5KN0A

Native bovine skeletal calsequestrin, low-ca2+ form
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
346
structure length
346
Chain Sequence
GLDFPEYDGVDRVVNVNAKNYKNVFKKYEVLALLYHEPPEDDKASQRQFEMDELILELAAQVLEDKGVGFGMVDSEKDAAVAKKLGLTEEDSVYVFKGDEVIEYDGEFSADTLVEFLLDVLEDPVELIEGERELQAFENIEDDNKLIGYFKNKDSEHYKAYEDAAEEFHPYIPFFATFDSKVAKKLTLKLNEIDFYEAFMEEPVTIPDKPNSEEEIVSFVEAHKRSTLRKLKPESMYETWEDDLDGIHIVAFAEETDPDGYEFLETLKAVAQDNTDNPDLSIIWIDPDDFPLLVPYWEKTFNIDLSAPQIGVVNVTDADSVWMEMDDEEDLPSAEELEDWLEDVLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calsequestrin
publication title Characterization of Post-Translational Modifications to Calsequestrins of Cardiac and Skeletal Muscle.
pubmed doi rcsb
molecule tags Metal binding protein
total genus 96
structure length 346
sequence length 346
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-06-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5kn0A03
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5kn0A01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5kn0A02
2A2RA 1ERWA 2CQ9A 3GV1A 3H8QA 4K0GA 3VWUA 4MF7A 2E0QA 2DJ1A 3HJMA 5A4WA 2R4VA 1GTIA 1PGTA 3GL5A 4ULXA 5CP1A 4KGIA 1M7TA 4OO4A 3EMXA 3FY7A 4HJMA 3VPQA 4EF0A 4ZILA 2L6DA 4JR4A 5IO2A 2NBSA 2H01A 2CV4A 4F2IA 3DEXA 2HNLA 5IPHA 3FR9A 3EE2A 2VD0A 4HDEA 1OVNA 2ZUPA 4NMUA 1PX6A 4L5OA 5DDLA 2WJUA 2P5QA 1X9MB 1E6BA 1Q4JA 4PNFA 4KE3A 3VI7A 1FB0A 2IJYA 3QAWA 1EWXA 2IWTA 2YPMA 2H70A 3IHQA 1TKDB 3A2WA 5ECLB 3IAM2 2PU9C 1GWCA 2TRCP 4G19A 3UEMA 2CA8A 1LU4A 4GRFA 1FG4A 1TI3A 3BCKA 2K18A 5DCGA 4IS0A 1THXA 4PURA 3HCZA 4TRXA 1YZXA 2L59A 3M3MA 4XS1A 4XCSA 4PGTA 3E0UA 2C4JA 2VLUA 4WR4A 2AJQB 2LNTA 4RQXA 5GAPD 1A2MA 3P90A 5DALB 2IN3A 3WT1A 1F2EA 2GZYA 5L71A 1JFUA 1A23A 1H4OA 2PVQA 1XOBA 1M0UA 1A0RP 2OBIA 3KZQA 3A2VA 2CZ2A 1BYEA 3BBYA 4N0VA 5H5QA 3FR6A 2K8SA 4GSNA 4MJAA 1SYRA 1LBKA 2L4QA 1XOAA 2H76A 3CMIA 1TK8B 3EMPA 4LA1A 4MZCA 1SKSB 2AYTA 1WWJA 7GSSA 4PNGA 1GH2A 2FWHA 1F9MA 1T00A 1SK0A 1JLVA 2L6CA 1BQ7A 2OE0A 4TXOB 5FHIA 1VF4A 2GT5A 2PMTA 2DMLA 1Z3EA 3TKSE 2H74A 2VCXA 1X9WB 2HE3A 2H6XA 1Z7RA 4ZL7A 3CRUA 3F3RA 3O76A 3O6TA 3L9UA 1U6TA 3VWVA 3F4RA 3TJGA 1SL1B 3HKRA 5INYA 1EGRA 4EC0A 1EP7A 4MJEA 2K6VA 1I9DA 3RBTA 5ECNB 3MWHA 3I69A 1EOHA 1ZCPA 4N30A 4EL1A 4DSSB 4HUAA 5D73A 3HXSA 3DRNA 2AAWA 2AHEA 4HS1A 2DJ2A 1YQ1A 4YQVA 1WP0A 3HZ4A 2M46A 1F3AA 3DGQA 2HFDA 4KUNA 3UIWA 1YKAA 2QKEA 2WS2A 10GSA 4TR1B 5DQSA 4EUYA 5F06A 1N8JA 4JU5A 3Q19A 1Y6EA 5IOXA 1T4YA 2HZEA 9GSSA 3NZNA 1FHEA 3D4MA 1SJIA 2NVLA 5GSSA 3GKKA 3ZYWA 2M72A 4POKA 2GZZA 1PN9A 3HD5A 3W8JA 2B5EA 4YAPA 2C0GA 4F03A 1AXDA 2TRXA 3WGDA 3FZ9A 4N11A 5D93A 5G1KA 3VI5A 4JBBA 4V2MA 5D96A 5HR3A 2LQOA 4PQIA 5DVBA 2DMMA 3KM6A 4N10A 5D9TA 3FK8A 4HOJA 4K6XA 4ZBAA 2RM6A 4MH3A 5A4UA 1C72A 3TUEA 1O81A 4Z7XA 2ZNMA 5G1LA 2PBJA 3WD6A 2GT6A 1DSBA 3P8WA 1UVZA 1ZMAA 2H0GA 1RQMA 1GUMA 3ZITA 2ON5A 1NW2A 1BEDA 2LEGA 2B1LA 1X5EA 1TJDA 2I4AA 3UMAA 3R2QA 3F8UA 1TK5B 5H5RA 4WXTA 3GIXA 1FB6A 2E7PA 3GHAA 4HU7A 1X0RA 4TOPA 3A5WA 1GRXA 1CQHA 1V40A 4TN8A 3DVXA 3P2AA 2XHFA 1VF1A 4LLRA 1M2DA 1U87A 1B4QA 1MEKA 1OC8A 2J9HA 1B9XC 4V1Ag 4XHMA 4PX1A 3FYGA 4I2TA 1XW9A 1J9BA 1O8WA 4XRDA 3TKQA 3IXRA 1O73A 2CAIA 4JRRA 1WRYA 3A2XA 4J56E 3EU3A 2LSTA 3KEBA 5AIXA 1G7OA 2ON7A 3HYPA 3QDNA 5GSTA 3H4KA 3LYKA 3LYPA 1R7HA 2RLIA 1U3AA 3ZVJA 2JSZA 2JACA 1A2LA 2H75A 1TOFA 1QUWA 4AJ8A 2ES7A 1OE8A 2JZTA 1SK2A 3FEUA 1K0MA 2EIQA 4KDUA 4POMA 5JCWA 4F0BA 5IO0A 1I5GA 1FO5A 4KW6A 3KH7A 2KP1A 4MP4A 2HI7A 4E8EA 2FWGA 3F6DA 4JZQA 1XBSA 2OA7A 3ME8A 2PGTA 1JLWA 1BAYA 2FHEA 2V41A 5F8BA 3GURA 3IDVA 1DE2A 5ECIB 1OKDA 1R4WA 3ZRDA 3QMXA 4WKWA 3PGTA 5E59A 3H79A 5J41A 4POBA 3ZFBA 1MDIA 4PXOA 1SK1A 2MBTA 4BL7A 2IL3A 1ACVA 3GRXA 1U88A 4ML6A 2O89A 4AF2A 2IPAA 4NXIA 3M8NA 1GLQA 4MPFA 3TGZA 2V6KA 1QMVA 5G5FA 3EINA 3F0IA 1S3DA 3I43A 3ERGA 3QCPA 3HDCA 2C1YA 4BVXA 3ZIVA 5FWGA 3EVIA 1KBNA 3D0ZA 1W4VA 3M0FA 2CVDA 1QQ2A 2OE1A 2C8UA 3KP9A 3HVSA 3CRTA 4V2LA 4XIHA 3WT2A 1XWKA 2X8HA 3M9JA 6GSUA 1A8LA 2DLXA 2H6YA 3GN3A 5ECOB 2WZ9A 1GUHA 5DCHA 3TRPA 1KNGA 2VL2C 4HEA2 3IC4A 4LMWA 3EWLA 3IOSA 3BOAA 4ID0A 4AJ6A 4K0NA 3KP8A 4IQ1A 3F4SA 3TRXA 4KB3A 1O8XA 4KDXA 2GSSA 2H1AA 3MDKA 4YAVA 2GSQA 2GDRA 18GSA 3RAZA 5A4VA 3ERWA 4ZBDA 3G7IA 3EURA 3ZZXA 2F8FA 3Q74A 3KTLA 2GQKA 2JSYA 2G0FA 2M80A 5J9CA 2IIYA 3GUSA 5LCZA 1NHYA 4ZBBA 5B7CA 5IMZA 2L5OA 4PUAA 3FZ4A 5G31A 2QC7A 4ZXGA 4X0XA 5G5EA 16GSA 1XIYA 5HQPA 2R2JA 1GSEA 2C3QA 1TRVA 4OFTA 5B6NA 2V1MA 4TKYA 1KTEA 1PX7A 1T7PB 3VWXA 11GSA 4KCEA 5DJMA 1WJKA 1ABAA 4OCFA 3FHKA 5ELAA 2RUEA 5F0GA 1FVKA 1W89A 1XZOA 5JWRB 3TB2A 5ECPB 4RI6A 4ZB6A 1OE7A 4KDYA 2BMXA 3GH6A 2RUFA 3FZ5A 3HJOA 2YV9A 2ALBA 4LL1B 2KP2A 8GSSA 1B48A 5EPFA 3L9SA 2KLXA 2LRTA 2BTOT 4WBRD 4JR6A 2LJAA 4K7OA 4GLTA 3ZTLA 2N5FA 4KSOA 3LG6A 1ZYEA 5A5KA 1O6JA 1TDIA 2LTKA 4ECJA 1A24A 3I6AA 2WULA 3LGCA 2YOIA 5DAKB 3IR4A 4XS4B 1QK8A 1XVQA 1XXUA 1VF2A 4L8EA 5HR0A 2LS5A 3IE3A 1PL1A 2LQQA 3UJ1A 4DSQA 1E2YA 1EV4A 5ECMB 2HLSA 1GSFA 1Z5YE 3ZIJA 3APOA 1DE1A 3N5OA 1VGLA 3WYWA 2NDOA 1WPIA 3LORA 3P7XA 1WOUA 6GSTA 3C73A 2NPBA 4AGSA 2H19A 5DALA 2KUCA 2F8AA 2F3MA 4EO3A 1ZL9A 2B5YA 3U6VA 1M9AA 2DJ3A 3TOTA 3J7Yk 3D22A 5HFGA 4TXVA 4ECBA 5DJLA 4O7HA 3L0HA 4WR5A 1TK0B 2EIRA 3LFLA 3CYNA 1M2AA 1H75A 3GKMA 2DJKA 1M2BA 2LRCA 3TJBA 1Z7PA 3DIEA 5D9VA 3IPZA 4HJ2A 22GSA 2VLTA 4I97A 1FW1A 6GSXA 4QL7A 3IRAA 2PUKC 4WF5A 2R37A 4MF5A 4TXOA 2GQMA 2C0EA 4FYBA 2C3TA 1IYHA 4BA7A 2H66A 2GZPA 2X64A 5EL8A 2P5RA 1GSSA 2NTOA 1MDKA 1Y25A 3LXZA 4I6XA 4QQ7A 4WF4A 5CAXA 4IBPA 1K3LA 4NHWA 1HNBA 2OKAA 3IAS2 1ERTA 3UBKA 2CZ3A 3MSZA 1F37A 3K8NA 5CNWA 1QGVA 2PWJA 2V6OA 4K7IA 2B6MA 1K0OA 1OC9B 1A8YA 4MJCA 2GSTA 3GNJA 5G30A 5ECHB 3DYRA 1EP8A 2K8VA 3ERFA 2CX3A 4YQUA 2LRNA 3UOMA 5IQYA 5AISA 5ECQB 6GSSA 3TKSC 3G9BA 4DSSA 1PL2A 5B8AA 2O7KA 3ZL5A 4BWSA 1K0CA 1XPVA 3LWAA 1K0NA 4ZL9A 1SL2B 4IVFA 3V1WA 4Q5FA 2DSAA 2FWFA 5D9WA 2TIRA 4EE0A 3E9JB 2HYXA 2GVPA 4TR1A 3LEFA 1MTCA 3EYTA 5ID2B 4OWYA 4P3YB 5IPGA 1EZKA 1OAZA 2C0FA 1AW9A 3L78A 1JZOA 1HD2A 1KEBA 2R3XA 1J0FA 3HA9A 1GTBA 2BJXA 2AUVA 4HI7A 3IK9A 1GULA 1ST9A 3FKFA 1G7EA 4L5LA 4OFNA 1NHOA 1Z6MA 4ZL8A 5FT3A 17GSA 2JZRA 3SBCA 1K3OA 1XWCA 2AV4A 1GTUA 1R26A 1JZRA 2XPEA 1F6MC 4XRAA 1OC3A 3QAVA 3GKNA 4ILFA 6GSVA 3MNGA 1TU8A 1V98A 4MCUA 3QR6A 3CSHA 5KN3A 4EKZA 5J9BA 3G7JA 4MH2A 4MK3A 1TRWA 4Q5RA 4KH7A 4DSRA 2VCZA 1EEJA 3ZREA 4K1FA 3ZMKA 3GSTA 2DJ0A 1AQVA 3LJRA 2JU5A 4F82A 4XS6A 1YF1A 2FGXA 2YV7A 1USBA 5D9XA 2MMOA 4ACSA 2H1BA 2B7KA 2MMAA 5JWOB 3GX8A 1G6YA 2A2SA 3OR5A 2F51A 2FY6A 3O3TA 4KCAA 3CSIA 3NOFA 2O8VB 4D73B 2X8GA 2H0HA 2KHPA 4HQZA 1ZGNA 1AAZA 2B5XA 3VPTA 3ME7A 1SKWB 4MLYA 5ABRA 2I3YA 1G0TA 1TU7A 2V2GA 1XW6A 1SJ6A 2VL3A 2VAFA 2IMKA 3M1GA 2LJKA 1SU9A 5G2ZA 1HNCA 3UBLA 3DKSA 2HZFA 2HSYA 1PKZA 4TR4A 2IFQB 3CSJA 5C04A 2FD3A 1XFLA 3A3TA 4EDZA 5IMCA 2G2QA 1FOVA 4HZ4A 1UA5A 4G9HA 2GTUA 1X5CA 2YNXA 4K8MA 5B6MA 4FYCA 4KSMA 5CRHA 3HY2A 2K9FA 2XBIA 2YWOA 3KXOA 4PQHA 1JZDA 4J57E 3CTFA 2H30A 4EDYA 2XBQA 3U5RE 1K0BA 3VLNA 2H0IA 3GTUB 4GTUA 2VCVA 4IJ3A 2MYGA 4Q5QA 4ECCA 2B3SA 5DBQA 1IYIA 2IMDA 1S3CA 2VIMA 6GSWA 3HVXA 4NV5A 1B8XA 3LQ7A 1WMJA 4OCEA 3CTGA 3QFBC 2YZUA 3UAPA 3GL3A 4MABA 5EVOA 1GL8A 3GSSA 3IBHA 1K3YA 4WEYA 1PRXA 2E2MA 1ZOFA 3D4TA 4HQSA 1V58A 4DVCA 2D2ZA 2LUSA 4K2DA 1A2JA 1TXXA 5AGYA 4F0CA 2H71A 3TCOA 2CX4A 2ZCTA 4ECIA 3F6FA 4O32A 4EVMA 4CW9A 3QPMA 1TTZA 2VD1A 4OFMA 2FLSA 4GF0A 2GS3A 4X1UA 4MPGA 1JZWA 2WCIA 4NPBA 1YEPA 3I9V2 3C1RA 4LMVA 3ZLPA 1EEMA 5J4UA 3LXTA 4GWRA 2B7JA 3M9KA 3AY8A 4L0UA 2XPDA 1O85A 4TVEA 5IOWA 4MMMA 4K9ZA 4NAXA 3J7Yb 1PMTA 3KJYA 3BJ5A 3KGKA 6GSYA 3TDGA 3H93A 2YJHA 3QD9A 3KD0A 1SD9A 4O5RA 4RQRA 2VCWA 2CAQA 3GH9A 3ISOA 1T1VA 1RK4A 3TRQA 1PSQA 3PR8A 1ML6A 5CRDA 3KH9A 12GSA 2VL2A 3MAKA 1YEXA 1NM3A 1SL0B 5LNKe 2QSIA 2PVOC 1AC1A 3GKXA 3C1SA 2L4CA 2FWEA 2HSHA 2VCTA 3UL3A 3ED3A 5CRGA 1TRSA 5ECKB 3D6IA 4YH2A 2HXKA 3FW2A 4IN0A 1ERVA 5D8IA 4IP6A 5DAKA 1J08A 4XS4A 1K0DA 5IMVA 5ECRB 2RM5A 2X99A 2HRFA 2YANA 4KX4A 2DC5A 2FA4A 1X5DA 1TI1A 5CO3A 4ZB8A 4JEDA 5HR2A 2OJLA 2MMZA 2WGRA 1TW9A 1MD3A 1SD8A 2VLVA 3CXGA 1ERUA 5EY6A 1M9BA 2YJ7A 5ELGA 4MJBA 5GAND 4F9ZA 4H86A 2HRNA 2PERA 5DQYA 4MZWA 5B8BA 3SWLA 3ZVJD 4GSSA 2R6KA 4GCIA 2YP6A 5IIZA 3KCMA 1V9WA 3W6GA 3C8EA 2WRTA 3KMNA 2H1GA 3L4NA 4RUVA 4JE1A 3D21A 4XTSA 1BJXA 2H1DA 1DBYA 3F3QA 2O87A 5ENUA 1ZYQB 5CYYA 3UARA 5LD0A 1SKRB 2XC2A 5J3RA 1OYJA 2YZHA 3G7YA 3HZ8A 4IKHA 3EC3A 4YQMA 4OD7A 2YWNA 4LL4B 3UVTA 4ZIJA 4POLA 2YWIA 1T4ZA 2OBKA 2I9HA 2CVBA 3Q6OA 5KN1A 3KMOA 1PKWA 1GSQA 4BWQA 4V2NA 4GSTA 3GFKA 2HZEB 5AN1A 2YWMA 4NHZA 1X9SB 2P31A 1JHBA 3Q18A 3H1NA 3F9UA 4TR0A 4MF6A 4Q5NA 3F63A 1V2AA 2H73A 3PINA 5CRWA 4HZ2A 1MD4A 1RW1A 2H72A 4MDCA 3APSA 1M99A 1R5AA 3C7MA 1NSWA 1TRUA 3FZAA 4OMVA 3BD2A 1AIUA 2REMA 3KIJA 4I5QA 1T3BA 3NIVA 4DEJA 1URMA 3EU4A 1OC9A 1SYXA 3RDWA 4G10A 1Q98A 4GQFA 1HQOA 3IA1A 14GSA 3RPNA 1ZZYA 1MDJA 13GSA 4TW5A 3FRCA 1Z9HA 1HNAA 3UVHA 4WETA 5H5SA 2I81A 1BX9A 4N0ZA 3RHBA 5GZZB 3TKPA 1PQNA 1YF0A 1XCCA 1PD21 3DVWA 1U3IA 2DIYA 3DXBA 2O85A 2I1UA 1PA3A 5IMFA 4QL9A 1Z6NA 3FR3A 5IM9A 3VFIA 5CREA 3TJFA 3US3A 1UC7A 3QFAC 3N9JA 1ON4A 1XWAA 1GSUA 3L9VA 1XWGA 2V32A 1AQXA 3QAGA 5ID2A 1WIKA 1YDKA 2N5AA 5HFIA 3PH9A 3C71A 1S3AA 1BG5A 5IMDA 2VM1A 2N5BA 2H6ZA 1GNEA 3RPPA 1K0AA 3E3EA 2JZSA 5KN0A 4GQCA 3RHCA 5E4WA 5IMAA 2VM2A 2YCDA 4CDOA 1GUKA 3S9FA 1EGOA 2LNSA 1QFNA 5F05A 4IGJA 4E8HA 2YN1A 2OE3A 1T8EB 2VCQA 2J23A 1OKTA 2FNOA 2R5GA 4NWYA 2KOKA 2GLRA 1HYUA 1ILOA 3HHVA 4OO5A 3BCIA 4NV2A 2C80A 3GA4A 1TP9A 3TKSA 1A0FA 1YJ6A 3GYKA 3HJPA 1FAAA 4FO5A 2PPTA 4KA0A 1EOGA 4IELA 4I2UA 2WDUA 2EIOA 3VK9A 1GP1A 2DBCA 4IW9A 4EXJA 2C3NA 1GSYA 1GLPA 4V1Ap 1VRSD 3DD3A 5J5NA 4ML1A 2JADA 1CQGA 5F07A 4IQAA 19GSA 2A4VA 2IMEA 2OACA 2LJRA 1N2AA 4G2EA 2RIIA 4J2FA 4WBJA 1LJRA 2OADA 3DWVA 5COHA 2WFCA 4PQ1A 4D73A 2DJJA 1VF3A 4KAEA 3APQA 2Z9SA 3CBUA 4L0WA 3D5JA 4KNDA 1SENA 1B4PA 3VWWA 2DIZA 3GMFA 4X43A 2B1KA 5ECSA 3WGXA 4BPYA 2F9SA 2X8CA 4ISDA 5HR1A 2JL4A 1XW5A 2CT6A 1QXHA 2VL9A 1WE0A 5HFKA 3LSZA 4RI7A 2PN8A 1B9YC 2CVKA 2H8LA 3DMLA 3IK7A 20GSA 4IJIA 5JCUA 3VURA 1GNWA 1AQWA 1YY7A 4O92A 3ZFLA 5C00A 2IMFA 1FVJA 4GXZA 2WB9A 2VUPA 5JCGA 5KN2A 2IFQA 4FYUA 1O7UA 4K7NA 4HU9A 3TJKA 1R5PA 2GQLA 2LKUA 2L57A 1DUGA 1G6WA 1UN2A 3W8SA 1F3BA 1GSDA 4TR3A 2FUG2 3TKRA 4IP1A 1YKCA 2P0GA 4ZB9A 4BVYA 2L5LA 3WGEA 2E2GA 3GX0A 2VO4A 2MZCA 2QGVA 2AB6A 3KTBA 2VOCA 2HT9A 2FCHA 4IHUA 3IV4A 5JWQB 1V57A 2GSRA 3F4TA 4PUFC 1XVWA 1XWBA 2MMNA 4MA9A 1SJZA 3QOUA 2FA8A 2EC4A 5KEJA 3TJJA 2C0DA 4CHSA 4FIWA 3ZMLA 1THOA 3GTUA 2MBSA 5AIVA 4FH8A 4I8BA 2LV3A 3JCML 1EV9A 3HVVA 2IMIA 1GTAA 4AJ7A 2GGTA 3TOUA 4MZBA 1AUCA
