1ERVA

Human thioredoxin mutant with cys 73 replaced by ser (reduced form)
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
105
structure length
105
Chain Sequence
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKSMPTFQFFKKGQKVGEFSGANKEKLEATINELV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THIOREDOXIN
publication title Crystal structures of reduced, oxidized, and mutated human thioredoxins: evidence for a regulatory homodimer.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 39
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 1996-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1ervA00
2YZHA 1TRWA 1PKZA 3CSIA 2R37A 2VM1A 3EMPA 1GSYA 3TOUA 2C0EA 4CW9A 1R5PA 4GQFA 2F8FA 1FB6A 2TRCP 1AW9A 3FYGA 3KGKA 3LWAA 3IAM2 5HQPA 1Z9HA 2V32A 1YQ1A 2VL3A 2I4AA 1T7PB 18GSA 3FR9A 5CRDA 3HYPA 1GSDA 1VRSD 2FUG2 2F8AA 2JL4A 3ME7A 5IMFA 5EL8A 2P5RA 2BMXA 5G5EA 1OC9A 1XXUA 2K18A 2L59A 1Q4JA 2GVPA 2CZ3A 1WMJA 3BCKA 1EGRA 3VURA 4F82A 3F4TA 4N10A 4YQMA 3E0UA 3F4SA 4MZBA 3U6VA 1Y25A 1VGLA 4ZB6A 1A0FA 3GIXA 4KE3A 3TGZA 1NHOA 3UAPA 2I81A 1BG5A 1G0TA 2HZEB 1XWBA 3KCMA 4X1UA 1Y6EA 3M8NA 2LRTA 4MK3A 1XZOA 4NHWA 4OFNA 3FZAA 2LSTA 2E7PA 1OKDA 2HRFA 2GLRA 5EPFA 2C0DA 2RUEA 2VL2A 3IOSA 5DBQA 3UBKA 2LQQA 5AGYA 2L6CA 4KDXA 5CRHA 4ECCA 2P31A 4X43A 4HUAA 3KMNA 2X8CA 4NXIA 1U6TA 2GQKA 1TI3A 3ZIVA 1SENA 2F51A 5J5NA 1PL1A 1VF4A 1V98A 1OAZA 3TUEA 2R5GA 5DCHA 5D93A 3CYNA 4EO3A 5LCZA 4DSSB 4K8MA 2E2GA 3QD9A 2AUVA 3NZNA 3ZMKA 1QQ2A 3QOUA 3TKQA 1QK8A 1Q98A 5C04A 2K8VA 2VCTA 4TR1A 2C80A 1F2EA 4KSMA 4FIWA 3TKPA 4G19A 4GQCA 1GTUA 1XW6A 5DVBA 2FD3A 3Q18A 3DIEA 1WIKA 5IPHA 1SYRA 3H93A 4O92A 1FOVA 4GSTA 1AQXA 3D4TA 3IHQA 3RHBA 5HFGA 3F3RA 1NSWA 3HJPA 2LJKA 2B5EA 2B3SA 2REMA 3I69A 3DD3A 2V1MA 3UJ1A 4POBA 1K0OA 1AIUA 4TKYA 3IDVA 1EEMA 1HYUA 1Z7PA 4KX4A 1ERVA 4LLRA 2LUSA 1MTCA 2VCZA 2WCIA 1WWJA 1B4PA 1OE7A 1PX7A 1Z5YE 2MYGA 2VCVA 4HZ4A 3LSZA 4XS6A 3IK7A 4P3YB 2OBIA 4I97A 2F3MA 5FT3A 5JWOB 2JADA 2LKUA 5KN3A 2HNLA 3GTUB 2FCHA 2CVKA 2YZUA 2H19A 2KP2A 5IIZA 2H0HA 4I8BA 2PPTA 1SU9A 3FZ5A 1KTEA 1TP9A 1ZZYA 1H75A 4TR4A 17GSA 5F0GA 3V1WA 2O8VB 1ST9A 4IP6A 3FR3A 5AN1A 4V2NA 3ERWA 4F9ZA 5E4WA 4EDYA 2RM5A 5F8BA 3VWVA 3WT2A 1TJDA 5HFIA 1I5GA 5CYYA 2CT6A 3DVWA 5D9TA 2P0GA 2OACA 2B1LA 3TKSE 3EMXA 3HVSA 1HD2A 4I5QA 2I3YA 2VL2C 1E2YA 1GSQA 3TRPA 2GDRA 1PX6A 3C1RA 3M1GA 1B4QA 3UBLA 2VL9A 4YH2A 2KP1A 4YAPA 3LORA 2YP6A 5A4UA 1TW9A 2L4CA 4KGIA 2IMFA 2VD1A 3WGDA 3A2XA 1GRXA 2WS2A 2H6ZA 3VWUA 2LTKA 5D73A 4QQ7A 1SK2A 3UL3A 4AJ7A 4DSSA 3CBUA 3A2WA 9GSSA 4ZL9A 2OJLA 4N30A 3MAKA 5CAXA 2YWOA 1BAYA 4MPFA 1SJIA 3KD0A 1AQVA 2DSAA 3HXSA 3J7Yk 3TKSC 2L4QA 4OWYA 2DJ3A 3VWXA 3ZTLA 4OCFA 3MDKA 6GSVA 4WBRD 2A4VA 3UEMA 4HQSA 2GTUA 2CAIA 3ISOA 1EP8A 1JZDA 4AJ8A 4XHMA 3QCPA 3LYKA 3RPNA 4JZQA 2P5QA 1A8LA 1UN2A 5J4UA 3GYKA 5ECIB 5D9XA 3US3A 2ZCTA 3ZVJD 3EU4A 2HSHA 1WOUA 1ERTA 1YY7A 5H5SA 3GH9A 3A2VA 2F9SA 1YEPA 1T4ZA 3BCIA 3EURA 3VPTA 3A3TA 2VLTA 1OKTA 4GRFA 3QFAC 3ERGA 2G0FA 4MF6A 4XTSA 1GSFA 4ZXGA 3TDGA 3NOFA 4TVEA 3WGEA 5ELGA 3J7Yb 2XBQA 4KCEA 4HEA2 2HI7A 2R6KA 3W6GA 1ZL9A 2DC5A 2AHEA 5ECSA 5AISA 1RQMA 3QDNA 1V57A 2FA4A 3O3TA 2IMDA 3FEUA 2L5OA 1ILOA 3PGTA 1T3BA 1SKSB 2YWIA 3CTGA 2EC4A 2X8HA 4J56E 4RUVA 2H75A 4MJAA 4RI7A 1VF3A 2FWHA 5JWQB 5B8AA 2WFCA 1UVZA 3MWHA 2C3TA 3AY8A 4MA9A 3R2QA 2C3QA 4NAXA 3IBHA 4FYUA 2R3XA 2K6VA 4KCAA 4RQXA 8GSSA 1THOA 2VCQA 2BTOT 4DSRA 3APQA 1PSQA 2XBIA 3HHVA 2YNXA 5CRWA 3ZMLA 5IM9A 2FGXA 1JZWA 1K3LA 3G7YA 4PUFC 3M3MA 1A2MA 2LRCA 1BJXA 3GMFA 4GTUA 3TRXA 2CVDA 3QAGA 5FWGA 5DAKB 5HR2A 4D73B 3H8QA 2O7KA 3F9UA 5ELAA 2A2RA 4DVCA 4L0WA 4WR4A 4EUYA 5DALA 2V6OA 1EGOA 2GT5A 2KHPA 2HYXA 4TN8A 4IW9A 2G2QA 5GAND 1B9XC 3P2AA 3QMXA 4PUAA 4CDOA 1Z7RA 6GSUA 1MD3A 4LMVA 2HZFA 3QR6A 1QUWA 5IQYA 5GSTA 3WD6A 3GX8A 2YANA 4PXOA 4ECIA 3SWLA 1TRVA 2E0QA 2JZTA 4TOPA 2MBTA 3KH9A 1PA3A 4X0XA 1SK1A 1NHYA 3ZITA 2L6DA 1F37A 1YZXA 1LU4A 4YAVA 1QXHA 3CMIA 4TR0A 3GKXA 5CNWA 4MLYA 4F2IA 4MABA 3DGQA 2H01A 4L5OA 2DJKA 3Q74A 2B5YA 3GH6A 2RIIA 2H74A 2R4VA 2M72A 5H5QA 1PKWA 4L8EA 3ZZXA 2FWFA 1M2AA 3FZ4A 3W8JA 1Z6MA 5G31A 2AV4A 3IE3A 1GSUA 4EL1A 1MDIA 1JLWA 3BD2A 1GL8A 4ZBBA 1TRSA 1HNCA 3ZFLA 3RDWA 1O8WA 2MMAA 3TOTA 1TRUA 2XPEA 2GS3A 1AC1A 1B9YC 5IMVA 1ERUA 5ECKB 1GSSA 2VCWA 3EE2A 1M9AA 4IN0A 5KN0A 2C0FA 2J23A 3ZREA 2HT9A 3IXRA 4WR5A 4XCSA 3A5WA 3APOA 5COHA 3HJOA 2IFQA 3F3QA 4AJ6A 3DEXA 3OR5A 1SL0B 4EDZA 4ILFA 2H30A 5IOXA 4G2EA 1G7OA 3H1NA 1U3IA 2YWNA 1A23A 1F3AA 4MF5A 4OO5A 3PH9A 5GZZB 3HY2A 5L71A 1EZKA 3IR4A 5B6NA 2ON5A 5EY6A 1RW1A 16GSA 4JE1A 2PBJA 2H6XA 2JU5A 1T8EB 3KIJA 1SYXA 1VF1A 4K6XA 12GSA 2HRNA 1FG4A 3KJYA 4I6XA 5AIXA 1ERWA 3RBTA 5D9WA 4NWYA 4WEYA 1A2LA 4LL1B 3E9JB 1XWAA 1Z3EA 2Z9SA 5C00A 5DQSA 2MZCA 5DJLA 4KDUA 3WT1A 1WRYA 2KLXA 2N5AA 3N9JA 5IO2A 1XW9A 1SL2B 2HE3A 2OA7A 4TXOB 1R4WA 1XW5A 3P8WA 4DEJA 3EC3A 2NBSA 1DSBA 5ID2B 2MMOA 5G2ZA 3GRXA 4BPYA 4YQVA 5J3RA 3L78A 3I9V2 3LG6A 4BWQA 4HU7A 1TKDB 5IPGA 2YV7A 4K7IA 4NPBA 1XWCA 3TJJA 3FY7A 2NPBA 3DKSA 3NIVA 4KDYA 2H76A 1SKWB 3C7MA 1X5DA 3QAWA 3ZL5A 2LRNA 2H6YA 2FLSA 1V58A 2B5XA 1T1VA 2GQMA 1THXA 1GTIA 3KZQA 2QGVA 3HA9A 2ZNMA 5KN1A 1IYHA 1M0UA 2HXKA 2OE0A 3KEBA 3GKMA 4TW5A 5DQYA 3ZVJA 1XOBA 1SJZA 4WF5A 5A4WA 2PGTA 2HZEA 3GURA 6GSSA 1TDIA 4O32A 4V1Ap 4IVFA 3L9UA 1KBNA 3G9BA 4ECJA 4HOJA 3HJMA 2N5BA 4NV5A 1UA5A 4OFMA 2CX4A 2FWGA 3Q6OA 3C8EA 1USBA 2H0GA 3LFLA 1IYIA 3TB2A 4BVXA 2X99A 1XVQA 1OVNA 1G6WA 2H1GA 4JEDA 3WGXA 1YF1A 4PNGA 2H71A 5FHIA 1SD9A 5KN2A 1ML6A 1TK8B 1WPIA 4HDEA 2TRXA 3IV4A 2IN3A 2NDOA 2O85A 4ZL7A 1RK4A 4IJ3A 2QSIA 1MEKA 3GL5A 4Q5QA 5ECQB 2HSYA 2C1YA 1A2JA 2MMZA 1Z6NA 1M99A 5DCGA 3BOAA 1FW1A 5F06A 5B8BA 4JRRA 3QPMA 1R5AA 1PD21 4GSNA 4POMA 3PR8A 1ZGNA 3HKRA 1G6YA 1YF0A 2AAWA 2YPMA 2KUCA 4HZ2A 5GSSA 1K3YA 1K0DA 4KH7A 4RI6A 1WE0A 3D21A 3GFKA 1ZCPA 3HD5A 5ECPB 1ABAA 5LNKe 3EWLA 3TRQA 3MSZA 4HQZA 3EVIA 2GGTA 3LXTA 5G1KA 3ZFBA 4K0GA 1O85A 5ID2A 1I9DA 4NMUA 1ZYEA 1HNAA 3ZIJA 3WYWA 4H86A 5A5KA 4WKWA 3LYPA 3DXBA 2IMEA 3F6DA 4LL4B 3GTUA 1PRXA 2IJYA 3L0HA 2DIZA 5JWRB 2CA8A 3LJRA 2FHEA 3GUSA 3HZ4A 1DE2A 2I9HA 3G7JA 1TK0B 1GP1A 4HJMA 1JFUA 1WP0A 4F03A 4NV2A 2LQOA 4MZCA 3GSTA 2LNTA 3UOMA 1X9WB 2DBCA 1ZYQB 1T00A 3M0FA 4EKZA 1MDJA 2XHFA 2GSQA 2QC7A 1SL1B 1OC3A 2JSYA 5F05A 2OE3A 4PQHA 3GA4A 1OC9B 4POKA 22GSA 3L9SA 4POLA 1EWXA 1ON4A 3HCZA 4Q5NA 1J08A 4ID0A 3TJKA 3ED3A 4GLTA 4EF0A 2OKAA 2CZ2A 3I6AA 2CAQA 2FNOA 5J9BA 5HFKA 1JZRA 2K9FA 2YJ7A 4MDCA 3I43A 1S3CA 1ZMAA 3FRCA 1YKAA 3K8NA 4DSQA 4F0CA 4OO4A 4BVYA 1CQGA 2VLVA 2FA8A 3SBCA 2PU9C 2RLIA 2YOIA 20GSA 4ML1A 1X0RA 4ECBA 4TXVA 3C1SA 5KEJA 1KEBA 3L4NA 3CRTA 5HR3A 3BBYA 3GKNA 4LMWA 1XWKA 3S9FA 5HR0A 5JCUA 1XOAA 5J41A 1U3AA 3IPZA 2WJUA 1X5EA 1SK0A 2AYTA 1F6MC 3GKKA 3RHCA 3TJBA 2N5FA 1O81A 2GZZA 4HJ2A 4ZBDA 2H72A 2OADA 4HU9A 2AJQB 2QKEA 2H66A 3GL3A 11GSA 1TK5B 2CQ9A 4K1FA 2O89A 5D96A 2YV9A 2FWEA 1FVKA 2WDUA 3P90A 2ALBA 1ACVA 4MZWA 4JR4A 4KSOA 4IBPA 4TR1B 6GSXA 3QFBC 4IQAA 1BX9A 5IMCA 4GF0A 1XWGA 1GSEA 3CRUA 2H0IA 4MP4A 1FVJA 3O6TA 1BEDA 1PGTA 1J0FA 1YEXA 4ZBAA 2VM2A 4IHUA 3TKRA 13GSA 1TU8A 2AB6A 4Q5RA 4G10A 3DYRA 4ZB9A 2YN1A 4PURA 3KM6A 2PWJA 2DJ1A 3CSHA 2H1BA 2GSSA 5DDLA 4K9ZA 2OBKA 2VO4A 3KP9A 4K7NA 4EXJA 2DJJA 4FH8A 1N2AA 4MJEA 2BJXA 2PVOC 3VLNA 4ZL8A 1E6BA 3EU3A 1NW2A 1GUMA 2CX3A 2DLXA 3ZLPA 3DWVA 6GSYA 3MNGA 3GSSA 2IIYA 2DJ2A 1BYEA 1EP7A 2GT6A 3JCML 2R2JA 2H1AA 5EVOA 3VI5A 3M9KA 1BQ7A 1YDKA 2H8LA 4ZIJA 5J9CA 2EIOA 4AF2A 1B48A 4MCUA 3GNJA 2GZPA 1A0RP 1TXXA 5IMZA 4XS4B 5B6MA 3IK9A 1M2BA 1XBSA 5IO0A 1XVWA 5ECRB 2VAFA 2IL3A 1UC7A 3KMOA 4ULXA 4F0BA 4IKHA 2B6MA 2LJRA 1WJKA 1EV4A 4K7OA 2GZYA 4GWRA 4PGTA 2EIQA 2M80A 1MD4A 3IRAA 3BJ5A 1V40A 3KXOA 4PQIA 4RQRA 2V41A 1GULA 1EOHA 2MBSA 2IMKA 1GLPA 4PQ1A 4ACSA 5DAKA 4HI7A 3UMAA 4D73A 1SD8A 2NTOA 4XRAA 1PL2A 2ON7A 3UVHA 2VUPA 3KTBA 2A2SA 4IJIA 4XRDA 3L9VA 4MH2A 4FYCA 4AGSA 3PINA 2C8UA 3LQ7A 1S3DA 5CO3A 2ZUPA 4WF4A 1FB0A 3F8UA 3GV1A 2X64A 3CSJA 1QFNA 5JCWA 1LJRA 3TCOA 2H73A 4BA7A 3VK9A 4V1Ag 2WULA 1KNGA 3ME8A 5ECOB 4HS1A 1TU7A 1U87A 4MH3A 3TKSA 3DMLA 3H4KA 1VF2A 1GUHA 1R26A 4TR3A 5B7CA 3UIWA 3D6IA 4MJCA 3LGCA 2IMIA 4IS0A 3W8SA 3HVXA 2DIYA 5ECMB 2L5LA 4LA1A 3O76A 1YKCA 10GSA 4WXTA 5IMDA 4J2FA 1JZOA 1HNBA 1GH2A 3TJGA 2DJ0A 1TOFA 3HZ8A 4KW6A 2C3NA 2OE1A 3VFIA 5JCGA 3DRNA 4WETA 4ZB8A 4ZILA 5G5FA 2NVLA 4MF7A 1JHBA 5D8IA 1SJ6A 1B8XA 2FY6A 4OCEA 1AXDA 1GLQA 4TRXA 2B7KA 1C72A 1W89A 1DUGA 1K3OA 4KB3A 3FKFA 4V2LA 3ZYWA 2JACA 5D9VA 2MMNA 1YJ6A 3P7XA 2DMMA 3C71A 2B1KA 2VOCA 2LV3A 2RUFA 1OC8A 1AAZA 1S3AA 2GSRA 2VD0A 4XS4A 4EVMA 3VWWA 5F07A 2VCXA 1K0NA 2DMLA 3EINA 3E3EA 5G1LA 1JLVA 1OYJA 4N0VA 1QMVA 3M9JA 2M46A 4IQ1A 4YQUA 2WGRA 3CTFA 2LEGA 4QL9A 1W4VA 2PUKC 3QAVA 4L5LA 1TI1A 2E2MA 3HDCA 5INYA 1N8JA 1T4YA 2EIRA 4MJBA 4XS1A 2D2ZA 4N0ZA 2KOKA 4WBJA 2H70A 4XIHA 3VPQA 1GTBA 4OMVA 3GX0A 4KUNA 2PVQA 4ML6A 2K8SA 3LXZA 1J9BA 1U88A 3UARA 1O6JA 1OE8A 3D5JA 2LJAA 3C73A 1TTZA 3HVVA 1GWCA 1ZOFA 4PX1A 2LNSA 2CV4A 5CREA 2XPDA 4CHSA 6GSTA 4E8HA 4J57E 1FHEA 4V2MA 1GUKA 1XIYA 3IC4A 1PQNA 2JZRA 2PERA 2O87A 4G9HA 1F9MA 2YWMA 3G7IA 4FO5A 3IAS2 1V9WA 4K0NA 5DALB 3N5OA 4TXOA 1GNWA 2C4JA 4OD7A 1XCCA 1NM3A 3RAZA 4IP1A 3D4MA 4IGJA 2RM6A 3FZ9A 3APSA 2PMTA 3DVXA 1EV9A 3VI7A 1LBKA 5ECLB 4JR6A 3H79A 3LEFA 3FHKA 4JBBA 1GTAA 4L0UA 4EC0A 3KP8A 3F6FA 1K0MA 3GHAA 2HFDA 2J9HA 5G30A 3KTLA 1K0AA 5IOWA 5CRGA 1F3BA 4JU5A 2VLUA 1EEJA 1FAAA 4FYBA 1K0CA 3ERFA 1PN9A 1O7UA 5CP1A 3FR6A 3GN3A 4GXZA 4EE0A 4GCIA 5ABRA 2ES7A 1GNEA 1SKRB 5ECHB 1XPVA 2WRTA 5DJMA 2I1UA 2VIMA 4GSSA 3EYTA 2HLSA 2LS5A 5AIVA 1DBYA 4Z7XA 5ENUA 1X9MB 4ISDA 4PNFA 2YJHA 1AUCA 1X5CA 4MPGA 2GQLA 4QL7A 5GAPD 2B7JA 4KA0A 2WZ9A 3TJFA 5E59A 1A24A 5H5RA 1HQOA 4O7HA 4I2UA 5IMAA 7GSSA 1URMA 3FW2A 3UVTA 4I2TA 4Q5FA 6GSWA 1A8YA 2WB9A 5HR1A 2V6KA 4BL7A 1M2DA 2CVBA 4KNDA 2L57A 3RPPA 4K2DA 3D22A 1EOGA 2PN8A 4N11A 3FK8A 2IFQB 1DE1A 1FO5A 4IELA 1O73A 1X9SB 3D0ZA 2C0GA 3Q19A 1MDKA 4NHZA 1AQWA 1PMTA 4E8EA 2XC2A 19GSA 2IWTA 3F4RA 3U5RE 3CXGA 3IA1A 5LD0A 1XFLA 1O8XA 3F0IA 2H1DA 14GSA 1H4OA 3F63A 5ECNB 1CQHA 3KH7A 3ZRDA 4O5RA 1K0BA 1M7TA 1QGVA 4KAEA 2GSTA 1V2AA 2X8GA 5A4VA 1G7EA 2TIRA 4MMMA 1M9BA 2JZSA 2V2GA 4OFTA 1R7HA 2IPAA 2YCDA 2JSZA 4BWSA
