1A8LA

Protein disulfide oxidoreductase from archaeon pyrococcus furiosus
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
226
structure length
226
Chain Sequence
MGLISDADKKVIKEEFFSKMVNPVKLIVFVRKDHCQYCDQLKQLVQELSELTDKLSYEIVDFDTPEGKELAKRYRIDRAPATTITQDGKDFGVRYFGLPAGHEFAAFLEDIVDVSREETNLMDETKQAIRNIDQDVRILVFVTPTCPYCPLAVRMAHKFAIENTKAGKGKILGDMVEAIEYPEWADQYNVMAVPKIVIQVNGEDRVEFEGAYPEKMFLEKLLSALS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN DISULFIDE OXIDOREDUCTASE
publication title A protein disulfide oxidoreductase from the archaeon Pyrococcus furiosus contains two thioredoxin fold units.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Oxidoreductase
total genus 83
structure length 226
sequence length 226
ec nomenclature
pdb deposition date 1998-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13192 Thioredoxin_3 Thioredoxin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1a8lA01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1a8lA02
3LGCA 2TRCP 16GSA 2XBIA 2QKEA 1A2JA 3EURA 2MBTA 1A24A 3NIVA 4PNGA 1B9YC 2VL3A 3KP9A 3HVXA 4PGTA 2PVOC 1F3BA 2IMFA 2PWJA 2LKUA 1WOUA 5ABRA 2IWTA 2KP2A 3VPTA 3ZIVA 1T8EB 1TRSA 3N9JA 4IJ3A 2VD0A 4OWYA 2P0GA 2B6MA 3C71A 1X9WB 1Q4JA 2C0FA 4I6XA 2OE0A 3RPNA 4EDYA 5F8BA 1J08A 2I1UA 2H1AA 3UVHA 1B48A 2MMZA 2LSTA 3ZYWA 3BCKA 6GSVA 1Z7RA 3P7XA 3C8EA 1YZXA 4HDEA 1EEJA 4GF0A 4PUFC 4OFTA 2CAQA 4TR4A 5ECLB 5LD0A 4PURA 3WT2A 1UN2A 3F0IA 5HFKA 2GSRA 1SK1A 1K0AA 3DMLA 3KD0A 1FO5A 5FWGA 3ZL5A 1TK5B 1ZMAA 4DVCA 1VF3A 1SD9A 1TRUA 2RIIA 3Q19A 4WEYA 3CMIA 1TU7A 3ZTLA 3ZFBA 1MDKA 4CDOA 3VURA 3QDNA 2GT6A 3L9VA 1J0FA 4KX4A 2F9SA 5B8AA 2R6KA 5DDLA 1XPVA 1FHEA 2H6XA 1ZYEA 3KP8A 2H6YA 1XIYA 2LNSA 2VLUA 1GSEA 4MK3A 4V1Ap 2YZUA 3Q74A 4K2DA 4NXIA 1AC1A 1GLQA 4GQFA 1A8YA 2FWGA 2L6CA 1FVJA 4E8EA 1V57A 1FAAA 1Z6NA 1V40A 3TRXA 2LEGA 4ZBDA 3UIWA 3D4MA 3C73A 2F3MA 2VOCA 3FW2A 2R5GA 1TXXA 3FEUA 4EXJA 1NHYA 4K6XA 3E9JB 1ABAA 2H66A 5JCUA 4TRXA 4MCUA 2ALBA 3TRPA 4OMVA 5ENUA 4WETA 5DVBA 1OKDA 5ECQB 2WGRA 3G7IA 4TXOA 1PKWA 1OC9A 3ZVJA 17GSA 5G5FA 1XVQA 1JLVA 1G7EA 1HNAA 1SL1B 3IK9A 1V2AA 3EU4A 3UARA 3SWLA 5IMVA 3GHAA 1EP8A 1XWAA 4K8MA 4NHWA 1PSQA 1SK2A 2VAFA 4ZL7A 3I43A 2VIMA 5G2ZA 3S9FA 1XWBA 3OR5A 1FG4A 3TGZA 3H8QA 5IOXA 5ID2B 1M7TA 3DWVA 1TU8A 1JLWA 4HJ2A 4XRDA 1G6YA 2VCZA 3CBUA 5H5SA 3O76A 3MSZA 5J4UA 3GX8A 2IFQA 2VCWA 2V6OA 4N0ZA 3P2AA 1OE8A 6GSYA 2PPTA 1WE0A 1HD2A 1I5GA 6GSTA 1YEPA 5HR3A 1B9XC 3GN3A 3DXBA 1THOA 3DVWA 4KW6A 5CAXA 2RM5A 3TRQA 1O7UA 4ECJA 4BWQA 4GRFA 2B5EA 3C1SA 5IIZA 3K8NA 3LWAA 1K0MA 6GSSA 4MH2A 3CSHA 2GT5A 1NM3A 4IW9A 3IPZA 1PGTA 1SKWB 4IBPA 2DC5A 2YV9A 2YV7A 5CO3A 1T3BA 3GKMA 2DIYA 1UC7A 3G9BA 1FB0A 4XRAA 4G19A 2JZTA 1U3IA 4ECIA 1VRSD 1TJDA 2ON7A 4JBBA 3IAS2 2QSIA 1EV4A 4LL1B 3HVSA 4V1Ag 5CNWA 2H6ZA 2FY6A 1CQHA 1YEXA 2DBCA 2PBJA 4AGSA 4XS4A 3L9SA 1AXDA 1PD21 4HUAA 5G5EA 4E8HA 3PINA 1OE7A 2WZ9A 4XS1A 2C0DA 2AJQB 1XXUA 5JWOB 3GH9A 3LFLA 1C72A 4AJ6A 2N5BA 1OC8A 1X5CA 2L4QA 2DLXA 3F9UA 2L5OA 5IMDA 5IMZA 1X0RA 3IA1A 5ECMB 2H01A 2FGXA 2E2GA 4OFMA 5B7CA 1M2DA 2CX4A 2C0EA 1E2YA 5D9WA 22GSA 2GS3A 2J9HA 2GZZA 1NSWA 2HZFA 2QC7A 4K7IA 1O6JA 4KDXA 3KTLA 1DUGA 2HNLA 5F05A 2RM6A 4TXOB 2OJLA 2WCIA 2KOKA 1LU4A 1OC9B 3KJYA 2RUEA 2ES7A 2X64A 5DJLA 2R2JA 2WJUA 2C3TA 3IRAA 4JR6A 3L78A 1JZOA 4MJAA 3O6TA 3A2VA 2IIYA 3LQ7A 1SKSB 3IDVA 4HJMA 4JE1A 1QMVA 2MZCA 3HJPA 3LORA 2JL4A 3LEFA 2JZSA 2XC2A 1PN9A 1V58A 4XTSA 4GSTA 2DJJA 3DGQA 3L4NA 3ZZXA 2L6DA 1YF0A 5G1KA 3KM6A 4NPBA 3UBKA 3V1WA 5CYYA 2IFQB 3US3A 1A0RP 2HSHA 5JCGA 4IP6A 2X99A 9GSSA 3EU3A 2YP6A 3HHVA 1YF1A 5D9XA 1A8LA 2GZPA 5IMAA 2FNOA 1ZYQB 1GUMA 1XZOA 2JADA 1GSQA 1ON4A 3IHQA 3UL3A 3QCPA 4YAPA 5HFIA 4OD7A 2DJKA 3GKXA 4LMWA 3UBLA 5CRHA 2B5YA 3APOA 2LJKA 2FD3A 4L8EA 5J41A 4H86A 5D9VA 3QAGA 2N5FA 2CV4A 2XHFA 2P31A 3VPQA 3GSSA 2GSTA 1SYRA 1V98A 2CVKA 3TJKA 2IL3A 2LQOA 2VUPA 3GTUA 1H75A 1GULA 4EVMA 2VD1A 4GSSA 1K3YA 3MAKA 3IV4A 1SD8A 4ZL8A 4KCEA 6GSWA 4JR4A 4BL7A 3LG6A 1GUKA 1SJ6A 2YPMA 4FH8A 3LSZA 2HSYA 4XS4B 5IPHA 1GNEA 2YCDA 2HLSA 3M0FA 1TRVA 4O92A 2LNTA 3QOUA 3A2XA 1F9MA 3PGTA 2O85A 1CQGA 3M8NA 3TKSA 2NDOA 4ZBBA 4PXOA 3W8JA 3TDGA 3EWLA 2HFDA 4NWYA 3D4TA 5CRWA 4HQZA 4ILFA 5H5RA 2RUFA 1PX7A 3ZMKA 3HDCA 2WULA 2R37A 2F51A 1DE1A 1XW5A 4OO5A 1ZCPA 1Z5YE 3HYPA 11GSA 5AIVA 2FWEA 2GSQA 1YKAA 5IMCA 1M2AA 3JCML 2C1YA 2HXKA 3TJBA 1EEMA 1FOVA 2VL9A 4KSMA 1XWGA 3AY8A 1BYEA 3VFIA 2JSYA 3KCMA 4GCIA 4ID0A 3HZ8A 1N8JA 4HOJA 1DSBA 1K3OA 4AJ8A 5B8BA 1QFNA 4KB3A 4Q5QA 1BJXA 2VL2A 1QUWA 1R5PA 2VM1A 3FR3A 3IOSA 2G2QA 3BBYA 5IMFA 1N2AA 3HY2A 5A4UA 5F06A 1HYUA 2QGVA 2IMDA 1Z3EA 1TKDB 3D22A 4ZBAA 4JU5A 3WGDA 2PERA 2B7KA 1X5EA 2H1DA 3TOTA 3D21A 2H71A 3G7YA 4HU7A 1YY7A 2CA8A 3IK7A 4IJIA 1O85A 3J7Yk 1R26A 4CHSA 2VCXA 5ECHB 1URMA 1F6MC 1PMTA 5A4WA 4PNFA 3KMNA 1HQOA 4F2IA 2LUSA 1RK4A 4KDYA 4BPYA 2LRCA 4KGIA 1JZWA 3QFBC 4LLRA 2K18A 1T4ZA 2I4AA 2M72A 4WBJA 7GSSA 2FCHA 3DD3A 3DEXA 4N30A 3LXZA 1QXHA 1TW9A 3F3RA 1BG5A 2I3YA 4IVFA 2GQKA 3CRUA 4MPFA 3WYWA 3QD9A 2X8HA 2E7PA 3GYKA 3VWXA 2RLIA 1ERTA 1GWCA 4GSNA 4GWRA 4J56E 3DYRA 4OO4A 3C7MA 3ZRDA 2WDUA 3QFAC 3ZFLA 2NBSA 4YAVA 4K1FA 5AIXA 2GGTA 1K0DA 3GTUB 2P5QA 1S3DA 4GLTA 3TJGA 4K0GA 2AB6A 3M3MA 2TRXA 1MD3A 1A0FA 3HVVA 1OVNA 4HQSA 2O8VB 2FLSA 1VF2A 2OKAA 2MMAA 2K8VA 1SENA 4HEA2 2YWOA 4K7NA 2HT9A 1XFLA 5D8IA 3FK8A 4DSRA 3ME8A 4WBRD 2LJRA 2LJAA 4KNDA 1LBKA 1B8XA 2O87A 5GSSA 4POLA 1YJ6A 3GURA 2NPBA 2CVDA 5FT3A 2GZYA 4MPGA 1SJIA 4IQAA 4KSOA 4ACSA 2FA8A 5EY6A 1ML6A 4IELA 2VCVA 1Z6MA 4MZCA 5IM9A 2IMEA 4AF2A 2CT6A 1XCCA 3HXSA 3UEMA 1NHOA 5EL8A 1QQ2A 2MYGA 3TJFA 5ECNB 3F3QA 4NMUA 3RBTA 2AAWA 1JFUA 3KH7A 1XOAA 4N11A 2H19A 3ED3A 2B7JA 1GTUA 2V2GA 3HJMA 3A3TA 1K3LA 2CZ3A 4I97A 1GL8A 1EP7A 3GX0A 3F8UA 5GAPD 3F63A 2F8AA 1EZKA 1AUCA 2O7KA 4LMVA 1GSUA 4IHUA 3PH9A 5C04A 4ECBA 4GXZA 1GSFA 4I2UA 3VI5A 5HQPA 1O8XA 4JEDA 1W89A 3M9JA 4KE3A 5IQYA 3KH9A 4DSSA 4JRRA 3A5WA 2ZUPA 5D96A 14GSA 4FYUA 2REMA 1FW1A 4NV2A 4KCAA 2JSZA 2WFCA 4MABA 4GQCA 1K0CA 1K0BA 2VM2A 3FZAA 1ZL9A 4LL4B 5D73A 1U87A 4K9ZA 4I2TA 3F6FA 2WS2A 5J9CA 2YWIA 4Z7XA 5IOWA 1EOGA 1WRYA 1DBYA 1HNBA 2H76A 3MWHA 4L0UA 1IYIA 1B4QA 2PN8A 2GDRA 1TRWA 2E2MA 2X8GA 2IMKA 3QR6A 4Q5NA 4MF7A 3GIXA 4TW5A 1ST9A 4O5RA 2GQLA 4AJ7A 2LRNA 1ZGNA 5GAND 2C3QA 4G2EA 4MH3A 2YWNA 5DBQA 1X5DA 3N5OA 2C4JA 3CSIA 5D9TA 2OACA 3FHKA 2CQ9A 2FWHA 4MJCA 5ELGA 4CW9A 3FKFA 3M1GA 5DCGA 4QQ7A 3E3EA 4NHZA 4MLYA 4V2LA 2H75A 3CTFA 1A2MA 3FZ5A 1KEBA 4KAEA 1XBSA 1Z7PA 4ZIJA 4MP4A 2VLVA 1QK8A 1RQMA 4TVEA 3EMXA 10GSA 3DIEA 1TK8B 3TUEA 3D0ZA 5E59A 2LV3A 4WR5A 4ZXGA 3KTBA 4RI7A 1AIUA 3I9V2 4EKZA 5CP1A 1YKCA 4OCFA 2ZCTA 4QL7A 2LTKA 2YZHA 1SKRB 4MZWA 5COHA 5KEJA 2A4VA 1MEKA 3ZVJD 2NVLA 4IN0A 2CAIA 3WGXA 4TR1A 3KMOA 1Q98A 5GSTA 2H73A 1FB6A 4BVXA 2BTOT 3KGKA 5DCHA 2MBSA 4PQIA 5EPFA 1TDIA 2OE3A 5G31A 3U5RE 1K0NA 1AW9A 3R2QA 2L4CA 5GZZB 3TOUA 3ZMLA 1AQXA 3UVTA 2YNXA 4N10A 3DRNA 1IYHA 2OBIA 1ILOA 3HKRA 1PL2A 2C3NA 1TTZA 2G0FA 3ERGA 4WXTA 2OE1A 1SU9A 3FR9A 1WMJA 3F4TA 1EV9A 5J3RA 1M0UA 3GH6A 4G9HA 4IQ1A 4D73A 1OYJA 1T1VA 5EVOA 4WKWA 2GLRA 2YWMA 3TB2A 2V1MA 1GRXA 1EOHA 1WP0A 1TP9A 2DJ2A 2DJ1A 1BEDA 5KN3A 1S3CA 4YQUA 2TIRA 4MMMA 2JU5A 3QAWA 5JCWA 4MA9A 2JACA 3GV1A 3GFKA 5DJMA 3CXGA 4DSSB 4TKYA 1BX9A 1H4OA 4X43A 5F07A 3GMFA 2VO4A 4ULXA 4WF4A 2YN1A 2AV4A 1OKTA 1M9BA 2H30A 1K0OA 2H1BA 2PMTA 3EVIA 3J7Yb 3VWVA 2CVBA 5LCZA 20GSA 4L5OA 5INYA 2FHEA 3IBHA 5H5QA 3IR4A 1KNGA 4RUVA 2H72A 13GSA 1O73A 1OC3A 2HE3A 4TXVA 4Q5FA 4TN8A 4G10A 2OBKA 4MF5A 4IKHA 2XPEA 1UA5A 2MMOA 4POKA 3EC3A 4RI6A 1UVZA 1EGRA 4DSQA 3UJ1A 2F8FA 1T00A 3GSTA 5E4WA 1XWCA 2A2RA 2DMMA 5ECIB 3TCOA 3F4RA 3PR8A 1AAZA 4EE0A 2O89A 1ZOFA 2DMLA 1GNWA 3GL3A 3BD2A 2N5AA 4IP1A 2H1GA 4EL1A 4ML6A 3C1RA 3CTGA 1GSDA 3TKSC 2AYTA 3Q18A 5KN0A 4LA1A 2LS5A 19GSA 3VI7A 1WIKA 2B1KA 1DE2A 3APQA 3D6IA 4YQMA 1R4WA 3HZ4A 4O7HA 3QMXA 3GKNA 3GKKA 2H74A 5LNKe 2AUVA 1U88A 5B6NA 4EDZA 5AISA 1OAZA 4TR1B 1BQ7A 1R5AA 4WR4A 2L5LA 5DQYA 3TKRA 5DALA 5ELAA 2KUCA 4XHMA 4ZB9A 4F0CA 1AQWA 4GTUA 2H0HA 2HZEA 1O8WA 3P8WA 1ERWA 1PL1A 3U6VA 4V2MA 2EC4A 3ERWA 3GRXA 2VL2C 1QGVA 2H8LA 3I69A 3W6GA 3APSA 1JHBA 5D93A 1GTAA 3UOMA 3LJRA 5ECPB 2GQMA 1ERUA 5G1LA 1G0TA 3ERFA 5DAKA 1VF1A 4ZB8A 3W8SA 6GSUA 3KXOA 2DIZA 4I5QA 3ZITA 1THXA 3BCIA 2K6VA 4D73B 5KN2A 3GA4A 1USBA 2V6KA 2ZNMA 1F2EA 3WD6A 1AQVA 1GSSA 2P5RA 4BVYA 3HCZA 2K9FA 2VCQA 1KBNA 4FO5A 3DVXA 4HZ4A 4K7OA 8GSSA 3MNGA 5ECSA 4J57E 4FYBA 4YQVA 1I9DA 1TI3A 1T7PB 3D5JA 2C8UA 4F82A 3EYTA 3G7JA 3CRTA 2I81A 1T4YA 3H1NA 3ZREA 3F4SA 4OFNA 2JZRA 4ZL9A 3GNJA 2B1LA 1S3AA 2K8SA 4L5LA 3CSJA 5HR0A 4PUAA 4XCSA 1GLPA 4I8BA 3M9KA 4O32A 5A4VA 2YANA 3HA9A 3KIJA 4HS1A 2IN3A 1BAYA 3LYPA 5HR2A 4HZ2A 1GUHA 6GSXA 5JWQB 1E6BA 1J9BA 3QAVA 4PQ1A 5ECOB 4WF5A 5B6MA 3GUSA 2HRNA 4BA7A 1V9WA 2OADA 4FIWA 2X8CA 4RQXA 3DKSA 2BJXA 4TR3A 2D2ZA 3RHCA 3E0UA 1FVKA 4KUNA 1XVWA 2KHPA 4KA0A 1U3AA 2J23A 3RHBA 3RDWA 2A2SA 1HNCA 3WT1A 4F03A 2CX3A 4QL9A 5ECKB 3IE3A 1W4VA 2M80A 2I9HA 1XOBA 1SYXA 5IO2A 1PQNA 1WPIA 4MJBA 4K0NA 1O81A 1YDKA 2WRTA 5CRDA 1ACVA 2HI7A 3SBCA 1VGLA 1M9AA 4MJEA 2NTOA 2R3XA 18GSA 2EIOA 1RW1A 2KLXA 2R4VA 3EE2A 4MZBA 2BMXA 1PRXA 2V32A 3FRCA 1M99A 4NV5A 1JZRA 4IS0A 3F6DA 3TKSE 2GTUA 4RQRA 2YJ7A 1XW9A 2PGTA 2E0QA 2LRTA 3H93A 3IC4A 3VLNA 5JWRB 2C80A 2Z9SA 5DQSA 1WWJA 3WGEA 3EINA 3A2WA 3UMAA 3KZQA 1KTEA 2C0GA 1TOFA 2GVPA 3BJ5A 4P3YB 3FZ4A 4MDCA 1JZDA 2H0GA 4EUYA 2LQQA 2VCTA 5DALB 3NOFA 3I6AA 2VLTA 5AGYA 2FUG2 1LJRA 4HI7A 4Q5RA 4V2NA 2HZEB 4ZB6A 1G6WA 1PX6A 2DSAA 3RAZA 3MDKA 1EGOA 4KH7A 4J2FA 3LYKA 3TKQA 1PKZA 2L57A 4JZQA 12GSA 1A23A 1GTBA 3UAPA 2B3SA 4ISDA 2HRFA 1M2BA 3VK9A 4XS6A 5DAKB 2PVQA 5L71A 3QPMA 1PA3A 4N0VA 1WJKA 1XWKA 4TR0A 4TOPA 4EO3A 5CRGA 2GSSA 5J5NA 4MF6A 4POBA 4EF0A 3FZ9A 5AN1A 1X9MB 1YQ1A 3TJJA 4POMA 1GH2A 1B4PA 2IJYA 2PUKC 5C00A 1U6TA 2FA4A 3KEBA 4L0WA 2KP1A 3RPPA 3FYGA 3BOAA 1Y6EA 3HJOA 2XBQA 3ISOA 4NAXA 4ML1A 5HFGA 1Y25A 2H0IA 2WB9A 2YJHA 1MDIA 1G7OA 4KDUA 1NW2A 5F0GA 4FYCA 4PX1A 4XIHA 2IMIA 1EWXA 4IGJA 2EIQA 3P90A 3EMPA 1Z9HA 3ME7A 3L0HA 1X9SB 1TI1A 1GSYA 3Q6OA 5G30A 4PQHA 4HU9A 2MMNA 1ZZYA 4F0BA 1MDJA 1A2LA 5HR1A 5KN1A 1SJZA 2H70A 5A5KA 5J9BA 2HYXA 4YH2A 1ERVA 5FHIA 2DJ0A 1F37A 5IPGA 4F9ZA 1GP1A 3O3TA 4ECCA 2L59A 3H79A 1MTCA 3L9UA 2FWFA 3TKPA 3H4KA 4BWSA 1VF4A 4DEJA 1GTIA 3CYNA 3FY7A 2ON5A 1TK0B 3ZIJA 1SL0B 3VWWA 2OA7A 3IAM2 5ID2A 1R7HA 5ECRB 2YOIA 1SK0A 4X1UA 2IPAA 3LXTA 2AHEA 1SL2B 2M46A 4OCEA 2CZ2A 3GL5A 4EC0A 4ZILA 3ZLPA 1XW6A 3IXRA 2V41A 2PU9C 1MD4A 2EIRA 2DJ3A 4X0XA 5CREA 2B5XA 1F3AA 3NZNA 3HD5A 3FR6A 3VWUA 5IO0A 2XPDA
