA 1A2MA 2XPEA 4MK3A 2NVLA 2X8HA 4FYBA 2M46A 5BMUA 5GSSA 2TRCP 2PERA 3Q19A 2KP1A 3QAWA 5IM9A 3M0FA 4CDOA 2V1MA 4PQIA 4KDXA 5KEJA 2HSHA 1X5DA 3PPUA 1K3YA 1HNCA 3G7YA 3TOTA 2AHEA 4GXZA 1SD8A 1R5PA 5CREA 5HFKA 3KP8A 2H30A 3HXSA 4MCUA 5DCHA 1Z6NA 2X8GA 1FOHA 1JZWA 8GSSA 2N5BA 3MSZA 2YCDA 4WETA 1YJ6A 3UJ1A 3V1WA 5ECSA 4BIKA 2MMZA 4KGIA 2HE3A 2I9HA 1QQ2A 1V9WA 4O5QA 2X64A 1A2JA 5AISA 3HHVA 3HY2A 3IE3A 3MNGA 5G30A 2O8VB 4MH2A 2WDUA 3IXRA 2Z9SA 3LXTA 3J7Yk 4TXOA 3VPTA 4ILFA 2CZ3A 2FD3A 4D73B 3SBCA 9GSSA 5DALA 2F9SA 5ECIB 1GNEA 2B6MA 2FY6A 3GYKA 3C8EA 4YKFA 1TRUA 4EDZA 1FVKA 4FQUA 1S3CA 3ZITA 2CX4A 2IFQB 2GSRA 1VRSD 3O76A 4YH2A 3PINA 2DKIA 2F8AA 2QGVA 3P7XA 4BL7B 1X5CA 3O6TA 3IC8A 3Q6OA 3TJFA 4J2FA 2DC5A 3G9BA 6GSVA 2H74A 4RI7A 3H8QA 3R3EA 2H8LA 3F4TA 1GTAA 3H79A 5INYA 4KDYA 2CAIA 1AUCA 3SWLA 4IGJA 4HDEA 1HYUA 1WRYA 2P31A 3KJYA 2L5LA 4OCEA 2F51A 4JR4A 4GSNA 3KP9A 4MJEA 3HVSA 3HD5A 1X9SB 2G2QA 3HVNA 2R0PA 2C0FA 1NHOA 5A5KA 3D5JA 1HQOA 2O85A 3LYKA 2RLIA 1RK4A 1B4QA 1DE2A 2LRNA 1A8YA 3ZIVA 2CV4A 1PN0A 3VWUA 1XCCA 1GH2A 2WJUA 4GLTA 3C1RA 2RM5A 1MTCA 2VAFA 4KSOA 1R4WA 3EMPA 2B1KA 2QSIA 5DQYA 1YQ1A 3UOMA 2CAQA 1J08A 3QAVA 5DJLA 4G9HA 1KTEA 2VL2C 4KX4A 4MABA 3TJKA 3F3RA 3RPPA 1GUKA 2OADA 4Z7XA 2H1BA 3A2XA 1U6TA 2FWGA 4Z2RA 5KOWA 3CQFA 3GX8A 2JL4A 3U6VA 3NZNA 1QXHA 5B6NA 3TJBA 1G7OA 5GSTA 3CTFA 2DBCA 4IJ3A 5HR1A 2R6KA 4AF2A 5ECKB 5DAKB 2WCIA 3F4RA 2FA8A 4GTUA 5IIZA 3LEFA 4EL1A 3TRXA 4D73A 4HQSA 4K9ZA 4KUNA 2HT9A 1EEJA 3IPZA 4L5LA 3R2QA 3KMNA 4ML1A 4FIWA 5CRHA 2B3SA 5F07A 2MZCA 2MYGA 2OE1A 2NTOA 1OE7A 3PH9A 5EVOA 4GF0A 1XVWA 4WF5A 2VL3A 4BL7A 2R0GA 2AYTA 5EPFA 1XZOA 2LV3A 2LNSA 1PKWA 5DQSA 5ECNB 1ON4A 3F6DA 2C1YA 4EXJA 4WXTA 4OWYA 4IELA 4F9ZA 5G2ZA 2ZUPA 5LD0A 4MF6A 5D9WA 4JEDA 2B7KA 5AIVA 3VWWA 5B6MA 3GSTA 1F3AA 1SL1B 3KM6A 1XBSA 3GIXA 4EUYA 5JCWA 1WMJA 1ERWA 4HU7A 1R26A 3GV1A 1B8XA 1PD21 4KCEA 4IN0A 5BRTA 1KEBA 1O8WA 4FO5A 4Q5FA 2H6XA 4EE0A 1A23A 4DSRA 1Q98A 3F4SA 4XS4B 1DE1A 2YZUA 4TW5A 2L5OA 2EIQA 1O6JA 1TRVA 3E3EA 3WGXA 2VIMA 2KHPA 1OKTA 3GKNA 3GH6A 2BMXA 2HRKA 1XW9A 6GSYA 4ECIA 1GTIA 3LW9A 2IMFA 2GQMA 3P8WA 4IQ1A 3S9FA 3WT1A 4WR5A 3PR8A 4HSCX 3HJOA 1XWGA 1BYEA 5LCZA 2HRFA 1GSQA 6GSTA 2PN8A 4I5QA 4ICYA 4YAVA 4ZB9A 4PQ1A 3WYWA 1OC9A 1YF0A 2VCTA 5AIXA 2GSQA 3NOFA 1XWBA 3TJGA 4F82A 1YY7A 3GKMA 2EIOA 3MWHA 2R3XA 3FR3A 5DAKA 1E6BA 2GZYA 4MZCA 2CVBA 5CNWA 2VCZA 5H5SA 5EY6A 4EIPA 4AJ7A 1TDIA 2OA7A 1U88A 4IQAA 3GL3A 4CY6A 5IMZA 3QMXA 2H6ZA 1BAYA 1EWXA 5A4VA 1GLQA 3IAM2 2M80A 5J5NA 2PVQA 1ILOA 1WIKA 3C7MA 2A4VA 1YDKA 2PBJA 4MJAA 1YEXA 1M2AA 4NHZA 2WGRA 4YQMA 5ECRB 1RW1A 2P5RA 4POKA 3UEMA 1O8XA 3CTGA 4CHSA 3ZZXA 3UBKA 1TRSA 3KTLA 2I1UA 4Z2TA 2BTOT 3IAS2 4NMUA 3FEUA 3RAZA 2H76A 5FT3A 3HA9A 1ZYQB 3BD2A 6GSSA 5D9TA 1G0TA 3LQ7A 2HRAA 4Q5NA 2J9HA 3MIXA 3D21A 1TI3A 3EYTA 2YJ7A 3HKRA 3L9SA 3FZ5A 1K0CA 1USBA 1OC3A 3QFBC 5ELGA 3L9UA 2JZRA 2LEGA 3IK7A 4J56E 4JRRA 1EV9A 1SJ6A 4A5PA 1I9DA 5AGYA 4G0KA 4K5SA 5FHIA 4K2XA 3ZRDA 3ZL5A 3JCML 2XPDA 1JZOA 2R0CA 1ABAA 4NV5A 2YNXA 4MPGA 2CA8A 2FA4A 3KH9A 1EZKA 2XBIA 5F8BA 3UMAA 1DUGA 2H0HA 2VLUA 4TXOB 1SYRA 3KD0A 1Z3EA 1TW9A 3CBUA 1M3JA 2X4AA 5JWRB 2HZFA 5DALB 3ZVJD 1VF4A 2WULA 1J0FA 2KLXA 2LRTA 3L4NA 1G6WA 1GSSA 2E0QA 5CRDA 3HJPA 1DSBA 4WKWA 1K0BA 2HSMA 5DCGA 1VF1A 1FG4A 2FUG2 1V57A 2AB6A 4MMMA 1SK2A 2GQLA 1OC8A 4V2LA 4V2MA 1G6YA 3MYDA 3ZMLA 1UA5A 1M99A 3ZFLA 3GKXA 1CQGA 4IP1A 4IW9A 3TCOA 4ECCA 2UZ8A 1RQMA 2V6KA 2OE3A 1PSQA 1JLWA 4TXVA 3A3TA 1BG5A 1JZRA 2QC7A 4XS1A 5G1KA 18GSA 2RUEA 4TKYA 2H1AA 3WT2A 2PGTA 5J41A 3LSZA 4HEA2 1WP0A 2DMLA 4I6XA 3MAKA 2DJ3A 2VLTA 4HOJA 5GAPD 2XC2A 1MD4A 4NPBA 3TB2A 3ZFBA 4RUVA 5J9BA 3CSJA 2YWIA 2IL3A 3LFLA 3J7Yb 4IKHA 2I81A 2OBIA 2YWMA 2PPTA 3VLNA 3DEXA 2AJQB 5ECPB 2FLSA 1THOA 3LWAA 5D93A 1U3IA 3P90A 2ON5A 4QL7A 1F3BA 1U87A 2JADA 2L6DA 1NSWA 1F6MC 1XOBA 4DVCA 4POLA 1ST9A 5A4WA 5HFIA 2FWEA 1XWCA 2O87A 4G10A 3W6GA 3F3QA 4ZL8A 1V58A 3ZIJA 1OKDA 3DXBA 4KE3A 1IYHA 1XIYA 2KP2A 2H71A 4TR3A 1XXUA 1M2DA 1PX7A 4KDUA 5D73A 1T00A 1SK0A 4EO3A 1GTBA 2A2SA 2YWNA 3EURA 3GNJA 4JU5A 5D9XA 1BQ7A 4CY8A 3M9JA 1H75A 4ZL9A 3VK9A 3F6FA 1FVJA 1JFUA 2N5FA 2PVOC 4IVFA 3LORA 4I8BA 2DJJA 4EKZA 1K0OA 2IMDA 2ZCTA 2K9FA 2IPAA 2J23A 3HVVA 4USSA 6GSWA 4RI6A 3BCKA 5C00A 3TKSA 3KZQA 5DJMA 2YOIA 4MJBA 2C3TA 3HCZA 4O5RA 7GSSA 4ZIJA 2YV7A 4L8EA 3FW2A 3IR4A 1WJKA 4E8HA 1A0RP 2FHEA 1H4OA 2QA2A 2CQ9A 2RM6A 2TIRA 2DMMA 1YKAA 2X49A 2B7JA 2LSTA 1M9BA 4HZ4A 2YN1A 3AY8A 3TUEA 5ECHB 3KXOA 2PU9C 3GURA 4GSTA 4HJMA 4GCIA 4AJ8A 3Q74A 4Q5QA 3GFKA 4CW9A 3D4MA 5CRGA 3GX0A 4AGSA 3HVXA 3D0ZA 5D9VA 4I2TA 2DSAA 3DMLA 1NW2A 1NHYA 1PFOA 2FGXA 5HFGA 3TDGA 3LGCA 4TN8A 3GTUA 1OC9B 2B5XA 4F0BA 3IV4A 2L4QA 4DSSB 2GZZA 2H01A 4ML6A 3LG6A 3DD3A 2OJLA 1TU8A 5GZZB 2IIYA 3ED3A 2GGTA 5IQYA 4QQ7A 3L0HA 1QMVA 1OVNA 2JZSA 5J4UA 2GSTA 2AV4A 2L57A 1YKCA 4O32A 5ENUA 2ON7A 1KBNA 4V2NA 2B5YA 2VCXA 1U3AA 5ECOB 4N11A 3GMFA 3APSA 3FZAA 1FHEA 4POBA 2GDRA 5JCUA 1K0NA 5DVBA 1SJZA 1CQHA 4HZ2A 5CP1A 4BWQA 1O7UA 2WFCA 1FW1A 3U5RE 4IBPA 1TJDA 4EDYA 3W8JA 4IS0A 1T1VA 1OE8A 2GQKA 3CSHA 2PMTA 3CXGA 4PTSA 1XOAA 1I5GA 3TKRA 3C71A 1EP7A 4OCFA 1SYXA 10GSA 2C0DA 2VO4A 4I97A 3VPQA 1M3IA 1SKRB 4JBBA 3GUSA 13GSA 1K0DA 2H1DA 4XS6A 3I69A 3FZ9A 5JWQB 5IMVA 3F8UA 4G0LA 1Z6MA 3GH9A 4IJIA 4GQFA 4PQHA 2VLVA 4Z2UA 3FHKA 5D8IA 1GRXA 3DKSA 3TKPA 4ZB6A 3NIVA 1THXA 3HZ4A 3A2WA 1Z7PA 1ZGNA 2NDOA 1K3OA 1AXDA 1ERTA 3APOA 3DGQA 4DSSA 1A0FA 3EPTA 5F05A 5ECQB 2FWFA 3WGEA 4K0GA 2JU5A 5G5FA 3VI7A 5HR0A 3KIJA 5G5EA 2LJAA 1GTUA 4BWSA 1ACVA 5D96A 4LMVA 1O85A 3O3TA 1T8EB 5EL8A 4YKGA 1W4VA 1ZL9A 5IMFA 5ID2A 1ERVA 1QGVA 3DVWA 1ZZYA 2H6YA 2VD1A 1R5AA 1PA3A 1YZXA 3ISOA 1YF1A 1SU9A 3UVHA 1TK0B 3QAGA 4AJ6A 2OBKA 2GS3A 4WEYA 3IOSA 2WS2A 1ERUA 5LNKe 19GSA 1GSFA 1VF2A 2DLXA 1YEPA 4FYUA 1PRXA 2MMAA 2DJ2A 14GSA 4KF9A 3UAPA 4K2DA 1MDJA 3ME8A 1XG8A 2ES7A 3N5OA 1GNWA 4GSSA 2LQQA 2GZPA 1TTZA 3EVIA 5CRWA 3ZYWA 4MLYA 3I43A 2H70A 1QFNA 1GLPA 4ZILA 2XHFA 1EGOA 2QKEA 5B8BA 4MNNA 1X0RA 2FNOA 3GRXA 1E2YA 2G0FA 4IHUA 1JLVA 1F9MA 3FMWA 4FH8A 3LJRA 5JCGA 1OAZA 1PN9A 4RQRA 4YQUA 5KN0A 2GTUA 4L0UA 4ZBDA 2C4JA 4HUAA 1GWCA 1EEMA 4OO4A 1GULA 1PL2A 2IWTA 5IOXA 3VWVA 4GRFA 3HDCA 1LJRA 1O73A 4F03A 1UVZA 2VCVA 1JHBA 4O7HA 3TKSC 2CX3A 3KEBA 1XFLA 4DSQA 4J57E 4ISDA 2V2GA 5L71A 4L0WA 2FCHA 3A2VA 2R5GA 4ACSA 4G2EA 1GUHA 2GT5A 4WBRD 2NBSA 2LJKA 3IRAA 2R37A 1XWKA 4KA0A 3CSIA 1ZOFA 3CRTA 1AQVA 3LYPA 1XPVA 2LNTA 4K0NA 5IMDA 4PURA 3KTBA 2KUCA 1GL8A 1X9MB 1XW6A 3TOUA 2AUVA 5DDLA 4I2UA 1PL1A 3UL3A 4BVYB 2DIYA 4MF7A 1SL0B 2DJ0A 3QCPA 1V98A 1K0AA 4MH3A 2H73A 3GHAA 5IO2A 1ML6A 3ERFA 2C8UA 2YANA 4XIHA 4N0VA 1SJIA 2OE0A 4XCSA 2VCWA 3UVTA 3HJMA 5JWOB 2X8CA 5ELAA 5IO0A 2VCQA 1F37A 1HNBA 3IHQA 1M7TA 3CYNA 4JR6A 4MA9A 4ZXGA 3QFAC 2H0GA 5E59A 2LRCA 2LTKA 4ZBAA 3TRQA 2IMKA 2HZEA 1AIUA 2X99A 3ME7A 2QA1A 2WB9A 5E4WA 3GTUB 3EE2A 1SKWB 2LUSA 2RUFA 2DJKA 1A2LA 2F3MA 4KW6A 1GSUA 4LA1A 4ULXA 2K6VA 3BOAA 1MDIA 2TRXA 2YV9A 2PWJA 1B4PA 4OFTA 3OR5A 4HJ2A 2V6OA 3A5IA 3ZTLA 1TP9A 4KH7A 4X43A 2C0GA 1PQNA 3GN3A 1B48A 4HQZA 3KCMA 1ZYNA 22GSA 1KNGA 3E9JB 1Q4JA 1XW5A 4K7OA 2L4CA 4TR4A 4X4JA 1TXXA 4N0ZA 2L6CA 3F9UA 4MF5A 3FY7A 1XWAA 3M3MA 3D4TA 4O5UA 5FWGA 2K18A 3EMXA 5F06A 4IP6A 2B5EA 2M72A 2I3YA 1URMA 3BJ5A 3GA4A 2NPBA 2OKAA 3RBTA 4F2IA 1LBKA 2H75A 2EC4A 5KN3A 3C73A 4BVYA 3I6AA 4BA7A 1TU7A 3ERWA 2HFDA 2CVDA 4V1Ap 2A4HA 2HXKA 2LKUA 3IDVA 4L5OA 4OFMA 4GQCA 2N5AA 1FB6A 1MDKA 3H1NA 3IK9A 4MPFA 4WF4A 2PUKC 2WRTA 5GAND 3UIWA 3TKQA 4G0IA 2MBTA 5ECMB 3W8SA 2O7KA 1PKZA 1N2AA 4KSMA 3UBLA 4K8MA 5H5QA 3D6IA 1B9YC 2MMNA 4EC0A 1AAZA 2HRNA 4QL9A 4KB3A 1EP8A 4PXOA 1O81A 1S3DA 4YAPA 6GSUA 1QUWA 3IA1A 2RIIA 2E7PA 2A2RA 3EU3A 2K8SA 1EGRA 2BJXA 2C3QA 3QPMA 3H93A 4MZBA 2I4AA 4KNDA 4LL1B 4V1Ag 3TRPA 5HQPA 1M2BA 2P0GA 3UARA 2F8FA 3E0UA 3ZREA 2DKHA 3DIEA 4K7IA 1VF3A 4NHWA 3IC4A 2E2GA 4NV2A 3KMOA 5ID2B 5J3RA 12GSA 3CRUA 1AQXA 1N8JA 3M1GA 5AN1A 1MD3A 1UC7A 4RQXA 2GVPA 3BBYA 5KN2A 3KH7A 4TR0A 1SD9A 1X9WB 4LMWA 1V2AA 5J9CA 