5KN0A

Native bovine skeletal calsequestrin, low-ca2+ form
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
346
structure length
346
Chain Sequence
GLDFPEYDGVDRVVNVNAKNYKNVFKKYEVLALLYHEPPEDDKASQRQFEMDELILELAAQVLEDKGVGFGMVDSEKDAAVAKKLGLTEEDSVYVFKGDEVIEYDGEFSADTLVEFLLDVLEDPVELIEGERELQAFENIEDDNKLIGYFKNKDSEHYKAYEDAAEEFHPYIPFFATFDSKVAKKLTLKLNEIDFYEAFMEEPVTIPDKPNSEEEIVSFVEAHKRSTLRKLKPESMYETWEDDLDGIHIVAFAEETDPDGYEFLETLKAVAQDNTDNPDLSIIWIDPDDFPLLVPYWEKTFNIDLSAPQIGVVNVTDADSVWMEMDDEEDLPSAEELEDWLEDVLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Calsequestrin
publication title Characterization of Post-Translational Modifications to Calsequestrins of Cardiac and Skeletal Muscle.
pubmed doi rcsb
total genus 96
structure length 346
sequence length 346
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-06-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5kn0A03
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5kn0A01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5kn0A02
2IN3A 2CVKA 4I97A 3F8UA 3M0FA 1SJZA 3TCOA 3EU3A 4TR4A 3ZTLA 1HNBA 1B48A 4JZQA 5H5SA 2L6CA 4POMA 1OC3A 3D6IA 1PD21 3KEBA 5D9VA 3I69A 5D8IA 2LSTA 5A4VA 5ABRA 2QC7A 3GA4A 5LD0A 2PERA 4ECIA 5IQYA 2V6OA 3FHKA 1GTBA 1HD2A 2P5QA 1MDJA 1PKZA 3UL3A 4TXVA 1ST9A 5CRHA 2GT5A 3KIJA 3IAM2 3IBHA 5DJLA 2P31A 3BOAA 3V1WA 3RHBA 3HZ4A 2DMMA 3UIWA 3GTUB 2C0DA 17GSA 5F0GA 1SK2A 1T4ZA 1IYHA 3M3MA 2GTUA 2IPAA 1TRVA 2L5LA 2LQOA 4N0ZA 3VLNA 2LJKA 3AY8A 3DEXA 2HI7A 2PPTA 3DIEA 1NHOA 3E3EA 2X8CA 3QR6A 5ID2B 1N8JA 1TK5B 4PGTA 5HR1A 2IL3A 2ZCTA 3QAVA 4N11A 2WGRA 2A2SA 4HJ2A 2YV7A 1G7OA 16GSA 1XOAA 1JFUA 2EIQA 3BCKA 3IR4A 4P3YB 4HEA2 2DJ3A 4HU7A 3ZRDA 1ZOFA 3ME7A 5G1LA 4XTSA 3ERFA 3CSIA 3CTGA 5G5EA 2H6XA 2IJYA 2L57A 2O87A 2K8SA 4MZCA 2VIMA 2JADA 3UBLA 1TJDA 1WE0A 4Q5RA 3C7MA 1VF3A 3FK8A 2CX3A 2BMXA 2YCDA 4TR3A 2AJQB 1G7EA 3GL3A 1Y6EA 2RM5A 2XBIA 1R5PA 4GF0A 1K0AA 4ISDA 2O85A 4KCAA 3CSHA 1S3AA 1TDIA 4GTUA 4MP4A 1MD3A 4EL1A 4MZWA 3HA9A 4NHWA 2M80A 4XCSA 3W6GA 4MDCA 3TJJA 2GSRA 2ZNMA 5E4WA 2LTKA 5DQSA 2KP1A 4OCEA 5DVBA 4BPYA 3KMNA 3WGDA 1YKCA 4I2TA 1SD8A 3WYWA 3CMIA 1K3YA 3TUEA 3A3TA 4IN0A 1SJ6A 1XWBA 1DE2A 5A4UA 3ZREA 5IMAA 5C00A 3RPPA 11GSA 1RK4A 1EGOA 4QL9A 2OBKA 4L0WA 2H1BA 2YP6A 2L59A 3DYRA 3HVXA 3TKSE 2VLVA 1EP8A 3LGCA 2HSYA 4V1Ag 3DXBA 2IMEA 3RAZA 4TR1B 1XCCA 4WETA 1JZWA 2ALBA 3BD2A 3EYTA 1YEXA 3WT1A 2B1LA 3VWWA 1TKDB 4KA0A 2D2ZA 1GWCA 1A8YA 1BAYA 4ZB6A 1PX6A 2XPEA 2JACA 1ERUA 2GQLA 3VWXA 3M8NA 2V32A 3LSZA 3CXGA 1DUGA 3GN3A 4IW9A 2HLSA 5H5RA 2H72A 1GNWA 2H66A 2VM1A 3FZ9A 2V2GA 4K7NA 1XXUA 2TIRA 5GZZB 3GX8A 4K7IA 4HOJA 6GSWA 1A2JA 5ELGA 1DSBA 1K0CA 1E2YA 3BJ5A 4OWYA 4IGJA 3UOMA 1OE7A 3U6VA 1G6WA 4ACSA 1GTAA 5CP1A 1NM3A 2V1MA 1H75A 3QAGA 1PA3A 2JSZA 1FB0A 3UEMA 2B5EA 3QFBC 1B4PA 3L4NA 8GSSA 10GSA 2YJ7A 2FY6A 1X5CA 5EVOA 4TR0A 1TOFA 2GSTA 4GSTA 3ZLPA 1PRXA 3Q6OA 4MPFA 2XPDA 3M1GA 3TJGA 3ZMKA 1NHYA 1BX9A 4KGIA 1JZDA 3FR6A 2H73A 2IMIA 3P2AA 4IKHA 2BJXA 2H71A 1WWJA 2DLXA 2YWIA 5IMVA 5KN0A 4WKWA 4PQHA 1XVWA 3W8SA 1EOHA 2H0HA 2WB9A 3TKSC 2M72A 3APQA 2G0FA 5IMZA 3VFIA 3KP9A 2VAFA 4BVXA 3NOFA 3L9UA 6GSUA 1KEBA 1XFLA 2PMTA 2B1KA 4EDYA 2I9HA 3IAS2 4GWRA 6GSTA 1K0DA 4LLRA 4XIHA 2GQKA 2M46A 2HYXA 4EDZA 2YZHA 4OFTA 4EE0A 2C3NA 1QXHA 4GSNA 2HXKA 1XW9A 4ZL7A 3F6DA 4MF5A 4WXTA 4G10A 4V2NA 2LRCA 3LG6A 2CQ9A 2C8UA 5ECLB 4F03A 2XHFA 2LRNA 5KN2A 3LWAA 1GSSA 5D93A 2CZ3A 1FAAA 3RBTA 2B7KA 4XS4B 4XS1A 4IJ3A 4MH3A 4AGSA 5B8BA 5ECHB 1ZGNA 1Z7PA 2CZ2A 2FA8A 3TOTA 3LJRA 3TRPA 3GUSA 4K1FA 4WF4A 1GLPA 2C0EA 4EUYA 5AIXA 1HYUA 4LL1B 4ML6A 1WIKA 1V9WA 2VCZA 2F8FA 3IC4A 3US3A 1QFNA 2I81A 3L9SA 3Q19A 4MH2A 1JLWA 2N5FA 4HQSA 1X9MB 1XWGA 5FHIA 4N0VA 2I4AA 2JZSA 1U87A 5F8BA 1Z9HA 5HFGA 1QQ2A 1X5EA 3PINA 5EPFA 5IO0A 2CVDA 5J9CA 1Q4JA 6GSSA 2FWHA 2C1YA 2IWTA 4N30A 1M9BA 1T1VA 3TKRA 3TOUA 2VD0A 2GSSA 1TW9A 4KSOA 3M9JA 2WULA 2IFQA 3IRAA 4KE3A 4MK3A 5IO2A 4X43A 4D73B 1SL0B 3WT2A 1AQXA 5IM9A 2OJLA 1K0BA 2FLSA 3GKKA 1PGTA 1TK0B 2OE0A 5J41A 3DMLA 4F0CA 6GSYA 1SKWB 1A24A 2A4VA 2R4VA 5DAKB 3E9JB 3H4KA 4WBRD 2NBSA 4Q5FA 4MF7A 4MJBA 3UVTA 1Y25A 4GRFA 1MD4A 2XC2A 1S3CA 1VF2A 1YDKA 1M2DA 4KB3A 2VCXA 5F05A 5HR0A 2EIRA 4N10A 1SKSB 3UAPA 4CDOA 2R37A 3D22A 3CRTA 3I43A 3LXTA 3ZZXA 2AB6A 1FVKA 1XOBA 1YJ6A 2JU5A 3ZIVA 1X9SB 4ZXGA 1M9AA 5DCGA 4GQFA 1QUWA 3A2XA 1EWXA 3LORA 3QMXA 2IIYA 1GUKA 3EMXA 4DSRA 2F3MA 2CAIA 2CAQA 2H74A 2RUEA 1PX7A 3QCPA 1BJXA 5FT3A 3KTLA 2OKAA 4ZBAA 5IMCA 2HZEB 3PH9A 3RDWA 1VF4A 2WFCA 3VPTA 3A2VA 1AAZA 3LXZA 3P7XA 4IQAA 3W8JA 1H4OA 2K18A 3WGXA 1X0RA 4IJIA 2DJJA 3UBKA 4I8BA 2YZUA 2OE3A 1GNEA 1NSWA 3DD3A 4NV2A 3Q74A 1SJIA 2PWJA 4CW9A 1XWKA 3ED3A 4WF5A 3UVHA 2DJ2A 4JU5A 3IOSA 2FUG2 3DRNA 4MPGA 5HR3A 1W4VA 2FD3A 1U88A 13GSA 5ECPB 3FR3A 1WP0A 3IV4A 1XW6A 4OFNA 4FIWA 1XWCA 1MDIA 3O6TA 2RIIA 3VK9A 3A2WA 4BWSA 2L6DA 4PX1A 4QQ7A 3MAKA 2OA7A 1GSUA 1TRUA 3VURA 4NWYA 1V57A 3IE3A 2K6VA 1B4QA 2I3YA 1K3OA 2DIYA 3FRCA 5EY6A 2LEGA 2VM2A 1XVQA 2ON5A 2MMZA 2H6ZA 1V2AA 2J23A 3ZL5A 2YN1A 2QGVA 4JE1A 4G19A 4Q5NA 1W89A 3KMOA 4ULXA 2KLXA 5DALA 2FNOA 1TI1A 2FWEA 2CX4A 2JZTA 3HDCA 2WS2A 1LJRA 1YF1A 4LA1A 4EVMA 3PGTA 2YWNA 2AHEA 1NW2A 3IDVA 2X99A 5H5QA 2FHEA 5G31A 5F07A 3G7YA 2H1GA 3IXRA 1VGLA 2GGTA 4V2LA 5B6MA 2GS3A 1OC9B 1GH2A 2REMA 3CTFA 4I5QA 5COHA 5ECOB 4ZB8A 4PXOA 5ECKB 4IELA 1MDKA 3F6FA 3TGZA 2VL9A 3IK9A 1OKTA 3BBYA 3F3QA 4K9ZA 2H70A 4KNDA 2PVQA 4ZILA 1OAZA 4E8HA 2H1DA 2N5BA 3FZ4A 3J7Yk 3WD6A 1XBSA 4AF2A 2VL2A 2EIOA 4Z7XA 1HNAA 1O6JA 5ECNB 1ZZYA 4YQMA 1AIUA 2PGTA 2B6MA 2PU9C 2B5XA 2GZZA 3KP8A 2H19A 2GLRA 3VWUA 5B8AA 1UC7A 3HHVA 1F9MA 3DGQA 2HZFA 1JHBA 3HKRA 2AYTA 1Z5YE 4DSQA 1Q98A 2V6KA 5D9XA 5CO3A 2F8AA 1XPVA 1M2AA 1A8LA 1SYXA 2VCWA 3D4MA 3I6AA 5AIVA 5KEJA 2K8VA 1EV4A 2L4QA 3KGKA 1YQ1A 1URMA 1LBKA 1TRWA 3FZAA 4GXZA 3GTUA 1FOVA 1EGRA 4RQXA 4DSSB 5HQPA 3H8QA 2L5OA 3F4RA 1A0RP 2C0GA 2H8LA 4OD7A 1QMVA 2E2MA 5CRDA 3NZNA 1GTIA 1BEDA 3MNGA 3FY7A 1CQGA 5ID2A 3G7JA 3HJPA 2OACA 4HJMA 1PSQA 2GDRA 3C73A 2KOKA 1Z6MA 1THOA 5JWQB 3RHCA 4TXOB 5KN3A 5IOWA 3TJFA 4F2IA 1E6BA 3EWLA 1GRXA 4H86A 5JWRB 1GULA 1ACVA 5IOXA 3IA1A 1A2LA 4POBA 3D0ZA 2GVPA 5A5KA 3GKXA 5DDLA 3C71A 4TKYA 3UARA 1K0NA 4HZ4A 2OADA 3HY2A 4OO5A 2VLUA 3C8EA 3ZVJD 4IHUA 4PUAA 3MDKA 3N9JA 5LNKe 4YQUA 2AUVA 4EXJA 2C80A 4TVEA 5J3RA 2H0IA 1C72A 2H0GA 4DEJA 3G9BA 1RW1A 5JCWA 1RQMA 2YJHA 2TRCP 3GURA 4JR6A 4YH2A 1F6MC 2O7KA 2R3XA 2H75A 3R2QA 4EO3A 3H93A 1AQVA 3GH9A 1F3BA 4G9HA 1UVZA 2Z9SA 3LFLA 1U3IA 4GCIA 1PKWA 4ZL8A 4XRAA 4IVFA 5AGYA 1FW1A 2KHPA 3UMAA 2VO4A 1DE1A 5J4UA 1PN9A 1T00A 1OVNA 2PUKC 4EC0A 1V58A 4K7OA 1OYJA 1PQNA 4TN8A 2XBQA 3ERGA 1WMJA 3GSTA 4MABA 2DJKA 4NV5A 3TDGA 4AJ6A 3KH9A 3GKMA 3RPNA 3TB2A 1GSFA 4EF0A 4TRXA 2TRXA 1AQWA 3DWVA 3GRXA 5GSTA 4JEDA 2ON7A 2HSHA 1UN2A 4FYBA 3EINA 4TR1A 1KTEA 3QDNA 4MF6A 5D73A 2LNSA 1A2MA 2FWFA 4IS0A 5ECMB 3GX0A 3KTBA 5LCZA 3DVXA 2FGXA 3J7Yb 3C1RA 3QD9A 3EURA 1F2EA 3IPZA 3N5OA 1JZOA 5JCGA 1GL8A 2QKEA 4IP6A 2I1UA 4HUAA 1DBYA 3ZFLA 1FB6A 3DVWA 4EKZA 2JL4A 2FWGA 1ERVA 4MMMA 1SK1A 4OO4A 4J57E 2HRFA 3D4TA 4LMVA 4X0XA 4O32A 2DIZA 1TRSA 2AAWA 2NPBA 1KBNA 3GH6A 3SBCA 4WEYA 3PR8A 3ZVJA 2KP2A 2R6KA 3APSA 1T3BA 5B7CA 4HS1A 3CRUA 1GSEA 5HFKA 3KXOA 4POKA 2X64A 3ME8A 5JCUA 1GP1A 3QAWA 5G2ZA 3GIXA 14GSA 4V1Ap 3CSJA 3LEFA 4X1UA 3D21A 1K3LA 1SK0A 1T8EB 2R5GA 4NHZA 1TXXA 4G2EA 1CQHA 2C4JA 2B5YA 3GHAA 3CYNA 7GSSA 2R2JA 4TXOA 3F63A 1B8XA 2GZYA 5AISA 4HZ2A 2YV9A 1F3AA 4IP1A 3HXSA 3TJKA 3FEUA 4GQCA 3KJYA 3HJOA 4E8EA 4PUFC 1THXA 4KH7A 4IBPA 1J0FA 4PQ1A 5INYA 2C3TA 4AJ8A 1AUCA 3IK7A 5DQYA 2RLIA 1EEJA 3GKNA 3QPMA 1WRYA 3TRQA 4RI6A 4MJAA 1ZYQB 3I9V2 2QSIA 2H01A 4F9ZA 3NIVA 1WJKA 2L4CA 3TRXA 1HNCA 1PL2A 1GSQA 2LS5A 1EP7A 2VCVA 1SL2B 3EU4A 1ON4A 3F4TA 4ECJA 4MLYA 3L78A 4I2UA 2E0QA 2X8HA 1BYEA 1FG4A 18GSA 5D9WA 5ECRB 5L71A 1IYIA 2OE1A 1XW5A 4BA7A 3TKPA 3EE2A 3ZYWA 3ERWA 4F0BA 1ILOA 2YANA 3GYKA 4O92A 4K0GA 3GL5A 1TU7A 4LMWA 4WR4A 2CA8A 1BG5A 1YF0A 1ERWA 9GSSA 1YZXA 1FO5A 1EZKA 4ID0A 1GLQA 5GSSA 1TK8B 3O76A 5FWGA 1T4YA 3D5JA 2WZ9A 1V40A 4HQZA 1AC1A 4XS4A 2PBJA 2CV4A 3O3TA 3E0UA 2EC4A 2DJ1A 2LKUA 2AV4A 2WCIA 5CNWA 5J5NA 2FA4A 4YAPA 1ZL9A 3HZ8A 3LQ7A 3ISOA 2YWOA 12GSA 3VI7A 4NPBA 3H1NA 4K0NA 1PL1A 4F82A 1GUMA 2HFDA 5IIZA 2CVBA 1YEPA 2DSAA 3HVVA 4LL4B 2LJRA 4KW6A 3TJBA 3S9FA 2ZUPA 3JCML 1M99A 5F06A 3F4SA 3MWHA 4HU9A 1S3DA 1Z3EA 1JZRA 3VPQA 5E59A 5KN1A 2NVLA 2LRTA 2PN8A 3FKFA 1V98A 3MSZA 2HNLA 3CBUA 1B9XC 4MCUA 2VOCA 3G7IA 4BL7A 1OC8A 1X9WB 4TW5A 4KDYA 3TKQA 2FCHA 2HT9A 4QL7A 4V2MA 4GLTA 5AN1A 3GFKA 2NTOA 3ZITA 2WDUA 4D73A 5G5FA 19GSA 4O5RA 2DC5A 4XS6A 2NDOA 4L5LA 2JSYA 4NMUA 3ZMLA 3P90A 5CAXA 4JBBA 1MEKA 5DAKA 3HYPA 3TKSA 2DBCA 2YNXA 4FO5A 1K0MA 3SWLA 1WOUA 1XIYA 1SD9A 1TP9A 5DCHA 1BQ7A 1J9BA 5DBQA 1R26A 2WRTA 3L9VA 5C04A 3IHQA 4ECCA 4WBJA 4ML1A 4I6XA 4PURA 2CT6A 2RUFA 4NXIA 1R5AA 2ES7A 3UJ1A 1GUHA 2F51A 4L8EA 5B6NA 1SL1B 4YAVA 4KSMA 1QK8A 2H1AA 3WGEA 3APOA 4FYCA 2HRNA 5GAPD 4JR4A 4FYUA 2C3QA 6GSVA 1GSYA 1XWAA 2GZPA 2LUSA 4KDXA 2MMOA 1O81A 2IMFA 2VD1A 3HCZA 4J56E 5CREA 1EV9A 3QFAC 1G6YA 1OKDA 1Z7RA 4KUNA 1GTUA 5ECSA 5IMFA 2N5AA 4BWQA 1EEMA 2HZEA 4DVCA 2O8VB 4ZBDA 1O8XA 1M0UA 4POLA 3GSSA 2IFQB 1ERTA 3A5WA 4AJ7A 1FVJA 2YPMA 2DJ0A 4HDEA 1AXDA 1PMTA 5IPHA 2WJUA 1YKAA 3F9UA 4L5OA 2VCTA 4K2DA 2GT6A 1O85A 3GMFA 4CHSA 2LV3A 1N2AA 2P0GA 4XHMA 1SKRB 4IQ1A 5GAND 4ZL9A 1GSDA 1QGVA 2F9SA 1G0TA 3VI5A 6GSXA 1ABAA 3KZQA 2MYGA 4KX4A 3H79A 2MZCA 2V41A 2IMDA 2LNTA 5J9BA 22GSA 2X8GA 3LYPA 2RM6A 1AW9A 2C0FA 3EVIA 4WR5A 1HQOA 3BCIA 3KD0A 4MA9A 1Z6NA 5A4WA 1K0OA 4ZB9A 4O7HA 3EMPA 4Q5QA 1O8WA 2B3SA 5DJMA 3FZ5A 5CRWA 3HD5A 1TU8A 2VL2C 1TI3A 5HFIA 1U3AA 4MJEA 2DMLA 2GQMA 3C1SA 3FYGA 3KCMA 2MBTA 1ZYEA 2H76A 4FH8A 2LJAA 4NAXA 2A2RA 1XZOA 1SU9A 1I9DA 4PNFA 1R4WA 2JZRA 5HR2A 3FR9A 1SENA 4PNGA 3GNJA 4GSSA 3U5RE 5EL8A 4JRRA 5CYYA 1OC9A 2H6YA 2MBSA 3LYKA 3EC3A 5JWOB 2IMKA 3P8WA 3OR5A 1SYRA 5IPGA 1YY7A 2BTOT 2B7JA 3KM6A 4L0UA 4HI7A 1B9YC 1O73A 4KAEA 3ZIJA 2YOIA 1WPIA 4K6XA 2O89A 4K8MA 4TOPA 2VCQA 2G2QA 3GV1A 4OMVA 2H30A 5IMDA 3F0IA 4BVYA 4PQIA 2P5RA 3VWVA 4ECBA 1O7UA 2OBIA 4MZBA 5G30A 4YQVA 4OFMA 1X5DA 5ELAA 1R7HA 4ILFA 5ECIB 3HJMA 1USBA 2VL3A 1M2BA 1ZMAA 1VRSD 1ZCPA 5DALB 2E2GA 2KUCA 2K9FA 1KNGA 3L0HA 2HE3A 1F37A 1U6TA 2J9HA 3FW2A 5CRGA 2VLTA 3DKSA 2MMNA 1I5GA 2MMAA 4OCFA 4KDUA 3F3RA 1T7PB 1EOGA 1MTCA 5D96A 5ECQB 2VUPA 1FHEA 20GSA 1M7TA 1LU4A 3K8NA 4KCEA 3M9KA 3HVSA 4RI7A 4ZIJA 2E7PA 3Q18A 2GSQA 4RQRA 1VF1A 2LQQA 4RUVA 3ZFBA 1A0FA 2YWMA 5ENUA 4DSSA 1A23A 4XRDA 1TTZA 3KH7A 5D9TA 1J08A 4MJCA 2PVOC 1ML6A 5G1KA 3QOUA 4ZBBA 1JLVA 1OE8A 1UA5A 4J2FA
