1ERVA

Human thioredoxin mutant with cys 73 replaced by ser (reduced form)
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
105
structure length
105
Chain Sequence
b'MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKSMPTFQFFKKGQKVGEFSGANKEKLEATINELV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THIOREDOXIN
publication title Crystal structures of reduced, oxidized, and mutated human thioredoxins: evidence for a regulatory homodimer.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 39
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 1996-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1ervA00
4IGJA 1F9MA 3UVHA 2LRNA 2QSIA 5IMDA 5D8IA 2NPBA 4AJ7A 3P7XA 3P8WA 4NHZA 3PR8A 2HZEB 1PGTA 1FG4A 3CMIA 3PGTA 1DE2A 3G7JA 4YH2A 1S3CA 2VUPA 3IBHA 2C3QA 2B1LA 5B6MA 2MMOA 1VF4A 2DJ1A 4KNDA 4XCSA 3L78A 1GTIA 3R2QA 3FRCA 3A2XA 2P31A 4J2FA 2C0FA 2YPMA 5G2ZA 4ZL9A 22GSA 5G31A 1ST9A 1R5AA 4ECBA 3CRTA 3V1WA 2GLRA 2N5AA 3O76A 3LQ7A 4MABA 4LMWA 1GTUA 4X1UA 2LV3A 3MDKA 6GSYA 3H79A 4AF2A 3TGZA 1Z6NA 4D73B 2L4CA 3KXOA 3F6DA 3O6TA 4NV5A 2DSAA 3FZ4A 4F2IA 1R26A 4V1Ap 3GV1A 3LFLA 5G5FA 2PGTA 2OBIA 4EDYA 4OD7A 4ZIJA 1T4YA 3HZ4A 4KSOA 2FHEA 4ECCA 4V2NA 2HSYA 4GF0A 4ID0A 2OACA 4OWYA 3GKNA 1KNGA 1O73A 3F4RA 2XBIA 4RI7A 2LJRA 1QMVA 1FAAA 1U3IA 4MZBA 4PGTA 2B5XA 2LJKA 5CRDA 3EE2A 3LYPA 4WF5A 2ALBA 3NOFA 5FWGA 2XBQA 1FVJA 5IOWA 5H5RA 1MDKA 4CW9A 1X5EA 3L4NA 3F4SA 4EC0A 3ZFBA 4K7IA 2YN1A 1U88A 2KOKA 3M9KA 2OE1A 2F8FA 2CV4A 3UVTA 2CT6A 2OE0A 1TK0B 6GSVA 3MWHA 1SENA 4ZL7A 3KP8A 1GSEA 2BJXA 4EL1A 3IDVA 1S3DA 1AQWA 2H1AA 3GYKA 4RI6A 5LCZA 3C7MA 4Q5NA 3KH9A 2H1DA 4MH3A 1G7EA 1GTAA 1PSQA 4KUNA 2GS3A 3A2VA 2FCHA 2AAWA 3CXGA 3CSHA 4XS4B 4N11A 2CVBA 1OKTA 5HR2A 1R4WA 2JADA 1ILOA 1LU4A 2H1GA 1GSDA 1WMJA 3DMLA 1O8WA 2N5FA 1EP7A 3HJPA 5ECMB 3TOTA 1FO5A 4K7NA 3GFKA 2GSRA 2NDOA 3IK9A 4K9ZA 4P3YB 2PN8A 1M2DA 4KA0A 2TRCP 4GSSA 4ACSA 3KTBA 2MMAA 3H4KA 3F3RA 5EY6A 4G9HA 1VF3A 4KE3A 3ZIVA 3EU4A 3DEXA 5LNKe 2O8VB 4TR1B 4Q5RA 2G0FA 1NHOA 2L57A 4TXOB 1H75A 1U3AA 4MCUA 2VCQA 1ERVA 3HZ8A 2C0DA 4TXVA 3QR6A 1LJRA 4EUYA 2B3SA 1AAZA 5HR1A 2F9SA 1JZDA 4F03A 1YJ6A 2EIOA 1T4ZA 12GSA 1E2YA 3C8EA 3IHQA 1SD8A 4MJEA 3EINA 2R3XA 4OFMA 4OMVA 4IHUA 1TRVA 1QFNA 2PVOC 3IAM2 2IL3A 4G19A 3KIJA 2Z9SA 1YQ1A 3BCKA 1W4VA 3G7IA 1XW9A 4FYCA 3KGKA 4GQCA 2B6MA 1A8LA 3UL3A 1XWAA 1CQHA 3GX8A 5AN1A 5EPFA 5DALB 4J57E 3ZIJA 4ECIA 5ECRB 1GSFA 4K8MA 1CQGA 2HE3A 3TJBA 1XIYA 3FW2A 4LMVA 2RIIA 2LKUA 1LBKA 1OVNA 1PL1A 2O7KA 1PL2A 3TOUA 2L5OA 1SL2B 4WBJA 3ERWA 4MK3A 3TB2A 1PMTA 2HYXA 2YZHA 1Z7RA 3UOMA 3APQA 3DXBA 3US3A 1SJZA 3JCML 2C80A 5ECIB 3VWWA 1A2JA 1GLPA 2CZ2A 3ERGA 4KAEA 3F0IA 4IJ3A 4XTSA 3HJOA 3LXZA 2B5EA 4RQRA 2B7JA 3TCOA 2B1KA 3IA1A 3CRUA 1A24A 5IMFA 2GDRA 2WRTA 4DSRA 2R5GA 1I5GA 4IELA 2VLTA 4JR6A 4JU5A 3TKSA 1OC8A 2IFQA 4XS1A 2NVLA 3F4TA 3DGQA 5ECNB 4JEDA 2FY6A 1MD4A 2GGTA 4QQ7A 3VURA 5CAXA 1EZKA 4POMA 5IOXA 1ZYEA 1AIUA 4EXJA 3FK8A 3RAZA 1OE8A 4NV2A 1M99A 3E0UA 4G10A 1A23A 2H0GA 1XBSA 5GSSA 1EGOA 1YEXA 2DJKA 2IIYA 4O92A 1VF2A 2AB6A 3GA4A 1KTEA 1IYIA 2F3MA 1TI3A 5G1LA 2J9HA 5A5KA 4IQAA 2H01A 4CDOA 1XOBA 2E2MA 1K3OA 2I3YA 4YQVA 3ZITA 2PPTA 2ON5A 5DVBA 4GLTA 3ZRDA 1SU9A 3KM6A 1URMA 5C00A 2TRXA 3IK7A 2H0HA 2DLXA 2VD0A 2V41A 3Q74A 4L5LA 2AV4A 2VCZA 3EVIA 4XS6A 2LRCA 1V40A 1HNAA 1Q98A 4OO5A 1QK8A 1PKWA 2KHPA 2IN3A 4NPBA 5H5QA 3BJ5A 2PUKC 3PH9A 4WXTA 1ACVA 1TRUA 1B8XA 2RM6A 4NAXA 5KN0A 3I6AA 5CYYA 3FR6A 4MF7A 3D5JA 2VL2A 4DSQA 1O8XA 4POKA 5AGYA 3TKSE 4PXOA 1GUKA 2QC7A 4V2MA 3C1SA 4L0WA 4LL4B 3DIEA 2DJJA 1F2EA 3E9JB 2YV7A 1GH2A 2MBSA 1GP1A 4MH2A 2X8HA 3WGDA 3A5WA 3TJFA 4MA9A 4F0BA 3D22A 1B9YC 4F0CA 1R7HA 2DIZA 4K2DA 1G0TA 1GNWA 1ZOFA 2JSYA 5KEJA 4HS1A 4GCIA 4EF0A 3QOUA 3IE3A 4I2TA 1YY7A 5D93A 2H30A 3UEMA 3ZVJA 4MMMA 5DJLA 3LG6A 5LD0A 1GL8A 3FZ5A 3EURA 2GTUA 4H86A 2FUG2 5J41A 3VPTA 1MDJA 1PD21 4O5RA 2E2GA 4ML1A 8GSSA 3A3TA 3NIVA 3LYKA 2M80A 1PQNA 1QUWA 5HFGA 5KN1A 3IXRA 1TRSA 5B8BA 2FWHA 5CO3A 4XRAA 2LEGA 3BD2A 1ML6A 1K0BA 3TJJA 5CRWA 1JFUA 4TOPA 19GSA 4ZB8A 3RPPA 2ZUPA 1X9WB 20GSA 1TTZA 1ERTA 2VCTA 4IKHA 4E8EA 3MAKA 2I9HA 1UC7A 1GRXA 2YOIA 3LWAA 4PX1A 3DWVA 14GSA 1G6YA 2IJYA 5ECKB 1F6MC 4WR5A 1ZL9A 3GNJA 3CSIA 1O85A 2R2JA 3G7YA 4OCEA 4KDYA 4ZB9A 3WYWA 3H1NA 5GSTA 3GX0A 4ULXA 5D9VA 2FA8A 1MD3A 3UMAA 4RUVA 3KJYA 1HD2A 2LJAA 2LTKA 2YJHA 4TR3A 4BWSA 1AXDA 3HJMA 5CP1A 3HDCA 3TKSC 2IMEA 2FA4A 3DYRA 2A2SA 1B4QA 4TW5A 2B5YA 3RPNA 3CTFA 4K0NA 2P5QA 3KP9A 1S3AA 2VLVA 1UN2A 3QPMA 2L6CA 1UA5A 1WRYA 5HFKA 3GH6A 4GQFA 2JSZA 2OA7A 1EEJA 1FB6A 2L6DA 4KDXA 3C73A 5F06A 3L9UA 3CSJA 1TP9A 2WS2A 2X99A 2E0QA 1OC9A 4EE0A 1U87A 3HVVA 1F3BA 2MZCA 3TJKA 2YWIA 4QL7A 2FNOA 4PURA 2AJQB 2LNSA 4NHWA 3TRQA 4KCAA 3WD6A 4IVFA 1M9AA 5IMAA 5HR0A 5IO0A 2FWFA 1TK5B 2HRNA 3D6IA 4LA1A 3C1RA 5ABRA 2ON7A 5D96A 2LNTA 2YWNA 3ME7A 2IFQB 4I8BA 3W8SA 3QD9A 1NHYA 4GRFA 3ZMLA 1AUCA 2ES7A 4GXZA 4OFNA 1ABAA 2D2ZA 2VCWA 1GTBA 2PERA 2H8LA 3H8QA 4YAVA 3L9VA 1HNCA 4TVEA 2RLIA 3ZYWA 11GSA 3RHCA 1BX9A 1GUHA 4ZBBA 3TDGA 1O7UA 2HI7A 3QAWA 5GZZB 2JACA 4KX4A 4HZ2A 3CBUA 1SKWB 5G5EA 2WGRA 4JZQA 1TOFA 3D21A 2EIQA 5A4UA 2JZSA 3HHVA 3WGXA 2V6KA 5KN3A 4I97A 2VL2C 3GL3A 5ECSA 2CX3A 2C3TA 2NTOA 5GAPD 1X5DA 5JCWA 2OE3A 4DVCA 3GSSA 4DEJA 2MBTA 3W8JA 5DQSA 1EWXA 1EOHA 2VL3A 3APSA 5B8AA 1BYEA 4AJ8A 2CX4A 3IV4A 4KB3A 2VLUA 1SJ6A 1ZCPA 4F9ZA 2LQOA 1SYRA 1SL1B 3QMXA 3KZQA 3APOA 3QDNA 3PINA 4JR4A 3RHBA 5JWRB 2VM1A 1Z9HA 3U6VA 4YQMA 2DBCA 4TN8A 2YZUA 1PA3A 2QGVA 4MJAA 4MPFA 1TK8B 1Y6EA 2VCXA 3GRXA 2IMIA 5AIVA 2K8SA 4FIWA 1ZMAA 3IOSA 2H76A 1XOAA 1A2LA 1XWCA 4TKYA 2A4VA 2LSTA 3I69A 3IC4A 1GSQA 1FW1A 5HQPA 3GN3A 1X9SB 4OO4A 4Q5QA 3HCZA 4KSMA 1XVQA 1J0FA 1G6WA 1B48A 4MJCA 3M1GA 3EYTA 4MZCA 2GSSA 1OE7A 1YDKA 2M46A 4FYUA 4NXIA 3D0ZA 2KUCA 3ZL5A 2FLSA 1GSYA 4N0ZA 2JZTA 4ZL8A 2F8AA 2HZFA 4HJMA 4POLA 5ID2B 3DVWA 3VWXA 2GQLA 3H93A 2K9FA 2H75A 3NZNA 2GQKA 2V1MA 4N0VA 1E6BA 1DSBA 1HQOA 4HUAA 5KN2A 1K0CA 3O3TA 4E8HA 1PN9A 1R5PA 1UVZA 2BTOT 2PWJA 1HNBA 3FHKA 1T8EB 2PU9C 1GNEA 3VPQA 3W6GA 4L0UA 1KBNA 1TJDA 1TU8A 3ZFLA 4QL9A 1SK1A 1SK0A 3U5RE 2RM5A 5J3RA 1ZGNA 3VI7A 18GSA 1FHEA 5CRHA 3GH9A 3ME8A 5A4WA 5J9CA 5ENUA 5JWOB 2GQMA 4LL1B 1ZZYA 3UJ1A 3QCPA 4HU9A 3KTLA 4BL7A 4IQ1A 3SBCA 1N2AA 3IAS2 4N30A 3DD3A 1T00A 5IPHA 2RUFA 4Q5FA 1THOA 1MEKA 3KMNA 2GVPA 2XPDA 1TI1A 1M2AA 3LORA 2OADA 2ZCTA 3GSTA 2GSTA 4EDZA 1B9XC 1EP8A 4JRRA 5DJMA 2JL4A 2J23A 2WFCA 1ON4A 1PX7A 3LSZA 4PUFC 1SKSB 4OFTA 2KP1A 6GSXA 2KLXA 1Z6MA 1QGVA 1G7OA 2I1UA 2VD1A 4TRXA 3F9UA 2WCIA 3HD5A 5ECQB 5D9XA 2VOCA 1WP0A 3HY2A 3EC3A 2R37A 2VCVA 2IMKA 5JCUA 1BG5A 1XCCA 3L0HA 4MPGA 1H4OA 2H72A 3TKPA 4IW9A 5E59A 3MSZA 4G2EA 2HRFA 1OC9B 4WBRD 4HQSA 4PQHA 3FR3A 1Z5YE 5D9WA 1XVWA 3KMOA 2H70A 5AIXA 5F8BA 3TKQA 5B6NA 4HJ2A 1O81A 1VGLA 3KEBA 3HA9A 2A2RA 2V6OA 1SL0B 2H6XA 2K18A 1V57A 3IR4A 2YWMA 4PQ1A 3Q18A 1YEPA 2X8GA 1JLVA 2CVKA 1F3AA 2DIYA 1EV9A 1AW9A 1BQ7A 5JCGA 2RUEA 2FWEA 1TW9A 4HOJA 5ID2A 3M9JA 4O32A 3A2WA 2HNLA 4HZ4A 4BPYA 5G30A 1GWCA 3P2AA 2OKAA 3OR5A 4L8EA 3UIWA 6GSTA 1K0OA 4FYBA 3F8UA 1PRXA 1GSUA 4J56E 5DBQA 2GZYA 3EMXA 1WWJA 3FYGA 3HYPA 4HI7A 2DJ0A 3C71A 4IP6A 1PX6A 3WGEA 1C72A 1MDIA 2YP6A 13GSA 1WOUA 4X43A 3VLNA 3HKRA 1XW6A 2G2QA 2I4AA 2CQ9A 4V1Ag 3BOAA 5IMZA 2X64A 2M72A 1AC1A 1OC3A 4K0GA 1EOGA 2YANA 5AISA 16GSA 1V58A 6GSWA 1GUMA 4DSSA 4TR4A 5J4UA 5CREA 4LLRA 6GSSA 1BJXA 4BVYA 3TUEA 2C1YA 3CTGA 5B7CA 4POBA 2DJ2A 1T1VA 2EIRA 3ZREA 2VM2A 1XWBA 1WJKA 2VL9A 3VFIA 4AJ6A 2EC4A 2GZPA 4KH7A 2X8CA 3LJRA 3TKRA 1WIKA 1WPIA 4ZB6A 2CAQA 3M3MA 1BAYA 4I5QA 3ZLPA 5DCGA 1V98A 3BBYA 2XPEA 4K1FA 3GTUA 4MF5A 1ZYQB 4MDCA 1PKZA 2DJ3A 1X9MB 2XC2A 5FT3A 17GSA 4PNGA 3KH7A 3GHAA 3ISOA 3RBTA 1W89A 5H5SA 2FD3A 2YV9A 2H6ZA 1VRSD 4WR4A 1F37A 3UAPA 2CAIA 1DBYA 2PMTA 1V9WA 3K8NA 3QAVA 2H0IA 5E4WA 10GSA 4ECJA 5DAKA 1AQXA 3GURA 4ZXGA 2YNXA 4EKZA 2MMNA 1Q4JA 5CRGA 2WJUA 2WZ9A 2JZRA 1JZRA 5D9TA 1XZOA 5IPGA 3F6FA 3KCMA 1YZXA 3I9V2 2VIMA 3HXSA 5F07A 2O85A 3S9FA 1K0NA 4N10A 3CYNA 3GMFA 5JWQB 2MMZA 1AQVA 3VK9A 3EMPA 3KD0A 2ZNMA 3F3QA 2GSQA 2H66A 1EV4A 4ZBAA 5CNWA 1JHBA 4ILFA 3UBLA 2JU5A 1GULA 2HZEA 3M8NA 5ECLB 1MTCA 2GZZA 3MNGA 5F05A 1ERUA 9GSSA 1O6JA 3QAGA 3N9JA 4WEYA 2WDUA 1FVKA 4KDUA 5D73A 4WETA 4BWQA 1GSSA 5IO2A 4OCFA 5HR3A 2B7KA 4CHSA 1RK4A 5J5NA 4MLYA 3UARA 1J9BA 2AUVA 3LXTA 1K3LA 2IPAA 5EL8A 3ZMKA 4IP1A 3LGCA 1XWGA 1M7TA 1SK2A 1A0RP 1YF0A 2YJ7A 3VWUA 4FO5A 4MP4A 4D73A 3N5OA 2V2GA 4GWRA 3FR9A 3IRAA 3ZVJD 2C4JA 1ERWA 5DCHA 7GSSA 2LUSA 1V2AA 2C0GA 1I9DA 3WT1A 2HSHA 2P0GA 4XIHA 3RDWA 1GLQA 4X0XA 5ELGA 4NWYA 4ISDA 4EO3A 1QXHA 1XW5A 2L5LA 2AYTA 3GKMA 3GL5A 3Q19A 4HDEA 3VI5A 4YQUA 1SD9A 2PVQA 1TDIA 2L4QA 3EU3A 1K3YA 5IMVA 1OKDA 3DRNA 5IIZA 1BEDA 3I43A 5IM9A 4Z7XA 3GUSA 1NSWA 4HQZA 3FZAA 2HLSA 1SJIA 2C8UA 3ZTLA 3GIXA 2H1BA 4JE1A 1B4PA 2P5RA 4IJIA 2KP2A 1VF1A 1FOVA 1N8JA 3QFBC 4IS0A 1JZOA 1YKCA 1NW2A 5F0GA 2FGXA 1TU7A 5INYA 1DUGA 2H6YA 2HFDA 2LS5A 1Y25A 1JZWA 1XPVA 2GT6A 4PUAA 4NMUA 1T7PB 4FH8A 1M0UA 1XWKA 2I81A 3D4TA 3FKFA 5C04A 4XRDA 4PNFA 1QQ2A 2LRTA 4I2UA 3GKXA 3ZZXA 1U6TA 1TXXA 3FEUA 4KW6A 1J08A 5IMCA 4EVMA 1XXUA 1OYJA 4I6XA 2H74A 3ED3A 4GSTA 2IWTA 5DDLA 4KGIA 5DQYA 4XHMA 5J9BA 4XS4A 1DE1A 5FHIA 3DVXA 5ECOB 1OAZA 3TJGA 4L5OA 3DKSA 1K0AA 2XHFA 1NM3A 4WKWA 1M2BA 2R6KA 4K6XA 3HVXA 2DMMA 2R4VA 5HFIA 1A8YA 5IQYA 1RQMA 4O7HA 4GSNA 3IPZA 3TRXA 2HT9A 1A2MA 3EWLA 1Z3EA 2VO4A 5G1KA 2H73A 4DSSB 1THXA 2BMXA 2L59A 1WE0A 2K6VA 4GTUA 2AHEA 4BA7A 2LQQA 5L71A 1YKAA 2E7PA 1TKDB 3QFAC 2OJLA 4PQIA 1M9BA 2O87A 3Q6OA 2WB9A 4MJBA 5ECHB 3P90A 5ECPB 2DMLA 4MZWA 4RQXA 2K8VA 4TR1A 3UBKA 1K0MA 2NBSA 3L9SA 4JBBA 4TXOA 3E3EA 2WULA 1Z7PA 1A0FA 4HU7A 1SYXA 4MF6A 4ZBDA 5GAND 4K7OA 3HVSA 4YAPA 4IBPA 2CVDA 2C3NA 3GTUB 2DC5A 3SWLA 1RW1A 2C0EA 4TR0A 2IMDA 2FWGA 2PBJA 1USBA 3VWVA 2YCDA 1XFLA 2YWOA 1IYHA 4AGSA 3J7Yb 1TRWA 4ZILA 3AY8A 4KCEA 3GKKA 1K0DA 2OBKA 3F63A 1X5CA 2TIRA 1HYUA 6GSUA 3J7Yk 3BCIA 2H19A 2HXKA 5DAKB 1EGRA 1FB0A 3FZ9A 2QKEA 1YF1A 2IMFA 2MYGA 4V2LA 2CZ3A 4WF4A 4F82A 5DALA 1T3BA 5EVOA 1KEBA 1SKRB 1JLWA 4ML6A 3LEFA 3TRPA 4IN0A 2O89A 5ELAA 2N5BA 2GT5A 2V32A 3D4MA 3ERFA 5COHA 3WT2A 2REMA 4BVXA 2H71A 3M0FA 2VAFA 4HEA2 5A4VA 1X0RA 3FY7A 1EEMA 2F51A 2CA8A 3G9BA