chains in the Genus database with same CATH superfamily
2YZHA 1TRWA 1PKZA 3CSIA 2R37A 2VM1A 3EMPA 1GSYA 3TOUA 2C0EA 4CW9A 1R5PA 4GQFA 2F8FA 1FB6A 2TRCP 1AW9A 3FYGA 3KGKA 3LWAA 3IAM2 5HQPA 4EIQA 1Z9HA 2V32A 1YQ1A 2VL3A 2I4AA 1T7PB 18GSA 3FR9A 5CRDA 2X4AA 3HYPA 1GSDA 1VRSD 2FUG2 2F8AA 2JL4A 3ME7A 5IMFA 4BIKA 5EL8A 2P5RA 2BMXA 5G5EA 1OC9A 1XXUA 2K18A 2L59A 1Q4JA 2GVPA 2CZ3A 1WMJA 3BCKA 1EGRA 3VURA 4F82A 3F4TA 4N10A 4YQMA 3E0UA 3F4SA 4MZBA 3U6VA 1Y25A 1VGLA 4ZB6A 1A0FA 3GIXA 4KE3A 3TGZA 1NHOA 3UAPA 2I81A 1BG5A 1G0TA 2HZEB 1XWBA 3KCMA 4X1UA 1Y6EA 3M8NA 2LRTA 4MK3A 1XZOA 4NHWA 4OFNA 3FZAA 2LSTA 2E7PA 1OKDA 2HRFA 2GLRA 5EPFA 2C0DA 2RUEA 2VL2A 3IOSA 5DBQA 3UBKA 4BVXB 2LQQA 5AGYA 2L6CA 4KDXA 5CRHA 4ECCA 2P31A 4X43A 4HUAA 3KMNA 2QA1A 2X8CA 4NXIA 1U6TA 2GQKA 1TI3A 3LW9A 3ZIVA 1SENA 2F51A 5J5NA 1PL1A 1VF4A 1V98A 1OAZA 3TUEA 2R5GA 5DCHA 5D93A 3CYNA 4EO3A 5LCZA 4DSSB 4K8MA 2E2GA 3QD9A 2AUVA 3NZNA 4K5SA 3ZMKA 1QQ2A 3QOUA 3TKQA 1QK8A 1Q98A 5C04A 2K8VA 2VCTA 4TR1A 2C80A 1F2EA 4KSMA 4FIWA 3TKPA 4G19A 4GQCA 1GTUA 1XW6A 5DVBA 2FD3A 3Q18A 3DIEA 1WIKA 5IPHA 1SYRA 3H93A 4O92A 1FOVA 4GSTA 1AQXA 3D4TA 3IHQA 3RHBA 2DKIA 5HFGA 3F3RA 1NSWA 3HJPA 2LJKA 2B5EA 2B3SA 2REMA 3I69A 3DD3A 2V1MA 3UJ1A 4POBA 1K0OA 1AIUA 4TKYA 3IDVA 1FOHA 1EEMA 1HYUA 1Z7PA 4KX4A 1ERVA 4LLRA 2LUSA 1MTCA 2VCZA 2WCIA 1WWJA 1B4PA 1OE7A 1PX7A 2HRKA 1Z5YE 2MYGA 2VCVA 4HZ4A 3LSZA 4XS6A 3IK7A 4P3YB 2OBIA 4I97A 2F3MA 5FT3A 5JWOB 2JADA 2LKUA 1M3IA 5KN3A 2HNLA 3GTUB 2FCHA 2CVKA 3A5IA 2YZUA 2H19A 2KP2A 5IIZA 2H0HA 4I8BA 2PPTA 1SU9A 3FZ5A 1KTEA 1TP9A 1ZZYA 1H75A 4TR4A 17GSA 5F0GA 3V1WA 2O8VB 1ST9A 4IP6A 3FR3A 5AN1A 4V2NA 3ERWA 1PFOA 4KF9A 4F9ZA 5E4WA 4EDYA 2RM5A 5F8BA 3VWVA 3WT2A 1TJDA 5HFIA 1I5GA 5CYYA 2CT6A 3DVWA 5D9TA 2P0GA 2OACA 2B1LA 4PTSA 3TKSE 3EMXA 3HVSA 1HD2A 4I5QA 2I3YA 2VL2C 1E2YA 1GSQA 3TRPA 2GDRA 3MYDA 1PX6A 3C1RA 3M1GA 1B4QA 3UBLA 2VL9A 4YH2A 4BVYB 2KP1A 3PPUA 4YAPA 3LORA 2YP6A 5A4UA 1TW9A 2L4CA 4KGIA 2IMFA 2VD1A 3WGDA 3A2XA 1GRXA 2WS2A 2H6ZA 3VWUA 2LTKA 5D73A 4QQ7A 1SK2A 3UL3A 4AJ7A 4DSSA 3CBUA 3A2WA 9GSSA 4ZL9A 2OJLA 1PN0A 4N30A 3MAKA 5CAXA 2YWOA 1BAYA 4MPFA 1SJIA 3KD0A 1AQVA 2DSAA 3HXSA 3J7Yk 3TKSC 2R0CA 2L4QA 4OWYA 2DJ3A 3VWXA 3ZTLA 4OCFA 3MDKA 6GSVA 4WBRD 2A4VA 3UEMA 4HQSA 2GTUA 2CAIA 3ISOA 1EP8A 1JZDA 4AJ8A 4XHMA 3QCPA 3LYKA 3RPNA 4JZQA 2P5QA 1A8LA 1UN2A 5J4UA 3GYKA 5ECIB 5D9XA 3US3A 2ZCTA 3ZVJD 3EU4A 2HSHA 1WOUA 1ERTA 1YY7A 5H5SA 3GH9A 3A2VA 2F9SA 1YEPA 1T4ZA 3BCIA 3EURA 3VPTA 3A3TA 2VLTA 1OKTA 4GRFA 3QFAC 3ERGA 2G0FA 4MF6A 4XTSA 1GSFA 4ZXGA 3TDGA 3NOFA 4TVEA 3WGEA 5ELGA 3J7Yb 2XBQA 4KCEA 4HEA2 2HI7A 2R6KA 3W6GA 1ZL9A 2DC5A 2AHEA 5ECSA 5AISA 1RQMA 3QDNA 1V57A 2FA4A 1ZYNA 3O3TA 2IMDA 3FEUA 2L5OA 1ILOA 3PGTA 1T3BA 1SKSB 2YWIA 3CTGA 2EC4A 2X8HA 4J56E 4RUVA 2H75A 4MJAA 4RI7A 1VF3A 2FWHA 5JWQB 5B8AA 2WFCA 1UVZA 3MWHA 2C3TA 3AY8A 4MA9A 3R2QA 2C3QA 4NAXA 3IBHA 4FYUA 2R3XA 2K6VA 4KCAA 4RQXA 8GSSA 1THOA 2VCQA 2BTOT 4DSRA 3APQA 1PSQA 2XBIA 3HHVA 2YNXA 5CRWA 3ZMLA 5IM9A 2FGXA 1JZWA 1K3LA 3G7YA 4PUFC 3M3MA 1A2MA 2LRCA 1BJXA 3GMFA 4GTUA 3TRXA 2CVDA 3QAGA 5FWGA 4HSCX 5DAKB 5HR2A 4D73B 3H8QA 2O7KA 3F9UA 5ELAA 2A2RA 4DVCA 2X49A 4L0WA 4WR4A 4EUYA 5DALA 2V6OA 1EGOA 2GT5A 2KHPA 2HYXA 4TN8A 4IW9A 2G2QA 5GAND 1B9XC 3P2AA 3QMXA 4PUAA 4CDOA 1Z7RA 6GSUA 1MD3A 4LMVA 2HZFA 3EPTA 3QR6A 1QUWA 5IQYA 5GSTA 2UZ8A 3WD6A 3GX8A 2YANA 4PXOA 4ECIA 3SWLA 1TRVA 2E0QA 2JZTA 4TOPA 2MBTA 3KH9A 1PA3A 4X0XA 1SK1A 1NHYA 3ZITA 2L6DA 1F37A 1YZXA 1LU4A 4YAVA 1QXHA 3CMIA 4EIPA 4TR0A 3GKXA 5CNWA 4MLYA 4F2IA 4MABA 3DGQA 2H01A 4L5OA 2DJKA 3Q74A 2B5YA 3GH6A 2RIIA 2H74A 2R4VA 2M72A 5H5QA 1PKWA 4L8EA 3ZZXA 2FWFA 1M2AA 3FZ4A 3W8JA 1Z6MA 5G31A 2AV4A 3IE3A 1GSUA 4EL1A 1MDIA 1JLWA 3BD2A 1GL8A 4ZBBA 1TRSA 1HNCA 3ZFLA 3RDWA 1O8WA 2MMAA 3TOTA 1TRUA 2XPEA 2GS3A 1AC1A 1B9YC 5IMVA 1ERUA 5ECKB 1GSSA 2VCWA 3EE2A 1M9AA 4IN0A 5KN0A 2C0FA 2J23A 3ZREA 2HT9A 3IXRA 4WR5A 4XCSA 3A5WA 3APOA 5COHA 3HJOA 4X4JA 2IFQA 3F3QA 4AJ6A 3DEXA 3OR5A 1SL0B 4EDZA 4ILFA 2H30A 5IOXA 4G2EA 1G7OA 3H1NA 1U3IA 2YWNA 1A23A 1F3AA 4MF5A 4OO5A 3PH9A 5GZZB 3HY2A 5L71A 1ZYPA 1EZKA 3IR4A 5B6NA 4YKFA 2ON5A 5EY6A 1RW1A 16GSA 4JE1A 2PBJA 2H6XA 2JU5A 1T8EB 3KIJA 1SYXA 1VF1A 4K6XA 12GSA 2HRNA 1FG4A 3KJYA 4I6XA 5AIXA 1ERWA 3RBTA 5D9WA 4NWYA 4WEYA 1A2LA 4LL1B 3E9JB 1XWAA 1Z3EA 2Z9SA 3HVNA 5C00A 5DQSA 2MZCA 5DJLA 4KDUA 3WT1A 1WRYA 2KLXA 2N5AA 3N9JA 5IO2A 1XW9A 1SL2B 2HE3A 2OA7A 4TXOB 1R4WA 1XW5A 3P8WA 4DEJA 3EC3A 2NBSA 1DSBA 4O5UA 5ID2B 2MMOA 5G2ZA 3GRXA 4BPYA 4YQVA 5J3RA 3L78A 3I9V2 3LG6A 4BWQA 4HU7A 1TKDB 5IPGA 2YV7A 4K7IA 4NPBA 1XWCA 3TJJA 3FY7A 2NPBA 3DKSA 3NIVA 4KDYA 2H76A 1SKWB 3C7MA 1X5DA 3MIXA 3QAWA 3ZL5A 2LRNA 2H6YA 2FLSA 1V58A 2B5XA 5KOWA 1T1VA 2GQMA 1THXA 1GTIA 3KZQA 2QGVA 3HA9A 2ZNMA 5KN1A 1IYHA 1M0UA 2HXKA 2OE0A 3KEBA 1S3RA 3GKMA 4TW5A 5DQYA 3ZVJA 1XOBA 1SJZA 4WF5A 5A4WA 2PGTA 2HZEA 3GURA 6GSSA 1TDIA 4O32A 4CY8A 4V1Ap 4IVFA 3L9UA 1KBNA 3G9BA 2HSMA 4ECJA 4HOJA 3HJMA 2N5BA 4NV5A 1UA5A 4OFMA 2CX4A 2FWGA 3Q6OA 3C8EA 1USBA 2H0GA 3LFLA 1IYIA 3TB2A 4BVXA 2X99A 1XVQA 1OVNA 1G6WA 2H1GA 4JEDA 3WGXA 1YF1A 4PNGA 2H71A 5FHIA 1SD9A 5KN2A 4Z2UA 1ML6A 1TK8B 1WPIA 4HDEA 2TRXA 3IV4A 2IN3A 2NDOA 2O85A 4BL7B 4ZL7A 1RK4A 4IJ3A 2QSIA 1MEKA 3GL5A 4Q5QA 5ECQB 2HSYA 2C1YA 1A2JA 2MMZA 1Z6NA 1M99A 5DCGA 3BOAA 1FW1A 5F06A 5B8BA 4JRRA 3QPMA 1R5AA 1PD21 4GSNA 4POMA 3PR8A 1ZGNA 3HKRA 1G6YA 1YF0A 2AAWA 2YPMA 2KUCA 4HZ2A 5GSSA 1K3YA 1K0DA 4KH7A 4RI6A 1WE0A 3D21A 3GFKA 1ZCPA 3HD5A 5ECPB 4Z2RA 1ABAA 5LNKe 3EWLA 3TRQA 3MSZA 4HQZA 3EVIA 2GGTA 3LXTA 5G1KA 3ZFBA 4K0GA 1O85A 5ID2A 1I9DA 4NMUA 1ZYEA 1HNAA 3ZIJA 3WYWA 4H86A 5A5KA 2QA2A 4WKWA 3LYPA 3DXBA 2IMEA 4Z2TA 3F6DA 4LL4B 3GTUA 1PRXA 2IJYA 3L0HA 2DIZA 5JWRB 2CA8A 3LJRA 2FHEA 3GUSA 2R0PA 3HZ4A 2I9HA 1DE2A 3G7JA 1TK0B 1GP1A 4HJMA 1JFUA 1WP0A 4F03A 4NV2A 2LQOA 4MZCA 3GSTA 2LNTA 3UOMA 1X9WB 2DBCA 1ZYQB 1T00A 3M0FA 4EKZA 1MDJA 2XHFA 2GSQA 2QC7A 1SL1B 1OC3A 2JSYA 5F05A 2OE3A 4PQHA 3GA4A 1OC9B 4POKA 22GSA 3L9SA 4POLA 1EWXA 1ON4A 3HCZA 4Q5NA 1J08A 4ID0A 3TJKA 3ED3A 4GLTA 4EF0A 2OKAA 2CZ2A 3I6AA 2CAQA 2FNOA 5J9BA 5HFKA 1JZRA 2K9FA 2YJ7A 4MDCA 3I43A 1S3CA 1ZMAA 3FRCA 1YKAA 3K8NA 4DSQA 4F0CA 4OO4A 4BVYA 1CQGA 2VLVA 2FA8A 3SBCA 2PU9C 2RLIA 2YOIA 20GSA 4ML1A 1X0RA 4ECBA 4TXVA 3C1SA 4USSA 5KEJA 1KEBA 3L4NA 3CRTA 5HR3A 3BBYA 3GKNA 4LMWA 1XWKA 3S9FA 5HR0A 5JCUA 1XOAA 5J41A 1U3AA 3IPZA 2WJUA 1X5EA 1SK0A 2AYTA 1F6MC 3GKKA 3RHCA 3TJBA 2N5FA 1O81A 2GZZA 4HJ2A 3IC8A 4ZBDA 2H72A 2OADA 4HU9A 2AJQB 2QKEA 2H66A 3GL3A 5BMUA 11GSA 1TK5B 2CQ9A 4K1FA 2O89A 5D96A 2YV9A 2FWEA 3IHGA 1FVKA 2WDUA 3P90A 2ALBA 1ACVA 4MZWA 4JR4A 4KSOA 4IBPA 4TR1B 6GSXA 3QFBC 4IQAA 1BX9A 5IMCA 4GF0A 1XWGA 4K2XA 1GSEA 3CRUA 2H0IA 4MP4A 1FVJA 3O6TA 1BEDA 1PGTA 1J0FA 1YEXA 4ZBAA 2VM2A 4IHUA 3TKRA 13GSA 1TU8A 2AB6A 4Q5RA 4G10A 3DYRA 3R3EA 4ZB9A 2YN1A 4PURA 3KM6A 2PWJA 2DJ1A 3CSHA 2H1BA 2GSSA 5DDLA 4YKGA 4K9ZA 2OBKA 2VO4A 2A4HA 3KP9A 4K7NA 4EXJA 2DJJA 4FH8A 1N2AA 4MJEA 2BJXA 2PVOC 3VLNA 4ZL8A 1E6BA 3EU3A 1NW2A 1GUMA 2CX3A 2DLXA 3ZLPA 3DWVA 6GSYA 3MNGA 3GSSA 2IIYA 2DJ2A 1BYEA 1EP7A 2GT6A 3JCML 2R2JA 2H1AA 5EVOA 3VI5A 3M9KA 1BQ7A 1YDKA 2H8LA 4ZIJA 5J9CA 2EIOA 4AF2A 1B48A 4MCUA 3GNJA 2GZPA 1A0RP 1TXXA 5IMZA 2R0GA 4XS4B 5B6MA 3IK9A 1M2BA 1XBSA 5IO0A 1XVWA 5ECRB 2VAFA 2IL3A 1UC7A 3KMOA 4ULXA 4F0BA 4IKHA 2B6MA 2LJRA 1WJKA 1EV4A 4K7OA 2GZYA 4GWRA 4PGTA 2EIQA 2M80A 1MD4A 4A5PA 3IRAA 3BJ5A 1V40A 3KXOA 4PQIA 4RQRA 2V41A 1GULA 1EOHA 2MBSA 2IMKA 1GLPA 4PQ1A 4ACSA 5DAKA 4HI7A 3UMAA 4D73A 1SD8A 2NTOA 4XRAA 1PL2A 2ON7A 3UVHA 2VUPA 3KTBA 2A2SA 4IJIA 4XRDA 3L9VA 4MH2A 4G0IA 4FYCA 4AGSA 3PINA 2C8UA 3LQ7A 1S3DA 5CO3A 2ZUPA 4WF4A 1FB0A 3F8UA 3GV1A 2X64A 3CSJA 1QFNA 5JCWA 1LJRA 3TCOA 2H73A 4BA7A 3VK9A 4V1Ag 2WULA 1KNGA 3ME8A 5ECOB 4HS1A 1TU7A 1U87A 4MH3A 4G0KA 3TKSA 3DMLA 3H4KA 4CY6A 1VF2A 4O5QA 1GUHA 1R26A 4TR3A 5B7CA 3UIWA 3D6IA 4MJCA 3LGCA 2IMIA 4IS0A 3W8SA 3HVXA 2DIYA 5ECMB 2L5LA 4LA1A 3O76A 1YKCA 10GSA 4WXTA 5IMDA 4J2FA 1JZOA 1HNBA 1GH2A 3TJGA 2DJ0A 1TOFA 3HZ8A 4KW6A 2C3NA 2OE1A 3VFIA 5JCGA 3DRNA 4WETA 4ZB8A 4ZILA 5G5FA 2NVLA 4MF7A 1JHBA 5D8IA 1SJ6A 1B8XA 2FY6A 4OCEA 1AXDA 1GLQA 4ICYA 4TRXA 2B7KA 1C72A 1W89A 1DUGA 1K3OA 4KB3A 3FKFA 4V2LA 3ZYWA 2JACA 2MMNA 5D9VA 1YJ6A 3P7XA 2DMMA 3C71A 2B1KA 2VOCA 2LV3A 2RUFA 4MNNA 1OC8A 1AAZA 1S3AA 2GSRA 2VD0A 4XS4A 4EVMA 3VWWA 5F07A 2VCXA 1K0NA 2DMLA 5BRTA 3EINA 3E3EA 5G1LA 1JLVA 1OYJA 4N0VA 1QMVA 3M9JA 2M46A 4IQ1A 4YQUA 2WGRA 3CTFA 