chains in the Genus database with same CATH superfamily
3LGCA 2TRCP 16GSA 2XBIA 3MYDA 2QKEA 1A2JA 3EURA 2MBTA 1A24A 3NIVA 4PNGA 1B9YC 2VL3A 3KP9A 1PFOA 3HVXA 4PGTA 2PVOC 1F3BA 2IMFA 2PWJA 2LKUA 1WOUA 5ABRA 2IWTA 2KP2A 3VPTA 3ZIVA 1T8EB 1TRSA 3N9JA 4IJ3A 2VD0A 4OWYA 2P0GA 2B6MA 3C71A 1X9WB 1Q4JA 2C0FA 4I6XA 2OE0A 3RPNA 4EDYA 5F8BA 1J08A 2I1UA 2H1AA 3UVHA 1B48A 2MMZA 2LSTA 3ZYWA 3BCKA 6GSVA 1Z7RA 3P7XA 3C8EA 1YZXA 4HDEA 4Z2RA 1EEJA 4GF0A 4PUFC 4OFTA 2CAQA 4TR4A 5ECLB 5LD0A 4PURA 3WT2A 1UN2A 3F0IA 5HFKA 2GSRA 1SK1A 1K0AA 3DMLA 3KD0A 1FO5A 5FWGA 3ZL5A 1TK5B 1ZMAA 4DVCA 1VF3A 1SD9A 2QA1A 1TRUA 2RIIA 3Q19A 4WEYA 3CMIA 1TU7A 3ZTLA 1FOHA 3ZFBA 1MDKA 4CDOA 3VURA 3QDNA 2GT6A 3L9VA 1J0FA 4KX4A 2F9SA 5B8AA 2R6KA 5DDLA 1XPVA 1FHEA 2H6XA 1ZYEA 3KP8A 2H6YA 1XIYA 2LNSA 2VLUA 1GSEA 4MK3A 4V1Ap 2YZUA 3Q74A 4K2DA 4NXIA 1AC1A 1GLQA 4GQFA 1A8YA 2FWGA 2L6CA 1FVJA 4E8EA 1V57A 1FAAA 1Z6NA 1V40A 3TRXA 4PTSA 2LEGA 4ZBDA 3UIWA 3D4MA 3C73A 2F3MA 2VOCA 3FW2A 2R5GA 1TXXA 3FEUA 4EXJA 1NHYA 4K6XA 3E9JB 1ABAA 2H66A 5JCUA 4TRXA 4MCUA 2ALBA 3TRPA 4OMVA 5ENUA 4WETA 5DVBA 1OKDA 2WGRA 3G7IA 4TXOA 5ECQB 1PKWA 1OC9A 3ZVJA 17GSA 5G5FA 1XVQA 1JLVA 1G7EA 1HNAA 1SL1B 3IK9A 1V2AA 3EU4A 3UARA 3SWLA 5IMVA 3GHAA 1EP8A 1XWAA 4K8MA 4NHWA 1PSQA 1SK2A 2VAFA 4ZL7A 3I43A 2VIMA 5G2ZA 3S9FA 1XWBA 3OR5A 1FG4A 3TGZA 3H8QA 5IOXA 5ID2B 1M7TA 3DWVA 1TU8A 1JLWA 4HJ2A 4XRDA 1G6YA 2VCZA 3CBUA 5H5SA 3O76A 3MSZA 5J4UA 3GX8A 2IFQA 2VCWA 2V6OA 1M3IA 4N0ZA 3P2AA 1OE8A 6GSYA 2PPTA 1WE0A 3IHGA 1HD2A 1I5GA 6GSTA 1YEPA 5HR3A 1B9XC 3GN3A 3DXBA 1THOA 3DVWA 4KW6A 5CAXA 2RM5A 3TRQA 1O7UA 4ECJA 4BWQA 4GRFA 2B5EA 3C1SA 5IIZA 3K8NA 3LWAA 1K0MA 6GSSA 4MH2A 3CSHA 2GT5A 1NM3A 4IW9A 3IPZA 1PGTA 1SKWB 4IBPA 2DC5A 2YV9A 2YV7A 5CO3A 1T3BA 3GKMA 2DIYA 1UC7A 2HSMA 3G9BA 1FB0A 4XRAA 4G19A 2JZTA 1U3IA 4ECIA 1VRSD 1TJDA 2ON7A 4K5SA 4JBBA 3IAS2 2QSIA 1EV4A 4LL1B 3HVSA 4V1Ag 5CNWA 2H6ZA 2FY6A 1CQHA 1YEXA 2DBCA 2PBJA 4AGSA 4XS4A 3L9SA 1AXDA 1PD21 4HUAA 5G5EA 4E8HA 3PINA 1OE7A 2WZ9A 4XS1A 2C0DA 2DKHA 2AJQB 1XXUA 5JWOB 3GH9A 3LFLA 1C72A 4AJ6A 2N5BA 1OC8A 1X5CA 2L4QA 2DLXA 3F9UA 2L5OA 5IMDA 5IMZA 1X0RA 3IA1A 5ECMB 2H01A 2FGXA 2E2GA 4OFMA 5B7CA 1M2DA 2CX4A 2C0EA 1E2YA 5D9WA 22GSA 2GS3A 2J9HA 2GZZA 1NSWA 2HZFA 2QC7A 4K7IA 1O6JA 4KDXA 3KTLA 1DUGA 2HNLA 5F05A 2RM6A 4TXOB 2OJLA 2WCIA 2KOKA 1LU4A 1OC9B 3KJYA 2RUEA 2ES7A 2X64A 5DJLA 2R2JA 2WJUA 2C3TA 3IRAA 4JR6A 3L78A 1JZOA 4MJAA 3O6TA 3A2VA 2IIYA 2R0GA 3LQ7A 1SKSB 3IDVA 4HJMA 4JE1A 1QMVA 2MZCA 3HJPA 3LORA 2JL4A 3LEFA 2JZSA 2XC2A 1PN9A 1V58A 4XTSA 4GSTA 2DJJA 3DGQA 3L4NA 3ZZXA 2L6DA 1YF0A 5G1KA 3KM6A 4NPBA 3UBKA 4USSA 1XG8A 2HRKA 3V1WA 5CYYA 2IFQB 3US3A 1A0RP 2HSHA 5JCGA 4IP6A 2X99A 9GSSA 3EU3A 2YP6A 3HHVA 1YF1A 5D9XA 1A8LA 2GZPA 5IMAA 2FNOA 1ZYQB 1GUMA 1XZOA 2JADA 1GSQA 1ON4A 3IHQA 3UL3A 3QCPA 4YAPA 5HFIA 4OD7A 2DJKA 3GKXA 4LMWA 3UBLA 5CRHA 2B5YA 3APOA 2LJKA 2FD3A 4L8EA 5J41A 4H86A 5D9VA 3QAGA 2N5FA 2CV4A 2XHFA 2P31A 3VPQA 3GSSA 2GSTA 1SYRA 1V98A 2CVKA 4YKFA 3TJKA 2IL3A 2LQOA 2VUPA 3GTUA 1H75A 1GULA 4EVMA 2VD1A 4GSSA 4O5QA 1K3YA 3MAKA 3IV4A 1SD8A 4ZL8A 4KCEA 6GSWA 4JR4A 4BL7A 3LG6A 1GUKA 1SJ6A 2YPMA 4FH8A 3LSZA 2HSYA 4XS4B 5IPHA 1GNEA 2YCDA 2HLSA 3M0FA 1TRVA 4O92A 2LNTA 3QOUA 3A2XA 1F9MA 3PGTA 2O85A 1CQGA 3M8NA 3TKSA 4K2XA 2NDOA 4ZBBA 4PXOA 3W8JA 3TDGA 3EWLA 2HFDA 4NWYA 3D4TA 5CRWA 4HQZA 2R0PA 4ILFA 5H5RA 2RUFA 1PX7A 3ZMKA 3HDCA 2WULA 2R37A 2F51A 1DE1A 1XW5A 4OO5A 1ZCPA 1Z5YE 3HYPA 11GSA 5AIVA 2FWEA 2GSQA 1YKAA 5IMCA 1M2AA 3JCML 2C1YA 2HXKA 3TJBA 1EEMA 1FOVA 2VL9A 4KSMA 1XWGA 3AY8A 1BYEA 3VFIA 2JSYA 3KCMA 4GCIA 4ID0A 3HZ8A 1N8JA 4HOJA 1DSBA 1K3OA 4AJ8A 5B8BA 1QFNA 4KB3A 4Q5QA 1BJXA 2VL2A 1QUWA 1R5PA 2VM1A 3FR3A 3IOSA 2G2QA 3BBYA 5IMFA 1N2AA 3HY2A 5A4UA 5F06A 1HYUA 2QGVA 2IMDA 1Z3EA 4FQUA 1TKDB 3D22A 2X4AA 4ZBAA 4JU5A 3WGDA 2PERA 2B7KA 1X5EA 2H1DA 3TOTA 3D21A 2H71A 3G7YA 4HU7A 1YY7A 2CA8A 3IK7A 4IJIA 1O85A 3J7Yk 1R26A 4CHSA 2VCXA 5ECHB 1URMA 1F6MC 1PMTA 5A4WA 4PNFA 3KMNA 1HQOA 4F2IA 2LUSA 1RK4A 4KDYA 4BPYA 4K5RA 2LRCA 4KGIA 1JZWA 3QFBC 4LLRA 2K18A 1T4ZA 2I4AA 2M72A 4WBJA 7GSSA 2FCHA 3DD3A 3DEXA 4N30A 3LXZA 1QXHA 1TW9A 3F3RA 1BG5A 2I3YA 4IVFA 2GQKA 3CRUA 4MPFA 3WYWA 2R0CA 3QD9A 2X8HA 1ZYPA 2E7PA 3GYKA 3VWXA 2RLIA 1ERTA 1GWCA 4GSNA 4GWRA 4J56E 3DYRA 4OO4A 3C7MA 3ZRDA 2WDUA 3QFAC 3ZFLA 2NBSA 4YAVA 4K1FA 5AIXA 2GGTA 1K0DA 3GTUB 2P5QA 1S3DA 4GLTA 3TJGA 4K0GA 2UZ8A 2AB6A 3M3MA 2TRXA 1MD3A 1A0FA 3HVVA 1OVNA 4HQSA 2O8VB 2FLSA 1VF2A 2OKAA 2MMAA 2K8VA 4BL7B 1SENA 4HEA2 2YWOA 4K7NA 4G0LA 2HT9A 1XFLA 5D8IA 3FK8A 4DSRA 3ME8A 4WBRD 2LJRA 2LJAA 4KNDA 1LBKA 1B8XA 2O87A 5GSSA 4POLA 2DKIA 3MIXA 1YJ6A 3GURA 2NPBA 2CVDA 5FT3A 2GZYA 4MPGA 1SJIA 4IQAA 4KSOA 4ACSA 2FA8A 5EY6A 1ML6A 4IELA 2VCVA 1Z6MA 4MZCA 5IM9A 2IMEA 4AF2A 2CT6A 1XCCA 3HXSA 3UEMA 1NHOA 5EL8A 1QQ2A 2MYGA 3TJFA 5ECNB 3F3QA 4NMUA 3RBTA 2AAWA 1JFUA 3KH7A 1XOAA 4N11A 2H19A 3ED3A 2B7JA 1GTUA 2V2GA 3HJMA 3A3TA 1K3LA 2CZ3A 4I97A 1GL8A 1EP7A 3GX0A 3F8UA 5GAPD 4CY8A 3F63A 2F8AA 1EZKA 1AUCA 4YKGA 2O7KA 4LMVA 1GSUA 4IHUA 3PH9A 5C04A 4ECBA 4HSCX 4GXZA 1GSFA 4I2UA 3VI5A 5HQPA 1O8XA 4JEDA 1W89A 3M9JA 4KE3A 5IQYA 3KH9A 4DSSA 4JRRA 3A5WA 2ZUPA 5D96A 14GSA 4FYUA 2REMA 1FW1A 4NV2A 4KCAA 2JSZA 2WFCA 3EPTA 4MABA 4GQCA 1K0CA 1K0BA 2VM2A 3FZAA 5KOWA 1ZL9A 4LL4B 5D73A 1U87A 4K9ZA 4I2TA 3F6FA 2WS2A 5J9CA 2YWIA 4Z7XA 5IOWA 1EOGA 1WRYA 1DBYA 1HNBA 2H76A 3MWHA 4L0UA 1IYIA 1B4QA 2X49A 2PN8A 2GDRA 1TRWA 2E2MA 2X8GA 2IMKA 3QR6A 4Q5NA 4MF7A 3GIXA 4TW5A 1ST9A 4O5RA 2GQLA 4AJ7A 2LRNA 1ZGNA 5GAND 2C3QA 4G2EA 4MH3A 2YWNA 5DBQA 4EIPA 1X5DA 3N5OA 3LW9A 2C4JA 3CSIA 5D9TA 2OACA 3FHKA 2QA2A 2CQ9A 2FWHA 4MJCA 5ELGA 4CW9A 3FKFA 3M1GA 5DCGA 4QQ7A 3E3EA 4NHZA 4MLYA 4V2LA 2H75A 3CTFA 1A2MA 3FZ5A 1KEBA 4KAEA 1XBSA 1Z7PA 4ZIJA 4MP4A 2VLVA 1QK8A 1RQMA 4TVEA 3EMXA 10GSA 3DIEA 1TK8B 3TUEA 3D0ZA 4Z2UA 5E59A 2LV3A 4WR5A 4ZXGA 3KTBA 4RI7A 1AIUA 3I9V2 4EKZA 5CP1A 1YKCA 4OCFA 2ZCTA 4QL7A 2LTKA 2YZHA 5BMUA 1SKRB 2A4HA 4MZWA 5COHA 5KEJA 2A4VA 1MEKA 3ZVJD 2NVLA 4IN0A 2CAIA 3A5IA 3WGXA 4TR1A 3KMOA 1Q98A 5GSTA 2H73A 1FB6A 4BVXA 2BTOT 3KGKA 5DCHA 2MBSA 4ICYA 4PQIA 5EPFA 1TDIA 2OE3A 5G31A 3U5RE 1K0NA 1AW9A 3R2QA 2L4CA 5GZZB 3TOUA 3ZMLA 1AQXA 3UVTA 2YNXA 4N10A 3DRNA 1IYHA 2OBIA 1ILOA 3HKRA 1PL2A 2C3NA 1TTZA 2G0FA 3ERGA 4WXTA 2OE1A 1SU9A 3HVNA 3FR9A 1WMJA 3F4TA 1EV9A 5J3RA 1M0UA 3GH6A 4G9HA 4IQ1A 4D73A 1OYJA 1T1VA 5EVOA 4WKWA 2GLRA 2YWMA 3TB2A 2V1MA 1GRXA 1EOHA 1WP0A 4X4JA 1TP9A 2DJ2A 2DJ1A 1BEDA 5KN3A 1S3CA 3CQFA 4YQUA 2TIRA 2A2PA 4MMMA 2JU5A 3QAWA 5JCWA 4MA9A 2JACA 3GV1A 3GFKA 2HRAA 5DJMA 3CXGA 4DSSB 4MNNA 4TKYA 1BX9A 1H4OA 4X43A 5F07A 3GMFA 2VO4A 4ULXA 4WF4A 2YN1A 2AV4A 1OKTA 1M9BA 2H30A 1K0OA 2H1BA 2PMTA 3EVIA 3J7Yb 3VWVA 2CVBA 5LCZA 20GSA 4L5OA 5INYA 2FHEA 3IBHA 5H5QA 3IR4A 1KNGA 4RUVA 2H72A 13GSA 1O73A 1OC3A 2HE3A 4TXVA 4Q5FA 4TN8A 4CY6A 4G10A 2OBKA 4MF5A 4IKHA 2XPEA 1UA5A 2MMOA 4POKA 4A5PA 1M3JA 3EC3A 4RI6A 1UVZA 1EGRA 4G0IA 4DSQA 3UJ1A 2F8FA 1T00A 3GSTA 5E4WA 1XWCA 2A2RA 2DMMA 5ECIB 3TCOA 3F4RA 3PR8A 1AAZA 4EE0A 2O89A 1ZOFA 2DMLA 1GNWA 3GL3A 3BD2A 2N5AA 4G0KA 4IP1A 2H1GA 4EL1A 4ML6A 3C1RA 3CTGA 1GSDA 3TKSC 2AYTA 3Q18A 5KN0A 4LA1A 2LS5A 19GSA 3VI7A 1WIKA 2B1KA 1DE2A 3APQA 3D6IA 4YQMA 1R4WA 3HZ4A 4O7HA 3QMXA 3GKNA 3GKKA 2H74A 5LNKe 2AUVA 1U88A 5B6NA 4EDZA 5AISA 1OAZA 4TR1B 1BQ7A 1R5AA 4WR4A 2L5LA 5DQYA 3TKRA 5DALA 5ELAA 2KUCA 4BVXB 4XHMA 4ZB9A 4F0CA 1AQWA 4GTUA 2H0HA 2HZEA 1O8WA 3P8WA 1ERWA 1PL1A 3U6VA 4V2MA 2EC4A 3ERWA 3GRXA 2VL2C 1QGVA 2H8LA 3I69A 3W6GA 3APSA 1JHBA 5D93A 1GTAA 3UOMA 3LJRA 5ECPB 2GQMA 1ZYNA 1ERUA 5G1LA 1G0TA 3ERFA 5DAKA 1VF1A 4ZB8A 3W8SA 6GSUA 4BIKA 3KXOA 2DIZA 4I5QA 3ZITA 1THXA 3BCIA 2K6VA 4D73B 5KN2A 3GA4A 1USBA 2V6KA 2ZNMA 1F2EA 3WD6A 1AQVA 1GSSA 2P5RA 4BVYA 3HCZA 2K9FA 2VCQA 1KBNA 4FO5A 3DVXA 4HZ4A 4K7OA 8GSSA 3MNGA 5ECSA 4J57E 4FYBA 4YQVA 1I9DA 1TI3A 1T7PB 3D5JA 2C8UA 4F82A 3EYTA 3G7JA 3CRTA 2I81A 1T4YA 3H1NA 3ZREA 3F4SA 5BRTA 4OFNA 2JZRA 4ZL9A 3GNJA 2B1LA 1S3AA 2K8SA 4L5LA 3CSJA 5HR0A 4O5UA 4PUAA 4XCSA 1GLPA 4I8BA 3M9KA 4O32A 5A4VA 2YANA 3HA9A 3KIJA 4HS1A 2IN3A 1BAYA 3LYPA 5HR2A 4HZ2A 1GUHA 6GSXA 5JWQB 1E6BA 1J9BA 3QAVA 4PQ1A 5ECOB 4WF5A 5B6MA 3GUSA 2HRNA 