chains in the Genus database with same CATH superfamily
4IGJA 1F9MA 3UVHA 2LRNA 2QSIA 5IMDA 5D8IA 2NPBA 4AJ7A 3P7XA 3P8WA 4NHZA 3PR8A 2HZEB 1PGTA 2R0GA 1FG4A 1M3JA 3CMIA 3PGTA 1DE2A 3G7JA 4YH2A 1S3CA 2VUPA 3IBHA 2C3QA 2B1LA 5B6MA 4Z2RA 2MMOA 1VF4A 2DJ1A 4KNDA 4XCSA 3L78A 1GTIA 3R2QA 3FRCA 3A2XA 2P31A 4J2FA 2C0FA 2YPMA 5G2ZA 4ZL9A 4KF9A 22GSA 5G31A 1ST9A 1R5AA 4ECBA 3CRTA 3V1WA 2GLRA 2N5AA 3O76A 3LQ7A 4MABA 4LMWA 1GTUA 4X1UA 2LV3A 3MDKA 6GSYA 3H79A 4AF2A 3TGZA 1Z6NA 4D73B 2L4CA 3KXOA 3F6DA 3O6TA 4NV5A 2DSAA 3FZ4A 4F2IA 1R26A 4V1Ap 3GV1A 3LFLA 5G5FA 2PGTA 2OBIA 4EDYA 4OD7A 4ZIJA 1T4YA 3HZ4A 4KSOA 2FHEA 4ECCA 4V2NA 2HSYA 4GF0A 4ID0A 2OACA 4OWYA 3GKNA 1KNGA 1O73A 3F4RA 2XBIA 4RI7A 2LJRA 1QMVA 1FAAA 1U3IA 4MZBA 4PGTA 2B5XA 2LJKA 5CRDA 3EE2A 3LYPA 4WF5A 3IC8A 2ALBA 3NOFA 5FWGA 2XBQA 1FVJA 5IOWA 5H5RA 1MDKA 4CW9A 1X5EA 3L4NA 3F4SA 4EC0A 3ZFBA 4K7IA 2YN1A 1U88A 2KOKA 3M9KA 2OE1A 2F8FA 2CV4A 3UVTA 2CT6A 2OE0A 1TK0B 6GSVA 3MWHA 1SENA 4ZL7A 3KP8A 1GSEA 2BJXA 4EL1A 3IDVA 1S3DA 1AQWA 2H1AA 3GYKA 4RI6A 5LCZA 3C7MA 4Q5NA 2A2PA 3KH9A 2H1DA 4MH3A 1G7EA 1GTAA 1PSQA 4KUNA 2GS3A 3A2VA 2FCHA 2AAWA 3CXGA 3CSHA 4XS4B 4N11A 2CVBA 1OKTA 5HR2A 1R4WA 2JADA 1ILOA 1LU4A 2H1GA 1GSDA 1WMJA 3DMLA 1O8WA 2N5FA 1EP7A 3HJPA 2A4HA 5ECMB 3TOTA 1FO5A 4K7NA 3GFKA 2GSRA 2NDOA 3IK9A 4K9ZA 1PFOA 4P3YB 2PN8A 1M2DA 4KA0A 2TRCP 4GSSA 4ACSA 3KTBA 2MMAA 3H4KA 3F3RA 5EY6A 4G9HA 1VF3A 4KE3A 3ZIVA 3EU4A 3DEXA 4A5PA 2O8VB 5LNKe 4TR1B 4Q5RA 2G0FA 1NHOA 2L57A 4TXOB 1H75A 1U3AA 4MCUA 2VCQA 1ERVA 3HZ8A 2C0DA 4TXVA 3QR6A 1LJRA 4EUYA 2B3SA 1AAZA 5HR1A 2F9SA 1JZDA 4F03A 1YJ6A 2EIOA 1T4ZA 12GSA 1E2YA 3C8EA 3IHQA 1SD8A 4MJEA 3EINA 2R3XA 4OFMA 4OMVA 4IHUA 1TRVA 1QFNA 2PVOC 3IAM2 2IL3A 4G19A 3KIJA 2Z9SA 1YQ1A 3BCKA 1W4VA 3G7IA 1XW9A 4FYCA 3KGKA 4GQCA 2B6MA 1A8LA 3UL3A 1XWAA 1CQHA 3GX8A 5AN1A 5EPFA 5DALB 4J57E 3ZIJA 4ECIA 5ECRB 1GSFA 4K8MA 3IHGA 1CQGA 2HE3A 3TJBA 1XIYA 3FW2A 4LMVA 2RIIA 2LKUA 4K5RA 1LBKA 1OVNA 1PL1A 2O7KA 1PL2A 3TOUA 2L5OA 1SL2B 4WBJA 3ERWA 4BVXB 4MK3A 3TB2A 1PMTA 2HYXA 2YZHA 1Z7RA 3UOMA 3APQA 3DXBA 3US3A 1SJZA 3JCML 2C80A 5ECIB 3VWWA 1A2JA 1GLPA 2CZ2A 3ERGA 4KAEA 3A5IA 3F0IA 4IJ3A 4XTSA 3HJOA 3LXZA 2B5EA 4RQRA 2B7JA 3TCOA 2B1KA 3IA1A 3CRUA 1A24A 5IMFA 2GDRA 2WRTA 4DSRA 2R5GA 1I5GA 4IELA 2VLTA 4JR6A 4JU5A 3TKSA 1OC8A 2IFQA 4XS1A 2NVLA 3F4TA 4Z2UA 3DGQA 5ECNB 4JEDA 2FY6A 1MD4A 2GGTA 4QQ7A 3VURA 5CAXA 1EZKA 4POMA 3MIXA 5IOXA 1ZYEA 1AIUA 4EXJA 3FK8A 3RAZA 1OE8A 4NV2A 1M99A 3E0UA 4G10A 1A23A 2H0GA 1XBSA 4USSA 5GSSA 1EGOA 1YEXA 2DJKA 2IIYA 4O92A 1VF2A 2AB6A 3FMWA 3GA4A 1KTEA 1IYIA 2F3MA 1TI3A 5G1LA 2J9HA 5A5KA 4IQAA 2H01A 4CDOA 1XOBA 2E2MA 1K3OA 4HSCX 2I3YA 4YQVA 3ZITA 2PPTA 2ON5A 5DVBA 4GLTA 3ZRDA 1SU9A 3KM6A 1URMA 5C00A 2TRXA 3IK7A 2H0HA 2DLXA 2VD0A 2V41A 3Q74A 4L5LA 4G0LA 2AV4A 2VCZA 3EVIA 4XS6A 2R0CA 2LRCA 1V40A 1HNAA 1Q98A 4OO5A 1QK8A 1PKWA 2KHPA 2IN3A 4NPBA 5H5QA 3BJ5A 5BRTA 2PUKC 3PH9A 4WXTA 1ACVA 1TRUA 1B8XA 2RM6A 4NAXA 5KN0A 3I6AA 5CYYA 3FR6A 4MF7A 3D5JA 2VL2A 4DSQA 1ZYNA 1O8XA 4POKA 5AGYA 3TKSE 4PXOA 1GUKA 2QC7A 4V2MA 3C1SA 4L0WA 4LL4B 3DIEA 2DJJA 1F2EA 3E9JB 2YV7A 1GH2A 2MBSA 1GP1A 4MH2A 2X8HA 3WGDA 3A5WA 3TJFA 4MA9A 4F0BA 3D22A 1B9YC 4F0CA 1R7HA 2DIZA 4K2DA 1G0TA 1GNWA 1ZOFA 2JSYA 5KEJA 4HS1A 4GCIA 4EF0A 3QOUA 3IE3A 4I2TA 1YY7A 5D93A 2H30A 3UEMA 3ZVJA 4MMMA 5DJLA 3LG6A 5LD0A 1GL8A 3FZ5A 3EURA 2GTUA 4H86A 2FUG2 5J41A 3VPTA 1MDJA 1PD21 4O5RA 2E2GA 4ML1A 8GSSA 3A3TA 3NIVA 3LYKA 2M80A 1PQNA 1QUWA 5HFGA 5KN1A 3IXRA 1TRSA 4BIKA 5B8BA 5KOXA 2FWHA 5CO3A 4XRAA 2LEGA 3BD2A 1ML6A 1K0BA 3TJJA 5CRWA 1JFUA 4TOPA 19GSA 4ZB8A 3RPPA 2ZUPA 1X9WB 20GSA 1TTZA 1ERTA 2VCTA 4IKHA 4E8EA 3MAKA 2I9HA 1UC7A 1GRXA 2YOIA 3LWAA 4PX1A 3DWVA 14GSA 1G6YA 2IJYA 5ECKB 1F6MC 4WR5A 1ZL9A 4CY8A 3GNJA 3CSIA 1O85A 2R2JA 3G7YA 4OCEA 4KDYA 4ZB9A 3WYWA 3H1NA 5GSTA 3GX0A 4ULXA 5D9VA 2FA8A 1MD3A 1PN0A 3UMAA 4RUVA 2R0PA 3KJYA 1HD2A 2LJAA 2LTKA 2YJHA 4TR3A 4BWSA 5BMUA 2HRAA 1AXDA 3HJMA 5CP1A 3HDCA 3TKSC 2IMEA 2FA4A 3DYRA 2A2SA 1B4QA 4TW5A 2B5YA 3RPNA 3CTFA 4K0NA 2P5QA 3KP9A 1S3AA 2VLVA 1UN2A 3QPMA 2L6CA 1UA5A 1WRYA 5HFKA 3GH6A 4GQFA 2JSZA 2OA7A 1EEJA 1FB6A 2L6DA 4KDXA 3C73A 5F06A 3L9UA 3CSJA 1TP9A 2WS2A 2X99A 2E0QA 1OC9A 4EE0A 1U87A 3HVVA 1F3BA 2MZCA 3TJKA 2YWIA 4QL7A 2FNOA 4PURA 2AJQB 2LNSA 4NHWA 3TRQA 4KCAA 3WD6A 4IVFA 1M9AA 5IMAA 5HR0A 1S3RA 5IO0A 2FWFA 1TK5B 2HRNA 3D6IA 4LA1A 3C1RA 5ABRA 2ON7A 5D96A 2LNTA 2YWNA 3ME7A 2IFQB 4I8BA 3W8SA 3QD9A 1NHYA 4GRFA 3ZMLA 1AUCA 2ES7A 4GXZA 4OFNA 1ABAA 2D2ZA 4G0IA 2VCWA 1GTBA 2PERA 2H8LA 3H8QA 4YAVA 3L9VA 1HNCA 4TVEA 2RLIA 3ZYWA 11GSA 3RHCA 1BX9A 1GUHA 4ZBBA 3TDGA 1O7UA 2HI7A 3QAWA 5GZZB 2JACA 4KX4A 4HZ2A 3CQFA 2UZ8A 3CBUA 1SKWB 5G5EA 2WGRA 4JZQA 4G0KA 1TOFA 3D21A 2EIQA 5A4UA 2JZSA 3HHVA 3WGXA 2V6KA 5KN3A 4I97A 2VL2C 3GL3A 5ECSA 2CX3A 2C3TA 2NTOA 5GAPD 1X5DA 5JCWA 2OE3A 4DVCA 3GSSA 4DEJA 2MBTA 3W8JA 5DQSA 1EWXA 1EOHA 2VL3A 3APSA 5B8AA 1BYEA 4AJ8A 2CX4A 4O5UA 3IV4A 4KB3A 2VLUA 1SJ6A 1ZCPA 4F9ZA 2LQOA 2QA1A 1SYRA 1SL1B 4YKFA 3QMXA 4FQUA 3KZQA 3APOA 3QDNA 3PINA 4JR4A 3RHBA 5JWRB 2VM1A 1Z9HA 3U6VA 4YQMA 2DBCA 4TN8A 2YZUA 1PA3A 2QGVA 4MJAA 4MPFA 1TK8B 1Y6EA 2VCXA 3GRXA 2DKHA 2IMIA 5AIVA 2K8SA 4FIWA 1ZMAA 3IOSA 2H76A 1XOAA 1A2LA 1XWCA 4TKYA 2A4VA 2LSTA 3I69A 3IC4A 1GSQA 1FW1A 5HQPA 3GN3A 1X9SB 4OO4A 4Q5QA 3HCZA 4KSMA 1XVQA 1J0FA 1G6WA 1B48A 4MJCA 3M1GA 3EYTA 4MZCA 2GSSA 1OE7A 1YDKA 2M46A 4FYUA 4NXIA 3D0ZA 2KUCA 3ZL5A 2FLSA 1GSYA 4N0ZA 2JZTA 4ZL8A 2F8AA 2HZFA 4HJMA 4POLA 5ID2B 3DVWA 3VWXA 2GQLA 3H93A 2K9FA 2H75A 3NZNA 2GQKA 2V1MA 4ICYA 4N0VA 1E6BA 1DSBA 1HQOA 4HUAA 5KN2A 1K0CA 3O3TA 4E8HA 1PN9A 1R5PA 1UVZA 2BTOT 2PWJA 1HNBA 3FHKA 1T8EB 2PU9C 1GNEA 3VPQA 3W6GA 4L0UA 1KBNA 1TJDA 1TU8A 3ZFLA 4QL9A 1SK1A 1SK0A 3U5RE 2RM5A 5J3RA 1ZGNA 3EPTA 3VI7A 18GSA 1FHEA 5CRHA 3GH9A 3ME8A 5A4WA 5J9CA 5ENUA 5JWOB 2GQMA 2X49A 4LL1B 1ZZYA 3UJ1A 3QCPA 4HU9A 3KTLA 4BL7A 4IQ1A 3SBCA 1N2AA 3IAS2 4N30A 3DD3A 1T00A 5IPHA 2RUFA 4Q5FA 1THOA 1MEKA 3KMNA 2GVPA 2HRKA 2XPDA 1TI1A 1M2AA 3LORA 2OADA 2ZCTA 3GSTA 2GSTA 4EDZA 1B9XC 1EP8A 4JRRA 5DJMA 2JL4A 2J23A 2WFCA 1ON4A 1PX7A 3LSZA 4PUFC 1SKSB 4OFTA 2KP1A 6GSXA 2KLXA 1Z6MA 1QGVA 5KOWA 1G7OA 2I1UA 2VD1A 4TRXA 3F9UA 2WCIA 3HD5A 5ECQB 5D9XA 2VOCA 1WP0A 3HY2A 3EC3A 2R37A 2VCVA 2IMKA 5JCUA 1BG5A 1XCCA 3L0HA 4MPGA 1H4OA 2H72A 3TKPA 4IW9A 5E59A 3MSZA 4G2EA 2HRFA 1OC9B 4WBRD 4HQSA 4PQHA 3FR3A 1Z5YE 5D9WA 1XVWA 3KMOA 2H70A 5AIXA 5F8BA 3TKQA 5B6NA 4HJ2A 1O81A 1VGLA 3KEBA 3HA9A 2A2RA 2V6OA 1SL0B 2H6XA 2K18A 1V57A 3IR4A 2YWMA 4PQ1A 3Q18A 1YEPA 2X8GA 1JLVA 2CVKA 1F3AA 2DIYA 1EV9A 1AW9A 1BQ7A 5JCGA 2RUEA 2FWEA 1TW9A 4HOJA 5ID2A 3M9JA 4K2XA 4O32A 3A2WA 2HNLA 4HZ4A 4BPYA 5G30A 1GWCA 3P2AA 2OKAA 3OR5A 4L8EA 3UIWA 6GSTA 1K0OA 4FYBA 3F8UA 1PRXA 1GSUA 4J56E 5DBQA 2GZYA 3EMXA 1WWJA 3FYGA 3HYPA 4HI7A 2DJ0A 3C71A 4IP6A 1PX6A 3WGEA 1C72A 1MDIA 2YP6A 13GSA 1WOUA 4X43A 3VLNA 3HKRA 1XW6A 2G2QA 2I4AA 2CQ9A 4V1Ag 3BOAA 5IMZA 2X64A 2M72A 1AC1A 1OC3A 4K0GA 1EOGA 1XG8A 2YANA 5AISA 16GSA 1V58A 6GSWA 1GUMA 4DSSA 4TR4A 5J4UA 5CREA 4LLRA 6GSSA 1BJXA 4BVYA 3TUEA 2C1YA 3CTGA 5B7CA 4POBA 2DJ2A 1T1VA 2EIRA 3ZREA 2VM2A 1XWBA 1WJKA 2VL9A 3VFIA 4AJ6A 2EC4A 2GZPA 4KH7A 2X8CA 3LJRA 3TKRA 1WIKA 4CY6A 1WPIA 4ZB6A 2CAQA 3M3MA 1BAYA 4I5QA 3ZLPA 5DCGA 1V98A 3BBYA 1ZYPA 2XPEA 4K1FA 3GTUA 4MF5A 1ZYQB 4MDCA 1PKZA 2DKIA 2DJ3A 1X9MB 2XC2A 5FT3A 17GSA 4PNGA 3KH7A 3GHAA 3ISOA 3RBTA 1W89A 5H5SA 2FD3A 2YV9A 2H6ZA 1VRSD 4WR4A 1F37A 3UAPA 2CAIA 1DBYA 2PMTA 1V9WA 3K8NA 3QAVA 2H0IA 5E4WA 10GSA 4ECJA 5DAKA 1M3IA 1AQXA 3GURA 4ZXGA 2YNXA 4EKZA 2MMNA 1Q4JA 5CRGA 2WJUA 2WZ9A 2JZRA 1JZRA 4YKGA 5D9TA 1XZOA 5IPGA 3F6FA 3KCMA 1YZXA 3I9V2 2VIMA 3HXSA 5F07A 2O85A 3S9FA 1K0NA 4N10A 3CYNA 3GMFA 5JWQB 2MMZA 1AQVA 3VK9A 3EMPA 3KD0A 2ZNMA 3F3QA 2GSQA 2H66A 1EV4A 4ZBAA 5CNWA 1JHBA 4ILFA 3UBLA 2JU5A 1GULA 2HZEA 3M8NA 5ECLB 1MTCA 2GZZA 3HVNA 3MNGA 4PTSA 5F05A 1ERUA 9GSSA 1O6JA 3QAGA 3N9JA 4WEYA 2WDUA 1FVKA 4KDUA 5D73A 4WETA 4BWQA 1GSSA 5IO2A 4OCFA 5HR3A 2B7KA 4CHSA 1RK4A 5J5NA 4BL7B 4MLYA 3UARA 1J9BA 2AUVA 3LXTA 1K3LA 2IPAA 5EL8A 3ZMKA 4IP1A 3LGCA 1XWGA 1M7TA 1SK2A 1A0RP 1YF0A 2YJ7A 3VWUA 4FO5A 3R3EA 4MP4A 4D73A 3N5OA 2V2GA 4GWRA 4K5SA 3FR9A 3IRAA 3ZVJD 2C4JA 4EIPA 1ERWA 5DCHA 7GSSA 2LUSA 1V2AA 2C0GA 1I9DA 3WT1A 2HSHA 2P0GA 4XIHA 3RDWA 1GLQA 4X0XA 4NWYA 5ELGA 4ISDA 4EO3A 1QXHA 1XW5A 2L5LA 4EIQA 2AYTA 3GKMA 3GL5A 3Q19A 4HDEA 3VI5A 4YQUA 1SD9A 2PVQA 1TDIA 2L4QA 3EU3A 1K3YA 5IMVA 1OKDA 