3IBHA 2IFQA 2KOKA 3DRNA 3WD6A 1W89A 4EIQA 1ZCPA 3ZVJA 1GP1A 1FO5A 4K1FA 4HS1A 4ID0A 2H66A 2DIZA 5KN1A 4ECBA 3RPNA 4PNGA 5G31A 1SK1A 4TOPA 4TR1B 4TRXA 2YP6A 2CT6A 5IOWA 1GSYA 4G19A 2R4VA 1T4YA 5B8AA 1OYJA 2YPMA 3L78A 3H4KA 1MEKA 3G7JA 2OACA 4FYCA 3TKSE 1UN2A 4YQVA 5IPHA 3ZMKA 2JSZA 4F0CA 2MBSA 3G7IA 4K6XA 5COHA 1PGTA 1Z9HA 4XTSA 5CAXA 3M8NA 3QD9A 4H86A 1K3LA 1AC1A 3K8NA 6GSXA 5ABRA 4E8EA 2ALBA 11GSA 3VWXA 1T4ZA 4PNFA 1S3AA 4OD7A 4MP4A 1GSDA 1Z7RA 2VL9A 1X5EA 4KAEA 1ZYEA 3LXZA 4BVXB 2IN3A 2LQOA 5IPGA 1S3RA 2IMEA 2A2PA 2H19A 4K5RA 1ZYPA 2C80A 3APQA 3I9V2 4O92A 1AQWA 1PX6A 1A8LA 20GSA 2VOCA 2V41A 1VGLA 1EV4A 3PGTA 3D22A 1Y25A 4XHMA 1TOFA 1WPIA 3ERGA 2GLRA 3QOUA 2HI7A 5HR2A 3WGDA 1XVQA 1JZDA 1TK8B 2VM2A 4OO5A 4N10A 5KOXA 2VL2A 5HR3A 3US3A 3QR6A 4POMA 1HNAA 2VM1A 5CO3A 3RDWA 1SENA 4ZB8A 2HLSA 3A5WA 4JE1A 4XRDA 2HYXA 1DBYA 2AAWA 5IMAA 4MZWA 4HU9A 5C04A 3MDKA 4K7NA 4MDCA 3RHBA 1A24A 3GSSA 3DWVA 1IYIA 4TR1A 3TJJA 1FB0A 5DBQA 2YZHA 3FR6A 4KCAA 1HD2A 3C1SA 1BJXA 2CVKA 2DJ1A 1M9AA 4PUFC 1TKDB 3Q18A 2CZ2A 4ZL7A 2E2MA 1FAAA 5A4UA 3DVXA 4GWRA 4WR4A 1T3BA 3IHGA 3P2AA 2V32A 4NWYA 1GUMA 2B1LA 1AW9A 1B9XC 1C72A 4PUAA 3CMIA 4WBJA 5ECLB 5G1LA 2R2JA 2GSSA 2H0IA 2HZEB 2IMIA 2EIRA 2XBQA 2MMOA 4OFNA 4DEJA 2H1GA 1WWJA 1TK5B 4P3YB 3HZ8A 2D2ZA 3DYRA 1R7HA 2C0EA 5F0GA 4JZQA 4XRAA 4XS4A 2HSYA 3TGZA 4TVEA 2WZ9A 2HNLA 1J9BA 3BCIA 3FYGA 4PGTA 2O89A 2JSYA 3FRCA 4ECJA 2C3NA 1QK8A 2YWOA 2VUPA 4BVXA 1EOHA 1WE0A 3QDNA 1TI1A 1F2EA 2YJHA 4LLRA 2VD0A 3VFIA 4OMVA 3F63A 5IMCA 4ZBBA
chains in the Genus database with same CATH topology
3EWLA 3ZLPA 1FOVA 1PMTA 3HYPA 3RHCA 3M9KA 5CYYA 4NXIA 1Y6EA 1ZMAA 3GKKA 1LU4A 2ZNMA 4EF0A 2FWHA 3FK8A 1EOGA 4Q5RA 2REMA 3FR9A 3F0IA 4LL4B 4HI7A 3FZ4A 2L59A 2JZTA 3GL5A 1V40A 2K8VA 1SL2B 3VURA 1BEDA 17GSA 5B7CA 2GT6A 1NM3A 4BPYA 1G7EA 1GSEA 4EVMA 2IJYA 2H72A 2LJRA 3FKFA 2JACA 1T7PB 4N30A 4PX1A 2LS5A 1Z5YE 3L9VA 1M0UA 1WOUA 3N9JA 3EINA 1K0MA 1TRWA 5H5RA 16GSA 3VI5A 4MJCA 2P5QA 3KGKA 3EU4A 4X0XA 4NAXA 1SKSB 1BX9A 3EC3A 4X1UA 1A2MA 2XPEA 4MK3A 2NVLA 2X8HA 4FYBA 2M46A 5BMUA 5GSSA 2TRCP 2PERA 3Q19A 2KP1A 3QAWA 5IM9A 3M0FA 4CDOA 2V1MA 4PQIA 4KDXA 5KEJA 2HSHA 1X5DA 3PPUA 1K3YA 1HNCA 3G7YA 3TOTA 2AHEA 4GXZA 1SD8A 1R5PA 5CREA 5HFKA 3KP8A 2H30A 3HXSA 4MCUA 5DCHA 1Z6NA 2X8GA 1FOHA 1JZWA 8GSSA 2N5BA 3MSZA 2YCDA 4WETA 1YJ6A 3UJ1A 3V1WA 5ECSA 2MMZA 4KGIA 2HE3A 2I9HA 1QQ2A 1V9WA 4O5QA 2X64A 1A2JA 5AISA 3HHVA 3HY2A 3IE3A 3MNGA 5G30A 2O8VB 4MH2A 2WDUA 3IXRA 2Z9SA 3LXTA 3J7Yk 4TXOA 3VPTA 4ILFA 2CZ3A 2FD3A 4D73B 3SBCA 9GSSA 5DALA 2F9SA 5ECIB 1GNEA 2B6MA 2FY6A 3GYKA 3C8EA 4YKFA 1TRUA 4EDZA 1FVKA 4FQUA 1S3CA 3ZITA 2CX4A 2IFQB 2GSRA 1VRSD 3O76A 4YH2A 3PINA 2DKIA 2F8AA 2QGVA 3P7XA 4BL7B 1X5CA 3O6TA 3IC8A 3Q6OA 3TJFA 4J2FA 2DC5A 3G9BA 6GSVA 2H74A 4RI7A 3H8QA 3R3EA 2H8LA 3F4TA 1GTAA 3H79A 5INYA 4KDYA 2CAIA 1AUCA 3SWLA 4IGJA 4HDEA 1HYUA 1WRYA 2P31A 3KJYA 2L5LA 4OCEA 2F51A 4JR4A 4GSNA 3KP9A 4MJEA 3HVSA 3HD5A 1X9SB 2G2QA 2R0PA 2C0FA 1NHOA 5A5KA 3D5JA 1HQOA 2O85A 3LYKA 2RLIA 1RK4A 1B4QA 1DE2A 2LRNA 1A8YA 3ZIVA 2CV4A 1PN0A 3VWUA 1XCCA 1GH2A 2WJUA 4GLTA 3C1RA 2RM5A 1MTCA 2VAFA 4KSOA 1R4WA 3EMPA 2B1KA 2QSIA 5DQYA 1YQ1A 3UOMA 2CAQA 1J08A 3QAVA 5DJLA 4G9HA 1KTEA 2VL2C 4KX4A 4MABA 3TJKA 3F3RA 3RPPA 1GUKA 2OADA 4Z7XA 2H1BA 3A2XA 1U6TA 2FWGA 4Z2RA 5KOWA 3GX8A 2JL4A 3U6VA 3NZNA 1QXHA 5B6NA 3TJBA 1G7OA 5GSTA 3CTFA 2DBCA 4IJ3A 5HR1A 2R6KA 4AF2A 5ECKB 5DAKB 2WCIA 3F4RA 2FA8A 4GTUA 5IIZA 3LEFA 4EL1A 3TRXA 4D73A 4HQSA 4K9ZA 4KUNA 2HT9A 1EEJA 3IPZA 4L5LA 3R2QA 3KMNA 4ML1A 4FIWA 5CRHA 2B3SA 5F07A 2MZCA 2MYGA 2OE1A 2NTOA 1OE7A 3PH9A 5EVOA 4GF0A 1XVWA 4WF5A 2VL3A 4BL7A 2R0GA 2AYTA 5EPFA 1XZOA 2LV3A 2LNSA 1PKWA 5DQSA 5ECNB 1ON4A 3F6DA 2C1YA 4EXJA 4WXTA 4OWYA 4IELA 4F9ZA 5G2ZA 2ZUPA 5LD0A 4MF6A 5D9WA 4JEDA 2B7KA 5AIVA 3VWWA 5B6MA 3GSTA 1F3AA 1SL1B 3KM6A 1XBSA 3GIXA 4EUYA 5JCWA 1WMJA 1ERWA 4HU7A 1R26A 3GV1A 1B8XA 1PD21 4KCEA 4IN0A 5BRTA 1KEBA 1O8WA 4FO5A 4Q5FA 2H6XA 4EE0A 1A23A 4DSRA 1Q98A 3F4SA 4XS4B 1DE1A 2YZUA 4TW5A 2L5OA 2EIQA 1O6JA 1TRVA 3E3EA 3WGXA 2VIMA 2KHPA 1OKTA 3GKNA 3GH6A 2BMXA 2HRKA 1XW9A 6GSYA 4ECIA 1GTIA 3LW9A 2IMFA 2GQMA 3P8WA 4IQ1A 3S9FA 3WT1A 4WR5A 3PR8A 3HJOA 1XWGA 1BYEA 5LCZA 2HRFA 1GSQA 6GSTA 2PN8A 4I5QA 4ICYA 4YAVA 4ZB9A 4PQ1A 3WYWA 1OC9A 1YF0A 2VCTA 5AIXA 2GSQA 3NOFA 1XWBA 3TJGA 4F82A 1YY7A 3GKMA 2EIOA 3MWHA 2R3XA 3FR3A 5DAKA 1E6BA 2GZYA 4MZCA 2CVBA 5CNWA 2VCZA 5H5SA 5EY6A 4EIPA 4AJ7A 1TDIA 2OA7A 1U88A 4IQAA 3GL3A 4CY6A 5IMZA 3QMXA 2H6ZA 1BAYA 1EWXA 5A4VA 1GLQA 3IAM2 2M80A 5J5NA 2PVQA 1ILOA 1WIKA 3C7MA 2A4VA 1YDKA 2PBJA 4MJAA 1YEXA 1M2AA 4NHZA 2WGRA 4YQMA 5ECRB 1RW1A 2P5RA 4POKA 3UEMA 1O8XA 3CTGA 4CHSA 3ZZXA 3UBKA 1TRSA 3KTLA 2I1UA 4Z2TA 2BTOT 3IAS2 4NMUA 3FEUA 3RAZA 2H76A 5FT3A 3HA9A 1ZYQB 3BD2A 6GSSA 5D9TA 1G0TA 3LQ7A 2HRAA 4Q5NA 2J9HA 3MIXA 3D21A 1TI3A 3EYTA 2YJ7A 3HKRA 3L9SA 3FZ5A 1K0CA 1USBA 1OC3A 3QFBC 5ELGA 3L9UA 2JZRA 2LEGA 3IK7A 4J56E 4JRRA 1EV9A 1SJ6A 4A5PA 1I9DA 5AGYA 4G0KA 4K5SA 5FHIA 4K2XA 3ZRDA 3ZL5A 3JCML 2XPDA 1JZOA 2R0CA 1ABAA 4NV5A 2YNXA 4MPGA 2CA8A 2FA4A 3KH9A 1EZKA 2XBIA 5F8BA 3UMAA 1DUGA 2H0HA 2VLUA 4TXOB 1SYRA 3KD0A 1Z3EA 1TW9A 3CBUA 2X4AA 5JWRB 2HZFA 5DALB 3ZVJD 1VF4A 2WULA 1J0FA 2KLXA 2LRTA 3L4NA 1G6WA 1GSSA 2E0QA 5CRDA 3HJPA 1DSBA 4WKWA 1K0BA 2HSMA 5DCGA 1VF1A 1FG4A 2FUG2 1V57A 2AB6A 4MMMA 1SK2A 2GQLA 1OC8A 4V2LA 4V2MA 1G6YA 3MYDA 3ZMLA 1UA5A 1M99A 3ZFLA 3GKXA 1CQGA 4IP1A 4IW9A 3TCOA 4ECCA 2UZ8A 1RQMA 2V6KA 2OE3A 1PSQA 1JLWA 4TXVA 3A3TA 1BG5A 1JZRA 2QC7A 4XS1A 5G1KA 18GSA 2RUEA 4TKYA 2H1AA 3WT2A 2PGTA 5J41A 3LSZA 4HEA2 1WP0A 2DMLA 4I6XA 3MAKA 2DJ3A 2VLTA 4HOJA 5GAPD 2XC2A 1MD4A 4NPBA 3TB2A 3ZFBA 4RUVA 5J9BA 3CSJA 2YWIA 2IL3A 3LFLA 3J7Yb 4IKHA 2I81A 2OBIA 2YWMA 2PPTA 3VLNA 3DEXA 2AJQB 5ECPB 2FLSA 1THOA 3LWAA 5D93A 1U3IA 3P90A 2ON5A 4QL7A 1F3BA 1U87A 2JADA 2L6DA 1NSWA 1F6MC 1XOBA 4DVCA 4POLA 1ST9A 5A4WA 5HFIA 2FWEA 1XWCA 2O87A 4G10A 3W6GA 3F3QA 4ZL8A 1V58A 3ZIJA 1OKDA 3DXBA 4KE3A 1IYHA 1XIYA 2KP2A 2H71A 4TR3A 1XXUA 1M2DA 1PX7A 4KDUA 5D73A 1T00A 1SK0A 4EO3A 1GTBA 2A2SA 2YWNA 3EURA 3GNJA 4JU5A 5D9XA 1BQ7A 4CY8A 3M9JA 1H75A 4ZL9A 3VK9A 3F6FA 1FVJA 1JFUA 2N5FA 2PVOC 4IVFA 3LORA 4I8BA 2DJJA 4EKZA 1K0OA 2IMDA 2ZCTA 2K9FA 2IPAA 2J23A 3HVVA 4USSA 6GSWA 4RI6A 3BCKA 5C00A 3TKSA 3KZQA 5DJMA 2YOIA 4MJBA 2C3TA 3HCZA 4O5RA 7GSSA 4ZIJA 2YV7A 4L8EA 3FW2A 3IR4A 1WJKA 4E8HA 1A0RP 2FHEA 1H4OA 2QA2A 2CQ9A 2RM6A 2TIRA 2DMMA 1YKAA 2X49A 2B7JA 2LSTA 1M9BA 4HZ4A 2YN1A 3AY8A 3TUEA 5ECHB 3KXOA 2PU9C 3GURA 4GSTA 4HJMA 4GCIA 4AJ8A 3Q74A 4Q5QA 3GFKA 4CW9A 3D4MA 5CRGA 3GX0A 4AGSA 3HVXA 3D0ZA 5D9VA 4I2TA 2DSAA 3DMLA 1NW2A 1NHYA 2FGXA 5HFGA 3TDGA 3LGCA 4TN8A 3GTUA 1OC9B 2B5XA 4F0BA 3IV4A 2L4QA 4DSSB 2GZZA 2H01A 4ML6A 3LG6A 3DD3A 2OJLA 1TU8A 5GZZB 2IIYA 3ED3A 2GGTA 5IQYA 4QQ7A 3L0HA 1QMVA 1OVNA 2JZSA 5J4UA 2GSTA 2AV4A 2L57A 1YKCA 4O32A 5ENUA 2ON7A 1KBNA 4V2NA 2B5YA 2VCXA 1U3AA 5ECOB 4N11A 3GMFA 3APSA 3FZAA 1FHEA 4POBA 2GDRA 5JCUA 1K0NA 5DVBA 1SJZA 1CQHA 4HZ2A 5CP1A 4BWQA 1O7UA 2WFCA 1FW1A 3U5RE 4IBPA 1TJDA 4EDYA 3W8JA 4IS0A 1T1VA 1OE8A 2GQKA 3CSHA 2PMTA 3CXGA 4PTSA 1XOAA 1I5GA 3TKRA 3C71A 1EP7A 4OCFA 1SYXA 10GSA 2C0DA 2VO4A 4I97A 3VPQA 1SKRB 4JBBA 3GUSA 13GSA 1K0DA 2H1DA 4XS6A 3I69A 3FZ9A 5JWQB 5IMVA 3F8UA 4G0LA 1Z6MA 3GH9A 4IJIA 4GQFA 4PQHA 2VLVA 4Z2UA 3FHKA 5D8IA 1GRXA 3DKSA 3TKPA 4ZB6A 3NIVA 1THXA 3HZ4A 3A2WA 1Z7PA 1ZGNA 2NDOA 1K3OA 1AXDA 1ERTA 3APOA 3DGQA 4DSSA 1A0FA 3EPTA 5F05A 5ECQB 2FWFA 3WGEA 4K0GA 2JU5A 5G5FA 3VI7A 5HR0A 3KIJA 5G5EA 2LJAA 1GTUA 4BWSA 1ACVA 5D96A 4LMVA 1O85A 3O3TA 1T8EB 5EL8A 4YKGA 1W4VA 1ZL9A 5IMFA 5ID2A 1ERVA 1QGVA 3DVWA 1ZZYA 2H6YA 2VD1A 1R5AA 1PA3A 1YZXA 3ISOA 1YF1A 1SU9A 3UVHA 1TK0B 3QAGA 4AJ6A 2OBKA 2GS3A 4WEYA 3IOSA 2WS2A 1ERUA 5LNKe 19GSA 1GSFA 1VF2A 2DLXA 1YEPA 4FYUA 1PRXA 2MMAA 2DJ2A 14GSA 4KF9A 3UAPA 4K2DA 1MDJA 3ME8A 2ES7A 3N5OA 1GNWA 4GSSA 2LQQA 2GZPA 1TTZA 3EVIA 5CRWA 3ZYWA 4MLYA 3I43A 2H70A 1QFNA 1GLPA 4ZILA 2XHFA 1EGOA 2QKEA 5B8BA 4MNNA 1X0RA 