chains in the Genus database with same CATH superfamily
2A2RA 1ERWA 2CQ9A 3GV1A 3H8QA 4K0GA 3VWUA 4MF7A 2E0QA 2DJ1A 3HJMA 4K5SA 5A4WA 2R4VA 1GTIA 1PGTA 3GL5A 4ULXA 5CP1A 4KGIA 4YKFA 1M7TA 4OO4A 4K5RA 3EMXA 3FY7A 4HJMA 3VPQA 4EF0A 4ZILA 2L6DA 4JR4A 5IO2A 2NBSA 2H01A 2CV4A 1PFOA 4F2IA 3DEXA 2HNLA 5IPHA 1ZYPA 3FR9A 3EE2A 2VD0A 4HDEA 1OVNA 2ZUPA 4NMUA 1PX6A 4L5OA 5DDLA 2WJUA 2P5QA 1X9MB 1E6BA 1Q4JA 4PNFA 4KE3A 3VI7A 5BMUA 1FB0A 2IJYA 3QAWA 1EWXA 2IWTA 2YPMA 2H70A 4CY6A 3IHQA 1TKDB 3A2WA 5ECLB 3IAM2 2PU9C 1GWCA 2TRCP 4G19A 3UEMA 2CA8A 1LU4A 2X49A 4Z2TA 4GRFA 1FG4A 1TI3A 3BCKA 2K18A 5DCGA 4IS0A 1THXA 4PURA 3HCZA 4TRXA 1YZXA 2L59A 3M3MA 4XS1A 4XCSA 4PGTA 3E0UA 2C4JA 2VLUA 4WR4A 2AJQB 2LNTA 4RQXA 5GAPD 1A2MA 3P90A 5DALB 2IN3A 3WT1A 1F2EA 2GZYA 5L71A 1JFUA 1A23A 1H4OA 2PVQA 1XOBA 1M0UA 1A0RP 2OBIA 3KZQA 3A2VA 2CZ2A 1BYEA 3BBYA 4N0VA 5H5QA 3FR6A 2K8SA 4GSNA 4MJAA 1SYRA 1LBKA 2L4QA 1XOAA 2H76A 3CMIA 1TK8B 3EMPA 4LA1A 4MZCA 1SKSB 2AYTA 1WWJA 7GSSA 4PNGA 1GH2A 2FWHA 1F9MA 1T00A 2R0PA 1SK0A 1JLVA 2L6CA 1BQ7A 2OE0A 4TXOB 5FHIA 1VF4A 2GT5A 2PMTA 2DMLA 1Z3EA 3TKSE 2H74A 2VCXA 4BIKA 1X9WB 2HE3A 2H6XA 1Z7RA 1XG8A 4ZL7A 3CRUA 3F3RA 3O76A 3O6TA 3L9UA 1U6TA 3VWVA 3F4RA 3TJGA 1SL1B 3HKRA 5INYA 1EGRA 4EC0A 1EP7A 4MJEA 2K6VA 1I9DA 3RBTA 5ECNB 3MWHA 3I69A 1EOHA 1ZYNA 1ZCPA 4N30A 4EL1A 4DSSB 2QA1A 4HUAA 3HXSA 5D73A 3DRNA 2AAWA 2AHEA 4HS1A 2DJ2A 1YQ1A 4YQVA 1WP0A 3HZ4A 2M46A 1F3AA 3DGQA 2HFDA 4KUNA 3UIWA 1YKAA 2QKEA 2WS2A 10GSA 4TR1B 5DQSA 4EUYA 5F06A 1N8JA 4JU5A 3Q19A 1Y6EA 5IOXA 1T4YA 2HZEA 9GSSA 3NZNA 1FHEA 3D4MA 1SJIA 2NVLA 5GSSA 3GKKA 3ZYWA 2M72A 4POKA 2GZZA 1PN9A 3HD5A 3W8JA 2B5EA 4YAPA 2C0GA 4F03A 1AXDA 2TRXA 3WGDA 3FZ9A 4N11A 5D93A 5G1KA 3VI5A 4JBBA 4V2MA 5D96A 5HR3A 2LQOA 4PQIA 5DVBA 2DMMA 3KM6A 4N10A 5D9TA 3FK8A 2R0GA 4HOJA 4K6XA 4ZBAA 2RM6A 4MH3A 5A4UA 1C72A 3TUEA 1O81A 4Z7XA 2ZNMA 5G1LA 2PBJA 3WD6A 2GT6A 1DSBA 3P8WA 1UVZA 1ZMAA 2H0GA 1RQMA 1GUMA 3ZITA 2ON5A 1NW2A 1BEDA 2LEGA 2B1LA 1X5EA 1TJDA 2I4AA 3UMAA 3R2QA 3F8UA 1TK5B 5H5RA 4WXTA 3GIXA 1FB6A 2E7PA 3GHAA 4HU7A 1X0RA 4TOPA 3A5WA 1GRXA 1CQHA 1V40A 4TN8A 3DVXA 3P2AA 2XHFA 1VF1A 4LLRA 1M2DA 1U87A 1B4QA 1MEKA 1OC8A 2J9HA 1B9XC 4V1Ag 4XHMA 4PX1A 3FYGA 3IHGA 4I2TA 1XW9A 3MYDA 1J9BA 1O8WA 4XRDA 3TKQA 3IXRA 1O73A 2CAIA 4JRRA 1WRYA 4EIPA 3A2XA 4J56E 3EU3A 2LSTA 3KEBA 5AIXA 1G7OA 2ON7A 3HYPA 3QDNA 5GSTA 3H4KA 3LYKA 3LYPA 1R7HA 2RLIA 1U3AA 3ZVJA 2JSZA 2JACA 1A2LA 2H75A 1TOFA 1QUWA 4AJ8A 2ES7A 1OE8A 2JZTA 1SK2A 3FEUA 1K0MA 2EIQA 4KDUA 4POMA 5JCWA 4F0BA 5IO0A 1I5GA 1FO5A 4KW6A 3KH7A 2KP1A 4MP4A 2HI7A 4E8EA 2FWGA 3F6DA 2HRKA 4JZQA 5BRTA 1XBSA 2OA7A 3ME8A 2PGTA 1JLWA 1BAYA 2FHEA 2V41A 5F8BA 3GURA 3IDVA 1DE2A 5ECIB 1OKDA 2X4AA 1R4WA 3ZRDA 3QMXA 4WKWA 3PGTA 5E59A 3H79A 5J41A 4POBA 3ZFBA 1MDIA 4PXOA 1SK1A 2MBTA 4BL7A 2IL3A 1ACVA 3GRXA 1U88A 4ML6A 2O89A 4AF2A 2IPAA 4NXIA 3M8NA 1GLQA 4MPFA 3TGZA 2V6KA 1QMVA 5G5FA 3EINA 3F0IA 1S3DA 3I43A 3ERGA 3QCPA 2DKIA 3HDCA 2C1YA 4BVXA 3ZIVA 5FWGA 3EVIA 1KBNA 3D0ZA 1W4VA 3M0FA 2CVDA 1QQ2A 2OE1A 2C8UA 3KP9A 2A2PA 3HVSA 3CRTA 4V2LA 4XIHA 3WT2A 1XWKA 2X8HA 3M9JA 6GSUA 1A8LA 2DLXA 2H6YA 3GN3A 5ECOB 2WZ9A 1GUHA 5DCHA 3TRPA 1KNGA 2VL2C 4HEA2 3IC4A 4LMWA 3EWLA 3IOSA 3BOAA 4ID0A 4AJ6A 4K0NA 3KP8A 4IQ1A 3F4SA 3TRXA 4KB3A 1O8XA 4KDXA 2GSSA 2H1AA 3MDKA 4YAVA 2GSQA 2GDRA 18GSA 3RAZA 5A4VA 4Z2RA 3ERWA 4ZBDA 3G7IA 3EURA 3ZZXA 2F8FA 3Q74A 3KTLA 2GQKA 2JSYA 2G0FA 2M80A 5J9CA 2UZ8A 2IIYA 3GUSA 5LCZA 1NHYA 4ZBBA 5B7CA 5IMZA 2L5OA 4PUAA 3FZ4A 5G31A 2QC7A 4ZXGA 4X0XA 5G5EA 16GSA 1XIYA 5HQPA 2HRAA 2R2JA 1GSEA 2C3QA 1TRVA 4OFTA 5B6NA 2V1MA 4TKYA 1KTEA 1PX7A 1T7PB 3VWXA 11GSA 4KCEA 5DJMA 1WJKA 1ABAA 4OCFA 3FHKA 5ELAA 2RUEA 5F0GA 1FVKA 1W89A 1XZOA 5JWRB 3TB2A 5ECPB 4RI6A 4ZB6A 1OE7A 2QA2A 4KDYA 2BMXA 3GH6A 2RUFA 3FZ5A 3HJOA 2YV9A 2ALBA 4LL1B 2KP2A 8GSSA 1B48A 5EPFA 3L9SA 2KLXA 2LRTA 2BTOT 4WBRD 4JR6A 2LJAA 4K7OA 4GLTA 3ZTLA 2N5FA 4KSOA 3LG6A 1ZYEA 5A5KA 1O6JA 1TDIA 2LTKA 4ECJA 1A24A 3I6AA 2WULA 3LGCA 2YOIA 5DAKB 3IR4A 4XS4B 1QK8A 1XVQA 1XXUA 1VF2A 4L8EA 5HR0A 2LS5A 3IE3A 1PL1A 2LQQA 3UJ1A 4DSQA 1E2YA 1EV4A 5ECMB 2HLSA 1GSFA 1Z5YE 3ZIJA 3APOA 1DE1A 3N5OA 1VGLA 3WYWA 2NDOA 4YKGA 1WPIA 3LORA 3P7XA 1WOUA 6GSTA 3C73A 2NPBA 4AGSA 2H19A 5DALA 2KUCA 2F8AA 2F3MA 4EO3A 1ZL9A 2B5YA 2R0CA 3U6VA 1M9AA 2DJ3A 3TOTA 3J7Yk 3D22A 5HFGA 4TXVA 4ECBA 5DJLA 4O7HA 3L0HA 4WR5A 1TK0B 2EIRA 3LFLA 3CYNA 1M2AA 1H75A 3GKMA 2DJKA 1M2BA 2LRCA 3TJBA 1Z7PA 3DIEA 5D9VA 3IPZA 4HJ2A 22GSA 2VLTA 4I97A 1FW1A 6GSXA 4QL7A 3IRAA 2PUKC 4WF5A 5KOWA 2R37A 4MF5A 4TXOA 2GQMA 2C0EA 4FYBA 2C3TA 1IYHA 4BA7A 2H66A 2GZPA 2X64A 5EL8A 2P5RA 1GSSA 2NTOA 3R3EA 1MDKA 1Y25A 3LXZA 4I6XA 4QQ7A 4WF4A 5CAXA 4IBPA 1K3LA 4NHWA 1HNBA 2OKAA 3IAS2 1ERTA 3UBKA 2CZ3A 3MSZA 1F37A 3K8NA 5CNWA 1QGVA 2PWJA 2V6OA 4K7IA 2B6MA 1K0OA 1OC9B 1A8YA 4MJCA 2GSTA 3GNJA 5G30A 5ECHB 3DYRA 1EP8A 1S3RA 2K8VA 3ERFA 2CX3A 4YQUA 2LRNA 3UOMA 5IQYA 5AISA 5ECQB 6GSSA 3TKSC 3G9BA 4DSSA 1PL2A 5B8AA 2O7KA 3ZL5A 4BWSA 1K0CA 1XPVA 3LWAA 1K0NA 4ZL9A 1SL2B 4IVFA 3V1WA 4Q5FA 2DSAA 2FWFA 5D9WA 2TIRA 4EE0A 3E9JB 2HYXA 2GVPA 4TR1A 3LEFA 1MTCA 3EYTA 5ID2B 4OWYA 4P3YB 5IPGA 1EZKA 1OAZA 2C0FA 2A4HA 3CQFA 1AW9A 3L78A 1JZOA 3PPUA 1HD2A 1KEBA 2R3XA 1J0FA 3HA9A 1GTBA 2BJXA 2AUVA 4HI7A 3IK9A 1GULA 1ST9A 3FKFA 1G7EA 4L5LA 4OFNA 4PTSA 1NHOA 1Z6MA 4ZL8A 5FT3A 17GSA 2JZRA 3SBCA 1K3OA 1XWCA 2AV4A 1GTUA 1M3IA 1R26A 1JZRA 2XPEA 1F6MC 4XRAA 1OC3A 3QAVA 3GKNA 4ILFA 6GSVA 3MNGA 1TU8A 1V98A 4MCUA 3QR6A 3CSHA 5KN3A 4EKZA 5J9BA 3G7JA 4MH2A 4MK3A 1TRWA 3HVNA 4Q5RA 4KH7A 4DSRA 2VCZA 1EEJA 3ZREA 3EPTA 4K1FA 3ZMKA 3GSTA 2DJ0A 4G0IA 1AQVA 3LJRA 2JU5A 4F82A 4XS6A 1YF1A 2FGXA 2YV7A 1USBA 5D9XA 2MMOA 4ACSA 2H1BA 2B7KA 2MMAA 5JWOB 3GX8A 1G6YA 2A2SA 1PN0A 3OR5A 2F51A 2FY6A 3O3TA 4KCAA 3CSIA 3NOFA 2O8VB 4D73B 2X8GA 2H0HA 2KHPA 4HQZA 1ZGNA 1AAZA 2B5XA 3VPTA 3ME7A 1SKWB 4MLYA 5ABRA 2I3YA 1G0TA 1TU7A 2V2GA 1XW6A 1SJ6A 2VL3A 2VAFA 2IMKA 3M1GA 2LJKA 1SU9A 5G2ZA 1HNCA 3UBLA 3DKSA 2HZFA 2HSYA 1PKZA 4TR4A 2IFQB 3CSJA 5C04A 2FD3A 1XFLA 3A3TA 4EDZA 5IMCA 2G2QA 1FOVA 4HZ4A 1UA5A 4G9HA 4BVYB 2GTUA 1X5CA 2YNXA 4K8MA 5B6MA 4FYCA 4KSMA 5CRHA 3FMWA 3HY2A 2K9FA 2XBIA 2YWOA 3KXOA 4PQHA 1JZDA 4J57E 3CTFA 2H30A 4EDYA 2XBQA 3U5RE 1K0BA 3A5IA 3VLNA 2H0IA 3GTUB 4GTUA 2VCVA 4IJ3A 2MYGA 4Q5QA 4ECCA 2B3SA 5DBQA 1IYIA 2IMDA 1S3CA 2VIMA 6GSWA 3HVXA 4NV5A 1B8XA 3LQ7A 1WMJA 4OCEA 3CTGA 4KF9A 3QFBC 2YZUA 3UAPA 3GL3A 4MABA 5EVOA 1GL8A 4O5QA 3GSSA 3IBHA 1K3YA 4WEYA 1PRXA 4FQUA 2E2MA 1ZOFA 3D4TA 4HQSA 1V58A 4DVCA 2D2ZA 2LUSA 4K2DA 1A2JA 1TXXA 5AGYA 4F0CA 2H71A 3TCOA 2CX4A 2ZCTA 4ECIA 3F6FA 4O32A 4EVMA 4CW9A 3QPMA 1TTZA 2VD1A 4OFMA 2FLSA 4GF0A 2GS3A 4X1UA 4MPGA 1JZWA 2WCIA 4NPBA 1YEPA 3I9V2 3C1RA 4LMVA 3ZLPA 1EEMA 5J4UA 3LXTA 4GWRA 2B7JA 3M9KA 3AY8A 4L0UA 2XPDA 1O85A 4TVEA 4Z2UA 5IOWA 3LW9A 4MMMA 4K9ZA 4NAXA 3J7Yb 1PMTA 4A5PA 3KJYA 3BJ5A 3KGKA 6GSYA 3TDGA 3H93A 2YJHA 3QD9A 3KD0A 1SD9A 4O5RA 4RQRA 2VCWA 2CAQA 3GH9A 3ISOA 1T1VA 1RK4A 3TRQA 1PSQA 3PR8A 1ML6A 5CRDA 3KH9A 12GSA 2VL2A 3MAKA 1YEXA 1NM3A 1SL0B 5LNKe 2QSIA 2PVOC 1AC1A 4HSCX 3GKXA 3C1SA 2L4CA 2FWEA 2HSHA 2VCTA 2DKHA 3UL3A 3ED3A 5CRGA 1TRSA 5ECKB 3D6IA 4YH2A 2HXKA 3FW2A 4IN0A 1ERVA 5D8IA 4IP6A 5DAKA 1J08A 4XS4A 1K0DA 5IMVA 5ECRB 2RM5A 2X99A 2HRFA 2YANA 4KX4A 2DC5A 2FA4A 1X5DA 1TI1A 5CO3A 4ZB8A 4JEDA 4G0LA 5HR2A 2OJLA 2MMZA 2WGRA 1TW9A 1MD3A 1SD8A 2VLVA 3CXGA 1ERUA 5EY6A 1M9BA 2YJ7A 5ELGA 4MJBA 5GAND 4F9ZA 4H86A 2HRNA 2PERA 5DQYA 4MZWA 5B8BA 3SWLA 3ZVJD 4GSSA 2R6KA 4GCIA 2YP6A 5IIZA 3KCMA 1V9WA 3W6GA 2HSMA 3C8EA 2WRTA 3KMNA 2H1GA 3L4NA 4RUVA 4JE1A 3D21A 4XTSA 1BJXA 2H1DA 1DBYA 3F3QA 2O87A 5ENUA 1ZYQB 5CYYA 3UARA 5LD0A 1SKRB 2XC2A 5J3RA 4EIQA 1OYJA 2YZHA 3G7YA 3HZ8A 4IKHA 3EC3A 4YQMA 4OD7A 2YWNA 4LL4B 3UVTA 4ZIJA 4POLA 2YWIA 1T4ZA 2OBKA 4MNNA 2I9HA 2CVBA 3Q6OA 4O5UA 5KN1A 3KMOA 1PKWA 1GSQA 4BWQA 4K2XA 4V2NA 4GSTA 3GFKA 2HZEB 5AN1A 2YWMA 4NHZA 1X9SB 2P31A 1JHBA 3Q18A 3H1NA 3F9UA 4TR0A 4MF6A 4Q5NA 3F63A 1V2AA 2H73A 3PINA 5CRWA 4HZ2A 1MD4A 1RW1A 2H72A 4MDCA 3APSA 1M99A 1R5AA 3C7MA 1NSWA 1TRUA 3FZAA 4OMVA 3BD2A 1AIUA 2REMA 3KIJA 4I5QA 1T3BA 3NIVA 4DEJA 