2LEGA 4QL9A 1W4VA 2PUKC 3QAVA 4L5LA 1TI1A 2E2MA 3HDCA 5INYA 1N8JA 1T4YA 2EIRA 4MJBA 4XS1A 2D2ZA 4N0ZA 2KOKA 4WBJA 5KOXA 2H70A 4XIHA 3VPQA 1GTBA 4OMVA 3GX0A 4KUNA 2PVQA 4ML6A 2K8SA 3LXZA 1J9BA 1U88A 3UARA 2DKHA 1O6JA 1OE8A 3D5JA 2LJAA 3C73A 1TTZA 3HVVA 1GWCA 1ZOFA 4PX1A 2LNSA 2CV4A 5CREA 2XPDA 4CHSA 6GSTA 4E8HA 4J57E 3FMWA 1XG8A 1FHEA 4V2MA 1GUKA 1XIYA 3IC4A 1PQNA 2JZRA 2PERA 2O87A 4G9HA 1F9MA 2YWMA 3G7IA 4FO5A 2A2PA 3IAS2 1V9WA 4K0NA 5DALB 3N5OA 4TXOA 1GNWA 2C4JA 4OD7A 1XCCA 1NM3A 3RAZA 4IP1A 3D4MA 4IGJA 2RM6A 3FZ9A 3APSA 2PMTA 3DVXA 1EV9A 3VI7A 1LBKA 5ECLB 4JR6A 3H79A 3LEFA 3FHKA 4JBBA 1GTAA 4L0UA 4EC0A 3KP8A 3F6FA 1K0MA 3GHAA 2HFDA 2J9HA 5G30A 3KTLA 1K0AA 5IOWA 5CRGA 1F3BA 4JU5A 2VLUA 1EEJA 1FAAA 4FYBA 1K0CA 3ERFA 1PN9A 1O7UA 2HRAA 5CP1A 3FR6A 3GN3A 4GXZA 4EE0A 4GCIA 5ABRA 2ES7A 3CQFA 1GNEA 1SKRB 4G0LA 5ECHB 1XPVA 2WRTA 5DJMA 4FQUA 2I1UA 2VIMA 4GSSA 3EYTA 2HLSA 2LS5A 5AIVA 1DBYA 4Z7XA 5ENUA 1X9MB 1M3JA 4ISDA 4PNFA 2YJHA 1AUCA 1X5CA 4MPGA 2GQLA 4QL7A 5GAPD 2B7JA 4KA0A 2WZ9A 3TJFA 5E59A 1A24A 5H5RA 1HQOA 4O7HA 4I2UA 5IMAA 7GSSA 1URMA 3FW2A 3UVTA 4I2TA 4Q5FA 6GSWA 1A8YA 2WB9A 5HR1A 2V6KA 4BL7A 1M2DA 2CVBA 4KNDA 2L57A 3RPPA 4K2DA 3D22A 4K5RA 1EOGA 2PN8A 4N11A 3FK8A 2IFQB 1DE1A 1FO5A 4IELA 1O73A 1X9SB 3D0ZA 2C0GA 3Q19A 1MDKA 4NHZA 1AQWA 1PMTA 4E8EA 2XC2A 19GSA 2IWTA 3F4RA 3U5RE 3CXGA 3IA1A 5LD0A 1XFLA 1O8XA 3F0IA 2H1DA 14GSA 1H4OA 3F63A 5ECNB 1CQHA 3KH7A 3ZRDA 4O5RA 1K0BA 1M7TA 1QGVA 4KAEA 2GSTA 1V2AA 2X8GA 5A4VA 1G7EA 2TIRA 4MMMA 1M9BA 2JZSA 2V2GA 4OFTA 1R7HA 2IPAA 2YCDA 2JSZA 4BWSA
chains in the Genus database with same CATH topology
2YZHA 1TRWA 1PKZA 3CSIA 2R37A 2VM1A 3EMPA 1GSYA 3TOUA 2C0EA 4CW9A 1R5PA 4GQFA 2F8FA 1FB6A 2TRCP 1AW9A 3FYGA 3KGKA 3LWAA 3IAM2 5HQPA 4EIQA 1Z9HA 2V32A 1YQ1A 2VL3A 2I4AA 1T7PB 18GSA 3FR9A 5CRDA 2X4AA 3HYPA 1GSDA 1VRSD 2FUG2 2F8AA 2JL4A 3ME7A 5IMFA 5EL8A 2P5RA 2BMXA 5G5EA 1OC9A 1XXUA 2K18A 2L59A 1Q4JA 2GVPA 2CZ3A 1WMJA 3BCKA 1EGRA 3VURA 4F82A 3F4TA 4N10A 4YQMA 3E0UA 3F4SA 4MZBA 3U6VA 1Y25A 1VGLA 4ZB6A 1A0FA 3GIXA 4KE3A 3TGZA 1NHOA 3UAPA 2I81A 1BG5A 1G0TA 2HZEB 1XWBA 3KCMA 4X1UA 1Y6EA 3M8NA 2LRTA 4MK3A 1XZOA 4NHWA 4OFNA 3FZAA 2LSTA 2E7PA 1OKDA 2HRFA 2GLRA 5EPFA 2C0DA 2RUEA 2VL2A 3IOSA 5DBQA 3UBKA 4BVXB 2LQQA 5AGYA 2L6CA 4KDXA 5CRHA 4ECCA 2P31A 4X43A 4HUAA 3KMNA 2QA1A 2X8CA 4NXIA 1U6TA 2GQKA 1TI3A 3LW9A 3ZIVA 1SENA 2F51A 5J5NA 1PL1A 1VF4A 1V98A 1OAZA 3TUEA 2R5GA 5DCHA 5D93A 3CYNA 4EO3A 5LCZA 4DSSB 4K8MA 2E2GA 3QD9A 2AUVA 3NZNA 4K5SA 3ZMKA 1QQ2A 3QOUA 3TKQA 1QK8A 1Q98A 5C04A 2K8VA 2VCTA 4TR1A 2C80A 1F2EA 4KSMA 4FIWA 3TKPA 4G19A 4GQCA 1GTUA 1XW6A 5DVBA 2FD3A 3Q18A 3DIEA 1WIKA 5IPHA 1SYRA 3H93A 4O92A 1FOVA 4GSTA 1AQXA 3D4TA 3IHQA 3RHBA 2DKIA 5HFGA 3F3RA 1NSWA 3HJPA 2LJKA 2B5EA 2B3SA 2REMA 3I69A 3DD3A 2V1MA 3UJ1A 4POBA 1K0OA 1AIUA 4TKYA 3IDVA 1FOHA 1EEMA 1HYUA 1Z7PA 4KX4A 1ERVA 4LLRA 2LUSA 1MTCA 2VCZA 2WCIA 1WWJA 1B4PA 1OE7A 1PX7A 2HRKA 1Z5YE 2MYGA 2VCVA 4HZ4A 3LSZA 4XS6A 3IK7A 4P3YB 2OBIA 4I97A 2F3MA 5FT3A 5JWOB 2JADA 2LKUA 5KN3A 2HNLA 3GTUB 2FCHA 2CVKA 3A5IA 2YZUA 2H19A 2KP2A 5IIZA 2H0HA 4I8BA 2PPTA 1SU9A 3FZ5A 1KTEA 1TP9A 1ZZYA 1H75A 4TR4A 17GSA 5F0GA 3V1WA 2O8VB 1ST9A 4IP6A 3FR3A 5AN1A 4V2NA 3ERWA 4KF9A 4F9ZA 5E4WA 4EDYA 2RM5A 5F8BA 3VWVA 3WT2A 1TJDA 5HFIA 1I5GA 5CYYA 2CT6A 3DVWA 5D9TA 2P0GA 2OACA 2B1LA 4PTSA 3TKSE 3EMXA 3HVSA 1HD2A 4I5QA 2I3YA 2VL2C 1E2YA 1GSQA 3TRPA 2GDRA 3MYDA 1PX6A 3C1RA 3M1GA 1B4QA 3UBLA 2VL9A 4YH2A 4BVYB 2KP1A 3PPUA 4YAPA 3LORA 2YP6A 5A4UA 1TW9A 2L4CA 4KGIA 2IMFA 2VD1A 3WGDA 3A2XA 1GRXA 2WS2A 2H6ZA 3VWUA 2LTKA 5D73A 4QQ7A 1SK2A 3UL3A 4AJ7A 4DSSA 3CBUA 3A2WA 9GSSA 4ZL9A 2OJLA 1PN0A 4N30A 3MAKA 5CAXA 2YWOA 1BAYA 4MPFA 1SJIA 3KD0A 1AQVA 2DSAA 3HXSA 3J7Yk 3TKSC 2R0CA 2L4QA 4OWYA 2DJ3A 3VWXA 3ZTLA 4OCFA 3MDKA 6GSVA 4WBRD 2A4VA 3UEMA 4HQSA 2GTUA 2CAIA 3ISOA 1EP8A 1JZDA 4AJ8A 4XHMA 3QCPA 3LYKA 3RPNA 4JZQA 2P5QA 1A8LA 1UN2A 5J4UA 3GYKA 5ECIB 5D9XA 3US3A 2ZCTA 3ZVJD 3EU4A 2HSHA 1WOUA 1ERTA 1YY7A 5H5SA 3GH9A 3A2VA 2F9SA 1YEPA 1T4ZA 3BCIA 3EURA 3VPTA 3A3TA 2VLTA 1OKTA 4GRFA 3QFAC 3ERGA 2G0FA 4MF6A 4XTSA 1GSFA 4ZXGA 3TDGA 3NOFA 4TVEA 3WGEA 5ELGA 3J7Yb 2XBQA 4KCEA 4HEA2 2HI7A 2R6KA 3W6GA 1ZL9A 2DC5A 2AHEA 5ECSA 5AISA 1RQMA 3QDNA 1V57A 2FA4A 1ZYNA 3O3TA 2IMDA 3FEUA 2L5OA 1ILOA 3PGTA 1T3BA 1SKSB 2YWIA 3CTGA 2EC4A 2X8HA 4J56E 4RUVA 2H75A 4MJAA 4RI7A 1VF3A 2FWHA 5JWQB 5B8AA 2WFCA 1UVZA 3MWHA 2C3TA 3AY8A 4MA9A 3R2QA 2C3QA 4NAXA 3IBHA 4FYUA 2R3XA 2K6VA 4KCAA 4RQXA 8GSSA 1THOA 2VCQA 2BTOT 4DSRA 3APQA 1PSQA 2XBIA 3HHVA 2YNXA 5CRWA 3ZMLA 5IM9A 2FGXA 1JZWA 1K3LA 3G7YA 4PUFC 3M3MA 1A2MA 2LRCA 1BJXA 3GMFA 4GTUA 3TRXA 2CVDA 3QAGA 5FWGA 5DAKB 5HR2A 4D73B 3H8QA 2O7KA 3F9UA 5ELAA 2A2RA 4DVCA 2X49A 4L0WA 4WR4A 4EUYA 5DALA 2V6OA 1EGOA 2GT5A 2KHPA 2HYXA 4TN8A 4IW9A 2G2QA 5GAND 1B9XC 3P2AA 3QMXA 4PUAA 4CDOA 1Z7RA 6GSUA 1MD3A 4LMVA 2HZFA 3EPTA 3QR6A 1QUWA 5IQYA 5GSTA 2UZ8A 3WD6A 3GX8A 2YANA 4PXOA 4ECIA 3SWLA 1TRVA 2E0QA 2JZTA 4TOPA 2MBTA 3KH9A 1PA3A 4X0XA 1SK1A 1NHYA 3ZITA 2L6DA 1F37A 1YZXA 1LU4A 4YAVA 1QXHA 3CMIA 4EIPA 4TR0A 3GKXA 5CNWA 4MLYA 4F2IA 4MABA 3DGQA 2H01A 4L5OA 2DJKA 3Q74A 2B5YA 3GH6A 2RIIA 2H74A 2R4VA 2M72A 5H5QA 1PKWA 4L8EA 3ZZXA 2FWFA 1M2AA 3FZ4A 3W8JA 1Z6MA 5G31A 2AV4A 3IE3A 1GSUA 4EL1A 1MDIA 1JLWA 3BD2A 1GL8A 4ZBBA 1TRSA 1HNCA 3ZFLA 3RDWA 1O8WA 2MMAA 3TOTA 1TRUA 2XPEA 2GS3A 1AC1A 1B9YC 5IMVA 1ERUA 5ECKB 1GSSA 2VCWA 3EE2A 1M9AA 4IN0A 5KN0A 2C0FA 2J23A 3ZREA 2HT9A 3IXRA 4WR5A 4XCSA 3A5WA 3APOA 5COHA 3HJOA 4X4JA 2IFQA 3F3QA 4AJ6A 3DEXA 3OR5A 1SL0B 4EDZA 4ILFA 2H30A 5IOXA 4G2EA 1G7OA 3H1NA 1U3IA 2YWNA 1A23A 1F3AA 4MF5A 4OO5A 3PH9A 5GZZB 3HY2A 5L71A 1ZYPA 1EZKA 3IR4A 5B6NA 4YKFA 2ON5A 5EY6A 1RW1A 16GSA 4JE1A 2PBJA 2H6XA 2JU5A 1T8EB 3KIJA 1SYXA 1VF1A 4K6XA 12GSA 2HRNA 1FG4A 3KJYA 4I6XA 5AIXA 1ERWA 3RBTA 5D9WA 4NWYA 4WEYA 1A2LA 4LL1B 3E9JB 1XWAA 1Z3EA 2Z9SA 5C00A 5DQSA 2MZCA 5DJLA 4KDUA 3WT1A 1WRYA 2KLXA 2N5AA 3N9JA 5IO2A 1XW9A 1SL2B 2HE3A 2OA7A 4TXOB 1R4WA 1XW5A 3P8WA 4DEJA 3EC3A 2NBSA 1DSBA 4O5UA 5ID2B 2MMOA 5G2ZA 3GRXA 4BPYA 4YQVA 5J3RA 3L78A 3I9V2 3LG6A 4BWQA 4HU7A 1TKDB 5IPGA 2YV7A 4K7IA 4NPBA 1XWCA 3TJJA 3FY7A 2NPBA 3DKSA 3NIVA 4KDYA 2H76A 1SKWB 3C7MA 1X5DA 3MIXA 3QAWA 3ZL5A 2LRNA 2H6YA 2FLSA 1V58A 2B5XA 5KOWA 1T1VA 2GQMA 1THXA 1GTIA 3KZQA 2QGVA 3HA9A 2ZNMA 5KN1A 1IYHA 1M0UA 2HXKA 2OE0A 3KEBA 3GKMA 4TW5A 5DQYA 3ZVJA 1XOBA 1SJZA 4WF5A 5A4WA 2PGTA 2HZEA 3GURA 6GSSA 1TDIA 4O32A 4CY8A 4V1Ap 4IVFA 3L9UA 1KBNA 3G9BA 2HSMA 4ECJA 4HOJA 3HJMA 2N5BA 4NV5A 1UA5A 4OFMA 2CX4A 2FWGA 3Q6OA 3C8EA 1USBA 2H0GA 3LFLA 1IYIA 3TB2A 4BVXA 2X99A 1XVQA 1OVNA 1G6WA 2H1GA 4JEDA 3WGXA 1YF1A 4PNGA 2H71A 5FHIA 1SD9A 5KN2A 4Z2UA 1ML6A 1TK8B 1WPIA 4HDEA 2TRXA 3IV4A 2IN3A 2NDOA 2O85A 4BL7B 4ZL7A 1RK4A 4IJ3A 2QSIA 1MEKA 3GL5A 4Q5QA 5ECQB 2HSYA 2C1YA 1A2JA 2MMZA 1Z6NA 1M99A 5DCGA 3BOAA 1FW1A 5F06A 5B8BA 4JRRA 3QPMA 1R5AA 1PD21 4GSNA 4POMA 3PR8A 1ZGNA 3HKRA 1G6YA 1YF0A 2AAWA 2YPMA 2KUCA 4HZ2A 5GSSA 1K3YA 1K0DA 4KH7A 4RI6A 1WE0A 3D21A 3GFKA 1ZCPA 3HD5A 5ECPB 4Z2RA 1ABAA 5LNKe 3EWLA 3TRQA 3MSZA 4HQZA 3EVIA 2GGTA 3LXTA 5G1KA 3ZFBA 4K0GA 1O85A 5ID2A 1I9DA 4NMUA 1ZYEA 1HNAA 3ZIJA 3WYWA 4H86A 5A5KA 2QA2A 4WKWA 3LYPA 3DXBA 2IMEA 4Z2TA 3F6DA 4LL4B 3GTUA 1PRXA 2IJYA 3L0HA 2DIZA 5JWRB 2CA8A 3LJRA 2FHEA 3GUSA 2R0PA 3HZ4A 2I9HA 1DE2A 3G7JA 1TK0B 1GP1A 4HJMA 1JFUA 1WP0A 4F03A 4NV2A 2LQOA 4MZCA 3GSTA 2LNTA 3UOMA 1X9WB 2DBCA 1ZYQB 1T00A 3M0FA 4EKZA 1MDJA 2XHFA 2GSQA 2QC7A 1SL1B 1OC3A 2JSYA 5F05A 2OE3A 4PQHA 3GA4A 1OC9B 4POKA 22GSA 3L9SA 4POLA 1EWXA 1ON4A 3HCZA 4Q5NA 1J08A 4ID0A 3TJKA 3ED3A 4GLTA 4EF0A 2OKAA 2CZ2A 3I6AA 2CAQA 2FNOA 5J9BA 5HFKA 1JZRA 2K9FA 2YJ7A 4MDCA 3I43A 1S3CA 1ZMAA 3FRCA 1YKAA 3K8NA 4DSQA 4F0CA 4OO4A 4BVYA 1CQGA 2VLVA 2FA8A 3SBCA 2PU9C 2RLIA 2YOIA 20GSA 4ML1A 1X0RA 4ECBA 4TXVA 3C1SA 4USSA 5KEJA 1KEBA 3L4NA 3CRTA 5HR3A 3BBYA 3GKNA 4LMWA 1XWKA 3S9FA 5HR0A 5JCUA 1XOAA 5J41A 1U3AA 3IPZA 2WJUA 1X5EA 1SK0A 2AYTA 1F6MC 3GKKA 3RHCA 3TJBA 2N5FA 1O81A 2GZZA 4HJ2A 3IC8A 4ZBDA 2H72A 2OADA 4HU9A 2AJQB 2QKEA 2H66A 3GL3A 5BMUA 11GSA 1TK5B 2CQ9A 4K1FA 2O89A 5D96A 2YV9A 2FWEA 3IHGA 1FVKA 2WDUA 3P90A 2ALBA 1ACVA 4MZWA 4JR4A 4KSOA 4IBPA 4TR1B 6GSXA 3QFBC 4IQAA 1BX9A 5IMCA 4GF0A 1XWGA 4K2XA 1GSEA 3CRUA 2H0IA 4MP4A 1FVJA 3O6TA 1BEDA 1PGTA 1J0FA 1YEXA 4ZBAA 2VM2A 4IHUA 3TKRA 13GSA 1TU8A 2AB6A 4Q5RA 4G10A 3DYRA 3R3EA 4ZB9A 2YN1A 4PURA 3KM6A 2PWJA 2DJ1A 3CSHA 2H1BA 2GSSA 5DDLA 4YKGA 4K9ZA 2OBKA 2VO4A 2A4HA 3KP9A 4K7NA 4EXJA 2DJJA 4FH8A 1N2AA 4MJEA 2BJXA 2PVOC 3VLNA 4ZL8A 1E6BA 3EU3A 1NW2A 1GUMA 2CX3A 2DLXA 3ZLPA 3DWVA 6GSYA 3MNGA 3GSSA 2IIYA 2DJ2A 1BYEA 1EP7A 2GT6A 3JCML 2R2JA 2H1AA 5EVOA 3VI5A 3M9KA 1BQ7A 1YDKA 2H8LA 4ZIJA 5J9CA 2EIOA 4AF2A 1B48A 4MCUA 3GNJA 2GZPA 1A0RP 1TXXA 5IMZA 2R0GA 4XS4B 5B6MA 3IK9A 1M2BA 1XBSA 5IO0A 1XVWA 5ECRB 2VAFA 2IL3A 1UC7A 3KMOA 4ULXA 4F0BA 4IKHA 2B6MA 2LJRA 1WJKA 1EV4A 4K7OA 2GZYA 4GWRA 4PGTA 2EIQA 2M80A 1MD4A 4A5PA 3IRAA 3BJ5A 1V40A 3KXOA 4PQIA 4RQRA 2V41A 1GULA 1EOHA 2MBSA 2IMKA 1GLPA 4PQ1A 4ACSA 5DAKA 4HI7A 3UMAA 4D73A 1SD8A 2NTOA 4XRAA 1PL2A 2ON7A 3UVHA 2VUPA 3KTBA 2A2SA 4IJIA 4XRDA 3L9VA 4MH2A 4G0IA 4FYCA 4AGSA 3PINA 2C8UA 3LQ7A 1S3DA 5CO3A 2ZUPA 4WF4A 1FB0A 3F8UA 3GV1A 2X64A 3CSJA 1QFNA 5JCWA 1LJRA 3TCOA 2H73A 4BA7A 3VK9A 4V1Ag 2WULA 1KNGA 3ME8A 5ECOB 4HS1A 1TU7A 1U87A 