chains in the Genus database with same CATH superfamily
2IN3A 2CVKA 4I97A 2X49A 3F8UA 3M0FA 1SJZA 3TCOA 3EU3A 4TR4A 3ZTLA 1HNBA 1B48A 4JZQA 5H5SA 2L6CA 4POMA 1OC3A 3D6IA 1PD21 3KEBA 5D9VA 3I69A 3MIXA 5D8IA 2LSTA 5A4VA 5ABRA 2QC7A 3GA4A 5LD0A 2PERA 4ECIA 5IQYA 2V6OA 3FHKA 1GTBA 1HD2A 2P5QA 1MDJA 1PKZA 4K2XA 3UL3A 4TXVA 1ST9A 5CRHA 2GT5A 3KIJA 3IAM2 3IBHA 5DJLA 4Z2UA 2P31A 3BOAA 3V1WA 3RHBA 3HZ4A 2DMMA 3UIWA 4YKGA 3GTUB 2C0DA 17GSA 5F0GA 1SK2A 1T4ZA 1IYHA 3M3MA 2GTUA 2IPAA 1TRVA 2L5LA 2LQOA 4N0ZA 3VLNA 2LJKA 3AY8A 3DEXA 2HI7A 2PPTA 3DIEA 1NHOA 3E3EA 2X8CA 3QR6A 2A2PA 5ID2B 1N8JA 1TK5B 4PGTA 5HR1A 2IL3A 2ZCTA 3QAVA 4N11A 2WGRA 2A2SA 4HJ2A 2YV7A 4EIPA 1G7OA 16GSA 1XOAA 1JFUA 2EIQA 3BCKA 1M3IA 3IR4A 4P3YB 4HEA2 2DJ3A 4HU7A 3ZRDA 1ZOFA 3ME7A 5G1LA 4XTSA 3ERFA 3CSIA 3CTGA 5G5EA 2H6XA 2IJYA 2L57A 2O87A 2K8SA 4MZCA 2VIMA 2JADA 3UBLA 1TJDA 1WE0A 4Q5RA 3C7MA 1VF3A 3FK8A 2CX3A 2BMXA 2YCDA 4TR3A 2AJQB 1G7EA 3GL3A 1Y6EA 2RM5A 2XBIA 1R5PA 4GF0A 3HVNA 1K0AA 4ISDA 2O85A 4KCAA 3CSHA 1S3AA 1TDIA 4GTUA 4MP4A 1MD3A 4EL1A 5BRTA 4MZWA 3HA9A 4NHWA 2M80A 4XCSA 3W6GA 4MDCA 3TJJA 2GSRA 4USSA 2ZNMA 5E4WA 2LTKA 5DQSA 2KP1A 4OCEA 5DVBA 4BPYA 3KMNA 3WGDA 1YKCA 4I2TA 1SD8A 3WYWA 3CMIA 1K3YA 3TUEA 3A3TA 4IN0A 1SJ6A 1XWBA 1DE2A 5A4UA 3ZREA 5IMAA 5C00A 3RPPA 11GSA 1RK4A 1EGOA 4QL9A 2OBKA 4L0WA 2H1BA 2YP6A 2L59A 3DYRA 3HVXA 3TKSE 2VLVA 1EP8A 3LGCA 2HSYA 4V1Ag 3DXBA 2IMEA 3RAZA 4TR1B 1XCCA 4WETA 1JZWA 2ALBA 3BD2A 3EYTA 1YEXA 1FOHA 3WT1A 2B1LA 3VWWA 1TKDB 4KA0A 2D2ZA 1GWCA 1A8YA 1BAYA 4ZB6A 1PX6A 2XPEA 2JACA 1ERUA 2GQLA 3VWXA 3M8NA 2V32A 3LSZA 3CXGA 1DUGA 3GN3A 4PTSA 4IW9A 2HLSA 5H5RA 2H72A 1GNWA 2H66A 3A5IA 2VM1A 3FZ9A 2V2GA 4K7NA 1XXUA 2TIRA 5GZZB 3GX8A 4K7IA 4HOJA 4CY6A 6GSWA 4G0LA 1A2JA 5ELGA 1DSBA 1K0CA 1E2YA 3BJ5A 4OWYA 4IGJA 3UOMA 1OE7A 3U6VA 1G6WA 4ACSA 1GTAA 5CP1A 1NM3A 2V1MA 1H75A 3QAGA 1PA3A 2JSZA 1FB0A 3UEMA 2B5EA 3QFBC 1B4PA 1PN0A 3L4NA 8GSSA 10GSA 2YJ7A 2FY6A 1X5CA 4X4JA 5EVOA 4TR0A 1TOFA 2GSTA 4GSTA 3ZLPA 1PRXA 3Q6OA 4MPFA 5BMUA 2XPDA 3M1GA 3TJGA 3ZMKA 1NHYA 1BX9A 4KGIA 1JZDA 3FR6A 2H73A 2IMIA 3P2AA 4IKHA 2BJXA 2H71A 1WWJA 2DLXA 2YWIA 5IMVA 5KN0A 4WKWA 4PQHA 1XVWA 3W8SA 1EOHA 2H0HA 2WB9A 3TKSC 2M72A 3APQA 2G0FA 5IMZA 3VFIA 3KP9A 2VAFA 4BVXA 3NOFA 3L9UA 6GSUA 1KEBA 1XFLA 2PMTA 2B1KA 4EDYA 2I9HA 3IAS2 4GWRA 6GSTA 1K0DA 4LLRA 4XIHA 2GQKA 2M46A 2HYXA 4EDZA 2YZHA 4OFTA 3IC8A 4EE0A 2C3NA 1QXHA 4K5SA 4GSNA 2HXKA 1XW9A 4ZL7A 3F6DA 4MF5A 4WXTA 4G10A 4V2NA 2LRCA 3LG6A 2CQ9A 2C8UA 5ECLB 4F03A 2XHFA 2LRNA 5KN2A 3LWAA 1GSSA 5D93A 2CZ3A 1FAAA 3RBTA 2B7KA 4XS4B 4XS1A 4IJ3A 4MH3A 4AGSA 5B8BA 5ECHB 1ZGNA 1Z7PA 2CZ2A 2FA8A 3TOTA 3PPUA 3LJRA 3TRPA 3GUSA 4K1FA 4WF4A 1GLPA 2C0EA 4EUYA 5AIXA 1HYUA 4A5PA 4LL1B 1S3RA 4ML6A 1WIKA 1V9WA 2VCZA 1ZYNA 2F8FA 3IC4A 3US3A 1QFNA 2I81A 3L9SA 3Q19A 4MH2A 1JLWA 2N5FA 4HQSA 1X9MB 1XWGA 5FHIA 4N0VA 2I4AA 2JZSA 1U87A 5F8BA 1Z9HA 5HFGA 1QQ2A 1X5EA 3PINA 5EPFA 5IO0A 2CVDA 5J9CA 4Z2RA 1Q4JA 6GSSA 4BL7B 2FWHA 2C1YA 2IWTA 4N30A 1M9BA 4YKFA 1T1VA 3TKRA 4Z2TA 3TOUA 2VD0A 2GSSA 1TW9A 4KSOA 3M9JA 2WULA 2IFQA 3IRAA 4KE3A 4MK3A 5IO2A 4X43A 4D73B 1SL0B 3WT2A 1AQXA 5IM9A 2OJLA 1K0BA 2FLSA 4KF9A 3GKKA 1PGTA 1TK0B 2OE0A 5J41A 3DMLA 4F0CA 6GSYA 1SKWB 1A24A 2A4VA 2R4VA 5DAKB 3E9JB 3H4KA 4WBRD 2NBSA 4Q5FA 4MF7A 4MJBA 3UVTA 1Y25A 4GRFA 1MD4A 2XC2A 4HSCX 1S3CA 1VF2A 1YDKA 1M2DA 4KB3A 2VCXA 5F05A 5HR0A 2EIRA 4N10A 1SKSB 3UAPA 4CDOA 2R37A 3D22A 3CRTA 3I43A 3LXTA 3ZZXA 2AB6A 1FVKA 1XOBA 1YJ6A 2JU5A 3ZIVA 1X9SB 4ZXGA 1M9AA 5DCGA 4GQFA 1QUWA 3A2XA 1EWXA 3LORA 3QMXA 2IIYA 1GUKA 3EMXA 4DSRA 2F3MA 2CAIA 2CAQA 2H74A 2RUEA 1PX7A 3QCPA 1BJXA 5FT3A 3KTLA 2OKAA 4ZBAA 5IMCA 2HZEB 3PH9A 3RDWA 1VF4A 2WFCA 3VPTA 3A2VA 1AAZA 3LXZA 3P7XA 4IQAA 3W8JA 1H4OA 2K18A 3WGXA 1X0RA 4IJIA 3IHGA 2DJJA 3UBKA 4I8BA 2YZUA 2OE3A 1GNEA 1NSWA 3DD3A 4NV2A 3Q74A 1SJIA 2PWJA 4CW9A 1XWKA 3ED3A 4WF5A 3UVHA 2DJ2A 4JU5A 4BIKA 3IOSA 2FUG2 2R0GA 3DRNA 4MPGA 5HR3A 1W4VA 2FD3A 1U88A 13GSA 5ECPB 3FR3A 1WP0A 3IV4A 1XW6A 4OFNA 4FIWA 1XWCA 1MDIA 3O6TA 2RIIA 3VK9A 3A2WA 4BWSA 2L6DA 4QQ7A 4PX1A 3MAKA 2OA7A 1GSUA 1TRUA 3VURA 4NWYA 1V57A 3IE3A 2K6VA 1B4QA 2I3YA 1K3OA 2DIYA 3FRCA 5EY6A 2LEGA 2VM2A 1XVQA 2ON5A 2MMZA 2H6ZA 1M3JA 1V2AA 2J23A 3ZL5A 2YN1A 2QGVA 4JE1A 4G19A 4Q5NA 1W89A 3KMOA 4ULXA 2KLXA 5DALA 2FNOA 1TI1A 2FWEA 2CX4A 2JZTA 3HDCA 2WS2A 1LJRA 1YF1A 4LA1A 4EVMA 3PGTA 2YWNA 2AHEA 1NW2A 3IDVA 2X99A 5H5QA 2FHEA 5G31A 3G7YA 5F07A 2H1GA 3IXRA 1VGLA 2GGTA 4V2LA 5B6MA 2GS3A 1OC9B 1GH2A 2REMA 3CTFA 4I5QA 5COHA 5ECOB 4ZB8A 4PXOA 5ECKB 2A4HA 4IELA 1MDKA 3F6FA 3TGZA 2VL9A 3IK9A 4MNNA 1OKTA 3BBYA 3F3QA 4K9ZA 2H70A 4KNDA 2PVQA 4ZILA 1OAZA 4E8HA 2H1DA 2N5BA 3FZ4A 3J7Yk 3WD6A 1XBSA 4AF2A 1XG8A 2VL2A 2EIOA 4Z7XA 1HNAA 1O6JA 5ECNB 4BVYB 1ZZYA 4YQMA 5KOWA 1AIUA 2PGTA 2B6MA 2PU9C 2B5XA 2GZZA 3KP8A 2H19A 2GLRA 3VWUA 5B8AA 1UC7A 3HHVA 1F9MA 2DKHA 3DGQA 2HZFA 2X4AA 1JHBA 3HKRA 2AYTA 1Z5YE 4DSQA 1Q98A 2V6KA 5D9XA 5CO3A 2F8AA 1XPVA 1M2AA 1A8LA 1SYXA 2VCWA 3D4MA 3I6AA 5AIVA 5KEJA 2K8VA 1EV4A 2L4QA 3KGKA 1YQ1A 1URMA 1LBKA 1TRWA 3FZAA 4GXZA 3GTUA 1FOVA 1EGRA 4RQXA 4DSSB 5HQPA 3H8QA 2L5OA 3F4RA 1A0RP 2C0GA 2H8LA 4OD7A 1QMVA 2E2MA 5CRDA 3NZNA 1GTIA 1BEDA 3MNGA 3FY7A 1CQGA 5ID2A 3G7JA 3HJPA 2OACA 4HJMA 1PSQA 2GDRA 3C73A 2R0PA 2KOKA 1Z6MA 1THOA 5JWQB 3RHCA 4TXOB 5KN3A 5IOWA 3TJFA 4F2IA 3EPTA 1E6BA 3EWLA 1GRXA 4H86A 5JWRB 1GULA 1ACVA 5IOXA 3IA1A 1A2LA 4POBA 3D0ZA 5KOXA 2GVPA 5A5KA 3GKXA 5DDLA 3C71A 4TKYA 3UARA 1K0NA 4HZ4A 2OADA 3HY2A 4OO5A 2VLUA 3C8EA 3ZVJD 4IHUA 4PUAA 4CY8A 3MDKA 3N9JA 5LNKe 4YQUA 2AUVA 4EXJA 2C80A 4TVEA 5J3RA 2H0IA 1C72A 2H0GA 4DEJA 3G9BA 1RW1A 5JCWA 1RQMA 2YJHA 2TRCP 3GURA 4JR6A 4YH2A 1F6MC 2O7KA 2R3XA 2H75A 3R2QA 4EO3A 3H93A 1AQVA 3GH9A 1F3BA 4G9HA 1UVZA 2Z9SA 3LFLA 1U3IA 4GCIA 1PKWA 4ZL8A 4XRAA 4O5UA 4IVFA 5AGYA 1FW1A 2KHPA 3UMAA 2VO4A 1DE1A 5J4UA 1PN9A 2UZ8A 1T00A 1OVNA 2PUKC 4EC0A 1V58A 4K7OA 1OYJA 1PQNA 4TN8A 2XBQA 3ERGA 1WMJA 3GSTA 4MABA 2DJKA 4NV5A 3TDGA 4AJ6A 3KH9A 3GKMA 3RPNA 3TB2A 1GSFA 4EF0A 4TRXA 2TRXA 1AQWA 3DWVA 3GRXA 5GSTA 4JEDA 2ON7A 2HSHA 1UN2A 4FYBA 3EINA 4TR1A 1KTEA 3QDNA 4MF6A 5D73A 2LNSA 1A2MA 2FWFA 4IS0A 5ECMB 3GX0A 3KTBA 5LCZA 3DVXA 2FGXA 3J7Yb 3C1RA 3QD9A 3EURA 1F2EA 3IPZA 3N5OA 1JZOA 3LW9A 5JCGA 1GL8A 2QKEA 4IP6A 2I1UA 4HUAA 1DBYA 3ZFLA 1FB6A 3DVWA 4EKZA 2JL4A 2FWGA 1ERVA 4MMMA 1SK1A 4OO4A 4J57E 2HRFA 3D4TA 4LMVA 4X0XA 4O32A 2DIZA 1TRSA 2AAWA 2NPBA 1KBNA 3GH6A 3SBCA 4WEYA 3PR8A 3ZVJA 2KP2A 2R6KA 3R3EA 3APSA 1T3BA 5B7CA 4HS1A 3CRUA 1GSEA 5HFKA 3KXOA 4POKA 2X64A 3ME8A 5JCUA 1GP1A 3FMWA 3QAWA 5G2ZA 3GIXA 14GSA 4V1Ap 3CSJA 3LEFA 4X1UA 3D21A 1K3LA 1SK0A 1T8EB 2R5GA 4NHZA 1TXXA 4G2EA 1CQHA 2C4JA 2B5YA 3GHAA 3CYNA 7GSSA 2R2JA 4TXOA 3F63A 1B8XA 2GZYA 5AISA 4HZ2A 2YV9A 1F3AA 4IP1A 3HXSA 3TJKA 3FEUA 4GQCA 3KJYA 3HJOA 4E8EA 4PUFC 1THXA 4KH7A 4IBPA 1J0FA 4PQ1A 5INYA 2C3TA 4AJ8A 1AUCA 3IK7A 5DQYA 2RLIA 1EEJA 3GKNA 3QPMA 1WRYA 3TRQA 4RI6A 4MJAA 1ZYQB 3I9V2 2QSIA 2H01A 4F9ZA 3NIVA 1WJKA 2L4CA 3TRXA 1HNCA 4EIQA 1PL2A 1GSQA 2LS5A 1EP7A 2VCVA 1SL2B 3EU4A 1ON4A 3F4TA 4ECJA 4MLYA 3L78A 4I2UA 2E0QA 2X8HA 1BYEA 1FG4A 18GSA 3CQFA 5D9WA 5ECRB 5L71A 1IYIA 2OE1A 1XW5A 4BA7A 3TKPA 3EE2A 3ZYWA 3ERWA 4F0BA 1ILOA 2YANA 3GYKA 4O92A 4K0GA 3GL5A 1TU7A 4LMWA 4WR4A 2CA8A 1BG5A 1YF0A 1ERWA 9GSSA 1YZXA 1FO5A 1EZKA 4ID0A 1GLQA 5GSSA 1TK8B 3O76A 5FWGA 1T4YA 3D5JA 2WZ9A 1V40A 4HQZA 1AC1A 4XS4A 2PBJA 2CV4A 3O3TA 3E0UA 2EC4A 2DJ1A 2LKUA 2AV4A 2WCIA 5CNWA 5J5NA 2FA4A 4ICYA 4YAPA 1ZL9A 3HZ8A 3LQ7A 3ISOA 2YWOA 12GSA 3VI7A 4NPBA 3H1NA 2DKIA 4K0NA 1PL1A 4F82A 1GUMA 2HFDA 5IIZA 2CVBA 1YEPA 2DSAA 3HVVA 4LL4B 2LJRA 1PFOA 4KW6A 3TJBA 3S9FA 2ZUPA 3JCML 1M99A 1ZYPA 5F06A 4BVXB 3F4SA 3MWHA 4HU9A 1S3DA 1Z3EA 1JZRA 3VPQA 5E59A 5KN1A 2NVLA 2LRTA 2PN8A 3FKFA 1V98A 3MSZA 2HNLA 3CBUA 1B9XC 4MCUA 2VOCA 3G7IA 4BL7A 1OC8A 1X9WB 4TW5A 4KDYA 3TKQA 2FCHA 2HT9A 4QL7A 4V2MA 4GLTA 5AN1A 3GFKA 2NTOA 3ZITA 2WDUA 4D73A 5G5FA 19GSA 4O5RA 2DC5A 4XS6A 2NDOA 4L5LA 2JSYA 4NMUA 3ZMLA 3P90A 5CAXA 4JBBA 1MEKA 5DAKA 3HYPA 3TKSA 2DBCA 2YNXA 4FO5A 1K0MA 3SWLA 1WOUA 1XIYA 1SD9A 1TP9A 5DCHA 1BQ7A 1J9BA 5DBQA 1R26A 2WRTA 3L9VA 5C04A 3IHQA 4ECCA 