2FNOA 3GRXA 1E2YA 2G0FA 4IHUA 1JLVA 1F9MA 3FMWA 4FH8A 3LJRA 5JCGA 1OAZA 1PN9A 4RQRA 4YQUA 5KN0A 2GTUA 4L0UA 4ZBDA 2C4JA 4HUAA 1GWCA 1EEMA 4OO4A 1GULA 1PL2A 2IWTA 5IOXA 3VWVA 4GRFA 3HDCA 1LJRA 1O73A 4F03A 1UVZA 2VCVA 1JHBA 4O7HA 3TKSC 2CX3A 3KEBA 1XFLA 4DSQA 4J57E 4ISDA 2V2GA 5L71A 4L0WA 2FCHA 3A2VA 2R5GA 4ACSA 4G2EA 1GUHA 2GT5A 4WBRD 2NBSA 2LJKA 3IRAA 2R37A 1XWKA 4KA0A 3CSIA 1ZOFA 3CRTA 1AQVA 3LYPA 1XPVA 2LNTA 4K0NA 5IMDA 4PURA 3KTBA 2KUCA 1GL8A 1X9MB 1XW6A 3TOUA 2AUVA 5DDLA 4I2UA 1PL1A 3UL3A 4BVYB 2DIYA 4MF7A 1SL0B 2DJ0A 3QCPA 1V98A 1K0AA 4MH3A 2H73A 3GHAA 5IO2A 1ML6A 3ERFA 2C8UA 2YANA 4XIHA 4N0VA 1SJIA 2OE0A 4XCSA 2VCWA 3UVTA 3HJMA 5JWOB 2X8CA 5ELAA 5IO0A 2VCQA 1F37A 1HNBA 3IHQA 1M7TA 3CYNA 4JR6A 4MA9A 4ZXGA 3QFAC 2H0GA 5E59A 2LRCA 2LTKA 4ZBAA 3TRQA 2IMKA 2HZEA 1AIUA 2X99A 3ME7A 2QA1A 2WB9A 5E4WA 3GTUB 3EE2A 1SKWB 2LUSA 2RUFA 2DJKA 1A2LA 2F3MA 4KW6A 1GSUA 4LA1A 4ULXA 2K6VA 3BOAA 1MDIA 2TRXA 2YV9A 2PWJA 1B4PA 4OFTA 3OR5A 4HJ2A 2V6OA 3A5IA 3ZTLA 1TP9A 4KH7A 4X43A 2C0GA 1PQNA 3GN3A 1B48A 4HQZA 3KCMA 1ZYNA 22GSA 1KNGA 3E9JB 1Q4JA 1XW5A 4K7OA 2L4CA 4TR4A 4X4JA 1TXXA 4N0ZA 2L6CA 3F9UA 4MF5A 3FY7A 1XWAA 3M3MA 3D4TA 4O5UA 5FWGA 2K18A 3EMXA 5F06A 4IP6A 2B5EA 2M72A 2I3YA 1URMA 3BJ5A 3GA4A 2NPBA 2OKAA 3RBTA 4F2IA 1LBKA 2H75A 2EC4A 5KN3A 3C73A 4BVYA 3I6AA 4BA7A 1TU7A 3ERWA 2HFDA 2CVDA 4V1Ap 2A4HA 2HXKA 2LKUA 3IDVA 4L5OA 4OFMA 4GQCA 2N5AA 1FB6A 1MDKA 3H1NA 3IK9A 4MPFA 4WF4A 2PUKC 2WRTA 5GAND 3UIWA 3TKQA 4G0IA 2MBTA 5ECMB 3W8SA 2O7KA 1PKZA 1N2AA 4KSMA 3UBLA 4K8MA 5H5QA 3D6IA 1B9YC 2MMNA 4EC0A 1AAZA 2HRNA 4QL9A 4KB3A 1EP8A 4PXOA 1O81A 1S3DA 4YAPA 6GSUA 1QUWA 3IA1A 2RIIA 2E7PA 2A2RA 3EU3A 2K8SA 1EGRA 2BJXA 2C3QA 3QPMA 3H93A 4MZBA 2I4AA 4KNDA 4LL1B 4V1Ag 3TRPA 5HQPA 1M2BA 2P0GA 3UARA 2F8FA 3E0UA 3ZREA 2DKHA 3DIEA 4K7IA 1VF3A 4NHWA 3IC4A 2E2GA 4NV2A 3KMOA 5ID2B 5J3RA 12GSA 3CRUA 1AQXA 1N8JA 3M1GA 5AN1A 1MD3A 1UC7A 4RQXA 2GVPA 3BBYA 5KN2A 3KH7A 4TR0A 1SD9A 1X9WB 4LMWA 1V2AA 5J9CA 3IBHA 2IFQA 2KOKA 3DRNA 3WD6A 1W89A 4EIQA 1ZCPA 3ZVJA 1GP1A 1FO5A 4K1FA 4HS1A 4ID0A 2H66A 2DIZA 5KN1A 4ECBA 3RPNA 4PNGA 5G31A 1SK1A 4TOPA 4TR1B 4TRXA 2YP6A 2CT6A 5IOWA 1GSYA 4G19A 2R4VA 1T4YA 5B8AA 1OYJA 2YPMA 3L78A 3H4KA 1MEKA 3G7JA 2OACA 4FYCA 3TKSE 1UN2A 4YQVA 5IPHA 3ZMKA 2JSZA 4F0CA 2MBSA 3G7IA 4K6XA 5COHA 1PGTA 1Z9HA 4XTSA 5CAXA 3M8NA 3QD9A 4H86A 1K3LA 1AC1A 3K8NA 6GSXA 5ABRA 4E8EA 2ALBA 11GSA 3VWXA 1T4ZA 4PNFA 1S3AA 4OD7A 4MP4A 1GSDA 1Z7RA 2VL9A 1X5EA 4KAEA 1ZYEA 3LXZA 4BVXB 2IN3A 2LQOA 5IPGA 2IMEA 2A2PA 2H19A 4K5RA 1ZYPA 2C80A 3APQA 3I9V2 4O92A 1AQWA 1PX6A 1A8LA 20GSA 2VOCA 2V41A 1VGLA 1EV4A 3PGTA 3D22A 1Y25A 4XHMA 1TOFA 1WPIA 3ERGA 2GLRA 3QOUA 2HI7A 5HR2A 3WGDA 1XVQA 1JZDA 1TK8B 2VM2A 4OO5A 4N10A 5KOXA 2VL2A 5HR3A 3US3A 3QR6A 4POMA 1HNAA 2VM1A 5CO3A 3RDWA 1SENA 4ZB8A 2HLSA 3A5WA 4JE1A 4XRDA 2HYXA 1DBYA 2AAWA 5IMAA 4MZWA 4HU9A 5C04A 3MDKA 4K7NA 4MDCA 3RHBA 1A24A 3GSSA 3DWVA 1IYIA 4TR1A 3TJJA 1FB0A 5DBQA 2YZHA 3FR6A 4KCAA 1HD2A 3C1SA 1BJXA 2CVKA 2DJ1A 1M9AA 4PUFC 1TKDB 3Q18A 2CZ2A 4ZL7A 2E2MA 1FAAA 5A4UA 3DVXA 4GWRA 4WR4A 1T3BA 3IHGA 3P2AA 2V32A 4NWYA 1GUMA 2B1LA 1AW9A 1B9XC 1C72A 4PUAA 3CMIA 4WBJA 5ECLB 5G1LA 2R2JA 2GSSA 2H0IA 2HZEB 2IMIA 2EIRA 2XBQA 2MMOA 4OFNA 4DEJA 2H1GA 1WWJA 1TK5B 4P3YB 3HZ8A 2D2ZA 3DYRA 1R7HA 2C0EA 5F0GA 4JZQA 4XRAA 4XS4A 2HSYA 3TGZA 4TVEA 2WZ9A 2HNLA 1J9BA 3BCIA 3FYGA 4PGTA 2O89A 2JSYA 3FRCA 4ECJA 2C3NA 1QK8A 2YWOA 2VUPA 4BVXA 1EOHA 1WE0A 3QDNA 1TI1A 1F2EA 2YJHA 4LLRA 2VD0A 3VFIA 4OMVA 3F63A 5IMCA 4ZBBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EWL A;  3ZLP A;  1FOV A;  1PMT A;  3HYP A;  3RHC A;  3M9K A;  5CYY A;  4NXI A;  1Y6E A;  1ZMA A;  3GKK A;  1LU4 A;  2ZNM A;  4EF0 A;  2FWH A;  3FK8 A;  1EOG A;  4Q5R A;  2REM A;  3FR9 A;  3F0I A;  4LL4 B;  4HI7 A;  3FZ4 A;  2L59 A;  2JZT A;  3GL5 A;  1V40 A;  2K8V A;  1SL2 B;  3VUR A;  1BED A;  17GS A;  5B7C A;  2GT6 A;  1NM3 A;  4BPY A;  1G7E A;  1GSE A;  4EVM A;  2IJY A;  2H72 A;  2LJR A;  3FKF A;  2JAC A;  1T7P B;  4N30 A;  4PX1 A;  2LS5 A;  1Z5Y E;  3L9V A;  1M0U A;  1WOU A;  3N9J A;  3EIN A;  1K0M A;  1TRW A;  5H5R A;  16GS A;  3VI5 A;  4MJC A;  2P5Q A;  3KGK A;  3EU4 A;  4X0X A;  4NAX A;  1SKS B;  1BX9 A;  3EC3 A;  4X1U A;  1A2M A;  2XPE A;  4MK3 A;  2NVL A;  2X8H A;  4FYB A;  2M46 A;  5GSS A;  2TRC P;  2PER A;  3Q19 A;  2KP1 A;  3QAW A;  5IM9 A;  3M0F A;  4CDO A;  2V1M A;  4PQI A;  4KDX A;  5KEJ A;  2HSH A;  1X5D A;  1K3Y A;  1HNC A;  3G7Y A;  3TOT A;  2AHE A;  4GXZ A;  1SD8 A;  1R5P A;  5CRE A;  5HFK A;  3KP8 A;  2H30 A;  3HXS A;  4MCU A;  5DCH A;  1Z6N A;  2X8G A;  1JZW A;  8GSS A;  2N5B A;  3MSZ A;  2YCD A;  4WET A;  1YJ6 A;  3UJ1 A;  3V1W A;  5ECS A;  2MMZ A;  4KGI A;  2HE3 A;  2I9H A;  1QQ2 A;  1V9W A;  2X64 A;  1A2J A;  5AIS A;  3HHV A;  3HY2 A;  3IE3 A;  3MNG A;  5G30 A;  2O8V B;  4MH2 A;  2WDU A;  3IXR A;  2Z9S A;  3LXT A;  3J7Y k;  4TXO A;  3VPT A;  4ILF A;  2CZ3 A;  2FD3 A;  4D73 B;  3SBC A;  9GSS A;  5DAL A;  2F9S A;  5ECI B;  1GNE A;  2B6M A;  2FY6 A;  3GYK A;  3C8E A;  1TRU A;  4EDZ A;  1FVK A;  1S3C A;  3ZIT A;  2CX4 A;  2IFQ B;  2GSR A;  1VRS D;  3O76 A;  4YH2 A;  3PIN A;  2F8A A;  2QGV A;  3P7X A;  1X5C A;  3O6T A;  3Q6O A;  3TJF A;  4J2F A;  2DC5 A;  3G9B A;  6GSV A;  2H74 A;  4RI7 A;  3H8Q A;  2H8L A;  3F4T A;  1GTA A;  3H79 A;  5INY A;  4KDY A;  2CAI A;  1AUC A;  3SWL A;  4IGJ A;  4HDE A;  1HYU A;  1WRY A;  2P31 A;  3KJY A;  2L5L A;  4OCE A;  2F51 A;  4JR4 A;  4GSN A;  3KP9 A;  4MJE A;  3HVS A;  3HD5 A;  1X9S B;  2G2Q A;  2C0F A;  1NHO A;  5A5K A;  3D5J A;  1HQO A;  2O85 A;  3LYK A;  2RLI A;  1RK4 A;  1B4Q A;  1DE2 A;  2LRN A;  1A8Y A;  3ZIV A;  2CV4 A;  3VWU A;  1XCC A;  1GH2 A;  2WJU A;  4GLT A;  3C1R A;  2RM5 A;  1MTC A;  2VAF A;  4KSO A;  1R4W A;  3EMP A;  2B1K A;  2QSI A;  5DQY A;  1YQ1 A;  3UOM A;  2CAQ A;  1J08 A;  3QAV A;  5DJL A;  4G9H A;  1KTE A;  2VL2 C;  4KX4 A;  4MAB A;  3TJK A;  3F3R A;  3RPP A;  1GUK A;  2OAD A;  4Z7X A;  2H1B A;  3A2X A;  1U6T A;  2FWG A;  3GX8 A;  2JL4 A;  3U6V A;  3NZN A;  1QXH A;  5B6N A;  3TJB A;  1G7O A;  5GST A;  3CTF A;  2DBC A;  4IJ3 A;  5HR1 A;  2R6K A;  4AF2 A;  5ECK B;  5DAK B;  2WCI A;  3F4R A;  2FA8 A;  4GTU A;  5IIZ A;  3LEF A;  4EL1 A;  3TRX A;  4D73 A;  4HQS A;  4K9Z A;  4KUN A;  2HT9 A;  1EEJ A;  3IPZ A;  4L5L A;  3R2Q A;  3KMN A;  4ML1 A;  4FIW A;  5CRH A;  2B3S A;  5F07 A;  2MZC A;  2MYG A;  2OE1 A;  2NTO A;  1OE7 A;  3PH9 A;  5EVO A;  4GF0 A;  1XVW A;  4WF5 A;  2VL3 A;  4BL7 A;  2AYT A;  5EPF A;  1XZO A;  2LV3 A;  2LNS A;  1PKW A;  5DQS A;  5ECN B;  1ON4 A;  3F6D A;  2C1Y A;  4EXJ A;  4WXT A;  4OWY A;  4IEL A;  4F9Z A;  5G2Z A;  2ZUP A;  5LD0 A;  4MF6 A;  5D9W A;  4JED A;  2B7K A;  5AIV A;  3VWW A;  5B6M A;  3GST A;  1F3A A;  1SL1 B;  3KM6 A;  1XBS A;  3GIX A;  4EUY A;  5JCW A;  1WMJ A;  1ERW A;  4HU7 A;  1R26 A;  3GV1 A;  1B8X A;  1PD2 1;  4KCE A;  4IN0 A;  1KEB A;  1O8W A;  4FO5 A;  4Q5F A;  2H6X A;  4EE0 A;  1A23 A;  4DSR A;  1Q98 A;  3F4S A;  4XS4 B;  1DE1 A;  2YZU A;  4TW5 A;  2L5O A;  2EIQ A;  1O6J A;  1TRV A;  3E3E A;  3WGX A;  2VIM A;  2KHP A;  1OKT A;  3GKN A;  3GH6 A;  2BMX A;  1XW9 A;  6GSY A;  4ECI A;  1GTI A;  2IMF A;  2GQM A;  3P8W A;  4IQ1 A;  3S9F A;  3WT1 A;  4WR5 A;  3PR8 A;  3HJO A;  1XWG A;  1BYE A;  5LCZ A;  2HRF A;  1GSQ A;  6GST A;  2PN8 A;  4I5Q A;  4YAV A;  4ZB9 A;  4PQ1 A;  3WYW A;  1OC9 A;  1YF0 A;  2VCT A;  5AIX A;  2GSQ A;  3NOF A;  1XWB A;  3TJG A;  4F82 A;  1YY7 A;  3GKM A;  2EIO A;  3MWH A;  2R3X A;  3FR3 A;  5DAK A;  1E6B A;  2GZY A;  4MZC A;  2CVB A;  5CNW A;  2VCZ A;  5H5S A;  5EY6 A;  4AJ7 A;  1TDI A;  2OA7 A;  1U88 A;  4IQA A;  3GL3 A;  5IMZ A;  3QMX A;  2H6Z A;  1BAY A;  1EWX A;  5A4V A;  1GLQ A;  3IAM 2;  2M80 A;  5J5N A;  2PVQ A;  1ILO A;  1WIK A;  3C7M A;  2A4V A;  1YDK A;  2PBJ A;  4MJA A;  1YEX A;  1M2A A;  4NHZ A;  2WGR A;  4YQM A;  5ECR B;  1RW1 A;  2P5R A;  4POK A;  3UEM