4MH3A 4G0KA 3TKSA 3DMLA 3H4KA 4CY6A 1VF2A 4O5QA 1GUHA 1R26A 4TR3A 5B7CA 3UIWA 3D6IA 4MJCA 3LGCA 2IMIA 4IS0A 3W8SA 3HVXA 2DIYA 5ECMB 2L5LA 4LA1A 3O76A 1YKCA 10GSA 4WXTA 5IMDA 4J2FA 1JZOA 1HNBA 1GH2A 3TJGA 2DJ0A 1TOFA 3HZ8A 4KW6A 2C3NA 2OE1A 3VFIA 5JCGA 3DRNA 4WETA 4ZB8A 4ZILA 5G5FA 2NVLA 4MF7A 1JHBA 5D8IA 1SJ6A 1B8XA 2FY6A 4OCEA 1AXDA 1GLQA 4ICYA 4TRXA 2B7KA 1C72A 1W89A 1DUGA 1K3OA 4KB3A 3FKFA 4V2LA 3ZYWA 2JACA 2MMNA 5D9VA 1YJ6A 3P7XA 2DMMA 3C71A 2B1KA 2VOCA 2LV3A 2RUFA 4MNNA 1OC8A 1AAZA 1S3AA 2GSRA 2VD0A 4XS4A 4EVMA 3VWWA 5F07A 2VCXA 1K0NA 2DMLA 5BRTA 3EINA 3E3EA 5G1LA 1JLVA 1OYJA 4N0VA 1QMVA 3M9JA 2M46A 4IQ1A 4YQUA 2WGRA 3CTFA 2LEGA 4QL9A 1W4VA 2PUKC 3QAVA 4L5LA 1TI1A 2E2MA 3HDCA 5INYA 1N8JA 1T4YA 2EIRA 4MJBA 4XS1A 2D2ZA 4N0ZA 2KOKA 4WBJA 5KOXA 2H70A 4XIHA 3VPQA 1GTBA 4OMVA 3GX0A 4KUNA 2PVQA 4ML6A 2K8SA 3LXZA 1J9BA 1U88A 3UARA 2DKHA 1O6JA 1OE8A 3D5JA 2LJAA 3C73A 1TTZA 3HVVA 1GWCA 1ZOFA 4PX1A 2LNSA 2CV4A 5CREA 2XPDA 4CHSA 6GSTA 4E8HA 4J57E 3FMWA 1FHEA 4V2MA 1GUKA 1XIYA 3IC4A 1PQNA 2JZRA 2PERA 2O87A 4G9HA 1F9MA 2YWMA 3G7IA 4FO5A 2A2PA 3IAS2 1V9WA 4K0NA 5DALB 3N5OA 4TXOA 1GNWA 2C4JA 4OD7A 1XCCA 1NM3A 3RAZA 4IP1A 3D4MA 4IGJA 2RM6A 3FZ9A 3APSA 2PMTA 3DVXA 1EV9A 3VI7A 1LBKA 5ECLB 4JR6A 3H79A 3LEFA 3FHKA 4JBBA 1GTAA 4L0UA 4EC0A 3KP8A 3F6FA 1K0MA 3GHAA 2HFDA 2J9HA 5G30A 3KTLA 1K0AA 5IOWA 5CRGA 1F3BA 4JU5A 2VLUA 1EEJA 1FAAA 4FYBA 1K0CA 3ERFA 1PN9A 1O7UA 2HRAA 5CP1A 3FR6A 3GN3A 4GXZA 4EE0A 4GCIA 5ABRA 2ES7A 1GNEA 1SKRB 4G0LA 5ECHB 1XPVA 2WRTA 5DJMA 4FQUA 2I1UA 2VIMA 4GSSA 3EYTA 2HLSA 2LS5A 5AIVA 1DBYA 4Z7XA 5ENUA 1X9MB 4ISDA 4PNFA 2YJHA 1AUCA 1X5CA 4MPGA 2GQLA 4QL7A 5GAPD 2B7JA 4KA0A 2WZ9A 3TJFA 5E59A 1A24A 5H5RA 1HQOA 4O7HA 4I2UA 5IMAA 7GSSA 1URMA 3FW2A 3UVTA 4I2TA 4Q5FA 6GSWA 1A8YA 2WB9A 5HR1A 2V6KA 4BL7A 1M2DA 2CVBA 4KNDA 2L57A 3RPPA 4K2DA 3D22A 4K5RA 1EOGA 2PN8A 4N11A 3FK8A 2IFQB 1DE1A 1FO5A 4IELA 1O73A 1X9SB 3D0ZA 2C0GA 3Q19A 1MDKA 4NHZA 1AQWA 1PMTA 4E8EA 2XC2A 19GSA 2IWTA 3F4RA 3U5RE 3CXGA 3IA1A 5LD0A 1XFLA 1O8XA 3F0IA 2H1DA 14GSA 1H4OA 3F63A 5ECNB 1CQHA 3KH7A 3ZRDA 4O5RA 1K0BA 1M7TA 1QGVA 4KAEA 2GSTA 1V2AA 2X8GA 5A4VA 1G7EA 2TIRA 4MMMA 1M9BA 2JZSA 2V2GA 4OFTA 1R7HA 2IPAA 2YCDA 2JSZA 4BWSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YZH A;  1TRW A;  1PKZ A;  3CSI A;  2R37 A;  2VM1 A;  3EMP A;  1GSY A;  3TOU A;  2C0E A;  4CW9 A;  1R5P A;  4GQF A;  2F8F A;  1FB6 A;  2TRC P;  1AW9 A;  3FYG A;  3KGK A;  3LWA A;  3IAM 2;  5HQP A;  1Z9H A;  2V32 A;  1YQ1 A;  2VL3 A;  2I4A A;  1T7P B;  18GS A;  3FR9 A;  5CRD A;  3HYP A;  1GSD A;  1VRS D;  2FUG 2;  2F8A A;  2JL4 A;  3ME7 A;  5IMF A;  5EL8 A;  2P5R A;  2BMX A;  5G5E A;  1OC9 A;  1XXU A;  2K18 A;  2L59 A;  1Q4J A;  2GVP A;  2CZ3 A;  1WMJ A;  3BCK A;  1EGR A;  3VUR A;  4F82 A;  3F4T A;  4N10 A;  4YQM A;  3E0U A;  3F4S A;  4MZB A;  3U6V A;  1Y25 A;  1VGL A;  4ZB6 A;  1A0F A;  3GIX A;  4KE3 A;  3TGZ A;  1NHO A;  3UAP A;  2I81 A;  1BG5 A;  1G0T A;  2HZE B;  1XWB A;  3KCM A;  4X1U A;  1Y6E A;  3M8N A;  2LRT A;  4MK3 A;  1XZO A;  4NHW A;  4OFN A;  3FZA A;  2LST A;  2E7P A;  1OKD A;  2HRF A;  2GLR A;  5EPF A;  2C0D A;  2RUE A;  2VL2 A;  3IOS A;  5DBQ A;  3UBK A;  2LQQ A;  5AGY A;  2L6C A;  4KDX A;  5CRH A;  4ECC A;  2P31 A;  4X43 A;  4HUA A;  3KMN A;  2X8C A;  4NXI A;  1U6T A;  2GQK A;  1TI3 A;  3ZIV A;  1SEN A;  2F51 A;  5J5N A;  1PL1 A;  1VF4 A;  1V98 A;  1OAZ A;  3TUE A;  2R5G A;  5DCH A;  5D93 A;  3CYN A;  4EO3 A;  5LCZ A;  4DSS B;  4K8M A;  2E2G A;  3QD9 A;  2AUV A;  3NZN A;  3ZMK A;  1QQ2 A;  3QOU A;  3TKQ A;  1QK8 A;  1Q98 A;  5C04 A;  2K8V A;  2VCT A;  4TR1 A;  2C80 A;  1F2E A;  4KSM A;  4FIW A;  3TKP A;  4G19 A;  4GQC A;  1GTU A;  1XW6 A;  5DVB A;  2FD3 A;  3Q18 A;  3DIE A;  1WIK A;  5IPH A;  1SYR A;  3H93 A;  4O92 A;  1FOV A;  4GST A;  1AQX A;  3D4T A;  3IHQ A;  3RHB A;  5HFG A;  3F3R A;  1NSW A;  3HJP A;  2LJK A;  2B5E A;  2B3S A;  2REM A;  3I69 A;  3DD3 A;  2V1M A;  3UJ1 A;  4POB A;  1K0O A;  1AIU A;  4TKY A;  3IDV A;  1EEM A;  1HYU A;  1Z7P A;  4KX4 A;  1ERV A;  4LLR A;  2LUS A;  1MTC A;  2VCZ A;  2WCI A;  1WWJ A;  1B4P A;  1OE7 A;  1PX7 A;  1Z5Y E;  2MYG A;  2VCV A;  4HZ4 A;  3LSZ A;  4XS6 A;  3IK7 A;  4P3Y B;  2OBI A;  4I97 A;  2F3M A;  5FT3 A;  5JWO B;  2JAD A;  2LKU A;  5KN3 A;  2HNL A;  3GTU B;  2FCH A;  2CVK A;  2YZU A;  2H19 A;  2KP2 A;  5IIZ A;  2H0H A;  4I8B A;  2PPT A;  1SU9 A;  3FZ5 A;  1KTE A;  1TP9 A;  1ZZY A;  1H75 A;  4TR4 A;  17GS A;  5F0G A;  3V1W A;  2O8V B;  1ST9 A;  4IP6 A;  3FR3 A;  5AN1 A;  4V2N A;  3ERW A;  4F9Z A;  5E4W A;  4EDY A;  2RM5 A;  5F8B A;  3VWV A;  3WT2 A;  1TJD A;  5HFI A;  1I5G A;  5CYY A;  2CT6 A;  3DVW A;  5D9T A;  2P0G A;  2OAC A;  2B1L A;  3TKS E;  3EMX A;  3HVS A;  1HD2 A;  4I5Q A;  2I3Y A;  2VL2 C;  1E2Y A;  1GSQ A;  3TRP A;  2GDR A;  1PX6 A;  3C1R A;  3M1G A;  1B4Q A;  3UBL A;  2VL9 A;  4YH2 A;  2KP1 A;  4YAP A;  3LOR A;  2YP6 A;  5A4U A;  1TW9 A;  2L4C A;  4KGI A;  2IMF A;  2VD1 A;  3WGD A;  3A2X A;  1GRX A;  2WS2 A;  2H6Z A;  3VWU A;  2LTK A;  5D73 A;  4QQ7 A;  1SK2 A;  3UL3 A;  4AJ7 A;  4DSS A;  3CBU A;  3A2W A;  9GSS A;  4ZL9 A;  2OJL A;  4N30 A;  3MAK A;  5CAX A;  2YWO A;  1BAY A;  4MPF A;  1SJI A;  3KD0 A;  1AQV A;  2DSA A;  3HXS A;  3J7Y k;  3TKS C;  2L4Q A;  4OWY A;  2DJ3 A;  3VWX A;  3ZTL A;  4OCF A;  3MDK A;  6GSV A;  4WBR D;  2A4V A;  3UEM A;  4HQS A;  2GTU A;  2CAI A;  3ISO A;  1EP8 A;  1JZD A;  4AJ8 A;  4XHM A;  3QCP A;  3LYK A;  3RPN A;  4JZQ A;  2P5Q A;  1A8L A;  1UN2 A;  5J4U A;  3GYK A;  5ECI B;  5D9X A;  3US3 A;  2ZCT A;  3ZVJ D;  3EU4 A;  2HSH A;  1WOU A;  1ERT A;  1YY7 A;  5H5S A;  3GH9 A;  3A2V A;  2F9S A;  1YEP A;  1T4Z A;  3BCI A;  3EUR A;  3VPT A;  3A3T A;  2VLT A;  1OKT A;  4GRF A;  3QFA C;  3ERG A;  2G0F A;  4MF6 A;  4XTS A;  1GSF A;  4ZXG A;  3TDG A;  3NOF A;  4TVE A;  3WGE A;  5ELG A;  3J7Y b;  2XBQ A;  4KCE A;  4HEA 2;  2HI7 A;  2R6K A;  3W6G A;  1ZL9 A;  2DC5 A;  2AHE A;  5ECS A;  5AIS A;  1RQM A;  3QDN A;  1V57 A;  2FA4 A;  3O3T A;  2IMD A;  3FEU A;  2L5O A;  1ILO A;  3PGT A;  1T3B A;  1SKS B;  2YWI A;  3CTG A;  2EC4 A;  2X8H A;  4J56 E;  4RUV A;  2H75 A;  4MJA A;  4RI7 A;  1VF3 A;  2FWH A;  5JWQ B;  5B8A A;  2WFC A;  1UVZ A;  3MWH A;  2C3T A;  3AY8 A;  4MA9 A;  3R2Q A;  2C3Q A;  4NAX A;  3IBH A;  4FYU A;  2R3X A;  2K6V A;  4KCA A;  4RQX A;  8GSS A;  1THO A;  2VCQ A;  2BTO T;  4DSR A;  3APQ A;  1PSQ A;  2XBI A;  3HHV A;  2YNX A;  5CRW A;  3ZML A;  5IM9 A;  2FGX A;  1JZW A;  1K3L A;  3G7Y A;  4PUF C;  3M3M A;  1A2M A;  2LRC A;  1BJX A;  3GMF A;  4GTU A;  3TRX A;  2CVD A;  3QAG A;  5FWG A;  5DAK B;  5HR2 A;  4D73 B;  3H8Q A;  2O7K A;  3F9U A;  5ELA A;  2A2R A;  4DVC A;  4L0W A;  4WR4 A;  4EUY A;  5DAL A;  2V6O A;  1EGO A;  2GT5 A;  2KHP A;  2HYX A;  4TN8 A;  4IW9 A;  2G2Q A;  5GAN D;  1B9X C;  3P2A A;  3QMX A;  4PUA A;  4CDO A;  1Z7R A;  6GSU A;  1MD3 A;  4LMV A;  2HZF A;  3QR6 A;  1QUW A;  5IQY A;  5GST A;  3WD6 A;  3GX8 A;  2YAN A;  4PXO A;  4ECI A;  3SWL A;  1TRV A;  2E0Q A;  2JZT A;  4TOP A;  2MBT A;  3KH9 A;  1PA3 A;  4X0X A;  1SK1 A;  1NHY A;  3ZIT A;  2L6D A;  1F37 A;  1YZX A;  1LU4 A;  4YAV A;  1QXH A;  3CMI A;  4TR0 A;  3GKX A;  5CNW A;  4MLY A;  4F2I A;  4MAB A;  3DGQ A;  2H01 A;  4L5O A;  2DJK A;  3Q74 A;  2B5Y A;  3GH6 A;  2RII A;  2H74 A;  2R4V A;  2M72 A;  5H5Q A;  1PKW A;  4L8E A;  3ZZX A;  2FWF A;  1M2A A;  3FZ4 A;  3W8J A;  1Z6M A;  5G31 A;  2AV4 A;  3IE3 A;  1GSU A;  4EL1 A;  1MDI A;  1JLW A;  3BD2 A;  1GL8 A;  4ZBB A;  1TRS A;  1HNC A;  3ZFL A;  3RDW A;  1O8W A;  2MMA A;  3TOT A;  1TRU A;  2XPE A;  2GS3 A;  1AC1 A;  1B9Y C;  5IMV A;  1ERU A;  5ECK B;  1GSS A;  2VCW A;  3EE2 A;  1M9A A;  4IN0 A;  5KN0 A;  2C0F A;  2J23 A;  3ZRE A;  2HT9 A;  3IXR A;  4WR5 A;  4XCS A;  3A5W A;  3APO A;  5COH A;  3HJO A;  2IFQ A;  3F3Q A;  4AJ6 A;  3DEX A;  3OR5 A;  1SL0 B;  4EDZ A;  4ILF A;  2H30 A;  5IOX A;  4G2E A;  1G7O A;  3H1N A;  1U3I A;  2YWN A;  1A23 A;  1F3A A;  4MF5 A;  4OO5 A;  3PH9 A;  5GZZ B;  3HY2 A;  5L71 A;  1EZK A;  3IR4 A;  5B6N A;  2ON5 A;  5EY6 A;  1RW1 A;  16GS A;  4JE1 A;  2PBJ A;  2H6X A;  2JU5 A;  1T8E B;  3KIJ A;  1SYX A;  1VF1 A;  4K6X A;  12GS A;  2HRN A;  1FG4 A;  3KJY A;  4I6X A;  5AIX A;  1ERW A;  3RBT A;  5D9W A;  4NWY A;  4WEY A;  1A2L A;  4LL1 B;  3E9J B;  1XWA A;  1Z3E A;  2Z9S A;  5C00 A;  5DQS A;  2MZC A;  5DJL A;  4KDU A;  3WT1 A;  1WRY A;  2KLX A;  2N5A A;  3N9J A;  5IO2 A;  1XW9 A;  1SL2 B;  2HE3 A;  2OA7 A;  4TXO B;  1R4W A;  1XW5 A;  3P8W A;  4DEJ A;  3EC3 A;  2NBS A;  1DSB A;  5ID2 B;  2MMO A;  5G2Z A;  3GRX A;  4BPY A;  4YQV A;  5J3R A;  3L78 A;  3I9V 2;  3LG6 A;  4BWQ A;  4HU7 A;  1TKD B;  5IPG A;  2YV7 A;  4K7I A;  4NPB A;  1XWC A;  3TJJ A;  3FY7 A;  2NPB A;  3DKS A;  3NIV A;  4KDY A;  2H76 A;  1SKW B;  3C7M A;  1X5D A;  3QAW A;  3ZL5 A;  2LRN A;  2H6Y A;  2FLS A;  1V58 A;  2B5X A;  1T1V A;  2GQM A;  1THX A;  1GTI A;  3KZQ A;  2QGV A;  3HA9 A;  2ZNM A;  5KN1 A;  1IYH A;  1M0U A;  2HXK A;  2OE0 A;  3KEB A;  3GKM A;  4TW5 A;  5DQY A;  3ZVJ A;  1XOB A;  1SJZ A;  4WF5 A;  5A4W A;  2PGT A;  2HZE A;  3GUR A;  6GSS A;  1TDI A;  4O32 A;  4V1A p;  4IVF A;  3L9U A;  1KBN A;  3G9B A;  4ECJ A;  4HOJ A;  3HJM A;  2N5B A;  