4WBJA 4ML1A 2HRKA 4I6XA 2CT6A 2RUFA 4NXIA 1R5AA 4PURA 2ES7A 3UJ1A 1GUHA 2F51A 4L8EA 5B6NA 1SL1B 4KSMA 4YAVA 1QK8A 2QA2A 2H1AA 3WGEA 3APOA 4FYCA 2HRNA 5GAPD 4JR4A 4FYUA 2C3QA 6GSVA 1GSYA 1XWAA 2GZPA 2LUSA 4KDXA 2MMOA 1O81A 2IMFA 2VD1A 3HCZA 4J56E 5CREA 1EV9A 3QFAC 1G6YA 1OKDA 1Z7RA 4KUNA 1GTUA 5ECSA 5IMFA 2N5AA 4BWQA 1EEMA 2HZEA 4DVCA 2O8VB 4ZBDA 1O8XA 1M0UA 4POLA 3GSSA 2IFQB 1ERTA 3A5WA 4AJ7A 1FVJA 2YPMA 2DJ0A 4HDEA 1AXDA 1PMTA 5IPHA 2WJUA 1YKAA 3F9UA 4L5OA 2VCTA 4K2DA 2GT6A 1O85A 3GMFA 4CHSA 2LV3A 1N2AA 2P0GA 4XHMA 1SKRB 4IQ1A 5GAND 4ZL9A 1GSDA 1QGVA 2F9SA 1G0TA 3VI5A 2R0CA 6GSXA 1ABAA 3KZQA 2MYGA 4KX4A 3H79A 2MZCA 3MYDA 2V41A 2IMDA 2LNTA 5J9BA 22GSA 2X8GA 3LYPA 2RM6A 1AW9A 2C0FA 3EVIA 4WR5A 1HQOA 2HSMA 3BCIA 3KD0A 4MA9A 1Z6NA 5A4WA 1K0OA 4ZB9A 4O7HA 3EMPA 4Q5QA 1O8WA 4FQUA 2B3SA 5DJMA 3FZ5A 5CRWA 3HD5A 1TU8A 2VL2C 1TI3A 5HFIA 1U3AA 4MJEA 2DMLA 2GQMA 3C1SA 3FYGA 3KCMA 2MBTA 1ZYEA 2H76A 4FH8A 2LJAA 4NAXA 2A2RA 1XZOA 1SU9A 1I9DA 4PNFA 1R4WA 2JZRA 5HR2A 3FR9A 1SENA 4PNGA 3GNJA 4GSSA 3U5RE 5EL8A 4JRRA 5CYYA 1OC9A 2H6YA 2MBSA 3LYKA 3EC3A 5JWOB 2IMKA 3P8WA 3OR5A 1SYRA 5IPGA 1YY7A 2BTOT 2B7JA 3KM6A 4L0UA 4HI7A 1B9YC 1O73A 4KAEA 2HRAA 3ZIJA 2YOIA 1WPIA 4K6XA 2O89A 4K8MA 4TOPA 2VCQA 2G2QA 3GV1A 4OMVA 2H30A 5IMDA 3F0IA 4BVYA 4PQIA 2P5RA 4K5RA 3VWVA 4ECBA 1O7UA 2OBIA 4MZBA 5G30A 4YQVA 4OFMA 1X5DA 5ELAA 1R7HA 4ILFA 5ECIB 3HJMA 1USBA 2VL3A 1M2BA 1ZMAA 1VRSD 1ZCPA 5DALB 2E2GA 2KUCA 2K9FA 1KNGA 3L0HA 2HE3A 1F37A 1U6TA 2J9HA 2QA1A 3FW2A 5CRGA 2VLTA 3DKSA 2MMNA 1I5GA 2MMAA 4OCFA 4KDUA 3F3RA 1T7PB 1EOGA 1MTCA 5D96A 5ECQB 2VUPA 1FHEA 20GSA 1M7TA 1LU4A 3K8NA 4KCEA 3M9KA 3HVSA 4RI7A 4ZIJA 2E7PA 3Q18A 2GSQA 4RQRA 1VF1A 2LQQA 4RUVA 3ZFBA 4G0KA 1A0FA 2YWMA 5ENUA 4DSSA 1A23A 4XRDA 1TTZA 4O5QA 3KH7A 5D9TA 1J08A 4MJCA 2PVOC 1ML6A 5G1KA 3QOUA 4ZBBA 1JLVA 1OE8A 4G0IA 1UA5A 4J2FA
chains in the Genus database with same CATH topology
2IN3A 2CVKA 4I97A 2X49A 3F8UA 3M0FA 1SJZA 3TCOA 3EU3A 4TR4A 3ZTLA 1HNBA 1B48A 4JZQA 5H5SA 2L6CA 4POMA 1OC3A 3D6IA 1PD21 3KEBA 5D9VA 3I69A 3MIXA 5D8IA 2LSTA 5A4VA 5ABRA 2QC7A 3GA4A 5LD0A 2PERA 4ECIA 5IQYA 2V6OA 3FHKA 1GTBA 1HD2A 2P5QA 1MDJA 1PKZA 4K2XA 3UL3A 4TXVA 1ST9A 5CRHA 2GT5A 3KIJA 3IAM2 3IBHA 5DJLA 4Z2UA 2P31A 3BOAA 3V1WA 3RHBA 3HZ4A 2DMMA 3UIWA 4YKGA 3GTUB 2C0DA 17GSA 5F0GA 1SK2A 1T4ZA 1IYHA 3M3MA 2GTUA 2IPAA 1TRVA 2L5LA 2LQOA 4N0ZA 3VLNA 2LJKA 3AY8A 3DEXA 2HI7A 2PPTA 3DIEA 1NHOA 3E3EA 2X8CA 3QR6A 2A2PA 5ID2B 1N8JA 1TK5B 4PGTA 5HR1A 2IL3A 2ZCTA 3QAVA 4N11A 2WGRA 2A2SA 4HJ2A 2YV7A 4EIPA 1G7OA 16GSA 1XOAA 1JFUA 2EIQA 3BCKA 3IR4A 4P3YB 4HEA2 2DJ3A 4HU7A 3ZRDA 1ZOFA 3ME7A 5G1LA 4XTSA 3ERFA 3CSIA 3CTGA 5G5EA 2H6XA 2IJYA 2L57A 2O87A 2K8SA 4MZCA 2VIMA 2JADA 3UBLA 1TJDA 1WE0A 4Q5RA 3C7MA 1VF3A 3FK8A 2CX3A 2BMXA 2YCDA 4TR3A 2AJQB 1G7EA 3GL3A 1Y6EA 2RM5A 2XBIA 1R5PA 4GF0A 1K0AA 4ISDA 2O85A 4KCAA 3CSHA 1S3AA 1TDIA 4GTUA 4MP4A 1MD3A 4EL1A 5BRTA 4MZWA 3HA9A 4NHWA 2M80A 4XCSA 3W6GA 4MDCA 3TJJA 2GSRA 4USSA 2ZNMA 5E4WA 2LTKA 5DQSA 2KP1A 4OCEA 5DVBA 4BPYA 3KMNA 3WGDA 1YKCA 4I2TA 1SD8A 3WYWA 3CMIA 1K3YA 3TUEA 3A3TA 4IN0A 1SJ6A 1XWBA 1DE2A 5A4UA 3ZREA 5IMAA 5C00A 3RPPA 11GSA 1RK4A 1EGOA 4QL9A 2OBKA 4L0WA 2H1BA 2YP6A 2L59A 3DYRA 3HVXA 3TKSE 2VLVA 1EP8A 3LGCA 2HSYA 4V1Ag 3DXBA 2IMEA 3RAZA 4TR1B 1XCCA 4WETA 1JZWA 2ALBA 3BD2A 3EYTA 1YEXA 1FOHA 3WT1A 2B1LA 3VWWA 1TKDB 4KA0A 2D2ZA 1GWCA 1A8YA 1BAYA 4ZB6A 1PX6A 2XPEA 2JACA 1ERUA 2GQLA 3VWXA 3M8NA 2V32A 3LSZA 3CXGA 1DUGA 3GN3A 4PTSA 4IW9A 2HLSA 5H5RA 2H72A 1GNWA 2H66A 3A5IA 2VM1A 3FZ9A 2V2GA 4K7NA 1XXUA 2TIRA 5GZZB 3GX8A 4K7IA 4HOJA 4CY6A 6GSWA 4G0LA 1A2JA 5ELGA 1DSBA 1K0CA 1E2YA 3BJ5A 4OWYA 4IGJA 3UOMA 1OE7A 3U6VA 1G6WA 4ACSA 1GTAA 5CP1A 1NM3A 2V1MA 1H75A 3QAGA 1PA3A 2JSZA 1FB0A 3UEMA 2B5EA 3QFBC 1B4PA 1PN0A 3L4NA 8GSSA 10GSA 2YJ7A 2FY6A 1X5CA 4X4JA 5EVOA 4TR0A 1TOFA 2GSTA 4GSTA 3ZLPA 1PRXA 3Q6OA 4MPFA 5BMUA 2XPDA 3M1GA 3TJGA 3ZMKA 1NHYA 1BX9A 4KGIA 1JZDA 3FR6A 2H73A 2IMIA 3P2AA 4IKHA 2BJXA 2H71A 1WWJA 2DLXA 2YWIA 5IMVA 5KN0A 4WKWA 4PQHA 1XVWA 3W8SA 1EOHA 2H0HA 2WB9A 3TKSC 2M72A 3APQA 2G0FA 5IMZA 3VFIA 3KP9A 2VAFA 4BVXA 3NOFA 3L9UA 6GSUA 1KEBA 1XFLA 2PMTA 2B1KA 4EDYA 2I9HA 3IAS2 4GWRA 6GSTA 1K0DA 4LLRA 4XIHA 2GQKA 2M46A 2HYXA 4EDZA 2YZHA 4OFTA 3IC8A 4EE0A 2C3NA 1QXHA 4K5SA 4GSNA 2HXKA 1XW9A 4ZL7A 3F6DA 4MF5A 4WXTA 4G10A 4V2NA 2LRCA 3LG6A 2CQ9A 2C8UA 5ECLB 4F03A 2XHFA 2LRNA 5KN2A 3LWAA 1GSSA 5D93A 2CZ3A 1FAAA 3RBTA 2B7KA 4XS4B 4XS1A 4IJ3A 4MH3A 4AGSA 5B8BA 5ECHB 1ZGNA 1Z7PA 2CZ2A 2FA8A 3TOTA 3PPUA 3LJRA 3TRPA 3GUSA 4K1FA 4WF4A 1GLPA 2C0EA 4EUYA 5AIXA 1HYUA 4A5PA 4LL1B 4ML6A 1WIKA 1V9WA 2VCZA 1ZYNA 2F8FA 3IC4A 3US3A 1QFNA 2I81A 3L9SA 3Q19A 4MH2A 1JLWA 2N5FA 4HQSA 1X9MB 1XWGA 5FHIA 4N0VA 2I4AA 2JZSA 1U87A 5F8BA 1Z9HA 5HFGA 1QQ2A 1X5EA 3PINA 5EPFA 5IO0A 2CVDA 5J9CA 4Z2RA 1Q4JA 6GSSA 4BL7B 2FWHA 2C1YA 2IWTA 4N30A 1M9BA 4YKFA 1T1VA 3TKRA 4Z2TA 3TOUA 2VD0A 2GSSA 1TW9A 4KSOA 3M9JA 2WULA 2IFQA 3IRAA 4KE3A 4MK3A 5IO2A 4X43A 4D73B 1SL0B 3WT2A 1AQXA 5IM9A 2OJLA 1K0BA 2FLSA 4KF9A 3GKKA 1PGTA 1TK0B 2OE0A 5J41A 3DMLA 4F0CA 6GSYA 1SKWB 1A24A 2A4VA 2R4VA 5DAKB 3E9JB 3H4KA 4WBRD 2NBSA 4Q5FA 4MF7A 4MJBA 3UVTA 1Y25A 4GRFA 1MD4A 2XC2A 1S3CA 1VF2A 1YDKA 1M2DA 4KB3A 2VCXA 5F05A 5HR0A 2EIRA 4N10A 1SKSB 3UAPA 4CDOA 2R37A 3D22A 3CRTA 3I43A 3LXTA 3ZZXA 2AB6A 1FVKA 1XOBA 1YJ6A 2JU5A 3ZIVA 1X9SB 4ZXGA 1M9AA 5DCGA 4GQFA 1QUWA 3A2XA 1EWXA 3LORA 3QMXA 2IIYA 1GUKA 3EMXA 4DSRA 2F3MA 2CAIA 2CAQA 2H74A 2RUEA 1PX7A 3QCPA 1BJXA 5FT3A 3KTLA 2OKAA 4ZBAA 5IMCA 2HZEB 3PH9A 3RDWA 1VF4A 2WFCA 3VPTA 3A2VA 1AAZA 3LXZA 3P7XA 4IQAA 3W8JA 1H4OA 2K18A 3WGXA 1X0RA 4IJIA 3IHGA 2DJJA 3UBKA 4I8BA 2YZUA 2OE3A 1GNEA 1NSWA 3DD3A 4NV2A 3Q74A 1SJIA 2PWJA 4CW9A 1XWKA 3ED3A 4WF5A 3UVHA 2DJ2A 4JU5A 3IOSA 2FUG2 2R0GA 3DRNA 4MPGA 5HR3A 1W4VA 2FD3A 1U88A 13GSA 5ECPB 3FR3A 1WP0A 3IV4A 1XW6A 4OFNA 4FIWA 1XWCA 1MDIA 3O6TA 2RIIA 3VK9A 3A2WA 4BWSA 2L6DA 4QQ7A 4PX1A 3MAKA 2OA7A 1GSUA 1TRUA 3VURA 4NWYA 1V57A 3IE3A 2K6VA 1B4QA 2I3YA 1K3OA 2DIYA 3FRCA 5EY6A 2LEGA 2VM2A 1XVQA 2ON5A 2MMZA 2H6ZA 1V2AA 2J23A 3ZL5A 2YN1A 2QGVA 4JE1A 4G19A 4Q5NA 1W89A 3KMOA 4ULXA 2KLXA 5DALA 2FNOA 1TI1A 2FWEA 2CX4A 2JZTA 3HDCA 2WS2A 1LJRA 1YF1A 4LA1A 4EVMA 3PGTA 2YWNA 2AHEA 1NW2A 3IDVA 2X99A 5H5QA 2FHEA 5G31A 3G7YA 5F07A 2H1GA 3IXRA 1VGLA 2GGTA 4V2LA 5B6MA 2GS3A 1OC9B 1GH2A 2REMA 3CTFA 4I5QA 5COHA 5ECOB 4ZB8A 4PXOA 5ECKB 2A4HA 4IELA 1MDKA 3F6FA 3TGZA 2VL9A 3IK9A 4MNNA 1OKTA 3BBYA 3F3QA 4K9ZA 2H70A 4KNDA 2PVQA 4ZILA 1OAZA 4E8HA 2H1DA 2N5BA 3FZ4A 3J7Yk 3WD6A 1XBSA 4AF2A 2VL2A 2EIOA 4Z7XA 1HNAA 1O6JA 5ECNB 4BVYB 1ZZYA 4YQMA 5KOWA 1AIUA 2PGTA 2B6MA 2PU9C 2B5XA 2GZZA 3KP8A 2H19A 2GLRA 3VWUA 5B8AA 1UC7A 3HHVA 1F9MA 2DKHA 3DGQA 2HZFA 2X4AA 1JHBA 3HKRA 2AYTA 1Z5YE 4DSQA 1Q98A 2V6KA 5D9XA 5CO3A 2F8AA 1XPVA 1M2AA 1A8LA 1SYXA 2VCWA 3D4MA 3I6AA 5AIVA 5KEJA 2K8VA 1EV4A 2L4QA 3KGKA 1YQ1A 1URMA 1LBKA 1TRWA 3FZAA 4GXZA 3GTUA 1FOVA 1EGRA 4RQXA 4DSSB 5HQPA 3H8QA 2L5OA 3F4RA 1A0RP 2C0GA 2H8LA 4OD7A 1QMVA 2E2MA 5CRDA 3NZNA 1GTIA 1BEDA 3MNGA 3FY7A 1CQGA 5ID2A 3G7JA 3HJPA 2OACA 4HJMA 1PSQA 2GDRA 3C73A 2R0PA 2KOKA 1Z6MA 1THOA 5JWQB 3RHCA 4TXOB 5KN3A 5IOWA 3TJFA 4F2IA 3EPTA 1E6BA 3EWLA 1GRXA 4H86A 5JWRB 1GULA 1ACVA 5IOXA 3IA1A 1A2LA 4POBA 3D0ZA 5KOXA 2GVPA 5A5KA 3GKXA 5DDLA 3C71A 4TKYA 3UARA 1K0NA 4HZ4A 2OADA 3HY2A 4OO5A 2VLUA 3C8EA 3ZVJD 4IHUA 4PUAA 4CY8A 3MDKA 3N9JA 5LNKe 4YQUA 2AUVA 4EXJA 2C80A 4TVEA 5J3RA 2H0IA 1C72A 2H0GA 4DEJA 3G9BA 1RW1A 5JCWA 1RQMA 2YJHA 2TRCP 3GURA 4JR6A 4YH2A 1F6MC 2O7KA 2R3XA 2H75A 3R2QA 4EO3A 3H93A 1AQVA 3GH9A 1F3BA 4G9HA 1UVZA 2Z9SA 3LFLA 1U3IA 4GCIA 1PKWA 4ZL8A 4XRAA 4O5UA 4IVFA 5AGYA 1FW1A 2KHPA 3UMAA 2VO4A 1DE1A 5J4UA 1PN9A 2UZ8A 1T00A 1OVNA 2PUKC 4EC0A 1V58A 4K7OA 1OYJA 1PQNA 4TN8A 2XBQA 3ERGA 1WMJA 3GSTA 4MABA 2DJKA 4NV5A 3TDGA 4AJ6A 3KH9A 3GKMA 3RPNA 3TB2A 1GSFA 4EF0A 4TRXA 2TRXA 1AQWA 3DWVA 3GRXA 5GSTA 4JEDA 2ON7A 2HSHA 1UN2A 4FYBA 3EINA 4TR1A 1KTEA 3QDNA 4MF6A 5D73A 2LNSA 1A2MA 2FWFA 4IS0A 5ECMB 3GX0A 3KTBA 5LCZA 3DVXA 2FGXA 3J7Yb 3C1RA 3QD9A 3EURA 1F2EA 3IPZA 3N5OA 1JZOA 3LW9A 5JCGA 1GL8A 2QKEA 4IP6A 2I1UA 4HUAA 1DBYA 3ZFLA 1FB6A 3DVWA 4EKZA 2JL4A 2FWGA 1ERVA 4MMMA 1SK1A 4OO4A 4J57E 2HRFA 3D4TA 4LMVA 4X0XA 4O32A 2DIZA 1TRSA 2AAWA 2NPBA 1KBNA 3GH6A 3SBCA 4WEYA 3PR8A 3ZVJA 2KP2A 2R6KA 3R3EA 3APSA 1T3BA 5B7CA 4HS1A 3CRUA 1GSEA 5HFKA 3KXOA 4POKA 2X64A 3ME8A 5JCUA 1GP1A 3FMWA 3QAWA 5G2ZA 3GIXA 14GSA 4V1Ap 3CSJA 3LEFA 4X1UA 3D21A 1K3LA 1SK0A 1T8EB 2R5GA 4NHZA 1TXXA 4G2EA 1CQHA 2C4JA 2B5YA 3GHAA 3CYNA 7GSSA 2R2JA 4TXOA 3F63A 1B8XA 2GZYA 5AISA 4HZ2A 2YV9A 1F3AA 4IP1A 3HXSA 3TJKA 3FEUA 4GQCA 3KJYA 3HJOA 4E8EA 4PUFC 1THXA 4KH7A 4IBPA 1J0FA 4PQ1A 5INYA 2C3TA 4AJ8A 1AUCA 3IK7A 5DQYA 2RLIA 1EEJA 3GKNA 3QPMA 1WRYA 3TRQA 4RI6A 4MJAA 1ZYQB 3I9V2 2QSIA 2H01A 4F9ZA 3NIVA 1WJKA 2L4CA 3TRXA 1HNCA 4EIQA 1PL2A 1GSQA 2LS5A 1EP7A 2VCVA 1SL2B 3EU4A 1ON4A 3F4TA 4ECJA 4MLYA 3L78A 4I2UA 2E0QA 2X8HA 1BYEA 1FG4A 18GSA 5D9WA 5ECRB 5L71A 1IYIA 2OE1A 1XW5A 4BA7A 3TKPA 3EE2A 3ZYWA 3ERWA 4F0BA 1ILOA 2YANA 3GYKA 4O92A 4K0GA 3GL5A 1TU7A 4LMWA 4WR4A 2CA8A 1BG5A 1YF0A 1ERWA 9GSSA 1YZXA 1FO5A 1EZKA 4ID0A 1GLQA 5GSSA 1TK8B 3O76A 5FWGA 1T4YA 3D5JA 2WZ9A 1V40A 4HQZA 1AC1A 4XS4A 2PBJA 2CV4A 3O3TA 3E0UA 2EC4A 2DJ1A 2LKUA 2AV4A 2WCIA 5CNWA 5J5NA 2FA4A 4ICYA 4YAPA 1ZL9A 3HZ8A 3LQ7A 3ISOA 2YWOA 12GSA 3VI7A 4NPBA 3H1NA 