1URMA 3EU4A 1OC9A 1SYXA 3RDWA 4G10A 1Q98A 4GQFA 1HQOA 3IA1A 14GSA 3RPNA 1ZZYA 1MDJA 13GSA 4TW5A 3FRCA 1Z9HA 1HNAA 3UVHA 4WETA 5H5SA 2I81A 1BX9A 4N0ZA 3RHBA 5GZZB 3TKPA 1PQNA 1YF0A 1XCCA 1PD21 3DVWA 1U3IA 2DIYA 3DXBA 2O85A 2I1UA 1PA3A 5IMFA 4QL9A 1Z6NA 3FR3A 5IM9A 3VFIA 5CREA 3TJFA 3US3A 4X4JA 1UC7A 3QFAC 3N9JA 1ON4A 1XWAA 1GSUA 3L9VA 1XWGA 2V32A 1AQXA 3QAGA 5ID2A 1WIKA 1YDKA 2N5AA 5HFIA 3PH9A 3C71A 1S3AA 1BG5A 5IMDA 2VM1A 2N5BA 2H6ZA 1GNEA 3RPPA 1K0AA 3E3EA 2JZSA 5KN0A 4GQCA 3RHCA 5E4WA 5IMAA 2VM2A 2YCDA 4CDOA 1GUKA 3S9FA 1EGOA 2LNSA 1QFNA 5F05A 4IGJA 4E8HA 2YN1A 2OE3A 1M3JA 1T8EB 2VCQA 2J23A 1OKTA 2FNOA 2R5GA 4NWYA 2KOKA 2GLRA 1HYUA 1ILOA 3HHVA 4OO5A 3BCIA 4NV2A 2C80A 3GA4A 1TP9A 3TKSA 1A0FA 1YJ6A 3GYKA 4G0KA 3HJPA 1FAAA 4FO5A 2PPTA 4KA0A 1EOGA 4IELA 4I2UA 2WDUA 2EIOA 4USSA 3VK9A 1GP1A 2DBCA 4IW9A 4EXJA 2C3NA 1GSYA 1GLPA 4V1Ap 1VRSD 3DD3A 5J5NA 4ML1A 2JADA 1CQGA 5F07A 4IQAA 19GSA 2A4VA 2IMEA 2OACA 3IC8A 2LJRA 1N2AA 4G2EA 2RIIA 4J2FA 4WBJA 1LJRA 2OADA 3DWVA 5COHA 2WFCA 4PQ1A 4D73A 2DJJA 1VF3A 4KAEA 4BL7B 3APQA 2Z9SA 4CY8A 3CBUA 4L0WA 3D5JA 4KNDA 1SENA 1B4PA 3VWWA 2DIZA 3GMFA 4X43A 2B1KA 5ECSA 3WGXA 4BPYA 2F9SA 2X8CA 4ISDA 5HR1A 2JL4A 1XW5A 2CT6A 1QXHA 2VL9A 1WE0A 5HFKA 4BVXB 3LSZA 4RI7A 2PN8A 1B9YC 2CVKA 2H8LA 3DMLA 3IK7A 20GSA 4IJIA 5JCUA 3VURA 1GNWA 1AQWA 1YY7A 4O92A 3ZFLA 5C00A 2IMFA 1FVJA 4GXZA 2WB9A 2VUPA 5JCGA 5KN2A 2IFQA 4FYUA 4K7NA 1O7UA 4HU9A 3TJKA 1R5PA 2GQLA 2LKUA 2L57A 1DUGA 1G6WA 1UN2A 1FOHA 3W8SA 1F3BA 1GSDA 4TR3A 2FUG2 3TKRA 4IP1A 1YKCA 2P0GA 4ZB9A 4BVYA 2L5LA 3WGEA 2E2GA 3GX0A 2VO4A 2MZCA 2QGVA 2AB6A 3KTBA 2VOCA 2HT9A 2FCHA 4IHUA 3IV4A 5JWQB 1V57A 2GSRA 3F4TA 4PUFC 1XVWA 1XWBA 2MMNA 5KOXA 4MA9A 1SJZA 3QOUA 2FA8A 2EC4A 5KEJA 3TJJA 2C0DA 4CHSA 4FIWA 3ZMLA 1THOA 3GTUA 2MBSA 5AIVA 4FH8A 4I8BA 2LV3A 3JCML 1EV9A 4ICYA 3MIXA 3HVVA 2IMIA 1GTAA 4AJ7A 2GGTA 3TOUA 4MZBA 1AUCA
chains in the Genus database with same CATH topology
2A2RA 1ERWA 2CQ9A 3GV1A 3H8QA 4K0GA 3VWUA 4MF7A 2E0QA 2DJ1A 3HJMA 4K5SA 5A4WA 2R4VA 1GTIA 1PGTA 3GL5A 4ULXA 5CP1A 4KGIA 4YKFA 1M7TA 4OO4A 4K5RA 3EMXA 3FY7A 4HJMA 3VPQA 4EF0A 4ZILA 2L6DA 4JR4A 5IO2A 2NBSA 2H01A 2CV4A 4F2IA 3DEXA 2HNLA 5IPHA 1ZYPA 3FR9A 3EE2A 2VD0A 4HDEA 1OVNA 2ZUPA 4NMUA 1PX6A 4L5OA 5DDLA 2WJUA 2P5QA 1X9MB 1E6BA 1Q4JA 4PNFA 4KE3A 3VI7A 5BMUA 1FB0A 2IJYA 3QAWA 1EWXA 2IWTA 2YPMA 2H70A 4CY6A 3IHQA 1TKDB 3A2WA 5ECLB 3IAM2 2PU9C 1GWCA 2TRCP 4G19A 3UEMA 2CA8A 1LU4A 2X49A 4Z2TA 4GRFA 1FG4A 1TI3A 3BCKA 2K18A 5DCGA 4IS0A 1THXA 4PURA 3HCZA 4TRXA 1YZXA 2L59A 3M3MA 4XS1A 4XCSA 4PGTA 3E0UA 2C4JA 2VLUA 4WR4A 2AJQB 2LNTA 4RQXA 5GAPD 1A2MA 3P90A 5DALB 2IN3A 3WT1A 1F2EA 2GZYA 5L71A 1JFUA 1A23A 1H4OA 2PVQA 1XOBA 1M0UA 1A0RP 2OBIA 3KZQA 3A2VA 2CZ2A 1BYEA 3BBYA 4N0VA 5H5QA 3FR6A 2K8SA 4GSNA 4MJAA 1SYRA 1LBKA 2L4QA 1XOAA 2H76A 3CMIA 1TK8B 3EMPA 4LA1A 4MZCA 1SKSB 2AYTA 1WWJA 7GSSA 4PNGA 1GH2A 2FWHA 1F9MA 1T00A 2R0PA 1SK0A 1JLVA 2L6CA 1BQ7A 2OE0A 4TXOB 5FHIA 1VF4A 2GT5A 2PMTA 2DMLA 1Z3EA 3TKSE 2H74A 2VCXA 1X9WB 2HE3A 2H6XA 1Z7RA 4ZL7A 3CRUA 3F3RA 3O76A 3O6TA 3L9UA 1U6TA 3VWVA 3F4RA 3TJGA 1SL1B 3HKRA 5INYA 1EGRA 4EC0A 1EP7A 4MJEA 2K6VA 1I9DA 3RBTA 5ECNB 3MWHA 3I69A 1EOHA 1ZYNA 1ZCPA 4N30A 4EL1A 4DSSB 2QA1A 4HUAA 5D73A 3HXSA 3DRNA 2AAWA 2AHEA 4HS1A 2DJ2A 1YQ1A 4YQVA 1WP0A 3HZ4A 2M46A 1F3AA 3DGQA 2HFDA 4KUNA 3UIWA 1YKAA 2QKEA 2WS2A 10GSA 4TR1B 5DQSA 4EUYA 5F06A 1N8JA 4JU5A 3Q19A 1Y6EA 5IOXA 1T4YA 2HZEA 9GSSA 3NZNA 1FHEA 3D4MA 1SJIA 2NVLA 5GSSA 3GKKA 3ZYWA 2M72A 4POKA 2GZZA 1PN9A 3HD5A 3W8JA 2B5EA 4YAPA 2C0GA 4F03A 1AXDA 2TRXA 3WGDA 3FZ9A 4N11A 5D93A 5G1KA 3VI5A 4JBBA 4V2MA 5D96A 5HR3A 2LQOA 4PQIA 5DVBA 2DMMA 3KM6A 4N10A 5D9TA 3FK8A 2R0GA 4HOJA 4K6XA 4ZBAA 2RM6A 4MH3A 5A4UA 1C72A 3TUEA 1O81A 4Z7XA 2ZNMA 5G1LA 2PBJA 3WD6A 2GT6A 1DSBA 3P8WA 1UVZA 1ZMAA 2H0GA 1RQMA 1GUMA 3ZITA 2ON5A 1NW2A 1BEDA 2LEGA 2B1LA 1X5EA 1TJDA 2I4AA 3UMAA 3R2QA 3F8UA 1TK5B 5H5RA 4WXTA 3GIXA 1FB6A 2E7PA 3GHAA 4HU7A 1X0RA 4TOPA 3A5WA 1GRXA 1CQHA 1V40A 4TN8A 3DVXA 3P2AA 2XHFA 1VF1A 4LLRA 1M2DA 1U87A 1B4QA 1MEKA 1OC8A 2J9HA 1B9XC 4V1Ag 4XHMA 4PX1A 3FYGA 3IHGA 4I2TA 1XW9A 3MYDA 1J9BA 1O8WA 4XRDA 3TKQA 3IXRA 1O73A 2CAIA 4JRRA 1WRYA 4EIPA 3A2XA 4J56E 3EU3A 2LSTA 3KEBA 5AIXA 1G7OA 2ON7A 3HYPA 3QDNA 5GSTA 3H4KA 3LYKA 3LYPA 1R7HA 2RLIA 1U3AA 3ZVJA 2JSZA 2JACA 1A2LA 2H75A 1TOFA 1QUWA 4AJ8A 2ES7A 1OE8A 2JZTA 1SK2A 3FEUA 1K0MA 2EIQA 4KDUA 4POMA 5JCWA 4F0BA 5IO0A 1I5GA 1FO5A 4KW6A 3KH7A 2KP1A 4MP4A 2HI7A 4E8EA 2FWGA 3F6DA 2HRKA 4JZQA 5BRTA 1XBSA 2OA7A 3ME8A 2PGTA 1JLWA 1BAYA 2FHEA 2V41A 5F8BA 3GURA 3IDVA 1DE2A 5ECIB 1OKDA 2X4AA 1R4WA 3ZRDA 3QMXA 4WKWA 3PGTA 5E59A 3H79A 5J41A 4POBA 3ZFBA 1MDIA 4PXOA 1SK1A 2MBTA 4BL7A 2IL3A 1ACVA 3GRXA 1U88A 4ML6A 2O89A 4AF2A 2IPAA 4NXIA 3M8NA 1GLQA 4MPFA 3TGZA 2V6KA 1QMVA 5G5FA 3EINA 3F0IA 1S3DA 3I43A 3ERGA 3QCPA 2DKIA 3HDCA 2C1YA 4BVXA 3ZIVA 5FWGA 3EVIA 1KBNA 3D0ZA 1W4VA 3M0FA 2CVDA 1QQ2A 2OE1A 2C8UA 3KP9A 2A2PA 3HVSA 3CRTA 4V2LA 4XIHA 3WT2A 1XWKA 2X8HA 3M9JA 6GSUA 1A8LA 2DLXA 2H6YA 3GN3A 5ECOB 2WZ9A 1GUHA 5DCHA 3TRPA 1KNGA 2VL2C 4HEA2 3IC4A 4LMWA 3EWLA 3IOSA 3BOAA 4ID0A 4AJ6A 4K0NA 3KP8A 4IQ1A 3F4SA 3TRXA 4KB3A 1O8XA 4KDXA 2GSSA 2H1AA 3MDKA 4YAVA 2GSQA 2GDRA 18GSA 3RAZA 5A4VA 4Z2RA 3ERWA 4ZBDA 3G7IA 3EURA 3ZZXA 2F8FA 3Q74A 3KTLA 2GQKA 2JSYA 2G0FA 2M80A 5J9CA 2UZ8A 2IIYA 3GUSA 5LCZA 1NHYA 4ZBBA 5B7CA 5IMZA 2L5OA 4PUAA 3FZ4A 5G31A 2QC7A 4ZXGA 4X0XA 5G5EA 16GSA 1XIYA 5HQPA 2HRAA 2R2JA 1GSEA 2C3QA 1TRVA 4OFTA 5B6NA 2V1MA 4TKYA 1KTEA 1PX7A 1T7PB 3VWXA 11GSA 4KCEA 5DJMA 1WJKA 1ABAA 4OCFA 3FHKA 5ELAA 2RUEA 5F0GA 1FVKA 1W89A 1XZOA 5JWRB 3TB2A 5ECPB 4RI6A 4ZB6A 1OE7A 2QA2A 4KDYA 2BMXA 3GH6A 2RUFA 3FZ5A 3HJOA 2YV9A 2ALBA 4LL1B 2KP2A 8GSSA 1B48A 5EPFA 3L9SA 2KLXA 2LRTA 2BTOT 4WBRD 4JR6A 2LJAA 4K7OA 4GLTA 3ZTLA 2N5FA 4KSOA 3LG6A 1ZYEA 5A5KA 1O6JA 1TDIA 2LTKA 4ECJA 1A24A 3I6AA 2WULA 3LGCA 2YOIA 5DAKB 3IR4A 4XS4B 1QK8A 1XVQA 1XXUA 1VF2A 4L8EA 5HR0A 2LS5A 3IE3A 1PL1A 2LQQA 3UJ1A 4DSQA 1E2YA 1EV4A 5ECMB 2HLSA 1GSFA 1Z5YE 3ZIJA 3APOA 1DE1A 3N5OA 1VGLA 3WYWA 2NDOA 4YKGA 1WPIA 3LORA 3P7XA 1WOUA 6GSTA 3C73A 2NPBA 4AGSA 2H19A 5DALA 2KUCA 2F8AA 2F3MA 4EO3A 1ZL9A 2B5YA 2R0CA 3U6VA 1M9AA 2DJ3A 3TOTA 3J7Yk 3D22A 5HFGA 4TXVA 4ECBA 5DJLA 4O7HA 3L0HA 4WR5A 1TK0B 2EIRA 3LFLA 3CYNA 1M2AA 1H75A 3GKMA 2DJKA 1M2BA 2LRCA 3TJBA 1Z7PA 3DIEA 5D9VA 3IPZA 4HJ2A 22GSA 2VLTA 4I97A 1FW1A 6GSXA 4QL7A 3IRAA 2PUKC 4WF5A 5KOWA 2R37A 4MF5A 4TXOA 2GQMA 2C0EA 4FYBA 2C3TA 1IYHA 4BA7A 2H66A 2GZPA 2X64A 5EL8A 2P5RA 1GSSA 2NTOA 3R3EA 1MDKA 1Y25A 3LXZA 4I6XA 4QQ7A 4WF4A 5CAXA 4IBPA 1K3LA 4NHWA 1HNBA 2OKAA 3IAS2 1ERTA 3UBKA 2CZ3A 3MSZA 1F37A 3K8NA 5CNWA 1QGVA 2PWJA 2V6OA 4K7IA 2B6MA 1K0OA 1OC9B 1A8YA 4MJCA 2GSTA 3GNJA 5G30A 5ECHB 3DYRA 1EP8A 2K8VA 3ERFA 2CX3A 4YQUA 2LRNA 3UOMA 5IQYA 5AISA 5ECQB 6GSSA 3TKSC 3G9BA 4DSSA 1PL2A 5B8AA 2O7KA 3ZL5A 4BWSA 1K0CA 1XPVA 3LWAA 1K0NA 4ZL9A 1SL2B 4IVFA 3V1WA 4Q5FA 2DSAA 2FWFA 5D9WA 2TIRA 4EE0A 3E9JB 2HYXA 2GVPA 4TR1A 3LEFA 1MTCA 3EYTA 5ID2B 4OWYA 4P3YB 5IPGA 1EZKA 1OAZA 2C0FA 2A4HA 1AW9A 3L78A 1JZOA 3PPUA 1HD2A 1KEBA 2R3XA 1J0FA 3HA9A 1GTBA 2BJXA 2AUVA 4HI7A 3IK9A 1GULA 1ST9A 3FKFA 1G7EA 4L5LA 4OFNA 4PTSA 1NHOA 1Z6MA 4ZL8A 5FT3A 17GSA 2JZRA 3SBCA 1K3OA 1XWCA 2AV4A 1GTUA 1R26A 1JZRA 2XPEA 1F6MC 4XRAA 1OC3A 3QAVA 3GKNA 4ILFA 6GSVA 3MNGA 1TU8A 1V98A 4MCUA 3QR6A 3CSHA 5KN3A 4EKZA 5J9BA 3G7JA 4MH2A 4MK3A 1TRWA 4Q5RA 4KH7A 4DSRA 2VCZA 1EEJA 3ZREA 3EPTA 4K1FA 3ZMKA 3GSTA 2DJ0A 4G0IA 1AQVA 3LJRA 2JU5A 4F82A 4XS6A 1YF1A 2FGXA 2YV7A 1USBA 5D9XA 2MMOA 4ACSA 2H1BA 2B7KA 2MMAA 5JWOB 3GX8A 1G6YA 2A2SA 1PN0A 3OR5A 2F51A 2FY6A 3O3TA 4KCAA 3CSIA 3NOFA 2O8VB 4D73B 2X8GA 2H0HA 2KHPA 4HQZA 1ZGNA 1AAZA 2B5XA 3VPTA 3ME7A 1SKWB 4MLYA 5ABRA 2I3YA 1G0TA 1TU7A 2V2GA 1XW6A 1SJ6A 2VL3A 2VAFA 2IMKA 3M1GA 2LJKA 1SU9A 5G2ZA 1HNCA 3UBLA 3DKSA 2HZFA 2HSYA 1PKZA 4TR4A 2IFQB 3CSJA 5C04A 2FD3A 1XFLA 3A3TA 4EDZA 5IMCA 2G2QA 1FOVA 4HZ4A 1UA5A 4G9HA 4BVYB 2GTUA 1X5CA 2YNXA 4K8MA 5B6MA 4FYCA 4KSMA 5CRHA 3FMWA 3HY2A 2K9FA 2XBIA 2YWOA 3KXOA 4PQHA 1JZDA 4J57E 3CTFA 2H30A 4EDYA 2XBQA 3U5RE 1K0BA 3A5IA 3VLNA 2H0IA 3GTUB 4GTUA 2VCVA 4IJ3A 2MYGA 4Q5QA 4ECCA 2B3SA 5DBQA 1IYIA 2IMDA 1S3CA 2VIMA 6GSWA 3HVXA 4NV5A 1B8XA 3LQ7A 1WMJA 4OCEA 3CTGA 4KF9A 3QFBC 2YZUA 3UAPA 3GL3A 4MABA 5EVOA 1GL8A 4O5QA 3GSSA 3IBHA 1K3YA 4WEYA 1PRXA 4FQUA 2E2MA 1ZOFA 3D4TA 4HQSA 1V58A 4DVCA 2D2ZA 2LUSA 4K2DA 1A2JA 1TXXA 5AGYA 4F0CA 2H71A 3TCOA 2CX4A 2ZCTA 4ECIA 3F6FA 4O32A 4EVMA 4CW9A 3QPMA 1TTZA 2VD1A 4OFMA 2FLSA 4GF0A 2GS3A 4X1UA 4MPGA 1JZWA 2WCIA 4NPBA 1YEPA 3I9V2 3C1RA 4LMVA 3ZLPA 1EEMA 5J4UA 3LXTA 4GWRA 2B7JA 3M9KA 3AY8A 4L0UA 2XPDA 1O85A 4TVEA 4Z2UA 5IOWA 3LW9A 4MMMA 4K9ZA 4NAXA 3J7Yb 1PMTA 4A5PA 3KJYA 3BJ5A 3KGKA 6GSYA 3TDGA 3H93A 2YJHA 3QD9A 3KD0A 1SD9A 4O5RA 4RQRA 2VCWA 2CAQA 3GH9A 3ISOA 1T1VA 1RK4A 3TRQA 1PSQA 3PR8A 1ML6A 5CRDA 3KH9A 12GSA 2VL2A 3MAKA 1YEXA 1NM3A 1SL0B 5LNKe 2QSIA 2PVOC 1AC1A 3GKXA 3C1SA 2L4CA 2FWEA 2HSHA 2VCTA 2DKHA 3UL3A 3ED3A 5CRGA 1TRSA 5ECKB 3D6IA 4YH2A 2HXKA 3FW2A 4IN0A 1ERVA 5D8IA 4IP6A 5DAKA 1J08A 4XS4A 1K0DA 5IMVA 5ECRB 2RM5A 2X99A 2HRFA 2YANA 4KX4A 2DC5A 2FA4A 1X5DA 1TI1A 5CO3A 4ZB8A 4JEDA 4G0LA 5HR2A 2OJLA 2MMZA 2WGRA 1TW9A 1MD3A 1SD8A 2VLVA 3CXGA 1ERUA 5EY6A 1M9BA 2YJ7A 5ELGA 4MJBA 5GAND 4F9ZA 4H86A 2HRNA 2PERA 5DQYA 4MZWA 5B8BA 3SWLA 3ZVJD 4GSSA 2R6KA 4GCIA 2YP6A 5IIZA 