4NV5 A;  1UA5 A;  4OFM A;  2CX4 A;  2FWG A;  3Q6O A;  3C8E A;  1USB A;  2H0G A;  3LFL A;  1IYI A;  3TB2 A;  4BVX A;  2X99 A;  1XVQ A;  1OVN A;  1G6W A;  2H1G A;  4JED A;  3WGX A;  1YF1 A;  4PNG A;  2H71 A;  5FHI A;  1SD9 A;  5KN2 A;  1ML6 A;  1TK8 B;  1WPI A;  4HDE A;  2TRX A;  3IV4 A;  2IN3 A;  2NDO A;  2O85 A;  4ZL7 A;  1RK4 A;  4IJ3 A;  2QSI A;  1MEK A;  3GL5 A;  4Q5Q A;  5ECQ B;  2HSY A;  2C1Y A;  1A2J A;  2MMZ A;  1Z6N A;  1M99 A;  5DCG A;  3BOA A;  1FW1 A;  5F06 A;  5B8B A;  4JRR A;  3QPM A;  1R5A A;  1PD2 1;  4GSN A;  4POM A;  3PR8 A;  1ZGN A;  3HKR A;  1G6Y A;  1YF0 A;  2AAW A;  2YPM A;  2KUC A;  4HZ2 A;  5GSS A;  1K3Y A;  1K0D A;  4KH7 A;  4RI6 A;  1WE0 A;  3D21 A;  3GFK A;  1ZCP A;  3HD5 A;  5ECP B;  1ABA A;  5LNK e;  3EWL A;  3TRQ A;  3MSZ A;  4HQZ A;  3EVI A;  2GGT A;  3LXT A;  5G1K A;  3ZFB A;  4K0G A;  1O85 A;  5ID2 A;  1I9D A;  4NMU A;  1ZYE A;  1HNA A;  3ZIJ A;  3WYW A;  4H86 A;  5A5K A;  4WKW A;  3LYP A;  3DXB A;  2IME A;  3F6D A;  4LL4 B;  3GTU A;  1PRX A;  2IJY A;  3L0H A;  2DIZ A;  5JWR B;  2CA8 A;  3LJR A;  2FHE A;  3GUS A;  3HZ4 A;  1DE2 A;  2I9H A;  3G7J A;  1TK0 B;  1GP1 A;  4HJM A;  1JFU A;  1WP0 A;  4F03 A;  4NV2 A;  2LQO A;  4MZC A;  3GST A;  2LNT A;  3UOM A;  1X9W B;  2DBC A;  1ZYQ B;  1T00 A;  3M0F A;  4EKZ A;  1MDJ A;  2XHF A;  2GSQ A;  2QC7 A;  1SL1 B;  1OC3 A;  2JSY A;  5F05 A;  2OE3 A;  4PQH A;  3GA4 A;  1OC9 B;  4POK A;  22GS A;  3L9S A;  4POL A;  1EWX A;  1ON4 A;  3HCZ A;  4Q5N A;  1J08 A;  4ID0 A;  3TJK A;  3ED3 A;  4GLT A;  4EF0 A;  2OKA A;  2CZ2 A;  3I6A A;  2CAQ A;  2FNO A;  5J9B A;  5HFK A;  1JZR A;  2K9F A;  2YJ7 A;  4MDC A;  3I43 A;  1S3C A;  1ZMA A;  3FRC A;  1YKA A;  3K8N A;  4DSQ A;  4F0C A;  4OO4 A;  4BVY A;  1CQG A;  2VLV A;  2FA8 A;  3SBC A;  2PU9 C;  2RLI A;  2YOI A;  20GS A;  4ML1 A;  1X0R A;  4ECB A;  4TXV A;  3C1S A;  5KEJ A;  1KEB A;  3L4N A;  3CRT A;  5HR3 A;  3BBY A;  3GKN A;  4LMW A;  1XWK A;  3S9F A;  5HR0 A;  5JCU A;  1XOA A;  5J41 A;  1U3A A;  3IPZ A;  2WJU A;  1X5E A;  1SK0 A;  2AYT A;  1F6M C;  3GKK A;  3RHC A;  3TJB A;  2N5F A;  1O81 A;  2GZZ A;  4HJ2 A;  4ZBD A;  2H72 A;  2OAD A;  4HU9 A;  2AJQ B;  2QKE A;  2H66 A;  3GL3 A;  11GS A;  1TK5 B;  2CQ9 A;  4K1F A;  2O89 A;  5D96 A;  2YV9 A;  2FWE A;  1FVK A;  2WDU A;  3P90 A;  2ALB A;  1ACV A;  4MZW A;  4JR4 A;  4KSO A;  4IBP A;  4TR1 B;  6GSX A;  3QFB C;  4IQA A;  1BX9 A;  5IMC A;  4GF0 A;  1XWG A;  1GSE A;  3CRU A;  2H0I A;  4MP4 A;  1FVJ A;  3O6T A;  1BED A;  1PGT A;  1J0F A;  1YEX A;  4ZBA A;  2VM2 A;  4IHU A;  3TKR A;  13GS A;  1TU8 A;  2AB6 A;  4Q5R A;  4G10 A;  3DYR A;  4ZB9 A;  2YN1 A;  4PUR A;  3KM6 A;  2PWJ A;  2DJ1 A;  3CSH A;  2H1B A;  2GSS A;  5DDL A;  4K9Z A;  2OBK A;  2VO4 A;  3KP9 A;  4K7N A;  4EXJ A;  2DJJ A;  4FH8 A;  1N2A A;  4MJE A;  2BJX A;  2PVO C;  3VLN A;  4ZL8 A;  1E6B A;  3EU3 A;  1NW2 A;  1GUM A;  2CX3 A;  2DLX A;  3ZLP A;  3DWV A;  6GSY A;  3MNG A;  3GSS A;  2IIY A;  2DJ2 A;  1BYE A;  1EP7 A;  2GT6 A;  3JCM L;  2R2J A;  2H1A A;  5EVO A;  3VI5 A;  3M9K A;  1BQ7 A;  1YDK A;  2H8L A;  4ZIJ A;  5J9C A;  2EIO A;  4AF2 A;  1B48 A;  4MCU A;  3GNJ A;  2GZP A;  1A0R P;  1TXX A;  5IMZ A;  4XS4 B;  5B6M A;  3IK9 A;  1M2B A;  1XBS A;  5IO0 A;  1XVW A;  5ECR B;  2VAF A;  2IL3 A;  1UC7 A;  3KMO A;  4ULX A;  4F0B A;  4IKH A;  2B6M A;  2LJR A;  1WJK A;  1EV4 A;  4K7O A;  2GZY A;  4GWR A;  4PGT A;  2EIQ A;  2M80 A;  1MD4 A;  3IRA A;  3BJ5 A;  1V40 A;  3KXO A;  4PQI A;  4RQR A;  2V41 A;  1GUL A;  1EOH A;  2MBS A;  2IMK A;  1GLP A;  4PQ1 A;  4ACS A;  5DAK A;  4HI7 A;  3UMA A;  4D73 A;  1SD8 A;  2NTO A;  4XRA A;  1PL2 A;  2ON7 A;  3UVH A;  2VUP A;  3KTB A;  2A2S A;  4IJI A;  4XRD A;  3L9V A;  4MH2 A;  4FYC A;  4AGS A;  3PIN A;  2C8U A;  3LQ7 A;  1S3D A;  5CO3 A;  2ZUP A;  4WF4 A;  1FB0 A;  3F8U A;  3GV1 A;  2X64 A;  3CSJ A;  1QFN A;  5JCW A;  1LJR A;  3TCO A;  2H73 A;  4BA7 A;  3VK9 A;  4V1A g;  2WUL A;  1KNG A;  3ME8 A;  5ECO B;  4HS1 A;  1TU7 A;  1U87 A;  4MH3 A;  3TKS A;  3DML A;  3H4K A;  1VF2 A;  1GUH A;  1R26 A;  4TR3 A;  5B7C A;  3UIW A;  3D6I A;  4MJC A;  3LGC A;  2IMI A;  4IS0 A;  3W8S A;  3HVX A;  2DIY A;  5ECM B;  2L5L A;  4LA1 A;  3O76 A;  1YKC A;  10GS A;  4WXT A;  5IMD A;  4J2F A;  1JZO A;  1HNB A;  1GH2 A;  3TJG A;  2DJ0 A;  1TOF A;  3HZ8 A;  4KW6 A;  2C3N A;  2OE1 A;  3VFI A;  5JCG A;  3DRN A;  4WET A;  4ZB8 A;  4ZIL A;  5G5F A;  2NVL A;  4MF7 A;  1JHB A;  5D8I A;  1SJ6 A;  1B8X A;  2FY6 A;  4OCE A;  1AXD A;  1GLQ A;  4TRX A;  2B7K A;  1C72 A;  1W89 A;  1DUG A;  1K3O A;  4KB3 A;  3FKF A;  4V2L A;  3ZYW A;  2JAC A;  5D9V A;  2MMN A;  1YJ6 A;  3P7X A;  2DMM A;  3C71 A;  2B1K A;  2VOC A;  2LV3 A;  2RUF A;  1OC8 A;  1AAZ A;  1S3A A;  2GSR A;  2VD0 A;  4XS4 A;  4EVM A;  3VWW A;  5F07 A;  2VCX A;  1K0N A;  2DML A;  3EIN A;  3E3E A;  5G1L A;  1JLV A;  1OYJ A;  4N0V A;  1QMV A;  3M9J A;  2M46 A;  4IQ1 A;  4YQU A;  2WGR A;  3CTF A;  2LEG A;  4QL9 A;  1W4V A;  2PUK C;  3QAV A;  4L5L A;  1TI1 A;  2E2M A;  3HDC A;  5INY A;  1N8J A;  1T4Y A;  2EIR A;  4MJB A;  4XS1 A;  2D2Z A;  4N0Z A;  2KOK A;  4WBJ A;  2H70 A;  4XIH A;  3VPQ A;  1GTB A;  4OMV A;  3GX0 A;  4KUN A;  2PVQ A;  4ML6 A;  2K8S A;  3LXZ A;  1J9B A;  1U88 A;  3UAR A;  1O6J A;  1OE8 A;  3D5J A;  2LJA A;  3C73 A;  1TTZ A;  3HVV A;  1GWC A;  1ZOF A;  4PX1 A;  2LNS A;  2CV4 A;  5CRE A;  2XPD A;  4CHS A;  6GST A;  4E8H A;  4J57 E;  1FHE A;  4V2M A;  1GUK A;  1XIY A;  3IC4 A;  1PQN A;  2JZR A;  2PER A;  2O87 A;  4G9H A;  1F9M A;  2YWM A;  3G7I A;  4FO5 A;  3IAS 2;  1V9W A;  4K0N A;  5DAL B;  3N5O A;  4TXO A;  1GNW A;  2C4J A;  4OD7 A;  1XCC A;  1NM3 A;  3RAZ A;  4IP1 A;  3D4M A;  4IGJ A;  2RM6 A;  3FZ9 A;  3APS A;  2PMT A;  3DVX A;  1EV9 A;  3VI7 A;  1LBK A;  5ECL B;  4JR6 A;  3H79 A;  3LEF A;  3FHK A;  4JBB A;  1GTA A;  4L0U A;  4EC0 A;  3KP8 A;  3F6F A;  1K0M A;  3GHA A;  2HFD A;  2J9H A;  5G30 A;  3KTL A;  1K0A A;  5IOW A;  5CRG A;  1F3B A;  4JU5 A;  2VLU A;  1EEJ A;  1FAA A;  4FYB A;  1K0C A;  3ERF A;  1PN9 A;  1O7U A;  5CP1 A;  3FR6 A;  3GN3 A;  4GXZ A;  4EE0 A;  4GCI A;  5ABR A;  2ES7 A;  1GNE A;  1SKR B;  5ECH B;  1XPV A;  2WRT A;  5DJM A;  2I1U A;  2VIM A;  4GSS A;  3EYT A;  2HLS A;  2LS5 A;  5AIV A;  1DBY A;  4Z7X A;  5ENU A;  1X9M B;  4ISD A;  4PNF A;  2YJH A;  1AUC A;  1X5C A;  4MPG A;  2GQL A;  4QL7 A;  5GAP D;  2B7J A;  4KA0 A;  2WZ9 A;  3TJF A;  5E59 A;  1A24 A;  5H5R A;  1HQO A;  4O7H A;  4I2U A;  5IMA A;  7GSS A;  1URM A;  3FW2 A;  3UVT A;  4I2T A;  4Q5F A;  6GSW A;  1A8Y A;  2WB9 A;  5HR1 A;  2V6K A;  4BL7 A;  1M2D A;  2CVB A;  4KND A;  2L57 A;  3RPP A;  4K2D A;  3D22 A;  1EOG A;  2PN8 A;  4N11 A;  3FK8 A;  2IFQ B;  1DE1 A;  1FO5 A;  4IEL A;  1O73 A;  1X9S B;  3D0Z A;  2C0G A;  3Q19 A;  1MDK A;  4NHZ A;  1AQW A;  1PMT A;  4E8E A;  2XC2 A;  19GS A;  2IWT A;  3F4R A;  3U5R E;  3CXG A;  3IA1 A;  5LD0 A;  1XFL A;  1O8X A;  3F0I A;  2H1D A;  14GS A;  1H4O A;  3F63 A;  5ECN B;  1CQH A;  3KH7 A;  3ZRD A;  4O5R A;  1K0B A;  1M7T A;  1QGV A;  4KAE A;  2GST A;  1V2A A;  2X8G A;  5A4V A;  1G7E A;  2TIR A;  4MMM A;  1M9B A;  2JZS A;  2V2G A;  4OFT A;  1R7H A;  2IPA A;  2YCD A;  2JSZ A;  4BWS A; 
#chains in the Genus database with same CATH topology
 2YZH A;  1TRW A;  1PKZ A;  3CSI A;  2R37 A;  2VM1 A;  3EMP A;  1GSY A;  3TOU A;  2C0E A;  4CW9 A;  1R5P A;  4GQF A;  2F8F A;  1FB6 A;  2TRC P;  1AW9 A;  3FYG A;  3KGK A;  3LWA A;  3IAM 2;  5HQP A;  4EIQ A;  1Z9H A;  2V32 A;  1YQ1 A;  2VL3 A;  2I4A A;  1T7P B;  18GS A;  3FR9 A;  5CRD A;  2X4A A;  3HYP A;  1GSD A;  1VRS D;  2FUG 2;  2F8A A;  2JL4 A;  3ME7 A;  5IMF A;  4BIK A;  5EL8 A;  2P5R A;  2BMX A;  5G5E A;  1OC9 A;  1XXU A;  2K18 A;  2L59 A;  1Q4J A;  2GVP A;  2CZ3 A;  1WMJ A;  3BCK A;  1EGR A;  3VUR A;  4F82 A;  3F4T A;  4N10 A;  4YQM A;  3E0U A;  3F4S A;  4MZB A;  3U6V A;  1Y25 A;  1VGL A;  4ZB6 A;  1A0F A;  3GIX A;  4KE3 A;  3TGZ A;  1NHO A;  3UAP A;  2I81 A;  1BG5 A;  1G0T A;  2HZE B;  1XWB A;  3KCM A;  4X1U A;  1Y6E A;  3M8N A;  2LRT A;  4MK3 A;  1XZO A;  4NHW A;  4OFN A;  3FZA A;  2LST A;  2E7P A;  1OKD A;  2HRF A;  2GLR A;  5EPF A;  2C0D A;  2RUE A;  2VL2 A;  3IOS A;  5DBQ A;  3UBK A;  4BVX B;  2LQQ A;  5AGY A;  2L6C A;  4KDX A;  5CRH A;  4ECC A;  2P31 A;  4X43 A;  4HUA A;  3KMN A;  2QA1 A;  2X8C A;  4NXI A;  1U6T A;  2GQK A;  1TI3 A;  3LW9 A;  3ZIV A;  1SEN A;  2F51 A;  5J5N A;  1PL1 A;  1VF4 A;  1V98 A;  1OAZ A;  3TUE A;  2R5G A;  5DCH A;  5D93 A;  3CYN A;  4EO3 A;  5LCZ A;  4DSS B;  4K8M A;  2E2G A;  3QD9 A;  2AUV A;  3NZN A;  4K5S A;  3ZMK A;  1QQ2 A;  3QOU A;  3TKQ A;  1QK8 A;  1Q98 A;  5C04 A;  2K8V A;  2VCT A;  4TR1 A;  2C80 A;  1F2E A;  4KSM A;  4FIW A;  3TKP A;  4G19 A;  4GQC A;  1GTU A;  1XW6 A;  5DVB A;  2FD3 A;  3Q18 A;  3DIE A;  1WIK A;  5IPH A;  1SYR A;  3H93 A;  4O92 A;  1FOV A;  4GST A;  1AQX A;  3D4T A;  3IHQ A;  3RHB A;  2DKI A;  5HFG A;  3F3R A;  1NSW A;  3HJP A;  2LJK A;  2B5E A;  2B3S A;  2REM A;  3I69 A;  3DD3 A;  2V1M A;  3UJ1 A;  4POB A;  1K0O A;  1AIU A;  4TKY A;  3IDV A;  1FOH A;  1EEM A;  1HYU A;  1Z7P A;  4KX4 A;  1ERV A;  4LLR A;  2LUS A;  1MTC A;  2VCZ A;  2WCI A;  1WWJ A;  1B4P A;  1OE7 A;  1PX7 A;  2HRK A;  1Z5Y E;  