2DKIA 4K0NA 1PL1A 4F82A 1GUMA 2HFDA 5IIZA 2CVBA 1YEPA 2DSAA 3HVVA 4LL4B 2LJRA 4KW6A 3TJBA 3S9FA 2ZUPA 3JCML 1M99A 1ZYPA 5F06A 4BVXB 3F4SA 3MWHA 4HU9A 1S3DA 1Z3EA 1JZRA 3VPQA 5E59A 5KN1A 2NVLA 2LRTA 2PN8A 3FKFA 1V98A 3MSZA 2HNLA 3CBUA 1B9XC 4MCUA 2VOCA 3G7IA 4BL7A 1OC8A 1X9WB 4TW5A 4KDYA 3TKQA 2FCHA 2HT9A 4QL7A 4V2MA 4GLTA 5AN1A 3GFKA 2NTOA 3ZITA 2WDUA 4D73A 5G5FA 19GSA 4O5RA 2DC5A 4XS6A 2NDOA 4L5LA 2JSYA 4NMUA 3ZMLA 3P90A 5CAXA 4JBBA 1MEKA 5DAKA 3HYPA 3TKSA 2DBCA 2YNXA 4FO5A 1K0MA 3SWLA 1WOUA 1XIYA 1SD9A 1TP9A 5DCHA 1BQ7A 1J9BA 5DBQA 1R26A 2WRTA 3L9VA 5C04A 3IHQA 4ECCA 4WBJA 4ML1A 2HRKA 4I6XA 2CT6A 2RUFA 4NXIA 1R5AA 4PURA 2ES7A 3UJ1A 1GUHA 2F51A 4L8EA 5B6NA 1SL1B 4YAVA 4KSMA 1QK8A 2QA2A 2H1AA 3WGEA 3APOA 4FYCA 2HRNA 5GAPD 4JR4A 4FYUA 2C3QA 6GSVA 1GSYA 1XWAA 2GZPA 2LUSA 4KDXA 2MMOA 1O81A 2IMFA 2VD1A 3HCZA 4J56E 5CREA 1EV9A 3QFAC 1G6YA 1OKDA 1Z7RA 4KUNA 1GTUA 5ECSA 5IMFA 2N5AA 4BWQA 1EEMA 2HZEA 4DVCA 2O8VB 4ZBDA 1O8XA 1M0UA 4POLA 3GSSA 2IFQB 1ERTA 3A5WA 4AJ7A 1FVJA 2YPMA 2DJ0A 4HDEA 1AXDA 1PMTA 5IPHA 2WJUA 1YKAA 3F9UA 4L5OA 2VCTA 4K2DA 2GT6A 1O85A 3GMFA 4CHSA 2LV3A 1N2AA 2P0GA 4XHMA 1SKRB 4IQ1A 5GAND 4ZL9A 1GSDA 1QGVA 2F9SA 1G0TA 3VI5A 2R0CA 6GSXA 1ABAA 3KZQA 2MYGA 4KX4A 3H79A 2MZCA 3MYDA 2V41A 2IMDA 2LNTA 5J9BA 22GSA 2X8GA 3LYPA 2RM6A 1AW9A 2C0FA 3EVIA 4WR5A 1HQOA 2HSMA 3BCIA 3KD0A 4MA9A 1Z6NA 5A4WA 1K0OA 4ZB9A 4O7HA 3EMPA 4Q5QA 1O8WA 4FQUA 2B3SA 5DJMA 3FZ5A 5CRWA 3HD5A 1TU8A 2VL2C 1TI3A 5HFIA 1U3AA 4MJEA 2DMLA 2GQMA 3C1SA 3FYGA 3KCMA 2MBTA 1ZYEA 2H76A 4FH8A 2LJAA 4NAXA 2A2RA 1XZOA 1SU9A 1I9DA 4PNFA 1R4WA 2JZRA 5HR2A 3FR9A 1SENA 4PNGA 3GNJA 4GSSA 3U5RE 5EL8A 4JRRA 5CYYA 1OC9A 2H6YA 2MBSA 3LYKA 3EC3A 5JWOB 2IMKA 3P8WA 3OR5A 1SYRA 5IPGA 1YY7A 2BTOT 2B7JA 3KM6A 4L0UA 4HI7A 1B9YC 1O73A 4KAEA 2HRAA 3ZIJA 2YOIA 1WPIA 4K6XA 2O89A 4K8MA 4TOPA 2VCQA 2G2QA 3GV1A 4OMVA 2H30A 5IMDA 3F0IA 4BVYA 4PQIA 2P5RA 4K5RA 3VWVA 4ECBA 1O7UA 2OBIA 4MZBA 5G30A 4YQVA 4OFMA 1X5DA 5ELAA 1R7HA 4ILFA 5ECIB 3HJMA 1USBA 2VL3A 1M2BA 1ZMAA 1VRSD 1ZCPA 5DALB 2E2GA 2KUCA 2K9FA 1KNGA 3L0HA 2HE3A 1F37A 1U6TA 2J9HA 2QA1A 3FW2A 5CRGA 2VLTA 3DKSA 2MMNA 1I5GA 2MMAA 4OCFA 4KDUA 3F3RA 1T7PB 1EOGA 1MTCA 5D96A 5ECQB 2VUPA 1FHEA 20GSA 1M7TA 1LU4A 3K8NA 4KCEA 3M9KA 3HVSA 4RI7A 4ZIJA 2E7PA 3Q18A 2GSQA 4RQRA 1VF1A 2LQQA 4RUVA 3ZFBA 4G0KA 1A0FA 2YWMA 5ENUA 4DSSA 1A23A 4XRDA 1TTZA 4O5QA 3KH7A 5D9TA 1J08A 4MJCA 2PVOC 1ML6A 5G1KA 3QOUA 4ZBBA 1JLVA 1OE8A 4G0IA 1UA5A 4J2FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IN3 A;  2CVK A;  4I97 A;  3F8U A;  3M0F A;  1SJZ A;  3TCO A;  3EU3 A;  4TR4 A;  3ZTL A;  1HNB A;  1B48 A;  4JZQ A;  5H5S A;  2L6C A;  4POM A;  1OC3 A;  3D6I A;  1PD2 1;  3KEB A;  5D9V A;  3I69 A;  5D8I A;  2LST A;  5A4V A;  5ABR A;  2QC7 A;  3GA4 A;  5LD0 A;  2PER A;  4ECI A;  5IQY A;  2V6O A;  3FHK A;  1GTB A;  1HD2 A;  2P5Q A;  1MDJ A;  1PKZ A;  3UL3 A;  4TXV A;  1ST9 A;  5CRH A;  2GT5 A;  3KIJ A;  3IAM 2;  3IBH A;  5DJL A;  2P31 A;  3BOA A;  3V1W A;  3RHB A;  3HZ4 A;  2DMM A;  3UIW A;  3GTU B;  2C0D A;  17GS A;  5F0G A;  1SK2 A;  1T4Z A;  1IYH A;  3M3M A;  2GTU A;  2IPA A;  1TRV A;  2L5L A;  2LQO A;  4N0Z A;  3VLN A;  2LJK A;  3AY8 A;  3DEX A;  2HI7 A;  2PPT A;  3DIE A;  1NHO A;  3E3E A;  2X8C A;  3QR6 A;  5ID2 B;  1N8J A;  1TK5 B;  4PGT A;  5HR1 A;  2IL3 A;  2ZCT A;  3QAV A;  4N11 A;  2WGR A;  2A2S A;  4HJ2 A;  2YV7 A;  1G7O A;  16GS A;  1XOA A;  1JFU A;  2EIQ A;  3BCK A;  3IR4 A;  4P3Y B;  4HEA 2;  2DJ3 A;  4HU7 A;  3ZRD A;  1ZOF A;  3ME7 A;  5G1L A;  4XTS A;  3ERF A;  3CSI A;  3CTG A;  5G5E A;  2H6X A;  2IJY A;  2L57 A;  2O87 A;  2K8S A;  4MZC A;  2VIM A;  2JAD A;  3UBL A;  1TJD A;  1WE0 A;  4Q5R A;  3C7M A;  1VF3 A;  3FK8 A;  2CX3 A;  2BMX A;  2YCD A;  4TR3 A;  2AJQ B;  1G7E A;  3GL3 A;  1Y6E A;  2RM5 A;  2XBI A;  1R5P A;  4GF0 A;  1K0A A;  4ISD A;  2O85 A;  4KCA A;  3CSH A;  1S3A A;  1TDI A;  4GTU A;  4MP4 A;  1MD3 A;  4EL1 A;  4MZW A;  3HA9 A;  4NHW A;  2M80 A;  4XCS A;  3W6G A;  4MDC A;  3TJJ A;  2GSR A;  2ZNM A;  5E4W A;  2LTK A;  5DQS A;  2KP1 A;  4OCE A;  5DVB A;  4BPY A;  3KMN A;  3WGD A;  1YKC A;  4I2T A;  1SD8 A;  3WYW A;  3CMI A;  1K3Y A;  3TUE A;  3A3T A;  4IN0 A;  1SJ6 A;  1XWB A;  1DE2 A;  5A4U A;  3ZRE A;  5IMA A;  5C00 A;  3RPP A;  11GS A;  1RK4 A;  1EGO A;  4QL9 A;  2OBK A;  4L0W A;  2H1B A;  2YP6 A;  2L59 A;  3DYR A;  3HVX A;  3TKS E;  2VLV A;  1EP8 A;  3LGC A;  2HSY A;  4V1A g;  3DXB A;  2IME A;  3RAZ A;  4TR1 B;  1XCC A;  4WET A;  1JZW A;  2ALB A;  3BD2 A;  3EYT A;  1YEX A;  3WT1 A;  2B1L A;  3VWW A;  1TKD B;  4KA0 A;  2D2Z A;  1GWC A;  1A8Y A;  1BAY A;  4ZB6 A;  1PX6 A;  2XPE A;  2JAC A;  1ERU A;  2GQL A;  3VWX A;  3M8N A;  2V32 A;  3LSZ A;  3CXG A;  1DUG A;  3GN3 A;  4IW9 A;  2HLS A;  5H5R A;  2H72 A;  1GNW A;  2H66 A;  2VM1 A;  3FZ9 A;  2V2G A;  4K7N A;  1XXU A;  2TIR A;  5GZZ B;  3GX8 A;  4K7I A;  4HOJ A;  6GSW A;  1A2J A;  5ELG A;  1DSB A;  1K0C A;  1E2Y A;  3BJ5 A;  4OWY A;  4IGJ A;  3UOM A;  1OE7 A;  3U6V A;  1G6W A;  4ACS A;  1GTA A;  5CP1 A;  1NM3 A;  2V1M A;  1H75 A;  3QAG A;  1PA3 A;  2JSZ A;  1FB0 A;  3UEM A;  2B5E A;  3QFB C;  1B4P A;  3L4N A;  8GSS A;  10GS A;  2YJ7 A;  2FY6 A;  1X5C A;  5EVO A;  4TR0 A;  1TOF A;  2GST A;  4GST A;  3ZLP A;  1PRX A;  3Q6O A;  4MPF A;  2XPD A;  3M1G A;  3TJG A;  3ZMK A;  1NHY A;  1BX9 A;  4KGI A;  1JZD A;  3FR6 A;  2H73 A;  2IMI A;  3P2A A;  4IKH A;  2BJX A;  2H71 A;  1WWJ A;  2DLX A;  2YWI A;  5IMV A;  5KN0 A;  4WKW A;  4PQH A;  1XVW A;  3W8S A;  1EOH A;  2H0H A;  2WB9 A;  3TKS C;  2M72 A;  3APQ A;  2G0F A;  5IMZ A;  3VFI A;  3KP9 A;  2VAF A;  4BVX A;  3NOF A;  3L9U A;  6GSU A;  1KEB A;  1XFL A;  2PMT A;  2B1K A;  4EDY A;  2I9H A;  3IAS 2;  4GWR A;  6GST A;  1K0D A;  4LLR A;  4XIH A;  2GQK A;  2M46 A;  2HYX A;  4EDZ A;  2YZH A;  4OFT A;  4EE0 A;  2C3N A;  1QXH A;  4GSN A;  2HXK A;  1XW9 A;  4ZL7 A;  3F6D A;  4MF5 A;  4WXT A;  4G10 A;  4V2N A;  2LRC A;  3LG6 A;  2CQ9 A;  2C8U A;  5ECL B;  4F03 A;  2XHF A;  2LRN A;  5KN2 A;  3LWA A;  1GSS A;  5D93 A;  2CZ3 A;  1FAA A;  3RBT A;  2B7K A;  4XS4 B;  4XS1 A;  4IJ3 A;  4MH3 A;  4AGS A;  5B8B A;  5ECH B;  1ZGN A;  1Z7P A;  2CZ2 A;  2FA8 A;  3TOT A;  3LJR A;  3TRP A;  3GUS A;  4K1F A;  4WF4 A;  1GLP A;  2C0E A;  4EUY A;  5AIX A;  1HYU A;  4LL1 B;  4ML6 A;  1WIK A;  1V9W A;  2VCZ A;  2F8F A;  3IC4 A;  3US3 A;  1QFN A;  2I81 A;  3L9S A;  3Q19 A;  4MH2 A;  1JLW A;  2N5F A;  4HQS A;  1X9M B;  1XWG A;  5FHI A;  4N0V A;  2I4A A;  2JZS A;  1U87 A;  5F8B A;  1Z9H A;  5HFG A;  1QQ2 A;  1X5E A;  3PIN A;  5EPF A;  5IO0 A;  2CVD A;  5J9C A;  1Q4J A;  6GSS A;  2FWH A;  2C1Y A;  2IWT A;  4N30 A;  1M9B A;  1T1V A;  3TKR A;  3TOU A;  2VD0 A;  2GSS A;  1TW9 A;  4KSO A;  3M9J A;  2WUL A;  2IFQ A;  3IRA A;  4KE3 A;  4MK3 A;  5IO2 A;  4X43 A;  4D73 B;  1SL0 B;  3WT2 A;  1AQX A;  5IM9 A;  2OJL A;  1K0B A;  2FLS A;  3GKK A;  1PGT A;  1TK0 B;  2OE0 A;  5J41 A;  3DML A;  4F0C A;  6GSY A;  1SKW B;  1A24 A;  2A4V A;  2R4V A;  5DAK B;  3E9J B;  3H4K A;  4WBR D;  2NBS A;  4Q5F A;  4MF7 A;  4MJB A;  3UVT A;  1Y25 A;  4GRF A;  1MD4 A;  2XC2 A;  1S3C A;  1VF2 A;  1YDK A;  1M2D A;  4KB3 A;  2VCX A;  5F05 A;  5HR0 A;  2EIR A;  4N10 A;  1SKS B;  3UAP A;  4CDO A;  2R37 A;  3D22 A;  3CRT A;  3I43 A;  3LXT A;  3ZZX A;  2AB6 A;  1FVK A;  1XOB A;  1YJ6 A;  2JU5 A;  3ZIV A;  1X9S B;  4ZXG A;  1M9A A;  5DCG A;  4GQF A;  1QUW A;  3A2X A;  1EWX A;  3LOR A;  3QMX A;  2IIY A;  1GUK A;  3EMX A;  4DSR A;  2F3M A;  2CAI A;  2CAQ A;  2H74 A;  2RUE A;  1PX7 A;  3QCP A;  1BJX A;  5FT3 A;  3KTL A;  2OKA A;  4ZBA A;  5IMC A;  2HZE B;  3PH9 A;  3RDW A;  1VF4 A;  2WFC A;  3VPT A;  3A2V A;  1AAZ A;  3LXZ A;  3P7X A;  4IQA A;  3W8J A;  1H4O A;  2K18 A;  3WGX A;  1X0R A;  4IJI A;  2DJJ A;  3UBK A;  4I8B A;  2YZU A;  2OE3 A;  1GNE A;  1NSW A;  3DD3 A;  4NV2 A;  3Q74 A;  1SJI A;  2PWJ A;  4CW9 A;  1XWK A;  3ED3 A;  4WF5 A;  3UVH A;  2DJ2 A;  4JU5 A;  3IOS A;  2FUG 2;  3DRN A;  4MPG A;  5HR3 A;  1W4V A;  2FD3 A;  1U88 A;  13GS A;  5ECP B;  3FR3 A;  1WP0 A;  3IV4 A;  1XW6 A;  4OFN A;  4FIW A;  1XWC A;  1MDI A;  3O6T A;  2RII A;  3VK9 A;  3A2W A;  4BWS A;  2L6D A;  4PX1 A;  4QQ7 A;  3MAK A;  2OA7 A;  1GSU A;  1TRU A;  3VUR A;  4NWY A;  1V57 A;  3IE3 A;  2K6V A;  1B4Q A;  2I3Y A;  1K3O A;  2DIY A;  3FRC A;  5EY6 A;  2LEG A;  2VM2 A;  1XVQ A;  2ON5 A;  2MMZ A;  2H6Z A;  1V2A A;  2J23 A;  3ZL5 A;  2YN1 A;  2QGV A;  4JE1 A;  4G19 A;  4Q5N A;  1W89 A;  3KMO A;  4ULX A;  2KLX A;  5DAL A;  2FNO A;  1TI1 A;  2FWE A;  2CX4 A;  2JZT A;  3HDC A;  2WS2 A;  1LJR A;  1YF1 A;  4LA1 A;  4EVM A;  3PGT A;  2YWN A;  2AHE A;  1NW2 A;  3IDV A;  2X99 A;  5H5Q A;  2FHE A;  5G31 A;  5F07 A;  3G7Y A;  2H1G A;  3IXR A;  1VGL A;  2GGT A;  4V2L A;  5B6M A;  2GS3 A;  1OC9 B;  1GH2 A;  2REM A;  3CTF A;  4I5Q A;  5COH A;  5ECO B;  4ZB8 A;  4PXO A;  5ECK B;  4IEL A;  1MDK A;  3F6F A;  3TGZ A;  2VL9 A;  3IK9 A;  1OKT A;  3BBY A;  3F3Q A;  4K9Z A;  2H70 A;  4KND A;  2PVQ A;  4ZIL A;  1OAZ A;  4E8H A;  2H1D A;  2N5B A;  3FZ4 A;  3J7Y k;  3WD6 A;  1XBS A;  4AF2 A;  2VL2 A;  2EIO A;  4Z7X A;  1HNA A;  1O6J A;  5ECN B;  1ZZY A;  4YQM A;  1AIU A;  2PGT A;  2B6M A;  2PU9 C;  2B5X A;  2GZZ A;  3KP8 A;  2H19 A;  2GLR A;  3VWU A;  5B8A A;  1UC7 A;  3HHV