3KCMA 1V9WA 3W6GA 2HSMA 3C8EA 2WRTA 3KMNA 2H1GA 3L4NA 4RUVA 4JE1A 3D21A 4XTSA 1BJXA 2H1DA 1DBYA 3F3QA 2O87A 5ENUA 1ZYQB 5CYYA 3UARA 5LD0A 1SKRB 2XC2A 5J3RA 4EIQA 1OYJA 2YZHA 3G7YA 3HZ8A 4IKHA 3EC3A 4YQMA 4OD7A 2YWNA 4LL4B 3UVTA 4ZIJA 4POLA 2YWIA 1T4ZA 2OBKA 4MNNA 2I9HA 2CVBA 3Q6OA 4O5UA 5KN1A 3KMOA 1PKWA 1GSQA 4BWQA 4K2XA 4V2NA 4GSTA 3GFKA 2HZEB 5AN1A 2YWMA 4NHZA 1X9SB 2P31A 1JHBA 3Q18A 3H1NA 3F9UA 4TR0A 4MF6A 4Q5NA 3F63A 1V2AA 2H73A 3PINA 5CRWA 4HZ2A 1MD4A 1RW1A 2H72A 4MDCA 3APSA 1M99A 1R5AA 3C7MA 1NSWA 1TRUA 3FZAA 4OMVA 3BD2A 1AIUA 2REMA 3KIJA 4I5QA 1T3BA 3NIVA 4DEJA 1URMA 3EU4A 1OC9A 1SYXA 3RDWA 4G10A 1Q98A 4GQFA 1HQOA 3IA1A 14GSA 3RPNA 1ZZYA 1MDJA 13GSA 4TW5A 3FRCA 1Z9HA 1HNAA 3UVHA 4WETA 5H5SA 2I81A 1BX9A 4N0ZA 3RHBA 5GZZB 3TKPA 1PQNA 1YF0A 1XCCA 1PD21 3DVWA 1U3IA 2DIYA 3DXBA 2O85A 2I1UA 1PA3A 5IMFA 4QL9A 1Z6NA 3FR3A 5IM9A 3VFIA 5CREA 3TJFA 3US3A 4X4JA 1UC7A 3QFAC 3N9JA 1ON4A 1XWAA 1GSUA 3L9VA 1XWGA 2V32A 1AQXA 3QAGA 5ID2A 1WIKA 1YDKA 2N5AA 5HFIA 3PH9A 3C71A 1S3AA 1BG5A 5IMDA 2VM1A 2N5BA 2H6ZA 1GNEA 3RPPA 1K0AA 3E3EA 2JZSA 5KN0A 4GQCA 3RHCA 5E4WA 5IMAA 2VM2A 2YCDA 4CDOA 1GUKA 3S9FA 1EGOA 2LNSA 1QFNA 5F05A 4IGJA 4E8HA 2YN1A 2OE3A 1T8EB 2VCQA 2J23A 1OKTA 2FNOA 2R5GA 4NWYA 2KOKA 2GLRA 1HYUA 1ILOA 3HHVA 4OO5A 3BCIA 4NV2A 2C80A 3GA4A 1TP9A 3TKSA 1A0FA 1YJ6A 3GYKA 4G0KA 3HJPA 1FAAA 4FO5A 2PPTA 4KA0A 1EOGA 4IELA 4I2UA 2WDUA 2EIOA 4USSA 3VK9A 1GP1A 2DBCA 4IW9A 4EXJA 2C3NA 1GSYA 1GLPA 4V1Ap 1VRSD 3DD3A 5J5NA 4ML1A 2JADA 1CQGA 5F07A 4IQAA 19GSA 2A4VA 2IMEA 2OACA 3IC8A 2LJRA 1N2AA 4G2EA 2RIIA 4J2FA 4WBJA 1LJRA 2OADA 3DWVA 5COHA 2WFCA 4PQ1A 4D73A 2DJJA 1VF3A 4KAEA 4BL7B 3APQA 2Z9SA 4CY8A 3CBUA 4L0WA 3D5JA 4KNDA 1SENA 1B4PA 3VWWA 2DIZA 3GMFA 4X43A 2B1KA 5ECSA 3WGXA 4BPYA 2F9SA 2X8CA 4ISDA 5HR1A 2JL4A 1XW5A 2CT6A 1QXHA 2VL9A 1WE0A 5HFKA 4BVXB 3LSZA 4RI7A 2PN8A 1B9YC 2CVKA 2H8LA 3DMLA 3IK7A 20GSA 4IJIA 5JCUA 3VURA 1GNWA 1AQWA 1YY7A 4O92A 3ZFLA 5C00A 2IMFA 1FVJA 4GXZA 2WB9A 2VUPA 5JCGA 5KN2A 2IFQA 4FYUA 4K7NA 1O7UA 4HU9A 3TJKA 1R5PA 2GQLA 2LKUA 2L57A 1DUGA 1G6WA 1UN2A 1FOHA 3W8SA 1F3BA 1GSDA 4TR3A 2FUG2 3TKRA 4IP1A 1YKCA 2P0GA 4ZB9A 4BVYA 2L5LA 3WGEA 2E2GA 3GX0A 2VO4A 2MZCA 2QGVA 2AB6A 3KTBA 2VOCA 2HT9A 2FCHA 4IHUA 3IV4A 5JWQB 1V57A 2GSRA 3F4TA 4PUFC 1XVWA 1XWBA 2MMNA 5KOXA 4MA9A 1SJZA 3QOUA 2FA8A 2EC4A 5KEJA 3TJJA 2C0DA 4CHSA 4FIWA 3ZMLA 1THOA 3GTUA 2MBSA 5AIVA 4FH8A 4I8BA 2LV3A 3JCML 1EV9A 4ICYA 3MIXA 3HVVA 2IMIA 1GTAA 4AJ7A 2GGTA 3TOUA 4MZBA 1AUCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A2R A;  1ERW A;  2CQ9 A;  3GV1 A;  3H8Q A;  4K0G A;  3VWU A;  4MF7 A;  2E0Q A;  2DJ1 A;  3HJM A;  5A4W A;  2R4V A;  1GTI A;  1PGT A;  3GL5 A;  4ULX A;  5CP1 A;  4KGI A;  1M7T A;  4OO4 A;  3EMX A;  3FY7 A;  4HJM A;  3VPQ A;  4EF0 A;  4ZIL A;  2L6D A;  4JR4 A;  5IO2 A;  2NBS A;  2H01 A;  2CV4 A;  4F2I A;  3DEX A;  2HNL A;  5IPH A;  3FR9 A;  3EE2 A;  2VD0 A;  4HDE A;  1OVN A;  2ZUP A;  4NMU A;  1PX6 A;  4L5O A;  5DDL A;  2WJU A;  2P5Q A;  1X9M B;  1E6B A;  1Q4J A;  4PNF A;  4KE3 A;  3VI7 A;  1FB0 A;  2IJY A;  3QAW A;  1EWX A;  2IWT A;  2YPM A;  2H70 A;  3IHQ A;  1TKD B;  3A2W A;  5ECL B;  3IAM 2;  2PU9 C;  1GWC A;  2TRC P;  4G19 A;  3UEM A;  2CA8 A;  1LU4 A;  4GRF A;  1FG4 A;  1TI3 A;  3BCK A;  2K18 A;  5DCG A;  4IS0 A;  1THX A;  4PUR A;  3HCZ A;  4TRX A;  1YZX A;  2L59 A;  3M3M A;  4XS1 A;  4XCS A;  4PGT A;  3E0U A;  2C4J A;  2VLU A;  4WR4 A;  2AJQ B;  2LNT A;  4RQX A;  5GAP D;  1A2M A;  3P90 A;  5DAL B;  2IN3 A;  3WT1 A;  1F2E A;  2GZY A;  5L71 A;  1JFU A;  1A23 A;  1H4O A;  2PVQ A;  1XOB A;  1M0U A;  1A0R P;  2OBI A;  3KZQ A;  3A2V A;  2CZ2 A;  1BYE A;  3BBY A;  4N0V A;  5H5Q A;  3FR6 A;  2K8S A;  4GSN A;  4MJA A;  1SYR A;  1LBK A;  2L4Q A;  1XOA A;  2H76 A;  3CMI A;  1TK8 B;  3EMP A;  4LA1 A;  4MZC A;  1SKS B;  2AYT A;  1WWJ A;  7GSS A;  4PNG A;  1GH2 A;  2FWH A;  1F9M A;  1T00 A;  1SK0 A;  1JLV A;  2L6C A;  1BQ7 A;  2OE0 A;  4TXO B;  5FHI A;  1VF4 A;  2GT5 A;  2PMT A;  2DML A;  1Z3E A;  3TKS E;  2H74 A;  2VCX A;  1X9W B;  2HE3 A;  2H6X A;  1Z7R A;  4ZL7 A;  3CRU A;  3F3R A;  3O76 A;  3O6T A;  3L9U A;  1U6T A;  3VWV A;  3F4R A;  3TJG A;  1SL1 B;  3HKR A;  5INY A;  1EGR A;  4EC0 A;  1EP7 A;  4MJE A;  2K6V A;  1I9D A;  3RBT A;  5ECN B;  3MWH A;  3I69 A;  1EOH A;  1ZCP A;  4N30 A;  4EL1 A;  4DSS B;  4HUA A;  5D73 A;  3HXS A;  3DRN A;  2AAW A;  2AHE A;  4HS1 A;  2DJ2 A;  1YQ1 A;  4YQV A;  1WP0 A;  3HZ4 A;  2M46 A;  1F3A A;  3DGQ A;  2HFD A;  4KUN A;  3UIW A;  1YKA A;  2QKE A;  2WS2 A;  10GS A;  4TR1 B;  5DQS A;  4EUY A;  5F06 A;  1N8J A;  4JU5 A;  3Q19 A;  1Y6E A;  5IOX A;  1T4Y A;  2HZE A;  9GSS A;  3NZN A;  1FHE A;  3D4M A;  1SJI A;  2NVL A;  5GSS A;  3GKK A;  3ZYW A;  2M72 A;  4POK A;  2GZZ A;  1PN9 A;  3HD5 A;  3W8J A;  2B5E A;  4YAP A;  2C0G A;  4F03 A;  1AXD A;  2TRX A;  3WGD A;  3FZ9 A;  4N11 A;  5D93 A;  5G1K A;  3VI5 A;  4JBB A;  4V2M A;  5D96 A;  5HR3 A;  2LQO A;  4PQI A;  5DVB A;  2DMM A;  3KM6 A;  4N10 A;  5D9T A;  3FK8 A;  4HOJ A;  4K6X A;  4ZBA A;  2RM6 A;  4MH3 A;  5A4U A;  1C72 A;  3TUE A;  1O81 A;  4Z7X A;  2ZNM A;  5G1L A;  2PBJ A;  3WD6 A;  2GT6 A;  1DSB A;  3P8W A;  1UVZ A;  1ZMA A;  2H0G A;  1RQM A;  1GUM A;  3ZIT A;  2ON5 A;  1NW2 A;  1BED A;  2LEG A;  2B1L A;  1X5E A;  1TJD A;  2I4A A;  3UMA A;  3R2Q A;  3F8U A;  1TK5 B;  5H5R A;  4WXT A;  3GIX A;  1FB6 A;  2E7P A;  3GHA A;  4HU7 A;  1X0R A;  4TOP A;  3A5W A;  1GRX A;  1CQH A;  1V40 A;  4TN8 A;  3DVX A;  3P2A A;  2XHF A;  1VF1 A;  4LLR A;  1M2D A;  1U87 A;  1B4Q A;  1MEK A;  1OC8 A;  2J9H A;  1B9X C;  4V1A g;  4XHM A;  4PX1 A;  3FYG A;  4I2T A;  1XW9 A;  1J9B A;  1O8W A;  4XRD A;  3TKQ A;  3IXR A;  1O73 A;  2CAI A;  4JRR A;  1WRY A;  3A2X A;  4J56 E;  3EU3 A;  2LST A;  3KEB A;  5AIX A;  1G7O A;  2ON7 A;  3HYP A;  3QDN A;  5GST A;  3H4K A;  3LYK A;  3LYP A;  1R7H A;  2RLI A;  1U3A A;  3ZVJ A;  2JSZ A;  2JAC A;  1A2L A;  2H75 A;  1TOF A;  1QUW A;  4AJ8 A;  2ES7 A;  1OE8 A;  2JZT A;  1SK2 A;  3FEU A;  1K0M A;  2EIQ A;  4KDU A;  4POM A;  5JCW A;  4F0B A;  5IO0 A;  1I5G A;  1FO5 A;  4KW6 A;  3KH7 A;  2KP1 A;  4MP4 A;  2HI7 A;  4E8E A;  2FWG A;  3F6D A;  4JZQ A;  1XBS A;  2OA7 A;  3ME8 A;  2PGT A;  1JLW A;  1BAY A;  2FHE A;  2V41 A;  5F8B A;  3GUR A;  3IDV A;  1DE2 A;  5ECI B;  1OKD A;  1R4W A;  3ZRD A;  3QMX A;  4WKW A;  3PGT A;  5E59 A;  3H79 A;  5J41 A;  4POB A;  3ZFB A;  1MDI A;  4PXO A;  1SK1 A;  2MBT A;  4BL7 A;  2IL3 A;  1ACV A;  3GRX A;  1U88 A;  4ML6 A;  2O89 A;  4AF2 A;  2IPA A;  4NXI A;  3M8N A;  1GLQ A;  4MPF A;  3TGZ A;  2V6K A;  1QMV A;  5G5F A;  3EIN A;  3F0I A;  1S3D A;  3I43 A;  3ERG A;  3QCP A;  3HDC A;  2C1Y A;  4BVX A;  3ZIV A;  5FWG A;  3EVI A;  1KBN A;  3D0Z A;  1W4V A;  3M0F A;  2CVD A;  1QQ2 A;  2OE1 A;  2C8U A;  3KP9 A;  3HVS A;  3CRT A;  4V2L A;  4XIH A;  3WT2 A;  1XWK A;  2X8H A;  3M9J A;  6GSU A;  1A8L A;  2DLX A;  2H6Y A;  3GN3 A;  5ECO B;  2WZ9 A;  1GUH A;  5DCH A;  3TRP A;  1KNG A;  2VL2 C;  4HEA 2;  3IC4 A;  4LMW A;  3EWL A;  3IOS A;  3BOA A;  4ID0 A;  4AJ6 A;  4K0N A;  3KP8 A;  4IQ1 A;  3F4S A;  3TRX A;  4KB3 A;  1O8X A;  4KDX A;  2GSS A;  2H1A A;  3MDK A;  4YAV A;  2GSQ A;  2GDR A;  18GS A;  3RAZ A;  5A4V A;  3ERW A;  4ZBD A;  3G7I A;  3EUR A;  3ZZX A;  2F8F A;  3Q74 A;  3KTL A;  2GQK A;  2JSY A;  2G0F A;  2M80 A;  5J9C A;  2IIY A;  3GUS A;  5LCZ A;  1NHY A;  4ZBB A;  5B7C A;  5IMZ A;  2L5O A;  4PUA A;  3FZ4 A;  5G31 A;  2QC7 A;  4ZXG A;  4X0X A;  5G5E A;  16GS A;  1XIY A;  5HQP A;  2R2J A;  1GSE A;  2C3Q A;  1TRV A;  4OFT A;  5B6N A;  2V1M A;  4TKY A;  1KTE A;  1PX7 A;  1T7P B;  3VWX A;  11GS A;  4KCE A;  5DJM A;  1WJK A;  1ABA A;  4OCF A;  3FHK A;  5ELA A;  2RUE A;  5F0G A;  1FVK A;  1W89 A;  1XZO A;  5JWR B;  3TB2 A;  5ECP B;  4RI6 A;  4ZB6 A;  1OE7 A;  4KDY A;  2BMX A;  3GH6 A;  2RUF A;  3FZ5 A;  3HJO A;  2YV9 A;  2ALB A;  4LL1 B;  2KP2 A;  8GSS A;  1B48 A;  5EPF A;  3L9S A;  2KLX A;  2LRT A;  2BTO T;  4WBR D;  4JR6 A;  2LJA A;  4K7O A;  4GLT A;  3ZTL A;  2N5F A;  4KSO A;  3LG6 A;  1ZYE A;  5A5K A;  1O6J A;  1TDI A;  2LTK A;  4ECJ A;  1A24 A;  3I6A A;  2WUL A;  3LGC A;  2YOI A;  5DAK B;  3IR4 A;  4XS4 B;  1QK8 A;  1XVQ A;  1XXU A;  1VF2 A;  4L8E A;  5HR0 A;  2LS5 A;  3IE3 A;  1PL1 A;  2LQQ A;  3UJ1 A;  4DSQ A;  1E2Y A;  1EV4 A;  5ECM B;  2HLS A;  1GSF A;  1Z5Y E;  3ZIJ A;  3APO A;  1DE1 A;  3N5O A;  1VGL A;  3WYW A;  2NDO A;  1WPI A;  3LOR A;  3P7X A;  1WOU A;  6GST A;  3C73 A;  2NPB A;  4AGS A;  2H19 A;  5DAL A;  2KUC A;  2F8A A;  2F3M A;  4EO3 A;  1ZL9 A;  2B5Y A;  3U6V A;  1M9A A;  2DJ3 A;  3TOT A;  3J7Y k;  3D22 A;  5HFG A;  4TXV A;  4ECB A;  5DJL A;  4O7H A;  3L0H A;  4WR5 A;  1TK0 B;  2EIR A;  3LFL A;  3CYN A;  1M2A A;  1H75 A;  3GKM A;  2DJK A;  1M2B A;  2LRC A;  3TJB A;  1Z7P A;  3DIE A;  5D9V A;  3IPZ A;  4HJ2 A;  22GS A;  2VLT A;  4I97 A;  1FW1 A;  6GSX A;  4QL7 A;  3IRA A;  2PUK C;  4WF5 A;  2R37 A;  4MF5 A;  4TXO A;  2GQM A;  2C0E A;  4FYB A;  2C3T A;  1IYH A;  4BA7 A;  2H66 A;  2GZP A;  2X64 A;  5EL8 A;  2P5R A;  1GSS A;  2NTO A;  1MDK A;  1Y25 A;  3LXZ A;  4I6X A;  4QQ7 A;  4WF4 A;  5CAX A;  4IBP A;  1K3L A;  4NHW A;  1HNB A;  2OKA A;  3IAS 2;  1ERT A;  3UBK A;  2CZ3 A;  3MSZ A;  1F37 A;  3K8N A;  5CNW A;  1QGV A;  2PWJ A;  2V6O