4BA7A 1V9WA 2OADA 4FIWA 2X8CA 4RQXA 3FMWA 3DKSA 2BJXA 4TR3A 2D2ZA 3RHCA 3E0UA 1FVKA 1S3RA 4KUNA 1XVWA 5KOXA 2KHPA 4KA0A 1U3AA 2J23A 3RHBA 3RDWA 2A2SA 1HNCA 3WT1A 4F03A 2CX3A 4QL9A 5ECKB 3IE3A 1W4VA 2M80A 2I9HA 1XOBA 1SYXA 5IO2A 1PQNA 1WPIA 4MJBA 4K0NA 1O81A 1YDKA 2WRTA 5CRDA 1ACVA 2HI7A 3SBCA 1VGLA 1M9AA 4MJEA 2NTOA 2R3XA 18GSA 2EIOA 1RW1A 2KLXA 2R4VA 3EE2A 4MZBA 2BMXA 1PRXA 2V32A 3FRCA 1M99A 4NV5A 1JZRA 4IS0A 3F6DA 3PPUA 3TKSE 2GTUA 4RQRA 2YJ7A 1XW9A 2PGTA 2E0QA 2LRTA 3H93A 3IC4A 3VLNA 5JWRB 2C80A 2Z9SA 5DQSA 1WWJA 3WGEA 3EINA 3A2WA 3UMAA 3KZQA 1KTEA 2C0GA 1TOFA 2GVPA 3BJ5A 4P3YB 3FZ4A 4MDCA 1JZDA 2H0GA 4EUYA 2LQQA 2VCTA 5DALB 3NOFA 3I6AA 2VLTA 5AGYA 2FUG2 1LJRA 4HI7A 4Q5RA 4V2NA 2HZEB 4ZB6A 1G6WA 1PX6A 2DSAA 3RAZA 3MDKA 1EGOA 4KH7A 4J2FA 3LYKA 3TKQA 1PKZA 2L57A 4JZQA 12GSA 1A23A 1GTBA 3UAPA 2B3SA 4ISDA 2HRFA 1M2BA 3VK9A 4XS6A 5DAKB 2PVQA 5L71A 3QPMA 1PA3A 4N0VA 1WJKA 1XWKA 4TR0A 4TOPA 4EO3A 5CRGA 4BVYB 2GSSA 5J5NA 4MF6A 4POBA 4EF0A 3FZ9A 5AN1A 1X9MB 1YQ1A 3TJJA 4POMA 1GH2A 1B4PA 2IJYA 2PUKC 5C00A 1U6TA 2FA4A 3KEBA 4L0WA 2KP1A 3RPPA 3FYGA 3BOAA 1Y6EA 3HJOA 2XBQA 3ISOA 4NAXA 4ML1A 4KF9A 5HFGA 1Y25A 2H0IA 2WB9A 2YJHA 1MDIA 1G7OA 4KDUA 1NW2A 5F0GA 4FYCA 4PX1A 4XIHA 2IMIA 1EWXA 4IGJA 2EIQA 3P90A 3EMPA 1Z9HA 3ME7A 3L0HA 1X9SB 1TI1A 1GSYA 3Q6OA 5G30A 4PQHA 4HU9A 2MMNA 1ZZYA 4F0BA 1MDJA 1A2LA 5HR1A 5KN1A 1SJZA 2H70A 5A5KA 5J9BA 2HYXA 4YH2A 1ERVA 5FHIA 2DJ0A 1F37A 5IPGA 4F9ZA 1GP1A 3O3TA 4ECCA 2L59A 3H79A 1MTCA 3L9UA 2FWFA 3TKPA 3H4KA 1PN0A 1VF4A 4BWSA 4DEJA 1GTIA 3CYNA 3FY7A 2ON5A 1TK0B 3ZIJA 1SL0B 3VWWA 2OA7A 3IAM2 5ID2A 1R7HA 5ECRB 2YOIA 1SK0A 4X1UA 2IPAA 3LXTA 2AHEA 1SL2B 2M46A 4OCEA 2CZ2A 3GL5A 4EIQA 4EC0A 4ZILA 3ZLPA 4Z2TA 1XW6A 3IXRA 2V41A 2PU9C 1MD4A 2EIRA 2DJ3A 4X0XA 3IC8A 5CREA 3R3EA 2B5XA 1F3AA 3NZNA 3HD5A 3FR6A 3VWUA 5IO0A 2XPDA
chains in the Genus database with same CATH topology
3LGCA 2TRCP 16GSA 2XBIA 3MYDA 2QKEA 1A2JA 3EURA 2MBTA 1A24A 3NIVA 4PNGA 1B9YC 2VL3A 3KP9A 3HVXA 4PGTA 2PVOC 1F3BA 2IMFA 2PWJA 2LKUA 1WOUA 5ABRA 2IWTA 2KP2A 3VPTA 3ZIVA 1T8EB 1TRSA 3N9JA 4IJ3A 2VD0A 4OWYA 2P0GA 2B6MA 3C71A 1X9WB 1Q4JA 2C0FA 4I6XA 2OE0A 3RPNA 4EDYA 5F8BA 1J08A 2I1UA 2H1AA 3UVHA 1B48A 2MMZA 2LSTA 3ZYWA 3BCKA 6GSVA 1Z7RA 3P7XA 3C8EA 1YZXA 4HDEA 4Z2RA 1EEJA 4GF0A 4PUFC 4OFTA 2CAQA 4TR4A 5ECLB 5LD0A 4PURA 3WT2A 1UN2A 3F0IA 5HFKA 2GSRA 1SK1A 1K0AA 3DMLA 3KD0A 1FO5A 5FWGA 3ZL5A 1TK5B 1ZMAA 4DVCA 1VF3A 1SD9A 2QA1A 1TRUA 2RIIA 3Q19A 4WEYA 3CMIA 1TU7A 3ZTLA 1FOHA 3ZFBA 1MDKA 4CDOA 3VURA 3QDNA 2GT6A 3L9VA 1J0FA 4KX4A 2F9SA 5B8AA 2R6KA 5DDLA 1XPVA 1FHEA 2H6XA 1ZYEA 3KP8A 2H6YA 1XIYA 2LNSA 2VLUA 1GSEA 4MK3A 4V1Ap 2YZUA 3Q74A 4K2DA 4NXIA 1AC1A 1GLQA 4GQFA 1A8YA 2FWGA 2L6CA 1FVJA 4E8EA 1V57A 1FAAA 1Z6NA 1V40A 3TRXA 4PTSA 2LEGA 4ZBDA 3UIWA 3D4MA 3C73A 2F3MA 2VOCA 3FW2A 2R5GA 1TXXA 3FEUA 4EXJA 1NHYA 4K6XA 3E9JB 1ABAA 2H66A 5JCUA 4TRXA 4MCUA 2ALBA 3TRPA 4OMVA 5ENUA 4WETA 5DVBA 1OKDA 2WGRA 3G7IA 4TXOA 5ECQB 1PKWA 1OC9A 3ZVJA 17GSA 5G5FA 1XVQA 1JLVA 1G7EA 1HNAA 1SL1B 3IK9A 1V2AA 3EU4A 3UARA 3SWLA 5IMVA 3GHAA 1EP8A 1XWAA 4K8MA 4NHWA 1PSQA 1SK2A 2VAFA 4ZL7A 3I43A 2VIMA 5G2ZA 3S9FA 1XWBA 3OR5A 1FG4A 3TGZA 3H8QA 5IOXA 5ID2B 1M7TA 3DWVA 1TU8A 1JLWA 4HJ2A 4XRDA 1G6YA 2VCZA 3CBUA 5H5SA 3O76A 3MSZA 5J4UA 3GX8A 2IFQA 2VCWA 2V6OA 4N0ZA 3P2AA 1OE8A 6GSYA 2PPTA 1WE0A 3IHGA 1HD2A 1I5GA 6GSTA 1YEPA 5HR3A 1B9XC 3GN3A 3DXBA 1THOA 3DVWA 4KW6A 5CAXA 2RM5A 3TRQA 1O7UA 4ECJA 4BWQA 4GRFA 2B5EA 3C1SA 5IIZA 3K8NA 3LWAA 1K0MA 6GSSA 4MH2A 3CSHA 2GT5A 1NM3A 4IW9A 3IPZA 1PGTA 1SKWB 4IBPA 2DC5A 2YV9A 2YV7A 5CO3A 1T3BA 3GKMA 2DIYA 1UC7A 2HSMA 3G9BA 1FB0A 4XRAA 4G19A 2JZTA 1U3IA 4ECIA 1VRSD 1TJDA 2ON7A 4K5SA 4JBBA 3IAS2 2QSIA 1EV4A 4LL1B 3HVSA 4V1Ag 5CNWA 2H6ZA 2FY6A 1CQHA 1YEXA 2DBCA 2PBJA 4AGSA 4XS4A 3L9SA 1AXDA 1PD21 4HUAA 5G5EA 4E8HA 3PINA 1OE7A 2WZ9A 4XS1A 2C0DA 2DKHA 2AJQB 1XXUA 5JWOB 3GH9A 3LFLA 1C72A 4AJ6A 2N5BA 1OC8A 1X5CA 2L4QA 2DLXA 3F9UA 2L5OA 5IMDA 5IMZA 1X0RA 3IA1A 5ECMB 2H01A 2FGXA 2E2GA 4OFMA 5B7CA 1M2DA 2CX4A 2C0EA 1E2YA 5D9WA 22GSA 2GS3A 2J9HA 2GZZA 1NSWA 2HZFA 2QC7A 4K7IA 1O6JA 4KDXA 3KTLA 1DUGA 2HNLA 5F05A 2RM6A 4TXOB 2OJLA 2WCIA 2KOKA 1LU4A 1OC9B 3KJYA 2RUEA 2ES7A 2X64A 5DJLA 2R2JA 2WJUA 2C3TA 3IRAA 4JR6A 3L78A 1JZOA 4MJAA 3O6TA 3A2VA 2IIYA 2R0GA 3LQ7A 1SKSB 3IDVA 4HJMA 4JE1A 1QMVA 2MZCA 3HJPA 3LORA 2JL4A 3LEFA 2JZSA 2XC2A 1PN9A 1V58A 4XTSA 4GSTA 2DJJA 3DGQA 3L4NA 3ZZXA 2L6DA 1YF0A 5G1KA 3KM6A 4NPBA 3UBKA 4USSA 2HRKA 3V1WA 5CYYA 2IFQB 3US3A 1A0RP 2HSHA 5JCGA 4IP6A 2X99A 9GSSA 3EU3A 2YP6A 3HHVA 1YF1A 5D9XA 1A8LA 2GZPA 5IMAA 2FNOA 1ZYQB 1GUMA 1XZOA 2JADA 1GSQA 1ON4A 3IHQA 3UL3A 3QCPA 4YAPA 5HFIA 4OD7A 2DJKA 3GKXA 4LMWA 3UBLA 5CRHA 2B5YA 3APOA 2LJKA 2FD3A 4L8EA 5J41A 4H86A 5D9VA 3QAGA 2N5FA 2CV4A 2XHFA 2P31A 3VPQA 3GSSA 2GSTA 1SYRA 1V98A 2CVKA 4YKFA 3TJKA 2IL3A 2LQOA 2VUPA 3GTUA 1H75A 1GULA 4EVMA 2VD1A 4GSSA 4O5QA 1K3YA 3MAKA 3IV4A 1SD8A 4ZL8A 4KCEA 6GSWA 4JR4A 4BL7A 3LG6A 1GUKA 1SJ6A 2YPMA 4FH8A 3LSZA 2HSYA 4XS4B 5IPHA 1GNEA 2YCDA 2HLSA 3M0FA 1TRVA 4O92A 2LNTA 3QOUA 3A2XA 1F9MA 3PGTA 2O85A 1CQGA 3M8NA 3TKSA 4K2XA 2NDOA 4ZBBA 4PXOA 3W8JA 3TDGA 3EWLA 2HFDA 4NWYA 3D4TA 5CRWA 4HQZA 2R0PA 4ILFA 5H5RA 2RUFA 1PX7A 3ZMKA 3HDCA 2WULA 2R37A 2F51A 1DE1A 1XW5A 4OO5A 1ZCPA 1Z5YE 3HYPA 11GSA 5AIVA 2FWEA 2GSQA 1YKAA 5IMCA 1M2AA 3JCML 2C1YA 2HXKA 3TJBA 1EEMA 1FOVA 2VL9A 4KSMA 1XWGA 3AY8A 1BYEA 3VFIA 2JSYA 3KCMA 4GCIA 4ID0A 3HZ8A 1N8JA 4HOJA 1DSBA 1K3OA 4AJ8A 5B8BA 1QFNA 4KB3A 4Q5QA 1BJXA 2VL2A 1QUWA 1R5PA 2VM1A 3FR3A 3IOSA 2G2QA 3BBYA 5IMFA 1N2AA 3HY2A 5A4UA 5F06A 1HYUA 2QGVA 2IMDA 1Z3EA 4FQUA 1TKDB 3D22A 2X4AA 4ZBAA 4JU5A 3WGDA 2PERA 2B7KA 1X5EA 2H1DA 3TOTA 3D21A 2H71A 3G7YA 4HU7A 1YY7A 2CA8A 3IK7A 4IJIA 1O85A 3J7Yk 1R26A 4CHSA 2VCXA 5ECHB 1URMA 1F6MC 1PMTA 5A4WA 4PNFA 3KMNA 1HQOA 4F2IA 2LUSA 1RK4A 4KDYA 4BPYA 4K5RA 2LRCA 4KGIA 1JZWA 3QFBC 4LLRA 2K18A 1T4ZA 2I4AA 2M72A 4WBJA 7GSSA 2FCHA 3DD3A 3DEXA 4N30A 3LXZA 1QXHA 1TW9A 3F3RA 1BG5A 2I3YA 4IVFA 2GQKA 3CRUA 4MPFA 3WYWA 2R0CA 3QD9A 2X8HA 1ZYPA 2E7PA 3GYKA 3VWXA 2RLIA 1ERTA 1GWCA 4GSNA 4GWRA 4J56E 3DYRA 4OO4A 3C7MA 3ZRDA 2WDUA 3QFAC 3ZFLA 2NBSA 4YAVA 4K1FA 5AIXA 2GGTA 1K0DA 3GTUB 2P5QA 1S3DA 4GLTA 3TJGA 4K0GA 2UZ8A 2AB6A 3M3MA 2TRXA 1MD3A 1A0FA 3HVVA 1OVNA 4HQSA 2O8VB 2FLSA 1VF2A 2OKAA 2MMAA 2K8VA 4BL7B 1SENA 4HEA2 2YWOA 4K7NA 4G0LA 2HT9A 1XFLA 5D8IA 3FK8A 4DSRA 3ME8A 4WBRD 2LJRA 2LJAA 4KNDA 1LBKA 1B8XA 2O87A 5GSSA 4POLA 2DKIA 3MIXA 1YJ6A 3GURA 2NPBA 2CVDA 5FT3A 2GZYA 4MPGA 1SJIA 4IQAA 4KSOA 4ACSA 2FA8A 5EY6A 1ML6A 4IELA 2VCVA 1Z6MA 4MZCA 5IM9A 2IMEA 4AF2A 2CT6A 1XCCA 3HXSA 3UEMA 1NHOA 5EL8A 1QQ2A 2MYGA 3TJFA 5ECNB 3F3QA 4NMUA 3RBTA 2AAWA 1JFUA 3KH7A 1XOAA 4N11A 2H19A 3ED3A 2B7JA 1GTUA 2V2GA 3HJMA 3A3TA 1K3LA 2CZ3A 4I97A 1GL8A 1EP7A 3GX0A 3F8UA 5GAPD 4CY8A 3F63A 2F8AA 1EZKA 1AUCA 4YKGA 2O7KA 4LMVA 1GSUA 4IHUA 3PH9A 5C04A 4ECBA 4GXZA 1GSFA 4I2UA 3VI5A 5HQPA 1O8XA 4JEDA 1W89A 3M9JA 4KE3A 5IQYA 3KH9A 4DSSA 4JRRA 3A5WA 2ZUPA 5D96A 14GSA 4FYUA 2REMA 1FW1A 4NV2A 4KCAA 2JSZA 2WFCA 3EPTA 4MABA 4GQCA 1K0CA 1K0BA 2VM2A 3FZAA 5KOWA 1ZL9A 4LL4B 5D73A 1U87A 4K9ZA 4I2TA 3F6FA 2WS2A 5J9CA 2YWIA 4Z7XA 5IOWA 1EOGA 1WRYA 1DBYA 1HNBA 2H76A 3MWHA 4L0UA 1IYIA 1B4QA 2X49A 2PN8A 2GDRA 1TRWA 2E2MA 2X8GA 2IMKA 3QR6A 4Q5NA 4MF7A 3GIXA 4TW5A 1ST9A 4O5RA 2GQLA 4AJ7A 2LRNA 1ZGNA 5GAND 2C3QA 4G2EA 4MH3A 2YWNA 5DBQA 4EIPA 1X5DA 3N5OA 3LW9A 2C4JA 3CSIA 5D9TA 2OACA 3FHKA 2QA2A 2CQ9A 2FWHA 4MJCA 5ELGA 4CW9A 3FKFA 3M1GA 5DCGA 4QQ7A 3E3EA 4NHZA 4MLYA 4V2LA 2H75A 3CTFA 1A2MA 3FZ5A 1KEBA 4KAEA 1XBSA 1Z7PA 4ZIJA 4MP4A 2VLVA 1QK8A 1RQMA 4TVEA 3EMXA 10GSA 3DIEA 1TK8B 3TUEA 3D0ZA 4Z2UA 5E59A 2LV3A 4WR5A 4ZXGA 3KTBA 4RI7A 1AIUA 3I9V2 4EKZA 5CP1A 1YKCA 4OCFA 2ZCTA 4QL7A 2LTKA 2YZHA 5BMUA 1SKRB 2A4HA 4MZWA 5COHA 5KEJA 2A4VA 1MEKA 3ZVJD 2NVLA 4IN0A 2CAIA 3A5IA 3WGXA 4TR1A 3KMOA 1Q98A 5GSTA 2H73A 1FB6A 4BVXA 2BTOT 3KGKA 5DCHA 2MBSA 4ICYA 4PQIA 5EPFA 1TDIA 2OE3A 5G31A 3U5RE 1K0NA 1AW9A 3R2QA 2L4CA 5GZZB 3TOUA 3ZMLA 1AQXA 3UVTA 2YNXA 4N10A 3DRNA 1IYHA 2OBIA 1ILOA 3HKRA 1PL2A 2C3NA 1TTZA 2G0FA 3ERGA 4WXTA 2OE1A 1SU9A 3FR9A 1WMJA 3F4TA 1EV9A 5J3RA 1M0UA 3GH6A 4G9HA 4IQ1A 4D73A 1OYJA 1T1VA 5EVOA 4WKWA 2GLRA 2YWMA 3TB2A 2V1MA 1GRXA 1EOHA 1WP0A 4X4JA 1TP9A 2DJ2A 2DJ1A 1BEDA 5KN3A 1S3CA 4YQUA 2TIRA 2A2PA 4MMMA 2JU5A 3QAWA 5JCWA 4MA9A 2JACA 3GV1A 3GFKA 2HRAA 5DJMA 3CXGA 4DSSB 4MNNA 4TKYA 1BX9A 1H4OA 4X43A 5F07A 3GMFA 2VO4A 4ULXA 4WF4A 2YN1A 2AV4A 1OKTA 1M9BA 2H30A 1K0OA 2H1BA 2PMTA 3EVIA 3J7Yb 3VWVA 2CVBA 5LCZA 20GSA 4L5OA 5INYA 2FHEA 3IBHA 5H5QA 3IR4A 1KNGA 4RUVA 2H72A 13GSA 1O73A 1OC3A 2HE3A 4TXVA 4Q5FA 4TN8A 4CY6A 4G10A 2OBKA 4MF5A 4IKHA 2XPEA 1UA5A 2MMOA 4POKA 4A5PA 3EC3A 4RI6A 1UVZA 1EGRA 4G0IA 4DSQA 3UJ1A 2F8FA 1T00A 3GSTA 5E4WA 1XWCA 2A2RA 2DMMA 5ECIB 3TCOA 3F4RA 3PR8A 1AAZA 4EE0A 2O89A 1ZOFA 2DMLA 1GNWA 3GL3A 3BD2A 2N5AA 4G0KA 4IP1A 2H1GA 4EL1A 4ML6A 3C1RA 3CTGA 1GSDA 3TKSC 2AYTA 3Q18A 5KN0A 4LA1A 2LS5A 19GSA 3VI7A 1WIKA 2B1KA 1DE2A 3APQA 3D6IA 4YQMA 1R4WA 3HZ4A 4O7HA 3QMXA 3GKNA 3GKKA 2H74A 5LNKe 2AUVA 1U88A 5B6NA 4EDZA 5AISA 1OAZA 4TR1B 1BQ7A 1R5AA 4WR4A 2L5LA 5DQYA 3TKRA 5DALA 5ELAA 2KUCA 4BVXB 4XHMA 4ZB9A 4F0CA 1AQWA 4GTUA 2H0HA 2HZEA 1O8WA 3P8WA 1ERWA 1PL1A 3U6VA 4V2MA 2EC4A 3ERWA 3GRXA 2VL2C 1QGVA 2H8LA 3I69A 3W6GA 3APSA 1JHBA 5D93A 1GTAA 3UOMA 3LJRA 5ECPB 2GQMA 