A;  1O8X A;  3CTG A;  4CHS A;  3ZZX A;  3UBK A;  1TRS A;  3KTL A;  2I1U A;  2BTO T;  3IAS 2;  4NMU A;  3FEU A;  3RAZ A;  2H76 A;  5FT3 A;  3HA9 A;  1ZYQ B;  3BD2 A;  6GSS A;  5D9T A;  1G0T A;  3LQ7 A;  4Q5N A;  2J9H A;  3D21 A;  1TI3 A;  3EYT A;  2YJ7 A;  3HKR A;  3L9S A;  3FZ5 A;  1K0C A;  1USB A;  1OC3 A;  3QFB C;  5ELG A;  3L9U A;  2JZR A;  2LEG A;  3IK7 A;  4J56 E;  4JRR A;  1EV9 A;  1SJ6 A;  1I9D A;  5AGY A;  5FHI A;  3ZRD A;  3ZL5 A;  3JCM L;  2XPD A;  1JZO A;  1ABA A;  4NV5 A;  2YNX A;  4MPG A;  2CA8 A;  2FA4 A;  3KH9 A;  1EZK A;  2XBI A;  5F8B A;  3UMA A;  1DUG A;  2H0H A;  2VLU A;  4TXO B;  1SYR A;  3KD0 A;  1Z3E A;  1TW9 A;  3CBU A;  5JWR B;  2HZF A;  5DAL B;  3ZVJ D;  1VF4 A;  2WUL A;  1J0F A;  2KLX A;  2LRT A;  3L4N A;  1G6W A;  1GSS A;  2E0Q A;  5CRD A;  3HJP A;  1DSB A;  4WKW A;  1K0B A;  5DCG A;  1VF1 A;  1FG4 A;  2FUG 2;  1V57 A;  2AB6 A;  4MMM A;  1SK2 A;  2GQL A;  1OC8 A;  4V2L A;  4V2M A;  1G6Y A;  3ZML A;  1UA5 A;  1M99 A;  3ZFL A;  3GKX A;  1CQG A;  4IP1 A;  4IW9 A;  3TCO A;  4ECC A;  1RQM A;  2V6K A;  2OE3 A;  1PSQ A;  1JLW A;  4TXV A;  3A3T A;  1BG5 A;  1JZR A;  2QC7 A;  4XS1 A;  5G1K A;  18GS A;  2RUE A;  4TKY A;  2H1A A;  3WT2 A;  2PGT A;  5J41 A;  3LSZ A;  4HEA 2;  1WP0 A;  2DML A;  4I6X A;  3MAK A;  2DJ3 A;  2VLT A;  4HOJ A;  5GAP D;  2XC2 A;  1MD4 A;  4NPB A;  3TB2 A;  3ZFB A;  4RUV A;  5J9B A;  3CSJ A;  2YWI A;  2IL3 A;  3LFL A;  3J7Y b;  4IKH A;  2I81 A;  2OBI A;  2YWM A;  2PPT A;  3VLN A;  3DEX A;  2AJQ B;  5ECP B;  2FLS A;  1THO A;  3LWA A;  5D93 A;  1U3I A;  3P90 A;  2ON5 A;  4QL7 A;  1F3B A;  1U87 A;  2JAD A;  2L6D A;  1NSW A;  1F6M C;  1XOB A;  4DVC A;  4POL A;  1ST9 A;  5A4W A;  5HFI A;  2FWE A;  1XWC A;  2O87 A;  4G10 A;  3W6G A;  3F3Q A;  4ZL8 A;  1V58 A;  3ZIJ A;  1OKD A;  3DXB A;  4KE3 A;  1IYH A;  1XIY A;  2KP2 A;  2H71 A;  4TR3 A;  1XXU A;  1M2D A;  1PX7 A;  4KDU A;  5D73 A;  1T00 A;  1SK0 A;  4EO3 A;  1GTB A;  2A2S A;  2YWN A;  3EUR A;  3GNJ A;  4JU5 A;  5D9X A;  1BQ7 A;  3M9J A;  1H75 A;  4ZL9 A;  3VK9 A;  3F6F A;  1FVJ A;  1JFU A;  2N5F A;  2PVO C;  4IVF A;  3LOR A;  4I8B A;  2DJJ A;  4EKZ A;  1K0O A;  2IMD A;  2ZCT A;  2K9F A;  2IPA A;  2J23 A;  3HVV A;  6GSW A;  4RI6 A;  3BCK A;  5C00 A;  3TKS A;  3KZQ A;  5DJM A;  2YOI A;  4MJB A;  2C3T A;  3HCZ A;  4O5R A;  7GSS A;  4ZIJ A;  2YV7 A;  4L8E A;  3FW2 A;  3IR4 A;  1WJK A;  4E8H A;  1A0R P;  2FHE A;  1H4O A;  2CQ9 A;  2RM6 A;  2TIR A;  2DMM A;  1YKA A;  2B7J A;  2LST A;  1M9B A;  4HZ4 A;  2YN1 A;  3AY8 A;  3TUE A;  5ECH B;  3KXO A;  2PU9 C;  3GUR A;  4GST A;  4HJM A;  4GCI A;  4AJ8 A;  3Q74 A;  4Q5Q A;  3GFK A;  4CW9 A;  3D4M A;  5CRG A;  3GX0 A;  4AGS A;  3HVX A;  3D0Z A;  5D9V A;  4I2T A;  2DSA A;  3DML A;  1NW2 A;  1NHY A;  2FGX A;  5HFG A;  3TDG A;  3LGC A;  4TN8 A;  3GTU A;  1OC9 B;  2B5X A;  4F0B A;  3IV4 A;  2L4Q A;  4DSS B;  2GZZ A;  2H01 A;  4ML6 A;  3LG6 A;  3DD3 A;  2OJL A;  1TU8 A;  5GZZ B;  2IIY A;  3ED3 A;  2GGT A;  5IQY A;  4QQ7 A;  3L0H A;  1QMV A;  1OVN A;  2JZS A;  5J4U A;  2GST A;  2AV4 A;  2L57 A;  1YKC A;  4O32 A;  5ENU A;  2ON7 A;  1KBN A;  4V2N A;  2B5Y A;  2VCX A;  1U3A A;  5ECO B;  4N11 A;  3GMF A;  3APS A;  3FZA A;  1FHE A;  4POB A;  2GDR A;  5JCU A;  1K0N A;  5DVB A;  1SJZ A;  1CQH A;  4HZ2 A;  5CP1 A;  4BWQ A;  1O7U A;  2WFC A;  1FW1 A;  3U5R E;  4IBP A;  1TJD A;  4EDY A;  3W8J A;  4IS0 A;  1T1V A;  1OE8 A;  2GQK A;  3CSH A;  2PMT A;  3CXG A;  1XOA A;  1I5G A;  3TKR A;  3C71 A;  1EP7 A;  4OCF A;  1SYX A;  10GS A;  2C0D A;  2VO4 A;  4I97 A;  3VPQ A;  1SKR B;  4JBB A;  3GUS A;  13GS A;  1K0D A;  2H1D A;  4XS6 A;  3I69 A;  3FZ9 A;  5JWQ B;  5IMV A;  3F8U A;  1Z6M A;  3GH9 A;  4IJI A;  4GQF A;  4PQH A;  2VLV A;  3FHK A;  5D8I A;  1GRX A;  3DKS A;  3TKP A;  4ZB6 A;  3NIV A;  1THX A;  3HZ4 A;  3A2W A;  1Z7P A;  1ZGN A;  2NDO A;  1K3O A;  1AXD A;  1ERT A;  3APO A;  3DGQ A;  4DSS A;  1A0F A;  5F05 A;  5ECQ B;  2FWF A;  3WGE A;  4K0G A;  2JU5 A;  5G5F A;  3VI7 A;  5HR0 A;  3KIJ A;  5G5E A;  2LJA A;  1GTU A;  4BWS A;  1ACV A;  5D96 A;  4LMV A;  1O85 A;  3O3T A;  1T8E B;  5EL8 A;  1W4V A;  1ZL9 A;  5IMF A;  5ID2 A;  1ERV A;  1QGV A;  3DVW A;  1ZZY A;  2H6Y A;  2VD1 A;  1R5A A;  1PA3 A;  1YZX A;  3ISO A;  1YF1 A;  1SU9 A;  3UVH A;  1TK0 B;  3QAG A;  4AJ6 A;  2OBK A;  2GS3 A;  4WEY A;  3IOS A;  2WS2 A;  1ERU A;  5LNK e;  19GS A;  1GSF A;  1VF2 A;  2DLX A;  1YEP A;  4FYU A;  1PRX A;  2MMA A;  2DJ2 A;  14GS A;  3UAP A;  4K2D A;  1MDJ A;  3ME8 A;  2ES7 A;  3N5O A;  1GNW A;  4GSS A;  2LQQ A;  2GZP A;  1TTZ A;  3EVI A;  5CRW A;  3ZYW A;  4MLY A;  3I43 A;  2H70 A;  1QFN A;  1GLP A;  4ZIL A;  2XHF A;  1EGO A;  2QKE A;  5B8B A;  1X0R A;  2FNO A;  3GRX A;  1E2Y A;  2G0F A;  4IHU A;  1JLV A;  1F9M A;  4FH8 A;  3LJR A;  5JCG A;  1OAZ A;  1PN9 A;  4RQR A;  4YQU A;  5KN0 A;  2GTU A;  4L0U A;  4ZBD A;  2C4J A;  4HUA A;  1GWC A;  1EEM A;  4OO4 A;  1GUL A;  1PL2 A;  2IWT A;  5IOX A;  3VWV A;  4GRF A;  3HDC A;  1LJR A;  1O73 A;  4F03 A;  1UVZ A;  2VCV A;  1JHB A;  4O7H A;  3TKS C;  2CX3 A;  3KEB A;  1XFL A;  4DSQ A;  4J57 E;  4ISD A;  2V2G A;  5L71 A;  4L0W A;  2FCH A;  3A2V A;  2R5G A;  4ACS A;  4G2E A;  1GUH A;  2GT5 A;  4WBR D;  2NBS A;  2LJK A;  3IRA A;  2R37 A;  1XWK A;  4KA0 A;  3CSI A;  1ZOF A;  3CRT A;  1AQV A;  3LYP A;  1XPV A;  2LNT A;  4K0N A;  5IMD A;  4PUR A;  3KTB A;  2KUC A;  1GL8 A;  1X9M B;  1XW6 A;  3TOU A;  2AUV A;  5DDL A;  4I2U A;  1PL1 A;  3UL3 A;  2DIY A;  4MF7 A;  1SL0 B;  2DJ0 A;  3QCP A;  1V98 A;  1K0A A;  4MH3 A;  2H73 A;  3GHA A;  5IO2 A;  1ML6 A;  3ERF A;  2C8U A;  2YAN A;  4XIH A;  4N0V A;  1SJI A;  2OE0 A;  4XCS A;  2VCW A;  3UVT A;  3HJM A;  5JWO B;  2X8C A;  5ELA A;  5IO0 A;  2VCQ A;  1F37 A;  1HNB A;  3IHQ A;  1M7T A;  3CYN A;  4JR6 A;  4MA9 A;  4ZXG A;  3QFA C;  2H0G A;  5E59 A;  2LRC A;  2LTK A;  4ZBA A;  3TRQ A;  2IMK A;  2HZE A;  1AIU A;  2X99 A;  3ME7 A;  2WB9 A;  5E4W A;  3GTU B;  3EE2 A;  1SKW B;  2LUS A;  2RUF A;  2DJK A;  1A2L A;  2F3M A;  4KW6 A;  1GSU A;  4LA1 A;  4ULX A;  2K6V A;  3BOA A;  1MDI A;  2TRX A;  2YV9 A;  2PWJ A;  1B4P A;  4OFT A;  3OR5 A;  4HJ2 A;  2V6O A;  3ZTL A;  1TP9 A;  4KH7 A;  4X43 A;  2C0G A;  1PQN A;  3GN3 A;  1B48 A;  4HQZ A;  3KCM A;  22GS A;  1KNG A;  3E9J B;  1Q4J A;  1XW5 A;  4K7O A;  2L4C A;  4TR4 A;  1TXX A;  4N0Z A;  2L6C A;  3F9U A;  4MF5 A;  3FY7 A;  1XWA A;  3M3M A;  3D4T A;  5FWG A;  2K18 A;  3EMX A;  5F06 A;  4IP6 A;  2B5E A;  2M72 A;  2I3Y A;  1URM A;  3BJ5 A;  3GA4 A;  2NPB A;  2OKA A;  3RBT A;  4F2I A;  1LBK A;  2H75 A;  2EC4 A;  5KN3 A;  3C73 A;  4BVY A;  3I6A A;  4BA7 A;  1TU7 A;  3ERW A;  2HFD A;  2CVD A;  4V1A p;  2LKU A;  2HXK A;  3IDV A;  4L5O A;  4OFM A;  4GQC A;  2N5A A;  1FB6 A;  1MDK A;  3H1N A;  3IK9 A;  4MPF A;  4WF4 A;  2PUK C;  2WRT A;  5GAN D;  3UIW A;  3TKQ A;  2MBT A;  5ECM B;  3W8S A;  2O7K A;  1PKZ A;  1N2A A;  4KSM A;  3UBL A;  4K8M A;  5H5Q A;  3D6I A;  1B9Y C;  2MMN A;  4EC0 A;  1AAZ A;  2HRN A;  4QL9 A;  4KB3 A;  1EP8 A;  4PXO A;  1O81 A;  1S3D A;  4YAP A;  6GSU A;  1QUW A;  3IA1 A;  2RII A;  2E7P A;  2A2R A;  3EU3 A;  2K8S A;  1EGR A;  2BJX A;  2C3Q A;  3QPM A;  3H93 A;  4MZB A;  2I4A A;  4KND A;  4LL1 B;  4V1A g;  3TRP A;  5HQP A;  1M2B A;  2P0G A;  3UAR A;  2F8F A;  3E0U A;  3ZRE A;  3DIE A;  4K7I A;  1VF3 A;  4NHW A;  3IC4 A;  2E2G A;  4NV2 A;  3KMO A;  5ID2 B;  5J3R A;  12GS A;  3CRU A;  1AQX A;  1N8J A;  3M1G A;  5AN1 A;  1MD3 A;  1UC7 A;  4RQX A;  2GVP A;  3BBY A;  5KN2 A;  3KH7 A;  4TR0 A;  1SD9 A;  1X9W B;  4LMW A;  1V2A A;  5J9C A;  3IBH A;  2IFQ A;  2KOK A;  3DRN A;  3WD6 A;  1W89 A;  1ZCP A;  3ZVJ A;  1GP1 A;  1FO5 A;  4K1F A;  4HS1 A;  4ID0 A;  2H66 A;  2DIZ A;  5KN1 A;  4ECB A;  3RPN A;  4PNG A;  5G31 A;  1SK1 A;  4TOP A;  4TR1 B;  4TRX A;  2YP6 A;  2CT6 A;  5IOW A;  1GSY A;  4G19 A;  2R4V A;  1T4Y A;  5B8A A;  1OYJ A;  