A;  4K7I A;  2B6M A;  1K0O A;  1OC9 B;  1A8Y A;  4MJC A;  2GST A;  3GNJ A;  5G30 A;  5ECH B;  3DYR A;  1EP8 A;  2K8V A;  3ERF A;  2CX3 A;  4YQU A;  2LRN A;  3UOM A;  5IQY A;  5AIS A;  5ECQ B;  6GSS A;  3TKS C;  3G9B A;  4DSS A;  1PL2 A;  5B8A A;  2O7K A;  3ZL5 A;  4BWS A;  1K0C A;  1XPV A;  3LWA A;  1K0N A;  4ZL9 A;  1SL2 B;  4IVF A;  3V1W A;  4Q5F A;  2DSA A;  2FWF A;  5D9W A;  2TIR A;  4EE0 A;  3E9J B;  2HYX A;  2GVP A;  4TR1 A;  3LEF A;  1MTC A;  3EYT A;  5ID2 B;  4OWY A;  4P3Y B;  5IPG A;  1EZK A;  1OAZ A;  2C0F A;  1AW9 A;  3L78 A;  1JZO A;  1HD2 A;  1KEB A;  2R3X A;  1J0F A;  3HA9 A;  1GTB A;  2BJX A;  2AUV A;  4HI7 A;  3IK9 A;  1GUL A;  1ST9 A;  3FKF A;  1G7E A;  4L5L A;  4OFN A;  1NHO A;  1Z6M A;  4ZL8 A;  5FT3 A;  17GS A;  2JZR A;  3SBC A;  1K3O A;  1XWC A;  2AV4 A;  1GTU A;  1R26 A;  1JZR A;  2XPE A;  1F6M C;  4XRA A;  1OC3 A;  3QAV A;  3GKN A;  4ILF A;  6GSV A;  3MNG A;  1TU8 A;  1V98 A;  4MCU A;  3QR6 A;  3CSH A;  5KN3 A;  4EKZ A;  5J9B A;  3G7J A;  4MH2 A;  4MK3 A;  1TRW A;  4Q5R A;  4KH7 A;  4DSR A;  2VCZ A;  1EEJ A;  3ZRE A;  4K1F A;  3ZMK A;  3GST A;  2DJ0 A;  1AQV A;  3LJR A;  2JU5 A;  4F82 A;  4XS6 A;  1YF1 A;  2FGX A;  2YV7 A;  1USB A;  5D9X A;  2MMO A;  4ACS A;  2H1B A;  2B7K A;  2MMA A;  5JWO B;  3GX8 A;  1G6Y A;  2A2S A;  3OR5 A;  2F51 A;  2FY6 A;  3O3T A;  4KCA A;  3CSI A;  3NOF A;  2O8V B;  4D73 B;  2X8G A;  2H0H A;  2KHP A;  4HQZ A;  1ZGN A;  1AAZ A;  2B5X A;  3VPT A;  3ME7 A;  1SKW B;  4MLY A;  5ABR A;  2I3Y A;  1G0T A;  1TU7 A;  2V2G A;  1XW6 A;  1SJ6 A;  2VL3 A;  2VAF A;  2IMK A;  3M1G A;  2LJK A;  1SU9 A;  5G2Z A;  1HNC A;  3UBL A;  3DKS A;  2HZF A;  2HSY A;  1PKZ A;  4TR4 A;  2IFQ B;  3CSJ A;  5C04 A;  2FD3 A;  1XFL A;  3A3T A;  4EDZ A;  5IMC A;  2G2Q A;  1FOV A;  4HZ4 A;  1UA5 A;  4G9H A;  2GTU A;  1X5C A;  2YNX A;  4K8M A;  5B6M A;  4FYC A;  4KSM A;  5CRH A;  3HY2 A;  2K9F A;  2XBI A;  2YWO A;  3KXO A;  4PQH A;  1JZD A;  4J57 E;  3CTF A;  2H30 A;  4EDY A;  2XBQ A;  3U5R E;  1K0B A;  3VLN A;  2H0I A;  3GTU B;  4GTU A;  2VCV A;  4IJ3 A;  2MYG A;  4Q5Q A;  4ECC A;  2B3S A;  5DBQ A;  1IYI A;  2IMD A;  1S3C A;  2VIM A;  6GSW A;  3HVX A;  4NV5 A;  1B8X A;  3LQ7 A;  1WMJ A;  4OCE A;  3CTG A;  3QFB C;  2YZU A;  3UAP A;  3GL3 A;  4MAB A;  5EVO A;  1GL8 A;  3GSS A;  3IBH A;  1K3Y A;  4WEY A;  1PRX A;  2E2M A;  1ZOF A;  3D4T A;  4HQS A;  1V58 A;  4DVC A;  2D2Z A;  2LUS A;  4K2D A;  1A2J A;  1TXX A;  5AGY A;  4F0C A;  2H71 A;  3TCO A;  2CX4 A;  2ZCT A;  4ECI A;  3F6F A;  4O32 A;  4EVM A;  4CW9 A;  3QPM A;  1TTZ A;  2VD1 A;  4OFM A;  2FLS A;  4GF0 A;  2GS3 A;  4X1U A;  4MPG A;  1JZW A;  2WCI A;  4NPB A;  1YEP A;  3I9V 2;  3C1R A;  4LMV A;  3ZLP A;  1EEM A;  5J4U A;  3LXT A;  4GWR A;  2B7J A;  3M9K A;  3AY8 A;  4L0U A;  2XPD A;  1O85 A;  4TVE A;  5IOW A;  4MMM A;  4K9Z A;  4NAX A;  3J7Y b;  1PMT A;  3KJY A;  3BJ5 A;  3KGK A;  6GSY A;  3TDG A;  3H93 A;  2YJH A;  3QD9 A;  3KD0 A;  1SD9 A;  4O5R A;  4RQR A;  2VCW A;  2CAQ A;  3GH9 A;  3ISO A;  1T1V A;  1RK4 A;  3TRQ A;  1PSQ A;  3PR8 A;  1ML6 A;  5CRD A;  3KH9 A;  12GS A;  2VL2 A;  3MAK A;  1YEX A;  1NM3 A;  1SL0 B;  5LNK e;  2QSI A;  2PVO C;  1AC1 A;  3GKX A;  3C1S A;  2L4C A;  2FWE A;  2HSH A;  2VCT A;  3UL3 A;  3ED3 A;  5CRG A;  1TRS A;  5ECK B;  3D6I A;  4YH2 A;  2HXK A;  3FW2 A;  4IN0 A;  1ERV A;  5D8I A;  4IP6 A;  5DAK A;  1J08 A;  4XS4 A;  1K0D A;  5IMV A;  5ECR B;  2RM5 A;  2X99 A;  2HRF A;  2YAN A;  4KX4 A;  2DC5 A;  2FA4 A;  1X5D A;  1TI1 A;  5CO3 A;  4ZB8 A;  4JED A;  5HR2 A;  2OJL A;  2MMZ A;  2WGR A;  1TW9 A;  1MD3 A;  1SD8 A;  2VLV A;  3CXG A;  1ERU A;  5EY6 A;  1M9B A;  2YJ7 A;  5ELG A;  4MJB A;  5GAN D;  4F9Z A;  4H86 A;  2HRN A;  2PER A;  5DQY A;  4MZW A;  5B8B A;  3SWL A;  3ZVJ D;  4GSS A;  2R6K A;  4GCI A;  2YP6 A;  5IIZ A;  3KCM A;  1V9W A;  3W6G A;  3C8E A;  2WRT A;  3KMN A;  2H1G A;  3L4N A;  4RUV A;  4JE1 A;  3D21 A;  4XTS A;  1BJX A;  2H1D A;  1DBY A;  3F3Q A;  2O87 A;  5ENU A;  1ZYQ B;  5CYY A;  3UAR A;  5LD0 A;  1SKR B;  2XC2 A;  5J3R A;  1OYJ A;  2YZH A;  3G7Y A;  3HZ8 A;  4IKH A;  3EC3 A;  4YQM A;  4OD7 A;  2YWN A;  4LL4 B;  3UVT A;  4ZIJ A;  4POL A;  2YWI A;  1T4Z A;  2OBK A;  2I9H A;  2CVB A;  3Q6O A;  5KN1 A;  3KMO A;  1PKW A;  1GSQ A;  4BWQ A;  4V2N A;  4GST A;  3GFK A;  2HZE B;  5AN1 A;  2YWM A;  4NHZ A;  1X9S B;  2P31 A;  1JHB A;  3Q18 A;  3H1N A;  3F9U A;  4TR0 A;  4MF6 A;  4Q5N A;  3F63 A;  1V2A A;  2H73 A;  3PIN A;  5CRW A;  4HZ2 A;  1MD4 A;  1RW1 A;  2H72 A;  4MDC A;  3APS A;  1M99 A;  1R5A A;  3C7M A;  1NSW A;  1TRU A;  3FZA A;  4OMV A;  3BD2 A;  1AIU A;  2REM A;  3KIJ A;  4I5Q A;  1T3B A;  3NIV A;  4DEJ A;  1URM A;  3EU4 A;  1OC9 A;  1SYX A;  3RDW A;  4G10 A;  1Q98 A;  4GQF A;  1HQO A;  3IA1 A;  14GS A;  3RPN A;  1ZZY A;  1MDJ A;  13GS A;  4TW5 A;  3FRC A;  1Z9H A;  1HNA A;  3UVH A;  4WET A;  5H5S A;  2I81 A;  1BX9 A;  4N0Z A;  3RHB A;  5GZZ B;  3TKP A;  1PQN A;  1YF0 A;  1XCC A;  1PD2 1;  3DVW A;  1U3I A;  2DIY A;  3DXB A;  2O85 A;  2I1U A;  1PA3 A;  5IMF A;  4QL9 A;  1Z6N A;  3FR3 A;  5IM9 A;  3VFI A;  5CRE A;  3TJF A;  3US3 A;  1UC7 A;  3QFA C;  3N9J A;  1ON4 A;  1XWA A;  1GSU A;  3L9V A;  1XWG A;  2V32 A;  1AQX A;  3QAG A;  5ID2 A;  1WIK A;  1YDK A;  2N5A A;  5HFI A;  3PH9 A;  3C71 A;  1S3A A;  1BG5 A;  5IMD A;  2VM1 A;  2N5B A;  2H6Z A;  1GNE A;  3RPP A;  1K0A A;  3E3E A;  2JZS A;  5KN0 A;  4GQC A;  3RHC A;  5E4W A;  5IMA A;  2VM2 A;  2YCD A;  4CDO A;  1GUK A;  3S9F A;  1EGO A;  2LNS A;  1QFN A;  5F05 A;  4IGJ A;  4E8H A;  2YN1 A;  2OE3 A;  1T8E B;  2VCQ A;  2J23 A;  1OKT A;  2FNO A;  2R5G A;  4NWY A;  2KOK A;  2GLR A;  1HYU A;  1ILO A;  3HHV A;  4OO5 A;  3BCI A;  4NV2 A;  2C80 A;  3GA4 A;  1TP9 A;  3TKS A;  1A0F A;  1YJ6 A;  3GYK A;  3HJP A;  1FAA A;  4FO5 A;  2PPT A;  4KA0 A;  1EOG A;  4IEL A;  4I2U A;  2WDU A;  2EIO A;  3VK9 A;  1GP1 A;  2DBC A;  4IW9 A;  4EXJ A;  2C3N A;  1GSY A;  1GLP A;  4V1A p;  1VRS D;  3DD3 A;  5J5N A;  4ML1 A;  2JAD A;  1CQG A;  5F07 A;  4IQA A;  19GS A;  2A4V A;  2IME A;  2OAC A;  2LJR A;  1N2A A;  4G2E A;  2RII A;  4J2F A;  4WBJ A;  1LJR A;  2OAD A;  3DWV A;  5COH A;  2WFC A;  4PQ1 A;  4D73 A;  2DJJ A;  1VF3 A;  4KAE A;  3APQ A;  2Z9S A;  3CBU A;  4L0W A;  3D5J A;  4KND A;  1SEN A;  1B4P A;  3VWW A;  2DIZ A;  3GMF A;  4X43 A;  2B1K A;  5ECS A;  3WGX A;  4BPY A;  2F9S A;  2X8C A;  4ISD A;  5HR1 A;  2JL4 A;  1XW5 A;  2CT6 A;  1QXH A;  2VL9 A;  1WE0 A;  5HFK A;  3LSZ A;  4RI7 A;  2PN8 A;  1B9Y C;  2CVK A;  2H8L A;  3DML A;  3IK7 A;  20GS A;  4IJI A;  5JCU A;  3VUR A;  1GNW A;  1AQW A;  1YY7 A;  4O92 A;  3ZFL A;  5C00 A;  2IMF A;  1FVJ A;  4GXZ A;  2WB9 A;  2VUP A;  5JCG A;  5KN2 A;  2IFQ A;  4FYU A;  1O7U A;  4K7N A;  4HU9 A;  3TJK A;  1R5P A;  2GQL A;  2LKU A;  2L57 A;  1DUG A;  1G6W A;  1UN2 A;  3W8S A;  1F3B A;  1GSD A;  4TR3 A;  2FUG 2;  3TKR A;  4IP1 A;  1YKC A;  2P0G A;  4ZB9 A;  4BVY A;  2L5L A;  3WGE A;  2E2G A;  3GX0 A;  2VO4 A;  2MZC A;  2QGV A;  2AB6 A;  3KTB A;  2VOC A;  2HT9 A;  2FCH A;  4IHU A;  3IV4 A;  5JWQ B;  1V57 A;  2GSR A;  3F4T A;  4PUF C;  1XVW A;  1XWB A;  2MMN A;  4MA9 A;  1SJZ A;  3QOU A;  2FA8 A;  2EC4 A;  5KEJ A;  3TJJ A;  2C0D A;  4CHS A;  4FIW A;  3ZML A;  1THO A;  3GTU A;  2MBS A;  5AIV A;  4FH8 A;  4I8B A;  2LV3 A;  3JCM L;  1EV9 A;  3HVV A;  2IMI A;  1GTA A;  4AJ7 A;  2GGT A;  3TOU A;  4MZB A;  1AUC A; 
#chains in the Genus database with same CATH topology
 2A2R A;  1ERW A;  2CQ9 A;  3GV1 A;  3H8Q A;  4K0G A;  3VWU A;  4MF7 A;  2E0Q A;  2DJ1 A;  3HJM A;  4K5S A;  5A4W A;  2R4V A;  1GTI A;  1PGT A;  3GL5 A;  4ULX A;  5CP1 A;  4KGI A;  4YKF A;  1M7T A;  4OO4 A;  4K5R A;  3EMX A;  3FY7 A;  4HJM A;  3VPQ A;  4EF0 A;  4ZIL A;  2L6D A;  4JR4 A;  5IO2 A;  2NBS A;  2H01 A;  2CV4 A;  1PFO A;  4F2I A;  3DEX A;  2HNL A;  5IPH A;  1ZYP A;  3FR9 A;  3EE2 A;  2VD0 A;  4HDE A;  1OVN A;  2ZUP A;  4NMU A;  1PX6 A;  4L5O A;  5DDL A;  2WJU A;  2P5Q A;  1X9M B;  1E6B A;  1Q4J A;  4PNF A;  4KE3 A;  3VI7 A;  5BMU A;  1FB0 A;  2IJY A;  3QAW A;  1EWX A;  2IWT A;  2YPM A;  2H70 A;  4CY6 A;  3IHQ A;  1TKD B;  3A2W A;  5ECL B;  3IAM 2;  2PU9 C;  1GWC A;  2TRC P;  4G19 A;  3UEM A;  2CA8 A;  1LU4 A;  2X49 A;  4Z2T A;  4GRF A;  1FG4 A;  1TI3 A;  3BCK A;  2K18 A;  5DCG A;  4IS0 A;  1THX A;  4PUR A;  3HCZ A;  4TRX A;  1YZX A;  2L59 A;  3M3M A;  4XS1 A;  4XCS A;  4PGT A;  3E0U A;  2C4J A;  2VLU A;  4WR4 A;  2AJQ B;  2LNT A;  4RQX A;  5GAP D;  1A2M A;  3P90 A;  5DAL B;  2IN3 A;  3WT1 A;  1F2E A;  2GZY A;  5L71 A;  1JFU A;  1A23 A;  1H4O A;  2PVQ A;  1XOB A;  1M0U A;  1A0R P;  2OBI A;  3KZQ A;  3A2V A;  2CZ2 A;  1BYE A;  3BBY A;  4N0V A;  5H5Q A;  3FR6 A;  2K8S A;  4GSN A;  4MJA A;  1SYR A;  1LBK A;  2L4Q A;  1XOA A;  2H76 A;  3CMI A;  1TK8 B;  3EMP A;  4LA1 A;  4MZC A;  1SKS B;  2AYT A;  1WWJ A;  7GSS A;  4PNG A;  1GH2 A;  2FWH A;  1F9M A;  1T00 A;  2R0P A;  1SK0 A;  1JLV A;  2L6C A;  1BQ7 A;  2OE0 A;  4TXO B;  5FHI A;  1VF4 A;  2GT5 A;  2PMT A;  2DML A;  1Z3E A;  3TKS E;  2H74 A;  2VCX A;  4BIK A;  1X9W B;  2HE3 A;  2H6X A;  1Z7R A;  1XG8 A;  4ZL7 A;  3CRU A;  3F3R A;  3O76 A;  3O6T A;  3L9U A;  1U6T A;  3VWV A;  3F4R A;  3TJG A;  1SL1 B;  3HKR A;  5INY A;  1EGR A;  4EC0 A;  1EP7 A;  4MJE A;  