3DRNA 5IIZA 1BEDA 3I43A 5IM9A 4Z7XA 3GUSA 1NSWA 4HQZA 3FZAA 2HLSA 1SJIA 2C8UA 3ZTLA 3GIXA 2H1BA 4JE1A 1B4PA 2QA2A 2P5RA 2X4AA 4IJIA 2KP2A 1VF1A 1FOVA 1N8JA 3QFBC 4IS0A 1JZOA 1YKCA 1NW2A 5F0GA 2FGXA 1TU7A 5INYA 1DUGA 2H6YA 2HFDA 2LS5A 1Y25A 1JZWA 1XPVA 2GT6A 4PUAA 4NMUA 1T7PB 4FH8A 1M0UA 1XWKA 2I81A 3D4TA 3FKFA 4MNNA 5C04A 4XRDA 4PNFA 1QQ2A 2LRTA 4I2UA 3GKXA 3ZZXA 4Z2TA 1U6TA 1TXXA 3FEUA 3MYDA 4KW6A 1J08A 5IMCA 4EVMA 1XXUA 1OYJA 4I6XA 2H74A 3ED3A 4GSTA 2IWTA 5DDLA 4KGIA 5DQYA 4XHMA 5J9BA 4XS4A 1DE1A 5FHIA 3DVXA 5ECOB 1OAZA 3TJGA 4L5OA 3DKSA 1K0AA 2XHFA 1NM3A 4WKWA 1M2BA 2R6KA 3LW9A 4K6XA 3HVXA 2DMMA 2R4VA 5HFIA 1A8YA 5IQYA 1RQMA 4O7HA 4GSNA 3IPZA 3TRXA 2HT9A 1A2MA 3EWLA 1Z3EA 2VO4A 5G1KA 2H73A 4DSSB 1THXA 2BMXA 2L59A 1WE0A 2K6VA 4BVYB 4GTUA 2AHEA 4BA7A 2LQQA 5L71A 1YKAA 2E7PA 1TKDB 3QFAC 2OJLA 4PQIA 1M9BA 2O87A 3Q6OA 2WB9A 4MJBA 5ECHB 3P90A 5ECPB 2DMLA 4MZWA 4RQXA 2K8VA 4TR1A 3UBKA 1K0MA 2NBSA 3L9SA 1FOHA 4TXOA 4JBBA 4O5QA 3E3EA 2WULA 1Z7PA 1A0FA 4HU7A 1SYXA 4MF6A 4ZBDA 5GAND 4K7OA 3HVSA 4YAPA 4IBPA 2CVDA 2C3NA 3GTUB 2DC5A 3SWLA 1RW1A 2C0EA 4TR0A 2IMDA 4X4JA 2FWGA 2PBJA 1USBA 3VWVA 2YCDA 1XFLA 2YWOA 1IYHA 4AGSA 3J7Yb 1TRWA 4ZILA 3AY8A 4KCEA 3GKKA 1K0DA 2OBKA 3F63A 1X5CA 2TIRA 1HYUA 6GSUA 3J7Yk 3BCIA 2H19A 2HXKA 5DAKB 1EGRA 1FB0A 3FZ9A 2HSMA 2QKEA 1YF1A 2IMFA 2MYGA 4V2LA 2CZ3A 4WF4A 4F82A 5DALA 1T3BA 5EVOA 3PPUA 1KEBA 1SKRB 1JLWA 4ML6A 3LEFA 3TRPA 4IN0A 2O89A 5ELAA 2N5BA 2GT5A 2V32A 3D4MA 3ERFA 5COHA 3WT2A 2REMA 4BVXA 2H71A 3M0FA 2VAFA 4HEA2 5A4VA 1X0RA 3FY7A 1EEMA 2F51A 2CA8A 3G9BA
chains in the Genus database with same CATH topology
4IGJA 1F9MA 3UVHA 2LRNA 2QSIA 5IMDA 5D8IA 2NPBA 4AJ7A 3P7XA 3P8WA 4NHZA 3PR8A 2HZEB 1PGTA 2R0GA 1FG4A 3CMIA 3PGTA 1DE2A 3G7JA 4YH2A 1S3CA 2VUPA 3IBHA 2C3QA 2B1LA 5B6MA 4Z2RA 2MMOA 1VF4A 2DJ1A 4KNDA 4XCSA 3L78A 1GTIA 3R2QA 3FRCA 3A2XA 2P31A 4J2FA 2C0FA 2YPMA 5G2ZA 4ZL9A 4KF9A 22GSA 5G31A 1ST9A 1R5AA 4ECBA 3CRTA 3V1WA 2GLRA 2N5AA 3O76A 3LQ7A 4MABA 4LMWA 1GTUA 4X1UA 2LV3A 3MDKA 6GSYA 3H79A 4AF2A 3TGZA 1Z6NA 4D73B 2L4CA 3KXOA 3F6DA 3O6TA 4NV5A 2DSAA 3FZ4A 4F2IA 1R26A 4V1Ap 3GV1A 3LFLA 5G5FA 2PGTA 2OBIA 4EDYA 4OD7A 4ZIJA 1T4YA 3HZ4A 4KSOA 2FHEA 4ECCA 4V2NA 2HSYA 4GF0A 4ID0A 2OACA 4OWYA 3GKNA 1KNGA 1O73A 3F4RA 2XBIA 4RI7A 2LJRA 1QMVA 1FAAA 1U3IA 4MZBA 4PGTA 2B5XA 2LJKA 5CRDA 3EE2A 3LYPA 4WF5A 3IC8A 2ALBA 3NOFA 5FWGA 2XBQA 1FVJA 5IOWA 5H5RA 1MDKA 4CW9A 1X5EA 3L4NA 3F4SA 4EC0A 3ZFBA 4K7IA 2YN1A 1U88A 2KOKA 3M9KA 2OE1A 2F8FA 2CV4A 3UVTA 2CT6A 2OE0A 1TK0B 6GSVA 3MWHA 1SENA 4ZL7A 3KP8A 1GSEA 2BJXA 4EL1A 3IDVA 1S3DA 1AQWA 2H1AA 3GYKA 4RI6A 5LCZA 3C7MA 4Q5NA 2A2PA 3KH9A 2H1DA 4MH3A 1G7EA 1GTAA 1PSQA 4KUNA 2GS3A 3A2VA 2FCHA 2AAWA 3CXGA 3CSHA 4XS4B 4N11A 2CVBA 1OKTA 5HR2A 1R4WA 2JADA 1ILOA 1LU4A 2H1GA 1GSDA 1WMJA 3DMLA 1O8WA 2N5FA 1EP7A 3HJPA 2A4HA 5ECMB 3TOTA 1FO5A 4K7NA 3GFKA 2GSRA 2NDOA 3IK9A 4K9ZA 4P3YB 2PN8A 1M2DA 4KA0A 2TRCP 4GSSA 4ACSA 3KTBA 2MMAA 3H4KA 3F3RA 5EY6A 4G9HA 1VF3A 4KE3A 3ZIVA 3EU4A 3DEXA 4A5PA 2O8VB 5LNKe 4TR1B 4Q5RA 2G0FA 1NHOA 2L57A 4TXOB 1H75A 1U3AA 4MCUA 2VCQA 1ERVA 3HZ8A 2C0DA 4TXVA 3QR6A 1LJRA 4EUYA 2B3SA 1AAZA 5HR1A 2F9SA 1JZDA 4F03A 1YJ6A 2EIOA 1T4ZA 12GSA 1E2YA 3C8EA 3IHQA 1SD8A 4MJEA 3EINA 2R3XA 4OFMA 4OMVA 4IHUA 1TRVA 1QFNA 2PVOC 3IAM2 2IL3A 4G19A 3KIJA 2Z9SA 1YQ1A 3BCKA 1W4VA 3G7IA 1XW9A 4FYCA 3KGKA 4GQCA 2B6MA 1A8LA 3UL3A 1XWAA 1CQHA 3GX8A 5AN1A 5EPFA 5DALB 4J57E 3ZIJA 4ECIA 5ECRB 1GSFA 4K8MA 3IHGA 1CQGA 2HE3A 3TJBA 1XIYA 3FW2A 4LMVA 2RIIA 2LKUA 4K5RA 1LBKA 1OVNA 1PL1A 2O7KA 1PL2A 3TOUA 2L5OA 1SL2B 4WBJA 3ERWA 4BVXB 4MK3A 3TB2A 1PMTA 2HYXA 2YZHA 1Z7RA 3UOMA 3APQA 3DXBA 3US3A 1SJZA 3JCML 2C80A 5ECIB 3VWWA 1A2JA 1GLPA 2CZ2A 3ERGA 4KAEA 3A5IA 3F0IA 4IJ3A 4XTSA 3HJOA 3LXZA 2B5EA 4RQRA 2B7JA 3TCOA 2B1KA 3IA1A 3CRUA 1A24A 5IMFA 2GDRA 2WRTA 4DSRA 2R5GA 1I5GA 4IELA 2VLTA 4JR6A 4JU5A 3TKSA 1OC8A 2IFQA 4XS1A 2NVLA 3F4TA 4Z2UA 3DGQA 5ECNB 4JEDA 2FY6A 1MD4A 2GGTA 4QQ7A 3VURA 5CAXA 1EZKA 4POMA 3MIXA 5IOXA 1ZYEA 1AIUA 4EXJA 3FK8A 3RAZA 1OE8A 4NV2A 1M99A 3E0UA 4G10A 1A23A 2H0GA 1XBSA 4USSA 5GSSA 1EGOA 1YEXA 2DJKA 2IIYA 4O92A 1VF2A 2AB6A 3FMWA 3GA4A 1KTEA 1IYIA 2F3MA 1TI3A 5G1LA 2J9HA 5A5KA 4IQAA 2H01A 4CDOA 1XOBA 2E2MA 1K3OA 2I3YA 4YQVA 3ZITA 2PPTA 2ON5A 5DVBA 4GLTA 3ZRDA 1SU9A 3KM6A 1URMA 5C00A 2TRXA 3IK7A 2H0HA 2DLXA 2VD0A 2V41A 3Q74A 4L5LA 4G0LA 2AV4A 2VCZA 3EVIA 4XS6A 2R0CA 2LRCA 1V40A 1HNAA 1Q98A 4OO5A 1QK8A 1PKWA 2KHPA 2IN3A 4NPBA 5H5QA 3BJ5A 5BRTA 2PUKC 3PH9A 4WXTA 1ACVA 1TRUA 1B8XA 2RM6A 4NAXA 5KN0A 3I6AA 5CYYA 3FR6A 4MF7A 3D5JA 2VL2A 4DSQA 1ZYNA 1O8XA 4POKA 5AGYA 3TKSE 4PXOA 1GUKA 2QC7A 4V2MA 3C1SA 4L0WA 4LL4B 3DIEA 2DJJA 1F2EA 3E9JB 2YV7A 1GH2A 2MBSA 1GP1A 4MH2A 2X8HA 3WGDA 3A5WA 3TJFA 4MA9A 4F0BA 3D22A 1B9YC 4F0CA 1R7HA 2DIZA 4K2DA 1G0TA 1GNWA 1ZOFA 2JSYA 5KEJA 4HS1A 4GCIA 4EF0A 3QOUA 3IE3A 4I2TA 1YY7A 5D93A 2H30A 3UEMA 3ZVJA 4MMMA 5DJLA 3LG6A 5LD0A 1GL8A 3FZ5A 3EURA 2GTUA 4H86A 2FUG2 5J41A 3VPTA 1MDJA 1PD21 4O5RA 2E2GA 4ML1A 8GSSA 3A3TA 3NIVA 3LYKA 2M80A 1PQNA 1QUWA 5HFGA 5KN1A 3IXRA 1TRSA 5B8BA 5KOXA 2FWHA 5CO3A 4XRAA 2LEGA 3BD2A 1ML6A 1K0BA 3TJJA 5CRWA 1JFUA 4TOPA 19GSA 4ZB8A 3RPPA 2ZUPA 1X9WB 20GSA 1TTZA 1ERTA 2VCTA 4IKHA 4E8EA 3MAKA 2I9HA 1UC7A 1GRXA 2YOIA 3LWAA 4PX1A 3DWVA 14GSA 1G6YA 2IJYA 5ECKB 1F6MC 4WR5A 1ZL9A 4CY8A 3GNJA 3CSIA 1O85A 2R2JA 3G7YA 4OCEA 4KDYA 4ZB9A 3WYWA 3H1NA 5GSTA 3GX0A 4ULXA 5D9VA 2FA8A 1MD3A 1PN0A 3UMAA 4RUVA 2R0PA 3KJYA 1HD2A 2LJAA 2LTKA 2YJHA 4TR3A 4BWSA 5BMUA 2HRAA 1AXDA 3HJMA 5CP1A 3HDCA 3TKSC 2IMEA 2FA4A 3DYRA 2A2SA 1B4QA 4TW5A 2B5YA 3RPNA 3CTFA 4K0NA 2P5QA 3KP9A 1S3AA 2VLVA 1UN2A 3QPMA 2L6CA 1UA5A 1WRYA 5HFKA 3GH6A 4GQFA 2JSZA 2OA7A 1EEJA 1FB6A 2L6DA 4KDXA 3C73A 5F06A 3L9UA 3CSJA 1TP9A 2WS2A 2X99A 2E0QA 1OC9A 4EE0A 1U87A 3HVVA 1F3BA 2MZCA 3TJKA 2YWIA 4QL7A 2FNOA 4PURA 2AJQB 2LNSA 4NHWA 3TRQA 4KCAA 3WD6A 4IVFA 1M9AA 5IMAA 5HR0A 5IO0A 2FWFA 1TK5B 2HRNA 3D6IA 4LA1A 3C1RA 5ABRA 2ON7A 5D96A 2LNTA 2YWNA 3ME7A 2IFQB 4I8BA 3W8SA 3QD9A 1NHYA 4GRFA 3ZMLA 1AUCA 2ES7A 4GXZA 4OFNA 1ABAA 2D2ZA 4G0IA 2VCWA 1GTBA 2PERA 2H8LA 3H8QA 4YAVA 3L9VA 1HNCA 4TVEA 2RLIA 3ZYWA 11GSA 3RHCA 1BX9A 1GUHA 4ZBBA 3TDGA 1O7UA 2HI7A 3QAWA 5GZZB 2JACA 4KX4A 4HZ2A 2UZ8A 3CBUA 1SKWB 5G5EA 2WGRA 4JZQA 4G0KA 1TOFA 3D21A 2EIQA 5A4UA 2JZSA 3HHVA 3WGXA 2V6KA 5KN3A 4I97A 2VL2C 3GL3A 5ECSA 2CX3A 2C3TA 2NTOA 5GAPD 1X5DA 5JCWA 2OE3A 4DVCA 3GSSA 4DEJA 2MBTA 3W8JA 5DQSA 1EWXA 1EOHA 2VL3A 3APSA 5B8AA 1BYEA 4AJ8A 2CX4A 4O5UA 3IV4A 4KB3A 2VLUA 1SJ6A 1ZCPA 4F9ZA 2LQOA 2QA1A 1SYRA 1SL1B 4YKFA 3QMXA 4FQUA 3KZQA 3APOA 3QDNA 3PINA 4JR4A 3RHBA 5JWRB 2VM1A 1Z9HA 3U6VA 4YQMA 2DBCA 4TN8A 2YZUA 1PA3A 2QGVA 4MJAA 4MPFA 1TK8B 1Y6EA 2VCXA 3GRXA 2DKHA 2IMIA 5AIVA 2K8SA 4FIWA 1ZMAA 3IOSA 2H76A 1XOAA 1A2LA 1XWCA 4TKYA 2A4VA 2LSTA 3I69A 3IC4A 1GSQA 1FW1A 5HQPA 3GN3A 1X9SB 4OO4A 4Q5QA 3HCZA 4KSMA 1XVQA 1J0FA 1G6WA 1B48A 4MJCA 3M1GA 3EYTA 4MZCA 2GSSA 1OE7A 1YDKA 2M46A 4FYUA 4NXIA 3D0ZA 2KUCA 3ZL5A 2FLSA 1GSYA 4N0ZA 2JZTA 4ZL8A 2F8AA 2HZFA 4HJMA 4POLA 5ID2B 3DVWA 3VWXA 2GQLA 3H93A 2K9FA 2H75A 3NZNA 2GQKA 2V1MA 4ICYA 4N0VA 1E6BA 1DSBA 1HQOA 4HUAA 5KN2A 1K0CA 3O3TA 4E8HA 1PN9A 1R5PA 1UVZA 2BTOT 2PWJA 1HNBA 3FHKA 1T8EB 2PU9C 1GNEA 3VPQA 3W6GA 4L0UA 1KBNA 1TJDA 1TU8A 3ZFLA 4QL9A 1SK1A 1SK0A 3U5RE 2RM5A 5J3RA 1ZGNA 3EPTA 3VI7A 18GSA 1FHEA 5CRHA 3GH9A 3ME8A 5A4WA 5J9CA 5ENUA 5JWOB 2GQMA 2X49A 4LL1B 1ZZYA 3UJ1A 3QCPA 4HU9A 3KTLA 4BL7A 4IQ1A 3SBCA 1N2AA 3IAS2 4N30A 3DD3A 1T00A 5IPHA 2RUFA 4Q5FA 1THOA 1MEKA 3KMNA 2GVPA 2HRKA 2XPDA 1TI1A 1M2AA 3LORA 2OADA 2ZCTA 3GSTA 2GSTA 4EDZA 1B9XC 1EP8A 4JRRA 5DJMA 2JL4A 2J23A 2WFCA 1ON4A 1PX7A 3LSZA 4PUFC 1SKSB 4OFTA 2KP1A 6GSXA 2KLXA 1Z6MA 1QGVA 5KOWA 1G7OA 2I1UA 2VD1A 4TRXA 3F9UA 2WCIA 3HD5A 5ECQB 5D9XA 2VOCA 1WP0A 3HY2A 3EC3A 2R37A 2VCVA 2IMKA 5JCUA 1BG5A 1XCCA 3L0HA 4MPGA 1H4OA 2H72A 3TKPA 4IW9A 5E59A 3MSZA 4G2EA 2HRFA 1OC9B 4WBRD 4HQSA 4PQHA 3FR3A 1Z5YE 5D9WA 1XVWA 3KMOA 2H70A 5AIXA 5F8BA 3TKQA 5B6NA 4HJ2A 1O81A 1VGLA 3KEBA 3HA9A 2A2RA 2V6OA 1SL0B 2H6XA 2K18A 1V57A 3IR4A 2YWMA 4PQ1A 3Q18A 1YEPA 2X8GA 1JLVA 2CVKA 1F3AA 2DIYA 1EV9A 1AW9A 1BQ7A 5JCGA 2RUEA 2FWEA 1TW9A 4HOJA 5ID2A 3M9JA 4K2XA 4O32A 3A2WA 2HNLA 4HZ4A 4BPYA 5G30A 1GWCA 3P2AA 2OKAA 3OR5A 4L8EA 3UIWA 6GSTA 1K0OA 4FYBA 3F8UA 1PRXA 1GSUA 4J56E 5DBQA 2GZYA 3EMXA 1WWJA 3FYGA 3HYPA 4HI7A 2DJ0A 3C71A 4IP6A 1PX6A 3WGEA 1C72A 1MDIA 2YP6A 13GSA 1WOUA 4X43A 3VLNA 3HKRA 1XW6A 2G2QA 2I4AA 2CQ9A 4V1Ag 3BOAA 5IMZA 2X64A 2M72A 1AC1A 1OC3A 4K0GA 1EOGA 2YANA 5AISA 16GSA 1V58A 6GSWA 1GUMA 4DSSA 4TR4A 5J4UA 5CREA 4LLRA 6GSSA 1BJXA 4BVYA 3TUEA 2C1YA 3CTGA 5B7CA 4POBA 2DJ2A 1T1VA 2EIRA 3ZREA 2VM2A 1XWBA 1WJKA 2VL9A 3VFIA 4AJ6A 2EC4A 2GZPA 4KH7A 2X8CA 3LJRA 3TKRA 1WIKA 4CY6A 1WPIA 4ZB6A 2CAQA 3M3MA 1BAYA 4I5QA 3ZLPA 5DCGA 1V98A 3BBYA 1ZYPA 2XPEA 4K1FA 3GTUA 4MF5A 1ZYQB 4MDCA 1PKZA 2DKIA 2DJ3A 1X9MB 2XC2A 5FT3A 17GSA 4PNGA 3KH7A 3GHAA 3ISOA 3RBTA 1W89A 5H5SA 2FD3A 2YV9A 2H6ZA 1VRSD 4WR4A 1F37A 3UAPA 2CAIA 1DBYA 2PMTA 1V9WA 3K8NA 3QAVA 2H0IA 5E4WA 10GSA 4ECJA 5DAKA 1AQXA 3GURA 4ZXGA 2YNXA 4EKZA 2MMNA 1Q4JA 5CRGA 2WJUA 2WZ9A 2JZRA 1JZRA 4YKGA 5D9TA 1XZOA 5IPGA 3F6FA 3KCMA 1YZXA 3I9V2 2VIMA 3HXSA 5F07A 2O85A 3S9FA 1K0NA 4N10A 3CYNA 3GMFA 5JWQB 2MMZA 1AQVA 3VK9A 3EMPA 3KD0A 2ZNMA 3F3QA 2GSQA 2H66A 1EV4A 