1ZYNA 1ERUA 5G1LA 1G0TA 3ERFA 5DAKA 1VF1A 4ZB8A 3W8SA 6GSUA 3KXOA 2DIZA 4I5QA 3ZITA 1THXA 3BCIA 2K6VA 4D73B 5KN2A 3GA4A 1USBA 2V6KA 2ZNMA 1F2EA 3WD6A 1AQVA 1GSSA 2P5RA 4BVYA 3HCZA 2K9FA 2VCQA 1KBNA 4FO5A 3DVXA 4HZ4A 4K7OA 8GSSA 3MNGA 5ECSA 4J57E 4FYBA 4YQVA 1I9DA 1TI3A 1T7PB 3D5JA 2C8UA 4F82A 3EYTA 3G7JA 3CRTA 2I81A 1T4YA 3H1NA 3ZREA 3F4SA 5BRTA 4OFNA 2JZRA 4ZL9A 3GNJA 2B1LA 1S3AA 2K8SA 4L5LA 3CSJA 5HR0A 4O5UA 4PUAA 4XCSA 1GLPA 4I8BA 3M9KA 4O32A 5A4VA 2YANA 3HA9A 3KIJA 4HS1A 2IN3A 1BAYA 3LYPA 5HR2A 4HZ2A 1GUHA 6GSXA 5JWQB 1E6BA 1J9BA 3QAVA 4PQ1A 5ECOB 4WF5A 5B6MA 3GUSA 2HRNA 4BA7A 1V9WA 2OADA 4FIWA 2X8CA 4RQXA 3FMWA 3DKSA 2BJXA 4TR3A 2D2ZA 3RHCA 3E0UA 1FVKA 4KUNA 1XVWA 5KOXA 2KHPA 4KA0A 1U3AA 2J23A 3RHBA 3RDWA 2A2SA 1HNCA 3WT1A 4F03A 2CX3A 4QL9A 5ECKB 3IE3A 1W4VA 2M80A 2I9HA 1XOBA 1SYXA 5IO2A 1PQNA 1WPIA 4MJBA 4K0NA 1O81A 1YDKA 2WRTA 5CRDA 1ACVA 2HI7A 3SBCA 1VGLA 1M9AA 4MJEA 2NTOA 2R3XA 18GSA 2EIOA 1RW1A 2KLXA 2R4VA 3EE2A 4MZBA 2BMXA 1PRXA 2V32A 3FRCA 1M99A 4NV5A 1JZRA 4IS0A 3F6DA 3PPUA 3TKSE 2GTUA 4RQRA 2YJ7A 1XW9A 2PGTA 2E0QA 2LRTA 3H93A 3IC4A 3VLNA 5JWRB 2C80A 2Z9SA 5DQSA 1WWJA 3WGEA 3EINA 3A2WA 3UMAA 3KZQA 1KTEA 2C0GA 1TOFA 2GVPA 3BJ5A 4P3YB 3FZ4A 4MDCA 1JZDA 2H0GA 4EUYA 2LQQA 2VCTA 5DALB 3NOFA 3I6AA 2VLTA 5AGYA 2FUG2 1LJRA 4HI7A 4Q5RA 4V2NA 2HZEB 4ZB6A 1G6WA 1PX6A 2DSAA 3RAZA 3MDKA 1EGOA 4KH7A 4J2FA 3LYKA 3TKQA 1PKZA 2L57A 4JZQA 12GSA 1A23A 1GTBA 3UAPA 2B3SA 4ISDA 2HRFA 1M2BA 3VK9A 4XS6A 5DAKB 2PVQA 5L71A 3QPMA 1PA3A 4N0VA 1WJKA 1XWKA 4TR0A 4TOPA 4EO3A 5CRGA 4BVYB 2GSSA 5J5NA 4MF6A 4POBA 4EF0A 3FZ9A 5AN1A 1X9MB 1YQ1A 3TJJA 4POMA 1GH2A 1B4PA 2IJYA 2PUKC 5C00A 1U6TA 2FA4A 3KEBA 4L0WA 2KP1A 3RPPA 3FYGA 3BOAA 1Y6EA 3HJOA 2XBQA 3ISOA 4NAXA 4ML1A 4KF9A 5HFGA 1Y25A 2H0IA 2WB9A 2YJHA 1MDIA 1G7OA 4KDUA 1NW2A 5F0GA 4FYCA 4PX1A 4XIHA 2IMIA 1EWXA 4IGJA 2EIQA 3P90A 3EMPA 1Z9HA 3ME7A 3L0HA 1X9SB 1TI1A 1GSYA 3Q6OA 5G30A 4PQHA 4HU9A 2MMNA 1ZZYA 4F0BA 1MDJA 1A2LA 5HR1A 5KN1A 1SJZA 2H70A 5A5KA 5J9BA 2HYXA 4YH2A 1ERVA 5FHIA 2DJ0A 1F37A 5IPGA 4F9ZA 1GP1A 3O3TA 4ECCA 2L59A 3H79A 1MTCA 3L9UA 2FWFA 3TKPA 3H4KA 1PN0A 1VF4A 4BWSA 4DEJA 1GTIA 3CYNA 3FY7A 2ON5A 1TK0B 3ZIJA 1SL0B 3VWWA 2OA7A 3IAM2 5ID2A 1R7HA 5ECRB 2YOIA 1SK0A 4X1UA 2IPAA 3LXTA 2AHEA 1SL2B 2M46A 4OCEA 2CZ2A 3GL5A 4EIQA 4EC0A 4ZILA 3ZLPA 4Z2TA 1XW6A 3IXRA 2V41A 2PU9C 1MD4A 2EIRA 2DJ3A 4X0XA 3IC8A 5CREA 3R3EA 2B5XA 1F3AA 3NZNA 3HD5A 3FR6A 3VWUA 5IO0A 2XPDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LGC A;  2TRC P;  16GS A;  2XBI A;  2QKE A;  1A2J A;  3EUR A;  2MBT A;  1A24 A;  3NIV A;  4PNG A;  1B9Y C;  2VL3 A;  3KP9 A;  3HVX A;  4PGT A;  2PVO C;  1F3B A;  2IMF A;  2PWJ A;  2LKU A;  1WOU A;  5ABR A;  2IWT A;  2KP2 A;  3VPT A;  3ZIV A;  1T8E B;  1TRS A;  3N9J A;  4IJ3 A;  2VD0 A;  4OWY A;  2P0G A;  2B6M A;  3C71 A;  1X9W B;  1Q4J A;  2C0F A;  4I6X A;  2OE0 A;  3RPN A;  4EDY A;  5F8B A;  1J08 A;  2I1U A;  2H1A A;  3UVH A;  1B48 A;  2MMZ A;  2LST A;  3ZYW A;  3BCK A;  6GSV A;  1Z7R A;  3P7X A;  3C8E A;  1YZX A;  4HDE A;  1EEJ A;  4GF0 A;  4PUF C;  4OFT A;  2CAQ A;  4TR4 A;  5ECL B;  5LD0 A;  4PUR A;  3WT2 A;  1UN2 A;  3F0I A;  5HFK A;  2GSR A;  1SK1 A;  1K0A A;  3DML A;  3KD0 A;  1FO5 A;  5FWG A;  3ZL5 A;  1TK5 B;  1ZMA A;  4DVC A;  1VF3 A;  1SD9 A;  1TRU A;  2RII A;  3Q19 A;  4WEY A;  3CMI A;  1TU7 A;  3ZTL A;  3ZFB A;  1MDK A;  4CDO A;  3VUR A;  3QDN A;  2GT6 A;  3L9V A;  1J0F A;  4KX4 A;  2F9S A;  5B8A A;  2R6K A;  5DDL A;  1XPV A;  1FHE A;  2H6X A;  1ZYE A;  3KP8 A;  2H6Y A;  1XIY A;  2LNS A;  2VLU A;  1GSE A;  4MK3 A;  4V1A p;  2YZU A;  3Q74 A;  4K2D A;  4NXI A;  1AC1 A;  1GLQ A;  4GQF A;  1A8Y A;  2FWG A;  2L6C A;  1FVJ A;  4E8E A;  1V57 A;  1FAA A;  1Z6N A;  1V40 A;  3TRX A;  2LEG A;  4ZBD A;  3UIW A;  3D4M A;  3C73 A;  2F3M A;  2VOC A;  3FW2 A;  2R5G A;  1TXX A;  3FEU A;  4EXJ A;  1NHY A;  4K6X A;  3E9J B;  1ABA A;  2H66 A;  5JCU A;  4TRX A;  4MCU A;  2ALB A;  3TRP A;  4OMV A;  5ENU A;  4WET A;  5DVB A;  1OKD A;  5ECQ B;  2WGR A;  3G7I A;  4TXO A;  1PKW A;  1OC9 A;  3ZVJ A;  17GS A;  5G5F A;  1XVQ A;  1JLV A;  1G7E A;  1HNA A;  1SL1 B;  3IK9 A;  1V2A A;  3EU4 A;  3UAR A;  3SWL A;  5IMV A;  3GHA A;  1EP8 A;  1XWA A;  4K8M A;  4NHW A;  1PSQ A;  1SK2 A;  2VAF A;  4ZL7 A;  3I43 A;  2VIM A;  5G2Z A;  3S9F A;  1XWB A;  3OR5 A;  1FG4 A;  3TGZ A;  3H8Q A;  5IOX A;  5ID2 B;  1M7T A;  3DWV A;  1TU8 A;  1JLW A;  4HJ2 A;  4XRD A;  1G6Y A;  2VCZ A;  3CBU A;  5H5S A;  3O76 A;  3MSZ A;  5J4U A;  3GX8 A;  2IFQ A;  2VCW A;  2V6O A;  4N0Z A;  3P2A A;  1OE8 A;  6GSY A;  2PPT A;  1WE0 A;  1HD2 A;  1I5G A;  6GST A;  1YEP A;  5HR3 A;  1B9X C;  3GN3 A;  3DXB A;  1THO A;  3DVW A;  4KW6 A;  5CAX A;  2RM5 A;  3TRQ A;  1O7U A;  4ECJ A;  4BWQ A;  4GRF A;  2B5E A;  3C1S A;  5IIZ A;  3K8N A;  3LWA A;  1K0M A;  6GSS A;  4MH2 A;  3CSH A;  2GT5 A;  1NM3 A;  4IW9 A;  3IPZ A;  1PGT A;  1SKW B;  4IBP A;  2DC5 A;  2YV9 A;  2YV7 A;  5CO3 A;  1T3B A;  3GKM A;  2DIY A;  1UC7 A;  3G9B A;  1FB0 A;  4XRA A;  4G19 A;  2JZT A;  1U3I A;  4ECI A;  1VRS D;  1TJD A;  2ON7 A;  4JBB A;  3IAS 2;  2QSI A;  1EV4 A;  4LL1 B;  3HVS A;  4V1A g;  5CNW A;  2H6Z A;  2FY6 A;  1CQH A;  1YEX A;  2DBC A;  2PBJ A;  4AGS A;  4XS4 A;  3L9S A;  1AXD A;  1PD2 1;  4HUA A;  5G5E A;  4E8H A;  3PIN A;  1OE7 A;  2WZ9 A;  4XS1 A;  2C0D A;  2AJQ B;  1XXU A;  5JWO B;  3GH9 A;  3LFL A;  1C72 A;  4AJ6 A;  2N5B A;  1OC8 A;  1X5C A;  2L4Q A;  2DLX A;  3F9U A;  2L5O A;  5IMD A;  5IMZ A;  1X0R A;  3IA1 A;  5ECM B;  2H01 A;  2FGX A;  2E2G A;  4OFM A;  5B7C A;  1M2D A;  2CX4 A;  2C0E A;  1E2Y A;  5D9W A;  22GS A;  2GS3 A;  2J9H A;  2GZZ A;  1NSW A;  2HZF A;  2QC7 A;  4K7I A;  1O6J A;  4KDX A;  3KTL A;  1DUG A;  2HNL A;  5F05 A;  2RM6 A;  4TXO B;  2OJL A;  2WCI A;  2KOK A;  1LU4 A;  1OC9 B;  3KJY A;  2RUE A;  2ES7 A;  2X64 A;  5DJL A;  2R2J A;  2WJU A;  2C3T A;  3IRA A;  4JR6 A;  3L78 A;  1JZO A;  4MJA A;  3O6T A;  3A2V A;  2IIY A;  3LQ7 A;  1SKS B;  3IDV A;  4HJM A;  4JE1 A;  1QMV A;  2MZC A;  3HJP A;  3LOR A;  2JL4 A;  3LEF A;  2JZS A;  2XC2 A;  1PN9 A;  1V58 A;  4XTS A;  4GST A;  2DJJ A;  3DGQ A;  3L4N A;  3ZZX A;  2L6D A;  1YF0 A;  5G1K A;  3KM6 A;  4NPB A;  3UBK A;  3V1W A;  5CYY A;  2IFQ B;  3US3 A;  1A0R P;  2HSH A;  5JCG A;  4IP6 A;  2X99 A;  9GSS A;  3EU3 A;  2YP6 A;  3HHV A;  1YF1 A;  5D9X A;  1A8L A;  2GZP A;  5IMA A;  2FNO A;  1ZYQ B;  1GUM A;  1XZO A;  2JAD A;  1GSQ A;  1ON4 A;  3IHQ A;  3UL3 A;  3QCP A;  4YAP A;  5HFI A;  4OD7 A;  2DJK A;  3GKX A;  4LMW A;  3UBL A;  5CRH A;  2B5Y A;  3APO A;  2LJK A;  2FD3 A;  4L8E A;  5J41 A;  4H86 A;  5D9V A;  3QAG A;  2N5F A;  2CV4 A;  2XHF A;  2P31 A;  3VPQ A;  3GSS A;  2GST A;  1SYR A;  1V98 A;  2CVK A;  3TJK A;  2IL3 A;  2LQO A;  2VUP A;  3GTU A;  1H75 A;  1GUL A;  4EVM A;  2VD1 A;  4GSS A;  1K3Y A;  3MAK A;  3IV4 A;  1SD8 A;  4ZL8 A;  4KCE A;  6GSW A;  4JR4 A;  4BL7 A;  3LG6 A;  1GUK A;  1SJ6 A;  2YPM A;  4FH8 A;  3LSZ A;  2HSY A;  4XS4 B;  5IPH A;  1GNE A;  2YCD A;  2HLS A;  3M0F A;  1TRV A;  4O92 A;  2LNT A;  3QOU A;  3A2X A;  1F9M A;  3PGT A;  2O85 A;  1CQG A;  3M8N A;  3TKS A;  2NDO A;  4ZBB A;  4PXO A;  3W8J A;  3TDG A;  3EWL A;  2HFD A;  4NWY A;  3D4T A;  5CRW A;  4HQZ A;  4ILF A;  5H5R A;  2RUF A;  1PX7 A;  3ZMK A;  3HDC A;  2WUL A;  2R37 A;  2F51 A;  1DE1 A;  1XW5 A;  4OO5 A;  1ZCP A;  1Z5Y E;  3HYP A;  11GS A;  5AIV A;  2FWE A;  2GSQ A;  1YKA A;  5IMC A;  1M2A A;  3JCM L;  2C1Y A;  2HXK A;  3TJB A;  1EEM A;  1FOV A;  2VL9 A;  4KSM A;  1XWG A;  3AY8 A;  1BYE A;  3VFI A;  2JSY A;  3KCM A;  4GCI A;  4ID0 A;  3HZ8 A;  1N8J A;  4HOJ A;  1DSB A;  1K3O A;  4AJ8 A;  5B8B A;  1QFN A;  4KB3 A;  4Q5Q A;  1BJX A;  2VL2 A;  1QUW A;  1R5P A;  2VM1 A;  3FR3 A;  3IOS A;  2G2Q A;  3BBY A;  5IMF A;  1N2A A;  3HY2 A;  5A4U A;  5F06 A;  1HYU A;  2QGV A;  2IMD A;  1Z3E A;  1TKD B;  3D22 A;  4ZBA A;  4JU5 A;  3WGD A;  2PER A;  2B7K A;  1X5E A;  2H1D A;  3TOT A;  3D21 A;  2H71 A;  3G7Y A;  4HU7 A;  1YY7 A;  2CA8 A;  3IK7 A;  4IJI A;  1O85 A;  3J7Y k;  1R26 A;  4CHS A;  2VCX A;  5ECH B;  1URM A;  1F6M C;  1PMT A;  5A4W A;  4PNF A;  3KMN A;  1HQO A;  4F2I A;  2LUS A;  1RK4 A;  4KDY A;  4BPY A;  2LRC A;  4KGI A;  1JZW A;  3QFB C;  4LLR A;  2K18 A;  1T4Z A;  2I4A A;  2M72 A;  4WBJ A;  7GSS A;  2FCH A;  3DD3 A;  3DEX A;  4N30 A;  3LXZ A;  1QXH A;  1TW9 A;  3F3R A;  1BG5 A;  2I3Y A;  4IVF A;  2GQK A;  3CRU A;  4MPF A;  3WYW A;  3QD9 A;  2X8H A;  2E7P A;  3GYK A;  3VWX A;  2RLI A;  1ERT A;  1GWC A;  4GSN A;  4GWR A;  4J56 E;  3DYR A;  4OO4 A;  3C7M A;  3ZRD A;  2WDU A;  3QFA C;  3ZFL A;  2NBS A;  4YAV A;  4K1F A;  5AIX A;  2GGT A;  1K0D A;  3GTU B;  2P5Q A;  1S3D A;  4GLT A;  3TJG A;  4K0G A;  2AB6 A;  3M3M A;  2TRX A;  1MD3 A;  1A0F A;  3HVV A;  1OVN A;  4HQS A;  2O8V B;  2FLS A;  1VF2 A;  2OKA A;  2MMA A;  2K8V A;  1SEN A;  4HEA 2;  2YWO A;  4K7N A;  2HT9 A;  1XFL A;  5D8I A;  3FK8 A;  4DSR A;  3ME8 A;  4WBR D;  2LJR A;  2LJA A;  4KND A;  1LBK A;  1B8X A;  2O87 A;  5GSS A;  4POL A;  1YJ6 A;  3GUR A;  2NPB A;  2CVD A;  5FT3 A;  2GZY A;  4MPG A;  1SJI A;  4IQA A;  4KSO A;  4ACS A;  2FA8 A;  5EY6 A;  1ML6 A;  4IEL A;  2VCV A;  1Z6M A;  4MZC A;  5IM9 A;  2IME A;  4AF2 A;  2CT6 A;  1XCC A;  3HXS A;  3UEM A;  1NHO A;  