A;  1F9M A;  3DGQ A;  2HZF A;  1JHB A;  3HKR A;  2AYT A;  1Z5Y E;  4DSQ A;  1Q98 A;  2V6K A;  5D9X A;  5CO3 A;  2F8A A;  1XPV A;  1M2A A;  1A8L A;  1SYX A;  2VCW A;  3D4M A;  3I6A A;  5AIV A;  5KEJ A;  2K8V A;  1EV4 A;  2L4Q A;  3KGK A;  1YQ1 A;  1URM A;  1LBK A;  1TRW A;  3FZA A;  4GXZ A;  3GTU A;  1FOV A;  1EGR A;  4RQX A;  4DSS B;  5HQP A;  3H8Q A;  2L5O A;  3F4R A;  1A0R P;  2C0G A;  2H8L A;  4OD7 A;  1QMV A;  2E2M A;  5CRD A;  3NZN A;  1GTI A;  1BED A;  3MNG A;  3FY7 A;  1CQG A;  5ID2 A;  3G7J A;  3HJP A;  2OAC A;  4HJM A;  1PSQ A;  2GDR A;  3C73 A;  2KOK A;  1Z6M A;  1THO A;  5JWQ B;  3RHC A;  4TXO B;  5KN3 A;  5IOW A;  3TJF A;  4F2I A;  1E6B A;  3EWL A;  1GRX A;  4H86 A;  5JWR B;  1GUL A;  1ACV A;  5IOX A;  3IA1 A;  1A2L A;  4POB A;  3D0Z A;  2GVP A;  5A5K A;  3GKX A;  5DDL A;  3C71 A;  4TKY A;  3UAR A;  1K0N A;  4HZ4 A;  2OAD A;  3HY2 A;  4OO5 A;  2VLU A;  3C8E A;  3ZVJ D;  4IHU A;  4PUA A;  3MDK A;  3N9J A;  5LNK e;  4YQU A;  2AUV A;  4EXJ A;  2C80 A;  4TVE A;  5J3R A;  2H0I A;  1C72 A;  2H0G A;  4DEJ A;  3G9B A;  1RW1 A;  5JCW A;  1RQM A;  2YJH A;  2TRC P;  3GUR A;  4JR6 A;  4YH2 A;  1F6M C;  2O7K A;  2R3X A;  2H75 A;  3R2Q A;  4EO3 A;  3H93 A;  1AQV A;  3GH9 A;  1F3B A;  4G9H A;  1UVZ A;  2Z9S A;  3LFL A;  1U3I A;  4GCI A;  1PKW A;  4ZL8 A;  4XRA A;  4IVF A;  5AGY A;  1FW1 A;  2KHP A;  3UMA A;  2VO4 A;  1DE1 A;  5J4U A;  1PN9 A;  1T00 A;  1OVN A;  2PUK C;  4EC0 A;  1V58 A;  4K7O A;  1OYJ A;  1PQN A;  4TN8 A;  2XBQ A;  3ERG A;  1WMJ A;  3GST A;  4MAB A;  2DJK A;  4NV5 A;  3TDG A;  4AJ6 A;  3KH9 A;  3GKM A;  3RPN A;  3TB2 A;  1GSF A;  4EF0 A;  4TRX A;  2TRX A;  1AQW A;  3DWV A;  3GRX A;  5GST A;  4JED A;  2ON7 A;  2HSH A;  1UN2 A;  4FYB A;  3EIN A;  4TR1 A;  1KTE A;  3QDN A;  4MF6 A;  5D73 A;  2LNS A;  1A2M A;  2FWF A;  4IS0 A;  5ECM B;  3GX0 A;  3KTB A;  5LCZ A;  3DVX A;  2FGX A;  3J7Y b;  3C1R A;  3QD9 A;  3EUR A;  1F2E A;  3IPZ A;  3N5O A;  1JZO A;  5JCG A;  1GL8 A;  2QKE A;  4IP6 A;  2I1U A;  4HUA A;  1DBY A;  3ZFL A;  1FB6 A;  3DVW A;  4EKZ A;  2JL4 A;  2FWG A;  1ERV A;  4MMM A;  1SK1 A;  4OO4 A;  4J57 E;  2HRF A;  3D4T A;  4LMV A;  4X0X A;  4O32 A;  2DIZ A;  1TRS A;  2AAW A;  2NPB A;  1KBN A;  3GH6 A;  3SBC A;  4WEY A;  3PR8 A;  3ZVJ A;  2KP2 A;  2R6K A;  3APS A;  1T3B A;  5B7C A;  4HS1 A;  3CRU A;  1GSE A;  5HFK A;  3KXO A;  4POK A;  2X64 A;  3ME8 A;  5JCU A;  1GP1 A;  3QAW A;  5G2Z A;  3GIX A;  14GS A;  4V1A p;  3CSJ A;  3LEF A;  4X1U A;  3D21 A;  1K3L A;  1SK0 A;  1T8E B;  2R5G A;  4NHZ A;  1TXX A;  4G2E A;  1CQH A;  2C4J A;  2B5Y A;  3GHA A;  3CYN A;  7GSS A;  2R2J A;  4TXO A;  3F63 A;  1B8X A;  2GZY A;  5AIS A;  4HZ2 A;  2YV9 A;  1F3A A;  4IP1 A;  3HXS A;  3TJK A;  3FEU A;  4GQC A;  3KJY A;  3HJO A;  4E8E A;  4PUF C;  1THX A;  4KH7 A;  4IBP A;  1J0F A;  4PQ1 A;  5INY A;  2C3T A;  4AJ8 A;  1AUC A;  3IK7 A;  5DQY A;  2RLI A;  1EEJ A;  3GKN A;  3QPM A;  1WRY A;  3TRQ A;  4RI6 A;  4MJA A;  1ZYQ B;  3I9V 2;  2QSI A;  2H01 A;  4F9Z A;  3NIV A;  1WJK A;  2L4C A;  3TRX A;  1HNC A;  1PL2 A;  1GSQ A;  2LS5 A;  1EP7 A;  2VCV A;  1SL2 B;  3EU4 A;  1ON4 A;  3F4T A;  4ECJ A;  4MLY A;  3L78 A;  4I2U A;  2E0Q A;  2X8H A;  1BYE A;  1FG4 A;  18GS A;  5D9W A;  5ECR B;  5L71 A;  1IYI A;  2OE1 A;  1XW5 A;  4BA7 A;  3TKP A;  3EE2 A;  3ZYW A;  3ERW A;  4F0B A;  1ILO A;  2YAN A;  3GYK A;  4O92 A;  4K0G A;  3GL5 A;  1TU7 A;  4LMW A;  4WR4 A;  2CA8 A;  1BG5 A;  1YF0 A;  1ERW A;  9GSS A;  1YZX A;  1FO5 A;  1EZK A;  4ID0 A;  1GLQ A;  5GSS A;  1TK8 B;  3O76 A;  5FWG A;  1T4Y A;  3D5J A;  2WZ9 A;  1V40 A;  4HQZ A;  1AC1 A;  4XS4 A;  2PBJ A;  2CV4 A;  3O3T A;  3E0U A;  2EC4 A;  2DJ1 A;  2LKU A;  2AV4 A;  2WCI A;  5CNW A;  5J5N A;  2FA4 A;  4YAP A;  1ZL9 A;  3HZ8 A;  3LQ7 A;  3ISO A;  2YWO A;  12GS A;  3VI7 A;  4NPB A;  3H1N A;  4K0N A;  1PL1 A;  4F82 A;  1GUM A;  2HFD A;  5IIZ A;  2CVB A;  1YEP A;  2DSA A;  3HVV A;  4LL4 B;  2LJR A;  4KW6 A;  3TJB A;  3S9F A;  2ZUP A;  3JCM L;  1M99 A;  5F06 A;  3F4S A;  3MWH A;  4HU9 A;  1S3D A;  1Z3E A;  1JZR A;  3VPQ A;  5E59 A;  5KN1 A;  2NVL A;  2LRT A;  2PN8 A;  3FKF A;  1V98 A;  3MSZ A;  2HNL A;  3CBU A;  1B9X C;  4MCU A;  2VOC A;  3G7I A;  4BL7 A;  1OC8 A;  1X9W B;  4TW5 A;  4KDY A;  3TKQ A;  2FCH A;  2HT9 A;  4QL7 A;  4V2M A;  4GLT A;  5AN1 A;  3GFK A;  2NTO A;  3ZIT A;  2WDU A;  4D73 A;  5G5F A;  19GS A;  4O5R A;  2DC5 A;  4XS6 A;  2NDO A;  4L5L A;  2JSY A;  4NMU A;  3ZML A;  3P90 A;  5CAX A;  4JBB A;  1MEK A;  5DAK A;  3HYP A;  3TKS A;  2DBC A;  2YNX A;  4FO5 A;  1K0M A;  3SWL A;  1WOU A;  1XIY A;  1SD9 A;  1TP9 A;  5DCH A;  1BQ7 A;  1J9B A;  5DBQ A;  1R26 A;  2WRT A;  3L9V A;  5C04 A;  3IHQ A;  4ECC A;  4WBJ A;  4ML1 A;  4I6X A;  4PUR A;  2CT6 A;  2RUF A;  4NXI A;  1R5A A;  2ES7 A;  3UJ1 A;  1GUH A;  2F51 A;  4L8E A;  5B6N A;  1SL1 B;  4YAV A;  4KSM A;  1QK8 A;  2H1A A;  3WGE A;  3APO A;  4FYC A;  2HRN A;  5GAP D;  4JR4 A;  4FYU A;  2C3Q A;  6GSV A;  1GSY A;  1XWA A;  2GZP A;  2LUS A;  4KDX A;  2MMO A;  1O81 A;  2IMF A;  2VD1 A;  3HCZ A;  4J56 E;  5CRE A;  1EV9 A;  3QFA C;  1G6Y A;  1OKD A;  1Z7R A;  4KUN A;  1GTU A;  5ECS A;  5IMF A;  2N5A A;  4BWQ A;  1EEM A;  2HZE A;  4DVC A;  2O8V B;  4ZBD A;  1O8X A;  1M0U A;  4POL A;  3GSS A;  2IFQ B;  1ERT A;  3A5W A;  4AJ7 A;  1FVJ A;  2YPM A;  2DJ0 A;  4HDE A;  1AXD A;  1PMT A;  5IPH A;  2WJU A;  1YKA A;  3F9U A;  4L5O A;  2VCT A;  4K2D A;  2GT6 A;  1O85 A;  3GMF A;  4CHS A;  2LV3 A;  1N2A A;  2P0G A;  4XHM A;  1SKR B;  4IQ1 A;  5GAN D;  4ZL9 A;  1GSD A;  1QGV A;  2F9S A;  1G0T A;  3VI5 A;  6GSX A;  1ABA A;  3KZQ A;  2MYG A;  4KX4 A;  3H79 A;  2MZC A;  2V41 A;  2IMD A;  2LNT A;  5J9B A;  22GS A;  2X8G A;  3LYP A;  2RM6 A;  1AW9 A;  2C0F A;  3EVI A;  4WR5 A;  1HQO A;  3BCI A;  3KD0 A;  4MA9 A;  1Z6N A;  5A4W A;  1K0O A;  4ZB9 A;  4O7H A;  3EMP A;  4Q5Q A;  1O8W A;  2B3S A;  5DJM A;  3FZ5 A;  5CRW A;  3HD5 A;  1TU8 A;  2VL2 C;  1TI3 A;  5HFI A;  1U3A A;  4MJE A;  2DML A;  2GQM A;  3C1S A;  3FYG A;  3KCM A;  2MBT A;  1ZYE A;  2H76 A;  4FH8 A;  2LJA A;  4NAX A;  2A2R A;  1XZO A;  1SU9 A;  1I9D A;  4PNF A;  1R4W A;  2JZR A;  5HR2 A;  3FR9 A;  1SEN A;  4PNG A;  3GNJ A;  4GSS A;  3U5R E;  5EL8 A;  4JRR A;  5CYY A;  1OC9 A;  2H6Y A;  2MBS A;  3LYK A;  3EC3 A;  5JWO B;  2IMK A;  3P8W A;  3OR5 A;  1SYR A;  5IPG A;  1YY7 A;  2BTO T;  2B7J A;  3KM6 A;  4L0U A;  4HI7 A;  1B9Y C;  1O73 A;  4KAE A;  3ZIJ A;  2YOI A;  1WPI A;  4K6X A;  2O89 A;  4K8M A;  4TOP A;  2VCQ A;  2G2Q A;  3GV1 A;  4OMV A;  2H30 A;  5IMD A;  3F0I A;  4BVY A;  4PQI A;  2P5R A;  3VWV A;  4ECB A;  1O7U A;  2OBI A;  4MZB A;  5G30 A;  4YQV A;  4OFM A;  1X5D A;  5ELA A;  1R7H A;  4ILF A;  5ECI B;  3HJM A;  1USB A;  2VL3 A;  1M2B A;  1ZMA A;  1VRS D;  1ZCP A;  5DAL B;  2E2G A;  2KUC A;  2K9F A;  1KNG A;  3L0H A;  2HE3 A;  1F37 A;  1U6T A;  2J9H A;  3FW2 A;  5CRG A;  2VLT A;  3DKS A;  2MMN A;  1I5G A;  2MMA A;  4OCF A;  4KDU A;  3F3R A;  1T7P B;  1EOG A;  1MTC A;  5D96 A;  5ECQ B;  2VUP A;  1FHE A;  20GS A;  1M7T A;  1LU4 A;  3K8N A;  4KCE A;  3M9K A;  3HVS A;  4RI7 A;  4ZIJ A;  2E7P A;  3Q18 A;  2GSQ A;  4RQR A;  1VF1 A;  2LQQ A;  4RUV A;  3ZFB A;  1A0F A;  2YWM A;  5ENU A;  4DSS A;  1A23 A;  4XRD A;  1TTZ A;  3KH7 A;  5D9T A;  1J08 A;  4MJC A;  2PVO C;  1ML6 A;  5G1K A;  3QOU A;  4ZBB A;  1JLV A;  1OE8 A;  1UA5 A;  4J2F A; 
#chains in the Genus database with same CATH topology
 2IN3 A;  2CVK A;  4I97 A;  2X49 A;  3F8U A;  3M0F A;  1SJZ A;  3TCO A;  3EU3 A;  4TR4 A;  3ZTL A;  1HNB A;  1B48 A;  4JZQ A;  5H5S A;  2L6C A;  4POM A;  1OC3 A;  3D6I A;  1PD2 1;  3KEB A;  5D9V A;  3I69 A;  3MIX A;  5D8I A;  2LST A;  5A4V A;  5ABR A;  2QC7 A;  3GA4 A;  5LD0 A;  2PER A;  4ECI A;  5IQY A;  2V6O A;  3FHK A;  1GTB A;  1HD2 A;  2P5Q A;  1MDJ A;  1PKZ A;  4K2X A;  3UL3 A;  4TXV A;  1ST9 A;  5CRH A;  2GT5 A;  3KIJ A;  3IAM 2;  3IBH A;  5DJL A;  4Z2U A;  2P31 A;  3BOA A;  3V1W A;  3RHB A;  3HZ4 A;  2DMM A;  3UIW A;  4YKG A;  3GTU B;  2C0D A;  17GS A;  5F0G A;  1SK2 A;  1T4Z A;  1IYH A;  3M3M A;  2GTU A;  2IPA A;  1TRV A;  2L5L A;  2LQO A;  4N0Z A;  3VLN A;  2LJK A;  3AY8 A;  3DEX A;  2HI7 A;  2PPT A;  3DIE A;  1NHO A;  3E3E A;  2X8C A;  3QR6 A;  2A2P A;  5ID2 B;  1N8J A;  1TK5 B;  4PGT A;  5HR1 A;  2IL3 A;  2ZCT A;  3QAV A;  4N11 A;  2WGR A;  2A2S A;  4HJ2 A;  2YV7 A;  4EIP A;  1G7O A;  16GS A;  1XOA A;  1JFU A;  2EIQ A;  3BCK A;  1M3I A;  3IR4 A;  4P3Y B;  4HEA 2;  2DJ3 A;  4HU7 A;  3ZRD A;  1ZOF A;  3ME7 A;  5G1L A;  4XTS A;  3ERF A;  3CSI A;  3CTG A;  5G5E A;  2H6X A;  2IJY A;  2L57 A;  2O87 A;  2K8S A;  4MZC A;  2VIM A;  2JAD A;  3UBL A;  1TJD A;  1WE0 A;  4Q5R A;  3C7M A;  1VF3 A;  3FK8 A;  2CX3 A;  2BMX A;  2YCD A;  4TR3 A;  2AJQ B;  1G7E A;  3GL3 A;  1Y6E A;  2RM5 A;  2XBI A;  1R5P A;  4GF0 A;  3HVN A;  1K0A A;  4ISD A;  2O85 A;  4KCA A;  3CSH A;  1S3A A;  1TDI A;  4GTU A;  4MP4 A;  1MD3 A;  4EL1 A;  5BRT A;  4MZW A;  3HA9 A;  4NHW A;  2M80 A;  4XCS A;  3W6G A;  4MDC A;  3TJJ A;  2GSR A;  4USS A;  2ZNM A;  5E4W A;  2LTK A;  5DQS A;  2KP1 A;  4OCE A;  5DVB A;  4BPY A;  3KMN A;  3WGD A;  1YKC A;  4I2T A;  1SD8 A;  3WYW A;  3CMI A;  1K3Y A;  3TUE A;  3A3T A;  4IN0 A;  1SJ6 A;  1XWB A;  1DE2 A;  5A4U A;  3ZRE