4ZBAA 5CNWA 1JHBA 4ILFA 3UBLA 2JU5A 1GULA 2HZEA 3M8NA 5ECLB 1MTCA 2GZZA 3MNGA 4PTSA 5F05A 1ERUA 9GSSA 1O6JA 3QAGA 3N9JA 4WEYA 2WDUA 1FVKA 4KDUA 5D73A 4WETA 4BWQA 1GSSA 5IO2A 4OCFA 5HR3A 2B7KA 4CHSA 1RK4A 5J5NA 4BL7B 4MLYA 3UARA 1J9BA 2AUVA 3LXTA 1K3LA 2IPAA 5EL8A 3ZMKA 4IP1A 3LGCA 1XWGA 1M7TA 1SK2A 1A0RP 1YF0A 2YJ7A 3VWUA 4FO5A 3R3EA 4MP4A 4D73A 3N5OA 2V2GA 4GWRA 4K5SA 3FR9A 3IRAA 3ZVJD 2C4JA 4EIPA 1ERWA 5DCHA 7GSSA 2LUSA 1V2AA 2C0GA 1I9DA 3WT1A 2HSHA 2P0GA 4XIHA 3RDWA 1GLQA 4X0XA 4NWYA 5ELGA 4ISDA 4EO3A 1QXHA 1XW5A 2L5LA 4EIQA 2AYTA 3GKMA 3GL5A 3Q19A 4HDEA 3VI5A 4YQUA 1SD9A 2PVQA 1TDIA 2L4QA 3EU3A 1K3YA 5IMVA 1OKDA 3DRNA 5IIZA 1BEDA 3I43A 5IM9A 4Z7XA 3GUSA 1NSWA 4HQZA 3FZAA 2HLSA 1SJIA 2C8UA 3ZTLA 3GIXA 2H1BA 4JE1A 1B4PA 2QA2A 2P5RA 2X4AA 4IJIA 2KP2A 1VF1A 1FOVA 1N8JA 3QFBC 4IS0A 1JZOA 1YKCA 1NW2A 5F0GA 2FGXA 1TU7A 5INYA 1DUGA 2H6YA 2HFDA 2LS5A 1Y25A 1JZWA 1XPVA 2GT6A 4PUAA 4NMUA 1T7PB 4FH8A 1M0UA 1XWKA 2I81A 3D4TA 3FKFA 4MNNA 5C04A 4XRDA 4PNFA 1QQ2A 2LRTA 4I2UA 3GKXA 3ZZXA 4Z2TA 1U6TA 1TXXA 3FEUA 3MYDA 4KW6A 1J08A 5IMCA 4EVMA 1XXUA 1OYJA 4I6XA 2H74A 3ED3A 4GSTA 2IWTA 5DDLA 4KGIA 5DQYA 4XHMA 5J9BA 4XS4A 1DE1A 5FHIA 3DVXA 5ECOB 1OAZA 3TJGA 4L5OA 3DKSA 1K0AA 2XHFA 1NM3A 4WKWA 1M2BA 2R6KA 3LW9A 4K6XA 3HVXA 2DMMA 2R4VA 5HFIA 1A8YA 5IQYA 1RQMA 4O7HA 4GSNA 3IPZA 3TRXA 2HT9A 1A2MA 3EWLA 1Z3EA 2VO4A 5G1KA 2H73A 4DSSB 1THXA 2BMXA 2L59A 1WE0A 2K6VA 4BVYB 4GTUA 2AHEA 4BA7A 2LQQA 5L71A 1YKAA 2E7PA 1TKDB 3QFAC 2OJLA 4PQIA 1M9BA 2O87A 3Q6OA 2WB9A 4MJBA 5ECHB 3P90A 5ECPB 2DMLA 4MZWA 4RQXA 2K8VA 4TR1A 3UBKA 1K0MA 2NBSA 3L9SA 1FOHA 4TXOA 4JBBA 4O5QA 3E3EA 2WULA 1Z7PA 1A0FA 4HU7A 1SYXA 4MF6A 4ZBDA 5GAND 4K7OA 3HVSA 4YAPA 4IBPA 2CVDA 2C3NA 3GTUB 2DC5A 3SWLA 1RW1A 2C0EA 4TR0A 2IMDA 4X4JA 2FWGA 2PBJA 1USBA 3VWVA 2YCDA 1XFLA 2YWOA 1IYHA 4AGSA 3J7Yb 1TRWA 4ZILA 3AY8A 4KCEA 3GKKA 1K0DA 2OBKA 3F63A 1X5CA 2TIRA 1HYUA 6GSUA 3J7Yk 3BCIA 2H19A 2HXKA 5DAKB 1EGRA 1FB0A 3FZ9A 2HSMA 2QKEA 1YF1A 2IMFA 2MYGA 4V2LA 2CZ3A 4WF4A 4F82A 5DALA 1T3BA 5EVOA 3PPUA 1KEBA 1SKRB 1JLWA 4ML6A 3LEFA 3TRPA 4IN0A 2O89A 5ELAA 2N5BA 2GT5A 2V32A 3D4MA 3ERFA 5COHA 3WT2A 2REMA 4BVXA 2H71A 3M0FA 2VAFA 4HEA2 5A4VA 1X0RA 3FY7A 1EEMA 2F51A 2CA8A 3G9BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IGJ A;  1F9M A;  3UVH A;  2LRN A;  2QSI A;  5IMD A;  5D8I A;  2NPB A;  4AJ7 A;  3P7X A;  3P8W A;  4NHZ A;  3PR8 A;  2HZE B;  1PGT A;  1FG4 A;  3CMI A;  3PGT A;  1DE2 A;  3G7J A;  4YH2 A;  1S3C A;  2VUP A;  3IBH A;  2C3Q A;  2B1L A;  5B6M A;  2MMO A;  1VF4 A;  2DJ1 A;  4KND A;  4XCS A;  3L78 A;  1GTI A;  3R2Q A;  3FRC A;  3A2X A;  2P31 A;  4J2F A;  2C0F A;  2YPM A;  5G2Z A;  4ZL9 A;  22GS A;  5G31 A;  1ST9 A;  1R5A A;  4ECB A;  3CRT A;  3V1W A;  2GLR A;  2N5A A;  3O76 A;  3LQ7 A;  4MAB A;  4LMW A;  1GTU A;  4X1U A;  2LV3 A;  3MDK A;  6GSY A;  3H79 A;  4AF2 A;  3TGZ A;  1Z6N A;  4D73 B;  2L4C A;  3KXO A;  3F6D A;  3O6T A;  4NV5 A;  2DSA A;  3FZ4 A;  4F2I A;  1R26 A;  4V1A p;  3GV1 A;  3LFL A;  5G5F A;  2PGT A;  2OBI A;  4EDY A;  4OD7 A;  4ZIJ A;  1T4Y A;  3HZ4 A;  4KSO A;  2FHE A;  4ECC A;  4V2N A;  2HSY A;  4GF0 A;  4ID0 A;  2OAC A;  4OWY A;  3GKN A;  1KNG A;  1O73 A;  3F4R A;  2XBI A;  4RI7 A;  2LJR A;  1QMV A;  1FAA A;  1U3I A;  4MZB A;  4PGT A;  2B5X A;  2LJK A;  5CRD A;  3EE2 A;  3LYP A;  4WF5 A;  2ALB A;  3NOF A;  5FWG A;  2XBQ A;  1FVJ A;  5IOW A;  5H5R A;  1MDK A;  4CW9 A;  1X5E A;  3L4N A;  3F4S A;  4EC0 A;  3ZFB A;  4K7I A;  2YN1 A;  1U88 A;  2KOK A;  3M9K A;  2OE1 A;  2F8F A;  2CV4 A;  3UVT A;  2CT6 A;  2OE0 A;  1TK0 B;  6GSV A;  3MWH A;  1SEN A;  4ZL7 A;  3KP8 A;  1GSE A;  2BJX A;  4EL1 A;  3IDV A;  1S3D A;  1AQW A;  2H1A A;  3GYK A;  4RI6 A;  5LCZ A;  3C7M A;  4Q5N A;  3KH9 A;  2H1D A;  4MH3 A;  1G7E A;  1GTA A;  1PSQ A;  4KUN A;  2GS3 A;  3A2V A;  2FCH A;  2AAW A;  3CXG A;  3CSH A;  4XS4 B;  4N11 A;  2CVB A;  1OKT A;  5HR2 A;  1R4W A;  2JAD A;  1ILO A;  1LU4 A;  2H1G A;  1GSD A;  1WMJ A;  3DML A;  1O8W A;  2N5F A;  1EP7 A;  3HJP A;  5ECM B;  3TOT A;  1FO5 A;  4K7N A;  3GFK A;  2GSR A;  2NDO A;  3IK9 A;  4K9Z A;  4P3Y B;  2PN8 A;  1M2D A;  4KA0 A;  2TRC P;  4GSS A;  4ACS A;  3KTB A;  2MMA A;  3H4K A;  3F3R A;  5EY6 A;  4G9H A;  1VF3 A;  4KE3 A;  3ZIV A;  3EU4 A;  3DEX A;  5LNK e;  2O8V B;  4TR1 B;  4Q5R A;  2G0F A;  1NHO A;  2L57 A;  4TXO B;  1H75 A;  1U3A A;  4MCU A;  2VCQ A;  1ERV A;  3HZ8 A;  2C0D A;  4TXV A;  3QR6 A;  1LJR A;  4EUY A;  2B3S A;  1AAZ A;  5HR1 A;  2F9S A;  1JZD A;  4F03 A;  1YJ6 A;  2EIO A;  1T4Z A;  12GS A;  1E2Y A;  3C8E A;  3IHQ A;  1SD8 A;  4MJE A;  3EIN A;  2R3X A;  4OFM A;  4OMV A;  4IHU A;  1TRV A;  1QFN A;  2PVO C;  3IAM 2;  2IL3 A;  4G19 A;  3KIJ A;  2Z9S A;  1YQ1 A;  3BCK A;  1W4V A;  3G7I A;  1XW9 A;  4FYC A;  3KGK A;  4GQC A;  2B6M A;  1A8L A;  3UL3 A;  1XWA A;  1CQH A;  3GX8 A;  5AN1 A;  5EPF A;  5DAL B;  4J57 E;  3ZIJ A;  4ECI A;  5ECR B;  1GSF A;  4K8M A;  1CQG A;  2HE3 A;  3TJB A;  1XIY A;  3FW2 A;  4LMV A;  2RII A;  2LKU A;  1LBK A;  1OVN A;  1PL1 A;  2O7K A;  1PL2 A;  3TOU A;  2L5O A;  1SL2 B;  4WBJ A;  3ERW A;  4MK3 A;  3TB2 A;  1PMT A;  2HYX A;  2YZH A;  1Z7R A;  3UOM A;  3APQ A;  3DXB A;  3US3 A;  1SJZ A;  3JCM L;  2C80 A;  5ECI B;  3VWW A;  1A2J A;  1GLP A;  2CZ2 A;  3ERG A;  4KAE A;  3F0I A;  4IJ3 A;  4XTS A;  3HJO A;  3LXZ A;  2B5E A;  4RQR A;  2B7J A;  3TCO A;  2B1K A;  3IA1 A;  3CRU A;  1A24 A;  5IMF A;  2GDR A;  2WRT A;  4DSR A;  2R5G A;  1I5G A;  4IEL A;  2VLT A;  4JR6 A;  4JU5 A;  3TKS A;  1OC8 A;  2IFQ A;  4XS1 A;  2NVL A;  3F4T A;  3DGQ A;  5ECN B;  4JED A;  2FY6 A;  1MD4 A;  2GGT A;  4QQ7 A;  3VUR A;  5CAX A;  1EZK A;  4POM A;  5IOX A;  1ZYE A;  1AIU A;  4EXJ A;  3FK8 A;  3RAZ A;  1OE8 A;  4NV2 A;  1M99 A;  3E0U A;  4G10 A;  1A23 A;  2H0G A;  1XBS A;  5GSS A;  1EGO A;  1YEX A;  2DJK A;  2IIY A;  4O92 A;  1VF2 A;  2AB6 A;  3GA4 A;  1KTE A;  1IYI A;  2F3M A;  1TI3 A;  5G1L A;  2J9H A;  5A5K A;  4IQA A;  2H01 A;  4CDO A;  1XOB A;  2E2M A;  1K3O A;  2I3Y A;  4YQV A;  3ZIT A;  2PPT A;  2ON5 A;  5DVB A;  4GLT A;  3ZRD A;  1SU9 A;  3KM6 A;  1URM A;  5C00 A;  2TRX A;  3IK7 A;  2H0H A;  2DLX A;  2VD0 A;  2V41 A;  3Q74 A;  4L5L A;  2AV4 A;  2VCZ A;  3EVI A;  4XS6 A;  2LRC A;  1V40 A;  1HNA A;  1Q98 A;  4OO5 A;  1QK8 A;  1PKW A;  2KHP A;  2IN3 A;  4NPB A;  5H5Q A;  3BJ5 A;  2PUK C;  3PH9 A;  4WXT A;  1ACV A;  1TRU A;  1B8X A;  2RM6 A;  4NAX A;  5KN0 A;  3I6A A;  5CYY A;  3FR6 A;  4MF7 A;  3D5J A;  2VL2 A;  4DSQ A;  1O8X A;  4POK A;  5AGY A;  3TKS E;  4PXO A;  1GUK A;  2QC7 A;  4V2M A;  3C1S A;  4L0W A;  4LL4 B;  3DIE A;  2DJJ A;  1F2E A;  3E9J B;  2YV7 A;  1GH2 A;  2MBS A;  1GP1 A;  4MH2 A;  2X8H A;  3WGD A;  3A5W A;  3TJF A;  4MA9 A;  4F0B A;  3D22 A;  1B9Y C;  4F0C A;  1R7H A;  2DIZ A;  4K2D A;  1G0T A;  1GNW A;  1ZOF A;  2JSY A;  5KEJ A;  4HS1 A;  4GCI A;  4EF0 A;  3QOU A;  3IE3 A;  4I2T A;  1YY7 A;  5D93 A;  2H30 A;  3UEM A;  3ZVJ A;  4MMM A;  5DJL A;  3LG6 A;  5LD0 A;  1GL8 A;  3FZ5 A;  3EUR A;  2GTU A;  4H86 A;  2FUG 2;  5J41 A;  3VPT A;  1MDJ A;  1PD2 1;  4O5R A;  2E2G A;  4ML1 A;  8GSS A;  3A3T A;  3NIV A;  3LYK A;  2M80 A;  1PQN A;  1QUW A;  5HFG A;  5KN1 A;  3IXR A;  1TRS A;  5B8B A;  2FWH A;  5CO3 A;  4XRA A;  2LEG A;  3BD2 A;  1ML6 A;  1K0B A;  3TJJ A;  5CRW A;  1JFU A;  4TOP A;  19GS A;  4ZB8 A;  3RPP A;  2ZUP A;  1X9W B;  20GS A;  1TTZ A;  1ERT A;  2VCT A;  4IKH A;  4E8E A;  3MAK A;  2I9H A;  1UC7 A;  1GRX A;  2YOI A;  3LWA A;  4PX1 A;  3DWV A;  14GS A;  1G6Y A;  2IJY A;  5ECK B;  1F6M C;  4WR5 A;  1ZL9 A;  3GNJ A;  3CSI A;  1O85 A;  2R2J A;  3G7Y A;  4OCE A;  4KDY A;  4ZB9 A;  3WYW A;  3H1N A;  5GST A;  3GX0 A;  4ULX A;  5D9V A;  2FA8 A;  1MD3 A;  3UMA A;  4RUV A;  3KJY A;  1HD2 A;  2LJA A;  2LTK A;  2YJH A;  4TR3 A;  4BWS A;  1AXD A;  3HJM A;  5CP1 A;  3HDC A;  3TKS C;  2IME A;  2FA4 A;  3DYR A;  2A2S A;  1B4Q A;  4TW5 A;  2B5Y A;  3RPN A;  3CTF A;  4K0N A;  2P5Q A;  3KP9 A;  1S3A A;  2VLV A;  1UN2 A;  3QPM A;  2L6C A;  1UA5 A;  1WRY A;  5HFK A;  3GH6 A;  4GQF A;  2JSZ A;  2OA7 A;  1EEJ A;  1FB6 A;  2L6D A;  4KDX A;  3C73 A;  5F06 A;  3L9U A;  3CSJ A;  1TP9 A;  2WS2 A;  2X99 A;  2E0Q A;  1OC9 A;  4EE0 A;  1U87 A;  3HVV A;  1F3B A;  2MZC A;  3TJK A;  2YWI A;  4QL7 A;  2FNO A;  4PUR A;  2AJQ B;  2LNS A;  4NHW A;  3TRQ A;  4KCA A;  3WD6 A;  4IVF A;  1M9A A;  5IMA A;  5HR0 A;  5IO0 A;  2FWF A;  1TK5 B;  2HRN A;  3D6I A;  4LA1 A;  3C1R A;  5ABR A;  2ON7 A;  5D96 A;  2LNT A;  2YWN A;  3ME7 A;  2IFQ B;  4I8B A;  3W8S A;  3QD9 A;  1NHY A;  4GRF A;  3ZML A;  1AUC A;  2ES7 A;  4GXZ A;  4OFN A;  1ABA A;  2D2Z A;  2VCW A;  1GTB A;  2PER A;  2H8L A;  3H8Q A;  4YAV A;  3L9V A;  1HNC A;  4TVE A;  2RLI A;  3ZYW A;  11GS A;  3RHC A;  1BX9 A;  1GUH A;  4ZBB A;  3TDG A;  1O7U A;  2HI7 A;  3QAW A;  5GZZ B;  2JAC A;  4KX4 A;  4HZ2 A;  3CBU A;  1SKW B;  5G5E A;  2WGR A;  4JZQ A;  1TOF A;  3D21 A;  2EIQ A;  5A4U A;  2JZS A;  3HHV A;  3WGX A;  2V6K A;  5KN3 A;  4I97 A;  2VL2 C;  3GL3 A;  5ECS A;  2CX3 A;  2C3T A;  2NTO A;  5GAP D;  1X5D A;  5JCW A;  2OE3 A;  4DVC A;  3GSS A;  4DEJ A;  2MBT A;  3W8J A;  5DQS A;  1EWX A;  1EOH A;  2VL3 A;  3APS A;  5B8A A;  1BYE A;  4AJ8 A;  2CX4 A;  3IV4 A;  4KB3 A;  