5EL8 A;  1QQ2 A;  2MYG A;  3TJF A;  5ECN B;  3F3Q A;  4NMU A;  3RBT A;  2AAW A;  1JFU A;  3KH7 A;  1XOA A;  4N11 A;  2H19 A;  3ED3 A;  2B7J A;  1GTU A;  2V2G A;  3HJM A;  3A3T A;  1K3L A;  2CZ3 A;  4I97 A;  1GL8 A;  1EP7 A;  3GX0 A;  3F8U A;  5GAP D;  3F63 A;  2F8A A;  1EZK A;  1AUC A;  2O7K A;  4LMV A;  1GSU A;  4IHU A;  3PH9 A;  5C04 A;  4ECB A;  4GXZ A;  1GSF A;  4I2U A;  3VI5 A;  5HQP A;  1O8X A;  4JED A;  1W89 A;  3M9J A;  4KE3 A;  5IQY A;  3KH9 A;  4DSS A;  4JRR A;  3A5W A;  2ZUP A;  5D96 A;  14GS A;  4FYU A;  2REM A;  1FW1 A;  4NV2 A;  4KCA A;  2JSZ A;  2WFC A;  4MAB A;  4GQC A;  1K0C A;  1K0B A;  2VM2 A;  3FZA A;  1ZL9 A;  4LL4 B;  5D73 A;  1U87 A;  4K9Z A;  4I2T A;  3F6F A;  2WS2 A;  5J9C A;  2YWI A;  4Z7X A;  5IOW A;  1EOG A;  1WRY A;  1DBY A;  1HNB A;  2H76 A;  3MWH A;  4L0U A;  1IYI A;  1B4Q A;  2PN8 A;  2GDR A;  1TRW A;  2E2M A;  2X8G A;  2IMK A;  3QR6 A;  4Q5N A;  4MF7 A;  3GIX A;  4TW5 A;  1ST9 A;  4O5R A;  2GQL A;  4AJ7 A;  2LRN A;  1ZGN A;  5GAN D;  2C3Q A;  4G2E A;  4MH3 A;  2YWN A;  5DBQ A;  1X5D A;  3N5O A;  2C4J A;  3CSI A;  5D9T A;  2OAC A;  3FHK A;  2CQ9 A;  2FWH A;  4MJC A;  5ELG A;  4CW9 A;  3FKF A;  3M1G A;  5DCG A;  4QQ7 A;  3E3E A;  4NHZ A;  4MLY A;  4V2L A;  2H75 A;  3CTF A;  1A2M A;  3FZ5 A;  1KEB A;  4KAE A;  1XBS A;  1Z7P A;  4ZIJ A;  4MP4 A;  2VLV A;  1QK8 A;  1RQM A;  4TVE A;  3EMX A;  10GS A;  3DIE A;  1TK8 B;  3TUE A;  3D0Z A;  5E59 A;  2LV3 A;  4WR5 A;  4ZXG A;  3KTB A;  4RI7 A;  1AIU A;  3I9V 2;  4EKZ A;  5CP1 A;  1YKC A;  4OCF A;  2ZCT A;  4QL7 A;  2LTK A;  2YZH A;  1SKR B;  4MZW A;  5COH A;  5KEJ A;  2A4V A;  1MEK A;  3ZVJ D;  2NVL A;  4IN0 A;  2CAI A;  3WGX A;  4TR1 A;  3KMO A;  1Q98 A;  5GST A;  2H73 A;  1FB6 A;  4BVX A;  2BTO T;  3KGK A;  5DCH A;  2MBS A;  4PQI A;  5EPF A;  1TDI A;  2OE3 A;  5G31 A;  3U5R E;  1K0N A;  1AW9 A;  3R2Q A;  2L4C A;  5GZZ B;  3TOU A;  3ZML A;  1AQX A;  3UVT A;  2YNX A;  4N10 A;  3DRN A;  1IYH A;  2OBI A;  1ILO A;  3HKR A;  1PL2 A;  2C3N A;  1TTZ A;  2G0F A;  3ERG A;  4WXT A;  2OE1 A;  1SU9 A;  3FR9 A;  1WMJ A;  3F4T A;  1EV9 A;  5J3R A;  1M0U A;  3GH6 A;  4G9H A;  4IQ1 A;  4D73 A;  1OYJ A;  1T1V A;  5EVO A;  4WKW A;  2GLR A;  2YWM A;  3TB2 A;  2V1M A;  1GRX A;  1EOH A;  1WP0 A;  1TP9 A;  2DJ2 A;  2DJ1 A;  1BED A;  5KN3 A;  1S3C A;  4YQU A;  2TIR A;  4MMM A;  2JU5 A;  3QAW A;  5JCW A;  4MA9 A;  2JAC A;  3GV1 A;  3GFK A;  5DJM A;  3CXG A;  4DSS B;  4TKY A;  1BX9 A;  1H4O A;  4X43 A;  5F07 A;  3GMF A;  2VO4 A;  4ULX A;  4WF4 A;  2YN1 A;  2AV4 A;  1OKT A;  1M9B A;  2H30 A;  1K0O A;  2H1B A;  2PMT A;  3EVI A;  3J7Y b;  3VWV A;  2CVB A;  5LCZ A;  20GS A;  4L5O A;  5INY A;  2FHE A;  3IBH A;  5H5Q A;  3IR4 A;  1KNG A;  4RUV A;  2H72 A;  13GS A;  1O73 A;  1OC3 A;  2HE3 A;  4TXV A;  4Q5F A;  4TN8 A;  4G10 A;  2OBK A;  4MF5 A;  4IKH A;  2XPE A;  1UA5 A;  2MMO A;  4POK A;  3EC3 A;  4RI6 A;  1UVZ A;  1EGR A;  4DSQ A;  3UJ1 A;  2F8F A;  1T00 A;  3GST A;  5E4W A;  1XWC A;  2A2R A;  2DMM A;  5ECI B;  3TCO A;  3F4R A;  3PR8 A;  1AAZ A;  4EE0 A;  2O89 A;  1ZOF A;  2DML A;  1GNW A;  3GL3 A;  3BD2 A;  2N5A A;  4IP1 A;  2H1G A;  4EL1 A;  4ML6 A;  3C1R A;  3CTG A;  1GSD A;  3TKS C;  2AYT A;  3Q18 A;  5KN0 A;  4LA1 A;  2LS5 A;  19GS A;  3VI7 A;  1WIK A;  2B1K A;  1DE2 A;  3APQ A;  3D6I A;  4YQM A;  1R4W A;  3HZ4 A;  4O7H A;  3QMX A;  3GKN A;  3GKK A;  2H74 A;  5LNK e;  2AUV A;  1U88 A;  5B6N A;  4EDZ A;  5AIS A;  1OAZ A;  4TR1 B;  1BQ7 A;  1R5A A;  4WR4 A;  2L5L A;  5DQY A;  3TKR A;  5DAL A;  5ELA A;  2KUC A;  4XHM A;  4ZB9 A;  4F0C A;  1AQW A;  4GTU A;  2H0H A;  2HZE A;  1O8W A;  3P8W A;  1ERW A;  1PL1 A;  3U6V A;  4V2M A;  2EC4 A;  3ERW A;  3GRX A;  2VL2 C;  1QGV A;  2H8L A;  3I69 A;  3W6G A;  3APS A;  1JHB A;  5D93 A;  1GTA A;  3UOM A;  3LJR A;  5ECP B;  2GQM A;  1ERU A;  5G1L A;  1G0T A;  3ERF A;  5DAK A;  1VF1 A;  4ZB8 A;  3W8S A;  6GSU A;  3KXO A;  2DIZ A;  4I5Q A;  3ZIT A;  1THX A;  3BCI A;  2K6V A;  4D73 B;  5KN2 A;  3GA4 A;  1USB A;  2V6K A;  2ZNM A;  1F2E A;  3WD6 A;  1AQV A;  1GSS A;  2P5R A;  4BVY A;  3HCZ A;  2K9F A;  2VCQ A;  1KBN A;  4FO5 A;  3DVX A;  4HZ4 A;  4K7O A;  8GSS A;  3MNG A;  5ECS A;  4J57 E;  4FYB A;  4YQV A;  1I9D A;  1TI3 A;  1T7P B;  3D5J A;  2C8U A;  4F82 A;  3EYT A;  3G7J A;  3CRT A;  2I81 A;  1T4Y A;  3H1N A;  3ZRE A;  3F4S A;  4OFN A;  2JZR A;  4ZL9 A;  3GNJ A;  2B1L A;  1S3A A;  2K8S A;  4L5L A;  3CSJ A;  5HR0 A;  4PUA A;  4XCS A;  1GLP A;  4I8B A;  3M9K A;  4O32 A;  5A4V A;  2YAN A;  3HA9 A;  3KIJ A;  4HS1 A;  2IN3 A;  1BAY A;  3LYP A;  5HR2 A;  4HZ2 A;  1GUH A;  6GSX A;  5JWQ B;  1E6B A;  1J9B A;  3QAV A;  4PQ1 A;  5ECO B;  4WF5 A;  5B6M A;  3GUS A;  2HRN A;  4BA7 A;  1V9W A;  2OAD A;  4FIW A;  2X8C A;  4RQX A;  3DKS A;  2BJX A;  4TR3 A;  2D2Z A;  3RHC A;  3E0U A;  1FVK A;  4KUN A;  1XVW A;  2KHP A;  4KA0 A;  1U3A A;  2J23 A;  3RHB A;  3RDW A;  2A2S A;  1HNC A;  3WT1 A;  4F03 A;  2CX3 A;  4QL9 A;  5ECK B;  3IE3 A;  1W4V A;  2M80 A;  2I9H A;  1XOB A;  1SYX A;  5IO2 A;  1PQN A;  1WPI A;  4MJB A;  4K0N A;  1O81 A;  1YDK A;  2WRT A;  5CRD A;  1ACV A;  2HI7 A;  3SBC A;  1VGL A;  1M9A A;  4MJE A;  2NTO A;  2R3X A;  18GS A;  2EIO A;  1RW1 A;  2KLX A;  2R4V A;  3EE2 A;  4MZB A;  2BMX A;  1PRX A;  2V32 A;  3FRC A;  1M99 A;  4NV5 A;  1JZR A;  4IS0 A;  3F6D A;  3TKS E;  2GTU A;  4RQR A;  2YJ7 A;  1XW9 A;  2PGT A;  2E0Q A;  2LRT A;  3H93 A;  3IC4 A;  3VLN A;  5JWR B;  2C80 A;  2Z9S A;  5DQS A;  1WWJ A;  3WGE A;  3EIN A;  3A2W A;  3UMA A;  3KZQ A;  1KTE A;  2C0G A;  1TOF A;  2GVP A;  3BJ5 A;  4P3Y B;  3FZ4 A;  4MDC A;  1JZD A;  2H0G A;  4EUY A;  2LQQ A;  2VCT A;  5DAL B;  3NOF A;  3I6A A;  2VLT A;  5AGY A;  2FUG 2;  1LJR A;  4HI7 A;  4Q5R A;  4V2N A;  2HZE B;  4ZB6 A;  1G6W A;  1PX6 A;  2DSA A;  3RAZ A;  3MDK A;  1EGO A;  4KH7 A;  4J2F A;  3LYK A;  3TKQ A;  1PKZ A;  2L57 A;  4JZQ A;  12GS A;  1A23 A;  1GTB A;  3UAP A;  2B3S A;  4ISD A;  2HRF A;  1M2B A;  3VK9 A;  4XS6 A;  5DAK B;  2PVQ A;  5L71 A;  3QPM A;  1PA3 A;  4N0V A;  1WJK A;  1XWK A;  4TR0 A;  4TOP A;  4EO3 A;  5CRG A;  2GSS A;  5J5N A;  4MF6 A;  4POB A;  4EF0 A;  3FZ9 A;  5AN1 A;  1X9M B;  1YQ1 A;  3TJJ A;  4POM A;  1GH2 A;  1B4P A;  2IJY A;  2PUK C;  5C00 A;  1U6T A;  2FA4 A;  3KEB A;  4L0W A;  2KP1 A;  3RPP A;  3FYG A;  3BOA A;  1Y6E A;  3HJO A;  2XBQ A;  3ISO A;  4NAX A;  4ML1 A;  5HFG A;  1Y25 A;  2H0I A;  2WB9 A;  2YJH A;  1MDI A;  1G7O A;  4KDU A;  1NW2 A;  5F0G A;  4FYC A;  4PX1 A;  4XIH A;  2IMI A;  1EWX A;  4IGJ A;  2EIQ A;  3P90 A;  3EMP A;  1Z9H A;  3ME7 A;  3L0H A;  1X9S B;  1TI1 A;  1GSY A;  3Q6O A;  5G30 A;  4PQH A;  4HU9 A;  2MMN A;  1ZZY A;  4F0B A;  1MDJ A;  1A2L A;  5HR1 A;  5KN1 A;  1SJZ A;  2H70 A;  5A5K A;  5J9B A;  2HYX A;  4YH2 A;  1ERV A;  5FHI A;  2DJ0 A;  1F37 A;  5IPG A;  4F9Z A;  1GP1 A;  3O3T A;  4ECC A;  2L59 A;  3H79 A;  1MTC A;  3L9U A;  2FWF A;  3TKP A;  3H4K A;  4BWS A;  1VF4 A;  4DEJ A;  1GTI A;  3CYN A;  3FY7 A;  2ON5 A;  1TK0 B;  3ZIJ A;  1SL0 B;  3VWW A;  2OA7 A;  3IAM 2;  5ID2 A;  1R7H A;  5ECR B;  2YOI A;  1SK0 A;  4X1U A;  2IPA A;  3LXT A;  2AHE A;  1SL2 B;  2M46 A;  4OCE A;  2CZ2 A;  3GL5 A;  4EC0 A;  4ZIL A;  3ZLP A;  1XW6 A;  3IXR A;  2V41 A;  2PU9 C;  1MD4 A;  2EIR A;  2DJ3 A;  4X0X A;  5CRE A;  2B5X A;  1F3A A;  3NZN A;  3HD5 A;  3FR6 A;  3VWU A;  5IO0 A;  2XPD A; 
#chains in the Genus database with same CATH topology
 3LGC A;  2TRC P;  16GS A;  2XBI A;  3MYD A;  2QKE A;  1A2J A;  3EUR A;  2MBT A;  1A24 A;  3NIV A;  4PNG A;  1B9Y C;  2VL3 A;  3KP9 A;  1PFO A;  3HVX A;  4PGT A;  2PVO C;  1F3B A;  2IMF A;  2PWJ A;  2LKU A;  1WOU A;  5ABR A;  2IWT A;  2KP2 A;  3VPT A;  3ZIV A;  1T8E B;  1TRS A;  3N9J A;  4IJ3 A;  2VD0 A;  4OWY A;  2P0G A;  2B6M A;  3C71 A;  1X9W B;  1Q4J A;  2C0F A;  4I6X A;  2OE0 A;  3RPN A;  4EDY A;  5F8B A;  1J08 A;  2I1U A;  2H1A A;  3UVH A;  1B48 A;  2MMZ A;  2LST A;  3ZYW A;  3BCK A;  6GSV A;  1Z7R A;  3P7X A;  3C8E A;  1YZX A;  4HDE A;  4Z2R A;  1EEJ A;  4GF0 A;  4PUF C;  4OFT A;  2CAQ A;  4TR4 A;  5ECL B;  5LD0 A;  4PUR A;  3WT2 A;  1UN2 A;  3F0I A;  5HFK A;  2GSR A;  1SK1 A;  1K0A A;  3DML A;  3KD0 A;  1FO5 A;  5FWG A;  3ZL5 A;  1TK5 B;  1ZMA A;  4DVC A;  1VF3 A;  1SD9 A;  2QA1 A;  1TRU A;  2RII A;  3Q19 A;  4WEY A;  3CMI A;  1TU7 A;  3ZTL A;  1FOH A;  3ZFB A;  1MDK A;  4CDO A;  3VUR A;  3QDN A;  2GT6 A;  3L9V A;  1J0F A;  4KX4 A;  2F9S A;  5B8A A;  2R6K A;  5DDL A;  1XPV A;  1FHE A;  2H6X A;  1ZYE A;  3KP8 A;  2H6Y A;  1XIY A;  2LNS A;  2VLU A;  1GSE A;  4MK3 A;  4V1A p;  2YZU A;  3Q74 A;  4K2D A;  4NXI A;  1AC1 A;  1GLQ A;  4GQF A;  1A8Y A;  2FWG A;  2L6C A;  1FVJ A;  4E8E A;  1V57 A;  1FAA A;  1Z6N A;  1V40 A;  3TRX A;  4PTS A;  2LEG A;  4ZBD A;  3UIW A;  3D4M A;  3C73 A;  2F3M A;  2VOC A;  3FW2 A;  2R5G A;  1TXX A;  3FEU A;  4EXJ A;  1NHY A;  4K6X A;  3E9J B;  1ABA A;  2H66 A;  5JCU A;  4TRX A;  4MCU A;  2ALB A;  3TRP A;  4OMV A;  5ENU A;  4WET A;  5DVB A;  1OKD A;  2WGR A;  3G7I A;  4TXO A;  5ECQ B;  1PKW A;  1OC9 A;  3ZVJ A;  17GS A;  5G5F A;  1XVQ A;  1JLV A;  1G7E A;  1HNA A;  1SL1 B;  3IK9 A;  1V2A A;  3EU4 A;  3UAR A;  3SWL A;  5IMV A;  3GHA A;  1EP8 A;  1XWA A;  4K8M A;  4NHW A;  1PSQ A;  1SK2 A;  2VAF A;  4ZL7 