2YPM A;  3L78 A;  3H4K A;  1MEK A;  3G7J A;  2OAC A;  4FYC A;  3TKS E;  1UN2 A;  4YQV A;  5IPH A;  3ZMK A;  2JSZ A;  4F0C A;  2MBS A;  3G7I A;  4K6X A;  5COH A;  1PGT A;  1Z9H A;  4XTS A;  5CAX A;  3M8N A;  3QD9 A;  4H86 A;  1K3L A;  1AC1 A;  3K8N A;  6GSX A;  5ABR A;  4E8E A;  2ALB A;  11GS A;  3VWX A;  1T4Z A;  4PNF A;  1S3A A;  4OD7 A;  4MP4 A;  1GSD A;  1Z7R A;  2VL9 A;  1X5E A;  4KAE A;  1ZYE A;  3LXZ A;  2IN3 A;  2LQO A;  5IPG A;  2IME A;  2H19 A;  2C80 A;  3APQ A;  3I9V 2;  4O92 A;  1AQW A;  1PX6 A;  1A8L A;  20GS A;  2VOC A;  2V41 A;  1VGL A;  1EV4 A;  3PGT A;  3D22 A;  1Y25 A;  4XHM A;  1TOF A;  1WPI A;  3ERG A;  2GLR A;  3QOU A;  2HI7 A;  5HR2 A;  3WGD A;  1XVQ A;  1JZD A;  1TK8 B;  2VM2 A;  4OO5 A;  4N10 A;  2VL2 A;  5HR3 A;  3US3 A;  3QR6 A;  4POM A;  1HNA A;  2VM1 A;  5CO3 A;  3RDW A;  1SEN A;  4ZB8 A;  2HLS A;  3A5W A;  4JE1 A;  4XRD A;  2HYX A;  1DBY A;  2AAW A;  5IMA A;  4MZW A;  4HU9 A;  5C04 A;  3MDK A;  4K7N A;  4MDC A;  3RHB A;  1A24 A;  3GSS A;  3DWV A;  1IYI A;  4TR1 A;  3TJJ A;  1FB0 A;  5DBQ A;  2YZH A;  3FR6 A;  4KCA A;  1HD2 A;  3C1S A;  1BJX A;  2CVK A;  2DJ1 A;  1M9A A;  4PUF C;  1TKD B;  3Q18 A;  2CZ2 A;  4ZL7 A;  2E2M A;  1FAA A;  5A4U A;  3DVX A;  4GWR A;  4WR4 A;  1T3B A;  3P2A A;  2V32 A;  4NWY A;  1GUM A;  2B1L A;  1AW9 A;  1B9X C;  1C72 A;  4PUA A;  3CMI A;  4WBJ A;  5ECL B;  5G1L A;  2R2J A;  2GSS A;  2H0I A;  2HZE B;  2IMI A;  2EIR A;  2XBQ A;  2MMO A;  4OFN A;  4DEJ A;  2H1G A;  1WWJ A;  1TK5 B;  4P3Y B;  3HZ8 A;  2D2Z A;  3DYR A;  1R7H A;  2C0E A;  5F0G A;  4JZQ A;  4XRA A;  4XS4 A;  2HSY A;  3TGZ A;  4TVE A;  2WZ9 A;  2HNL A;  1J9B A;  3BCI A;  3FYG A;  4PGT A;  2O89 A;  2JSY A;  3FRC A;  4ECJ A;  2C3N A;  1QK8 A;  2YWO A;  2VUP A;  4BVX A;  1EOH A;  1WE0 A;  3QDN A;  1TI1 A;  1F2E A;  2YJH A;  4LLR A;  2VD0 A;  3VFI A;  4OMV A;  3F63 A;  5IMC A;  4ZBB A; 
#chains in the Genus database with same CATH topology
 3EWL A;  3ZLP A;  1FOV A;  1PMT A;  3HYP A;  3RHC A;  3M9K A;  5CYY A;  4NXI A;  1Y6E A;  1ZMA A;  3GKK A;  1LU4 A;  2ZNM A;  4EF0 A;  2FWH A;  3FK8 A;  1EOG A;  4Q5R A;  2REM A;  3FR9 A;  3F0I A;  4LL4 B;  4HI7 A;  3FZ4 A;  2L59 A;  2JZT A;  3GL5 A;  1V40 A;  2K8V A;  1SL2 B;  3VUR A;  1BED A;  17GS A;  5B7C A;  2GT6 A;  1NM3 A;  4BPY A;  1G7E A;  1GSE A;  4EVM A;  2IJY A;  2H72 A;  2LJR A;  3FKF A;  2JAC A;  1T7P B;  4N30 A;  4PX1 A;  2LS5 A;  1Z5Y E;  3L9V A;  1M0U A;  1WOU A;  3N9J A;  3EIN A;  1K0M A;  1TRW A;  5H5R A;  16GS A;  3VI5 A;  4MJC A;  2P5Q A;  3KGK A;  3EU4 A;  4X0X A;  4NAX A;  1SKS B;  1BX9 A;  3EC3 A;  4X1U A;  1A2M A;  2XPE A;  4MK3 A;  2NVL A;  2X8H A;  4FYB A;  2M46 A;  5BMU A;  5GSS A;  2TRC P;  2PER A;  3Q19 A;  2KP1 A;  3QAW A;  5IM9 A;  3M0F A;  4CDO A;  2V1M A;  4PQI A;  4KDX A;  5KEJ A;  2HSH A;  1X5D A;  3PPU A;  1K3Y A;  1HNC A;  3G7Y A;  3TOT A;  2AHE A;  4GXZ A;  1SD8 A;  1R5P A;  5CRE A;  5HFK A;  3KP8 A;  2H30 A;  3HXS A;  4MCU A;  5DCH A;  1Z6N A;  2X8G A;  1FOH A;  1JZW A;  8GSS A;  2N5B A;  3MSZ A;  2YCD A;  4WET A;  1YJ6 A;  3UJ1 A;  3V1W A;  5ECS A;  4BIK A;  2MMZ A;  4KGI A;  2HE3 A;  2I9H A;  1QQ2 A;  1V9W A;  4O5Q A;  2X64 A;  1A2J A;  5AIS A;  3HHV A;  3HY2 A;  3IE3 A;  3MNG A;  5G30 A;  2O8V B;  4MH2 A;  2WDU A;  3IXR A;  2Z9S A;  3LXT A;  3J7Y k;  4TXO A;  3VPT A;  4ILF A;  2CZ3 A;  2FD3 A;  4D73 B;  3SBC A;  9GSS A;  5DAL A;  2F9S A;  5ECI B;  1GNE A;  2B6M A;  2FY6 A;  3GYK A;  3C8E A;  4YKF A;  1TRU A;  4EDZ A;  1FVK A;  4FQU A;  1S3C A;  3ZIT A;  2CX4 A;  2IFQ B;  2GSR A;  1VRS D;  3O76 A;  4YH2 A;  3PIN A;  2DKI A;  2F8A A;  2QGV A;  3P7X A;  4BL7 B;  1X5C A;  3O6T A;  3IC8 A;  3Q6O A;  3TJF A;  4J2F A;  2DC5 A;  3G9B A;  6GSV A;  2H74 A;  4RI7 A;  3H8Q A;  3R3E A;  2H8L A;  3F4T A;  1GTA A;  3H79 A;  5INY A;  4KDY A;  2CAI A;  1AUC A;  3SWL A;  4IGJ A;  4HDE A;  1HYU A;  1WRY A;  2P31 A;  3KJY A;  2L5L A;  4OCE A;  2F51 A;  4JR4 A;  4GSN A;  3KP9 A;  4MJE A;  3HVS A;  3HD5 A;  1X9S B;  2G2Q A;  3HVN A;  2R0P A;  2C0F A;  1NHO A;  5A5K A;  3D5J A;  1HQO A;  2O85 A;  3LYK A;  2RLI A;  1RK4 A;  1B4Q A;  1DE2 A;  2LRN A;  1A8Y A;  3ZIV A;  2CV4 A;  1PN0 A;  3VWU A;  1XCC A;  1GH2 A;  2WJU A;  4GLT A;  3C1R A;  2RM5 A;  1MTC A;  2VAF A;  4KSO A;  1R4W A;  3EMP A;  2B1K A;  2QSI A;  5DQY A;  1YQ1 A;  3UOM A;  2CAQ A;  1J08 A;  3QAV A;  5DJL A;  4G9H A;  1KTE A;  2VL2 C;  4KX4 A;  4MAB A;  3TJK A;  3F3R A;  3RPP A;  1GUK A;  2OAD A;  4Z7X A;  2H1B A;  3A2X A;  1U6T A;  2FWG A;  4Z2R A;  5KOW A;  3CQF A;  3GX8 A;  2JL4 A;  3U6V A;  3NZN A;  1QXH A;  5B6N A;  3TJB A;  1G7O A;  5GST A;  3CTF A;  2DBC A;  4IJ3 A;  5HR1 A;  2R6K A;  4AF2 A;  5ECK B;  5DAK B;  2WCI A;  3F4R A;  2FA8 A;  4GTU A;  5IIZ A;  3LEF A;  4EL1 A;  3TRX A;  4D73 A;  4HQS A;  4K9Z A;  4KUN A;  2HT9 A;  1EEJ A;  3IPZ A;  4L5L A;  3R2Q A;  3KMN A;  4ML1 A;  4FIW A;  5CRH A;  2B3S A;  5F07 A;  2MZC A;  2MYG A;  2OE1 A;  2NTO A;  1OE7 A;  3PH9 A;  5EVO A;  4GF0 A;  1XVW A;  4WF5 A;  2VL3 A;  4BL7 A;  2R0G A;  2AYT A;  5EPF A;  1XZO A;  2LV3 A;  2LNS A;  1PKW A;  5DQS A;  5ECN B;  1ON4 A;  3F6D A;  2C1Y A;  4EXJ A;  4WXT A;  4OWY A;  4IEL A;  4F9Z A;  5G2Z A;  2ZUP A;  5LD0 A;  4MF6 A;  5D9W A;  4JED A;  2B7K A;  5AIV A;  3VWW A;  5B6M A;  3GST A;  1F3A A;  1SL1 B;  3KM6 A;  1XBS A;  3GIX A;  4EUY A;  5JCW A;  1WMJ A;  1ERW A;  4HU7 A;  1R26 A;  3GV1 A;  1B8X A;  1PD2 1;  4KCE A;  4IN0 A;  5BRT A;  1KEB A;  1O8W A;  4FO5 A;  4Q5F A;  2H6X A;  4EE0 A;  1A23 A;  4DSR A;  1Q98 A;  3F4S A;  4XS4 B;  1DE1 A;  2YZU A;  4TW5 A;  2L5O A;  2EIQ A;  1O6J A;  1TRV A;  3E3E A;  3WGX A;  2VIM A;  2KHP A;  1OKT A;  3GKN A;  3GH6 A;  2BMX A;  2HRK A;  1XW9 A;  6GSY A;  4ECI A;  1GTI A;  3LW9 A;  2IMF A;  2GQM A;  3P8W A;  4IQ1 A;  3S9F A;  3WT1 A;  4WR5 A;  3PR8 A;  4HSC X;  3HJO A;  1XWG A;  1BYE A;  5LCZ A;  2HRF A;  1GSQ A;  6GST A;  2PN8 A;  4I5Q A;  4ICY A;  4YAV A;  4ZB9 A;  4PQ1 A;  3WYW A;  1OC9 A;  1YF0 A;  2VCT A;  5AIX A;  2GSQ A;  3NOF A;  1XWB A;  3TJG A;  4F82 A;  1YY7 A;  3GKM A;  2EIO A;  3MWH A;  2R3X A;  3FR3 A;  5DAK A;  1E6B A;  2GZY A;  4MZC A;  2CVB A;  5CNW A;  2VCZ A;  5H5S A;  5EY6 A;  4EIP A;  4AJ7 A;  1TDI A;  2OA7 A;  1U88 A;  4IQA A;  3GL3 A;  4CY6 A;  5IMZ A;  3QMX A;  2H6Z A;  1BAY A;  1EWX A;  5A4V A;  1GLQ A;  3IAM 2;  2M80 A;  5J5N A;  2PVQ A;  1ILO A;  1WIK A;  3C7M A;  2A4V A;  1YDK A;  2PBJ A;  4MJA A;  1YEX A;  1M2A A;  4NHZ A;  2WGR A;  4YQM A;  5ECR B;  1RW1 A;  2P5R A;  4POK A;  3UEM A;  1O8X A;  3CTG A;  4CHS A;  3ZZX A;  3UBK A;  1TRS A;  3KTL A;  2I1U A;  4Z2T A;  2BTO T;  3IAS 2;  4NMU A;  3FEU A;  3RAZ A;  2H76 A;  5FT3 A;  3HA9 A;  1ZYQ B;  3BD2 A;  6GSS A;  5D9T A;  1G0T A;  3LQ7 A;  2HRA A;  4Q5N A;  2J9H A;  3MIX A;  3D21 A;  1TI3 A;  3EYT A;  2YJ7 A;  3HKR A;  3L9S A;  3FZ5 A;  1K0C A;  1USB A;  1OC3 A;  3QFB C;  5ELG A;  3L9U A;  2JZR A;  2LEG A;  3IK7 A;  4J56 E;  4JRR A;  1EV9 A;  1SJ6 A;  4A5P A;  1I9D A;  5AGY A;  4G0K A;  4K5S A;  5FHI A;  4K2X A;  3ZRD A;  3ZL5 A;  3JCM L;  2XPD A;  1JZO A;  2R0C A;  1ABA A;  4NV5 A;  2YNX A;  4MPG A;  2CA8 A;  2FA4 A;  3KH9 A;  1EZK A;  2XBI A;  5F8B A;  3UMA A;  1DUG A;  2H0H A;  2VLU A;  4TXO B;  1SYR A;  3KD0 A;  1Z3E A;  1TW9 A;  3CBU A;  1M3J A;  2X4A A;  5JWR B;  2HZF A;  5DAL B;  3ZVJ D;  1VF4 A;  2WUL A;  1J0F A;  2KLX A;  2LRT A;  3L4N A;  1G6W A;  1GSS A;  2E0Q A;  5CRD A;  3HJP A;  1DSB A;  4WKW A;  1K0B A;  2HSM A;  5DCG A;  1VF1 A;  1FG4 A;  2FUG 2;  1V57 A;  2AB6 A;  4MMM A;  1SK2 A;  2GQL A;  1OC8 A;  4V2L A;  4V2M A;  1G6Y A;  3MYD A;  3ZML A;  1UA5 A;  1M99 A;  3ZFL A;  3GKX A;  1CQG A;  4IP1 A;  4IW9 A;  3TCO A;  4ECC A;  2UZ8 A;  1RQM A;  2V6K A;  2OE3 A;  1PSQ A;  1JLW A;  4TXV A;  3A3T A;  1BG5 A;  1JZR A;  2QC7 A;  4XS1 A;  5G1K A;  18GS A;  2RUE A;  4TKY A;  2H1A A;  3WT2 A;  2PGT A;  