2VLU A;  1SJ6 A;  1ZCP A;  4F9Z A;  2LQO A;  1SYR A;  1SL1 B;  3QMX A;  3KZQ A;  3APO A;  3QDN A;  3PIN A;  4JR4 A;  3RHB A;  5JWR B;  2VM1 A;  1Z9H A;  3U6V A;  4YQM A;  2DBC A;  4TN8 A;  2YZU A;  1PA3 A;  2QGV A;  4MJA A;  4MPF A;  1TK8 B;  1Y6E A;  2VCX A;  3GRX A;  2IMI A;  5AIV A;  2K8S A;  4FIW A;  1ZMA A;  3IOS A;  2H76 A;  1XOA A;  1A2L A;  1XWC A;  4TKY A;  2A4V A;  2LST A;  3I69 A;  3IC4 A;  1GSQ A;  1FW1 A;  5HQP A;  3GN3 A;  1X9S B;  4OO4 A;  4Q5Q A;  3HCZ A;  4KSM A;  1XVQ A;  1J0F A;  1G6W A;  1B48 A;  4MJC A;  3M1G A;  3EYT A;  4MZC A;  2GSS A;  1OE7 A;  1YDK A;  2M46 A;  4FYU A;  4NXI A;  3D0Z A;  2KUC A;  3ZL5 A;  2FLS A;  1GSY A;  4N0Z A;  2JZT A;  4ZL8 A;  2F8A A;  2HZF A;  4HJM A;  4POL A;  5ID2 B;  3DVW A;  3VWX A;  2GQL A;  3H93 A;  2K9F A;  2H75 A;  3NZN A;  2GQK A;  2V1M A;  4N0V A;  1E6B A;  1DSB A;  1HQO A;  4HUA A;  5KN2 A;  1K0C A;  3O3T A;  4E8H A;  1PN9 A;  1R5P A;  1UVZ A;  2BTO T;  2PWJ A;  1HNB A;  3FHK A;  1T8E B;  2PU9 C;  1GNE A;  3VPQ A;  3W6G A;  4L0U A;  1KBN A;  1TJD A;  1TU8 A;  3ZFL A;  4QL9 A;  1SK1 A;  1SK0 A;  3U5R E;  2RM5 A;  5J3R A;  1ZGN A;  3VI7 A;  18GS A;  1FHE A;  5CRH A;  3GH9 A;  3ME8 A;  5A4W A;  5J9C A;  5ENU A;  5JWO B;  2GQM A;  4LL1 B;  1ZZY A;  3UJ1 A;  3QCP A;  4HU9 A;  3KTL A;  4BL7 A;  4IQ1 A;  3SBC A;  1N2A A;  3IAS 2;  4N30 A;  3DD3 A;  1T00 A;  5IPH A;  2RUF A;  4Q5F A;  1THO A;  1MEK A;  3KMN A;  2GVP A;  2XPD A;  1TI1 A;  1M2A A;  3LOR A;  2OAD A;  2ZCT A;  3GST A;  2GST A;  4EDZ A;  1B9X C;  1EP8 A;  4JRR A;  5DJM A;  2JL4 A;  2J23 A;  2WFC A;  1ON4 A;  1PX7 A;  3LSZ A;  4PUF C;  1SKS B;  4OFT A;  2KP1 A;  6GSX A;  2KLX A;  1Z6M A;  1QGV A;  1G7O A;  2I1U A;  2VD1 A;  4TRX A;  3F9U A;  2WCI A;  3HD5 A;  5ECQ B;  5D9X A;  2VOC A;  1WP0 A;  3HY2 A;  3EC3 A;  2R37 A;  2VCV A;  2IMK A;  5JCU A;  1BG5 A;  1XCC A;  3L0H A;  4MPG A;  1H4O A;  2H72 A;  3TKP A;  4IW9 A;  5E59 A;  3MSZ A;  4G2E A;  2HRF A;  1OC9 B;  4WBR D;  4HQS A;  4PQH A;  3FR3 A;  1Z5Y E;  5D9W A;  1XVW A;  3KMO A;  2H70 A;  5AIX A;  5F8B A;  3TKQ A;  5B6N A;  4HJ2 A;  1O81 A;  1VGL A;  3KEB A;  3HA9 A;  2A2R A;  2V6O A;  1SL0 B;  2H6X A;  2K18 A;  1V57 A;  3IR4 A;  2YWM A;  4PQ1 A;  3Q18 A;  1YEP A;  2X8G A;  1JLV A;  2CVK A;  1F3A A;  2DIY A;  1EV9 A;  1AW9 A;  1BQ7 A;  5JCG A;  2RUE A;  2FWE A;  1TW9 A;  4HOJ A;  5ID2 A;  3M9J A;  4O32 A;  3A2W A;  2HNL A;  4HZ4 A;  4BPY A;  5G30 A;  1GWC A;  3P2A A;  2OKA A;  3OR5 A;  4L8E A;  3UIW A;  6GST A;  1K0O A;  4FYB A;  3F8U A;  1PRX A;  1GSU A;  4J56 E;  5DBQ A;  2GZY A;  3EMX A;  1WWJ A;  3FYG A;  3HYP A;  4HI7 A;  2DJ0 A;  3C71 A;  4IP6 A;  1PX6 A;  3WGE A;  1C72 A;  1MDI A;  2YP6 A;  13GS A;  1WOU A;  4X43 A;  3VLN A;  3HKR A;  1XW6 A;  2G2Q A;  2I4A A;  2CQ9 A;  4V1A g;  3BOA A;  5IMZ A;  2X64 A;  2M72 A;  1AC1 A;  1OC3 A;  4K0G A;  1EOG A;  2YAN A;  5AIS A;  16GS A;  1V58 A;  6GSW A;  1GUM A;  4DSS A;  4TR4 A;  5J4U A;  5CRE A;  4LLR A;  6GSS A;  1BJX A;  4BVY A;  3TUE A;  2C1Y A;  3CTG A;  5B7C A;  4POB A;  2DJ2 A;  1T1V A;  2EIR A;  3ZRE A;  2VM2 A;  1XWB A;  1WJK A;  2VL9 A;  3VFI A;  4AJ6 A;  2EC4 A;  2GZP A;  4KH7 A;  2X8C A;  3LJR A;  3TKR A;  1WIK A;  1WPI A;  4ZB6 A;  2CAQ A;  3M3M A;  1BAY A;  4I5Q A;  3ZLP A;  5DCG A;  1V98 A;  3BBY A;  2XPE A;  4K1F A;  3GTU A;  4MF5 A;  1ZYQ B;  4MDC A;  1PKZ A;  2DJ3 A;  1X9M B;  2XC2 A;  5FT3 A;  17GS A;  4PNG A;  3KH7 A;  3GHA A;  3ISO A;  3RBT A;  1W89 A;  5H5S A;  2FD3 A;  2YV9 A;  2H6Z A;  1VRS D;  4WR4 A;  1F37 A;  3UAP A;  2CAI A;  1DBY A;  2PMT A;  1V9W A;  3K8N A;  3QAV A;  2H0I A;  5E4W A;  10GS A;  4ECJ A;  5DAK A;  1AQX A;  3GUR A;  4ZXG A;  2YNX A;  4EKZ A;  2MMN A;  1Q4J A;  5CRG A;  2WJU A;  2WZ9 A;  2JZR A;  1JZR A;  5D9T A;  1XZO A;  5IPG A;  3F6F A;  3KCM A;  1YZX A;  3I9V 2;  2VIM A;  3HXS A;  5F07 A;  2O85 A;  3S9F A;  1K0N A;  4N10 A;  3CYN A;  3GMF A;  5JWQ B;  2MMZ A;  1AQV A;  3VK9 A;  3EMP A;  3KD0 A;  2ZNM A;  3F3Q A;  2GSQ A;  2H66 A;  1EV4 A;  4ZBA A;  5CNW A;  1JHB A;  4ILF A;  3UBL A;  2JU5 A;  1GUL A;  2HZE A;  3M8N A;  5ECL B;  1MTC A;  2GZZ A;  3MNG A;  5F05 A;  1ERU A;  9GSS A;  1O6J A;  3QAG A;  3N9J A;  4WEY A;  2WDU A;  1FVK A;  4KDU A;  5D73 A;  4WET A;  4BWQ A;  1GSS A;  5IO2 A;  4OCF A;  5HR3 A;  2B7K A;  4CHS A;  1RK4 A;  5J5N A;  4MLY A;  3UAR A;  1J9B A;  2AUV A;  3LXT A;  1K3L A;  2IPA A;  5EL8 A;  3ZMK A;  4IP1 A;  3LGC A;  1XWG A;  1M7T A;  1SK2 A;  1A0R P;  1YF0 A;  2YJ7 A;  3VWU A;  4FO5 A;  4MP4 A;  4D73 A;  3N5O A;  2V2G A;  4GWR A;  3FR9 A;  3IRA A;  3ZVJ D;  2C4J A;  1ERW A;  5DCH A;  7GSS A;  2LUS A;  1V2A A;  2C0G A;  1I9D A;  3WT1 A;  2HSH A;  2P0G A;  4XIH A;  3RDW A;  1GLQ A;  4X0X A;  5ELG A;  4NWY A;  4ISD A;  4EO3 A;  1QXH A;  1XW5 A;  2L5L A;  2AYT A;  3GKM A;  3GL5 A;  3Q19 A;  4HDE A;  3VI5 A;  4YQU A;  1SD9 A;  2PVQ A;  1TDI A;  2L4Q A;  3EU3 A;  1K3Y A;  5IMV A;  1OKD A;  3DRN A;  5IIZ A;  1BED A;  3I43 A;  5IM9 A;  4Z7X A;  3GUS A;  1NSW A;  4HQZ A;  3FZA A;  2HLS A;  1SJI A;  2C8U A;  3ZTL A;  3GIX A;  2H1B A;  4JE1 A;  1B4P A;  2P5R A;  4IJI A;  2KP2 A;  1VF1 A;  1FOV A;  1N8J A;  3QFB C;  4IS0 A;  1JZO A;  1YKC A;  1NW2 A;  5F0G A;  2FGX A;  1TU7 A;  5INY A;  1DUG A;  2H6Y A;  2HFD A;  2LS5 A;  1Y25 A;  1JZW A;  1XPV A;  2GT6 A;  4PUA A;  4NMU A;  1T7P B;  4FH8 A;  1M0U A;  1XWK A;  2I81 A;  3D4T A;  3FKF A;  5C04 A;  4XRD A;  4PNF A;  1QQ2 A;  2LRT A;  4I2U A;  3GKX A;  3ZZX A;  1U6T A;  1TXX A;  3FEU A;  4KW6 A;  1J08 A;  5IMC A;  4EVM A;  1XXU A;  1OYJ A;  4I6X A;  2H74 A;  3ED3 A;  4GST A;  2IWT A;  5DDL A;  4KGI A;  5DQY A;  4XHM A;  5J9B A;  4XS4 A;  1DE1 A;  5FHI A;  3DVX A;  5ECO B;  1OAZ A;  3TJG A;  4L5O A;  3DKS A;  1K0A A;  2XHF A;  1NM3 A;  4WKW A;  1M2B A;  2R6K A;  4K6X A;  3HVX A;  2DMM A;  2R4V A;  5HFI A;  1A8Y A;  5IQY A;  1RQM A;  4O7H A;  4GSN A;  3IPZ A;  3TRX A;  2HT9 A;  1A2M A;  3EWL A;  1Z3E A;  2VO4 A;  5G1K A;  2H73 A;  4DSS B;  1THX A;  2BMX A;  2L59 A;  1WE0 A;  2K6V A;  4GTU A;  2AHE A;  4BA7 A;  2LQQ A;  5L71 A;  1YKA A;  2E7P A;  1TKD B;  3QFA C;  2OJL A;  4PQI A;  1M9B A;  2O87 A;  3Q6O A;  2WB9 A;  4MJB A;  5ECH B;  3P90 A;  5ECP B;  2DML A;  4MZW A;  4RQX A;  2K8V A;  4TR1 A;  3UBK A;  1K0M A;  2NBS A;  3L9S A;  4JBB A;  4TXO A;  3E3E A;  2WUL A;  1Z7P A;  1A0F A;  4HU7 A;  1SYX A;  4MF6 A;  4ZBD A;  5GAN D;  4K7O A;  3HVS A;  4YAP A;  4IBP A;  2CVD A;  2C3N A;  3GTU B;  2DC5 A;  3SWL A;  1RW1 A;  2C0E A;  4TR0 A;  2IMD A;  2FWG A;  2PBJ A;  1USB A;  3VWV A;  2YCD A;  1XFL A;  2YWO A;  1IYH A;  4AGS A;  3J7Y b;  1TRW A;  4ZIL A;  3AY8 A;  4KCE A;  3GKK A;  1K0D A;  2OBK A;  3F63 A;  1X5C A;  2TIR A;  1HYU A;  6GSU A;  3J7Y k;  3BCI A;  2H19 A;  2HXK A;  5DAK B;  1EGR A;  1FB0 A;  3FZ9 A;  2QKE A;  1YF1 A;  2IMF A;  2MYG A;  4V2L A;  2CZ3 A;  4WF4 A;  4F82 A;  5DAL A;  1T3B A;  5EVO A;  1KEB A;  1SKR B;  1JLW A;  4ML6 A;  3LEF A;  3TRP A;  4IN0 A;  2O89 A;  5ELA A;  2N5B A;  2GT5 A;  2V32 A;  3D4M A;  3ERF A;  5COH A;  3WT2 A;  2REM A;  4BVX A;  2H71 A;  3M0F A;  2VAF A;  4HEA 2;  5A4V A;  1X0R A;  3FY7 A;  1EEM A;  2F51 A;  2CA8 A;  3G9B A; 
#chains in the Genus database with same CATH topology
 4IGJ A;  1F9M A;  3UVH A;  2LRN A;  2QSI A;  5IMD A;  5D8I A;  2NPB A;  4AJ7 A;  3P7X A;  3P8W A;  4NHZ A;  3PR8 A;  2HZE B;  1PGT A;  2R0G A;  1FG4 A;  1M3J A;  3CMI A;  3PGT A;  1DE2 A;  3G7J A;  4YH2 A;  1S3C A;  2VUP A;  3IBH A;  2C3Q A;  2B1L A;  5B6M A;  4Z2R A;  2MMO A;  1VF4 A;  2DJ1 A;  4KND A;  4XCS A;  3L78 A;  1GTI A;  3R2Q A;  3FRC A;  3A2X A;  2P31 A;  4J2F A;  2C0F A;  2YPM A;  5G2Z A;  4ZL9 A;  4KF9 A;  22GS A;  5G31 A;  1ST9 A;  1R5A A;  4ECB A;  3CRT A;  3V1W A;  2GLR A;  2N5A A;  3O76 A;  3LQ7 A;  4MAB A;  4LMW A;  1GTU A;  4X1U A;  2LV3 A;  3MDK A;  6GSY A;  3H79 A;  4AF2 A;  3TGZ A;  1Z6N A;  4D73 B;  2L4C A;  3KXO A;  3F6D A;  3O6T A;  4NV5 A;  2DSA A;  3FZ4 A;  4F2I A;  1R26 A;  4V1A p;  3GV1 A;  3LFL A;  5G5F A;  2PGT A;  2OBI A;  4EDY A;  4OD7 A;  4ZIJ A;  1T4Y A;  3HZ4 A;  4KSO A;  2FHE A;  4ECC A;  4V2N A;  2HSY A;  4GF0 A;  4ID0 A;  2OAC A;  4OWY A;  3GKN A;  1KNG A;  1O73 A;  3F4R A;  2XBI A;  4RI7 A;  2LJR A;  1QMV A;  1FAA A;  1U3I A;  4MZB A;  4PGT A;  2B5X A;  2LJK A;  5CRD A;  3EE2 A;  3LYP A;  4WF5 A;  3IC8 A;  2ALB A;  3NOF A;  5FWG A;  2XBQ A;  1FVJ A;  5IOW A;  5H5R A;  1MDK A;  4CW9 A;  1X5E A;  3L4N A;  3F4S A;  4EC0 A;  3ZFB A;  4K7I A;  2YN1 A;  1U88 A;  2KOK A;  3M9K A;  2OE1 A;  2F8F A;  2CV4 A;  3UVT A;  2CT6 A;  2OE0 A;  1TK0 B;  6GSV A;  3MWH A;  1SEN A;  4ZL7 A;  3KP8 A;  1GSE A;  2BJX A;  4EL1 A;  3IDV A;  1S3D A;  1AQW A;  2H1A A;  3GYK A;  4RI6 A;  5LCZ A;  3C7M A;  4Q5N A;  2A2P A;  3KH9 A;  2H1D A;  4MH3 A;  1G7E A;  1GTA A;  1PSQ A;  4KUN A;  2GS3 A;  3A2V A;  2FCH A;  2AAW A;  3CXG A;  3CSH A;  4XS4 B;  4N11 A;  2CVB A;  1OKT A;  5HR2 A;  1R4W A;  2JAD A;  1ILO A;  1LU4 A;  2H1G A;  1GSD A;  1WMJ A;  3DML A;  1O8W A;  2N5F A;  1EP7 A;  3HJP A;  2A4H A;  5ECM B;  3TOT A;  1FO5 A;  4K7N A;  3GFK A;  2GSR A;  2NDO A;  3IK9 A;  4K9Z A;  1PFO A;  4P3Y B;  2PN8 A;  1M2D A;  4KA0 A;  2TRC P;  4GSS A;  4ACS A;  