2K6V A;  1I9D A;  3RBT A;  5ECN B;  3MWH A;  3I69 A;  1EOH A;  1ZYN A;  1ZCP A;  4N30 A;  4EL1 A;  4DSS B;  2QA1 A;  4HUA A;  3HXS A;  5D73 A;  3DRN A;  2AAW A;  2AHE A;  4HS1 A;  2DJ2 A;  1YQ1 A;  4YQV A;  1WP0 A;  3HZ4 A;  2M46 A;  1F3A A;  3DGQ A;  2HFD A;  4KUN A;  3UIW A;  1YKA A;  2QKE A;  2WS2 A;  10GS A;  4TR1 B;  5DQS A;  4EUY A;  5F06 A;  1N8J A;  4JU5 A;  3Q19 A;  1Y6E A;  5IOX A;  1T4Y A;  2HZE A;  9GSS A;  3NZN A;  1FHE A;  3D4M A;  1SJI A;  2NVL A;  5GSS A;  3GKK A;  3ZYW A;  2M72 A;  4POK A;  2GZZ A;  1PN9 A;  3HD5 A;  3W8J A;  2B5E A;  4YAP A;  2C0G A;  4F03 A;  1AXD A;  2TRX A;  3WGD A;  3FZ9 A;  4N11 A;  5D93 A;  5G1K A;  3VI5 A;  4JBB A;  4V2M A;  5D96 A;  5HR3 A;  2LQO A;  4PQI A;  5DVB A;  2DMM A;  3KM6 A;  4N10 A;  5D9T A;  3FK8 A;  2R0G A;  4HOJ A;  4K6X A;  4ZBA A;  2RM6 A;  4MH3 A;  5A4U A;  1C72 A;  3TUE A;  1O81 A;  4Z7X A;  2ZNM A;  5G1L A;  2PBJ A;  3WD6 A;  2GT6 A;  1DSB A;  3P8W A;  1UVZ A;  1ZMA A;  2H0G A;  1RQM A;  1GUM A;  3ZIT A;  2ON5 A;  1NW2 A;  1BED A;  2LEG A;  2B1L A;  1X5E A;  1TJD A;  2I4A A;  3UMA A;  3R2Q A;  3F8U A;  1TK5 B;  5H5R A;  4WXT A;  3GIX A;  1FB6 A;  2E7P A;  3GHA A;  4HU7 A;  1X0R A;  4TOP A;  3A5W A;  1GRX A;  1CQH A;  1V40 A;  4TN8 A;  3DVX A;  3P2A A;  2XHF A;  1VF1 A;  4LLR A;  1M2D A;  1U87 A;  1B4Q A;  1MEK A;  1OC8 A;  2J9H A;  1B9X C;  4V1A g;  4XHM A;  4PX1 A;  3FYG A;  3IHG A;  4I2T A;  1XW9 A;  3MYD A;  1J9B A;  1O8W A;  4XRD A;  3TKQ A;  3IXR A;  1O73 A;  2CAI A;  4JRR A;  1WRY A;  4EIP A;  3A2X A;  4J56 E;  3EU3 A;  2LST A;  3KEB A;  5AIX A;  1G7O A;  2ON7 A;  3HYP A;  3QDN A;  5GST A;  3H4K A;  3LYK A;  3LYP A;  1R7H A;  2RLI A;  1U3A A;  3ZVJ A;  2JSZ A;  2JAC A;  1A2L A;  2H75 A;  1TOF A;  1QUW A;  4AJ8 A;  2ES7 A;  1OE8 A;  2JZT A;  1SK2 A;  3FEU A;  1K0M A;  2EIQ A;  4KDU A;  4POM A;  5JCW A;  4F0B A;  5IO0 A;  1I5G A;  1FO5 A;  4KW6 A;  3KH7 A;  2KP1 A;  4MP4 A;  2HI7 A;  4E8E A;  2FWG A;  3F6D A;  2HRK A;  4JZQ A;  5BRT A;  1XBS A;  2OA7 A;  3ME8 A;  2PGT A;  1JLW A;  1BAY A;  2FHE A;  2V41 A;  5F8B A;  3GUR A;  3IDV A;  1DE2 A;  5ECI B;  1OKD A;  2X4A A;  1R4W A;  3ZRD A;  3QMX A;  4WKW A;  3PGT A;  5E59 A;  3H79 A;  5J41 A;  4POB A;  3ZFB A;  1MDI A;  4PXO A;  1SK1 A;  2MBT A;  4BL7 A;  2IL3 A;  1ACV A;  3GRX A;  1U88 A;  4ML6 A;  2O89 A;  4AF2 A;  2IPA A;  4NXI A;  3M8N A;  1GLQ A;  4MPF A;  3TGZ A;  2V6K A;  1QMV A;  5G5F A;  3EIN A;  3F0I A;  1S3D A;  3I43 A;  3ERG A;  3QCP A;  2DKI A;  3HDC A;  2C1Y A;  4BVX A;  3ZIV A;  5FWG A;  3EVI A;  1KBN A;  3D0Z A;  1W4V A;  3M0F A;  2CVD A;  1QQ2 A;  2OE1 A;  2C8U A;  3KP9 A;  2A2P A;  3HVS A;  3CRT A;  4V2L A;  4XIH A;  3WT2 A;  1XWK A;  2X8H A;  3M9J A;  6GSU A;  1A8L A;  2DLX A;  2H6Y A;  3GN3 A;  5ECO B;  2WZ9 A;  1GUH A;  5DCH A;  3TRP A;  1KNG A;  2VL2 C;  4HEA 2;  3IC4 A;  4LMW A;  3EWL A;  3IOS A;  3BOA A;  4ID0 A;  4AJ6 A;  4K0N A;  3KP8 A;  4IQ1 A;  3F4S A;  3TRX A;  4KB3 A;  1O8X A;  4KDX A;  2GSS A;  2H1A A;  3MDK A;  4YAV A;  2GSQ A;  2GDR A;  18GS A;  3RAZ A;  5A4V A;  4Z2R A;  3ERW A;  4ZBD A;  3G7I A;  3EUR A;  3ZZX A;  2F8F A;  3Q74 A;  3KTL A;  2GQK A;  2JSY A;  2G0F A;  2M80 A;  5J9C A;  2UZ8 A;  2IIY A;  3GUS A;  5LCZ A;  1NHY A;  4ZBB A;  5B7C A;  5IMZ A;  2L5O A;  4PUA A;  3FZ4 A;  5G31 A;  2QC7 A;  4ZXG A;  4X0X A;  5G5E A;  16GS A;  1XIY A;  5HQP A;  2HRA A;  2R2J A;  1GSE A;  2C3Q A;  1TRV A;  4OFT A;  5B6N A;  2V1M A;  4TKY A;  1KTE A;  1PX7 A;  1T7P B;  3VWX A;  11GS A;  4KCE A;  5DJM A;  1WJK A;  1ABA A;  4OCF A;  3FHK A;  5ELA A;  2RUE A;  5F0G A;  1FVK A;  1W89 A;  1XZO A;  5JWR B;  3TB2 A;  5ECP B;  4RI6 A;  4ZB6 A;  1OE7 A;  2QA2 A;  4KDY A;  2BMX A;  3GH6 A;  2RUF A;  3FZ5 A;  3HJO A;  2YV9 A;  2ALB A;  4LL1 B;  2KP2 A;  8GSS A;  1B48 A;  5EPF A;  3L9S A;  2KLX A;  2LRT A;  2BTO T;  4WBR D;  4JR6 A;  2LJA A;  4K7O A;  4GLT A;  3ZTL A;  2N5F A;  4KSO A;  3LG6 A;  1ZYE A;  5A5K A;  1O6J A;  1TDI A;  2LTK A;  4ECJ A;  1A24 A;  3I6A A;  2WUL A;  3LGC A;  2YOI A;  5DAK B;  3IR4 A;  4XS4 B;  1QK8 A;  1XVQ A;  1XXU A;  1VF2 A;  4L8E A;  5HR0 A;  2LS5 A;  3IE3 A;  1PL1 A;  2LQQ A;  3UJ1 A;  4DSQ A;  1E2Y A;  1EV4 A;  5ECM B;  2HLS A;  1GSF A;  1Z5Y E;  3ZIJ A;  3APO A;  1DE1 A;  3N5O A;  1VGL A;  3WYW A;  2NDO A;  4YKG A;  1WPI A;  3LOR A;  3P7X A;  1WOU A;  6GST A;  3C73 A;  2NPB A;  4AGS A;  2H19 A;  5DAL A;  2KUC A;  2F8A A;  2F3M A;  4EO3 A;  1ZL9 A;  2B5Y A;  2R0C A;  3U6V A;  1M9A A;  2DJ3 A;  3TOT A;  3J7Y k;  3D22 A;  5HFG A;  4TXV A;  4ECB A;  5DJL A;  4O7H A;  3L0H A;  4WR5 A;  1TK0 B;  2EIR A;  3LFL A;  3CYN A;  1M2A A;  1H75 A;  3GKM A;  2DJK A;  1M2B A;  2LRC A;  3TJB A;  1Z7P A;  3DIE A;  5D9V A;  3IPZ A;  4HJ2 A;  22GS A;  2VLT A;  4I97 A;  1FW1 A;  6GSX A;  4QL7 A;  3IRA A;  2PUK C;  4WF5 A;  5KOW A;  2R37 A;  4MF5 A;  4TXO A;  2GQM A;  2C0E A;  4FYB A;  2C3T A;  1IYH A;  4BA7 A;  2H66 A;  2GZP A;  2X64 A;  5EL8 A;  2P5R A;  1GSS A;  2NTO A;  3R3E A;  1MDK A;  1Y25 A;  3LXZ A;  4I6X A;  4QQ7 A;  4WF4 A;  5CAX A;  4IBP A;  1K3L A;  4NHW A;  1HNB A;  2OKA A;  3IAS 2;  1ERT A;  3UBK A;  2CZ3 A;  3MSZ A;  1F37 A;  3K8N A;  5CNW A;  1QGV A;  2PWJ A;  2V6O A;  4K7I A;  2B6M A;  1K0O A;  1OC9 B;  1A8Y A;  4MJC A;  2GST A;  3GNJ A;  5G30 A;  5ECH B;  3DYR A;  1EP8 A;  1S3R A;  2K8V A;  3ERF A;  2CX3 A;  4YQU A;  2LRN A;  3UOM A;  5IQY A;  5AIS A;  5ECQ B;  6GSS A;  3TKS C;  3G9B A;  4DSS A;  1PL2 A;  5B8A A;  2O7K A;  3ZL5 A;  4BWS A;  1K0C A;  1XPV A;  3LWA A;  1K0N A;  4ZL9 A;  1SL2 B;  4IVF A;  3V1W A;  4Q5F A;  2DSA A;  2FWF A;  5D9W A;  2TIR A;  4EE0 A;  3E9J B;  2HYX A;  2GVP A;  4TR1 A;  3LEF A;  1MTC A;  3EYT A;  5ID2 B;  4OWY A;  4P3Y B;  5IPG A;  1EZK A;  1OAZ A;  2C0F A;  2A4H A;  3CQF A;  1AW9 A;  3L78 A;  1JZO A;  3PPU A;  1HD2 A;  1KEB A;  2R3X A;  1J0F A;  3HA9 A;  1GTB A;  2BJX A;  2AUV A;  4HI7 A;  3IK9 A;  1GUL A;  1ST9 A;  3FKF A;  1G7E A;  4L5L A;  4OFN A;  4PTS A;  1NHO A;  1Z6M A;  4ZL8 A;  5FT3 A;  17GS A;  2JZR A;  3SBC A;  1K3O A;  1XWC A;  2AV4 A;  1GTU A;  1M3I A;  1R26 A;  1JZR A;  2XPE A;  1F6M C;  4XRA A;  1OC3 A;  3QAV A;  3GKN A;  4ILF A;  6GSV A;  3MNG A;  1TU8 A;  1V98 A;  4MCU A;  3QR6 A;  3CSH A;  5KN3 A;  4EKZ A;  5J9B A;  3G7J A;  4MH2 A;  4MK3 A;  1TRW A;  3HVN A;  4Q5R A;  4KH7 A;  4DSR A;  2VCZ A;  1EEJ A;  3ZRE A;  3EPT A;  4K1F A;  3ZMK A;  3GST A;  2DJ0 A;  4G0I A;  1AQV A;  3LJR A;  2JU5 A;  4F82 A;  4XS6 A;  1YF1 A;  2FGX A;  2YV7 A;  1USB A;  5D9X A;  2MMO A;  4ACS A;  2H1B A;  2B7K A;  2MMA A;  5JWO B;  3GX8 A;  1G6Y A;  2A2S A;  1PN0 A;  3OR5 A;  2F51 A;  2FY6 A;  3O3T A;  4KCA A;  3CSI A;  3NOF A;  2O8V B;  4D73 B;  2X8G A;  2H0H A;  2KHP A;  4HQZ A;  1ZGN A;  1AAZ A;  2B5X A;  3VPT A;  3ME7 A;  1SKW B;  4MLY A;  5ABR A;  2I3Y A;  1G0T A;  1TU7 A;  2V2G A;  1XW6 A;  1SJ6 A;  2VL3 A;  2VAF A;  2IMK A;  3M1G A;  2LJK A;  1SU9 A;  5G2Z A;  1HNC A;  3UBL A;  3DKS A;  2HZF A;  2HSY A;  1PKZ A;  4TR4 A;  2IFQ B;  3CSJ A;  5C04 A;  2FD3 A;  1XFL A;  3A3T A;  4EDZ A;  5IMC A;  2G2Q A;  1FOV A;  4HZ4 A;  1UA5 A;  4G9H A;  4BVY B;  2GTU A;  1X5C A;  2YNX A;  4K8M A;  5B6M A;  4FYC A;  4KSM A;  5CRH A;  3FMW A;  3HY2 A;  2K9F A;  2XBI A;  2YWO A;  3KXO A;  4PQH A;  1JZD A;  4J57 E;  3CTF A;  2H30 A;  4EDY A;  2XBQ A;  3U5R E;  1K0B A;  3A5I A;  3VLN A;  2H0I A;  3GTU B;  4GTU A;  2VCV A;  4IJ3 A;  2MYG A;  4Q5Q A;  4ECC A;  2B3S A;  5DBQ A;  1IYI A;  2IMD A;  1S3C A;  2VIM A;  6GSW A;  3HVX A;  4NV5 A;  1B8X A;  3LQ7 A;  1WMJ A;  4OCE A;  3CTG A;  4KF9 A;  3QFB C;  2YZU A;  3UAP A;  3GL3 A;  4MAB A;  5EVO A;  1GL8 A;  4O5Q A;  3GSS A;  3IBH A;  1K3Y A;  4WEY A;  1PRX A;  4FQU A;  2E2M A;  1ZOF A;  3D4T A;  4HQS A;  1V58 A;  4DVC A;  2D2Z A;  2LUS A;  4K2D A;  1A2J A;  1TXX A;  5AGY A;  4F0C A;  2H71 A;  3TCO A;  2CX4 A;  2ZCT A;  4ECI A;  3F6F A;  4O32 A;  4EVM A;  4CW9 A;  3QPM A;  1TTZ A;  2VD1 A;  4OFM A;  2FLS A;  4GF0 A;  2GS3 A;  4X1U A;  4MPG A;  1JZW A;  2WCI A;  4NPB A;  1YEP A;  3I9V 2;  3C1R A;  4LMV A;  3ZLP A;  1EEM A;  5J4U A;  3LXT A;  4GWR A;  2B7J A;  3M9K A;  3AY8 A;  4L0U A;  2XPD A;  1O85 A;  4TVE A;  4Z2U A;  5IOW A;  3LW9 A;  4MMM A;  4K9Z A;  4NAX A;  3J7Y b;  1PMT A;  4A5P A;  3KJY A;  3BJ5 A;  3KGK A;  6GSY A;  3TDG A;  3H93 A;  2YJH A;  3QD9 A;  3KD0 A;  1SD9 A;  4O5R A;  4RQR A;  2VCW A;  2CAQ A;  3GH9 A;  3ISO A;  1T1V A;  1RK4 A;  3TRQ A;  1PSQ A;  3PR8 A;  1ML6 A;  5CRD A;  3KH9 A;  12GS A;  2VL2 A;  3MAK A;  1YEX A;  1NM3 A;  1SL0 B;  5LNK e;  2QSI A;  2PVO C;  1AC1 A;  4HSC X;  3GKX A;  3C1S A;  2L4C A;  2FWE A;  2HSH A;  2VCT A;  2DKH A;  3UL3 A;  3ED3 A;  5CRG A;  1TRS A;  5ECK B;  3D6I A;  4YH2 A;  2HXK A;  3FW2 A;  4IN0 A;  1ERV A;  5D8I A;  4IP6 A;  5DAK A;  1J08 A;  4XS4 A;  1K0D A;  5IMV A;  5ECR B;  2RM5 A;  2X99 A;  2HRF A;  2YAN A;  4KX4 A;  2DC5 A;  2FA4 A;  1X5D A;  1TI1 A;  5CO3 A;  4ZB8 A;  4JED A;  4G0L A;  5HR2 A;  2OJL A;  2MMZ A;  2WGR A;  1TW9 A;  1MD3 A;  1SD8 A;  2VLV A;  3CXG A;  1ERU A;  5EY6 A;  1M9B A;  2YJ7 A;  5ELG A;  4MJB A;  5GAN D;  4F9Z A;  4H86 A;  2HRN A;  2PER A;  5DQY A;  4MZW A;  5B8B A;  3SWL A;  3ZVJ D;  4GSS A;  2R6K A;  4GCI A;  2YP6 A;  5IIZ A;  3KCM A;  1V9W