5J41 A;  3LSZ A;  4HEA 2;  1WP0 A;  2DML A;  4I6X A;  3MAK A;  2DJ3 A;  2VLT A;  4HOJ A;  5GAP D;  2XC2 A;  1MD4 A;  4NPB A;  3TB2 A;  3ZFB A;  4RUV A;  5J9B A;  3CSJ A;  2YWI A;  2IL3 A;  3LFL A;  3J7Y b;  4IKH A;  2I81 A;  2OBI A;  2YWM A;  2PPT A;  3VLN A;  3DEX A;  2AJQ B;  5ECP B;  2FLS A;  1THO A;  3LWA A;  5D93 A;  1U3I A;  3P90 A;  2ON5 A;  4QL7 A;  1F3B A;  1U87 A;  2JAD A;  2L6D A;  1NSW A;  1F6M C;  1XOB A;  4DVC A;  4POL A;  1ST9 A;  5A4W A;  5HFI A;  2FWE A;  1XWC A;  2O87 A;  4G10 A;  3W6G A;  3F3Q A;  4ZL8 A;  1V58 A;  3ZIJ A;  1OKD A;  3DXB A;  4KE3 A;  1IYH A;  1XIY A;  2KP2 A;  2H71 A;  4TR3 A;  1XXU A;  1M2D A;  1PX7 A;  4KDU A;  5D73 A;  1T00 A;  1SK0 A;  4EO3 A;  1GTB A;  2A2S A;  2YWN A;  3EUR A;  3GNJ A;  4JU5 A;  5D9X A;  1BQ7 A;  4CY8 A;  3M9J A;  1H75 A;  4ZL9 A;  3VK9 A;  3F6F A;  1FVJ A;  1JFU A;  2N5F A;  2PVO C;  4IVF A;  3LOR A;  4I8B A;  2DJJ A;  4EKZ A;  1K0O A;  2IMD A;  2ZCT A;  2K9F A;  2IPA A;  2J23 A;  3HVV A;  4USS A;  6GSW A;  4RI6 A;  3BCK A;  5C00 A;  3TKS A;  3KZQ A;  5DJM A;  2YOI A;  4MJB A;  2C3T A;  3HCZ A;  4O5R A;  7GSS A;  4ZIJ A;  2YV7 A;  4L8E A;  3FW2 A;  3IR4 A;  1WJK A;  4E8H A;  1A0R P;  2FHE A;  1H4O A;  2QA2 A;  2CQ9 A;  2RM6 A;  2TIR A;  2DMM A;  1YKA A;  2X49 A;  2B7J A;  2LST A;  1M9B A;  4HZ4 A;  2YN1 A;  3AY8 A;  3TUE A;  5ECH B;  3KXO A;  2PU9 C;  3GUR A;  4GST A;  4HJM A;  4GCI A;  4AJ8 A;  3Q74 A;  4Q5Q A;  3GFK A;  4CW9 A;  3D4M A;  5CRG A;  3GX0 A;  4AGS A;  3HVX A;  3D0Z A;  5D9V A;  4I2T A;  2DSA A;  3DML A;  1NW2 A;  1NHY A;  1PFO A;  2FGX A;  5HFG A;  3TDG A;  3LGC A;  4TN8 A;  3GTU A;  1OC9 B;  2B5X A;  4F0B A;  3IV4 A;  2L4Q A;  4DSS B;  2GZZ A;  2H01 A;  4ML6 A;  3LG6 A;  3DD3 A;  2OJL A;  1TU8 A;  5GZZ B;  2IIY A;  3ED3 A;  2GGT A;  5IQY A;  4QQ7 A;  3L0H A;  1QMV A;  1OVN A;  2JZS A;  5J4U A;  2GST A;  2AV4 A;  2L57 A;  1YKC A;  4O32 A;  5ENU A;  2ON7 A;  1KBN A;  4V2N A;  2B5Y A;  2VCX A;  1U3A A;  5ECO B;  4N11 A;  3GMF A;  3APS A;  3FZA A;  1FHE A;  4POB A;  2GDR A;  5JCU A;  1K0N A;  5DVB A;  1SJZ A;  1CQH A;  4HZ2 A;  5CP1 A;  4BWQ A;  1O7U A;  2WFC A;  1FW1 A;  3U5R E;  4IBP A;  1TJD A;  4EDY A;  3W8J A;  4IS0 A;  1T1V A;  1OE8 A;  2GQK A;  3CSH A;  2PMT A;  3CXG A;  4PTS A;  1XOA A;  1I5G A;  3TKR A;  3C71 A;  1EP7 A;  4OCF A;  1SYX A;  10GS A;  2C0D A;  2VO4 A;  4I97 A;  3VPQ A;  1M3I A;  1SKR B;  4JBB A;  3GUS A;  13GS A;  1K0D A;  2H1D A;  4XS6 A;  3I69 A;  3FZ9 A;  5JWQ B;  5IMV A;  3F8U A;  4G0L A;  1Z6M A;  3GH9 A;  4IJI A;  4GQF A;  4PQH A;  2VLV A;  4Z2U A;  3FHK A;  5D8I A;  1GRX A;  3DKS A;  3TKP A;  4ZB6 A;  3NIV A;  1THX A;  3HZ4 A;  3A2W A;  1Z7P A;  1ZGN A;  2NDO A;  1K3O A;  1AXD A;  1ERT A;  3APO A;  3DGQ A;  4DSS A;  1A0F A;  3EPT A;  5F05 A;  5ECQ B;  2FWF A;  3WGE A;  4K0G A;  2JU5 A;  5G5F A;  3VI7 A;  5HR0 A;  3KIJ A;  5G5E A;  2LJA A;  1GTU A;  4BWS A;  1ACV A;  5D96 A;  4LMV A;  1O85 A;  3O3T A;  1T8E B;  5EL8 A;  4YKG A;  1W4V A;  1ZL9 A;  5IMF A;  5ID2 A;  1ERV A;  1QGV A;  3DVW A;  1ZZY A;  2H6Y A;  2VD1 A;  1R5A A;  1PA3 A;  1YZX A;  3ISO A;  1YF1 A;  1SU9 A;  3UVH A;  1TK0 B;  3QAG A;  4AJ6 A;  2OBK A;  2GS3 A;  4WEY A;  3IOS A;  2WS2 A;  1ERU A;  5LNK e;  19GS A;  1GSF A;  1VF2 A;  2DLX A;  1YEP A;  4FYU A;  1PRX A;  2MMA A;  2DJ2 A;  14GS A;  4KF9 A;  3UAP A;  4K2D A;  1MDJ A;  3ME8 A;  1XG8 A;  2ES7 A;  3N5O A;  1GNW A;  4GSS A;  2LQQ A;  2GZP A;  1TTZ A;  3EVI A;  5CRW A;  3ZYW A;  4MLY A;  3I43 A;  2H70 A;  1QFN A;  1GLP A;  4ZIL A;  2XHF A;  1EGO A;  2QKE A;  5B8B A;  4MNN A;  1X0R A;  2FNO A;  3GRX A;  1E2Y A;  2G0F A;  4IHU A;  1JLV A;  1F9M A;  3FMW A;  4FH8 A;  3LJR A;  5JCG A;  1OAZ A;  1PN9 A;  4RQR A;  4YQU A;  5KN0 A;  2GTU A;  4L0U A;  4ZBD A;  2C4J A;  4HUA A;  1GWC A;  1EEM A;  4OO4 A;  1GUL A;  1PL2 A;  2IWT A;  5IOX A;  3VWV A;  4GRF A;  3HDC A;  1LJR A;  1O73 A;  4F03 A;  1UVZ A;  2VCV A;  1JHB A;  4O7H A;  3TKS C;  2CX3 A;  3KEB A;  1XFL A;  4DSQ A;  4J57 E;  4ISD A;  2V2G A;  5L71 A;  4L0W A;  2FCH A;  3A2V A;  2R5G A;  4ACS A;  4G2E A;  1GUH A;  2GT5 A;  4WBR D;  2NBS A;  2LJK A;  3IRA A;  2R37 A;  1XWK A;  4KA0 A;  3CSI A;  1ZOF A;  3CRT A;  1AQV A;  3LYP A;  1XPV A;  2LNT A;  4K0N A;  5IMD A;  4PUR A;  3KTB A;  2KUC A;  1GL8 A;  1X9M B;  1XW6 A;  3TOU A;  2AUV A;  5DDL A;  4I2U A;  1PL1 A;  3UL3 A;  4BVY B;  2DIY A;  4MF7 A;  1SL0 B;  2DJ0 A;  3QCP A;  1V98 A;  1K0A A;  4MH3 A;  2H73 A;  3GHA A;  5IO2 A;  1ML6 A;  3ERF A;  2C8U A;  2YAN A;  4XIH A;  4N0V A;  1SJI A;  2OE0 A;  4XCS A;  2VCW A;  3UVT A;  3HJM A;  5JWO B;  2X8C A;  5ELA A;  5IO0 A;  2VCQ A;  1F37 A;  1HNB A;  3IHQ A;  1M7T A;  3CYN A;  4JR6 A;  4MA9 A;  4ZXG A;  3QFA C;  2H0G A;  5E59 A;  2LRC A;  2LTK A;  4ZBA A;  3TRQ A;  2IMK A;  2HZE A;  1AIU A;  2X99 A;  3ME7 A;  2QA1 A;  2WB9 A;  5E4W A;  3GTU B;  3EE2 A;  1SKW B;  2LUS A;  2RUF A;  2DJK A;  1A2L A;  2F3M A;  4KW6 A;  1GSU A;  4LA1 A;  4ULX A;  2K6V A;  3BOA A;  1MDI A;  2TRX A;  2YV9 A;  2PWJ A;  1B4P A;  4OFT A;  3OR5 A;  4HJ2 A;  2V6O A;  3A5I A;  3ZTL A;  1TP9 A;  4KH7 A;  4X43 A;  2C0G A;  1PQN A;  3GN3 A;  1B48 A;  4HQZ A;  3KCM A;  1ZYN A;  22GS A;  1KNG A;  3E9J B;  1Q4J A;  1XW5 A;  4K7O A;  2L4C A;  4TR4 A;  4X4J A;  1TXX A;  4N0Z A;  2L6C A;  3F9U A;  4MF5 A;  3FY7 A;  1XWA A;  3M3M A;  3D4T A;  4O5U A;  5FWG A;  2K18 A;  3EMX A;  5F06 A;  4IP6 A;  2B5E A;  2M72 A;  2I3Y A;  1URM A;  3BJ5 A;  3GA4 A;  2NPB A;  2OKA A;  3RBT A;  4F2I A;  1LBK A;  2H75 A;  2EC4 A;  5KN3 A;  3C73 A;  4BVY A;  3I6A A;  4BA7 A;  1TU7 A;  3ERW A;  2HFD A;  2CVD A;  4V1A p;  2A4H A;  2HXK A;  2LKU A;  3IDV A;  4L5O A;  4OFM A;  4GQC A;  2N5A A;  1FB6 A;  1MDK A;  3H1N A;  3IK9 A;  4MPF A;  4WF4 A;  2PUK C;  2WRT A;  5GAN D;  3UIW A;  3TKQ A;  4G0I A;  2MBT A;  5ECM B;  3W8S A;  2O7K A;  1PKZ A;  1N2A A;  4KSM A;  3UBL A;  4K8M A;  5H5Q A;  3D6I A;  1B9Y C;  2MMN A;  4EC0 A;  1AAZ A;  2HRN A;  4QL9 A;  4KB3 A;  1EP8 A;  4PXO A;  1O81 A;  1S3D A;  4YAP A;  6GSU A;  1QUW A;  3IA1 A;  2RII A;  2E7P A;  2A2R A;  3EU3 A;  2K8S A;  1EGR A;  2BJX A;  2C3Q A;  3QPM A;  3H93 A;  4MZB A;  2I4A A;  4KND A;  4LL1 B;  4V1A g;  3TRP A;  5HQP A;  1M2B A;  2P0G A;  3UAR A;  2F8F A;  3E0U A;  3ZRE A;  2DKH A;  3DIE A;  4K7I A;  1VF3 A;  4NHW A;  3IC4 A;  2E2G A;  4NV2 A;  3KMO A;  5ID2 B;  5J3R A;  12GS A;  3CRU A;  1AQX A;  1N8J A;  3M1G A;  5AN1 A;  1MD3 A;  1UC7 A;  4RQX A;  2GVP A;  3BBY A;  5KN2 A;  3KH7 A;  4TR0 A;  1SD9 A;  1X9W B;  4LMW A;  1V2A A;  5J9C A;  3IBH A;  2IFQ A;  2KOK A;  3DRN A;  3WD6 A;  1W89 A;  4EIQ A;  1ZCP A;  3ZVJ A;  1GP1 A;  1FO5 A;  4K1F A;  4HS1 A;  4ID0 A;  2H66 A;  2DIZ A;  5KN1 A;  4ECB A;  3RPN A;  4PNG A;  5G31 A;  1SK1 A;  4TOP A;  4TR1 B;  4TRX A;  2YP6 A;  2CT6 A;  5IOW A;  1GSY A;  4G19 A;  2R4V A;  1T4Y A;  5B8A A;  1OYJ A;  2YPM A;  3L78 A;  3H4K A;  1MEK A;  3G7J A;  2OAC A;  4FYC A;  3TKS E;  1UN2 A;  4YQV A;  5IPH A;  3ZMK A;  2JSZ A;  4F0C A;  2MBS A;  3G7I A;  4K6X A;  5COH A;  1PGT A;  1Z9H A;  4XTS A;  5CAX A;  3M8N A;  3QD9 A;  4H86 A;  1K3L A;  1AC1 A;  3K8N A;  6GSX A;  5ABR A;  4E8E A;  2ALB A;  11GS A;  3VWX A;  1T4Z A;  4PNF A;  1S3A A;  4OD7 A;  4MP4 A;  1GSD A;  1Z7R A;  2VL9 A;  1X5E A;  4KAE A;  1ZYE A;  3LXZ A;  4BVX B;  2IN3 A;  2LQO A;  5IPG A;  1S3R A;  2IME A;  2A2P A;  2H19 A;  4K5R A;  1ZYP A;  2C80 A;  3APQ A;  3I9V 2;  4O92 A;  1AQW A;  1PX6 A;  1A8L A;  20GS A;  2VOC A;  2V41 A;  1VGL A;  1EV4 A;  3PGT A;  3D22 A;  1Y25 A;  4XHM A;  1TOF A;  1WPI A;  3ERG A;  2GLR A;  3QOU A;  2HI7 A;  5HR2 A;  3WGD A;  1XVQ A;  1JZD A;  1TK8 B;  2VM2 A;  4OO5 A;  4N10 A;  5KOX A;  2VL2 A;  5HR3 A;  3US3 A;  3QR6 A;  4POM A;  1HNA A;  2VM1 A;  5CO3 A;  3RDW A;  1SEN A;  4ZB8 A;  2HLS A;  3A5W A;  4JE1 A;  4XRD A;  2HYX A;  1DBY A;  2AAW A;  5IMA A;  4MZW A;  4HU9 A;  5C04 A;  3MDK A;  4K7N A;  4MDC A;  3RHB A;  1A24 A;  3GSS A;  3DWV A;  1IYI A;  4TR1 A;  3TJJ A;  1FB0 A;  5DBQ A;  2YZH A;  3FR6 A;  4KCA A;  1HD2 A;  3C1S A;  1BJX A;  2CVK A;  2DJ1 A;  1M9A A;  4PUF C;  1TKD B;  3Q18 A;  2CZ2 A;  4ZL7 A;  2E2M A;  1FAA A;  5A4U A;  3DVX A;  4GWR A;  4WR4 A;  1T3B A;  3IHG A;  3P2A A;  2V32 A;  4NWY A;  1GUM A;  2B1L A;  1AW9 A;  1B9X C;  1C72 A;  4PUA A;  3CMI A;  4WBJ A;  5ECL B;  5G1L A;  2R2J A;  2GSS A;  2H0I A;  2HZE B;  2IMI A;  2EIR A;  2XBQ A;  2MMO A;  4OFN A;  4DEJ A;  2H1G A;  1WWJ A;  1TK5 B;  4P3Y B;  3HZ8 A;  2D2Z A;  3DYR A;  1R7H A;  2C0E A;  5F0G A;  4JZQ A;  4XRA A;  4XS4 A;  2HSY A;  3TGZ A;  4TVE A;  2WZ9 A;  2HNL A;  1J9B A;  3BCI A;  3FYG A;  4PGT A;  2O89 A;  2JSY A;  3FRC A;  4ECJ A;  2C3N A;  1QK8 A;  2YWO A;  2VUP A;  4BVX A;  1EOH A;  1WE0 A;  3QDN A;  1TI1 A;  1F2E A;  2YJH A;  4LLR A;  2VD0 A;  3VFI A;  4OMV A;  3F63 A;  5IMC A;  4ZBB A; 