A;  5IMA A;  5C00 A;  3RPP A;  11GS A;  1RK4 A;  1EGO A;  4QL9 A;  2OBK A;  4L0W A;  2H1B A;  2YP6 A;  2L59 A;  3DYR A;  3HVX A;  3TKS E;  2VLV A;  1EP8 A;  3LGC A;  2HSY A;  4V1A g;  3DXB A;  2IME A;  3RAZ A;  4TR1 B;  1XCC A;  4WET A;  1JZW A;  2ALB A;  3BD2 A;  3EYT A;  1YEX A;  1FOH A;  3WT1 A;  2B1L A;  3VWW A;  1TKD B;  4KA0 A;  2D2Z A;  1GWC A;  1A8Y A;  1BAY A;  4ZB6 A;  1PX6 A;  2XPE A;  2JAC A;  1ERU A;  2GQL A;  3VWX A;  3M8N A;  2V32 A;  3LSZ A;  3CXG A;  1DUG A;  3GN3 A;  4PTS A;  4IW9 A;  2HLS A;  5H5R A;  2H72 A;  1GNW A;  2H66 A;  3A5I A;  2VM1 A;  3FZ9 A;  2V2G A;  4K7N A;  1XXU A;  2TIR A;  5GZZ B;  3GX8 A;  4K7I A;  4HOJ A;  4CY6 A;  6GSW A;  4G0L A;  1A2J A;  5ELG A;  1DSB A;  1K0C A;  1E2Y A;  3BJ5 A;  4OWY A;  4IGJ A;  3UOM A;  1OE7 A;  3U6V A;  1G6W A;  4ACS A;  1GTA A;  5CP1 A;  1NM3 A;  2V1M A;  1H75 A;  3QAG A;  1PA3 A;  2JSZ A;  1FB0 A;  3UEM A;  2B5E A;  3QFB C;  1B4P A;  1PN0 A;  3L4N A;  8GSS A;  10GS A;  2YJ7 A;  2FY6 A;  1X5C A;  4X4J A;  5EVO A;  4TR0 A;  1TOF A;  2GST A;  4GST A;  3ZLP A;  1PRX A;  3Q6O A;  4MPF A;  5BMU A;  2XPD A;  3M1G A;  3TJG A;  3ZMK A;  1NHY A;  1BX9 A;  4KGI A;  1JZD A;  3FR6 A;  2H73 A;  2IMI A;  3P2A A;  4IKH A;  2BJX A;  2H71 A;  1WWJ A;  2DLX A;  2YWI A;  5IMV A;  5KN0 A;  4WKW A;  4PQH A;  1XVW A;  3W8S A;  1EOH A;  2H0H A;  2WB9 A;  3TKS C;  2M72 A;  3APQ A;  2G0F A;  5IMZ A;  3VFI A;  3KP9 A;  2VAF A;  4BVX A;  3NOF A;  3L9U A;  6GSU A;  1KEB A;  1XFL A;  2PMT A;  2B1K A;  4EDY A;  2I9H A;  3IAS 2;  4GWR A;  6GST A;  1K0D A;  4LLR A;  4XIH A;  2GQK A;  2M46 A;  2HYX A;  4EDZ A;  2YZH A;  4OFT A;  3IC8 A;  4EE0 A;  2C3N A;  1QXH A;  4K5S A;  4GSN A;  2HXK A;  1XW9 A;  4ZL7 A;  3F6D A;  4MF5 A;  4WXT A;  4G10 A;  4V2N A;  2LRC A;  3LG6 A;  2CQ9 A;  2C8U A;  5ECL B;  4F03 A;  2XHF A;  2LRN A;  5KN2 A;  3LWA A;  1GSS A;  5D93 A;  2CZ3 A;  1FAA A;  3RBT A;  2B7K A;  4XS4 B;  4XS1 A;  4IJ3 A;  4MH3 A;  4AGS A;  5B8B A;  5ECH B;  1ZGN A;  1Z7P A;  2CZ2 A;  2FA8 A;  3TOT A;  3PPU A;  3LJR A;  3TRP A;  3GUS A;  4K1F A;  4WF4 A;  1GLP A;  2C0E A;  4EUY A;  5AIX A;  1HYU A;  4A5P A;  4LL1 B;  1S3R A;  4ML6 A;  1WIK A;  1V9W A;  2VCZ A;  1ZYN A;  2F8F A;  3IC4 A;  3US3 A;  1QFN A;  2I81 A;  3L9S A;  3Q19 A;  4MH2 A;  1JLW A;  2N5F A;  4HQS A;  1X9M B;  1XWG A;  5FHI A;  4N0V A;  2I4A A;  2JZS A;  1U87 A;  5F8B A;  1Z9H A;  5HFG A;  1QQ2 A;  1X5E A;  3PIN A;  5EPF A;  5IO0 A;  2CVD A;  5J9C A;  4Z2R A;  1Q4J A;  6GSS A;  4BL7 B;  2FWH A;  2C1Y A;  2IWT A;  4N30 A;  1M9B A;  4YKF A;  1T1V A;  3TKR A;  4Z2T A;  3TOU A;  2VD0 A;  2GSS A;  1TW9 A;  4KSO A;  3M9J A;  2WUL A;  2IFQ A;  3IRA A;  4KE3 A;  4MK3 A;  5IO2 A;  4X43 A;  4D73 B;  1SL0 B;  3WT2 A;  1AQX A;  5IM9 A;  2OJL A;  1K0B A;  2FLS A;  4KF9 A;  3GKK A;  1PGT A;  1TK0 B;  2OE0 A;  5J41 A;  3DML A;  4F0C A;  6GSY A;  1SKW B;  1A24 A;  2A4V A;  2R4V A;  5DAK B;  3E9J B;  3H4K A;  4WBR D;  2NBS A;  4Q5F A;  4MF7 A;  4MJB A;  3UVT A;  1Y25 A;  4GRF A;  1MD4 A;  2XC2 A;  4HSC X;  1S3C A;  1VF2 A;  1YDK A;  1M2D A;  4KB3 A;  2VCX A;  5F05 A;  5HR0 A;  2EIR A;  4N10 A;  1SKS B;  3UAP A;  4CDO A;  2R37 A;  3D22 A;  3CRT A;  3I43 A;  3LXT A;  3ZZX A;  2AB6 A;  1FVK A;  1XOB A;  1YJ6 A;  2JU5 A;  3ZIV A;  1X9S B;  4ZXG A;  1M9A A;  5DCG A;  4GQF A;  1QUW A;  3A2X A;  1EWX A;  3LOR A;  3QMX A;  2IIY A;  1GUK A;  3EMX A;  4DSR A;  2F3M A;  2CAI A;  2CAQ A;  2H74 A;  2RUE A;  1PX7 A;  3QCP A;  1BJX A;  5FT3 A;  3KTL A;  2OKA A;  4ZBA A;  5IMC A;  2HZE B;  3PH9 A;  3RDW A;  1VF4 A;  2WFC A;  3VPT A;  3A2V A;  1AAZ A;  3LXZ A;  3P7X A;  4IQA A;  3W8J A;  1H4O A;  2K18 A;  3WGX A;  1X0R A;  4IJI A;  3IHG A;  2DJJ A;  3UBK A;  4I8B A;  2YZU A;  2OE3 A;  1GNE A;  1NSW A;  3DD3 A;  4NV2 A;  3Q74 A;  1SJI A;  2PWJ A;  4CW9 A;  1XWK A;  3ED3 A;  4WF5 A;  3UVH A;  2DJ2 A;  4JU5 A;  4BIK A;  3IOS A;  2FUG 2;  2R0G A;  3DRN A;  4MPG A;  5HR3 A;  1W4V A;  2FD3 A;  1U88 A;  13GS A;  5ECP B;  3FR3 A;  1WP0 A;  3IV4 A;  1XW6 A;  4OFN A;  4FIW A;  1XWC A;  1MDI A;  3O6T A;  2RII A;  3VK9 A;  3A2W A;  4BWS A;  2L6D A;  4QQ7 A;  4PX1 A;  3MAK A;  2OA7 A;  1GSU A;  1TRU A;  3VUR A;  4NWY A;  1V57 A;  3IE3 A;  2K6V A;  1B4Q A;  2I3Y A;  1K3O A;  2DIY A;  3FRC A;  5EY6 A;  2LEG A;  2VM2 A;  1XVQ A;  2ON5 A;  2MMZ A;  2H6Z A;  1M3J A;  1V2A A;  2J23 A;  3ZL5 A;  2YN1 A;  2QGV A;  4JE1 A;  4G19 A;  4Q5N A;  1W89 A;  3KMO A;  4ULX A;  2KLX A;  5DAL A;  2FNO A;  1TI1 A;  2FWE A;  2CX4 A;  2JZT A;  3HDC A;  2WS2 A;  1LJR A;  1YF1 A;  4LA1 A;  4EVM A;  3PGT A;  2YWN A;  2AHE A;  1NW2 A;  3IDV A;  2X99 A;  5H5Q A;  2FHE A;  5G31 A;  3G7Y A;  5F07 A;  2H1G A;  3IXR A;  1VGL A;  2GGT A;  4V2L A;  5B6M A;  2GS3 A;  1OC9 B;  1GH2 A;  2REM A;  3CTF A;  4I5Q A;  5COH A;  5ECO B;  4ZB8 A;  4PXO A;  5ECK B;  2A4H A;  4IEL A;  1MDK A;  3F6F A;  3TGZ A;  2VL9 A;  3IK9 A;  4MNN A;  1OKT A;  3BBY A;  3F3Q A;  4K9Z A;  2H70 A;  4KND A;  2PVQ A;  4ZIL A;  1OAZ A;  4E8H A;  2H1D A;  2N5B A;  3FZ4 A;  3J7Y k;  3WD6 A;  1XBS A;  4AF2 A;  1XG8 A;  2VL2 A;  2EIO A;  4Z7X A;  1HNA A;  1O6J A;  5ECN B;  4BVY B;  1ZZY A;  4YQM A;  5KOW A;  1AIU A;  2PGT A;  2B6M A;  2PU9 C;  2B5X A;  2GZZ A;  3KP8 A;  2H19 A;  2GLR A;  3VWU A;  5B8A A;  1UC7 A;  3HHV A;  1F9M A;  2DKH A;  3DGQ A;  2HZF A;  2X4A A;  1JHB A;  3HKR A;  2AYT A;  1Z5Y E;  4DSQ A;  1Q98 A;  2V6K A;  5D9X A;  5CO3 A;  2F8A A;  1XPV A;  1M2A A;  1A8L A;  1SYX A;  2VCW A;  3D4M A;  3I6A A;  5AIV A;  5KEJ A;  2K8V A;  1EV4 A;  2L4Q A;  3KGK A;  1YQ1 A;  1URM A;  1LBK A;  1TRW A;  3FZA A;  4GXZ A;  3GTU A;  1FOV A;  1EGR A;  4RQX A;  4DSS B;  5HQP A;  3H8Q A;  2L5O A;  3F4R A;  1A0R P;  2C0G A;  2H8L A;  4OD7 A;  1QMV A;  2E2M A;  5CRD A;  3NZN A;  1GTI A;  1BED A;  3MNG A;  3FY7 A;  1CQG A;  5ID2 A;  3G7J A;  3HJP A;  2OAC A;  4HJM A;  1PSQ A;  2GDR A;  3C73 A;  2R0P A;  2KOK A;  1Z6M A;  1THO A;  5JWQ B;  3RHC A;  4TXO B;  5KN3 A;  5IOW A;  3TJF A;  4F2I A;  3EPT A;  1E6B A;  3EWL A;  1GRX A;  4H86 A;  5JWR B;  1GUL A;  1ACV A;  5IOX A;  3IA1 A;  1A2L A;  4POB A;  3D0Z A;  5KOX A;  2GVP A;  5A5K A;  3GKX A;  5DDL A;  3C71 A;  4TKY A;  3UAR A;  1K0N A;  4HZ4 A;  2OAD A;  3HY2 A;  4OO5 A;  2VLU A;  3C8E A;  3ZVJ D;  4IHU A;  4PUA A;  4CY8 A;  3MDK A;  3N9J A;  5LNK e;  4YQU A;  2AUV A;  4EXJ A;  2C80 A;  4TVE A;  5J3R A;  2H0I A;  1C72 A;  2H0G A;  4DEJ A;  3G9B A;  1RW1 A;  5JCW A;  1RQM A;  2YJH A;  2TRC P;  3GUR A;  4JR6 A;  4YH2 A;  1F6M C;  2O7K A;  2R3X A;  2H75 A;  3R2Q A;  4EO3 A;  3H93 A;  1AQV A;  3GH9 A;  1F3B A;  4G9H A;  1UVZ A;  2Z9S A;  3LFL A;  1U3I A;  4GCI A;  1PKW A;  4ZL8 A;  4XRA A;  4O5U A;  4IVF A;  5AGY A;  1FW1 A;  2KHP A;  3UMA A;  2VO4 A;  1DE1 A;  5J4U A;  1PN9 A;  2UZ8 A;  1T00 A;  1OVN A;  2PUK C;  4EC0 A;  1V58 A;  4K7O A;  1OYJ A;  1PQN A;  4TN8 A;  2XBQ A;  3ERG A;  1WMJ A;  3GST A;  4MAB A;  2DJK A;  4NV5 A;  3TDG A;  4AJ6 A;  3KH9 A;  3GKM A;  3RPN A;  3TB2 A;  1GSF A;  4EF0 A;  4TRX A;  2TRX A;  1AQW A;  3DWV A;  3GRX A;  5GST A;  4JED A;  2ON7 A;  2HSH A;  1UN2 A;  4FYB A;  3EIN A;  4TR1 A;  1KTE A;  3QDN A;  4MF6 A;  5D73 A;  2LNS A;  1A2M A;  2FWF A;  4IS0 A;  5ECM B;  3GX0 A;  3KTB A;  5LCZ A;  3DVX A;  2FGX A;  3J7Y b;  3C1R A;  3QD9 A;  3EUR A;  1F2E A;  3IPZ A;  3N5O A;  1JZO A;  3LW9 A;  5JCG A;  1GL8 A;  2QKE A;  4IP6 A;  2I1U A;  4HUA A;  1DBY A;  3ZFL A;  1FB6 A;  3DVW A;  4EKZ A;  2JL4 A;  2FWG A;  1ERV A;  4MMM A;  1SK1 A;  4OO4 A;  4J57 E;  2HRF A;  3D4T A;  4LMV A;  4X0X A;  4O32 A;  2DIZ A;  1TRS A;  2AAW A;  2NPB A;  1KBN A;  3GH6 A;  3SBC A;  4WEY A;  3PR8 A;  3ZVJ A;  2KP2 A;  2R6K A;  3R3E A;  3APS A;  1T3B A;  5B7C A;  4HS1 A;  3CRU A;  1GSE A;  5HFK A;  3KXO A;  4POK A;  2X64 A;  3ME8 A;  5JCU A;  1GP1 A;  3FMW A;  3QAW A;  5G2Z A;  3GIX A;  14GS A;  4V1A p;  3CSJ A;  3LEF A;  4X1U A;  3D21 A;  1K3L A;  1SK0 A;  1T8E B;  2R5G A;  4NHZ A;  1TXX A;  4G2E A;  1CQH A;  2C4J A;  2B5Y A;  3GHA A;  3CYN A;  7GSS A;  2R2J A;  4TXO A;  3F63 A;  1B8X A;  2GZY A;  5AIS A;  4HZ2 A;  2YV9 A;  1F3A A;  4IP1 A;  3HXS A;  3TJK A;  3FEU A;  4GQC A;  3KJY A;  3HJO A;  4E8E A;  4PUF C;  1THX A;  4KH7 A;  4IBP A;  1J0F A;  4PQ1 A;  5INY A;  2C3T A;  4AJ8 A;  1AUC A;  3IK7 A;  5DQY A;  2RLI A;  1EEJ A;  3GKN A;  3QPM A;  1WRY A;  3TRQ A;  4RI6 A;  4MJA A;  1ZYQ B;  3I9V 2;  2QSI A;  2H01 A;  4F9Z A;  3NIV A;  1WJK A;  2L4C A;  3TRX A;  1HNC A;  4EIQ A;  1PL2 A;  1GSQ A;  2LS5 A;  1EP7 A;  2VCV A;  1SL2 B;  3EU4 A;  1ON4 A;  3F4T A;  4ECJ A;  4MLY A;  3L78 A;  4I2U A;  2E0Q A;  2X8H A;  1BYE A;  1FG4 A;  18GS A;  3CQF A;  5D9W A;  5ECR B;  5L71 A;  1IYI A;  2OE1 A;  1XW5 A;  4BA7 A;  3TKP A;  3EE2 A;  3ZYW A;  3ERW A;  4F0B A;  1ILO A;  2YAN A;  3GYK A;  4O92 A;  4K0G A;  3GL5 A;  1TU7 A;  4LMW A;  4WR4 A;  2CA8 A;  1BG5 A;  1YF0 A;  1ERW A;  9GSS A;  1YZX A;  1FO5 A;  1EZK A;  4ID0 A;  1GLQ A;  5GSS A;  1TK8 B;  3O76 A;  5FWG A;  1T4Y A;  3D5J A;  2WZ9 A;  1V40 A;  4HQZ A;  1AC1 A;  4XS4 A;  2PBJ A;  2CV4 A;  3O3T A;  3E0U A;  2EC4 A;  2DJ1 A;  2LKU A;  2AV4 A;  2WCI A;  5CNW A;  5J5N A;  2FA4 A;  4ICY A;  4YAP A;  1ZL9 A;  3HZ8 A;  3LQ7 A;  3ISO A;  2YWO A;  12GS A;  3VI7 A;  4NPB