A;  3I43 A;  2VIM A;  5G2Z A;  3S9F A;  1XWB A;  3OR5 A;  1FG4 A;  3TGZ A;  3H8Q A;  5IOX A;  5ID2 B;  1M7T A;  3DWV A;  1TU8 A;  1JLW A;  4HJ2 A;  4XRD A;  1G6Y A;  2VCZ A;  3CBU A;  5H5S A;  3O76 A;  3MSZ A;  5J4U A;  3GX8 A;  2IFQ A;  2VCW A;  2V6O A;  1M3I A;  4N0Z A;  3P2A A;  1OE8 A;  6GSY A;  2PPT A;  1WE0 A;  3IHG A;  1HD2 A;  1I5G A;  6GST A;  1YEP A;  5HR3 A;  1B9X C;  3GN3 A;  3DXB A;  1THO A;  3DVW A;  4KW6 A;  5CAX A;  2RM5 A;  3TRQ A;  1O7U A;  4ECJ A;  4BWQ A;  4GRF A;  2B5E A;  3C1S A;  5IIZ A;  3K8N A;  3LWA A;  1K0M A;  6GSS A;  4MH2 A;  3CSH A;  2GT5 A;  1NM3 A;  4IW9 A;  3IPZ A;  1PGT A;  1SKW B;  4IBP A;  2DC5 A;  2YV9 A;  2YV7 A;  5CO3 A;  1T3B A;  3GKM A;  2DIY A;  1UC7 A;  2HSM A;  3G9B A;  1FB0 A;  4XRA A;  4G19 A;  2JZT A;  1U3I A;  4ECI A;  1VRS D;  1TJD A;  2ON7 A;  4K5S A;  4JBB A;  3IAS 2;  2QSI A;  1EV4 A;  4LL1 B;  3HVS A;  4V1A g;  5CNW A;  2H6Z A;  2FY6 A;  1CQH A;  1YEX A;  2DBC A;  2PBJ A;  4AGS A;  4XS4 A;  3L9S A;  1AXD A;  1PD2 1;  4HUA A;  5G5E A;  4E8H A;  3PIN A;  1OE7 A;  2WZ9 A;  4XS1 A;  2C0D A;  2DKH A;  2AJQ B;  1XXU A;  5JWO B;  3GH9 A;  3LFL A;  1C72 A;  4AJ6 A;  2N5B A;  1OC8 A;  1X5C A;  2L4Q A;  2DLX A;  3F9U A;  2L5O A;  5IMD A;  5IMZ A;  1X0R A;  3IA1 A;  5ECM B;  2H01 A;  2FGX A;  2E2G A;  4OFM A;  5B7C A;  1M2D A;  2CX4 A;  2C0E A;  1E2Y A;  5D9W A;  22GS A;  2GS3 A;  2J9H A;  2GZZ A;  1NSW A;  2HZF A;  2QC7 A;  4K7I A;  1O6J A;  4KDX A;  3KTL A;  1DUG A;  2HNL A;  5F05 A;  2RM6 A;  4TXO B;  2OJL A;  2WCI A;  2KOK A;  1LU4 A;  1OC9 B;  3KJY A;  2RUE A;  2ES7 A;  2X64 A;  5DJL A;  2R2J A;  2WJU A;  2C3T A;  3IRA A;  4JR6 A;  3L78 A;  1JZO A;  4MJA A;  3O6T A;  3A2V A;  2IIY A;  2R0G A;  3LQ7 A;  1SKS B;  3IDV A;  4HJM A;  4JE1 A;  1QMV A;  2MZC A;  3HJP A;  3LOR A;  2JL4 A;  3LEF A;  2JZS A;  2XC2 A;  1PN9 A;  1V58 A;  4XTS A;  4GST A;  2DJJ A;  3DGQ A;  3L4N A;  3ZZX A;  2L6D A;  1YF0 A;  5G1K A;  3KM6 A;  4NPB A;  3UBK A;  4USS A;  1XG8 A;  2HRK A;  3V1W A;  5CYY A;  2IFQ B;  3US3 A;  1A0R P;  2HSH A;  5JCG A;  4IP6 A;  2X99 A;  9GSS A;  3EU3 A;  2YP6 A;  3HHV A;  1YF1 A;  5D9X A;  1A8L A;  2GZP A;  5IMA A;  2FNO A;  1ZYQ B;  1GUM A;  1XZO A;  2JAD A;  1GSQ A;  1ON4 A;  3IHQ A;  3UL3 A;  3QCP A;  4YAP A;  5HFI A;  4OD7 A;  2DJK A;  3GKX A;  4LMW A;  3UBL A;  5CRH A;  2B5Y A;  3APO A;  2LJK A;  2FD3 A;  4L8E A;  5J41 A;  4H86 A;  5D9V A;  3QAG A;  2N5F A;  2CV4 A;  2XHF A;  2P31 A;  3VPQ A;  3GSS A;  2GST A;  1SYR A;  1V98 A;  2CVK A;  4YKF A;  3TJK A;  2IL3 A;  2LQO A;  2VUP A;  3GTU A;  1H75 A;  1GUL A;  4EVM A;  2VD1 A;  4GSS A;  4O5Q A;  1K3Y A;  3MAK A;  3IV4 A;  1SD8 A;  4ZL8 A;  4KCE A;  6GSW A;  4JR4 A;  4BL7 A;  3LG6 A;  1GUK A;  1SJ6 A;  2YPM A;  4FH8 A;  3LSZ A;  2HSY A;  4XS4 B;  5IPH A;  1GNE A;  2YCD A;  2HLS A;  3M0F A;  1TRV A;  4O92 A;  2LNT A;  3QOU A;  3A2X A;  1F9M A;  3PGT A;  2O85 A;  1CQG A;  3M8N A;  3TKS A;  4K2X A;  2NDO A;  4ZBB A;  4PXO A;  3W8J A;  3TDG A;  3EWL A;  2HFD A;  4NWY A;  3D4T A;  5CRW A;  4HQZ A;  2R0P A;  4ILF A;  5H5R A;  2RUF A;  1PX7 A;  3ZMK A;  3HDC A;  2WUL A;  2R37 A;  2F51 A;  1DE1 A;  1XW5 A;  4OO5 A;  1ZCP A;  1Z5Y E;  3HYP A;  11GS A;  5AIV A;  2FWE A;  2GSQ A;  1YKA A;  5IMC A;  1M2A A;  3JCM L;  2C1Y A;  2HXK A;  3TJB A;  1EEM A;  1FOV A;  2VL9 A;  4KSM A;  1XWG A;  3AY8 A;  1BYE A;  3VFI A;  2JSY A;  3KCM A;  4GCI A;  4ID0 A;  3HZ8 A;  1N8J A;  4HOJ A;  1DSB A;  1K3O A;  4AJ8 A;  5B8B A;  1QFN A;  4KB3 A;  4Q5Q A;  1BJX A;  2VL2 A;  1QUW A;  1R5P A;  2VM1 A;  3FR3 A;  3IOS A;  2G2Q A;  3BBY A;  5IMF A;  1N2A A;  3HY2 A;  5A4U A;  5F06 A;  1HYU A;  2QGV A;  2IMD A;  1Z3E A;  4FQU A;  1TKD B;  3D22 A;  2X4A A;  4ZBA A;  4JU5 A;  3WGD A;  2PER A;  2B7K A;  1X5E A;  2H1D A;  3TOT A;  3D21 A;  2H71 A;  3G7Y A;  4HU7 A;  1YY7 A;  2CA8 A;  3IK7 A;  4IJI A;  1O85 A;  3J7Y k;  1R26 A;  4CHS A;  2VCX A;  5ECH B;  1URM A;  1F6M C;  1PMT A;  5A4W A;  4PNF A;  3KMN A;  1HQO A;  4F2I A;  2LUS A;  1RK4 A;  4KDY A;  4BPY A;  4K5R A;  2LRC A;  4KGI A;  1JZW A;  3QFB C;  4LLR A;  2K18 A;  1T4Z A;  2I4A A;  2M72 A;  4WBJ A;  7GSS A;  2FCH A;  3DD3 A;  3DEX A;  4N30 A;  3LXZ A;  1QXH A;  1TW9 A;  3F3R A;  1BG5 A;  2I3Y A;  4IVF A;  2GQK A;  3CRU A;  4MPF A;  3WYW A;  2R0C A;  3QD9 A;  2X8H A;  1ZYP A;  2E7P A;  3GYK A;  3VWX A;  2RLI A;  1ERT A;  1GWC A;  4GSN A;  4GWR A;  4J56 E;  3DYR A;  4OO4 A;  3C7M A;  3ZRD A;  2WDU A;  3QFA C;  3ZFL A;  2NBS A;  4YAV A;  4K1F A;  5AIX A;  2GGT A;  1K0D A;  3GTU B;  2P5Q A;  1S3D A;  4GLT A;  3TJG A;  4K0G A;  2UZ8 A;  2AB6 A;  3M3M A;  2TRX A;  1MD3 A;  1A0F A;  3HVV A;  1OVN A;  4HQS A;  2O8V B;  2FLS A;  1VF2 A;  2OKA A;  2MMA A;  2K8V A;  4BL7 B;  1SEN A;  4HEA 2;  2YWO A;  4K7N A;  4G0L A;  2HT9 A;  1XFL A;  5D8I A;  3FK8 A;  4DSR A;  3ME8 A;  4WBR D;  2LJR A;  2LJA A;  4KND A;  1LBK A;  1B8X A;  2O87 A;  5GSS A;  4POL A;  2DKI A;  3MIX A;  1YJ6 A;  3GUR A;  2NPB A;  2CVD A;  5FT3 A;  2GZY A;  4MPG A;  1SJI A;  4IQA A;  4KSO A;  4ACS A;  2FA8 A;  5EY6 A;  1ML6 A;  4IEL A;  2VCV A;  1Z6M A;  4MZC A;  5IM9 A;  2IME A;  4AF2 A;  2CT6 A;  1XCC A;  3HXS A;  3UEM A;  1NHO A;  5EL8 A;  1QQ2 A;  2MYG A;  3TJF A;  5ECN B;  3F3Q A;  4NMU A;  3RBT A;  2AAW A;  1JFU A;  3KH7 A;  1XOA A;  4N11 A;  2H19 A;  3ED3 A;  2B7J A;  1GTU A;  2V2G A;  3HJM A;  3A3T A;  1K3L A;  2CZ3 A;  4I97 A;  1GL8 A;  1EP7 A;  3GX0 A;  3F8U A;  5GAP D;  4CY8 A;  3F63 A;  2F8A A;  1EZK A;  1AUC A;  4YKG A;  2O7K A;  4LMV A;  1GSU A;  4IHU A;  3PH9 A;  5C04 A;  4ECB A;  4HSC X;  4GXZ A;  1GSF A;  4I2U A;  3VI5 A;  5HQP A;  1O8X A;  4JED A;  1W89 A;  3M9J A;  4KE3 A;  5IQY A;  3KH9 A;  4DSS A;  4JRR A;  3A5W A;  2ZUP A;  5D96 A;  14GS A;  4FYU A;  2REM A;  1FW1 A;  4NV2 A;  4KCA A;  2JSZ A;  2WFC A;  3EPT A;  4MAB A;  4GQC A;  1K0C A;  1K0B A;  2VM2 A;  3FZA A;  5KOW A;  1ZL9 A;  4LL4 B;  5D73 A;  1U87 A;  4K9Z A;  4I2T A;  3F6F A;  2WS2 A;  5J9C A;  2YWI A;  4Z7X A;  5IOW A;  1EOG A;  1WRY A;  1DBY A;  1HNB A;  2H76 A;  3MWH A;  4L0U A;  1IYI A;  1B4Q A;  2X49 A;  2PN8 A;  2GDR A;  1TRW A;  2E2M A;  2X8G A;  2IMK A;  3QR6 A;  4Q5N A;  4MF7 A;  3GIX A;  4TW5 A;  1ST9 A;  4O5R A;  2GQL A;  4AJ7 A;  2LRN A;  1ZGN A;  5GAN D;  2C3Q A;  4G2E A;  4MH3 A;  2YWN A;  5DBQ A;  4EIP A;  1X5D A;  3N5O A;  3LW9 A;  2C4J A;  3CSI A;  5D9T A;  2OAC A;  3FHK A;  2QA2 A;  2CQ9 A;  2FWH A;  4MJC A;  5ELG A;  4CW9 A;  3FKF A;  3M1G A;  5DCG A;  4QQ7 A;  3E3E A;  4NHZ A;  4MLY A;  4V2L A;  2H75 A;  3CTF A;  1A2M A;  3FZ5 A;  1KEB A;  4KAE A;  1XBS A;  1Z7P A;  4ZIJ A;  4MP4 A;  2VLV A;  1QK8 A;  1RQM A;  4TVE A;  3EMX A;  10GS A;  3DIE A;  1TK8 B;  3TUE A;  3D0Z A;  4Z2U A;  5E59 A;  2LV3 A;  4WR5 A;  4ZXG A;  3KTB A;  4RI7 A;  1AIU A;  3I9V 2;  4EKZ A;  5CP1 A;  1YKC A;  4OCF A;  2ZCT A;  4QL7 A;  2LTK A;  2YZH A;  5BMU A;  1SKR B;  2A4H A;  4MZW A;  5COH A;  5KEJ A;  2A4V A;  1MEK A;  3ZVJ D;  2NVL A;  4IN0 A;  2CAI A;  3A5I A;  3WGX A;  4TR1 A;  3KMO A;  1Q98 A;  5GST A;  2H73 A;  1FB6 A;  4BVX A;  2BTO T;  3KGK A;  5DCH A;  2MBS A;  4ICY A;  4PQI A;  5EPF A;  1TDI A;  2OE3 A;  5G31 A;  3U5R E;  1K0N A;  1AW9 A;  3R2Q A;  2L4C A;  5GZZ B;  3TOU A;  3ZML A;  1AQX A;  3UVT A;  2YNX A;  4N10 A;  3DRN A;  1IYH A;  2OBI A;  1ILO A;  3HKR A;  1PL2 A;  2C3N A;  1TTZ A;  2G0F A;  3ERG A;  4WXT A;  2OE1 A;  1SU9 A;  3HVN A;  3FR9 A;  1WMJ A;  3F4T A;  1EV9 A;  5J3R A;  1M0U A;  3GH6 A;  4G9H A;  4IQ1 A;  4D73 A;  1OYJ A;  1T1V A;  5EVO A;  4WKW A;  2GLR A;  2YWM A;  3TB2 A;  2V1M A;  1GRX A;  1EOH A;  1WP0 A;  4X4J A;  1TP9 A;  2DJ2 A;  2DJ1 A;  1BED A;  5KN3 A;  1S3C A;  3CQF A;  4YQU A;  2TIR A;  2A2P A;  4MMM A;  2JU5 A;  3QAW A;  5JCW A;  4MA9 A;  2JAC A;  3GV1 A;  3GFK A;  2HRA A;  5DJM A;  3CXG A;  4DSS B;  4MNN A;  4TKY A;  1BX9 A;  1H4O A;  4X43 A;  5F07 A;  3GMF A;  2VO4 A;  4ULX A;  4WF4 A;  2YN1 A;  2AV4 A;  1OKT A;  1M9B A;  2H30 A;  1K0O A;  2H1B A;  2PMT A;  3EVI A;  3J7Y b;  3VWV A;  2CVB A;  5LCZ A;  20GS A;  4L5O A;  5INY A;  2FHE A;  3IBH A;  5H5Q A;  3IR4 A;  1KNG A;  4RUV A;  2H72 A;  13GS A;  1O73 A;  1OC3 A;  2HE3 A;  4TXV A;  4Q5F A;  4TN8 A;  4CY6 A;  4G10 A;  2OBK A;  4MF5 A;  4IKH A;  2XPE A;  1UA5 A;  2MMO A;  4POK A;  4A5P A;  1M3J A;  3EC3 A;  4RI6 A;  1UVZ A;  1EGR A;  4G0I A;  4DSQ A;  3UJ1 A;  2F8F A;  1T00 A;  3GST A;  5E4W A;  1XWC A;  2A2R A;  2DMM A;  5ECI B;  3TCO A;  3F4R A;  3PR8 A;  1AAZ A;  4EE0 A;  2O89 A;  1ZOF A;  2DML A;  1GNW A;  3GL3 A;  3BD2 A;  2N5A A;  4G0K A;  4IP1 A;  2H1G A;  4EL1 A;  4ML6 A;  3C1R A;  3CTG A;  1GSD A;  3TKS C;  2AYT A;  3Q18 A;  5KN0 A;  4LA1 A;  2LS5 A;  19GS A;  3VI7 A;  1WIK A;  2B1K A;  1DE2 A;  3APQ A;  3D6I A;  4YQM A;  1R4W A;  3HZ4 A;  4O7H A;  3QMX A;  3GKN A;  3GKK A;  2H74 A;  5LNK e;  2AUV A;  1U88 A;  5B6N A;  4EDZ A;  5AIS A;  1OAZ A;  4TR1 B;  1BQ7 A;  1R5A A;  4WR4 A;  2L5L A;  5DQY A;  3TKR A;  5DAL A;  5ELA A;  2KUC A;  4BVX B;  4XHM A;  4ZB9 A;  4F0C A;  1AQW A;  4GTU A;  2H0H A;  2HZE A;  1O8W A;  3P8W A;  1ERW A;  1PL1 A;  3U6V A;  4V2M A;  2EC4 A;  3ERW A;  3GRX A;  2VL2 C;  1QGV A;  2H8L A;  3I69 A;  3W6G A;  3APS A;  1JHB A;  5D93 A;  1GTA A;  3UOM A;  3LJR