3KTB A;  2MMA A;  3H4K A;  3F3R A;  5EY6 A;  4G9H A;  1VF3 A;  4KE3 A;  3ZIV A;  3EU4 A;  3DEX A;  4A5P A;  2O8V B;  5LNK e;  4TR1 B;  4Q5R A;  2G0F A;  1NHO A;  2L57 A;  4TXO B;  1H75 A;  1U3A A;  4MCU A;  2VCQ A;  1ERV A;  3HZ8 A;  2C0D A;  4TXV A;  3QR6 A;  1LJR A;  4EUY A;  2B3S A;  1AAZ A;  5HR1 A;  2F9S A;  1JZD A;  4F03 A;  1YJ6 A;  2EIO A;  1T4Z A;  12GS A;  1E2Y A;  3C8E A;  3IHQ A;  1SD8 A;  4MJE A;  3EIN A;  2R3X A;  4OFM A;  4OMV A;  4IHU A;  1TRV A;  1QFN A;  2PVO C;  3IAM 2;  2IL3 A;  4G19 A;  3KIJ A;  2Z9S A;  1YQ1 A;  3BCK A;  1W4V A;  3G7I A;  1XW9 A;  4FYC A;  3KGK A;  4GQC A;  2B6M A;  1A8L A;  3UL3 A;  1XWA A;  1CQH A;  3GX8 A;  5AN1 A;  5EPF A;  5DAL B;  4J57 E;  3ZIJ A;  4ECI A;  5ECR B;  1GSF A;  4K8M A;  3IHG A;  1CQG A;  2HE3 A;  3TJB A;  1XIY A;  3FW2 A;  4LMV A;  2RII A;  2LKU A;  4K5R A;  1LBK A;  1OVN A;  1PL1 A;  2O7K A;  1PL2 A;  3TOU A;  2L5O A;  1SL2 B;  4WBJ A;  3ERW A;  4BVX B;  4MK3 A;  3TB2 A;  1PMT A;  2HYX A;  2YZH A;  1Z7R A;  3UOM A;  3APQ A;  3DXB A;  3US3 A;  1SJZ A;  3JCM L;  2C80 A;  5ECI B;  3VWW A;  1A2J A;  1GLP A;  2CZ2 A;  3ERG A;  4KAE A;  3A5I A;  3F0I A;  4IJ3 A;  4XTS A;  3HJO A;  3LXZ A;  2B5E A;  4RQR A;  2B7J A;  3TCO A;  2B1K A;  3IA1 A;  3CRU A;  1A24 A;  5IMF A;  2GDR A;  2WRT A;  4DSR A;  2R5G A;  1I5G A;  4IEL A;  2VLT A;  4JR6 A;  4JU5 A;  3TKS A;  1OC8 A;  2IFQ A;  4XS1 A;  2NVL A;  3F4T A;  4Z2U A;  3DGQ A;  5ECN B;  4JED A;  2FY6 A;  1MD4 A;  2GGT A;  4QQ7 A;  3VUR A;  5CAX A;  1EZK A;  4POM A;  3MIX A;  5IOX A;  1ZYE A;  1AIU A;  4EXJ A;  3FK8 A;  3RAZ A;  1OE8 A;  4NV2 A;  1M99 A;  3E0U A;  4G10 A;  1A23 A;  2H0G A;  1XBS A;  4USS A;  5GSS A;  1EGO A;  1YEX A;  2DJK A;  2IIY A;  4O92 A;  1VF2 A;  2AB6 A;  3FMW A;  3GA4 A;  1KTE A;  1IYI A;  2F3M A;  1TI3 A;  5G1L A;  2J9H A;  5A5K A;  4IQA A;  2H01 A;  4CDO A;  1XOB A;  2E2M A;  1K3O A;  4HSC X;  2I3Y A;  4YQV A;  3ZIT A;  2PPT A;  2ON5 A;  5DVB A;  4GLT A;  3ZRD A;  1SU9 A;  3KM6 A;  1URM A;  5C00 A;  2TRX A;  3IK7 A;  2H0H A;  2DLX A;  2VD0 A;  2V41 A;  3Q74 A;  4L5L A;  4G0L A;  2AV4 A;  2VCZ A;  3EVI A;  4XS6 A;  2R0C A;  2LRC A;  1V40 A;  1HNA A;  1Q98 A;  4OO5 A;  1QK8 A;  1PKW A;  2KHP A;  2IN3 A;  4NPB A;  5H5Q A;  3BJ5 A;  5BRT A;  2PUK C;  3PH9 A;  4WXT A;  1ACV A;  1TRU A;  1B8X A;  2RM6 A;  4NAX A;  5KN0 A;  3I6A A;  5CYY A;  3FR6 A;  4MF7 A;  3D5J A;  2VL2 A;  4DSQ A;  1ZYN A;  1O8X A;  4POK A;  5AGY A;  3TKS E;  4PXO A;  1GUK A;  2QC7 A;  4V2M A;  3C1S A;  4L0W A;  4LL4 B;  3DIE A;  2DJJ A;  1F2E A;  3E9J B;  2YV7 A;  1GH2 A;  2MBS A;  1GP1 A;  4MH2 A;  2X8H A;  3WGD A;  3A5W A;  3TJF A;  4MA9 A;  4F0B A;  3D22 A;  1B9Y C;  4F0C A;  1R7H A;  2DIZ A;  4K2D A;  1G0T A;  1GNW A;  1ZOF A;  2JSY A;  5KEJ A;  4HS1 A;  4GCI A;  4EF0 A;  3QOU A;  3IE3 A;  4I2T A;  1YY7 A;  5D93 A;  2H30 A;  3UEM A;  3ZVJ A;  4MMM A;  5DJL A;  3LG6 A;  5LD0 A;  1GL8 A;  3FZ5 A;  3EUR A;  2GTU A;  4H86 A;  2FUG 2;  5J41 A;  3VPT A;  1MDJ A;  1PD2 1;  4O5R A;  2E2G A;  4ML1 A;  8GSS A;  3A3T A;  3NIV A;  3LYK A;  2M80 A;  1PQN A;  1QUW A;  5HFG A;  5KN1 A;  3IXR A;  1TRS A;  4BIK A;  5B8B A;  5KOX A;  2FWH A;  5CO3 A;  4XRA A;  2LEG A;  3BD2 A;  1ML6 A;  1K0B A;  3TJJ A;  5CRW A;  1JFU A;  4TOP A;  19GS A;  4ZB8 A;  3RPP A;  2ZUP A;  1X9W B;  20GS A;  1TTZ A;  1ERT A;  2VCT A;  4IKH A;  4E8E A;  3MAK A;  2I9H A;  1UC7 A;  1GRX A;  2YOI A;  3LWA A;  4PX1 A;  3DWV A;  14GS A;  1G6Y A;  2IJY A;  5ECK B;  1F6M C;  4WR5 A;  1ZL9 A;  4CY8 A;  3GNJ A;  3CSI A;  1O85 A;  2R2J A;  3G7Y A;  4OCE A;  4KDY A;  4ZB9 A;  3WYW A;  3H1N A;  5GST A;  3GX0 A;  4ULX A;  5D9V A;  2FA8 A;  1MD3 A;  1PN0 A;  3UMA A;  4RUV A;  2R0P A;  3KJY A;  1HD2 A;  2LJA A;  2LTK A;  2YJH A;  4TR3 A;  4BWS A;  5BMU A;  2HRA A;  1AXD A;  3HJM A;  5CP1 A;  3HDC A;  3TKS C;  2IME A;  2FA4 A;  3DYR A;  2A2S A;  1B4Q A;  4TW5 A;  2B5Y A;  3RPN A;  3CTF A;  4K0N A;  2P5Q A;  3KP9 A;  1S3A A;  2VLV A;  1UN2 A;  3QPM A;  2L6C A;  1UA5 A;  1WRY A;  5HFK A;  3GH6 A;  4GQF A;  2JSZ A;  2OA7 A;  1EEJ A;  1FB6 A;  2L6D A;  4KDX A;  3C73 A;  5F06 A;  3L9U A;  3CSJ A;  1TP9 A;  2WS2 A;  2X99 A;  2E0Q A;  1OC9 A;  4EE0 A;  1U87 A;  3HVV A;  1F3B A;  2MZC A;  3TJK A;  2YWI A;  4QL7 A;  2FNO A;  4PUR A;  2AJQ B;  2LNS A;  4NHW A;  3TRQ A;  4KCA A;  3WD6 A;  4IVF A;  1M9A A;  5IMA A;  5HR0 A;  1S3R A;  5IO0 A;  2FWF A;  1TK5 B;  2HRN A;  3D6I A;  4LA1 A;  3C1R A;  5ABR A;  2ON7 A;  5D96 A;  2LNT A;  2YWN A;  3ME7 A;  2IFQ B;  4I8B A;  3W8S A;  3QD9 A;  1NHY A;  4GRF A;  3ZML A;  1AUC A;  2ES7 A;  4GXZ A;  4OFN A;  1ABA A;  2D2Z A;  4G0I A;  2VCW A;  1GTB A;  2PER A;  2H8L A;  3H8Q A;  4YAV A;  3L9V A;  1HNC A;  4TVE A;  2RLI A;  3ZYW A;  11GS A;  3RHC A;  1BX9 A;  1GUH A;  4ZBB A;  3TDG A;  1O7U A;  2HI7 A;  3QAW A;  5GZZ B;  2JAC A;  4KX4 A;  4HZ2 A;  3CQF A;  2UZ8 A;  3CBU A;  1SKW B;  5G5E A;  2WGR A;  4JZQ A;  4G0K A;  1TOF A;  3D21 A;  2EIQ A;  5A4U A;  2JZS A;  3HHV A;  3WGX A;  2V6K A;  5KN3 A;  4I97 A;  2VL2 C;  3GL3 A;  5ECS A;  2CX3 A;  2C3T A;  2NTO A;  5GAP D;  1X5D A;  5JCW A;  2OE3 A;  4DVC A;  3GSS A;  4DEJ A;  2MBT A;  3W8J A;  5DQS A;  1EWX A;  1EOH A;  2VL3 A;  3APS A;  5B8A A;  1BYE A;  4AJ8 A;  2CX4 A;  4O5U A;  3IV4 A;  4KB3 A;  2VLU A;  1SJ6 A;  1ZCP A;  4F9Z A;  2LQO A;  2QA1 A;  1SYR A;  1SL1 B;  4YKF A;  3QMX A;  4FQU A;  3KZQ A;  3APO A;  3QDN A;  3PIN A;  4JR4 A;  3RHB A;  5JWR B;  2VM1 A;  1Z9H A;  3U6V A;  4YQM A;  2DBC A;  4TN8 A;  2YZU A;  1PA3 A;  2QGV A;  4MJA A;  4MPF A;  1TK8 B;  1Y6E A;  2VCX A;  3GRX A;  2DKH A;  2IMI A;  5AIV A;  2K8S A;  4FIW A;  1ZMA A;  3IOS A;  2H76 A;  1XOA A;  1A2L A;  1XWC A;  4TKY A;  2A4V A;  2LST A;  3I69 A;  3IC4 A;  1GSQ A;  1FW1 A;  5HQP A;  3GN3 A;  1X9S B;  4OO4 A;  4Q5Q A;  3HCZ A;  4KSM A;  1XVQ A;  1J0F A;  1G6W A;  1B48 A;  4MJC A;  3M1G A;  3EYT A;  4MZC A;  2GSS A;  1OE7 A;  1YDK A;  2M46 A;  4FYU A;  4NXI A;  3D0Z A;  2KUC A;  3ZL5 A;  2FLS A;  1GSY A;  4N0Z A;  2JZT A;  4ZL8 A;  2F8A A;  2HZF A;  4HJM A;  4POL A;  5ID2 B;  3DVW A;  3VWX A;  2GQL A;  3H93 A;  2K9F A;  2H75 A;  3NZN A;  2GQK A;  2V1M A;  4ICY A;  4N0V A;  1E6B A;  1DSB A;  1HQO A;  4HUA A;  5KN2 A;  1K0C A;  3O3T A;  4E8H A;  1PN9 A;  1R5P A;  1UVZ A;  2BTO T;  2PWJ A;  1HNB A;  3FHK A;  1T8E B;  2PU9 C;  1GNE A;  3VPQ A;  3W6G A;  4L0U A;  1KBN A;  1TJD A;  1TU8 A;  3ZFL A;  4QL9 A;  1SK1 A;  1SK0 A;  3U5R E;  2RM5 A;  5J3R A;  1ZGN A;  3EPT A;  3VI7 A;  18GS A;  1FHE A;  5CRH A;  3GH9 A;  3ME8 A;  5A4W A;  5J9C A;  5ENU A;  5JWO B;  2GQM A;  2X49 A;  4LL1 B;  1ZZY A;  3UJ1 A;  3QCP A;  4HU9 A;  3KTL A;  4BL7 A;  4IQ1 A;  3SBC A;  1N2A A;  3IAS 2;  4N30 A;  3DD3 A;  1T00 A;  5IPH A;  2RUF A;  4Q5F A;  1THO A;  1MEK A;  3KMN A;  2GVP A;  2HRK A;  2XPD A;  1TI1 A;  1M2A A;  3LOR A;  2OAD A;  2ZCT A;  3GST A;  2GST A;  4EDZ A;  1B9X C;  1EP8 A;  4JRR A;  5DJM A;  2JL4 A;  2J23 A;  2WFC A;  1ON4 A;  1PX7 A;  3LSZ A;  4PUF C;  1SKS B;  4OFT A;  2KP1 A;  6GSX A;  2KLX A;  1Z6M A;  1QGV A;  5KOW A;  1G7O A;  2I1U A;  2VD1 A;  4TRX A;  3F9U A;  2WCI A;  3HD5 A;  5ECQ B;  5D9X A;  2VOC A;  1WP0 A;  3HY2 A;  3EC3 A;  2R37 A;  2VCV A;  2IMK A;  5JCU A;  1BG5 A;  1XCC A;  3L0H A;  4MPG A;  1H4O A;  2H72 A;  3TKP A;  4IW9 A;  5E59 A;  3MSZ A;  4G2E A;  2HRF A;  1OC9 B;  4WBR D;  4HQS A;  4PQH A;  3FR3 A;  1Z5Y E;  5D9W A;  1XVW A;  3KMO A;  2H70 A;  5AIX A;  5F8B A;  3TKQ A;  5B6N A;  4HJ2 A;  1O81 A;  1VGL A;  3KEB A;  3HA9 A;  2A2R A;  2V6O A;  1SL0 B;  2H6X A;  2K18 A;  1V57 A;  3IR4 A;  2YWM A;  4PQ1 A;  3Q18 A;  1YEP A;  2X8G A;  1JLV A;  2CVK A;  1F3A A;  2DIY A;  1EV9 A;  1AW9 A;  1BQ7 A;  5JCG A;  2RUE A;  2FWE A;  1TW9 A;  4HOJ A;  5ID2 A;  3M9J A;  4K2X A;  4O32 A;  3A2W A;  2HNL A;  4HZ4 A;  4BPY A;  5G30 A;  1GWC A;  3P2A A;  2OKA A;  3OR5 A;  4L8E A;  3UIW A;  6GST A;  1K0O A;  4FYB A;  3F8U A;  1PRX A;  1GSU A;  4J56 E;  5DBQ A;  2GZY A;  3EMX A;  1WWJ A;  3FYG A;  3HYP A;  4HI7 A;  2DJ0 A;  3C71 A;  4IP6 A;  1PX6 A;  3WGE A;  1C72 A;  1MDI A;  2YP6 A;  13GS A;  1WOU A;  4X43 A;  3VLN A;  3HKR A;  1XW6 A;  2G2Q A;  2I4A A;  2CQ9 A;  4V1A g;  3BOA A;  5IMZ A;  2X64 A;  2M72 A;  1AC1 A;  1OC3 A;  4K0G A;  1EOG A;  1XG8 A;  2YAN A;  5AIS A;  16GS A;  1V58 A;  6GSW A;  1GUM A;  4DSS A;  4TR4 A;  5J4U A;  5CRE A;  4LLR A;  6GSS A;  1BJX A;  4BVY A;  3TUE A;  2C1Y A;  3CTG A;  5B7C A;  4POB A;  2DJ2 A;  1T1V A;  2EIR A;  3ZRE A;  2VM2 A;  1XWB A;  1WJK A;  2VL9 A;  3VFI A;  4AJ6 A;  2EC4 A;  2GZP A;  4KH7 A;  2X8C A;  3LJR A;  3TKR A;  1WIK A;  4CY6 A;  1WPI A;  4ZB6 A;  2CAQ A;  3M3M A;  1BAY A;  4I5Q A;  3ZLP A;  5DCG A;  1V98 A;  3BBY A;  1ZYP A;  2XPE A;  4K1F A;  3GTU A;  4MF5 A;  1ZYQ B;  4MDC A;  1PKZ A;  2DKI A;  2DJ3 A;  1X9M B;  2XC2 A;  5FT3 A;  17GS A;  4PNG A;  3KH7 A;  3GHA A;  3ISO A;  3RBT A;  1W89 A;  5H5S A;  2FD3 A;  2YV9 A;  2H6Z A;  1VRS D;  4WR4 A;  1F37 A;  3UAP A;  2CAI A;  1DBY A;  2PMT A;  1V9W A;  3K8N A;  3QAV A;  2H0I A;  5E4W A;  10GS A;  4ECJ A;  5DAK A;  1M3I A;  1AQX A;  3GUR A;  4ZXG A;  2YNX A;  4EKZ A;  2MMN A;  1Q4J A;  5CRG A;  2WJU A;  2WZ9 A;  2JZR A;  