#chains in the Genus database with same CATH homology
 3EWL A;  3ZLP A;  1FOV A;  1PMT A;  3HYP A;  3RHC A;  3M9K A;  5CYY A;  4NXI A;  1Y6E A;  1ZMA A;  3GKK A;  1LU4 A;  2ZNM A;  4EF0 A;  2FWH A;  3FK8 A;  1EOG A;  4Q5R A;  2REM A;  3FR9 A;  3F0I A;  4LL4 B;  4HI7 A;  3FZ4 A;  2L59 A;  2JZT A;  3GL5 A;  1V40 A;  2K8V A;  1SL2 B;  3VUR A;  1BED A;  17GS A;  5B7C A;  2GT6 A;  1NM3 A;  4BPY A;  1G7E A;  1GSE A;  4EVM A;  2IJY A;  2H72 A;  2LJR A;  3FKF A;  2JAC A;  1T7P B;  4N30 A;  4PX1 A;  2LS5 A;  1Z5Y E;  3L9V A;  1M0U A;  1WOU A;  3N9J A;  3EIN A;  1K0M A;  1TRW A;  5H5R A;  16GS A;  3VI5 A;  4MJC A;  2P5Q A;  3KGK A;  3EU4 A;  4X0X A;  4NAX A;  1SKS B;  1BX9 A;  3EC3 A;  4X1U A;  1A2M A;  2XPE A;  4MK3 A;  2NVL A;  2X8H A;  4FYB A;  2M46 A;  5BMU A;  5GSS A;  2TRC P;  2PER A;  3Q19 A;  2KP1 A;  3QAW A;  5IM9 A;  3M0F A;  4CDO A;  2V1M A;  4PQI A;  4KDX A;  5KEJ A;  2HSH A;  1X5D A;  3PPU A;  1K3Y A;  1HNC A;  3G7Y A;  3TOT A;  2AHE A;  4GXZ A;  1SD8 A;  1R5P A;  5CRE A;  5HFK A;  3KP8 A;  2H30 A;  3HXS A;  4MCU A;  5DCH A;  1Z6N A;  2X8G A;  1FOH A;  1JZW A;  8GSS A;  2N5B A;  3MSZ A;  2YCD A;  4WET A;  1YJ6 A;  3UJ1 A;  3V1W A;  5ECS A;  2MMZ A;  4KGI A;  2HE3 A;  2I9H A;  1QQ2 A;  1V9W A;  4O5Q A;  2X64 A;  1A2J A;  5AIS A;  3HHV A;  3HY2 A;  3IE3 A;  3MNG A;  5G30 A;  2O8V B;  4MH2 A;  2WDU A;  3IXR A;  2Z9S A;  3LXT A;  3J7Y k;  4TXO A;  3VPT A;  4ILF A;  2CZ3 A;  2FD3 A;  4D73 B;  3SBC A;  9GSS A;  5DAL A;  2F9S A;  5ECI B;  1GNE A;  2B6M A;  2FY6 A;  3GYK A;  3C8E A;  4YKF A;  1TRU A;  4EDZ A;  1FVK A;  4FQU A;  1S3C A;  3ZIT A;  2CX4 A;  2IFQ B;  2GSR A;  1VRS D;  3O76 A;  4YH2 A;  3PIN A;  2DKI A;  2F8A A;  2QGV A;  3P7X A;  4BL7 B;  1X5C A;  3O6T A;  3IC8 A;  3Q6O A;  3TJF A;  4J2F A;  2DC5 A;  3G9B A;  6GSV A;  2H74 A;  4RI7 A;  3H8Q A;  3R3E A;  2H8L A;  3F4T A;  1GTA A;  3H79 A;  5INY A;  4KDY A;  2CAI A;  1AUC A;  3SWL A;  4IGJ A;  4HDE A;  1HYU A;  1WRY A;  2P31 A;  3KJY A;  2L5L A;  4OCE A;  2F51 A;  4JR4 A;  4GSN A;  3KP9 A;  4MJE A;  3HVS A;  3HD5 A;  1X9S B;  2G2Q A;  2R0P A;  2C0F A;  1NHO A;  5A5K A;  3D5J A;  1HQO A;  2O85 A;  3LYK A;  2RLI A;  1RK4 A;  1B4Q A;  1DE2 A;  2LRN A;  1A8Y A;  3ZIV A;  2CV4 A;  1PN0 A;  3VWU A;  1XCC A;  1GH2 A;  2WJU A;  4GLT A;  3C1R A;  2RM5 A;  1MTC A;  2VAF A;  4KSO A;  1R4W A;  3EMP A;  2B1K A;  2QSI A;  5DQY A;  1YQ1 A;  3UOM A;  2CAQ A;  1J08 A;  3QAV A;  5DJL A;  4G9H A;  1KTE A;  2VL2 C;  4KX4 A;  4MAB A;  3TJK A;  3F3R A;  3RPP A;  1GUK A;  2OAD A;  4Z7X A;  2H1B A;  3A2X A;  1U6T A;  2FWG A;  4Z2R A;  5KOW A;  3GX8 A;  2JL4 A;  3U6V A;  3NZN A;  1QXH A;  5B6N A;  3TJB A;  1G7O A;  5GST A;  3CTF A;  2DBC A;  4IJ3 A;  5HR1 A;  2R6K A;  4AF2 A;  5ECK B;  5DAK B;  2WCI A;  3F4R A;  2FA8 A;  4GTU A;  5IIZ A;  3LEF A;  4EL1 A;  3TRX A;  4D73 A;  4HQS A;  4K9Z A;  4KUN A;  2HT9 A;  1EEJ A;  3IPZ A;  4L5L A;  3R2Q A;  3KMN A;  4ML1 A;  4FIW A;  5CRH A;  2B3S A;  5F07 A;  2MZC A;  2MYG A;  2OE1 A;  2NTO A;  1OE7 A;  3PH9 A;  5EVO A;  4GF0 A;  1XVW A;  4WF5 A;  2VL3 A;  4BL7 A;  2R0G A;  2AYT A;  5EPF A;  1XZO A;  2LV3 A;  2LNS A;  1PKW A;  5DQS A;  5ECN B;  1ON4 A;  3F6D A;  2C1Y A;  4EXJ A;  4WXT A;  4OWY A;  4IEL A;  4F9Z A;  5G2Z A;  2ZUP A;  5LD0 A;  4MF6 A;  5D9W A;  4JED A;  2B7K A;  5AIV A;  3VWW A;  5B6M A;  3GST A;  1F3A A;  1SL1 B;  3KM6 A;  1XBS A;  3GIX A;  4EUY A;  5JCW A;  1WMJ A;  1ERW A;  4HU7 A;  1R26 A;  3GV1 A;  1B8X A;  1PD2 1;  4KCE A;  4IN0 A;  5BRT A;  1KEB A;  1O8W A;  4FO5 A;  4Q5F A;  2H6X A;  4EE0 A;  1A23 A;  4DSR A;  1Q98 A;  3F4S A;  4XS4 B;  1DE1 A;  2YZU A;  4TW5 A;  2L5O A;  2EIQ A;  1O6J A;  1TRV A;  3E3E A;  3WGX A;  2VIM A;  2KHP A;  1OKT A;  3GKN A;  3GH6 A;  2BMX A;  2HRK A;  1XW9 A;  6GSY A;  4ECI A;  1GTI A;  3LW9 A;  2IMF A;  2GQM A;  3P8W A;  4IQ1 A;  3S9F A;  3WT1 A;  4WR5 A;  3PR8 A;  3HJO A;  1XWG A;  1BYE A;  5LCZ A;  2HRF A;  1GSQ A;  6GST A;  2PN8 A;  4I5Q A;  4ICY A;  4YAV A;  4ZB9 A;  4PQ1 A;  3WYW A;  1OC9 A;  1YF0 A;  2VCT A;  5AIX A;  2GSQ A;  3NOF A;  1XWB A;  3TJG A;  4F82 A;  1YY7 A;  3GKM A;  2EIO A;  3MWH A;  2R3X A;  3FR3 A;  5DAK A;  1E6B A;  2GZY A;  4MZC A;  2CVB A;  5CNW A;  2VCZ A;  5H5S A;  5EY6 A;  4EIP A;  4AJ7 A;  1TDI A;  2OA7 A;  1U88 A;  4IQA A;  3GL3 A;  4CY6 A;  5IMZ A;  3QMX A;  2H6Z A;  1BAY A;  1EWX A;  5A4V A;  1GLQ A;  3IAM 2;  2M80 A;  5J5N A;  2PVQ A;  1ILO A;  1WIK A;  3C7M A;  2A4V A;  1YDK A;  2PBJ A;  4MJA A;  1YEX A;  1M2A A;  4NHZ A;  2WGR A;  4YQM A;  5ECR B;  1RW1 A;  2P5R A;  4POK A;  3UEM A;  1O8X A;  3CTG A;  4CHS A;  3ZZX A;  3UBK A;  1TRS A;  3KTL A;  2I1U A;  4Z2T A;  2BTO T;  3IAS 2;  4NMU A;  3FEU A;  3RAZ A;  2H76 A;  5FT3 A;  3HA9 A;  1ZYQ B;  3BD2 A;  6GSS A;  5D9T A;  1G0T A;  3LQ7 A;  2HRA A;  4Q5N A;  2J9H A;  3MIX A;  3D21 A;  1TI3 A;  3EYT A;  2YJ7 A;  3HKR A;  3L9S A;  3FZ5 A;  1K0C A;  1USB A;  1OC3 A;  3QFB C;  5ELG A;  3L9U A;  2JZR A;  2LEG A;  3IK7 A;  4J56 E;  4JRR A;  1EV9 A;  1SJ6 A;  4A5P A;  1I9D A;  5AGY A;  4G0K A;  4K5S A;  5FHI A;  4K2X A;  3ZRD A;  3ZL5 A;  3JCM L;  2XPD A;  1JZO A;  2R0C A;  1ABA A;  4NV5 A;  2YNX A;  4MPG A;  2CA8 A;  2FA4 A;  3KH9 A;  1EZK A;  2XBI A;  5F8B A;  3UMA A;  1DUG A;  2H0H A;  2VLU A;  4TXO B;  1SYR A;  3KD0 A;  1Z3E A;  1TW9 A;  3CBU A;  2X4A A;  5JWR B;  2HZF A;  5DAL B;  3ZVJ D;  1VF4 A;  2WUL A;  1J0F A;  2KLX A;  2LRT A;  3L4N A;  1G6W A;  1GSS A;  2E0Q A;  5CRD A;  3HJP A;  1DSB A;  4WKW A;  1K0B A;  2HSM A;  5DCG A;  1VF1 A;  1FG4 A;  2FUG 2;  1V57 A;  2AB6 A;  4MMM A;  1SK2 A;  2GQL A;  1OC8 A;  4V2L A;  4V2M A;  1G6Y A;  3MYD A;  3ZML A;  1UA5 A;  1M99 A;  3ZFL A;  3GKX A;  1CQG A;  4IP1 A;  4IW9 A;  3TCO A;  4ECC A;  2UZ8 A;  1RQM A;  2V6K A;  2OE3 A;  1PSQ A;  1JLW A;  4TXV A;  3A3T A;  1BG5 A;  1JZR A;  2QC7 A;  4XS1 A;  5G1K A;  18GS A;  2RUE A;  4TKY A;  2H1A A;  3WT2 A;  2PGT A;  5J41 A;  3LSZ A;  4HEA 2;  1WP0 A;  2DML A;  4I6X A;  3MAK A;  2DJ3 A;  2VLT A;  4HOJ A;  5GAP D;  2XC2 A;  1MD4 A;  4NPB A;  3TB2 A;  3ZFB A;  4RUV A;  5J9B A;  3CSJ A;  2YWI A;  2IL3 A;  3LFL A;  3J7Y b;  4IKH A;  2I81 A;  2OBI A;  2YWM A;  2PPT A;  3VLN A;  3DEX A;  2AJQ B;  5ECP B;  2FLS A;  1THO A;  3LWA A;  5D93 A;  1U3I A;  3P90 A;  2ON5 A;  4QL7 A;  1F3B A;  1U87 A;  2JAD A;  2L6D A;  1NSW A;  1F6M C;  1XOB A;  4DVC A;  4POL A;  1ST9 A;  5A4W A;  5HFI A;  2FWE A;  1XWC A;  2O87 A;  4G10 A;  3W6G A;  3F3Q A;  4ZL8 A;  1V58 A;  3ZIJ A;  1OKD A;  3DXB A;  4KE3 A;  1IYH A;  1XIY A;  2KP2 A;  2H71 A;  4TR3 A;  1XXU A;  1M2D A;  1PX7 A;  4KDU A;  5D73 A;  1T00 A;  1SK0 A;  4EO3 A;  1GTB A;  2A2S A;  2YWN A;  3EUR A;  3GNJ A;  4JU5 A;  5D9X A;  1BQ7 A;  4CY8 A;  3M9J A;  1H75 A;  4ZL9 A;  3VK9 A;  3F6F A;  1FVJ A;  1JFU A;  2N5F A;  2PVO C;  4IVF A;  3LOR A;  4I8B A;  2DJJ A;  4EKZ A;  1K0O A;  2IMD A;  2ZCT A;  2K9F A;  2IPA