A;  5ECP B;  2GQM A;  1ZYN A;  1ERU A;  5G1L A;  1G0T A;  3ERF A;  5DAK A;  1VF1 A;  4ZB8 A;  3W8S A;  6GSU A;  4BIK A;  3KXO A;  2DIZ A;  4I5Q A;  3ZIT A;  1THX A;  3BCI A;  2K6V A;  4D73 B;  5KN2 A;  3GA4 A;  1USB A;  2V6K A;  2ZNM A;  1F2E A;  3WD6 A;  1AQV A;  1GSS A;  2P5R A;  4BVY A;  3HCZ A;  2K9F A;  2VCQ A;  1KBN A;  4FO5 A;  3DVX A;  4HZ4 A;  4K7O A;  8GSS A;  3MNG A;  5ECS A;  4J57 E;  4FYB A;  4YQV A;  1I9D A;  1TI3 A;  1T7P B;  3D5J A;  2C8U A;  4F82 A;  3EYT A;  3G7J A;  3CRT A;  2I81 A;  1T4Y A;  3H1N A;  3ZRE A;  3F4S A;  5BRT A;  4OFN A;  2JZR A;  4ZL9 A;  3GNJ A;  2B1L A;  1S3A A;  2K8S A;  4L5L A;  3CSJ A;  5HR0 A;  4O5U A;  4PUA A;  4XCS A;  1GLP A;  4I8B A;  3M9K A;  4O32 A;  5A4V A;  2YAN A;  3HA9 A;  3KIJ A;  4HS1 A;  2IN3 A;  1BAY A;  3LYP A;  5HR2 A;  4HZ2 A;  1GUH A;  6GSX A;  5JWQ B;  1E6B A;  1J9B A;  3QAV A;  4PQ1 A;  5ECO B;  4WF5 A;  5B6M A;  3GUS A;  2HRN A;  4BA7 A;  1V9W A;  2OAD A;  4FIW A;  2X8C A;  4RQX A;  3FMW A;  3DKS A;  2BJX A;  4TR3 A;  2D2Z A;  3RHC A;  3E0U A;  1FVK A;  1S3R A;  4KUN A;  1XVW A;  5KOX A;  2KHP A;  4KA0 A;  1U3A A;  2J23 A;  3RHB A;  3RDW A;  2A2S A;  1HNC A;  3WT1 A;  4F03 A;  2CX3 A;  4QL9 A;  5ECK B;  3IE3 A;  1W4V A;  2M80 A;  2I9H A;  1XOB A;  1SYX A;  5IO2 A;  1PQN A;  1WPI A;  4MJB A;  4K0N A;  1O81 A;  1YDK A;  2WRT A;  5CRD A;  1ACV A;  2HI7 A;  3SBC A;  1VGL A;  1M9A A;  4MJE A;  2NTO A;  2R3X A;  18GS A;  2EIO A;  1RW1 A;  2KLX A;  2R4V A;  3EE2 A;  4MZB A;  2BMX A;  1PRX A;  2V32 A;  3FRC A;  1M99 A;  4NV5 A;  1JZR A;  4IS0 A;  3F6D A;  3PPU A;  3TKS E;  2GTU A;  4RQR A;  2YJ7 A;  1XW9 A;  2PGT A;  2E0Q A;  2LRT A;  3H93 A;  3IC4 A;  3VLN A;  5JWR B;  2C80 A;  2Z9S A;  5DQS A;  1WWJ A;  3WGE A;  3EIN A;  3A2W A;  3UMA A;  3KZQ A;  1KTE A;  2C0G A;  1TOF A;  2GVP A;  3BJ5 A;  4P3Y B;  3FZ4 A;  4MDC A;  1JZD A;  2H0G A;  4EUY A;  2LQQ A;  2VCT A;  5DAL B;  3NOF A;  3I6A A;  2VLT A;  5AGY A;  2FUG 2;  1LJR A;  4HI7 A;  4Q5R A;  4V2N A;  2HZE B;  4ZB6 A;  1G6W A;  1PX6 A;  2DSA A;  3RAZ A;  3MDK A;  1EGO A;  4KH7 A;  4J2F A;  3LYK A;  3TKQ A;  1PKZ A;  2L57 A;  4JZQ A;  12GS A;  1A23 A;  1GTB A;  3UAP A;  2B3S A;  4ISD A;  2HRF A;  1M2B A;  3VK9 A;  4XS6 A;  5DAK B;  2PVQ A;  5L71 A;  3QPM A;  1PA3 A;  4N0V A;  1WJK A;  1XWK A;  4TR0 A;  4TOP A;  4EO3 A;  5CRG A;  4BVY B;  2GSS A;  5J5N A;  4MF6 A;  4POB A;  4EF0 A;  3FZ9 A;  5AN1 A;  1X9M B;  1YQ1 A;  3TJJ A;  4POM A;  1GH2 A;  1B4P A;  2IJY A;  2PUK C;  5C00 A;  1U6T A;  2FA4 A;  3KEB A;  4L0W A;  2KP1 A;  3RPP A;  3FYG A;  3BOA A;  1Y6E A;  3HJO A;  2XBQ A;  3ISO A;  4NAX A;  4ML1 A;  4KF9 A;  5HFG A;  1Y25 A;  2H0I A;  2WB9 A;  2YJH A;  1MDI A;  1G7O A;  4KDU A;  1NW2 A;  5F0G A;  4FYC A;  4PX1 A;  4XIH A;  2IMI A;  1EWX A;  4IGJ A;  2EIQ A;  3P90 A;  3EMP A;  1Z9H A;  3ME7 A;  3L0H A;  1X9S B;  1TI1 A;  1GSY A;  3Q6O A;  5G30 A;  4PQH A;  4HU9 A;  2MMN A;  1ZZY A;  4F0B A;  1MDJ A;  1A2L A;  5HR1 A;  5KN1 A;  1SJZ A;  2H70 A;  5A5K A;  5J9B A;  2HYX A;  4YH2 A;  1ERV A;  5FHI A;  2DJ0 A;  1F37 A;  5IPG A;  4F9Z A;  1GP1 A;  3O3T A;  4ECC A;  2L59 A;  3H79 A;  1MTC A;  3L9U A;  2FWF A;  3TKP A;  3H4K A;  1PN0 A;  1VF4 A;  4BWS A;  4DEJ A;  1GTI A;  3CYN A;  3FY7 A;  2ON5 A;  1TK0 B;  3ZIJ A;  1SL0 B;  3VWW A;  2OA7 A;  3IAM 2;  5ID2 A;  1R7H A;  5ECR B;  2YOI A;  1SK0 A;  4X1U A;  2IPA A;  3LXT A;  2AHE A;  1SL2 B;  2M46 A;  4OCE A;  2CZ2 A;  3GL5 A;  4EIQ A;  4EC0 A;  4ZIL A;  3ZLP A;  4Z2T A;  1XW6 A;  3IXR A;  2V41 A;  2PU9 C;  1MD4 A;  2EIR A;  2DJ3 A;  4X0X A;  3IC8 A;  5CRE A;  3R3E A;  2B5X A;  1F3A A;  3NZN A;  3HD5 A;  3FR6 A;  3VWU A;  5IO0 A;  2XPD A; 
#chains in the Genus database with same CATH homology
 3LGC A;  2TRC P;  16GS A;  2XBI A;  3MYD A;  2QKE A;  1A2J A;  3EUR A;  2MBT A;  1A24 A;  3NIV A;  4PNG A;  1B9Y C;  2VL3 A;  3KP9 A;  3HVX A;  4PGT A;  2PVO C;  1F3B A;  2IMF A;  2PWJ A;  2LKU A;  1WOU A;  5ABR A;  2IWT A;  2KP2 A;  3VPT A;  3ZIV A;  1T8E B;  1TRS A;  3N9J A;  4IJ3 A;  2VD0 A;  4OWY A;  2P0G A;  2B6M A;  3C71 A;  1X9W B;  1Q4J A;  2C0F A;  4I6X A;  2OE0 A;  3RPN A;  4EDY A;  5F8B A;  1J08 A;  2I1U A;  2H1A A;  3UVH A;  1B48 A;  2MMZ A;  2LST A;  3ZYW A;  3BCK A;  6GSV A;  1Z7R A;  3P7X A;  3C8E A;  1YZX A;  4HDE A;  4Z2R A;  1EEJ A;  4GF0 A;  4PUF C;  4OFT A;  2CAQ A;  4TR4 A;  5ECL B;  5LD0 A;  4PUR A;  3WT2 A;  1UN2 A;  3F0I A;  5HFK A;  2GSR A;  1SK1 A;  1K0A A;  3DML A;  3KD0 A;  1FO5 A;  5FWG A;  3ZL5 A;  1TK5 B;  1ZMA A;  4DVC A;  1VF3 A;  1SD9 A;  2QA1 A;  1TRU A;  2RII A;  3Q19 A;  4WEY A;  3CMI A;  1TU7 A;  3ZTL A;  1FOH A;  3ZFB A;  1MDK A;  4CDO A;  3VUR A;  3QDN A;  2GT6 A;  3L9V A;  1J0F A;  4KX4 A;  2F9S A;  5B8A A;  2R6K A;  5DDL A;  1XPV A;  1FHE A;  2H6X A;  1ZYE A;  3KP8 A;  2H6Y A;  1XIY A;  2LNS A;  2VLU A;  1GSE A;  4MK3 A;  4V1A p;  2YZU A;  3Q74 A;  4K2D A;  4NXI A;  1AC1 A;  1GLQ A;  4GQF A;  1A8Y A;  2FWG A;  2L6C A;  1FVJ A;  4E8E A;  1V57 A;  1FAA A;  1Z6N A;  1V40 A;  3TRX A;  4PTS A;  2LEG A;  4ZBD A;  3UIW A;  3D4M A;  3C73 A;  2F3M A;  2VOC A;  3FW2 A;  2R5G A;  1TXX A;  3FEU A;  4EXJ A;  1NHY A;  4K6X A;  3E9J B;  1ABA A;  2H66 A;  5JCU A;  4TRX A;  4MCU A;  2ALB A;  3TRP A;  4OMV A;  5ENU A;  4WET A;  5DVB A;  1OKD A;  2WGR A;  3G7I A;  4TXO A;  5ECQ B;  1PKW A;  1OC9 A;  3ZVJ A;  17GS A;  5G5F A;  1XVQ A;  1JLV A;  1G7E A;  1HNA A;  1SL1 B;  3IK9 A;  1V2A A;  3EU4 A;  3UAR A;  3SWL A;  5IMV A;  3GHA A;  1EP8 A;  1XWA A;  4K8M A;  4NHW A;  1PSQ A;  1SK2 A;  2VAF A;  4ZL7 A;  3I43 A;  2VIM A;  5G2Z A;  3S9F A;  1XWB A;  3OR5 A;  1FG4 A;  3TGZ A;  3H8Q A;  5IOX A;  5ID2 B;  1M7T A;  3DWV A;  1TU8 A;  1JLW A;  4HJ2 A;  4XRD A;  1G6Y A;  2VCZ A;  3CBU A;  5H5S A;  3O76 A;  3MSZ A;  5J4U A;  3GX8 A;  2IFQ A;  2VCW A;  2V6O A;  4N0Z A;  3P2A A;  1OE8 A;  6GSY A;  2PPT A;  1WE0 A;  3IHG A;  1HD2 A;  1I5G A;  6GST A;  1YEP A;  5HR3 A;  1B9X C;  3GN3 A;  3DXB A;  1THO A;  3DVW A;  4KW6 A;  5CAX A;  2RM5 A;  3TRQ A;  1O7U A;  4ECJ A;  4BWQ A;  4GRF A;  2B5E A;  3C1S A;  5IIZ A;  3K8N A;  3LWA A;  1K0M A;  6GSS A;  4MH2 A;  3CSH A;  2GT5 A;  1NM3 A;  4IW9 A;  3IPZ A;  1PGT A;  1SKW B;  4IBP A;  2DC5 A;  2YV9 A;  2YV7 A;  5CO3 A;  1T3B A;  3GKM A;  2DIY A;  1UC7 A;  2HSM A;  3G9B A;  1FB0 A;  4XRA A;  4G19 A;  2JZT A;  1U3I A;  4ECI A;  1VRS D;  1TJD A;  2ON7 A;  4K5S A;  4JBB A;  3IAS 2;  2QSI A;  1EV4 A;  4LL1 B;  3HVS A;  4V1A g;  5CNW A;  2H6Z A;  2FY6 A;  1CQH A;  1YEX A;  2DBC A;  2PBJ A;  4AGS A;  4XS4 A;  3L9S A;  1AXD A;  1PD2 1;  4HUA A;  5G5E A;  4E8H A;  3PIN A;  1OE7 A;  2WZ9 A;  4XS1 A;  2C0D A;  2DKH A;  2AJQ B;  1XXU A;  5JWO B;  3GH9 A;  3LFL A;  1C72 A;  4AJ6 A;  2N5B A;  1OC8 A;  1X5C A;  2L4Q A;  2DLX A;  3F9U A;  2L5O A;  5IMD A;  5IMZ A;  1X0R A;  3IA1 A;  5ECM B;  2H01 A;  2FGX A;  2E2G A;  4OFM A;  5B7C A;  1M2D A;  2CX4 A;  2C0E A;  1E2Y A;  5D9W A;  22GS A;  2GS3 A;  2J9H A;  2GZZ A;  1NSW A;  2HZF A;  2QC7 A;  4K7I A;  1O6J A;  4KDX A;  3KTL A;  1DUG A;  2HNL A;  5F05 A;  2RM6 A;  4TXO B;  2OJL A;  2WCI A;  2KOK A;  1LU4 A;  1OC9 B;  3KJY A;  2RUE A;  2ES7 A;  2X64 A;  5DJL A;  2R2J A;  2WJU A;  2C3T A;  3IRA A;  4JR6 A;  3L78 A;  1JZO A;  4MJA A;  3O6T A;  3A2V A;  2IIY A;  2R0G A;  3LQ7 A;  1SKS B;  3IDV A;  4HJM A;  4JE1 A;  1QMV A;  2MZC A;  3HJP A;  3LOR A;  2JL4 A;  3LEF A;  2JZS A;  2XC2 A;  1PN9 A;  1V58 A;  4XTS A;  4GST A;  2DJJ A;  3DGQ A;  3L4N A;  3ZZX A;  2L6D A;  1YF0 A;  5G1K A;  3KM6 A;  4NPB A;  3UBK A;  4USS A;  2HRK A;  3V1W A;  5CYY A;  2IFQ B;  3US3 A;  1A0R P;  2HSH A;  5JCG A;  4IP6 A;  2X99 A;  9GSS A;  3EU3 A;  2YP6 A;  3HHV A;  1YF1 A;  5D9X A;  1A8L A;  2GZP A;  5IMA A;  2FNO A;  1ZYQ B;  1GUM A;  1XZO A;  2JAD A;  1GSQ A;  1ON4 A;  3IHQ A;  3UL3 A;  3QCP A;  4YAP A;  5HFI A;  4OD7 A;  2DJK A;  3GKX A;  4LMW A;  3UBL A;  5CRH A;  2B5Y A;  3APO A;  2LJK A;  2FD3 A;  4L8E A;  5J41 A;  4H86 A;  5D9V A;  3QAG A;  2N5F A;  2CV4 A;  2XHF A;  2P31 A;  3VPQ A;  3GSS A;  2GST A;  1SYR A;  1V98 A;  2CVK A;  4YKF A;  3TJK A;  2IL3 A;  2LQO A;  2VUP A;  3GTU A;  1H75 A;  1GUL A;  4EVM A;  2VD1 A;  4GSS A;  4O5Q A;  1K3Y A;  3MAK A;  3IV4 A;  1SD8 A;  4ZL8 A;  4KCE A;  6GSW A;  4JR4 A;  4BL7 A;  3LG6 A;  1GUK A;  1SJ6 A;  2YPM A;  4FH8 A;  3LSZ A;  2HSY A;  4XS4 B;  5IPH A;  1GNE A;  2YCD A;  2HLS A;  3M0F A;  1TRV A;  4O92 A;  2LNT A;  3QOU A;  3A2X A;  1F9M A;  3PGT A;  2O85 A;  1CQG A;  3M8N A;  3TKS A;  4K2X A;  2NDO A;  4ZBB A;  4PXO A;  3W8J A;  3TDG A;  3EWL A;  2HFD A;  4NWY A;  3D4T A;  5CRW A;  4HQZ A;  2R0P A;  4ILF A;  5H5R A;  2RUF A;  1PX7 A;  3ZMK A;  3HDC A;  2WUL A;  2R37 A;  2F51 A;  1DE1 A;  1XW5 A;  4OO5 A;  1ZCP A;  1Z5Y E;  3HYP A;  11GS A;  5AIV A;  2FWE A;  2GSQ A;  1YKA A;  5IMC A;  1M2A A;  3JCM L;  2C1Y A;  2HXK A;  3TJB A;  1EEM A;  1FOV A;  2VL9 A;  4KSM A;  1XWG A;  3AY8 A;  1BYE A;  3VFI A;  2JSY A;  3KCM A;  4GCI A;  4ID0 A;  3HZ8 A;  1N8J A;  4HOJ A;  1DSB A;  1K3O A;  4AJ8 A;  5B8B A;  1QFN A;  4KB3 A;  4Q5Q A;  1BJX A;  2VL2 A;  1QUW A;  1R5P A;  2VM1 A;  3FR3 A;  3IOS A;  2G2Q A;  3BBY A;  5IMF A;  1N2A A;  3HY2 A;  5A4U A;  5F06 A;  1HYU A;  2QGV A;  2IMD A;  1Z3E A;  