2MYG A;  2VCV A;  4HZ4 A;  3LSZ A;  4XS6 A;  3IK7 A;  4P3Y B;  2OBI A;  4I97 A;  2F3M A;  5FT3 A;  5JWO B;  2JAD A;  2LKU A;  1M3I A;  5KN3 A;  2HNL A;  3GTU B;  2FCH A;  2CVK A;  3A5I A;  2YZU A;  2H19 A;  2KP2 A;  5IIZ A;  2H0H A;  4I8B A;  2PPT A;  1SU9 A;  3FZ5 A;  1KTE A;  1TP9 A;  1ZZY A;  1H75 A;  4TR4 A;  17GS A;  5F0G A;  3V1W A;  2O8V B;  1ST9 A;  4IP6 A;  3FR3 A;  5AN1 A;  4V2N A;  3ERW A;  1PFO A;  4KF9 A;  4F9Z A;  5E4W A;  4EDY A;  2RM5 A;  5F8B A;  3VWV A;  3WT2 A;  1TJD A;  5HFI A;  1I5G A;  5CYY A;  2CT6 A;  3DVW A;  5D9T A;  2P0G A;  2OAC A;  2B1L A;  4PTS A;  3TKS E;  3EMX A;  3HVS A;  1HD2 A;  4I5Q A;  2I3Y A;  2VL2 C;  1E2Y A;  1GSQ A;  3TRP A;  2GDR A;  3MYD A;  1PX6 A;  3C1R A;  3M1G A;  1B4Q A;  3UBL A;  2VL9 A;  4YH2 A;  4BVY B;  2KP1 A;  3PPU A;  4YAP A;  3LOR A;  2YP6 A;  5A4U A;  1TW9 A;  2L4C A;  4KGI A;  2IMF A;  2VD1 A;  3WGD A;  3A2X A;  1GRX A;  2WS2 A;  2H6Z A;  3VWU A;  2LTK A;  5D73 A;  4QQ7 A;  1SK2 A;  3UL3 A;  4AJ7 A;  4DSS A;  3CBU A;  3A2W A;  9GSS A;  4ZL9 A;  2OJL A;  1PN0 A;  4N30 A;  3MAK A;  5CAX A;  2YWO A;  1BAY A;  4MPF A;  1SJI A;  3KD0 A;  1AQV A;  2DSA A;  3HXS A;  3J7Y k;  3TKS C;  2R0C A;  2L4Q A;  4OWY A;  2DJ3 A;  3VWX A;  3ZTL A;  4OCF A;  3MDK A;  6GSV A;  4WBR D;  2A4V A;  3UEM A;  4HQS A;  2GTU A;  2CAI A;  3ISO A;  1EP8 A;  1JZD A;  4AJ8 A;  4XHM A;  3QCP A;  3LYK A;  3RPN A;  4JZQ A;  2P5Q A;  1A8L A;  1UN2 A;  5J4U A;  3GYK A;  5ECI B;  5D9X A;  3US3 A;  2ZCT A;  3ZVJ D;  3EU4 A;  2HSH A;  1WOU A;  1ERT A;  1YY7 A;  5H5S A;  3GH9 A;  3A2V A;  2F9S A;  1YEP A;  1T4Z A;  3BCI A;  3EUR A;  3VPT A;  3A3T A;  2VLT A;  1OKT A;  4GRF A;  3QFA C;  3ERG A;  2G0F A;  4MF6 A;  4XTS A;  1GSF A;  4ZXG A;  3TDG A;  3NOF A;  4TVE A;  3WGE A;  5ELG A;  3J7Y b;  2XBQ A;  4KCE A;  4HEA 2;  2HI7 A;  2R6K A;  3W6G A;  1ZL9 A;  2DC5 A;  2AHE A;  5ECS A;  5AIS A;  1RQM A;  3QDN A;  1V57 A;  2FA4 A;  1ZYN A;  3O3T A;  2IMD A;  3FEU A;  2L5O A;  1ILO A;  3PGT A;  1T3B A;  1SKS B;  2YWI A;  3CTG A;  2EC4 A;  2X8H A;  4J56 E;  4RUV A;  2H75 A;  4MJA A;  4RI7 A;  1VF3 A;  2FWH A;  5JWQ B;  5B8A A;  2WFC A;  1UVZ A;  3MWH A;  2C3T A;  3AY8 A;  4MA9 A;  3R2Q A;  2C3Q A;  4NAX A;  3IBH A;  4FYU A;  2R3X A;  2K6V A;  4KCA A;  4RQX A;  8GSS A;  1THO A;  2VCQ A;  2BTO T;  4DSR A;  3APQ A;  1PSQ A;  2XBI A;  3HHV A;  2YNX A;  5CRW A;  3ZML A;  5IM9 A;  2FGX A;  1JZW A;  1K3L A;  3G7Y A;  4PUF C;  3M3M A;  1A2M A;  2LRC A;  1BJX A;  3GMF A;  4GTU A;  3TRX A;  2CVD A;  3QAG A;  5FWG A;  4HSC X;  5DAK B;  5HR2 A;  4D73 B;  3H8Q A;  2O7K A;  3F9U A;  5ELA A;  2A2R A;  4DVC A;  2X49 A;  4L0W A;  4WR4 A;  4EUY A;  5DAL A;  2V6O A;  1EGO A;  2GT5 A;  2KHP A;  2HYX A;  4TN8 A;  4IW9 A;  2G2Q A;  5GAN D;  1B9X C;  3P2A A;  3QMX A;  4PUA A;  4CDO A;  1Z7R A;  6GSU A;  1MD3 A;  4LMV A;  2HZF A;  3EPT A;  3QR6 A;  1QUW A;  5IQY A;  5GST A;  2UZ8 A;  3WD6 A;  3GX8 A;  2YAN A;  4PXO A;  4ECI A;  3SWL A;  1TRV A;  2E0Q A;  2JZT A;  4TOP A;  2MBT A;  3KH9 A;  1PA3 A;  4X0X A;  1SK1 A;  1NHY A;  3ZIT A;  2L6D A;  1F37 A;  1YZX A;  1LU4 A;  4YAV A;  1QXH A;  3CMI A;  4EIP A;  4TR0 A;  3GKX A;  5CNW A;  4MLY A;  4F2I A;  4MAB A;  3DGQ A;  2H01 A;  4L5O A;  2DJK A;  3Q74 A;  2B5Y A;  3GH6 A;  2RII A;  2H74 A;  2R4V A;  2M72 A;  5H5Q A;  1PKW A;  4L8E A;  3ZZX A;  2FWF A;  1M2A A;  3FZ4 A;  3W8J A;  1Z6M A;  5G31 A;  2AV4 A;  3IE3 A;  1GSU A;  4EL1 A;  1MDI A;  1JLW A;  3BD2 A;  1GL8 A;  4ZBB A;  1TRS A;  1HNC A;  3ZFL A;  3RDW A;  1O8W A;  2MMA A;  3TOT A;  1TRU A;  2XPE A;  2GS3 A;  1AC1 A;  1B9Y C;  5IMV A;  1ERU A;  5ECK B;  1GSS A;  2VCW A;  3EE2 A;  1M9A A;  4IN0 A;  5KN0 A;  2C0F A;  2J23 A;  3ZRE A;  2HT9 A;  3IXR A;  4WR5 A;  4XCS A;  3A5W A;  3APO A;  5COH A;  3HJO A;  4X4J A;  2IFQ A;  3F3Q A;  4AJ6 A;  3DEX A;  3OR5 A;  1SL0 B;  4EDZ A;  4ILF A;  2H30 A;  5IOX A;  4G2E A;  1G7O A;  3H1N A;  1U3I A;  2YWN A;  1A23 A;  1F3A A;  4MF5 A;  4OO5 A;  3PH9 A;  5GZZ B;  3HY2 A;  5L71 A;  1ZYP A;  1EZK A;  3IR4 A;  5B6N A;  4YKF A;  2ON5 A;  5EY6 A;  1RW1 A;  16GS A;  4JE1 A;  2PBJ A;  2H6X A;  2JU5 A;  1T8E B;  3KIJ A;  1SYX A;  1VF1 A;  4K6X A;  12GS A;  2HRN A;  1FG4 A;  3KJY A;  4I6X A;  5AIX A;  1ERW A;  3RBT A;  5D9W A;  4NWY A;  4WEY A;  1A2L A;  4LL1 B;  3E9J B;  1XWA A;  1Z3E A;  2Z9S A;  3HVN A;  5C00 A;  5DQS A;  2MZC A;  5DJL A;  4KDU A;  3WT1 A;  1WRY A;  2KLX A;  2N5A A;  3N9J A;  5IO2 A;  1XW9 A;  1SL2 B;  2HE3 A;  2OA7 A;  4TXO B;  1R4W A;  1XW5 A;  3P8W A;  4DEJ A;  3EC3 A;  2NBS A;  1DSB A;  4O5U A;  5ID2 B;  2MMO A;  5G2Z A;  3GRX A;  4BPY A;  4YQV A;  5J3R A;  3L78 A;  3I9V 2;  3LG6 A;  4BWQ A;  4HU7 A;  1TKD B;  5IPG A;  2YV7 A;  4K7I A;  4NPB A;  1XWC A;  3TJJ A;  3FY7 A;  2NPB A;  3DKS A;  3NIV A;  4KDY A;  2H76 A;  1SKW B;  3C7M A;  1X5D A;  3MIX A;  3QAW A;  3ZL5 A;  2LRN A;  2H6Y A;  2FLS A;  1V58 A;  2B5X A;  5KOW A;  1T1V A;  2GQM A;  1THX A;  1GTI A;  3KZQ A;  2QGV A;  3HA9 A;  2ZNM A;  5KN1 A;  1IYH A;  1M0U A;  2HXK A;  2OE0 A;  3KEB A;  1S3R A;  3GKM A;  4TW5 A;  5DQY A;  3ZVJ A;  1XOB A;  1SJZ A;  4WF5 A;  5A4W A;  2PGT A;  2HZE A;  3GUR A;  6GSS A;  1TDI A;  4O32 A;  4CY8 A;  4V1A p;  4IVF A;  3L9U A;  1KBN A;  3G9B A;  2HSM A;  4ECJ A;  4HOJ A;  3HJM A;  2N5B A;  4NV5 A;  1UA5 A;  4OFM A;  2CX4 A;  2FWG A;  3Q6O A;  3C8E A;  1USB A;  2H0G A;  3LFL A;  1IYI A;  3TB2 A;  4BVX A;  2X99 A;  1XVQ A;  1OVN A;  1G6W A;  2H1G A;  4JED A;  3WGX A;  1YF1 A;  4PNG A;  2H71 A;  5FHI A;  1SD9 A;  5KN2 A;  4Z2U A;  1ML6 A;  1TK8 B;  1WPI A;  4HDE A;  2TRX A;  3IV4 A;  2IN3 A;  2NDO A;  2O85 A;  4BL7 B;  4ZL7 A;  1RK4 A;  4IJ3 A;  2QSI A;  1MEK A;  3GL5 A;  4Q5Q A;  5ECQ B;  2HSY A;  2C1Y A;  1A2J A;  2MMZ A;  1Z6N A;  1M99 A;  5DCG A;  3BOA A;  1FW1 A;  5F06 A;  5B8B A;  4JRR A;  3QPM A;  1R5A A;  1PD2 1;  4GSN A;  4POM A;  3PR8 A;  1ZGN A;  3HKR A;  1G6Y A;  1YF0 A;  2AAW A;  2YPM A;  2KUC A;  4HZ2 A;  5GSS A;  1K3Y A;  1K0D A;  4KH7 A;  4RI6 A;  1WE0 A;  3D21 A;  3GFK A;  1ZCP A;  3HD5 A;  5ECP B;  4Z2R A;  1ABA A;  5LNK e;  3EWL A;  3TRQ A;  3MSZ A;  4HQZ A;  3EVI A;  2GGT A;  3LXT A;  5G1K A;  3ZFB A;  4K0G A;  1O85 A;  5ID2 A;  1I9D A;  4NMU A;  1ZYE A;  1HNA A;  3ZIJ A;  3WYW A;  4H86 A;  5A5K A;  2QA2 A;  4WKW A;  3LYP A;  3DXB A;  2IME A;  4Z2T A;  3F6D A;  4LL4 B;  3GTU A;  1PRX A;  2IJY A;  3L0H A;  2DIZ A;  5JWR B;  2CA8 A;  3LJR A;  2FHE A;  3GUS A;  2R0P A;  3HZ4 A;  2I9H A;  1DE2 A;  3G7J A;  1TK0 B;  1GP1 A;  4HJM A;  1JFU A;  1WP0 A;  4F03 A;  4NV2 A;  2LQO A;  4MZC A;  3GST A;  2LNT A;  3UOM A;  1X9W B;  2DBC A;  1ZYQ B;  1T00 A;  3M0F A;  4EKZ A;  1MDJ A;  2XHF A;  2GSQ A;  2QC7 A;  1SL1 B;  1OC3 A;  2JSY A;  5F05 A;  2OE3 A;  4PQH A;  3GA4 A;  1OC9 B;  4POK A;  22GS A;  3L9S A;  4POL A;  1EWX A;  1ON4 A;  3HCZ A;  4Q5N A;  1J08 A;  4ID0 A;  3TJK A;  3ED3 A;  4GLT A;  4EF0 A;  2OKA A;  2CZ2 A;  3I6A A;  2CAQ A;  2FNO A;  5J9B A;  5HFK A;  1JZR A;  2K9F A;  2YJ7 A;  4MDC A;  3I43 A;  1S3C A;  1ZMA A;  3FRC A;  1YKA A;  3K8N A;  4DSQ A;  4F0C A;  4OO4 A;  4BVY A;  1CQG A;  2VLV A;  2FA8 A;  3SBC A;  2PU9 C;  2RLI A;  2YOI A;  20GS A;  4ML1 A;  1X0R A;  4ECB A;  4TXV A;  3C1S A;  4USS A;  5KEJ A;  1KEB A;  3L4N A;  3CRT A;  5HR3 A;  3BBY A;  3GKN A;  4LMW A;  1XWK A;  3S9F A;  5HR0 A;  5JCU A;  1XOA A;  5J41 A;  1U3A A;  3IPZ A;  2WJU A;  1X5E A;  1SK0 A;  2AYT A;  1F6M C;  3GKK A;  3RHC A;  3TJB A;  2N5F A;  1O81 A;  2GZZ A;  4HJ2 A;  3IC8 A;  4ZBD A;  2H72 A;  2OAD A;  4HU9 A;  2AJQ B;  2QKE A;  2H66 A;  3GL3 A;  5BMU A;  11GS A;  1TK5 B;  2CQ9 A;  4K1F A;  2O89 A;  5D96 A;  2YV9 A;  2FWE A;  3IHG A;  1FVK A;  2WDU A;  3P90 A;  2ALB A;  1ACV A;  4MZW A;  4JR4 A;  4KSO A;  4IBP A;  4TR1 B;  6GSX A;  3QFB C;  4IQA A;  1BX9 A;  5IMC A;  4GF0 A;  1XWG A;  4K2X A;  1GSE A;  3CRU A;  2H0I A;  4MP4 A;  1FVJ A;  3O6T A;  1BED A;  1PGT A;  1J0F A;  1YEX A;  4ZBA A;  2VM2 A;  4IHU A;  3TKR A;  13GS A;  1TU8 A;  2AB6 A;  4Q5R A;  4G10 A;  3DYR A;  3R3E A;  4ZB9 A;  2YN1 A;  4PUR A;  3KM6 A;  2PWJ A;  2DJ1 A;  3CSH A;  2H1B A;  2GSS A;  5DDL A;  4YKG A;  4K9Z A;  2OBK A;  2VO4 A;  2A4H A;  3KP9 A;  4K7N A;  4EXJ A;  2DJJ A;  4FH8 A;  1N2A A;  4MJE A;  2BJX A;  2PVO C;  3VLN A;  4ZL8 A;  1E6B A;  3EU3 A;  1NW2 A;  1GUM A;  2CX3 A;  2DLX A;  3ZLP A;  3DWV A;  6GSY A;  3MNG A;  3GSS A;  2IIY A;  2DJ2 A;  1BYE A;  1EP7 A;  2GT6 A;  3JCM L;  2R2J A;  2H1A A;  5EVO A;  3VI5 A;  3M9K A;  1BQ7 A;  1YDK A;  2H8L A;  4ZIJ A;  5J9C A;  2EIO A;  4AF2 A;  1B48 A;  4MCU A;  3GNJ A;  2GZP A;  1A0R P;  1TXX A;  5IMZ A;  2R0G A;  4XS4 B;  5B6M A;  3IK9 A;  1M2B A;  1XBS A;  5IO0 A;  1XVW A;  5ECR B;  2VAF A;  2IL3 A;  1UC7 A;  3KMO A;  4ULX A;  4F0B A;  4IKH A;  2B6M A;  2LJR A;  1WJK A;  1EV4 A;  4K7O A;  2GZY A;  4GWR A;  4PGT A;  2EIQ A;  2M80 A;  1MD4 A;  4A5P A;  3IRA A;  3BJ5 A;  1V40 A;  3KXO A;  4PQI A;  4RQR A;  2V41 A;  1GUL A;  1EOH A;  2MBS A;  2IMK A;  1GLP A;  4PQ1 A;  4ACS A;  5DAK A;  4HI7 A;  3UMA A;  4D73 A;  1SD8 A;  2NTO A;  4XRA A;  1PL2 A;  2ON7 A;  3UVH A;  2VUP A;  3KTB A;  2A2S A;  4IJI A;  4XRD A;  3L9V A;  4MH2 A;  4G0I A;  4FYC A;  