1JZR A;  4YKG A;  5D9T A;  1XZO A;  5IPG A;  3F6F A;  3KCM A;  1YZX A;  3I9V 2;  2VIM A;  3HXS A;  5F07 A;  2O85 A;  3S9F A;  1K0N A;  4N10 A;  3CYN A;  3GMF A;  5JWQ B;  2MMZ A;  1AQV A;  3VK9 A;  3EMP A;  3KD0 A;  2ZNM A;  3F3Q A;  2GSQ A;  2H66 A;  1EV4 A;  4ZBA A;  5CNW A;  1JHB A;  4ILF A;  3UBL A;  2JU5 A;  1GUL A;  2HZE A;  3M8N A;  5ECL B;  1MTC A;  2GZZ A;  3HVN A;  3MNG A;  4PTS A;  5F05 A;  1ERU A;  9GSS A;  1O6J A;  3QAG A;  3N9J A;  4WEY A;  2WDU A;  1FVK A;  4KDU A;  5D73 A;  4WET A;  4BWQ A;  1GSS A;  5IO2 A;  4OCF A;  5HR3 A;  2B7K A;  4CHS A;  1RK4 A;  5J5N A;  4BL7 B;  4MLY A;  3UAR A;  1J9B A;  2AUV A;  3LXT A;  1K3L A;  2IPA A;  5EL8 A;  3ZMK A;  4IP1 A;  3LGC A;  1XWG A;  1M7T A;  1SK2 A;  1A0R P;  1YF0 A;  2YJ7 A;  3VWU A;  4FO5 A;  3R3E A;  4MP4 A;  4D73 A;  3N5O A;  2V2G A;  4GWR A;  4K5S A;  3FR9 A;  3IRA A;  3ZVJ D;  2C4J A;  4EIP A;  1ERW A;  5DCH A;  7GSS A;  2LUS A;  1V2A A;  2C0G A;  1I9D A;  3WT1 A;  2HSH A;  2P0G A;  4XIH A;  3RDW A;  1GLQ A;  4X0X A;  4NWY A;  5ELG A;  4ISD A;  4EO3 A;  1QXH A;  1XW5 A;  2L5L A;  4EIQ A;  2AYT A;  3GKM A;  3GL5 A;  3Q19 A;  4HDE A;  3VI5 A;  4YQU A;  1SD9 A;  2PVQ A;  1TDI A;  2L4Q A;  3EU3 A;  1K3Y A;  5IMV A;  1OKD A;  3DRN A;  5IIZ A;  1BED A;  3I43 A;  5IM9 A;  4Z7X A;  3GUS A;  1NSW A;  4HQZ A;  3FZA A;  2HLS A;  1SJI A;  2C8U A;  3ZTL A;  3GIX A;  2H1B A;  4JE1 A;  1B4P A;  2QA2 A;  2P5R A;  2X4A A;  4IJI A;  2KP2 A;  1VF1 A;  1FOV A;  1N8J A;  3QFB C;  4IS0 A;  1JZO A;  1YKC A;  1NW2 A;  5F0G A;  2FGX A;  1TU7 A;  5INY A;  1DUG A;  2H6Y A;  2HFD A;  2LS5 A;  1Y25 A;  1JZW A;  1XPV A;  2GT6 A;  4PUA A;  4NMU A;  1T7P B;  4FH8 A;  1M0U A;  1XWK A;  2I81 A;  3D4T A;  3FKF A;  4MNN A;  5C04 A;  4XRD A;  4PNF A;  1QQ2 A;  2LRT A;  4I2U A;  3GKX A;  3ZZX A;  4Z2T A;  1U6T A;  1TXX A;  3FEU A;  3MYD A;  4KW6 A;  1J08 A;  5IMC A;  4EVM A;  1XXU A;  1OYJ A;  4I6X A;  2H74 A;  3ED3 A;  4GST A;  2IWT A;  5DDL A;  4KGI A;  5DQY A;  4XHM A;  5J9B A;  4XS4 A;  1DE1 A;  5FHI A;  3DVX A;  5ECO B;  1OAZ A;  3TJG A;  4L5O A;  3DKS A;  1K0A A;  2XHF A;  1NM3 A;  4WKW A;  1M2B A;  2R6K A;  3LW9 A;  4K6X A;  3HVX A;  2DMM A;  2R4V A;  5HFI A;  1A8Y A;  5IQY A;  1RQM A;  4O7H A;  4GSN A;  3IPZ A;  3TRX A;  2HT9 A;  1A2M A;  3EWL A;  1Z3E A;  2VO4 A;  5G1K A;  2H73 A;  4DSS B;  1THX A;  2BMX A;  2L59 A;  1WE0 A;  2K6V A;  4BVY B;  4GTU A;  2AHE A;  4BA7 A;  2LQQ A;  5L71 A;  1YKA A;  2E7P A;  1TKD B;  3QFA C;  2OJL A;  4PQI A;  1M9B A;  2O87 A;  3Q6O A;  2WB9 A;  4MJB A;  5ECH B;  3P90 A;  5ECP B;  2DML A;  4MZW A;  4RQX A;  2K8V A;  4TR1 A;  3UBK A;  1K0M A;  2NBS A;  3L9S A;  1FOH A;  4TXO A;  4JBB A;  4O5Q A;  3E3E A;  2WUL A;  1Z7P A;  1A0F A;  4HU7 A;  1SYX A;  4MF6 A;  4ZBD A;  5GAN D;  4K7O A;  3HVS A;  4YAP A;  4IBP A;  2CVD A;  2C3N A;  3GTU B;  2DC5 A;  3SWL A;  1RW1 A;  2C0E A;  4TR0 A;  2IMD A;  4X4J A;  2FWG A;  2PBJ A;  1USB A;  3VWV A;  2YCD A;  1XFL A;  2YWO A;  1IYH A;  4AGS A;  3J7Y b;  1TRW A;  4ZIL A;  3AY8 A;  4KCE A;  3GKK A;  1K0D A;  2OBK A;  3F63 A;  1X5C A;  2TIR A;  1HYU A;  6GSU A;  3J7Y k;  3BCI A;  2H19 A;  2HXK A;  5DAK B;  1EGR A;  1FB0 A;  3FZ9 A;  2HSM A;  2QKE A;  1YF1 A;  2IMF A;  2MYG A;  4V2L A;  2CZ3 A;  4WF4 A;  4F82 A;  5DAL A;  1T3B A;  5EVO A;  3PPU A;  1KEB A;  1SKR B;  1JLW A;  4ML6 A;  3LEF A;  3TRP A;  4IN0 A;  2O89 A;  5ELA A;  2N5B A;  2GT5 A;  2V32 A;  3D4M A;  3ERF A;  5COH A;  3WT2 A;  2REM A;  4BVX A;  2H71 A;  3M0F A;  2VAF A;  4HEA 2;  5A4V A;  1X0R A;  3FY7 A;  1EEM A;  2F51 A;  2CA8 A;  3G9B A; 
#chains in the Genus database with same CATH homology
 4IGJ A;  1F9M A;  3UVH A;  2LRN A;  2QSI A;  5IMD A;  5D8I A;  2NPB A;  4AJ7 A;  3P7X A;  3P8W A;  4NHZ A;  3PR8 A;  2HZE B;  1PGT A;  2R0G A;  1FG4 A;  3CMI A;  3PGT A;  1DE2 A;  3G7J A;  4YH2 A;  1S3C A;  2VUP A;  3IBH A;  2C3Q A;  2B1L A;  5B6M A;  4Z2R A;  2MMO A;  1VF4 A;  2DJ1 A;  4KND A;  4XCS A;  3L78 A;  1GTI A;  3R2Q A;  3FRC A;  3A2X A;  2P31 A;  4J2F A;  2C0F A;  2YPM A;  5G2Z A;  4ZL9 A;  4KF9 A;  22GS A;  5G31 A;  1ST9 A;  1R5A A;  4ECB A;  3CRT A;  3V1W A;  2GLR A;  2N5A A;  3O76 A;  3LQ7 A;  4MAB A;  4LMW A;  1GTU A;  4X1U A;  2LV3 A;  3MDK A;  6GSY A;  3H79 A;  4AF2 A;  3TGZ A;  1Z6N A;  4D73 B;  2L4C A;  3KXO A;  3F6D A;  3O6T A;  4NV5 A;  2DSA A;  3FZ4 A;  4F2I A;  1R26 A;  4V1A p;  3GV1 A;  3LFL A;  5G5F A;  2PGT A;  2OBI A;  4EDY A;  4OD7 A;  4ZIJ A;  1T4Y A;  3HZ4 A;  4KSO A;  2FHE A;  4ECC A;  4V2N A;  2HSY A;  4GF0 A;  4ID0 A;  2OAC A;  4OWY A;  3GKN A;  1KNG A;  1O73 A;  3F4R A;  2XBI A;  4RI7 A;  2LJR A;  1QMV A;  1FAA A;  1U3I A;  4MZB A;  4PGT A;  2B5X A;  2LJK A;  5CRD A;  3EE2 A;  3LYP A;  4WF5 A;  3IC8 A;  2ALB A;  3NOF A;  5FWG A;  2XBQ A;  1FVJ A;  5IOW A;  5H5R A;  1MDK A;  4CW9 A;  1X5E A;  3L4N A;  3F4S A;  4EC0 A;  3ZFB A;  4K7I A;  2YN1 A;  1U88 A;  2KOK A;  3M9K A;  2OE1 A;  2F8F A;  2CV4 A;  3UVT A;  2CT6 A;  2OE0 A;  1TK0 B;  6GSV A;  3MWH A;  1SEN A;  4ZL7 A;  3KP8 A;  1GSE A;  2BJX A;  4EL1 A;  3IDV A;  1S3D A;  1AQW A;  2H1A A;  3GYK A;  4RI6 A;  5LCZ A;  3C7M A;  4Q5N A;  2A2P A;  3KH9 A;  2H1D A;  4MH3 A;  1G7E A;  1GTA A;  1PSQ A;  4KUN A;  2GS3 A;  3A2V A;  2FCH A;  2AAW A;  3CXG A;  3CSH A;  4XS4 B;  4N11 A;  2CVB A;  1OKT A;  5HR2 A;  1R4W A;  2JAD A;  1ILO A;  1LU4 A;  2H1G A;  1GSD A;  1WMJ A;  3DML A;  1O8W A;  2N5F A;  1EP7 A;  3HJP A;  2A4H A;  5ECM B;  3TOT A;  1FO5 A;  4K7N A;  3GFK A;  2GSR A;  2NDO A;  3IK9 A;  4K9Z A;  4P3Y B;  2PN8 A;  1M2D A;  4KA0 A;  2TRC P;  4GSS A;  4ACS A;  3KTB A;  2MMA A;  3H4K A;  3F3R A;  5EY6 A;  4G9H A;  1VF3 A;  4KE3 A;  3ZIV A;  3EU4 A;  3DEX A;  4A5P A;  2O8V B;  5LNK e;  4TR1 B;  4Q5R A;  2G0F A;  1NHO A;  2L57 A;  4TXO B;  1H75 A;  1U3A A;  4MCU A;  2VCQ A;  1ERV A;  3HZ8 A;  2C0D A;  4TXV A;  3QR6 A;  1LJR A;  4EUY A;  2B3S A;  1AAZ A;  5HR1 A;  2F9S A;  1JZD A;  4F03 A;  1YJ6 A;  2EIO A;  1T4Z A;  12GS A;  1E2Y A;  3C8E A;  3IHQ A;  1SD8 A;  4MJE A;  3EIN A;  2R3X A;  4OFM A;  4OMV A;  4IHU A;  1TRV A;  1QFN A;  2PVO C;  3IAM 2;  2IL3 A;  4G19 A;  3KIJ A;  2Z9S A;  1YQ1 A;  3BCK A;  1W4V A;  3G7I A;  1XW9 A;  4FYC A;  3KGK A;  4GQC A;  2B6M A;  1A8L A;  3UL3 A;  1XWA A;  1CQH A;  3GX8 A;  5AN1 A;  5EPF A;  5DAL B;  4J57 E;  3ZIJ A;  4ECI A;  5ECR B;  1GSF A;  4K8M A;  3IHG A;  1CQG A;  2HE3 A;  3TJB A;  1XIY A;  3FW2 A;  4LMV A;  2RII A;  2LKU A;  4K5R A;  1LBK A;  1OVN A;  1PL1 A;  2O7K A;  1PL2 A;  3TOU A;  2L5O A;  1SL2 B;  4WBJ A;  3ERW A;  4BVX B;  4MK3 A;  3TB2 A;  1PMT A;  2HYX A;  2YZH A;  1Z7R A;  3UOM A;  3APQ A;  3DXB A;  3US3 A;  1SJZ A;  3JCM L;  2C80 A;  5ECI B;  3VWW A;  1A2J A;  1GLP A;  2CZ2 A;  3ERG A;  4KAE A;  3A5I A;  3F0I A;  4IJ3 A;  4XTS A;  3HJO A;  3LXZ A;  2B5E A;  4RQR A;  2B7J A;  3TCO A;  2B1K A;  3IA1 A;  3CRU A;  1A24 A;  5IMF A;  2GDR A;  2WRT A;  4DSR A;  2R5G A;  1I5G A;  4IEL A;  2VLT A;  4JR6 A;  4JU5 A;  3TKS A;  1OC8 A;  2IFQ A;  4XS1 A;  2NVL A;  3F4T A;  4Z2U A;  3DGQ A;  5ECN B;  4JED A;  2FY6 A;  1MD4 A;  2GGT A;  4QQ7 A;  3VUR A;  5CAX A;  1EZK A;  4POM A;  3MIX A;  5IOX A;  1ZYE A;  1AIU A;  4EXJ A;  3FK8 A;  3RAZ A;  1OE8 A;  4NV2 A;  1M99 A;  3E0U A;  4G10 A;  1A23 A;  2H0G A;  1XBS A;  4USS A;  5GSS A;  1EGO A;  1YEX A;  2DJK A;  2IIY A;  4O92 A;  1VF2 A;  2AB6 A;  3FMW A;  3GA4 A;  1KTE A;  1IYI A;  2F3M A;  1TI3 A;  5G1L A;  2J9H A;  5A5K A;  4IQA A;  2H01 A;  4CDO A;  1XOB A;  2E2M A;  1K3O A;  2I3Y A;  4YQV A;  3ZIT A;  2PPT A;  2ON5 A;  5DVB A;  4GLT A;  3ZRD A;  1SU9 A;  3KM6 A;  1URM A;  5C00 A;  2TRX A;  3IK7 A;  2H0H A;  2DLX A;  2VD0 A;  2V41 A;  3Q74 A;  4L5L A;  4G0L A;  2AV4 A;  2VCZ A;  3EVI A;  4XS6 A;  2R0C A;  2LRC A;  1V40 A;  1HNA A;  1Q98 A;  4OO5 A;  1QK8 A;  1PKW A;  2KHP A;  2IN3 A;  4NPB A;  5H5Q A;  3BJ5 A;  5BRT A;  2PUK C;  3PH9 A;  4WXT A;  1ACV A;  1TRU A;  1B8X A;  2RM6 A;  4NAX A;  5KN0 A;  3I6A A;  5CYY A;  3FR6 A;  4MF7 A;  3D5J A;  2VL2 A;  4DSQ A;  1ZYN A;  1O8X A;  4POK A;  5AGY A;  3TKS E;  4PXO A;  1GUK A;  2QC7 A;  4V2M A;  3C1S A;  4L0W A;  4LL4 B;  3DIE A;  2DJJ A;  1F2E A;  3E9J B;  2YV7 A;  1GH2 A;  2MBS A;  1GP1 A;  4MH2 A;  2X8H A;  3WGD A;  3A5W A;  3TJF A;  4MA9 A;  4F0B A;  3D22 A;  1B9Y C;  4F0C A;  1R7H A;  2DIZ A;  4K2D A;  1G0T A;  1GNW A;  1ZOF A;  2JSY A;  5KEJ A;  4HS1 A;  4GCI A;  4EF0 A;  3QOU A;  3IE3 A;  4I2T A;  1YY7 A;  5D93 A;  2H30 A;  3UEM A;  3ZVJ A;  4MMM A;  5DJL A;  3LG6 A;  5LD0 A;  1GL8 A;  3FZ5 A;  3EUR A;  2GTU A;  4H86 A;  2FUG 2;  5J41 A;  3VPT A;  1MDJ A;  1PD2 1;  4O5R A;  2E2G A;  4ML1 A;  8GSS A;  3A3T A;  3NIV A;  3LYK A;  2M80 A;  1PQN A;  1QUW A;  5HFG A;  5KN1 A;  3IXR A;  1TRS A;  5B8B A;  5KOX A;  2FWH A;  5CO3 A;  4XRA A;  2LEG A;  3BD2 A;  1ML6 A;  1K0B A;  3TJJ A;  5CRW A;  1JFU A;  4TOP A;  19GS A;  4ZB8 A;  3RPP A;  2ZUP A;  1X9W B;  20GS A;  1TTZ A;  1ERT A;  2VCT A;  4IKH A;  4E8E A;  3MAK A;  2I9H A;  1UC7 A;  1GRX A;  2YOI A;  3LWA A;  4PX1 A;  3DWV A;  14GS A;  1G6Y A;  2IJY A;  5ECK B;  1F6M C;  4WR5 A;  1ZL9 A;  4CY8 A;  3GNJ A;  3CSI A;  1O85 A;  2R2J A;  3G7Y A;  4OCE A;  4KDY A;  4ZB9 