A;  3W6G A;  2HSM A;  3C8E A;  2WRT A;  3KMN A;  2H1G A;  3L4N A;  4RUV A;  4JE1 A;  3D21 A;  4XTS A;  1BJX A;  2H1D A;  1DBY A;  3F3Q A;  2O87 A;  5ENU A;  1ZYQ B;  5CYY A;  3UAR A;  5LD0 A;  1SKR B;  2XC2 A;  5J3R A;  4EIQ A;  1OYJ A;  2YZH A;  3G7Y A;  3HZ8 A;  4IKH A;  3EC3 A;  4YQM A;  4OD7 A;  2YWN A;  4LL4 B;  3UVT A;  4ZIJ A;  4POL A;  2YWI A;  1T4Z A;  2OBK A;  4MNN A;  2I9H A;  2CVB A;  3Q6O A;  4O5U A;  5KN1 A;  3KMO A;  1PKW A;  1GSQ A;  4BWQ A;  4K2X A;  4V2N A;  4GST A;  3GFK A;  2HZE B;  5AN1 A;  2YWM A;  4NHZ A;  1X9S B;  2P31 A;  1JHB A;  3Q18 A;  3H1N A;  3F9U A;  4TR0 A;  4MF6 A;  4Q5N A;  3F63 A;  1V2A A;  2H73 A;  3PIN A;  5CRW A;  4HZ2 A;  1MD4 A;  1RW1 A;  2H72 A;  4MDC A;  3APS A;  1M99 A;  1R5A A;  3C7M A;  1NSW A;  1TRU A;  3FZA A;  4OMV A;  3BD2 A;  1AIU A;  2REM A;  3KIJ A;  4I5Q A;  1T3B A;  3NIV A;  4DEJ A;  1URM A;  3EU4 A;  1OC9 A;  1SYX A;  3RDW A;  4G10 A;  1Q98 A;  4GQF A;  1HQO A;  3IA1 A;  14GS A;  3RPN A;  1ZZY A;  1MDJ A;  13GS A;  4TW5 A;  3FRC A;  1Z9H A;  1HNA A;  3UVH A;  4WET A;  5H5S A;  2I81 A;  1BX9 A;  4N0Z A;  3RHB A;  5GZZ B;  3TKP A;  1PQN A;  1YF0 A;  1XCC A;  1PD2 1;  3DVW A;  1U3I A;  2DIY A;  3DXB A;  2O85 A;  2I1U A;  1PA3 A;  5IMF A;  4QL9 A;  1Z6N A;  3FR3 A;  5IM9 A;  3VFI A;  5CRE A;  3TJF A;  3US3 A;  4X4J A;  1UC7 A;  3QFA C;  3N9J A;  1ON4 A;  1XWA A;  1GSU A;  3L9V A;  1XWG A;  2V32 A;  1AQX A;  3QAG A;  5ID2 A;  1WIK A;  1YDK A;  2N5A A;  5HFI A;  3PH9 A;  3C71 A;  1S3A A;  1BG5 A;  5IMD A;  2VM1 A;  2N5B A;  2H6Z A;  1GNE A;  3RPP A;  1K0A A;  3E3E A;  2JZS A;  5KN0 A;  4GQC A;  3RHC A;  5E4W A;  5IMA A;  2VM2 A;  2YCD A;  4CDO A;  1GUK A;  3S9F A;  1EGO A;  2LNS A;  1QFN A;  5F05 A;  4IGJ A;  4E8H A;  2YN1 A;  2OE3 A;  1M3J A;  1T8E B;  2VCQ A;  2J23 A;  1OKT A;  2FNO A;  2R5G A;  4NWY A;  2KOK A;  2GLR A;  1HYU A;  1ILO A;  3HHV A;  4OO5 A;  3BCI A;  4NV2 A;  2C80 A;  3GA4 A;  1TP9 A;  3TKS A;  1A0F A;  1YJ6 A;  3GYK A;  4G0K A;  3HJP A;  1FAA A;  4FO5 A;  2PPT A;  4KA0 A;  1EOG A;  4IEL A;  4I2U A;  2WDU A;  2EIO A;  4USS A;  3VK9 A;  1GP1 A;  2DBC A;  4IW9 A;  4EXJ A;  2C3N A;  1GSY A;  1GLP A;  4V1A p;  1VRS D;  3DD3 A;  5J5N A;  4ML1 A;  2JAD A;  1CQG A;  5F07 A;  4IQA A;  19GS A;  2A4V A;  2IME A;  2OAC A;  3IC8 A;  2LJR A;  1N2A A;  4G2E A;  2RII A;  4J2F A;  4WBJ A;  1LJR A;  2OAD A;  3DWV A;  5COH A;  2WFC A;  4PQ1 A;  4D73 A;  2DJJ A;  1VF3 A;  4KAE A;  4BL7 B;  3APQ A;  2Z9S A;  4CY8 A;  3CBU A;  4L0W A;  3D5J A;  4KND A;  1SEN A;  1B4P A;  3VWW A;  2DIZ A;  3GMF A;  4X43 A;  2B1K A;  5ECS A;  3WGX A;  4BPY A;  2F9S A;  2X8C A;  4ISD A;  5HR1 A;  2JL4 A;  1XW5 A;  2CT6 A;  1QXH A;  2VL9 A;  1WE0 A;  5HFK A;  4BVX B;  3LSZ A;  4RI7 A;  2PN8 A;  1B9Y C;  2CVK A;  2H8L A;  3DML A;  3IK7 A;  20GS A;  4IJI A;  5JCU A;  3VUR A;  1GNW A;  1AQW A;  1YY7 A;  4O92 A;  3ZFL A;  5C00 A;  2IMF A;  1FVJ A;  4GXZ A;  2WB9 A;  2VUP A;  5JCG A;  5KN2 A;  2IFQ A;  4FYU A;  4K7N A;  1O7U A;  4HU9 A;  3TJK A;  1R5P A;  2GQL A;  2LKU A;  2L57 A;  1DUG A;  1G6W A;  1UN2 A;  1FOH A;  3W8S A;  1F3B A;  1GSD A;  4TR3 A;  2FUG 2;  3TKR A;  4IP1 A;  1YKC A;  2P0G A;  4ZB9 A;  4BVY A;  2L5L A;  3WGE A;  2E2G A;  3GX0 A;  2VO4 A;  2MZC A;  2QGV A;  2AB6 A;  3KTB A;  2VOC A;  2HT9 A;  2FCH A;  4IHU A;  3IV4 A;  5JWQ B;  1V57 A;  2GSR A;  3F4T A;  4PUF C;  1XVW A;  1XWB A;  2MMN A;  5KOX A;  4MA9 A;  1SJZ A;  3QOU A;  2FA8 A;  2EC4 A;  5KEJ A;  3TJJ A;  2C0D A;  4CHS A;  4FIW A;  3ZML A;  1THO A;  3GTU A;  2MBS A;  5AIV A;  4FH8 A;  4I8B A;  2LV3 A;  3JCM L;  1EV9 A;  4ICY A;  3MIX A;  3HVV A;  2IMI A;  1GTA A;  4AJ7 A;  2GGT A;  3TOU A;  4MZB A;  1AUC A; 
#chains in the Genus database with same CATH homology
 2A2R A;  1ERW A;  2CQ9 A;  3GV1 A;  3H8Q A;  4K0G A;  3VWU A;  4MF7 A;  2E0Q A;  2DJ1 A;  3HJM A;  4K5S A;  5A4W A;  2R4V A;  1GTI A;  1PGT A;  3GL5 A;  4ULX A;  5CP1 A;  4KGI A;  4YKF A;  1M7T A;  4OO4 A;  4K5R A;  3EMX A;  3FY7 A;  4HJM A;  3VPQ A;  4EF0 A;  4ZIL A;  2L6D A;  4JR4 A;  5IO2 A;  2NBS A;  2H01 A;  2CV4 A;  4F2I A;  3DEX A;  2HNL A;  5IPH A;  1ZYP A;  3FR9 A;  3EE2 A;  2VD0 A;  4HDE A;  1OVN A;  2ZUP A;  4NMU A;  1PX6 A;  4L5O A;  5DDL A;  2WJU A;  2P5Q A;  1X9M B;  1E6B A;  1Q4J A;  4PNF A;  4KE3 A;  3VI7 A;  5BMU A;  1FB0 A;  2IJY A;  3QAW A;  1EWX A;  2IWT A;  2YPM A;  2H70 A;  4CY6 A;  3IHQ A;  1TKD B;  3A2W A;  5ECL B;  3IAM 2;  2PU9 C;  1GWC A;  2TRC P;  4G19 A;  3UEM A;  2CA8 A;  1LU4 A;  2X49 A;  4Z2T A;  4GRF A;  1FG4 A;  1TI3 A;  3BCK A;  2K18 A;  5DCG A;  4IS0 A;  1THX A;  4PUR A;  3HCZ A;  4TRX A;  1YZX A;  2L59 A;  3M3M A;  4XS1 A;  4XCS A;  4PGT A;  3E0U A;  2C4J A;  2VLU A;  4WR4 A;  2AJQ B;  2LNT A;  4RQX A;  5GAP D;  1A2M A;  3P90 A;  5DAL B;  2IN3 A;  3WT1 A;  1F2E A;  2GZY A;  5L71 A;  1JFU A;  1A23 A;  1H4O A;  2PVQ A;  1XOB A;  1M0U A;  1A0R P;  2OBI A;  3KZQ A;  3A2V A;  2CZ2 A;  1BYE A;  3BBY A;  4N0V A;  5H5Q A;  3FR6 A;  2K8S A;  4GSN A;  4MJA A;  1SYR A;  1LBK A;  2L4Q A;  1XOA A;  2H76 A;  3CMI A;  1TK8 B;  3EMP A;  4LA1 A;  4MZC A;  1SKS B;  2AYT A;  1WWJ A;  7GSS A;  4PNG A;  1GH2 A;  2FWH A;  1F9M A;  1T00 A;  2R0P A;  1SK0 A;  1JLV A;  2L6C A;  1BQ7 A;  2OE0 A;  4TXO B;  5FHI A;  1VF4 A;  2GT5 A;  2PMT A;  2DML A;  1Z3E A;  3TKS E;  2H74 A;  2VCX A;  1X9W B;  2HE3 A;  2H6X A;  1Z7R A;  4ZL7 A;  3CRU A;  3F3R A;  3O76 A;  3O6T A;  3L9U A;  1U6T A;  3VWV A;  3F4R A;  3TJG A;  1SL1 B;  3HKR A;  5INY A;  1EGR A;  4EC0 A;  1EP7 A;  4MJE A;  2K6V A;  1I9D A;  3RBT A;  5ECN B;  3MWH A;  3I69 A;  1EOH A;  1ZYN A;  1ZCP A;  4N30 A;  4EL1 A;  4DSS B;  2QA1 A;  4HUA A;  5D73 A;  3HXS A;  3DRN A;  2AAW A;  2AHE A;  4HS1 A;  2DJ2 A;  1YQ1 A;  4YQV A;  1WP0 A;  3HZ4 A;  2M46 A;  1F3A A;  3DGQ A;  2HFD A;  4KUN A;  3UIW A;  1YKA A;  2QKE A;  2WS2 A;  10GS A;  4TR1 B;  5DQS A;  4EUY A;  5F06 A;  1N8J A;  4JU5 A;  3Q19 A;  1Y6E A;  5IOX A;  1T4Y A;  2HZE A;  9GSS A;  3NZN A;  1FHE A;  3D4M A;  1SJI A;  2NVL A;  5GSS A;  3GKK A;  3ZYW A;  2M72 A;  4POK A;  2GZZ A;  1PN9 A;  3HD5 A;  3W8J A;  2B5E A;  4YAP A;  2C0G A;  4F03 A;  1AXD A;  2TRX A;  3WGD A;  3FZ9 A;  4N11 A;  5D93 A;  5G1K A;  3VI5 A;  4JBB A;  4V2M A;  5D96 A;  5HR3 A;  2LQO A;  4PQI A;  5DVB A;  2DMM A;  3KM6 A;  4N10 A;  5D9T A;  3FK8 A;  2R0G A;  4HOJ A;  4K6X A;  4ZBA A;  2RM6 A;  4MH3 A;  5A4U A;  1C72 A;  3TUE A;  1O81 A;  4Z7X A;  2ZNM A;  5G1L A;  2PBJ A;  3WD6 A;  2GT6 A;  1DSB A;  3P8W A;  1UVZ A;  1ZMA A;  2H0G A;  1RQM A;  1GUM A;  3ZIT A;  2ON5 A;  1NW2 A;  1BED A;  2LEG A;  2B1L A;  1X5E A;  1TJD A;  2I4A A;  3UMA A;  3R2Q A;  3F8U A;  1TK5 B;  5H5R A;  4WXT A;  3GIX A;  1FB6 A;  2E7P A;  3GHA A;  4HU7 A;  1X0R A;  4TOP A;  3A5W A;  1GRX A;  1CQH A;  1V40 A;  4TN8 A;  3DVX A;  3P2A A;  2XHF A;  1VF1 A;  4LLR A;  1M2D A;  1U87 A;  1B4Q A;  1MEK A;  1OC8 A;  2J9H A;  1B9X C;  4V1A g;  4XHM A;  4PX1 A;  3FYG A;  3IHG A;  4I2T A;  1XW9 A;  3MYD A;  1J9B A;  1O8W A;  4XRD A;  3TKQ A;  3IXR A;  1O73 A;  2CAI A;  4JRR A;  1WRY A;  4EIP A;  3A2X A;  4J56 E;  3EU3 A;  2LST A;  3KEB A;  5AIX A;  1G7O A;  2ON7 A;  3HYP A;  3QDN A;  5GST A;  3H4K A;  3LYK A;  3LYP A;  1R7H A;  2RLI A;  1U3A A;  3ZVJ A;  2JSZ A;  2JAC A;  1A2L A;  2H75 A;  1TOF A;  1QUW A;  4AJ8 A;  2ES7 A;  1OE8 A;  2JZT A;  1SK2 A;  3FEU A;  1K0M A;  2EIQ A;  4KDU A;  4POM A;  5JCW A;  4F0B A;  5IO0 A;  1I5G A;  1FO5 A;  4KW6 A;  3KH7 A;  2KP1 A;  4MP4 A;  2HI7 A;  4E8E A;  2FWG A;  3F6D A;  2HRK A;  4JZQ A;  5BRT A;  1XBS A;  2OA7 A;  3ME8 A;  2PGT A;  1JLW A;  1BAY A;  2FHE A;  2V41 A;  5F8B A;  3GUR A;  3IDV A;  1DE2 A;  5ECI B;  1OKD A;  2X4A A;  1R4W A;  3ZRD A;  3QMX A;  4WKW A;  3PGT A;  5E59 A;  3H79 A;  5J41 A;  4POB A;  3ZFB A;  1MDI A;  4PXO A;  1SK1 A;  2MBT A;  4BL7 A;  2IL3 A;  1ACV A;  3GRX A;  1U88 A;  4ML6 A;  2O89 A;  4AF2 A;  2IPA A;  4NXI A;  3M8N A;  1GLQ A;  4MPF A;  3TGZ A;  2V6K A;  1QMV A;  5G5F A;  3EIN A;  3F0I A;  1S3D A;  3I43 A;  3ERG A;  3QCP A;  2DKI A;  3HDC A;  2C1Y A;  4BVX A;  3ZIV A;  5FWG A;  3EVI A;  1KBN A;  3D0Z A;  1W4V A;  3M0F A;  2CVD A;  1QQ2 A;  2OE1 A;  2C8U A;  3KP9 A;  2A2P A;  3HVS A;  3CRT A;  4V2L A;  4XIH A;  3WT2 A;  1XWK A;  2X8H A;  3M9J A;  6GSU A;  1A8L A;  2DLX A;  2H6Y A;  3GN3 A;  5ECO B;  2WZ9 A;  1GUH A;  5DCH A;  3TRP A;  1KNG A;  2VL2 C;  4HEA 2;  3IC4 A;  4LMW A;  3EWL A;  3IOS A;  3BOA A;  4ID0 A;  4AJ6 A;  4K0N A;  3KP8 A;  4IQ1 A;  3F4S A;  3TRX A;  4KB3 A;  1O8X A;  4KDX A;  2GSS A;  2H1A A;  3MDK A;  4YAV A;  2GSQ A;  2GDR A;  18GS A;  3RAZ A;  5A4V A;  4Z2R A;  3ERW A;  4ZBD A;  3G7I A;  3EUR A;  3ZZX A;  2F8F A;  3Q74 A;  3KTL A;  2GQK A;  2JSY A;  2G0F A;  2M80 A;  5J9C A;  2UZ8 A;  2IIY A;  3GUS A;  5LCZ A;  1NHY A;  4ZBB A;  5B7C A;  5IMZ A;  2L5O A;  4PUA A;  3FZ4 A;  5G31 A;  2QC7 A;  4ZXG A;  4X0X A;  5G5E A;  16GS A;  1XIY A;  5HQP A;  2HRA A;  2R2J A;  1GSE A;  2C3Q A;  1TRV A;  4OFT A;  5B6N A;  2V1M A;  4TKY A;  1KTE A;  1PX7 A;  1T7P B;  3VWX A;  11GS A;  4KCE A;  5DJM A;  1WJK A;  1ABA A;  4OCF A;  3FHK A;  5ELA A;  2RUE A;  5F0G A;  1FVK A;  1W89 A;  1XZO A;  5JWR B;  3TB2 A;  5ECP B;  4RI6 A;  4ZB6 A;  1OE7 A;  2QA2 A;  4KDY A;  