4AGS A;  3PIN A;  2C8U A;  3LQ7 A;  1S3D A;  5CO3 A;  2ZUP A;  4WF4 A;  1FB0 A;  3F8U A;  3GV1 A;  2X64 A;  3CSJ A;  1QFN A;  5JCW A;  1LJR A;  3TCO A;  2H73 A;  4BA7 A;  3VK9 A;  4V1A g;  2WUL A;  1KNG A;  3ME8 A;  5ECO B;  4HS1 A;  1TU7 A;  1U87 A;  4MH3 A;  4G0K A;  3TKS A;  3DML A;  3H4K A;  4CY6 A;  1VF2 A;  4O5Q A;  1GUH A;  1R26 A;  4TR3 A;  5B7C A;  3UIW A;  3D6I A;  4MJC A;  3LGC A;  2IMI A;  4IS0 A;  3W8S A;  3HVX A;  2DIY A;  5ECM B;  2L5L A;  4LA1 A;  3O76 A;  1YKC A;  10GS A;  4WXT A;  5IMD A;  4J2F A;  1JZO A;  1HNB A;  1GH2 A;  3TJG A;  2DJ0 A;  1TOF A;  3HZ8 A;  4KW6 A;  2C3N A;  2OE1 A;  3VFI A;  5JCG A;  3DRN A;  4WET A;  4ZB8 A;  4ZIL A;  5G5F A;  2NVL A;  4MF7 A;  1JHB A;  5D8I A;  1SJ6 A;  1B8X A;  2FY6 A;  4OCE A;  1AXD A;  1GLQ A;  4ICY A;  4TRX A;  2B7K A;  1C72 A;  1W89 A;  1DUG A;  1K3O A;  4KB3 A;  3FKF A;  4V2L A;  3ZYW A;  2JAC A;  2MMN A;  5D9V A;  1YJ6 A;  3P7X A;  2DMM A;  3C71 A;  2B1K A;  2VOC A;  2LV3 A;  2RUF A;  4MNN A;  1OC8 A;  1AAZ A;  1S3A A;  2GSR A;  2VD0 A;  4XS4 A;  4EVM A;  3VWW A;  5F07 A;  2VCX A;  1K0N A;  2DML A;  5BRT A;  3EIN A;  3E3E A;  5G1L A;  1JLV A;  1OYJ A;  4N0V A;  1QMV A;  3M9J A;  2M46 A;  4IQ1 A;  4YQU A;  2WGR A;  3CTF A;  2LEG A;  4QL9 A;  1W4V A;  2PUK C;  3QAV A;  4L5L A;  1TI1 A;  2E2M A;  3HDC A;  5INY A;  1N8J A;  1T4Y A;  2EIR A;  4MJB A;  4XS1 A;  2D2Z A;  4N0Z A;  2KOK A;  4WBJ A;  5KOX A;  2H70 A;  4XIH A;  3VPQ A;  1GTB A;  4OMV A;  3GX0 A;  4KUN A;  2PVQ A;  4ML6 A;  2K8S A;  3LXZ A;  1J9B A;  1U88 A;  3UAR A;  2DKH A;  1O6J A;  1OE8 A;  3D5J A;  2LJA A;  3C73 A;  1TTZ A;  3HVV A;  1GWC A;  1ZOF A;  4PX1 A;  2LNS A;  2CV4 A;  5CRE A;  2XPD A;  4CHS A;  6GST A;  4E8H A;  4J57 E;  3FMW A;  1XG8 A;  1FHE A;  4V2M A;  1GUK A;  1XIY A;  3IC4 A;  1PQN A;  2JZR A;  2PER A;  2O87 A;  4G9H A;  1F9M A;  2YWM A;  3G7I A;  4FO5 A;  2A2P A;  3IAS 2;  1V9W A;  4K0N A;  5DAL B;  3N5O A;  4TXO A;  1GNW A;  2C4J A;  4OD7 A;  1XCC A;  1NM3 A;  3RAZ A;  4IP1 A;  3D4M A;  4IGJ A;  2RM6 A;  3FZ9 A;  3APS A;  2PMT A;  3DVX A;  1EV9 A;  3VI7 A;  1LBK A;  5ECL B;  4JR6 A;  3H79 A;  3LEF A;  3FHK A;  4JBB A;  1GTA A;  4L0U A;  4EC0 A;  3KP8 A;  3F6F A;  1K0M A;  3GHA A;  2HFD A;  2J9H A;  5G30 A;  3KTL A;  1K0A A;  5IOW A;  5CRG A;  1F3B A;  4JU5 A;  2VLU A;  1EEJ A;  1FAA A;  4FYB A;  1K0C A;  3ERF A;  1PN9 A;  1O7U A;  2HRA A;  5CP1 A;  3FR6 A;  3GN3 A;  4GXZ A;  4EE0 A;  4GCI A;  5ABR A;  2ES7 A;  3CQF A;  1GNE A;  1SKR B;  4G0L A;  5ECH B;  1XPV A;  2WRT A;  5DJM A;  4FQU A;  2I1U A;  2VIM A;  4GSS A;  3EYT A;  2HLS A;  2LS5 A;  5AIV A;  1DBY A;  4Z7X A;  5ENU A;  1X9M B;  1M3J A;  4ISD A;  4PNF A;  2YJH A;  1AUC A;  1X5C A;  4MPG A;  2GQL A;  4QL7 A;  5GAP D;  2B7J A;  4KA0 A;  2WZ9 A;  3TJF A;  5E59 A;  1A24 A;  5H5R A;  1HQO A;  4O7H A;  4I2U A;  5IMA A;  7GSS A;  1URM A;  3FW2 A;  3UVT A;  4I2T A;  4Q5F A;  6GSW A;  1A8Y A;  2WB9 A;  5HR1 A;  2V6K A;  4BL7 A;  1M2D A;  2CVB A;  4KND A;  2L57 A;  3RPP A;  4K2D A;  3D22 A;  4K5R A;  1EOG A;  2PN8 A;  4N11 A;  3FK8 A;  2IFQ B;  1DE1 A;  1FO5 A;  4IEL A;  1O73 A;  1X9S B;  3D0Z A;  2C0G A;  3Q19 A;  1MDK A;  4NHZ A;  1AQW A;  1PMT A;  4E8E A;  2XC2 A;  19GS A;  2IWT A;  3F4R A;  3U5R E;  3CXG A;  3IA1 A;  5LD0 A;  1XFL A;  1O8X A;  3F0I A;  2H1D A;  14GS A;  1H4O A;  3F63 A;  5ECN B;  1CQH A;  3KH7 A;  3ZRD A;  4O5R A;  1K0B A;  1M7T A;  1QGV A;  4KAE A;  2GST A;  1V2A A;  2X8G A;  5A4V A;  1G7E A;  2TIR A;  4MMM A;  1M9B A;  2JZS A;  2V2G A;  4OFT A;  1R7H A;  2IPA A;  2YCD A;  2JSZ A;  4BWS A; 
#chains in the Genus database with same CATH homology
 2YZH A;  1TRW A;  1PKZ A;  3CSI A;  2R37 A;  2VM1 A;  3EMP A;  1GSY A;  3TOU A;  2C0E A;  4CW9 A;  1R5P A;  4GQF A;  2F8F A;  1FB6 A;  2TRC P;  1AW9 A;  3FYG A;  3KGK A;  3LWA A;  3IAM 2;  5HQP A;  4EIQ A;  1Z9H A;  2V32 A;  1YQ1 A;  2VL3 A;  2I4A A;  1T7P B;  18GS A;  3FR9 A;  5CRD A;  2X4A A;  3HYP A;  1GSD A;  1VRS D;  2FUG 2;  2F8A A;  2JL4 A;  3ME7 A;  5IMF A;  5EL8 A;  2P5R A;  2BMX A;  5G5E A;  1OC9 A;  1XXU A;  2K18 A;  2L59 A;  1Q4J A;  2GVP A;  2CZ3 A;  1WMJ A;  3BCK A;  1EGR A;  3VUR A;  4F82 A;  3F4T A;  4N10 A;  4YQM A;  3E0U A;  3F4S A;  4MZB A;  3U6V A;  1Y25 A;  1VGL A;  4ZB6 A;  1A0F A;  3GIX A;  4KE3 A;  3TGZ A;  1NHO A;  3UAP A;  2I81 A;  1BG5 A;  1G0T A;  2HZE B;  1XWB A;  3KCM A;  4X1U A;  1Y6E A;  3M8N A;  2LRT A;  4MK3 A;  1XZO A;  4NHW A;  4OFN A;  3FZA A;  2LST A;  2E7P A;  1OKD A;  2HRF A;  2GLR A;  5EPF A;  2C0D A;  2RUE A;  2VL2 A;  3IOS A;  5DBQ A;  3UBK A;  4BVX B;  2LQQ A;  5AGY A;  2L6C A;  4KDX A;  5CRH A;  4ECC A;  2P31 A;  4X43 A;  4HUA A;  3KMN A;  2QA1 A;  2X8C A;  4NXI A;  1U6T A;  2GQK A;  1TI3 A;  3LW9 A;  3ZIV A;  1SEN A;  2F51 A;  5J5N A;  1PL1 A;  1VF4 A;  1V98 A;  1OAZ A;  3TUE A;  2R5G A;  5DCH A;  5D93 A;  3CYN A;  4EO3 A;  5LCZ A;  4DSS B;  4K8M A;  2E2G A;  3QD9 A;  2AUV A;  3NZN A;  4K5S A;  3ZMK A;  1QQ2 A;  3QOU A;  3TKQ A;  1QK8 A;  1Q98 A;  5C04 A;  2K8V A;  2VCT A;  4TR1 A;  2C80 A;  1F2E A;  4KSM A;  4FIW A;  3TKP A;  4G19 A;  4GQC A;  1GTU A;  1XW6 A;  5DVB A;  2FD3 A;  3Q18 A;  3DIE A;  1WIK A;  5IPH A;  1SYR A;  3H93 A;  4O92 A;  1FOV A;  4GST A;  1AQX A;  3D4T A;  3IHQ A;  3RHB A;  2DKI A;  5HFG A;  3F3R A;  1NSW A;  3HJP A;  2LJK A;  2B5E A;  2B3S A;  2REM A;  3I69 A;  3DD3 A;  2V1M A;  3UJ1 A;  4POB A;  1K0O A;  1AIU A;  4TKY A;  3IDV A;  1FOH A;  1EEM A;  1HYU A;  1Z7P A;  4KX4 A;  1ERV A;  4LLR A;  2LUS A;  1MTC A;  2VCZ A;  2WCI A;  1WWJ A;  1B4P A;  1OE7 A;  1PX7 A;  2HRK A;  1Z5Y E;  2MYG A;  2VCV A;  4HZ4 A;  3LSZ A;  4XS6 A;  3IK7 A;  4P3Y B;  2OBI A;  4I97 A;  2F3M A;  5FT3 A;  5JWO B;  2JAD A;  2LKU A;  5KN3 A;  2HNL A;  3GTU B;  2FCH A;  2CVK A;  3A5I A;  2YZU A;  2H19 A;  2KP2 A;  5IIZ A;  2H0H A;  4I8B A;  2PPT A;  1SU9 A;  3FZ5 A;  1KTE A;  1TP9 A;  1ZZY A;  1H75 A;  4TR4 A;  17GS A;  5F0G A;  3V1W A;  2O8V B;  1ST9 A;  4IP6 A;  3FR3 A;  5AN1 A;  4V2N A;  3ERW A;  4KF9 A;  4F9Z A;  5E4W A;  4EDY A;  2RM5 A;  5F8B A;  3VWV A;  3WT2 A;  1TJD A;  5HFI A;  1I5G A;  5CYY A;  2CT6 A;  3DVW A;  5D9T A;  2P0G A;  2OAC A;  2B1L A;  4PTS A;  3TKS E;  3EMX A;  3HVS A;  1HD2 A;  4I5Q A;  2I3Y A;  2VL2 C;  1E2Y A;  1GSQ A;  3TRP A;  2GDR A;  3MYD A;  1PX6 A;  3C1R A;  3M1G A;  1B4Q A;  3UBL A;  2VL9 A;  4YH2 A;  4BVY B;  2KP1 A;  3PPU A;  4YAP A;  3LOR A;  2YP6 A;  5A4U A;  1TW9 A;  2L4C A;  4KGI A;  2IMF A;  2VD1 A;  3WGD A;  3A2X A;  1GRX A;  2WS2 A;  2H6Z A;  3VWU A;  2LTK A;  5D73 A;  4QQ7 A;  1SK2 A;  3UL3 A;  4AJ7 A;  4DSS A;  3CBU A;  3A2W A;  9GSS A;  4ZL9 A;  2OJL A;  1PN0 A;  4N30 A;  3MAK A;  5CAX A;  2YWO A;  1BAY A;  4MPF A;  1SJI A;  3KD0 A;  1AQV A;  2DSA A;  3HXS A;  3J7Y k;  3TKS C;  2R0C A;  2L4Q A;  4OWY A;  2DJ3 A;  3VWX A;  3ZTL A;  4OCF A;  3MDK A;  6GSV A;  4WBR D;  2A4V A;  3UEM A;  4HQS A;  2GTU A;  2CAI A;  3ISO A;  1EP8 A;  1JZD A;  4AJ8 A;  4XHM A;  3QCP A;  3LYK A;  3RPN A;  4JZQ A;  2P5Q A;  1A8L A;  1UN2 A;  5J4U A;  3GYK A;  5ECI B;  5D9X A;  3US3 A;  2ZCT A;  3ZVJ D;  3EU4 A;  2HSH A;  1WOU A;  1ERT A;  1YY7 A;  5H5S A;  3GH9 A;  3A2V A;  2F9S A;  1YEP A;  1T4Z A;  3BCI A;  3EUR A;  3VPT A;  3A3T A;  2VLT A;  1OKT A;  4GRF A;  3QFA C;  3ERG A;  2G0F A;  4MF6 A;  4XTS A;  1GSF A;  4ZXG A;  3TDG A;  3NOF A;  4TVE A;  3WGE A;  5ELG A;  3J7Y b;  2XBQ A;  4KCE A;  4HEA 2;  2HI7 A;  2R6K A;  3W6G A;  1ZL9 A;  2DC5 A;  2AHE A;  5ECS A;  5AIS A;  1RQM A;  3QDN A;  1V57 A;  2FA4 A;  1ZYN A;  3O3T A;  2IMD A;  3FEU A;  2L5O A;  1ILO A;  3PGT A;  1T3B A;  1SKS B;  2YWI A;  3CTG A;  2EC4 A;  2X8H A;  4J56 E;  4RUV A;  2H75 A;  4MJA A;  4RI7 A;  1VF3 A;  2FWH A;  5JWQ B;  5B8A A;  2WFC A;  1UVZ A;  3MWH A;  2C3T A;  3AY8 A;  4MA9 A;  3R2Q A;  2C3Q A;  4NAX A;  3IBH A;  4FYU A;  2R3X A;  2K6V A;  4KCA A;  4RQX A;  8GSS A;  1THO A;  2VCQ A;  2BTO T;  4DSR A;  3APQ A;  1PSQ A;  2XBI A;  3HHV A;  2YNX A;  5CRW A;  3ZML A;  5IM9 A;  2FGX A;  1JZW A;  1K3L A;  3G7Y A;  4PUF C;  3M3M A;  1A2M A;  2LRC A;  1BJX A;  3GMF A;  4GTU A;  3TRX A;  2CVD A;  3QAG A;  5FWG A;  5DAK B;  5HR2 A;  4D73 B;  3H8Q A;  2O7K A;  3F9U A;  5ELA A;  2A2R A;  4DVC A;  2X49 A;  4L0W A;  4WR4 A;  4EUY A;  5DAL A;  2V6O A;  1EGO A;  2GT5 A;  2KHP A;  2HYX A;  4TN8 A;  4IW9 A;  2G2Q A;  5GAN D;  1B9X C;  3P2A A;  3QMX A;  4PUA A;  4CDO A;  1Z7R A;  6GSU A;  1MD3 A;  4LMV A;  2HZF A;  3EPT A;  3QR6 A;  1QUW A;  5IQY A;  5GST A;  2UZ8 A;  3WD6 A;  3GX8 A;  2YAN A;  4PXO A;  4ECI A;  3SWL A;  1TRV A;  2E0Q A;  2JZT A;  4TOP A;  2MBT A;  3KH9 A;  1PA3 A;  4X0X A;  1SK1 A;  1NHY A;  3ZIT A;  2L6D A;  1F37 A;  1YZX A;  1LU4 A;  4YAV A;  1QXH A;  3CMI A;  4EIP A;  4TR0 A;  3GKX A;  5CNW A;  4MLY A;  4F2I A;  4MAB A;  3DGQ A;  2H01 A;  4L5O A;  2DJK A;  3Q74 A;  2B5Y A;  3GH6 A;  2RII A;  2H74 A;  2R4V A;  2M72 A;  5H5Q A;  1PKW A;  4L8E A;  3ZZX A;  2FWF A;  1M2A A;  3FZ4 A;  3W8J A;  1Z6M A;  5G31 A;  2AV4 A;  3IE3 A;  1GSU A;  4EL1 A;  1MDI A;  1JLW A;  3BD2 A;  1GL8 A;  4ZBB A;  1TRS A;  1HNC A;  3ZFL A;  3RDW A;  1O8W A;  2MMA A;  3TOT A;  1TRU A;  2XPE A;  2GS3 A;  1AC1 A;  1B9Y