A;  2J23 A;  3HVV A;  4USS A;  6GSW A;  4RI6 A;  3BCK A;  5C00 A;  3TKS A;  3KZQ A;  5DJM A;  2YOI A;  4MJB A;  2C3T A;  3HCZ A;  4O5R A;  7GSS A;  4ZIJ A;  2YV7 A;  4L8E A;  3FW2 A;  3IR4 A;  1WJK A;  4E8H A;  1A0R P;  2FHE A;  1H4O A;  2QA2 A;  2CQ9 A;  2RM6 A;  2TIR A;  2DMM A;  1YKA A;  2X49 A;  2B7J A;  2LST A;  1M9B A;  4HZ4 A;  2YN1 A;  3AY8 A;  3TUE A;  5ECH B;  3KXO A;  2PU9 C;  3GUR A;  4GST A;  4HJM A;  4GCI A;  4AJ8 A;  3Q74 A;  4Q5Q A;  3GFK A;  4CW9 A;  3D4M A;  5CRG A;  3GX0 A;  4AGS A;  3HVX A;  3D0Z A;  5D9V A;  4I2T A;  2DSA A;  3DML A;  1NW2 A;  1NHY A;  2FGX A;  5HFG A;  3TDG A;  3LGC A;  4TN8 A;  3GTU A;  1OC9 B;  2B5X A;  4F0B A;  3IV4 A;  2L4Q A;  4DSS B;  2GZZ A;  2H01 A;  4ML6 A;  3LG6 A;  3DD3 A;  2OJL A;  1TU8 A;  5GZZ B;  2IIY A;  3ED3 A;  2GGT A;  5IQY A;  4QQ7 A;  3L0H A;  1QMV A;  1OVN A;  2JZS A;  5J4U A;  2GST A;  2AV4 A;  2L57 A;  1YKC A;  4O32 A;  5ENU A;  2ON7 A;  1KBN A;  4V2N A;  2B5Y A;  2VCX A;  1U3A A;  5ECO B;  4N11 A;  3GMF A;  3APS A;  3FZA A;  1FHE A;  4POB A;  2GDR A;  5JCU A;  1K0N A;  5DVB A;  1SJZ A;  1CQH A;  4HZ2 A;  5CP1 A;  4BWQ A;  1O7U A;  2WFC A;  1FW1 A;  3U5R E;  4IBP A;  1TJD A;  4EDY A;  3W8J A;  4IS0 A;  1T1V A;  1OE8 A;  2GQK A;  3CSH A;  2PMT A;  3CXG A;  4PTS A;  1XOA A;  1I5G A;  3TKR A;  3C71 A;  1EP7 A;  4OCF A;  1SYX A;  10GS A;  2C0D A;  2VO4 A;  4I97 A;  3VPQ A;  1SKR B;  4JBB A;  3GUS A;  13GS A;  1K0D A;  2H1D A;  4XS6 A;  3I69 A;  3FZ9 A;  5JWQ B;  5IMV A;  3F8U A;  4G0L A;  1Z6M A;  3GH9 A;  4IJI A;  4GQF A;  4PQH A;  2VLV A;  4Z2U A;  3FHK A;  5D8I A;  1GRX A;  3DKS A;  3TKP A;  4ZB6 A;  3NIV A;  1THX A;  3HZ4 A;  3A2W A;  1Z7P A;  1ZGN A;  2NDO A;  1K3O A;  1AXD A;  1ERT A;  3APO A;  3DGQ A;  4DSS A;  1A0F A;  3EPT A;  5F05 A;  5ECQ B;  2FWF A;  3WGE A;  4K0G A;  2JU5 A;  5G5F A;  3VI7 A;  5HR0 A;  3KIJ A;  5G5E A;  2LJA A;  1GTU A;  4BWS A;  1ACV A;  5D96 A;  4LMV A;  1O85 A;  3O3T A;  1T8E B;  5EL8 A;  4YKG A;  1W4V A;  1ZL9 A;  5IMF A;  5ID2 A;  1ERV A;  1QGV A;  3DVW A;  1ZZY A;  2H6Y A;  2VD1 A;  1R5A A;  1PA3 A;  1YZX A;  3ISO A;  1YF1 A;  1SU9 A;  3UVH A;  1TK0 B;  3QAG A;  4AJ6 A;  2OBK A;  2GS3 A;  4WEY A;  3IOS A;  2WS2 A;  1ERU A;  5LNK e;  19GS A;  1GSF A;  1VF2 A;  2DLX A;  1YEP A;  4FYU A;  1PRX A;  2MMA A;  2DJ2 A;  14GS A;  4KF9 A;  3UAP A;  4K2D A;  1MDJ A;  3ME8 A;  2ES7 A;  3N5O A;  1GNW A;  4GSS A;  2LQQ A;  2GZP A;  1TTZ A;  3EVI A;  5CRW A;  3ZYW A;  4MLY A;  3I43 A;  2H70 A;  1QFN A;  1GLP A;  4ZIL A;  2XHF A;  1EGO A;  2QKE A;  5B8B A;  4MNN A;  1X0R A;  2FNO A;  3GRX A;  1E2Y A;  2G0F A;  4IHU A;  1JLV A;  1F9M A;  3FMW A;  4FH8 A;  3LJR A;  5JCG A;  1OAZ A;  1PN9 A;  4RQR A;  4YQU A;  5KN0 A;  2GTU A;  4L0U A;  4ZBD A;  2C4J A;  4HUA A;  1GWC A;  1EEM A;  4OO4 A;  1GUL A;  1PL2 A;  2IWT A;  5IOX A;  3VWV A;  4GRF A;  3HDC A;  1LJR A;  1O73 A;  4F03 A;  1UVZ A;  2VCV A;  1JHB A;  4O7H A;  3TKS C;  2CX3 A;  3KEB A;  1XFL A;  4DSQ A;  4J57 E;  4ISD A;  2V2G A;  5L71 A;  4L0W A;  2FCH A;  3A2V A;  2R5G A;  4ACS A;  4G2E A;  1GUH A;  2GT5 A;  4WBR D;  2NBS A;  2LJK A;  3IRA A;  2R37 A;  1XWK A;  4KA0 A;  3CSI A;  1ZOF A;  3CRT A;  1AQV A;  3LYP A;  1XPV A;  2LNT A;  4K0N A;  5IMD A;  4PUR A;  3KTB A;  2KUC A;  1GL8 A;  1X9M B;  1XW6 A;  3TOU A;  2AUV A;  5DDL A;  4I2U A;  1PL1 A;  3UL3 A;  4BVY B;  2DIY A;  4MF7 A;  1SL0 B;  2DJ0 A;  3QCP A;  1V98 A;  1K0A A;  4MH3 A;  2H73 A;  3GHA A;  5IO2 A;  1ML6 A;  3ERF A;  2C8U A;  2YAN A;  4XIH A;  4N0V A;  1SJI A;  2OE0 A;  4XCS A;  2VCW A;  3UVT A;  3HJM A;  5JWO B;  2X8C A;  5ELA A;  5IO0 A;  2VCQ A;  1F37 A;  1HNB A;  3IHQ A;  1M7T A;  3CYN A;  4JR6 A;  4MA9 A;  4ZXG A;  3QFA C;  2H0G A;  5E59 A;  2LRC A;  2LTK A;  4ZBA A;  3TRQ A;  2IMK A;  2HZE A;  1AIU A;  2X99 A;  3ME7 A;  2QA1 A;  2WB9 A;  5E4W A;  3GTU B;  3EE2 A;  1SKW B;  2LUS A;  2RUF A;  2DJK A;  1A2L A;  2F3M A;  4KW6 A;  1GSU A;  4LA1 A;  4ULX A;  2K6V A;  3BOA A;  1MDI A;  2TRX A;  2YV9 A;  2PWJ A;  1B4P A;  4OFT A;  3OR5 A;  4HJ2 A;  2V6O A;  3A5I A;  3ZTL A;  1TP9 A;  4KH7 A;  4X43 A;  2C0G A;  1PQN A;  3GN3 A;  1B48 A;  4HQZ A;  3KCM A;  1ZYN A;  22GS A;  1KNG A;  3E9J B;  1Q4J A;  1XW5 A;  4K7O A;  2L4C A;  4TR4 A;  4X4J A;  1TXX A;  4N0Z A;  2L6C A;  3F9U A;  4MF5 A;  3FY7 A;  1XWA A;  3M3M A;  3D4T A;  4O5U A;  5FWG A;  2K18 A;  3EMX A;  5F06 A;  4IP6 A;  2B5E A;  2M72 A;  2I3Y A;  1URM A;  3BJ5 A;  3GA4 A;  2NPB A;  2OKA A;  3RBT A;  4F2I A;  1LBK A;  2H75 A;  2EC4 A;  5KN3 A;  3C73 A;  4BVY A;  3I6A A;  4BA7 A;  1TU7 A;  3ERW A;  2HFD A;  2CVD A;  4V1A p;  2A4H A;  2HXK A;  2LKU A;  3IDV A;  4L5O A;  4OFM A;  4GQC A;  2N5A A;  1FB6 A;  1MDK A;  3H1N A;  3IK9 A;  4MPF A;  4WF4 A;  2PUK C;  2WRT A;  5GAN D;  3UIW A;  3TKQ A;  4G0I A;  2MBT A;  5ECM B;  3W8S A;  2O7K A;  1PKZ A;  1N2A A;  4KSM A;  3UBL A;  4K8M A;  5H5Q A;  3D6I A;  1B9Y C;  2MMN A;  4EC0 A;  1AAZ A;  2HRN A;  4QL9 A;  4KB3 A;  1EP8 A;  4PXO A;  1O81 A;  1S3D A;  4YAP A;  6GSU A;  1QUW A;  3IA1 A;  2RII A;  2E7P A;  2A2R A;  3EU3 A;  2K8S A;  1EGR A;  2BJX A;  2C3Q A;  3QPM A;  3H93 A;  4MZB A;  2I4A A;  4KND A;  4LL1 B;  4V1A g;  3TRP A;  5HQP A;  1M2B A;  2P0G A;  3UAR A;  2F8F A;  3E0U A;  3ZRE A;  2DKH A;  3DIE A;  4K7I A;  1VF3 A;  4NHW A;  3IC4 A;  2E2G A;  4NV2 A;  3KMO A;  5ID2 B;  5J3R A;  12GS A;  3CRU A;  1AQX A;  1N8J A;  3M1G A;  5AN1 A;  1MD3 A;  1UC7 A;  4RQX A;  2GVP A;  3BBY A;  5KN2 A;  3KH7 A;  4TR0 A;  1SD9 A;  1X9W B;  4LMW A;  1V2A A;  5J9C A;  3IBH A;  2IFQ A;  2KOK A;  3DRN A;  3WD6 A;  1W89 A;  4EIQ A;  1ZCP A;  3ZVJ A;  1GP1 A;  1FO5 A;  4K1F A;  4HS1 A;  4ID0 A;  2H66 A;  2DIZ A;  5KN1 A;  4ECB A;  3RPN A;  4PNG A;  5G31 A;  1SK1 A;  4TOP A;  4TR1 B;  4TRX A;  2YP6 A;  2CT6 A;  5IOW A;  1GSY A;  4G19 A;  2R4V A;  1T4Y A;  5B8A A;  1OYJ A;  2YPM A;  3L78 A;  3H4K A;  1MEK A;  3G7J A;  2OAC A;  4FYC A;  3TKS E;  1UN2 A;  4YQV A;  5IPH A;  3ZMK A;  2JSZ A;  4F0C A;  2MBS A;  3G7I A;  4K6X A;  5COH A;  1PGT A;  1Z9H A;  4XTS A;  5CAX A;  3M8N A;  3QD9 A;  4H86 A;  1K3L A;  1AC1 A;  3K8N A;  6GSX A;  5ABR A;  4E8E A;  2ALB A;  11GS A;  3VWX A;  1T4Z A;  4PNF A;  1S3A A;  4OD7 A;  4MP4 A;  1GSD A;  1Z7R A;  2VL9 A;  1X5E A;  4KAE A;  1ZYE A;  3LXZ A;  4BVX B;  2IN3 A;  2LQO A;  5IPG A;  2IME A;  2A2P A;  2H19 A;  4K5R A;  1ZYP A;  2C80 A;  3APQ A;  3I9V 2;  4O92 A;  1AQW A;  1PX6 A;  1A8L A;  20GS A;  2VOC A;  2V41 A;  1VGL A;  1EV4 A;  3PGT A;  3D22 A;  1Y25 A;  4XHM A;  1TOF A;  1WPI A;  3ERG A;  2GLR A;  3QOU A;  2HI7 A;  5HR2 A;  3WGD A;  1XVQ A;  1JZD A;  1TK8 B;  2VM2 A;  4OO5 A;  4N10 A;  5KOX A;  2VL2 A;  5HR3 A;  3US3 A;  3QR6 A;  4POM A;  1HNA A;  2VM1 A;  5CO3 A;  3RDW A;  1SEN A;  4ZB8 A;  2HLS A;  3A5W A;  4JE1 A;  4XRD A;  2HYX A;  1DBY A;  2AAW A;  5IMA A;  4MZW A;  4HU9 A;  5C04 A;  3MDK A;  4K7N A;  4MDC A;  3RHB A;  1A24 A;  3GSS A;  3DWV A;  1IYI A;  4TR1 A;  3TJJ A;  1FB0 A;  5DBQ A;  2YZH A;  3FR6 A;  4KCA A;  1HD2 A;  3C1S A;  1BJX A;  2CVK A;  2DJ1 A;  1M9A A;  4PUF C;  1TKD B;  3Q18 A;  2CZ2 A;  4ZL7 A;  2E2M A;  1FAA A;  5A4U A;  3DVX A;  4GWR A;  4WR4 A;  1T3B A;  3IHG A;  3P2A A;  2V32 A;  4NWY A;  1GUM A;  2B1L A;  1AW9 A;  1B9X C;  1C72 A;  4PUA A;  3CMI A;  4WBJ A;  5ECL B;  5G1L A;  2R2J A;  2GSS A;  2H0I A;  2HZE B;  2IMI A;  2EIR A;  2XBQ A;  2MMO A;  4OFN A;  4DEJ A;  2H1G A;  1WWJ A;  1TK5 B;  4P3Y B;  3HZ8 A;  2D2Z A;  3DYR A;  1R7H A;  2C0E A;  5F0G A;  4JZQ A;  4XRA A;  4XS4 A;  2HSY A;  3TGZ A;  4TVE A;  2WZ9 A;  2HNL A;  1J9B A;  3BCI A;  3FYG A;  4PGT A;  2O89 A;  2JSY A;  3FRC A;  4ECJ A;  2C3N A;  1QK8 A;  2YWO A;  2VUP A;  4BVX A;  1EOH A;  1WE0 A;  3QDN A;  1TI1 A;  1F2E A;  2YJH A;  4LLR A;  2VD0 A;  3VFI A;  4OMV A;  3F63 A;  5IMC A;  4ZBB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...