A;  3WYW A;  3H1N A;  5GST A;  3GX0 A;  4ULX A;  5D9V A;  2FA8 A;  1MD3 A;  1PN0 A;  3UMA A;  4RUV A;  2R0P A;  3KJY A;  1HD2 A;  2LJA A;  2LTK A;  2YJH A;  4TR3 A;  4BWS A;  5BMU A;  2HRA A;  1AXD A;  3HJM A;  5CP1 A;  3HDC A;  3TKS C;  2IME A;  2FA4 A;  3DYR A;  2A2S A;  1B4Q A;  4TW5 A;  2B5Y A;  3RPN A;  3CTF A;  4K0N A;  2P5Q A;  3KP9 A;  1S3A A;  2VLV A;  1UN2 A;  3QPM A;  2L6C A;  1UA5 A;  1WRY A;  5HFK A;  3GH6 A;  4GQF A;  2JSZ A;  2OA7 A;  1EEJ A;  1FB6 A;  2L6D A;  4KDX A;  3C73 A;  5F06 A;  3L9U A;  3CSJ A;  1TP9 A;  2WS2 A;  2X99 A;  2E0Q A;  1OC9 A;  4EE0 A;  1U87 A;  3HVV A;  1F3B A;  2MZC A;  3TJK A;  2YWI A;  4QL7 A;  2FNO A;  4PUR A;  2AJQ B;  2LNS A;  4NHW A;  3TRQ A;  4KCA A;  3WD6 A;  4IVF A;  1M9A A;  5IMA A;  5HR0 A;  5IO0 A;  2FWF A;  1TK5 B;  2HRN A;  3D6I A;  4LA1 A;  3C1R A;  5ABR A;  2ON7 A;  5D96 A;  2LNT A;  2YWN A;  3ME7 A;  2IFQ B;  4I8B A;  3W8S A;  3QD9 A;  1NHY A;  4GRF A;  3ZML A;  1AUC A;  2ES7 A;  4GXZ A;  4OFN A;  1ABA A;  2D2Z A;  4G0I A;  2VCW A;  1GTB A;  2PER A;  2H8L A;  3H8Q A;  4YAV A;  3L9V A;  1HNC A;  4TVE A;  2RLI A;  3ZYW A;  11GS A;  3RHC A;  1BX9 A;  1GUH A;  4ZBB A;  3TDG A;  1O7U A;  2HI7 A;  3QAW A;  5GZZ B;  2JAC A;  4KX4 A;  4HZ2 A;  2UZ8 A;  3CBU A;  1SKW B;  5G5E A;  2WGR A;  4JZQ A;  4G0K A;  1TOF A;  3D21 A;  2EIQ A;  5A4U A;  2JZS A;  3HHV A;  3WGX A;  2V6K A;  5KN3 A;  4I97 A;  2VL2 C;  3GL3 A;  5ECS A;  2CX3 A;  2C3T A;  2NTO A;  5GAP D;  1X5D A;  5JCW A;  2OE3 A;  4DVC A;  3GSS A;  4DEJ A;  2MBT A;  3W8J A;  5DQS A;  1EWX A;  1EOH A;  2VL3 A;  3APS A;  5B8A A;  1BYE A;  4AJ8 A;  2CX4 A;  4O5U A;  3IV4 A;  4KB3 A;  2VLU A;  1SJ6 A;  1ZCP A;  4F9Z A;  2LQO A;  2QA1 A;  1SYR A;  1SL1 B;  4YKF A;  3QMX A;  4FQU A;  3KZQ A;  3APO A;  3QDN A;  3PIN A;  4JR4 A;  3RHB A;  5JWR B;  2VM1 A;  1Z9H A;  3U6V A;  4YQM A;  2DBC A;  4TN8 A;  2YZU A;  1PA3 A;  2QGV A;  4MJA A;  4MPF A;  1TK8 B;  1Y6E A;  2VCX A;  3GRX A;  2DKH A;  2IMI A;  5AIV A;  2K8S A;  4FIW A;  1ZMA A;  3IOS A;  2H76 A;  1XOA A;  1A2L A;  1XWC A;  4TKY A;  2A4V A;  2LST A;  3I69 A;  3IC4 A;  1GSQ A;  1FW1 A;  5HQP A;  3GN3 A;  1X9S B;  4OO4 A;  4Q5Q A;  3HCZ A;  4KSM A;  1XVQ A;  1J0F A;  1G6W A;  1B48 A;  4MJC A;  3M1G A;  3EYT A;  4MZC A;  2GSS A;  1OE7 A;  1YDK A;  2M46 A;  4FYU A;  4NXI A;  3D0Z A;  2KUC A;  3ZL5 A;  2FLS A;  1GSY A;  4N0Z A;  2JZT A;  4ZL8 A;  2F8A A;  2HZF A;  4HJM A;  4POL A;  5ID2 B;  3DVW A;  3VWX A;  2GQL A;  3H93 A;  2K9F A;  2H75 A;  3NZN A;  2GQK A;  2V1M A;  4ICY A;  4N0V A;  1E6B A;  1DSB A;  1HQO A;  4HUA A;  5KN2 A;  1K0C A;  3O3T A;  4E8H A;  1PN9 A;  1R5P A;  1UVZ A;  2BTO T;  2PWJ A;  1HNB A;  3FHK A;  1T8E B;  2PU9 C;  1GNE A;  3VPQ A;  3W6G A;  4L0U A;  1KBN A;  1TJD A;  1TU8 A;  3ZFL A;  4QL9 A;  1SK1 A;  1SK0 A;  3U5R E;  2RM5 A;  5J3R A;  1ZGN A;  3EPT A;  3VI7 A;  18GS A;  1FHE A;  5CRH A;  3GH9 A;  3ME8 A;  5A4W A;  5J9C A;  5ENU A;  5JWO B;  2GQM A;  2X49 A;  4LL1 B;  1ZZY A;  3UJ1 A;  3QCP A;  4HU9 A;  3KTL A;  4BL7 A;  4IQ1 A;  3SBC A;  1N2A A;  3IAS 2;  4N30 A;  3DD3 A;  1T00 A;  5IPH A;  2RUF A;  4Q5F A;  1THO A;  1MEK A;  3KMN A;  2GVP A;  2HRK A;  2XPD A;  1TI1 A;  1M2A A;  3LOR A;  2OAD A;  2ZCT A;  3GST A;  2GST A;  4EDZ A;  1B9X C;  1EP8 A;  4JRR A;  5DJM A;  2JL4 A;  2J23 A;  2WFC A;  1ON4 A;  1PX7 A;  3LSZ A;  4PUF C;  1SKS B;  4OFT A;  2KP1 A;  6GSX A;  2KLX A;  1Z6M A;  1QGV A;  5KOW A;  1G7O A;  2I1U A;  2VD1 A;  4TRX A;  3F9U A;  2WCI A;  3HD5 A;  5ECQ B;  5D9X A;  2VOC A;  1WP0 A;  3HY2 A;  3EC3 A;  2R37 A;  2VCV A;  2IMK A;  5JCU A;  1BG5 A;  1XCC A;  3L0H A;  4MPG A;  1H4O A;  2H72 A;  3TKP A;  4IW9 A;  5E59 A;  3MSZ A;  4G2E A;  2HRF A;  1OC9 B;  4WBR D;  4HQS A;  4PQH A;  3FR3 A;  1Z5Y E;  5D9W A;  1XVW A;  3KMO A;  2H70 A;  5AIX A;  5F8B A;  3TKQ A;  5B6N A;  4HJ2 A;  1O81 A;  1VGL A;  3KEB A;  3HA9 A;  2A2R A;  2V6O A;  1SL0 B;  2H6X A;  2K18 A;  1V57 A;  3IR4 A;  2YWM A;  4PQ1 A;  3Q18 A;  1YEP A;  2X8G A;  1JLV A;  2CVK A;  1F3A A;  2DIY A;  1EV9 A;  1AW9 A;  1BQ7 A;  5JCG A;  2RUE A;  2FWE A;  1TW9 A;  4HOJ A;  5ID2 A;  3M9J A;  4K2X A;  4O32 A;  3A2W A;  2HNL A;  4HZ4 A;  4BPY A;  5G30 A;  1GWC A;  3P2A A;  2OKA A;  3OR5 A;  4L8E A;  3UIW A;  6GST A;  1K0O A;  4FYB A;  3F8U A;  1PRX A;  1GSU A;  4J56 E;  5DBQ A;  2GZY A;  3EMX A;  1WWJ A;  3FYG A;  3HYP A;  4HI7 A;  2DJ0 A;  3C71 A;  4IP6 A;  1PX6 A;  3WGE A;  1C72 A;  1MDI A;  2YP6 A;  13GS A;  1WOU A;  4X43 A;  3VLN A;  3HKR A;  1XW6 A;  2G2Q A;  2I4A A;  2CQ9 A;  4V1A g;  3BOA A;  5IMZ A;  2X64 A;  2M72 A;  1AC1 A;  1OC3 A;  4K0G A;  1EOG A;  2YAN A;  5AIS A;  16GS A;  1V58 A;  6GSW A;  1GUM A;  4DSS A;  4TR4 A;  5J4U A;  5CRE A;  4LLR A;  6GSS A;  1BJX A;  4BVY A;  3TUE A;  2C1Y A;  3CTG A;  5B7C A;  4POB A;  2DJ2 A;  1T1V A;  2EIR A;  3ZRE A;  2VM2 A;  1XWB A;  1WJK A;  2VL9 A;  3VFI A;  4AJ6 A;  2EC4 A;  2GZP A;  4KH7 A;  2X8C A;  3LJR A;  3TKR A;  1WIK A;  4CY6 A;  1WPI A;  4ZB6 A;  2CAQ A;  3M3M A;  1BAY A;  4I5Q A;  3ZLP A;  5DCG A;  1V98 A;  3BBY A;  1ZYP A;  2XPE A;  4K1F A;  3GTU A;  4MF5 A;  1ZYQ B;  4MDC A;  1PKZ A;  2DKI A;  2DJ3 A;  1X9M B;  2XC2 A;  5FT3 A;  17GS A;  4PNG A;  3KH7 A;  3GHA A;  3ISO A;  3RBT A;  1W89 A;  5H5S A;  2FD3 A;  2YV9 A;  2H6Z A;  1VRS D;  4WR4 A;  1F37 A;  3UAP A;  2CAI A;  1DBY A;  2PMT A;  1V9W A;  3K8N A;  3QAV A;  2H0I A;  5E4W A;  10GS A;  4ECJ A;  5DAK A;  1AQX A;  3GUR A;  4ZXG A;  2YNX A;  4EKZ A;  2MMN A;  1Q4J A;  5CRG A;  2WJU A;  2WZ9 A;  2JZR A;  1JZR A;  4YKG A;  5D9T A;  1XZO A;  5IPG A;  3F6F A;  3KCM A;  1YZX A;  3I9V 2;  2VIM A;  3HXS A;  5F07 A;  2O85 A;  3S9F A;  1K0N A;  4N10 A;  3CYN A;  3GMF A;  5JWQ B;  2MMZ A;  1AQV A;  3VK9 A;  3EMP A;  3KD0 A;  2ZNM A;  3F3Q A;  2GSQ A;  2H66 A;  1EV4 A;  4ZBA A;  5CNW A;  1JHB A;  4ILF A;  3UBL A;  2JU5 A;  1GUL A;  2HZE A;  3M8N A;  5ECL B;  1MTC A;  2GZZ A;  3MNG A;  4PTS A;  5F05 A;  1ERU A;  9GSS A;  1O6J A;  3QAG A;  3N9J A;  4WEY A;  2WDU A;  1FVK A;  4KDU A;  5D73 A;  4WET A;  4BWQ A;  1GSS A;  5IO2 A;  4OCF A;  5HR3 A;  2B7K A;  4CHS A;  1RK4 A;  5J5N A;  4BL7 B;  4MLY A;  3UAR A;  1J9B A;  2AUV A;  3LXT A;  1K3L A;  2IPA A;  5EL8 A;  3ZMK A;  4IP1 A;  3LGC A;  1XWG A;  1M7T A;  1SK2 A;  1A0R P;  1YF0 A;  2YJ7 A;  3VWU A;  4FO5 A;  3R3E A;  4MP4 A;  4D73 A;  3N5O A;  2V2G A;  4GWR A;  4K5S A;  3FR9 A;  3IRA A;  3ZVJ D;  2C4J A;  4EIP A;  1ERW A;  5DCH A;  7GSS A;  2LUS A;  1V2A A;  2C0G A;  1I9D A;  3WT1 A;  2HSH A;  2P0G A;  4XIH A;  3RDW A;  1GLQ A;  4X0X A;  4NWY A;  5ELG A;  4ISD A;  4EO3 A;  1QXH A;  1XW5 A;  2L5L A;  4EIQ A;  2AYT A;  3GKM A;  3GL5 A;  3Q19 A;  4HDE A;  3VI5 A;  4YQU A;  1SD9 A;  2PVQ A;  1TDI A;  2L4Q A;  3EU3 A;  1K3Y A;  5IMV A;  1OKD A;  3DRN A;  5IIZ A;  1BED A;  3I43 A;  5IM9 A;  4Z7X A;  3GUS A;  1NSW A;  4HQZ A;  3FZA A;  2HLS A;  1SJI A;  2C8U A;  3ZTL A;  3GIX A;  2H1B A;  4JE1 A;  1B4P A;  2QA2 A;  2P5R A;  2X4A A;  4IJI A;  2KP2 A;  1VF1 A;  1FOV A;  1N8J A;  3QFB C;  4IS0 A;  1JZO A;  1YKC A;  1NW2 A;  5F0G A;  2FGX A;  1TU7 A;  5INY A;  1DUG A;  2H6Y A;  2HFD A;  2LS5 A;  1Y25 A;  1JZW A;  1XPV A;  2GT6 A;  4PUA A;  4NMU A;  1T7P B;  4FH8 A;  1M0U A;  1XWK A;  2I81 A;  3D4T A;  3FKF A;  4MNN A;  5C04 A;  4XRD A;  4PNF A;  1QQ2 A;  2LRT A;  4I2U A;  3GKX A;  3ZZX A;  4Z2T A;  1U6T A;  1TXX A;  3FEU A;  3MYD A;  4KW6 A;  1J08 A;  5IMC A;  4EVM A;  1XXU A;  1OYJ A;  4I6X A;  2H74 A;  3ED3 A;  4GST A;  2IWT A;  5DDL A;  4KGI A;  5DQY A;  4XHM A;  5J9B A;  4XS4 A;  1DE1 A;  5FHI A;  3DVX A;  5ECO B;  1OAZ A;  3TJG A;  4L5O A;  3DKS A;  1K0A A;  2XHF A;  1NM3 A;  4WKW A;  1M2B A;  2R6K A;  3LW9 A;  4K6X A;  3HVX A;  2DMM A;  2R4V A;  5HFI A;  1A8Y A;  5IQY A;  1RQM A;  4O7H A;  4GSN A;  3IPZ A;  3TRX A;  2HT9 A;  1A2M A;  3EWL A;  1Z3E A;  2VO4 A;  5G1K A;  2H73 A;  4DSS B;  1THX A;  2BMX A;  2L59 A;  1WE0 A;  2K6V A;  4BVY B;  4GTU A;  2AHE A;  4BA7 A;  2LQQ A;  5L71 A;  1YKA A;  2E7P A;  1TKD B;  3QFA C;  2OJL A;  4PQI A;  1M9B A;  2O87 A;  3Q6O A;  2WB9 A;  4MJB A;  5ECH B;  3P90 A;  5ECP B;  2DML A;  4MZW A;  4RQX A;  2K8V A;  4TR1 A;  3UBK A;  1K0M A;  2NBS A;  3L9S A;  1FOH A;  4TXO A;  4JBB A;  4O5Q A;  3E3E A;  2WUL A;  1Z7P A;  1A0F A;  4HU7 A;  1SYX A;  4MF6 A;  4ZBD A;  5GAN D;  4K7O A;  3HVS A;  4YAP A;  4IBP A;  2CVD A;  2C3N A;  3GTU B;  2DC5 A;  3SWL A;  1RW1 A;  2C0E A;  4TR0 A;  2IMD A;  4X4J A;  2FWG A;  2PBJ A;  1USB A;  3VWV A;  2YCD A;  1XFL A;  2YWO A;  1IYH A;  4AGS A;  3J7Y b;  1TRW A;  4ZIL A;  3AY8 A;  4KCE A;  3GKK A;  1K0D A;  2OBK A;  3F63 A;  1X5C A;  2TIR A;  1HYU A;  6GSU A;  3J7Y k;  3BCI A;  2H19 A;  2HXK A;  5DAK B;  1EGR A;  1FB0 A;  3FZ9 A;  2HSM A;  2QKE A;  1YF1 A;  2IMF A;  2MYG A;  4V2L A;  2CZ3 A;  4WF4 A;  4F82 A;  5DAL A;  1T3B A;  5EVO A;  3PPU A;  1KEB A;  1SKR B;  1JLW A;  4ML6 A;  3LEF A;  3TRP A;  4IN0 A;  2O89 A;  5ELA A;  2N5B A;  2GT5 A;  2V32 A;  3D4M A;  3ERF A;  5COH A;  3WT2 A;  2REM A;  4BVX A;  2H71 A;  3M0F A;  2VAF A;  4HEA 2;  5A4V A;  1X0R A;  3FY7 A;  1EEM A;  2F51 A;  2CA8 A;  3G9B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...