2BMX A;  3GH6 A;  2RUF A;  3FZ5 A;  3HJO A;  2YV9 A;  2ALB A;  4LL1 B;  2KP2 A;  8GSS A;  1B48 A;  5EPF A;  3L9S A;  2KLX A;  2LRT A;  2BTO T;  4WBR D;  4JR6 A;  2LJA A;  4K7O A;  4GLT A;  3ZTL A;  2N5F A;  4KSO A;  3LG6 A;  1ZYE A;  5A5K A;  1O6J A;  1TDI A;  2LTK A;  4ECJ A;  1A24 A;  3I6A A;  2WUL A;  3LGC A;  2YOI A;  5DAK B;  3IR4 A;  4XS4 B;  1QK8 A;  1XVQ A;  1XXU A;  1VF2 A;  4L8E A;  5HR0 A;  2LS5 A;  3IE3 A;  1PL1 A;  2LQQ A;  3UJ1 A;  4DSQ A;  1E2Y A;  1EV4 A;  5ECM B;  2HLS A;  1GSF A;  1Z5Y E;  3ZIJ A;  3APO A;  1DE1 A;  3N5O A;  1VGL A;  3WYW A;  2NDO A;  4YKG A;  1WPI A;  3LOR A;  3P7X A;  1WOU A;  6GST A;  3C73 A;  2NPB A;  4AGS A;  2H19 A;  5DAL A;  2KUC A;  2F8A A;  2F3M A;  4EO3 A;  1ZL9 A;  2B5Y A;  2R0C A;  3U6V A;  1M9A A;  2DJ3 A;  3TOT A;  3J7Y k;  3D22 A;  5HFG A;  4TXV A;  4ECB A;  5DJL A;  4O7H A;  3L0H A;  4WR5 A;  1TK0 B;  2EIR A;  3LFL A;  3CYN A;  1M2A A;  1H75 A;  3GKM A;  2DJK A;  1M2B A;  2LRC A;  3TJB A;  1Z7P A;  3DIE A;  5D9V A;  3IPZ A;  4HJ2 A;  22GS A;  2VLT A;  4I97 A;  1FW1 A;  6GSX A;  4QL7 A;  3IRA A;  2PUK C;  4WF5 A;  5KOW A;  2R37 A;  4MF5 A;  4TXO A;  2GQM A;  2C0E A;  4FYB A;  2C3T A;  1IYH A;  4BA7 A;  2H66 A;  2GZP A;  2X64 A;  5EL8 A;  2P5R A;  1GSS A;  2NTO A;  3R3E A;  1MDK A;  1Y25 A;  3LXZ A;  4I6X A;  4QQ7 A;  4WF4 A;  5CAX A;  4IBP A;  1K3L A;  4NHW A;  1HNB A;  2OKA A;  3IAS 2;  1ERT A;  3UBK A;  2CZ3 A;  3MSZ A;  1F37 A;  3K8N A;  5CNW A;  1QGV A;  2PWJ A;  2V6O A;  4K7I A;  2B6M A;  1K0O A;  1OC9 B;  1A8Y A;  4MJC A;  2GST A;  3GNJ A;  5G30 A;  5ECH B;  3DYR A;  1EP8 A;  2K8V A;  3ERF A;  2CX3 A;  4YQU A;  2LRN A;  3UOM A;  5IQY A;  5AIS A;  5ECQ B;  6GSS A;  3TKS C;  3G9B A;  4DSS A;  1PL2 A;  5B8A A;  2O7K A;  3ZL5 A;  4BWS A;  1K0C A;  1XPV A;  3LWA A;  1K0N A;  4ZL9 A;  1SL2 B;  4IVF A;  3V1W A;  4Q5F A;  2DSA A;  2FWF A;  5D9W A;  2TIR A;  4EE0 A;  3E9J B;  2HYX A;  2GVP A;  4TR1 A;  3LEF A;  1MTC A;  3EYT A;  5ID2 B;  4OWY A;  4P3Y B;  5IPG A;  1EZK A;  1OAZ A;  2C0F A;  2A4H A;  1AW9 A;  3L78 A;  1JZO A;  3PPU A;  1HD2 A;  1KEB A;  2R3X A;  1J0F A;  3HA9 A;  1GTB A;  2BJX A;  2AUV A;  4HI7 A;  3IK9 A;  1GUL A;  1ST9 A;  3FKF A;  1G7E A;  4L5L A;  4OFN A;  4PTS A;  1NHO A;  1Z6M A;  4ZL8 A;  5FT3 A;  17GS A;  2JZR A;  3SBC A;  1K3O A;  1XWC A;  2AV4 A;  1GTU A;  1R26 A;  1JZR A;  2XPE A;  1F6M C;  4XRA A;  1OC3 A;  3QAV A;  3GKN A;  4ILF A;  6GSV A;  3MNG A;  1TU8 A;  1V98 A;  4MCU A;  3QR6 A;  3CSH A;  5KN3 A;  4EKZ A;  5J9B A;  3G7J A;  4MH2 A;  4MK3 A;  1TRW A;  4Q5R A;  4KH7 A;  4DSR A;  2VCZ A;  1EEJ A;  3ZRE A;  3EPT A;  4K1F A;  3ZMK A;  3GST A;  2DJ0 A;  4G0I A;  1AQV A;  3LJR A;  2JU5 A;  4F82 A;  4XS6 A;  1YF1 A;  2FGX A;  2YV7 A;  1USB A;  5D9X A;  2MMO A;  4ACS A;  2H1B A;  2B7K A;  2MMA A;  5JWO B;  3GX8 A;  1G6Y A;  2A2S A;  1PN0 A;  3OR5 A;  2F51 A;  2FY6 A;  3O3T A;  4KCA A;  3CSI A;  3NOF A;  2O8V B;  4D73 B;  2X8G A;  2H0H A;  2KHP A;  4HQZ A;  1ZGN A;  1AAZ A;  2B5X A;  3VPT A;  3ME7 A;  1SKW B;  4MLY A;  5ABR A;  2I3Y A;  1G0T A;  1TU7 A;  2V2G A;  1XW6 A;  1SJ6 A;  2VL3 A;  2VAF A;  2IMK A;  3M1G A;  2LJK A;  1SU9 A;  5G2Z A;  1HNC A;  3UBL A;  3DKS A;  2HZF A;  2HSY A;  1PKZ A;  4TR4 A;  2IFQ B;  3CSJ A;  5C04 A;  2FD3 A;  1XFL A;  3A3T A;  4EDZ A;  5IMC A;  2G2Q A;  1FOV A;  4HZ4 A;  1UA5 A;  4G9H A;  4BVY B;  2GTU A;  1X5C A;  2YNX A;  4K8M A;  5B6M A;  4FYC A;  4KSM A;  5CRH A;  3FMW A;  3HY2 A;  2K9F A;  2XBI A;  2YWO A;  3KXO A;  4PQH A;  1JZD A;  4J57 E;  3CTF A;  2H30 A;  4EDY A;  2XBQ A;  3U5R E;  1K0B A;  3A5I A;  3VLN A;  2H0I A;  3GTU B;  4GTU A;  2VCV A;  4IJ3 A;  2MYG A;  4Q5Q A;  4ECC A;  2B3S A;  5DBQ A;  1IYI A;  2IMD A;  1S3C A;  2VIM A;  6GSW A;  3HVX A;  4NV5 A;  1B8X A;  3LQ7 A;  1WMJ A;  4OCE A;  3CTG A;  4KF9 A;  3QFB C;  2YZU A;  3UAP A;  3GL3 A;  4MAB A;  5EVO A;  1GL8 A;  4O5Q A;  3GSS A;  3IBH A;  1K3Y A;  4WEY A;  1PRX A;  4FQU A;  2E2M A;  1ZOF A;  3D4T A;  4HQS A;  1V58 A;  4DVC A;  2D2Z A;  2LUS A;  4K2D A;  1A2J A;  1TXX A;  5AGY A;  4F0C A;  2H71 A;  3TCO A;  2CX4 A;  2ZCT A;  4ECI A;  3F6F A;  4O32 A;  4EVM A;  4CW9 A;  3QPM A;  1TTZ A;  2VD1 A;  4OFM A;  2FLS A;  4GF0 A;  2GS3 A;  4X1U A;  4MPG A;  1JZW A;  2WCI A;  4NPB A;  1YEP A;  3I9V 2;  3C1R A;  4LMV A;  3ZLP A;  1EEM A;  5J4U A;  3LXT A;  4GWR A;  2B7J A;  3M9K A;  3AY8 A;  4L0U A;  2XPD A;  1O85 A;  4TVE A;  4Z2U A;  5IOW A;  3LW9 A;  4MMM A;  4K9Z A;  4NAX A;  3J7Y b;  1PMT A;  4A5P A;  3KJY A;  3BJ5 A;  3KGK A;  6GSY A;  3TDG A;  3H93 A;  2YJH A;  3QD9 A;  3KD0 A;  1SD9 A;  4O5R A;  4RQR A;  2VCW A;  2CAQ A;  3GH9 A;  3ISO A;  1T1V A;  1RK4 A;  3TRQ A;  1PSQ A;  3PR8 A;  1ML6 A;  5CRD A;  3KH9 A;  12GS A;  2VL2 A;  3MAK A;  1YEX A;  1NM3 A;  1SL0 B;  5LNK e;  2QSI A;  2PVO C;  1AC1 A;  3GKX A;  3C1S A;  2L4C A;  2FWE A;  2HSH A;  2VCT A;  2DKH A;  3UL3 A;  3ED3 A;  5CRG A;  1TRS A;  5ECK B;  3D6I A;  4YH2 A;  2HXK A;  3FW2 A;  4IN0 A;  1ERV A;  5D8I A;  4IP6 A;  5DAK A;  1J08 A;  4XS4 A;  1K0D A;  5IMV A;  5ECR B;  2RM5 A;  2X99 A;  2HRF A;  2YAN A;  4KX4 A;  2DC5 A;  2FA4 A;  1X5D A;  1TI1 A;  5CO3 A;  4ZB8 A;  4JED A;  4G0L A;  5HR2 A;  2OJL A;  2MMZ A;  2WGR A;  1TW9 A;  1MD3 A;  1SD8 A;  2VLV A;  3CXG A;  1ERU A;  5EY6 A;  1M9B A;  2YJ7 A;  5ELG A;  4MJB A;  5GAN D;  4F9Z A;  4H86 A;  2HRN A;  2PER A;  5DQY A;  4MZW A;  5B8B A;  3SWL A;  3ZVJ D;  4GSS A;  2R6K A;  4GCI A;  2YP6 A;  5IIZ A;  3KCM A;  1V9W A;  3W6G A;  2HSM A;  3C8E A;  2WRT A;  3KMN A;  2H1G A;  3L4N A;  4RUV A;  4JE1 A;  3D21 A;  4XTS A;  1BJX A;  2H1D A;  1DBY A;  3F3Q A;  2O87 A;  5ENU A;  1ZYQ B;  5CYY A;  3UAR A;  5LD0 A;  1SKR B;  2XC2 A;  5J3R A;  4EIQ A;  1OYJ A;  2YZH A;  3G7Y A;  3HZ8 A;  4IKH A;  3EC3 A;  4YQM A;  4OD7 A;  2YWN A;  4LL4 B;  3UVT A;  4ZIJ A;  4POL A;  2YWI A;  1T4Z A;  2OBK A;  4MNN A;  2I9H A;  2CVB A;  3Q6O A;  4O5U A;  5KN1 A;  3KMO A;  1PKW A;  1GSQ A;  4BWQ A;  4K2X A;  4V2N A;  4GST A;  3GFK A;  2HZE B;  5AN1 A;  2YWM A;  4NHZ A;  1X9S B;  2P31 A;  1JHB A;  3Q18 A;  3H1N A;  3F9U A;  4TR0 A;  4MF6 A;  4Q5N A;  3F63 A;  1V2A A;  2H73 A;  3PIN A;  5CRW A;  4HZ2 A;  1MD4 A;  1RW1 A;  2H72 A;  4MDC A;  3APS A;  1M99 A;  1R5A A;  3C7M A;  1NSW A;  1TRU A;  3FZA A;  4OMV A;  3BD2 A;  1AIU A;  2REM A;  3KIJ A;  4I5Q A;  1T3B A;  3NIV A;  4DEJ A;  1URM A;  3EU4 A;  1OC9 A;  1SYX A;  3RDW A;  4G10 A;  1Q98 A;  4GQF A;  1HQO A;  3IA1 A;  14GS A;  3RPN A;  1ZZY A;  1MDJ A;  13GS A;  4TW5 A;  3FRC A;  1Z9H A;  1HNA A;  3UVH A;  4WET A;  5H5S A;  2I81 A;  1BX9 A;  4N0Z A;  3RHB A;  5GZZ B;  3TKP A;  1PQN A;  1YF0 A;  1XCC A;  1PD2 1;  3DVW A;  1U3I A;  2DIY A;  3DXB A;  2O85 A;  2I1U A;  1PA3 A;  5IMF A;  4QL9 A;  1Z6N A;  3FR3 A;  5IM9 A;  3VFI A;  5CRE A;  3TJF A;  3US3 A;  4X4J A;  1UC7 A;  3QFA C;  3N9J A;  1ON4 A;  1XWA A;  1GSU A;  3L9V A;  1XWG A;  2V32 A;  1AQX A;  3QAG A;  5ID2 A;  1WIK A;  1YDK A;  2N5A A;  5HFI A;  3PH9 A;  3C71 A;  1S3A A;  1BG5 A;  5IMD A;  2VM1 A;  2N5B A;  2H6Z A;  1GNE A;  3RPP A;  1K0A A;  3E3E A;  2JZS A;  5KN0 A;  4GQC A;  3RHC A;  5E4W A;  5IMA A;  2VM2 A;  2YCD A;  4CDO A;  1GUK A;  3S9F A;  1EGO A;  2LNS A;  1QFN A;  5F05 A;  4IGJ A;  4E8H A;  2YN1 A;  2OE3 A;  1T8E B;  2VCQ A;  2J23 A;  1OKT A;  2FNO A;  2R5G A;  4NWY A;  2KOK A;  2GLR A;  1HYU A;  1ILO A;  3HHV A;  4OO5 A;  3BCI A;  4NV2 A;  2C80 A;  3GA4 A;  1TP9 A;  3TKS A;  1A0F A;  1YJ6 A;  3GYK A;  4G0K A;  3HJP A;  1FAA A;  4FO5 A;  2PPT A;  4KA0 A;  1EOG A;  4IEL A;  4I2U A;  2WDU A;  2EIO A;  4USS A;  3VK9 A;  1GP1 A;  2DBC A;  4IW9 A;  4EXJ A;  2C3N A;  1GSY A;  1GLP A;  4V1A p;  1VRS D;  3DD3 A;  5J5N A;  4ML1 A;  2JAD A;  1CQG A;  5F07 A;  4IQA A;  19GS A;  2A4V A;  2IME A;  2OAC A;  3IC8 A;  2LJR A;  1N2A A;  4G2E A;  2RII A;  4J2F A;  4WBJ A;  1LJR A;  2OAD A;  3DWV A;  5COH A;  2WFC A;  4PQ1 A;  4D73 A;  2DJJ A;  1VF3 A;  4KAE A;  4BL7 B;  3APQ A;  2Z9S A;  4CY8 A;  3CBU A;  4L0W A;  3D5J A;  4KND A;  1SEN A;  1B4P A;  3VWW A;  2DIZ A;  3GMF A;  4X43 A;  2B1K A;  5ECS A;  3WGX A;  4BPY A;  2F9S A;  2X8C A;  4ISD A;  5HR1 A;  2JL4 A;  1XW5 A;  2CT6 A;  1QXH A;  2VL9 A;  1WE0 A;  5HFK A;  4BVX B;  3LSZ A;  4RI7 A;  2PN8 A;  1B9Y C;  2CVK A;  2H8L A;  3DML A;  3IK7 A;  20GS A;  4IJI A;  5JCU A;  3VUR A;  1GNW A;  1AQW A;  1YY7 A;  4O92 A;  3ZFL A;  5C00 A;  2IMF A;  1FVJ A;  4GXZ A;  2WB9 A;  2VUP A;  5JCG A;  5KN2 A;  2IFQ A;  4FYU A;  4K7N A;  1O7U A;  4HU9 A;  3TJK A;  1R5P A;  2GQL A;  2LKU A;  2L57 A;  1DUG A;  1G6W A;  1UN2 A;  1FOH A;  3W8S A;  1F3B A;  1GSD A;  4TR3 A;  2FUG 2;  3TKR A;  4IP1 A;  1YKC A;  2P0G A;  4ZB9 A;  4BVY A;  2L5L A;  3WGE A;  2E2G A;  3GX0 A;  2VO4 A;  2MZC A;  2QGV A;  2AB6 A;  3KTB A;  2VOC A;  2HT9 A;  2FCH A;  4IHU A;  3IV4 A;  5JWQ B;  1V57 A;  2GSR A;  3F4T A;  4PUF C;  1XVW A;  1XWB A;  2MMN A;  5KOX A;  4MA9 A;  1SJZ A;  3QOU A;  2FA8 A;  2EC4 A;  5KEJ A;  3TJJ A;  2C0D A;  4CHS A;  4FIW A;  3ZML A;  1THO A;  3GTU A;  2MBS A;  5AIV A;  4FH8 A;  4I8B A;  2LV3 A;  3JCM L;  1EV9 A;  4ICY A;  3MIX A;  3HVV A;  2IMI A;  1GTA A;  4AJ7 A;  2GGT A;  3TOU A;  4MZB A;  1AUC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...