A;  3H1N A;  2DKI A;  4K0N A;  1PL1 A;  4F82 A;  1GUM A;  2HFD A;  5IIZ A;  2CVB A;  1YEP A;  2DSA A;  3HVV A;  4LL4 B;  2LJR A;  1PFO A;  4KW6 A;  3TJB A;  3S9F A;  2ZUP A;  3JCM L;  1M99 A;  1ZYP A;  5F06 A;  4BVX B;  3F4S A;  3MWH A;  4HU9 A;  1S3D A;  1Z3E A;  1JZR A;  3VPQ A;  5E59 A;  5KN1 A;  2NVL A;  2LRT A;  2PN8 A;  3FKF A;  1V98 A;  3MSZ A;  2HNL A;  3CBU A;  1B9X C;  4MCU A;  2VOC A;  3G7I A;  4BL7 A;  1OC8 A;  1X9W B;  4TW5 A;  4KDY A;  3TKQ A;  2FCH A;  2HT9 A;  4QL7 A;  4V2M A;  4GLT A;  5AN1 A;  3GFK A;  2NTO A;  3ZIT A;  2WDU A;  4D73 A;  5G5F A;  19GS A;  4O5R A;  2DC5 A;  4XS6 A;  2NDO A;  4L5L A;  2JSY A;  4NMU A;  3ZML A;  3P90 A;  5CAX A;  4JBB A;  1MEK A;  5DAK A;  3HYP A;  3TKS A;  2DBC A;  2YNX A;  4FO5 A;  1K0M A;  3SWL A;  1WOU A;  1XIY A;  1SD9 A;  1TP9 A;  5DCH A;  1BQ7 A;  1J9B A;  5DBQ A;  1R26 A;  2WRT A;  3L9V A;  5C04 A;  3IHQ A;  4ECC A;  4WBJ A;  4ML1 A;  2HRK A;  4I6X A;  2CT6 A;  2RUF A;  4NXI A;  1R5A A;  4PUR A;  2ES7 A;  3UJ1 A;  1GUH A;  2F51 A;  4L8E A;  5B6N A;  1SL1 B;  4KSM A;  4YAV A;  1QK8 A;  2QA2 A;  2H1A A;  3WGE A;  3APO A;  4FYC A;  2HRN A;  5GAP D;  4JR4 A;  4FYU A;  2C3Q A;  6GSV A;  1GSY A;  1XWA A;  2GZP A;  2LUS A;  4KDX A;  2MMO A;  1O81 A;  2IMF A;  2VD1 A;  3HCZ A;  4J56 E;  5CRE A;  1EV9 A;  3QFA C;  1G6Y A;  1OKD A;  1Z7R A;  4KUN A;  1GTU A;  5ECS A;  5IMF A;  2N5A A;  4BWQ A;  1EEM A;  2HZE A;  4DVC A;  2O8V B;  4ZBD A;  1O8X A;  1M0U A;  4POL A;  3GSS A;  2IFQ B;  1ERT A;  3A5W A;  4AJ7 A;  1FVJ A;  2YPM A;  2DJ0 A;  4HDE A;  1AXD A;  1PMT A;  5IPH A;  2WJU A;  1YKA A;  3F9U A;  4L5O A;  2VCT A;  4K2D A;  2GT6 A;  1O85 A;  3GMF A;  4CHS A;  2LV3 A;  1N2A A;  2P0G A;  4XHM A;  1SKR B;  4IQ1 A;  5GAN D;  4ZL9 A;  1GSD A;  1QGV A;  2F9S A;  1G0T A;  3VI5 A;  2R0C A;  6GSX A;  1ABA A;  3KZQ A;  2MYG A;  4KX4 A;  3H79 A;  2MZC A;  3MYD A;  2V41 A;  2IMD A;  2LNT A;  5J9B A;  22GS A;  2X8G A;  3LYP A;  2RM6 A;  1AW9 A;  2C0F A;  3EVI A;  4WR5 A;  1HQO A;  2HSM A;  3BCI A;  3KD0 A;  4MA9 A;  1Z6N A;  5A4W A;  1K0O A;  4ZB9 A;  4O7H A;  3EMP A;  4Q5Q A;  1O8W A;  4FQU A;  2B3S A;  5DJM A;  3FZ5 A;  5CRW A;  3HD5 A;  1TU8 A;  2VL2 C;  1TI3 A;  5HFI A;  1U3A A;  4MJE A;  2DML A;  2GQM A;  3C1S A;  3FYG A;  3KCM A;  2MBT A;  1ZYE A;  2H76 A;  4FH8 A;  2LJA A;  4NAX A;  2A2R A;  1XZO A;  1SU9 A;  1I9D A;  4PNF A;  1R4W A;  2JZR A;  5HR2 A;  3FR9 A;  1SEN A;  4PNG A;  3GNJ A;  4GSS A;  3U5R E;  5EL8 A;  4JRR A;  5CYY A;  1OC9 A;  2H6Y A;  2MBS A;  3LYK A;  3EC3 A;  5JWO B;  2IMK A;  3P8W A;  3OR5 A;  1SYR A;  5IPG A;  1YY7 A;  2BTO T;  2B7J A;  3KM6 A;  4L0U A;  4HI7 A;  1B9Y C;  1O73 A;  4KAE A;  2HRA A;  3ZIJ A;  2YOI A;  1WPI A;  4K6X A;  2O89 A;  4K8M A;  4TOP A;  2VCQ A;  2G2Q A;  3GV1 A;  4OMV A;  2H30 A;  5IMD A;  3F0I A;  4BVY A;  4PQI A;  2P5R A;  4K5R A;  3VWV A;  4ECB A;  1O7U A;  2OBI A;  4MZB A;  5G30 A;  4YQV A;  4OFM A;  1X5D A;  5ELA A;  1R7H A;  4ILF A;  5ECI B;  3HJM A;  1USB A;  2VL3 A;  1M2B A;  1ZMA A;  1VRS D;  1ZCP A;  5DAL B;  2E2G A;  2KUC A;  2K9F A;  1KNG A;  3L0H A;  2HE3 A;  1F37 A;  1U6T A;  2J9H A;  2QA1 A;  3FW2 A;  5CRG A;  2VLT A;  3DKS A;  2MMN A;  1I5G A;  2MMA A;  4OCF A;  4KDU A;  3F3R A;  1T7P B;  1EOG A;  1MTC A;  5D96 A;  5ECQ B;  2VUP A;  1FHE A;  20GS A;  1M7T A;  1LU4 A;  3K8N A;  4KCE A;  3M9K A;  3HVS A;  4RI7 A;  4ZIJ A;  2E7P A;  3Q18 A;  2GSQ A;  4RQR A;  1VF1 A;  2LQQ A;  4RUV A;  3ZFB A;  4G0K A;  1A0F A;  2YWM A;  5ENU A;  4DSS A;  1A23 A;  4XRD A;  1TTZ A;  4O5Q A;  3KH7 A;  5D9T A;  1J08 A;  4MJC A;  2PVO C;  1ML6 A;  5G1K A;  3QOU A;  4ZBB A;  1JLV A;  1OE8 A;  4G0I A;  1UA5 A;  4J2F A; 
#chains in the Genus database with same CATH homology
 2IN3 A;  2CVK A;  4I97 A;  2X49 A;  3F8U A;  3M0F A;  1SJZ A;  3TCO A;  3EU3 A;  4TR4 A;  3ZTL A;  1HNB A;  1B48 A;  4JZQ A;  5H5S A;  2L6C A;  4POM A;  1OC3 A;  3D6I A;  1PD2 1;  3KEB A;  5D9V A;  3I69 A;  3MIX A;  5D8I A;  2LST A;  5A4V A;  5ABR A;  2QC7 A;  3GA4 A;  5LD0 A;  2PER A;  4ECI A;  5IQY A;  2V6O A;  3FHK A;  1GTB A;  1HD2 A;  2P5Q A;  1MDJ A;  1PKZ A;  4K2X A;  3UL3 A;  4TXV A;  1ST9 A;  5CRH A;  2GT5 A;  3KIJ A;  3IAM 2;  3IBH A;  5DJL A;  4Z2U A;  2P31 A;  3BOA A;  3V1W A;  3RHB A;  3HZ4 A;  2DMM A;  3UIW A;  4YKG A;  3GTU B;  2C0D A;  17GS A;  5F0G A;  1SK2 A;  1T4Z A;  1IYH A;  3M3M A;  2GTU A;  2IPA A;  1TRV A;  2L5L A;  2LQO A;  4N0Z A;  3VLN A;  2LJK A;  3AY8 A;  3DEX A;  2HI7 A;  2PPT A;  3DIE A;  1NHO A;  3E3E A;  2X8C A;  3QR6 A;  2A2P A;  5ID2 B;  1N8J A;  1TK5 B;  4PGT A;  5HR1 A;  2IL3 A;  2ZCT A;  3QAV A;  4N11 A;  2WGR A;  2A2S A;  4HJ2 A;  2YV7 A;  4EIP A;  1G7O A;  16GS A;  1XOA A;  1JFU A;  2EIQ A;  3BCK A;  3IR4 A;  4P3Y B;  4HEA 2;  2DJ3 A;  4HU7 A;  3ZRD A;  1ZOF A;  3ME7 A;  5G1L A;  4XTS A;  3ERF A;  3CSI A;  3CTG A;  5G5E A;  2H6X A;  2IJY A;  2L57 A;  2O87 A;  2K8S A;  4MZC A;  2VIM A;  2JAD A;  3UBL A;  1TJD A;  1WE0 A;  4Q5R A;  3C7M A;  1VF3 A;  3FK8 A;  2CX3 A;  2BMX A;  2YCD A;  4TR3 A;  2AJQ B;  1G7E A;  3GL3 A;  1Y6E A;  2RM5 A;  2XBI A;  1R5P A;  4GF0 A;  1K0A A;  4ISD A;  2O85 A;  4KCA A;  3CSH A;  1S3A A;  1TDI A;  4GTU A;  4MP4 A;  1MD3 A;  4EL1 A;  5BRT A;  4MZW A;  3HA9 A;  4NHW A;  2M80 A;  4XCS A;  3W6G A;  4MDC A;  3TJJ A;  2GSR A;  4USS A;  2ZNM A;  5E4W A;  2LTK A;  5DQS A;  2KP1 A;  4OCE A;  5DVB A;  4BPY A;  3KMN A;  3WGD A;  1YKC A;  4I2T A;  1SD8 A;  3WYW A;  3CMI A;  1K3Y A;  3TUE A;  3A3T A;  4IN0 A;  1SJ6 A;  1XWB A;  1DE2 A;  5A4U A;  3ZRE A;  5IMA A;  5C00 A;  3RPP A;  11GS A;  1RK4 A;  1EGO A;  4QL9 A;  2OBK A;  4L0W A;  2H1B A;  2YP6 A;  2L59 A;  3DYR A;  3HVX A;  3TKS E;  2VLV A;  1EP8 A;  3LGC A;  2HSY A;  4V1A g;  3DXB A;  2IME A;  3RAZ A;  4TR1 B;  1XCC A;  4WET A;  1JZW A;  2ALB A;  3BD2 A;  3EYT A;  1YEX A;  1FOH A;  3WT1 A;  2B1L A;  3VWW A;  1TKD B;  4KA0 A;  2D2Z A;  1GWC A;  1A8Y A;  1BAY A;  4ZB6 A;  1PX6 A;  2XPE A;  2JAC A;  1ERU A;  2GQL A;  3VWX A;  3M8N A;  2V32 A;  3LSZ A;  3CXG A;  1DUG A;  3GN3 A;  4PTS A;  4IW9 A;  2HLS A;  5H5R A;  2H72 A;  1GNW A;  2H66 A;  3A5I A;  2VM1 A;  3FZ9 A;  2V2G A;  4K7N A;  1XXU A;  2TIR A;  5GZZ B;  3GX8 A;  4K7I A;  4HOJ A;  4CY6 A;  6GSW A;  4G0L A;  1A2J A;  5ELG A;  1DSB A;  1K0C A;  1E2Y A;  3BJ5 A;  4OWY A;  4IGJ A;  3UOM A;  1OE7 A;  3U6V A;  1G6W A;  4ACS A;  1GTA A;  5CP1 A;  1NM3 A;  2V1M A;  1H75 A;  3QAG A;  1PA3 A;  2JSZ A;  1FB0 A;  3UEM A;  2B5E A;  3QFB C;  1B4P A;  1PN0 A;  3L4N A;  8GSS A;  10GS A;  2YJ7 A;  2FY6 A;  1X5C A;  4X4J A;  5EVO A;  4TR0 A;  1TOF A;  2GST A;  4GST A;  3ZLP A;  1PRX A;  3Q6O A;  4MPF A;  5BMU A;  2XPD A;  3M1G A;  3TJG A;  3ZMK A;  1NHY A;  1BX9 A;  4KGI A;  1JZD A;  3FR6 A;  2H73 A;  2IMI A;  3P2A A;  4IKH A;  2BJX A;  2H71 A;  1WWJ A;  2DLX A;  2YWI A;  5IMV A;  5KN0 A;  4WKW A;  4PQH A;  1XVW A;  3W8S A;  1EOH A;  2H0H A;  2WB9 A;  3TKS C;  2M72 A;  3APQ A;  2G0F A;  5IMZ A;  3VFI A;  3KP9 A;  2VAF A;  4BVX A;  3NOF A;  3L9U A;  6GSU A;  1KEB A;  1XFL A;  2PMT A;  2B1K A;  4EDY A;  2I9H A;  3IAS 2;  4GWR A;  6GST A;  1K0D A;  4LLR A;  4XIH A;  2GQK A;  2M46 A;  2HYX A;  4EDZ A;  2YZH A;  4OFT A;  3IC8 A;  4EE0 A;  2C3N A;  1QXH A;  4K5S A;  4GSN A;  2HXK A;  1XW9 A;  4ZL7 A;  3F6D A;  4MF5 A;  4WXT A;  4G10 A;  4V2N A;  2LRC A;  3LG6 A;  2CQ9 A;  2C8U A;  5ECL B;  4F03 A;  2XHF A;  2LRN A;  5KN2 A;  3LWA A;  1GSS A;  5D93 A;  2CZ3 A;  1FAA A;  3RBT A;  2B7K A;  4XS4 B;  4XS1 A;  4IJ3 A;  4MH3 A;  4AGS A;  5B8B A;  5ECH B;  1ZGN A;  1Z7P A;  2CZ2 A;  2FA8 A;  3TOT A;  3PPU A;  3LJR A;  3TRP A;  3GUS A;  4K1F A;  4WF4 A;  1GLP A;  2C0E A;  4EUY A;  5AIX A;  1HYU A;  4A5P A;  4LL1 B;  4ML6 A;  1WIK A;  1V9W A;  2VCZ A;  1ZYN A;  2F8F A;  3IC4 A;  3US3 A;  1QFN A;  2I81 A;  3L9S A;  3Q19 A;  4MH2 A;  1JLW A;  2N5F A;  4HQS A;  1X9M B;  1XWG A;  5FHI A;  4N0V A;  2I4A A;  2JZS A;  1U87 A;  5F8B A;  1Z9H A;  5HFG A;  1QQ2 A;  1X5E A;  3PIN A;  5EPF A;  5IO0 A;  2CVD A;  5J9C A;  4Z2R A;  1Q4J A;  6GSS A;  4BL7 B;  2FWH A;  2C1Y A;  2IWT A;  4N30 A;  1M9B A;  4YKF A;  1T1V A;  3TKR A;  4Z2T A;  3TOU A;  2VD0 A;  2GSS A;  1TW9 A;  4KSO A;  3M9J A;  2WUL A;  2IFQ A;  3IRA A;  4KE3 A;  4MK3 A;  5IO2 A;  4X43 A;  4D73 B;  1SL0 B;  3WT2 A;  1AQX A;  5IM9 A;  2OJL A;  1K0B A;  2FLS A;  4KF9 A;  3GKK A;  1PGT A;  1TK0 B;  2OE0 A;  5J41 A;  3DML A;  4F0C A;  6GSY A;  1SKW B;  1A24 A;  2A4V A;  2R4V A;  5DAK B;  3E9J B;  3H4K A;  4WBR D;  2NBS A;  4Q5F A;  4MF7 A;  4MJB A;  3UVT A;  1Y25 A;  4GRF A;  1MD4 A;  2XC2 A;  1S3C A;  1VF2 A;  1YDK A;  1M2D A;  4KB3 A;  2VCX A;  5F05 A;  5HR0 A;  2EIR A;  4N10 A;  1SKS B;  3UAP A;  4CDO A;  2R37 A;  3D22 A;  3CRT A;  3I43 A;  3LXT A;  3ZZX A;  2AB6 A;  1FVK A;  1XOB A;  1YJ6 A;  2JU5 A;  3ZIV A;  1X9S B;  4ZXG A;  1M9A A;  5DCG A;  4GQF A;  1QUW A;  3A2X A;  1EWX A;  3LOR A;  3QMX A;  2IIY A;  1GUK A;  3EMX A;  4DSR A;  2F3M A;  2CAI A;  2CAQ A;  2H74 A;  2RUE A;  1PX7 A;  3QCP A;  1BJX A;  5FT3 A;  3KTL A;  2OKA A;  4ZBA A;  5IMC A;  2HZE B;  3PH9 A;  3RDW A;  1VF4 A;  2WFC A;  3VPT A;  3A2V A;  1AAZ A;  3LXZ A;  3P7X A;  4IQA A;  3W8J A;  1H4O A;  2K18 A;  3WGX A;  1X0R A;  4IJI A;  3IHG