C;  5IMV A;  1ERU A;  5ECK B;  1GSS A;  2VCW A;  3EE2 A;  1M9A A;  4IN0 A;  5KN0 A;  2C0F A;  2J23 A;  3ZRE A;  2HT9 A;  3IXR A;  4WR5 A;  4XCS A;  3A5W A;  3APO A;  5COH A;  3HJO A;  4X4J A;  2IFQ A;  3F3Q A;  4AJ6 A;  3DEX A;  3OR5 A;  1SL0 B;  4EDZ A;  4ILF A;  2H30 A;  5IOX A;  4G2E A;  1G7O A;  3H1N A;  1U3I A;  2YWN A;  1A23 A;  1F3A A;  4MF5 A;  4OO5 A;  3PH9 A;  5GZZ B;  3HY2 A;  5L71 A;  1ZYP A;  1EZK A;  3IR4 A;  5B6N A;  4YKF A;  2ON5 A;  5EY6 A;  1RW1 A;  16GS A;  4JE1 A;  2PBJ A;  2H6X A;  2JU5 A;  1T8E B;  3KIJ A;  1SYX A;  1VF1 A;  4K6X A;  12GS A;  2HRN A;  1FG4 A;  3KJY A;  4I6X A;  5AIX A;  1ERW A;  3RBT A;  5D9W A;  4NWY A;  4WEY A;  1A2L A;  4LL1 B;  3E9J B;  1XWA A;  1Z3E A;  2Z9S A;  5C00 A;  5DQS A;  2MZC A;  5DJL A;  4KDU A;  3WT1 A;  1WRY A;  2KLX A;  2N5A A;  3N9J A;  5IO2 A;  1XW9 A;  1SL2 B;  2HE3 A;  2OA7 A;  4TXO B;  1R4W A;  1XW5 A;  3P8W A;  4DEJ A;  3EC3 A;  2NBS A;  1DSB A;  4O5U A;  5ID2 B;  2MMO A;  5G2Z A;  3GRX A;  4BPY A;  4YQV A;  5J3R A;  3L78 A;  3I9V 2;  3LG6 A;  4BWQ A;  4HU7 A;  1TKD B;  5IPG A;  2YV7 A;  4K7I A;  4NPB A;  1XWC A;  3TJJ A;  3FY7 A;  2NPB A;  3DKS A;  3NIV A;  4KDY A;  2H76 A;  1SKW B;  3C7M A;  1X5D A;  3MIX A;  3QAW A;  3ZL5 A;  2LRN A;  2H6Y A;  2FLS A;  1V58 A;  2B5X A;  5KOW A;  1T1V A;  2GQM A;  1THX A;  1GTI A;  3KZQ A;  2QGV A;  3HA9 A;  2ZNM A;  5KN1 A;  1IYH A;  1M0U A;  2HXK A;  2OE0 A;  3KEB A;  3GKM A;  4TW5 A;  5DQY A;  3ZVJ A;  1XOB A;  1SJZ A;  4WF5 A;  5A4W A;  2PGT A;  2HZE A;  3GUR A;  6GSS A;  1TDI A;  4O32 A;  4CY8 A;  4V1A p;  4IVF A;  3L9U A;  1KBN A;  3G9B A;  2HSM A;  4ECJ A;  4HOJ A;  3HJM A;  2N5B A;  4NV5 A;  1UA5 A;  4OFM A;  2CX4 A;  2FWG A;  3Q6O A;  3C8E A;  1USB A;  2H0G A;  3LFL A;  1IYI A;  3TB2 A;  4BVX A;  2X99 A;  1XVQ A;  1OVN A;  1G6W A;  2H1G A;  4JED A;  3WGX A;  1YF1 A;  4PNG A;  2H71 A;  5FHI A;  1SD9 A;  5KN2 A;  4Z2U A;  1ML6 A;  1TK8 B;  1WPI A;  4HDE A;  2TRX A;  3IV4 A;  2IN3 A;  2NDO A;  2O85 A;  4BL7 B;  4ZL7 A;  1RK4 A;  4IJ3 A;  2QSI A;  1MEK A;  3GL5 A;  4Q5Q A;  5ECQ B;  2HSY A;  2C1Y A;  1A2J A;  2MMZ A;  1Z6N A;  1M99 A;  5DCG A;  3BOA A;  1FW1 A;  5F06 A;  5B8B A;  4JRR A;  3QPM A;  1R5A A;  1PD2 1;  4GSN A;  4POM A;  3PR8 A;  1ZGN A;  3HKR A;  1G6Y A;  1YF0 A;  2AAW A;  2YPM A;  2KUC A;  4HZ2 A;  5GSS A;  1K3Y A;  1K0D A;  4KH7 A;  4RI6 A;  1WE0 A;  3D21 A;  3GFK A;  1ZCP A;  3HD5 A;  5ECP B;  4Z2R A;  1ABA A;  5LNK e;  3EWL A;  3TRQ A;  3MSZ A;  4HQZ A;  3EVI A;  2GGT A;  3LXT A;  5G1K A;  3ZFB A;  4K0G A;  1O85 A;  5ID2 A;  1I9D A;  4NMU A;  1ZYE A;  1HNA A;  3ZIJ A;  3WYW A;  4H86 A;  5A5K A;  2QA2 A;  4WKW A;  3LYP A;  3DXB A;  2IME A;  4Z2T A;  3F6D A;  4LL4 B;  3GTU A;  1PRX A;  2IJY A;  3L0H A;  2DIZ A;  5JWR B;  2CA8 A;  3LJR A;  2FHE A;  3GUS A;  2R0P A;  3HZ4 A;  2I9H A;  1DE2 A;  3G7J A;  1TK0 B;  1GP1 A;  4HJM A;  1JFU A;  1WP0 A;  4F03 A;  4NV2 A;  2LQO A;  4MZC A;  3GST A;  2LNT A;  3UOM A;  1X9W B;  2DBC A;  1ZYQ B;  1T00 A;  3M0F A;  4EKZ A;  1MDJ A;  2XHF A;  2GSQ A;  2QC7 A;  1SL1 B;  1OC3 A;  2JSY A;  5F05 A;  2OE3 A;  4PQH A;  3GA4 A;  1OC9 B;  4POK A;  22GS A;  3L9S A;  4POL A;  1EWX A;  1ON4 A;  3HCZ A;  4Q5N A;  1J08 A;  4ID0 A;  3TJK A;  3ED3 A;  4GLT A;  4EF0 A;  2OKA A;  2CZ2 A;  3I6A A;  2CAQ A;  2FNO A;  5J9B A;  5HFK A;  1JZR A;  2K9F A;  2YJ7 A;  4MDC A;  3I43 A;  1S3C A;  1ZMA A;  3FRC A;  1YKA A;  3K8N A;  4DSQ A;  4F0C A;  4OO4 A;  4BVY A;  1CQG A;  2VLV A;  2FA8 A;  3SBC A;  2PU9 C;  2RLI A;  2YOI A;  20GS A;  4ML1 A;  1X0R A;  4ECB A;  4TXV A;  3C1S A;  4USS A;  5KEJ A;  1KEB A;  3L4N A;  3CRT A;  5HR3 A;  3BBY A;  3GKN A;  4LMW A;  1XWK A;  3S9F A;  5HR0 A;  5JCU A;  1XOA A;  5J41 A;  1U3A A;  3IPZ A;  2WJU A;  1X5E A;  1SK0 A;  2AYT A;  1F6M C;  3GKK A;  3RHC A;  3TJB A;  2N5F A;  1O81 A;  2GZZ A;  4HJ2 A;  3IC8 A;  4ZBD A;  2H72 A;  2OAD A;  4HU9 A;  2AJQ B;  2QKE A;  2H66 A;  3GL3 A;  5BMU A;  11GS A;  1TK5 B;  2CQ9 A;  4K1F A;  2O89 A;  5D96 A;  2YV9 A;  2FWE A;  3IHG A;  1FVK A;  2WDU A;  3P90 A;  2ALB A;  1ACV A;  4MZW A;  4JR4 A;  4KSO A;  4IBP A;  4TR1 B;  6GSX A;  3QFB C;  4IQA A;  1BX9 A;  5IMC A;  4GF0 A;  1XWG A;  4K2X A;  1GSE A;  3CRU A;  2H0I A;  4MP4 A;  1FVJ A;  3O6T A;  1BED A;  1PGT A;  1J0F A;  1YEX A;  4ZBA A;  2VM2 A;  4IHU A;  3TKR A;  13GS A;  1TU8 A;  2AB6 A;  4Q5R A;  4G10 A;  3DYR A;  3R3E A;  4ZB9 A;  2YN1 A;  4PUR A;  3KM6 A;  2PWJ A;  2DJ1 A;  3CSH A;  2H1B A;  2GSS A;  5DDL A;  4YKG A;  4K9Z A;  2OBK A;  2VO4 A;  2A4H A;  3KP9 A;  4K7N A;  4EXJ A;  2DJJ A;  4FH8 A;  1N2A A;  4MJE A;  2BJX A;  2PVO C;  3VLN A;  4ZL8 A;  1E6B A;  3EU3 A;  1NW2 A;  1GUM A;  2CX3 A;  2DLX A;  3ZLP A;  3DWV A;  6GSY A;  3MNG A;  3GSS A;  2IIY A;  2DJ2 A;  1BYE A;  1EP7 A;  2GT6 A;  3JCM L;  2R2J A;  2H1A A;  5EVO A;  3VI5 A;  3M9K A;  1BQ7 A;  1YDK A;  2H8L A;  4ZIJ A;  5J9C A;  2EIO A;  4AF2 A;  1B48 A;  4MCU A;  3GNJ A;  2GZP A;  1A0R P;  1TXX A;  5IMZ A;  2R0G A;  4XS4 B;  5B6M A;  3IK9 A;  1M2B A;  1XBS A;  5IO0 A;  1XVW A;  5ECR B;  2VAF A;  2IL3 A;  1UC7 A;  3KMO A;  4ULX A;  4F0B A;  4IKH A;  2B6M A;  2LJR A;  1WJK A;  1EV4 A;  4K7O A;  2GZY A;  4GWR A;  4PGT A;  2EIQ A;  2M80 A;  1MD4 A;  4A5P A;  3IRA A;  3BJ5 A;  1V40 A;  3KXO A;  4PQI A;  4RQR A;  2V41 A;  1GUL A;  1EOH A;  2MBS A;  2IMK A;  1GLP A;  4PQ1 A;  4ACS A;  5DAK A;  4HI7 A;  3UMA A;  4D73 A;  1SD8 A;  2NTO A;  4XRA A;  1PL2 A;  2ON7 A;  3UVH A;  2VUP A;  3KTB A;  2A2S A;  4IJI A;  4XRD A;  3L9V A;  4MH2 A;  4G0I A;  4FYC A;  4AGS A;  3PIN A;  2C8U A;  3LQ7 A;  1S3D A;  5CO3 A;  2ZUP A;  4WF4 A;  1FB0 A;  3F8U A;  3GV1 A;  2X64 A;  3CSJ A;  1QFN A;  5JCW A;  1LJR A;  3TCO A;  2H73 A;  4BA7 A;  3VK9 A;  4V1A g;  2WUL A;  1KNG A;  3ME8 A;  5ECO B;  4HS1 A;  1TU7 A;  1U87 A;  4MH3 A;  4G0K A;  3TKS A;  3DML A;  3H4K A;  4CY6 A;  1VF2 A;  4O5Q A;  1GUH A;  1R26 A;  4TR3 A;  5B7C A;  3UIW A;  3D6I A;  4MJC A;  3LGC A;  2IMI A;  4IS0 A;  3W8S A;  3HVX A;  2DIY A;  5ECM B;  2L5L A;  4LA1 A;  3O76 A;  1YKC A;  10GS A;  4WXT A;  5IMD A;  4J2F A;  1JZO A;  1HNB A;  1GH2 A;  3TJG A;  2DJ0 A;  1TOF A;  3HZ8 A;  4KW6 A;  2C3N A;  2OE1 A;  3VFI A;  5JCG A;  3DRN A;  4WET A;  4ZB8 A;  4ZIL A;  5G5F A;  2NVL A;  4MF7 A;  1JHB A;  5D8I A;  1SJ6 A;  1B8X A;  2FY6 A;  4OCE A;  1AXD A;  1GLQ A;  4ICY A;  4TRX A;  2B7K A;  1C72 A;  1W89 A;  1DUG A;  1K3O A;  4KB3 A;  3FKF A;  4V2L A;  3ZYW A;  2JAC A;  2MMN A;  5D9V A;  1YJ6 A;  3P7X A;  2DMM A;  3C71 A;  2B1K A;  2VOC A;  2LV3 A;  2RUF A;  4MNN A;  1OC8 A;  1AAZ A;  1S3A A;  2GSR A;  2VD0 A;  4XS4 A;  4EVM A;  3VWW A;  5F07 A;  2VCX A;  1K0N A;  2DML A;  5BRT A;  3EIN A;  3E3E A;  5G1L A;  1JLV A;  1OYJ A;  4N0V A;  1QMV A;  3M9J A;  2M46 A;  4IQ1 A;  4YQU A;  2WGR A;  3CTF A;  2LEG A;  4QL9 A;  1W4V A;  2PUK C;  3QAV A;  4L5L A;  1TI1 A;  2E2M A;  3HDC A;  5INY A;  1N8J A;  1T4Y A;  2EIR A;  4MJB A;  4XS1 A;  2D2Z A;  4N0Z A;  2KOK A;  4WBJ A;  5KOX A;  2H70 A;  4XIH A;  3VPQ A;  1GTB A;  4OMV A;  3GX0 A;  4KUN A;  2PVQ A;  4ML6 A;  2K8S A;  3LXZ A;  1J9B A;  1U88 A;  3UAR A;  2DKH A;  1O6J A;  1OE8 A;  3D5J A;  2LJA A;  3C73 A;  1TTZ A;  3HVV A;  1GWC A;  1ZOF A;  4PX1 A;  2LNS A;  2CV4 A;  5CRE A;  2XPD A;  4CHS A;  6GST A;  4E8H A;  4J57 E;  3FMW A;  1FHE A;  4V2M A;  1GUK A;  1XIY A;  3IC4 A;  1PQN A;  2JZR A;  2PER A;  2O87 A;  4G9H A;  1F9M A;  2YWM A;  3G7I A;  4FO5 A;  2A2P A;  3IAS 2;  1V9W A;  4K0N A;  5DAL B;  3N5O A;  4TXO A;  1GNW A;  2C4J A;  4OD7 A;  1XCC A;  1NM3 A;  3RAZ A;  4IP1 A;  3D4M A;  4IGJ A;  2RM6 A;  3FZ9 A;  3APS A;  2PMT A;  3DVX A;  1EV9 A;  3VI7 A;  1LBK A;  5ECL B;  4JR6 A;  3H79 A;  3LEF A;  3FHK A;  4JBB A;  1GTA A;  4L0U A;  4EC0 A;  3KP8 A;  3F6F A;  1K0M A;  3GHA A;  2HFD A;  2J9H A;  5G30 A;  3KTL A;  1K0A A;  5IOW A;  5CRG A;  1F3B A;  4JU5 A;  2VLU A;  1EEJ A;  1FAA A;  4FYB A;  1K0C A;  3ERF A;  1PN9 A;  1O7U A;  2HRA A;  5CP1 A;  3FR6 A;  3GN3 A;  4GXZ A;  4EE0 A;  4GCI A;  5ABR A;  2ES7 A;  1GNE A;  1SKR B;  4G0L A;  5ECH B;  1XPV A;  2WRT A;  5DJM A;  4FQU A;  2I1U A;  2VIM A;  4GSS A;  3EYT A;  2HLS A;  2LS5 A;  5AIV A;  1DBY A;  4Z7X A;  5ENU A;  1X9M B;  4ISD A;  4PNF A;  2YJH A;  1AUC A;  1X5C A;  4MPG A;  2GQL A;  4QL7 A;  5GAP D;  2B7J A;  4KA0 A;  2WZ9 A;  3TJF A;  5E59 A;  1A24 A;  5H5R A;  1HQO A;  4O7H A;  4I2U A;  5IMA A;  7GSS A;  1URM A;  3FW2 A;  3UVT A;  4I2T A;  4Q5F A;  6GSW A;  1A8Y A;  2WB9 A;  5HR1 A;  2V6K A;  4BL7 A;  1M2D A;  2CVB A;  4KND A;  2L57 A;  3RPP A;  4K2D A;  3D22 A;  4K5R A;  1EOG A;  2PN8 A;  4N11 A;  3FK8 A;  2IFQ B;  1DE1 A;  1FO5 A;  4IEL A;  1O73 A;  1X9S B;  3D0Z A;  2C0G A;  3Q19 A;  1MDK A;  4NHZ A;  1AQW A;  1PMT A;  4E8E A;  2XC2 A;  19GS A;  2IWT A;  3F4R A;  3U5R E;  3CXG A;  3IA1 A;  5LD0 A;  1XFL A;  1O8X A;  3F0I A;  2H1D A;  14GS A;  1H4O A;  3F63 A;  5ECN B;  1CQH A;  3KH7 A;  3ZRD A;  4O5R A;  1K0B A;  1M7T A;  1QGV A;  4KAE A;  2GST A;  1V2A A;  2X8G A;  5A4V A;  1G7E A;  2TIR A;  4MMM A;  1M9B A;  2JZS A;  2V2G A;  4OFT A;  1R7H A;  2IPA A;  2YCD A;  2JSZ A;  4BWS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...