4FQU A;  1TKD B;  3D22 A;  2X4A A;  4ZBA A;  4JU5 A;  3WGD A;  2PER A;  2B7K A;  1X5E A;  2H1D A;  3TOT A;  3D21 A;  2H71 A;  3G7Y A;  4HU7 A;  1YY7 A;  2CA8 A;  3IK7 A;  4IJI A;  1O85 A;  3J7Y k;  1R26 A;  4CHS A;  2VCX A;  5ECH B;  1URM A;  1F6M C;  1PMT A;  5A4W A;  4PNF A;  3KMN A;  1HQO A;  4F2I A;  2LUS A;  1RK4 A;  4KDY A;  4BPY A;  4K5R A;  2LRC A;  4KGI A;  1JZW A;  3QFB C;  4LLR A;  2K18 A;  1T4Z A;  2I4A A;  2M72 A;  4WBJ A;  7GSS A;  2FCH A;  3DD3 A;  3DEX A;  4N30 A;  3LXZ A;  1QXH A;  1TW9 A;  3F3R A;  1BG5 A;  2I3Y A;  4IVF A;  2GQK A;  3CRU A;  4MPF A;  3WYW A;  2R0C A;  3QD9 A;  2X8H A;  1ZYP A;  2E7P A;  3GYK A;  3VWX A;  2RLI A;  1ERT A;  1GWC A;  4GSN A;  4GWR A;  4J56 E;  3DYR A;  4OO4 A;  3C7M A;  3ZRD A;  2WDU A;  3QFA C;  3ZFL A;  2NBS A;  4YAV A;  4K1F A;  5AIX A;  2GGT A;  1K0D A;  3GTU B;  2P5Q A;  1S3D A;  4GLT A;  3TJG A;  4K0G A;  2UZ8 A;  2AB6 A;  3M3M A;  2TRX A;  1MD3 A;  1A0F A;  3HVV A;  1OVN A;  4HQS A;  2O8V B;  2FLS A;  1VF2 A;  2OKA A;  2MMA A;  2K8V A;  4BL7 B;  1SEN A;  4HEA 2;  2YWO A;  4K7N A;  4G0L A;  2HT9 A;  1XFL A;  5D8I A;  3FK8 A;  4DSR A;  3ME8 A;  4WBR D;  2LJR A;  2LJA A;  4KND A;  1LBK A;  1B8X A;  2O87 A;  5GSS A;  4POL A;  2DKI A;  3MIX A;  1YJ6 A;  3GUR A;  2NPB A;  2CVD A;  5FT3 A;  2GZY A;  4MPG A;  1SJI A;  4IQA A;  4KSO A;  4ACS A;  2FA8 A;  5EY6 A;  1ML6 A;  4IEL A;  2VCV A;  1Z6M A;  4MZC A;  5IM9 A;  2IME A;  4AF2 A;  2CT6 A;  1XCC A;  3HXS A;  3UEM A;  1NHO A;  5EL8 A;  1QQ2 A;  2MYG A;  3TJF A;  5ECN B;  3F3Q A;  4NMU A;  3RBT A;  2AAW A;  1JFU A;  3KH7 A;  1XOA A;  4N11 A;  2H19 A;  3ED3 A;  2B7J A;  1GTU A;  2V2G A;  3HJM A;  3A3T A;  1K3L A;  2CZ3 A;  4I97 A;  1GL8 A;  1EP7 A;  3GX0 A;  3F8U A;  5GAP D;  4CY8 A;  3F63 A;  2F8A A;  1EZK A;  1AUC A;  4YKG A;  2O7K A;  4LMV A;  1GSU A;  4IHU A;  3PH9 A;  5C04 A;  4ECB A;  4GXZ A;  1GSF A;  4I2U A;  3VI5 A;  5HQP A;  1O8X A;  4JED A;  1W89 A;  3M9J A;  4KE3 A;  5IQY A;  3KH9 A;  4DSS A;  4JRR A;  3A5W A;  2ZUP A;  5D96 A;  14GS A;  4FYU A;  2REM A;  1FW1 A;  4NV2 A;  4KCA A;  2JSZ A;  2WFC A;  3EPT A;  4MAB A;  4GQC A;  1K0C A;  1K0B A;  2VM2 A;  3FZA A;  5KOW A;  1ZL9 A;  4LL4 B;  5D73 A;  1U87 A;  4K9Z A;  4I2T A;  3F6F A;  2WS2 A;  5J9C A;  2YWI A;  4Z7X A;  5IOW A;  1EOG A;  1WRY A;  1DBY A;  1HNB A;  2H76 A;  3MWH A;  4L0U A;  1IYI A;  1B4Q A;  2X49 A;  2PN8 A;  2GDR A;  1TRW A;  2E2M A;  2X8G A;  2IMK A;  3QR6 A;  4Q5N A;  4MF7 A;  3GIX A;  4TW5 A;  1ST9 A;  4O5R A;  2GQL A;  4AJ7 A;  2LRN A;  1ZGN A;  5GAN D;  2C3Q A;  4G2E A;  4MH3 A;  2YWN A;  5DBQ A;  4EIP A;  1X5D A;  3N5O A;  3LW9 A;  2C4J A;  3CSI A;  5D9T A;  2OAC A;  3FHK A;  2QA2 A;  2CQ9 A;  2FWH A;  4MJC A;  5ELG A;  4CW9 A;  3FKF A;  3M1G A;  5DCG A;  4QQ7 A;  3E3E A;  4NHZ A;  4MLY A;  4V2L A;  2H75 A;  3CTF A;  1A2M A;  3FZ5 A;  1KEB A;  4KAE A;  1XBS A;  1Z7P A;  4ZIJ A;  4MP4 A;  2VLV A;  1QK8 A;  1RQM A;  4TVE A;  3EMX A;  10GS A;  3DIE A;  1TK8 B;  3TUE A;  3D0Z A;  4Z2U A;  5E59 A;  2LV3 A;  4WR5 A;  4ZXG A;  3KTB A;  4RI7 A;  1AIU A;  3I9V 2;  4EKZ A;  5CP1 A;  1YKC A;  4OCF A;  2ZCT A;  4QL7 A;  2LTK A;  2YZH A;  5BMU A;  1SKR B;  2A4H A;  4MZW A;  5COH A;  5KEJ A;  2A4V A;  1MEK A;  3ZVJ D;  2NVL A;  4IN0 A;  2CAI A;  3A5I A;  3WGX A;  4TR1 A;  3KMO A;  1Q98 A;  5GST A;  2H73 A;  1FB6 A;  4BVX A;  2BTO T;  3KGK A;  5DCH A;  2MBS A;  4ICY A;  4PQI A;  5EPF A;  1TDI A;  2OE3 A;  5G31 A;  3U5R E;  1K0N A;  1AW9 A;  3R2Q A;  2L4C A;  5GZZ B;  3TOU A;  3ZML A;  1AQX A;  3UVT A;  2YNX A;  4N10 A;  3DRN A;  1IYH A;  2OBI A;  1ILO A;  3HKR A;  1PL2 A;  2C3N A;  1TTZ A;  2G0F A;  3ERG A;  4WXT A;  2OE1 A;  1SU9 A;  3FR9 A;  1WMJ A;  3F4T A;  1EV9 A;  5J3R A;  1M0U A;  3GH6 A;  4G9H A;  4IQ1 A;  4D73 A;  1OYJ A;  1T1V A;  5EVO A;  4WKW A;  2GLR A;  2YWM A;  3TB2 A;  2V1M A;  1GRX A;  1EOH A;  1WP0 A;  4X4J A;  1TP9 A;  2DJ2 A;  2DJ1 A;  1BED A;  5KN3 A;  1S3C A;  4YQU A;  2TIR A;  2A2P A;  4MMM A;  2JU5 A;  3QAW A;  5JCW A;  4MA9 A;  2JAC A;  3GV1 A;  3GFK A;  2HRA A;  5DJM A;  3CXG A;  4DSS B;  4MNN A;  4TKY A;  1BX9 A;  1H4O A;  4X43 A;  5F07 A;  3GMF A;  2VO4 A;  4ULX A;  4WF4 A;  2YN1 A;  2AV4 A;  1OKT A;  1M9B A;  2H30 A;  1K0O A;  2H1B A;  2PMT A;  3EVI A;  3J7Y b;  3VWV A;  2CVB A;  5LCZ A;  20GS A;  4L5O A;  5INY A;  2FHE A;  3IBH A;  5H5Q A;  3IR4 A;  1KNG A;  4RUV A;  2H72 A;  13GS A;  1O73 A;  1OC3 A;  2HE3 A;  4TXV A;  4Q5F A;  4TN8 A;  4CY6 A;  4G10 A;  2OBK A;  4MF5 A;  4IKH A;  2XPE A;  1UA5 A;  2MMO A;  4POK A;  4A5P A;  3EC3 A;  4RI6 A;  1UVZ A;  1EGR A;  4G0I A;  4DSQ A;  3UJ1 A;  2F8F A;  1T00 A;  3GST A;  5E4W A;  1XWC A;  2A2R A;  2DMM A;  5ECI B;  3TCO A;  3F4R A;  3PR8 A;  1AAZ A;  4EE0 A;  2O89 A;  1ZOF A;  2DML A;  1GNW A;  3GL3 A;  3BD2 A;  2N5A A;  4G0K A;  4IP1 A;  2H1G A;  4EL1 A;  4ML6 A;  3C1R A;  3CTG A;  1GSD A;  3TKS C;  2AYT A;  3Q18 A;  5KN0 A;  4LA1 A;  2LS5 A;  19GS A;  3VI7 A;  1WIK A;  2B1K A;  1DE2 A;  3APQ A;  3D6I A;  4YQM A;  1R4W A;  3HZ4 A;  4O7H A;  3QMX A;  3GKN A;  3GKK A;  2H74 A;  5LNK e;  2AUV A;  1U88 A;  5B6N A;  4EDZ A;  5AIS A;  1OAZ A;  4TR1 B;  1BQ7 A;  1R5A A;  4WR4 A;  2L5L A;  5DQY A;  3TKR A;  5DAL A;  5ELA A;  2KUC A;  4BVX B;  4XHM A;  4ZB9 A;  4F0C A;  1AQW A;  4GTU A;  2H0H A;  2HZE A;  1O8W A;  3P8W A;  1ERW A;  1PL1 A;  3U6V A;  4V2M A;  2EC4 A;  3ERW A;  3GRX A;  2VL2 C;  1QGV A;  2H8L A;  3I69 A;  3W6G A;  3APS A;  1JHB A;  5D93 A;  1GTA A;  3UOM A;  3LJR A;  5ECP B;  2GQM A;  1ZYN A;  1ERU A;  5G1L A;  1G0T A;  3ERF A;  5DAK A;  1VF1 A;  4ZB8 A;  3W8S A;  6GSU A;  3KXO A;  2DIZ A;  4I5Q A;  3ZIT A;  1THX A;  3BCI A;  2K6V A;  4D73 B;  5KN2 A;  3GA4 A;  1USB A;  2V6K A;  2ZNM A;  1F2E A;  3WD6 A;  1AQV A;  1GSS A;  2P5R A;  4BVY A;  3HCZ A;  2K9F A;  2VCQ A;  1KBN A;  4FO5 A;  3DVX A;  4HZ4 A;  4K7O A;  8GSS A;  3MNG A;  5ECS A;  4J57 E;  4FYB A;  4YQV A;  1I9D A;  1TI3 A;  1T7P B;  3D5J A;  2C8U A;  4F82 A;  3EYT A;  3G7J A;  3CRT A;  2I81 A;  1T4Y A;  3H1N A;  3ZRE A;  3F4S A;  5BRT A;  4OFN A;  2JZR A;  4ZL9 A;  3GNJ A;  2B1L A;  1S3A A;  2K8S A;  4L5L A;  3CSJ A;  5HR0 A;  4O5U A;  4PUA A;  4XCS A;  1GLP A;  4I8B A;  3M9K A;  4O32 A;  5A4V A;  2YAN A;  3HA9 A;  3KIJ A;  4HS1 A;  2IN3 A;  1BAY A;  3LYP A;  5HR2 A;  4HZ2 A;  1GUH A;  6GSX A;  5JWQ B;  1E6B A;  1J9B A;  3QAV A;  4PQ1 A;  5ECO B;  4WF5 A;  5B6M A;  3GUS A;  2HRN A;  4BA7 A;  1V9W A;  2OAD A;  4FIW A;  2X8C A;  4RQX A;  3FMW A;  3DKS A;  2BJX A;  4TR3 A;  2D2Z A;  3RHC A;  3E0U A;  1FVK A;  4KUN A;  1XVW A;  5KOX A;  2KHP A;  4KA0 A;  1U3A A;  2J23 A;  3RHB A;  3RDW A;  2A2S A;  1HNC A;  3WT1 A;  4F03 A;  2CX3 A;  4QL9 A;  5ECK B;  3IE3 A;  1W4V A;  2M80 A;  2I9H A;  1XOB A;  1SYX A;  5IO2 A;  1PQN A;  1WPI A;  4MJB A;  4K0N A;  1O81 A;  1YDK A;  2WRT A;  5CRD A;  1ACV A;  2HI7 A;  3SBC A;  1VGL A;  1M9A A;  4MJE A;  2NTO A;  2R3X A;  18GS A;  2EIO A;  1RW1 A;  2KLX A;  2R4V A;  3EE2 A;  4MZB A;  2BMX A;  1PRX A;  2V32 A;  3FRC A;  1M99 A;  4NV5 A;  1JZR A;  4IS0 A;  3F6D A;  3PPU A;  3TKS E;  2GTU A;  4RQR A;  2YJ7 A;  1XW9 A;  2PGT A;  2E0Q A;  2LRT A;  3H93 A;  3IC4 A;  3VLN A;  5JWR B;  2C80 A;  2Z9S A;  5DQS A;  1WWJ A;  3WGE A;  3EIN A;  3A2W A;  3UMA A;  3KZQ A;  1KTE A;  2C0G A;  1TOF A;  2GVP A;  3BJ5 A;  4P3Y B;  3FZ4 A;  4MDC A;  1JZD A;  2H0G A;  4EUY A;  2LQQ A;  2VCT A;  5DAL B;  3NOF A;  3I6A A;  2VLT A;  5AGY A;  2FUG 2;  1LJR A;  4HI7 A;  4Q5R A;  4V2N A;  2HZE B;  4ZB6 A;  1G6W A;  1PX6 A;  2DSA A;  3RAZ A;  3MDK A;  1EGO A;  4KH7 A;  4J2F A;  3LYK A;  3TKQ A;  1PKZ A;  2L57 A;  4JZQ A;  12GS A;  1A23 A;  1GTB A;  3UAP A;  2B3S A;  4ISD A;  2HRF A;  1M2B A;  3VK9 A;  4XS6 A;  5DAK B;  2PVQ A;  5L71 A;  3QPM A;  1PA3 A;  4N0V A;  1WJK A;  1XWK A;  4TR0 A;  4TOP A;  4EO3 A;  5CRG A;  4BVY B;  2GSS A;  5J5N A;  4MF6 A;  4POB A;  4EF0 A;  3FZ9 A;  5AN1 A;  1X9M B;  1YQ1 A;  3TJJ A;  4POM A;  1GH2 A;  1B4P A;  2IJY A;  2PUK C;  5C00 A;  1U6T A;  2FA4 A;  3KEB A;  4L0W A;  2KP1 A;  3RPP A;  3FYG A;  3BOA A;  1Y6E A;  3HJO A;  2XBQ A;  3ISO A;  4NAX A;  4ML1 A;  4KF9 A;  5HFG A;  1Y25 A;  2H0I A;  2WB9 A;  2YJH A;  1MDI A;  1G7O A;  4KDU A;  1NW2 A;  5F0G A;  4FYC A;  4PX1 A;  4XIH A;  2IMI A;  1EWX A;  4IGJ A;  2EIQ A;  3P90 A;  3EMP A;  1Z9H A;  3ME7 A;  3L0H A;  1X9S B;  1TI1 A;  1GSY A;  3Q6O A;  5G30 A;  4PQH A;  4HU9 A;  2MMN A;  1ZZY A;  4F0B A;  1MDJ A;  1A2L A;  5HR1 A;  5KN1 A;  1SJZ A;  2H70 A;  5A5K A;  5J9B A;  2HYX A;  4YH2 A;  1ERV A;  5FHI A;  2DJ0 A;  1F37 A;  5IPG A;  4F9Z A;  1GP1 A;  3O3T A;  4ECC A;  2L59 A;  3H79 A;  1MTC A;  3L9U A;  2FWF A;  3TKP A;  3H4K A;  1PN0 A;  1VF4 A;  4BWS A;  4DEJ A;  1GTI A;  3CYN A;  3FY7 A;  2ON5 A;  1TK0 B;  3ZIJ A;  1SL0 B;  3VWW A;  2OA7 A;  3IAM 2;  5ID2 A;  1R7H A;  5ECR B;  2YOI A;  1SK0 A;  4X1U A;  2IPA A;  3LXT A;  2AHE A;  1SL2 B;  2M46 A;  4OCE A;  2CZ2 A;  3GL5 A;  4EIQ A;  4EC0 A;  4ZIL A;  3ZLP A;  4Z2T A;  1XW6 A;  3IXR A;  2V41 A;  2PU9 C;  1MD4 A;  2EIR A;  2DJ3 A;  4X0X A;  3IC8 A;  5CRE A;  3R3E A;  2B5X A;  1F3A A;  3NZN A;  3HD5 A;  3FR6 A;  3VWU A;  5IO0 A;  2XPD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...