A;  2DJJ A;  3UBK A;  4I8B A;  2YZU A;  2OE3 A;  1GNE A;  1NSW A;  3DD3 A;  4NV2 A;  3Q74 A;  1SJI A;  2PWJ A;  4CW9 A;  1XWK A;  3ED3 A;  4WF5 A;  3UVH A;  2DJ2 A;  4JU5 A;  3IOS A;  2FUG 2;  2R0G A;  3DRN A;  4MPG A;  5HR3 A;  1W4V A;  2FD3 A;  1U88 A;  13GS A;  5ECP B;  3FR3 A;  1WP0 A;  3IV4 A;  1XW6 A;  4OFN A;  4FIW A;  1XWC A;  1MDI A;  3O6T A;  2RII A;  3VK9 A;  3A2W A;  4BWS A;  2L6D A;  4QQ7 A;  4PX1 A;  3MAK A;  2OA7 A;  1GSU A;  1TRU A;  3VUR A;  4NWY A;  1V57 A;  3IE3 A;  2K6V A;  1B4Q A;  2I3Y A;  1K3O A;  2DIY A;  3FRC A;  5EY6 A;  2LEG A;  2VM2 A;  1XVQ A;  2ON5 A;  2MMZ A;  2H6Z A;  1V2A A;  2J23 A;  3ZL5 A;  2YN1 A;  2QGV A;  4JE1 A;  4G19 A;  4Q5N A;  1W89 A;  3KMO A;  4ULX A;  2KLX A;  5DAL A;  2FNO A;  1TI1 A;  2FWE A;  2CX4 A;  2JZT A;  3HDC A;  2WS2 A;  1LJR A;  1YF1 A;  4LA1 A;  4EVM A;  3PGT A;  2YWN A;  2AHE A;  1NW2 A;  3IDV A;  2X99 A;  5H5Q A;  2FHE A;  5G31 A;  3G7Y A;  5F07 A;  2H1G A;  3IXR A;  1VGL A;  2GGT A;  4V2L A;  5B6M A;  2GS3 A;  1OC9 B;  1GH2 A;  2REM A;  3CTF A;  4I5Q A;  5COH A;  5ECO B;  4ZB8 A;  4PXO A;  5ECK B;  2A4H A;  4IEL A;  1MDK A;  3F6F A;  3TGZ A;  2VL9 A;  3IK9 A;  4MNN A;  1OKT A;  3BBY A;  3F3Q A;  4K9Z A;  2H70 A;  4KND A;  2PVQ A;  4ZIL A;  1OAZ A;  4E8H A;  2H1D A;  2N5B A;  3FZ4 A;  3J7Y k;  3WD6 A;  1XBS A;  4AF2 A;  2VL2 A;  2EIO A;  4Z7X A;  1HNA A;  1O6J A;  5ECN B;  4BVY B;  1ZZY A;  4YQM A;  5KOW A;  1AIU A;  2PGT A;  2B6M A;  2PU9 C;  2B5X A;  2GZZ A;  3KP8 A;  2H19 A;  2GLR A;  3VWU A;  5B8A A;  1UC7 A;  3HHV A;  1F9M A;  2DKH A;  3DGQ A;  2HZF A;  2X4A A;  1JHB A;  3HKR A;  2AYT A;  1Z5Y E;  4DSQ A;  1Q98 A;  2V6K A;  5D9X A;  5CO3 A;  2F8A A;  1XPV A;  1M2A A;  1A8L A;  1SYX A;  2VCW A;  3D4M A;  3I6A A;  5AIV A;  5KEJ A;  2K8V A;  1EV4 A;  2L4Q A;  3KGK A;  1YQ1 A;  1URM A;  1LBK A;  1TRW A;  3FZA A;  4GXZ A;  3GTU A;  1FOV A;  1EGR A;  4RQX A;  4DSS B;  5HQP A;  3H8Q A;  2L5O A;  3F4R A;  1A0R P;  2C0G A;  2H8L A;  4OD7 A;  1QMV A;  2E2M A;  5CRD A;  3NZN A;  1GTI A;  1BED A;  3MNG A;  3FY7 A;  1CQG A;  5ID2 A;  3G7J A;  3HJP A;  2OAC A;  4HJM A;  1PSQ A;  2GDR A;  3C73 A;  2R0P A;  2KOK A;  1Z6M A;  1THO A;  5JWQ B;  3RHC A;  4TXO B;  5KN3 A;  5IOW A;  3TJF A;  4F2I A;  3EPT A;  1E6B A;  3EWL A;  1GRX A;  4H86 A;  5JWR B;  1GUL A;  1ACV A;  5IOX A;  3IA1 A;  1A2L A;  4POB A;  3D0Z A;  5KOX A;  2GVP A;  5A5K A;  3GKX A;  5DDL A;  3C71 A;  4TKY A;  3UAR A;  1K0N A;  4HZ4 A;  2OAD A;  3HY2 A;  4OO5 A;  2VLU A;  3C8E A;  3ZVJ D;  4IHU A;  4PUA A;  4CY8 A;  3MDK A;  3N9J A;  5LNK e;  4YQU A;  2AUV A;  4EXJ A;  2C80 A;  4TVE A;  5J3R A;  2H0I A;  1C72 A;  2H0G A;  4DEJ A;  3G9B A;  1RW1 A;  5JCW A;  1RQM A;  2YJH A;  2TRC P;  3GUR A;  4JR6 A;  4YH2 A;  1F6M C;  2O7K A;  2R3X A;  2H75 A;  3R2Q A;  4EO3 A;  3H93 A;  1AQV A;  3GH9 A;  1F3B A;  4G9H A;  1UVZ A;  2Z9S A;  3LFL A;  1U3I A;  4GCI A;  1PKW A;  4ZL8 A;  4XRA A;  4O5U A;  4IVF A;  5AGY A;  1FW1 A;  2KHP A;  3UMA A;  2VO4 A;  1DE1 A;  5J4U A;  1PN9 A;  2UZ8 A;  1T00 A;  1OVN A;  2PUK C;  4EC0 A;  1V58 A;  4K7O A;  1OYJ A;  1PQN A;  4TN8 A;  2XBQ A;  3ERG A;  1WMJ A;  3GST A;  4MAB A;  2DJK A;  4NV5 A;  3TDG A;  4AJ6 A;  3KH9 A;  3GKM A;  3RPN A;  3TB2 A;  1GSF A;  4EF0 A;  4TRX A;  2TRX A;  1AQW A;  3DWV A;  3GRX A;  5GST A;  4JED A;  2ON7 A;  2HSH A;  1UN2 A;  4FYB A;  3EIN A;  4TR1 A;  1KTE A;  3QDN A;  4MF6 A;  5D73 A;  2LNS A;  1A2M A;  2FWF A;  4IS0 A;  5ECM B;  3GX0 A;  3KTB A;  5LCZ A;  3DVX A;  2FGX A;  3J7Y b;  3C1R A;  3QD9 A;  3EUR A;  1F2E A;  3IPZ A;  3N5O A;  1JZO A;  3LW9 A;  5JCG A;  1GL8 A;  2QKE A;  4IP6 A;  2I1U A;  4HUA A;  1DBY A;  3ZFL A;  1FB6 A;  3DVW A;  4EKZ A;  2JL4 A;  2FWG A;  1ERV A;  4MMM A;  1SK1 A;  4OO4 A;  4J57 E;  2HRF A;  3D4T A;  4LMV A;  4X0X A;  4O32 A;  2DIZ A;  1TRS A;  2AAW A;  2NPB A;  1KBN A;  3GH6 A;  3SBC A;  4WEY A;  3PR8 A;  3ZVJ A;  2KP2 A;  2R6K A;  3R3E A;  3APS A;  1T3B A;  5B7C A;  4HS1 A;  3CRU A;  1GSE A;  5HFK A;  3KXO A;  4POK A;  2X64 A;  3ME8 A;  5JCU A;  1GP1 A;  3FMW A;  3QAW A;  5G2Z A;  3GIX A;  14GS A;  4V1A p;  3CSJ A;  3LEF A;  4X1U A;  3D21 A;  1K3L A;  1SK0 A;  1T8E B;  2R5G A;  4NHZ A;  1TXX A;  4G2E A;  1CQH A;  2C4J A;  2B5Y A;  3GHA A;  3CYN A;  7GSS A;  2R2J A;  4TXO A;  3F63 A;  1B8X A;  2GZY A;  5AIS A;  4HZ2 A;  2YV9 A;  1F3A A;  4IP1 A;  3HXS A;  3TJK A;  3FEU A;  4GQC A;  3KJY A;  3HJO A;  4E8E A;  4PUF C;  1THX A;  4KH7 A;  4IBP A;  1J0F A;  4PQ1 A;  5INY A;  2C3T A;  4AJ8 A;  1AUC A;  3IK7 A;  5DQY A;  2RLI A;  1EEJ A;  3GKN A;  3QPM A;  1WRY A;  3TRQ A;  4RI6 A;  4MJA A;  1ZYQ B;  3I9V 2;  2QSI A;  2H01 A;  4F9Z A;  3NIV A;  1WJK A;  2L4C A;  3TRX A;  1HNC A;  4EIQ A;  1PL2 A;  1GSQ A;  2LS5 A;  1EP7 A;  2VCV A;  1SL2 B;  3EU4 A;  1ON4 A;  3F4T A;  4ECJ A;  4MLY A;  3L78 A;  4I2U A;  2E0Q A;  2X8H A;  1BYE A;  1FG4 A;  18GS A;  5D9W A;  5ECR B;  5L71 A;  1IYI A;  2OE1 A;  1XW5 A;  4BA7 A;  3TKP A;  3EE2 A;  3ZYW A;  3ERW A;  4F0B A;  1ILO A;  2YAN A;  3GYK A;  4O92 A;  4K0G A;  3GL5 A;  1TU7 A;  4LMW A;  4WR4 A;  2CA8 A;  1BG5 A;  1YF0 A;  1ERW A;  9GSS A;  1YZX A;  1FO5 A;  1EZK A;  4ID0 A;  1GLQ A;  5GSS A;  1TK8 B;  3O76 A;  5FWG A;  1T4Y A;  3D5J A;  2WZ9 A;  1V40 A;  4HQZ A;  1AC1 A;  4XS4 A;  2PBJ A;  2CV4 A;  3O3T A;  3E0U A;  2EC4 A;  2DJ1 A;  2LKU A;  2AV4 A;  2WCI A;  5CNW A;  5J5N A;  2FA4 A;  4ICY A;  4YAP A;  1ZL9 A;  3HZ8 A;  3LQ7 A;  3ISO A;  2YWO A;  12GS A;  3VI7 A;  4NPB A;  3H1N A;  2DKI A;  4K0N A;  1PL1 A;  4F82 A;  1GUM A;  2HFD A;  5IIZ A;  2CVB A;  1YEP A;  2DSA A;  3HVV A;  4LL4 B;  2LJR A;  4KW6 A;  3TJB A;  3S9F A;  2ZUP A;  3JCM L;  1M99 A;  1ZYP A;  5F06 A;  4BVX B;  3F4S A;  3MWH A;  4HU9 A;  1S3D A;  1Z3E A;  1JZR A;  3VPQ A;  5E59 A;  5KN1 A;  2NVL A;  2LRT A;  2PN8 A;  3FKF A;  1V98 A;  3MSZ A;  2HNL A;  3CBU A;  1B9X C;  4MCU A;  2VOC A;  3G7I A;  4BL7 A;  1OC8 A;  1X9W B;  4TW5 A;  4KDY A;  3TKQ A;  2FCH A;  2HT9 A;  4QL7 A;  4V2M A;  4GLT A;  5AN1 A;  3GFK A;  2NTO A;  3ZIT A;  2WDU A;  4D73 A;  5G5F A;  19GS A;  4O5R A;  2DC5 A;  4XS6 A;  2NDO A;  4L5L A;  2JSY A;  4NMU A;  3ZML A;  3P90 A;  5CAX A;  4JBB A;  1MEK A;  5DAK A;  3HYP A;  3TKS A;  2DBC A;  2YNX A;  4FO5 A;  1K0M A;  3SWL A;  1WOU A;  1XIY A;  1SD9 A;  1TP9 A;  5DCH A;  1BQ7 A;  1J9B A;  5DBQ A;  1R26 A;  2WRT A;  3L9V A;  5C04 A;  3IHQ A;  4ECC A;  4WBJ A;  4ML1 A;  2HRK A;  4I6X A;  2CT6 A;  2RUF A;  4NXI A;  1R5A A;  4PUR A;  2ES7 A;  3UJ1 A;  1GUH A;  2F51 A;  4L8E A;  5B6N A;  1SL1 B;  4YAV A;  4KSM A;  1QK8 A;  2QA2 A;  2H1A A;  3WGE A;  3APO A;  4FYC A;  2HRN A;  5GAP D;  4JR4 A;  4FYU A;  2C3Q A;  6GSV A;  1GSY A;  1XWA A;  2GZP A;  2LUS A;  4KDX A;  2MMO A;  1O81 A;  2IMF A;  2VD1 A;  3HCZ A;  4J56 E;  5CRE A;  1EV9 A;  3QFA C;  1G6Y A;  1OKD A;  1Z7R A;  4KUN A;  1GTU A;  5ECS A;  5IMF A;  2N5A A;  4BWQ A;  1EEM A;  2HZE A;  4DVC A;  2O8V B;  4ZBD A;  1O8X A;  1M0U A;  4POL A;  3GSS A;  2IFQ B;  1ERT A;  3A5W A;  4AJ7 A;  1FVJ A;  2YPM A;  2DJ0 A;  4HDE A;  1AXD A;  1PMT A;  5IPH A;  2WJU A;  1YKA A;  3F9U A;  4L5O A;  2VCT A;  4K2D A;  2GT6 A;  1O85 A;  3GMF A;  4CHS A;  2LV3 A;  1N2A A;  2P0G A;  4XHM A;  1SKR B;  4IQ1 A;  5GAN D;  4ZL9 A;  1GSD A;  1QGV A;  2F9S A;  1G0T A;  3VI5 A;  2R0C A;  6GSX A;  1ABA A;  3KZQ A;  2MYG A;  4KX4 A;  3H79 A;  2MZC A;  3MYD A;  2V41 A;  2IMD A;  2LNT A;  5J9B A;  22GS A;  2X8G A;  3LYP A;  2RM6 A;  1AW9 A;  2C0F A;  3EVI A;  4WR5 A;  1HQO A;  2HSM A;  3BCI A;  3KD0 A;  4MA9 A;  1Z6N A;  5A4W A;  1K0O A;  4ZB9 A;  4O7H A;  3EMP A;  4Q5Q A;  1O8W A;  4FQU A;  2B3S A;  5DJM A;  3FZ5 A;  5CRW A;  3HD5 A;  1TU8 A;  2VL2 C;  1TI3 A;  5HFI A;  1U3A A;  4MJE A;  2DML A;  2GQM A;  3C1S A;  3FYG A;  3KCM A;  2MBT A;  1ZYE A;  2H76 A;  4FH8 A;  2LJA A;  4NAX A;  2A2R A;  1XZO A;  1SU9 A;  1I9D A;  4PNF A;  1R4W A;  2JZR A;  5HR2 A;  3FR9 A;  1SEN A;  4PNG A;  3GNJ A;  4GSS A;  3U5R E;  5EL8 A;  4JRR A;  5CYY A;  1OC9 A;  2H6Y A;  2MBS A;  3LYK A;  3EC3 A;  5JWO B;  2IMK A;  3P8W A;  3OR5 A;  1SYR A;  5IPG A;  1YY7 A;  2BTO T;  2B7J A;  3KM6 A;  4L0U A;  4HI7 A;  1B9Y C;  1O73 A;  4KAE A;  2HRA A;  3ZIJ A;  2YOI A;  1WPI A;  4K6X A;  2O89 A;  4K8M A;  4TOP A;  2VCQ A;  2G2Q A;  3GV1 A;  4OMV A;  2H30 A;  5IMD A;  3F0I A;  4BVY A;  4PQI A;  2P5R A;  4K5R A;  3VWV A;  4ECB A;  1O7U A;  2OBI A;  4MZB A;  5G30 A;  4YQV A;  4OFM A;  1X5D A;  5ELA A;  1R7H A;  4ILF A;  5ECI B;  3HJM A;  1USB A;  2VL3 A;  1M2B A;  1ZMA A;  1VRS D;  1ZCP A;  5DAL B;  2E2G A;  2KUC A;  2K9F A;  1KNG A;  3L0H A;  2HE3 A;  1F37 A;  1U6T A;  2J9H A;  2QA1 A;  3FW2 A;  5CRG A;  2VLT A;  3DKS A;  2MMN A;  1I5G A;  2MMA A;  4OCF A;  4KDU A;  3F3R A;  1T7P B;  1EOG A;  1MTC A;  5D96 A;  5ECQ B;  2VUP A;  1FHE A;  20GS A;  1M7T A;  1LU4 A;  3K8N A;  4KCE A;  3M9K A;  3HVS A;  4RI7 A;  4ZIJ A;  2E7P A;  3Q18 A;  2GSQ A;  4RQR A;  1VF1 A;  2LQQ A;  4RUV A;  3ZFB A;  4G0K A;  1A0F A;  2YWM A;  5ENU A;  4DSS A;  1A23 A;  4XRD A;  1TTZ A;  4O5Q A;  3KH7 A;  5D9T A;  1J08 A;  4MJC A;  2PVO C;  1ML6 A;  5G1K A;  3QOU A;  4ZBB A;  1JLV A;  1OE8 A;  4G0I A;  1UA5 A;  4J2F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...